3RAUA

Crystal structure of the hd-ptp bro1 domain
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
358
structure length
358
Chain Sequence
VPRMPMIWLDLKEAGDFHFQPAVKKFVLKNYGENPEAYNEELKKLELLRQNAVRVPRDFEGCSVLRKYLGQLHYLQSRVPMGSGQEAAVPVTWTEIFSGKSVAHEDIKYEQACILYNLGALHSMLGAMDKRVSEEGMKVSCTHFQCAAGAFAYLREHFPQAYSVDMSRQILTLNVNLMLGQAQECLLEKSMLDNRKSFLVARISAQVVDYYKEACRALENPDTASLLGRIQKDWKKLVQMKIYYFAAVAHLHMGKQAEEQQKFGERVAYFQSALDKLNEAIKLAKGQPDTVQDALRFTMDVIGGKYNSAKKDNDFIYHEAVPALDTLQPVKGAPLVKPLPVNPTDPAVTGPDIFAKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Phe105 Loop of Alix Bro1 Domain Plays a Key Role in HIV-1 Release.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Tyrosine-protein phosphatase non-receptor type 23
total genus 143
structure length 358
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2011-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.280 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat alix/aip1 like domains 3rauA00
2R02A 2OEVA 3C3QA 2R05A 3UM0A 2OEWA 2R03A 3RAUA 2XS8A 3C3RA 1ZB1A 5CRVA 5CRUA 3R9MA 3C3OA 2XS1A 3UM1A 3UM2A 3UM3A 3ULYA 3ZXPA
chains in the Genus database with same CATH superfamily
2E2EA 3HVEB 4AJWA 3R7RA 5FZRA 4J8EA 5CECB 3NZSA 4FADA 5JJ7A 1KZOA 2P9KG 1S63A 4A63B 4B94A 3SF4A 1IYGA 3MCXA 3J5QB 4J6IA 4M7CA 1MHQA 2ZXWE 1HH8A 5CHEE 1AWCB 1WY6A 5FQ6A 1XNFA 4U07A 3TWSA 2VGXA 2XENA 1YYHA 3D9MA 1EPUA 2VYIA 3LYAA 2X6JA 3DSUA 3CSFA 1V55E 3HYMB 5FIOA 2MYOA 5ENOD 2KBXA 2R05A 3S7DA 3PE3A 4IRUA 2KATA 3TWVA 4UQXA 3UMVA 3UT7A 3CHRA 4LCTA 3FEYA 3EHNA 1K1AA 3CHOA 1RW2A 4QFVA 4HLLA 2VTBA 4YDOA 1H2TC 4ACLA 2XQ0A 4HI9A 3TWTA 4DLQA 1IHBA 5CERB 3AJIA 4C9BB 2KZTB 2RKKA 3AS4A 4O1OA 3MEKA 1N94A 2ZISA 2L6JA 1IQUA 4MLPA 2ETAA 3JQ1A 4K5BA 5AQ7A 1YA0A 3PZ3A 2MHKA 3ZXPA 4LNUD 4WWOA 1WG0A 2EQXA 3I4GA 3CR3A 2EIJE 3C5RA 2ZIRA 4HI8A 2FULA 3PZ1A 5ENNA 4F7AA 3O48A 5E75A 5G04J 2OOEA 4MRUA 5C2YA 3DEPA 3C3OA 3CGHA 2IFUA 2WXHA 4TXQA 4U0SA 2CG2A 4G25A 2NC9A 4Z68A 3ENEA 5ENQD 4U96D 3TG4A 4K0RA 2V5QC 4GTOA 2WXQA 4G23A 3RO3A 4EQFA 1MYOA 3CLJA 4IN3B 5JA4D 1MX2A 3W9FA 3MV2B 3IHVA 4I17A 5EIBE 1SA4A 2WQ6A 1TR4A 1TN6A 1FT2A 1OCRE 5ENRD 3EIQC 5FINA 1IXVA 3S7FA 1YMPA 3BU8A 2YNQA 5CRUA 3PH0C 4GTVA 4L1BA 4I6GA 3ABLE 4DX5D 2WVIA 3QKYA 3L16A 3MA5A 3SGHA 4WNEA 3Q79A 3KEZA 3MGBA 3E32A 3SHFA 3RK6A 1SW6A 4H7YA 2WPVA 4B89A 2YINA 4O1PA 1AP7A 4J8FA 3TL5A 1TN8A 1DCQA 1TJCA 2OEVA 3SQVA 2XGOA 5AAOA 1N4QA 2I1KA 4ILIA 4J8SA 4XIFA 3L54A 4AXHA 4WNDA 1ELWA 2LAHA 3QDNA 5FWQA 1K1BA 3TWRA 4BETA 4G24A 2V8SE 1DCEA 4JVSA 5HRYA 5T8IA 1E90A 1DVPA 1O1SA 5J08A 1TNYA 2PM7A 2H6HA 4CGWA 2QYUA 3L17A 3LXUX 4MKTA 3U4TA 4CT4A 1BI7B 4TV3A 4QQIA 3B13A 2J4DA 5EX0A 4A55A 2CHWA 3UM2A 5CMWA 5HQ8A 4HFGA 3VLDA 1S64A 2F8YA 3DRAA 4I2WA 3MX3A 1OT8A 4ATGA 3OXGA 3UM0A 3ZNGA 3FH8A 4NRHB 4APOA 3CQGB 1Z3YA 3LY7A 5CCLA 3B95A 1LF8A 1KT1A 3U9WA 2IOSA 3FUIA 3RO2A 4ZFHA 5A23A 3URZA 2DZNA 3DSXA 4TXPA 4XKCA 3ZKJA 1K3ZD 5CRVA 3FUEA 2P9UG 3ZPJA 3F6QA 2GRNB 3ZVVA 3L6AA 2CHXA 1FT1A 1OCCE 3APFA 4GYYA 3CVWA 4BSXA 2CG3A 3Q49B 1LD8A 4XZ4A 4NIKA 3C3RA 3Q47B 4GTSA 4GYWA 3MV3B 4DPRA 5CBOA 3L9TA 3MKQA 3JXJA 2P9IG 4AV7A 2GRLA 3DBSA 3FTUA 4LUNU 3LVQE 3QJZA 3AG3E 4N2SA 2VSXE 3APDA 3HIZA 4U95D 3KAEA 3FY4A 2XCCA 3VLEA 2X6HA 4IYPA 1ELRA 3SO8A 1BPOA 2IEJA 4WWNA 3FEXA 2KCLA 4G8KA 3B7TA 3V79K 1EDUA 2R5SA 4BX8A 1UJKA 3PRZA 1TEZA 1TNOA 2GROB 4A1SA 4UWKA 2V4HC 2VGEA 4PS3A 4AM9A 3NAWA 4FLHA 4FA6A 1NA3A 3QB2A 4JPSA 2L6BA 3ZYLA 3FUDA 5DIZA 1NI1A 1SQMA 1H19A 2HE0A 3L22A 3T8MA 4RLYA 1HG2A 4EBAA 3E37A 2AXUA 1H2UA 1YCSB 4L2LA 5C1DA 3UKRG 2AXZA 4GTTA 5ENPD 5LP0A 4O6FA 3LY9A 4W9RA 3PZDA 5D66A 4LERA 3TXMA 4XE0A 1TN7A 3Q15A 1OCOE 4GA0A 2CHZA 3OXLA 2VSNA 5AQAA 4ANXA 2J49A 5FQ4A 2A5UA 3HXCA 4V3IA 2C0LA 3PNLB 5KJKA 3P2BA 1BI8B 2R02A 2Y0BG 2J9QA 2ETBA 1FVHA 3LPZA 3FDHA 2A4ZA 5HS0A 3MJWA 3AS5A 4Q94A 2JLBA 3NB2A 5B1AE 1A5EA 3LCAA 3IBEA 3ZW3A 1OXJA 3HDXA 3FH5A 2VSYA 4CRWA 4UI9K 1X5BA 5FJYA 4CEMA 3C3QA 1NP7A 3UIPC 4N2QA 1N4SA 4D10C 3ZXSA 5HKPA 4E6HA 4OAUC 5G05C 1KPSB 4BERA 4GYOA 4U8VD 3PUJA 3CK9A 2DYSE 1SVXA 2V5FA 4OVVA 4I6EA 3CKCA 2OV8A 4GTRA 4K5AB 3K9IA 2VGXB 4HBDA 1UG3A 5AQBA 4DX2A 5BUZA 4XKBA 3IEGA 4Q96A 2DWZA 1ZB1A 1B89A 1JPLA 2XRYA 3G2UA 5FZSA 4UWFA 3PDNA 1E8XA 1JCQA 4WAFA 2XHEA 2X6KA 1JUQA 1KT0A 4B93B 4BSZB 3S7JA 1PY1A 4ANWA 3G2VA 2Y3AA 3UX4A 3CVNA 5KJMA 1E96B 2LO6A 4UI9C 4GPKA 3QWWA 1WM5A 2ZGDA 4HOQA 1Y6IA 1N0RA 2DIWA 4PH4B 3TXNA 3ULEG 2A5EA 3PUKA 3UPVA 4NQ0A 3FUNA 3E30A 3QWVA 4DLOA 4HQDA 3CHQA 2NXPA 4KT6B 2AW6A 5JJ6A 3EHMA 3ZUVB 4RVBA 5ANRA 5ARFA 3TWXA 2IY0C 3LJ3A 3D9KA 2R03A 2WXJA 4N39A 3ZHEB 5ENSD 3LDZA 4AY6A 1Z3XA 2KZTA 2XEEA 3FTWA 2R59A 4JEUA 3Q73A 5AJDA 4XI9A 3UM3A 2J08A 4I1AA 5ITZF 3NF1A 3Q7FA 2X3MA 2JEKA 4HOSA 5FQ7A 2GRQB 3DPYA 5B1BE 1TJFA 1SZAA 1P5QA 5BT1A 2P9SG 3FFLA 4JEHA 4U7EB 2LAIA 2EINE 2KXPC 5BV1A 5E76A 2LXMA 4HLEA 2ETCA 2PQRA 1H6OA 4O60A 3ASHA 1MX4A 3RRMB 2XGSA 3LJNA 5EDSA 2PNNA 1W3BA 2Q7FA 3G2SA 3KD7A 3FUKA 3AG1E 3FTVA 4TUUA 3JQ0A 3JYSA 4AIFA 4N3CA 3HXDA 4GPMA 4CT0A 1G3NB 4WNFA 2RD0A 2M63A 3G2WA 2WQHA 3RU0A 1KZPA 2UWJG 1OWOA 2J8SD 3HHMA 1HU3A 3JUIA 4XEIG 5AJLA 5AQ9A 2AWIA 3T8KA 5FT9A 4ABNA 2CFUA 4APFA 1PAQA 2RFMA 2C0MA 4HNAD 1IQRA 1DC2A 2WXOA 4HS2A 4JA7A 2DBAA 3ZYKA 1JWFA 2AXVA 2IO2C 3APCA 4I43A 4UWLA 3BG1B 1QNFA 3PNTB 1Z6TA 4FJYA 2IJGX 2XZTG 2WXKA 3R7QA 4B0ZA 3CVLA 4YDEA 3RIBA 3LEWA 4ANUA 1N0QA 4HB5A 3NZUA 3UTMA 2I1JA 4GA1A 5D0OD 5FZQA 2J09A 1A17A 4N5QA 2LUHA 3E4BA 5EKQD 3U3WA 3ULQA 4BT9A 2Y69E 2Y1LE 4R7LA 1E7UA 5G55A 1Y8MA 4UWHA 4EZLA 4I9CA 5BXUA 5H7PA 3HVEA 5CMYA 2WXFA 3I3NA 3LKUA 4OVUA 4LEUA 4CGVA 3VTYA 1E8ZA 1HZ4A 1NL4A 3FTSA 4J8YA 4FP7A 5FQ8A 3L08A 3ISMC 3ASDA 3G2TA 5BW8C 3R9MA 4EBAG 1ZU2A 4KXKB 4PDXA 5ARGA 2FBNA 2EIME 2KCKA 3MKQB 4JHKA 2XPZA 5CCMA 3ASGA 3TWUA 2XEVA 3PEUB 5ENTD 3EU9A 4XI0A 4F53A 4LSZE 3JXIA 2PZIA 2DYRE 2X6FA 3B7RL 4Y6WA 3BUAA 3C98A 1HG5A 2UY1B 4U8YD 2PM6A 1JWGA 3ASFA 3QARA 2BEDA 3SFYA 3Q9UC 2FO1E 1KLXA 3SFXA 1UN9A 2WXLA 4G2VA 4DRXE 3EIJA 4HORA 2VQ2A 3UKUG 5G2NA 4F1PA 4X8QA 1N54A 3PS6A 3IXEA 1UW4B 2QFCA 3QAQA 3J5PA 4DX7D 3CK7A 4JHRA 4ACKA 3SY2A 3CIAA 2BTDA 4ILGA 3D3MA 2P9NG 1BLXB 3HG0D 3V2XA 4RSYA 2WXPA 1MX6A 2YHCA 4AOFA 2I6HA 2LNIA 2GW1A 4GZ6A 3ZIMA 1OWMA 3ESKA 1Q2ZA 4KYOB 3T5XA 4AEZC 4YDWA 2P9LG 3TWWA 3ZYMA 3UUXA 4UI9J 1VDYA 4HXIA 5CBNA 3KSQA 3D9OA 5KWDA 1ZBPA 1K8KG 3GZSA 5EYLA 3CVQA 5JHBA 4CDMA 5D0QD 3T9KA 1N11A 2NYJA 1U3CA 5BV0A 4GZCA 1N9AA 2WMOA 4KZCA 3JCKC 4DI4A 3MZLB 4GAAA 3HXFA 5AYWD 2Y4UA 1E8WA 1MQSA 2BUGA 3OXFA 4BFRA 3EUVA 2DCPA 4GMRA 4M3OA 1DNPA 1INZA 5JMND 3WXXA 1SZ9A 4GCOA 2R17C 3FP3A 4FHKA 3E33A 1S0PA 3DXMG 3QNKA 3BG0B 1O1TA 3DSWA 2WXRA 3CVPA 1TNBA 3QC1A 4JB8P 5KBAA 5M72A 3RJVA 3CVVA 1HF8A 3Q7AA 4F1SA 3AU4A 3B7SA 5IY5E 3GW4A 1RZ4A 3EU5A 2KM4A 4F6RD 2KC7A 4UWGA 4ILHB 3S2AA 2BKGA 4TXRA 2MRIA 2VGYA 3NQPA 4AP2A 3QOUA 2IF4A 3Q78A 2WXGA 2VJ8A 2R2LA 2ONDA 1V54E 2BKKB 2JABA 4G8LA 2LXLA 3KEAA 3DSVA 3ZYQA 1OWLA 4OAVB 4BX9A 3CV0A 3L82A 1OWNA 4KMOA 5LCWC 4CDNA 3UQ3A 2EIKE 4JA9A 3DWLG 2J4BA 1JCSA 4DX6D 4PS8A 4KVMA 3EJNA 2GRMA 4FHJA 3VTXA 2GGFA 4J8DA 3FWVA 5LCWJ 3FULA 1HX8A 4J7WA 4GMJA 2FF4A 4HOTA 4MS6A 3ZHEA 2LSVA 4LNBA 1NZNA 1FVFA 3R9AB 4BY6A 3FUMA 4TUMA 3CQCB 3O4ZA 4KBQA 2F37A 2ILRA 4HRNA 4DUIA 5KJLA 5D2MC 4GZ3A 3ML8A 1UN8A 5KJNA 4I1OB 3C72A 4U8HA 1BD8A 5AIJA 1IKND 4CYMD 4BEPA 2IQCA 2F0YA 2V0PA 3SI5A 2XS1A 3Q9NC 2L0TB 4I6JA 2P9PG 3QWPA 1FPPA 3FUJA 4DJAA 3EHRA 1LTXA 4WUYA 4YDYA 3ZN3A 2XGMA 1EYHA 2FI7A 3TG5A 4ATZD 4G11A 4J0UA 2J07A 4LG6A 1H6KA 1FCHA 2HM8A 2C2LA 3I5PA 1TNUA 3ASOE 2XCBA 4LRZA 3TJPA 3FU5A 3UINC 3AAAC 3UIOC 5AENA 5KCMA 3RAUA 4P29A 3FH7A 3DEOA 4EECA 4TRQA 1O5MA 3CVUA 4E85A 4UUCA 5EYPF 5EX3A 3CHMA 1TNZA 2L9BA 1L5JA 3MKRA 1WAO1 3D9IA 3LVRE 5BPPA 4EZKA 4AY5A 3EDTB 4L7TA 3SBTB 1D9SA 3X2QE 4KZ0A 2OVFA 1HE8A 5EN5D 3ZEFA 1MJ0A 3RKVA 4K5CA 2H6GA 4RG6A 3UM1A 3BQOA 3PZ2A 4U04A 2H6IA 2VTBB 1PC2A 4I1MA 4AVXA 3TAXA 3T5VA 3NBNB 4DX1A 1H0AA 5FTPA 3IHYA 3LY8A 2F8XK 1MZCA 1LD7A 3RSEG 3WG7E 3GYZA 1N4RA 4B8AA 4EZJA 4GTPA 2WB2A 1ELKA 3NOCD 3ONKA 3DSSA 2WXIA 4GZDA 3CKBA 3ABME 1U2VG 5T3RA 3D9PA 3AS8A 2IOLA 5EILA 4I9EA 5HI7A 4K03A 2B0OE 4JL0A 4RQIA 3ZFWA 3UI2A 3ONLA 3CVYA 3LS8A 1JCRA 2WXNA 5LX8A 2BF0X 4JC8A 4U0UA 3FTYA 4U63A 2OVBA 4A1GA 4FU3A 4HRLA 3CEQA 1XGWA 4YVOA 2HYZA 1UJJA 3FUFA 2WQ7A 4L9PA 3CHSA 3CK8A 2RG8A 2KCVA 2XPYA 5BXOA 4PUCA 1OUVA 3W9GA 3N71A 4CDRA 2GRRB 4KVOA 2VSOE 1HXIA 5AN8A 3DPDA 1WDYA 4UQZA 4U0ZA 3S7BA 4GTMA 4G26A 2ZU6B 2OEWA 2E0IA 4BT8A 3V30A 2YHEA 3HXBA 1D8DA 2XEHA 2XPIA 3PEVB 4B8CB 4JZYA 4OYSA 4BESA 5DBKA 4GCNA 4A3TA 3FTZA 5JJTA 4YVQC 2IONA 3Q5MA 1GW6A 4ME2A 5ANLA 2XZDG 3UT4A 1U3DA 4URKA 2AJAA 2YQ8A 2QYJA 5LOZA 3DXKG 4DK5A 4WWPA 5KNHD 5KNGA 3ESLA 3BEEA 4NACA 4H7XA 2ZGGA 4HOUA 3CHPA 4GTQA 2DZOA 1EF1C 4GU5A 4HVBA 1H6PA 5A7DB 1QQEA 4G1TA 5T4YA 4GB9A 4MBGA 4GZ5A 3RRNB 1NFIE 5G05J 1D8EA 3P1UA 5EIDA 3TGOA 4N5CA 4XX5A 2XS8A 4C0MA 3OTNA 4HRMB 3AU5A 2MOWA 1HFAA 3UXGA 2I9CA 2IO3C 2L0IA 2PQNA 3RRUA 5LFAA 1E7VA 3FTXA 1OCZE 3D9JA 3Q4AB 3E34A 1N4PA 3PZ4A 4L2YA 3ZGQA 3SBSA 2PL2A 3U64A 4DI3A 4F3VA 2V4LA 3CSTA 4C48B 3L13A 1O1RA 3FU0A 2P58C 4JXTA 3Q75A 3SZ7A 3VLFA 4C0EA 4FC8A 3JUEA 3FUHA 1E8YA 4NURA 3ASNE 1HO8A 3UT8A 1TYQG 2WXMA 4GA2A 3NOGD 2B6CA 4N3AA 3KS2A 5A6CA 5J90A 3GZ2A 2QC9A 3ZU7B 2LSUA 4IULA 2DVWA 3FU6A 3FHEA 4FLBA 3ZRHA 1HS6A 4PS7A 2QY7A 1NA0A 4BTBA 2Y4TA 1QZ2A 4I2ZA 3FU3A 2FEZA 2H6FA 3OAWA 4CCAA 3CVXA 2OCCE 1QYMA 2P2CP 2XRZA 2CFZA 3SD5A 5BNWA 4CZ2D 4JHJA 3AG4E 2WMNA 2NSZA 1X81A 3IV0A 1S70B 4Q69A 1SA5A 3HXEA 1UOHA 3V31A 1H2VC 2X6IA 5JHAA 2HO1A 3B7BA 3KSLA 3GZ1A 3TWQA 5AARA 4FULA 3D9LA 1N95A 1Z5SC 3EHQA 4GMLA 5CEAA 1IHGA 3SNXA 3MYVA 3ML9A 3AG2E 2I2OA 4WNGA 3ULYA 4YNDA 3U66A 2X38A 3DSTA 4JD2G 1OWPA 5G04C 1QBQA 4FJZA 1BU9A 4LNGA 4EHMA 4ANVA 3I4RB 5CEDB 3V2OA 2IU1A 2AVPA 4JW1A 4Y6CA 2RFAA 3D9HA 1OY3D 3IKOB 3D9NA 2FO7A 3ABKE 3PE4A 3PREA 4RG9A 3SFZA 4ZHBA 4A3VA 4L23A 2EILE 4N3BA 3PVLA 4EPZA 1N52A 4UQYA 4BTAA 2WM9A 2GRPB 3HRAA 2QZAA 5B3SE 3B7UX 4BWRA 3QK0A 2HR2A 2UY1A
chains in the Genus database with same CATH topology
2OEXA 2R02A 2OEVA 4JIOA 3C3QA 2R05A 2OJQA 3UM0A 2OEWA 2R03A 3RAUA 2XS8A 3C3RA 1ZB1A 5CRVA 5CRUA 3R9MA 3C3OA 2XS1A 3UM1A 3UM2A 3UM3A 3ULYA 3ZXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R02 A;  2OEV A;  3C3Q A;  2R05 A;  3UM0 A;  2OEW A;  2R03 A;  3RAU A;  2XS8 A;  3C3R A;  1ZB1 A;  5CRV A;  5CRU A;  3R9M A;  3C3O A;  2XS1 A;  3UM1 A;  3UM2 A;  3UM3 A;  3ULY A;  3ZXP A; 
#chains in the Genus database with same CATH topology
 2E2E A;  3HVE B;  4AJW A;  3R7R A;  5FZR A;  4J8E A;  5CEC B;  3NZS A;  4FAD A;  5JJ7 A;  1KZO A;  2P9K G;  1S63 A;  4A63 B;  4B94 A;  3SF4 A;  1IYG A;  3MCX A;  3J5Q B;  4J6I A;  4M7C A;  1MHQ A;  2ZXW E;  1HH8 A;  5CHE E;  1AWC B;  1WY6 A;  5FQ6 A;  1XNF A;  4U07 A;  3TWS A;  2VGX A;  2XEN A;  1YYH A;  3D9M A;  1EPU A;  2VYI A;  3LYA A;  2X6J A;  3DSU A;  3CSF A;  1V55 E;  3HYM B;  5FIO A;  2MYO A;  5ENO D;  2KBX A;  2R05 A;  3S7D A;  3PE3 A;  4IRU A;  2KAT A;  3TWV A;  4UQX A;  3UMV A;  3UT7 A;  3CHR A;  4LCT A;  3FEY A;  3EHN A;  1K1A A;  3CHO A;  1RW2 A;  4QFV A;  4HLL A;  2VTB A;  4YDO A;  1H2T C;  4ACL A;  2XQ0 A;  4HI9 A;  3TWT A;  4DLQ A;  1IHB A;  5CER B;  3AJI A;  4C9B B;  2KZT B;  2RKK A;  3AS4 A;  4O1O A;  3MEK A;  1N94 A;  2ZIS A;  2L6J A;  1IQU A;  4MLP A;  2ETA A;  3JQ1 A;  4K5B A;  5AQ7 A;  1YA0 A;  3PZ3 A;  2MHK A;  3ZXP A;  4LNU D;  4WWO A;  1WG0 A;  2EQX A;  3I4G A;  3CR3 A;  2EIJ E;  3C5R A;  2ZIR A;  4HI8 A;  2FUL A;  3PZ1 A;  5ENN A;  4F7A A;  3O48 A;  5E75 A;  5G04 J;  2OOE A;  4MRU A;  5C2Y A;  3DEP A;  3C3O A;  3CGH A;  2IFU A;  2WXH A;  4TXQ A;  4U0S A;  2CG2 A;  4G25 A;  2NC9 A;  4Z68 A;  3ENE A;  5ENQ D;  4U96 D;  3TG4 A;  4K0R A;  2V5Q C;  4GTO A;  2WXQ A;  4G23 A;  3RO3 A;  4EQF A;  1MYO A;  3CLJ A;  4IN3 B;  5JA4 D;  1MX2 A;  3W9F A;  3MV2 B;  3IHV A;  4I17 A;  5EIB E;  1SA4 A;  2WQ6 A;  1TR4 A;  1TN6 A;  1FT2 A;  1OCR E;  5ENR D;  3EIQ C;  5FIN A;  1IXV A;  3S7F A;  1YMP A;  3BU8 A;  2YNQ A;  5CRU A;  3PH0 C;  4GTV A;  4L1B A;  4I6G A;  3ABL E;  4DX5 D;  2WVI A;  3QKY A;  3L16 A;  3MA5 A;  3SGH A;  4WNE A;  3Q79 A;  3KEZ A;  3MGB A;  3E32 A;  3SHF A;  3RK6 A;  1SW6 A;  4H7Y A;  2WPV A;  4B89 A;  2YIN A;  4O1P A;  1AP7 A;  4J8F A;  3TL5 A;  1TN8 A;  1DCQ A;  1TJC A;  2OEV A;  3SQV A;  2XGO A;  5AAO A;  1N4Q A;  2I1K A;  4ILI A;  4J8S A;  4XIF A;  3L54 A;  4AXH A;  4WND A;  1ELW A;  2LAH A;  3QDN A;  5FWQ A;  1K1B A;  3TWR A;  4BET A;  4G24 A;  2V8S E;  1DCE A;  4JVS A;  5HRY A;  5T8I A;  1E90 A;  1DVP A;  1O1S A;  5J08 A;  1TNY A;  2PM7 A;  2H6H A;  4CGW A;  2QYU A;  3L17 A;  3LXU X;  4MKT A;  3U4T A;  4CT4 A;  1BI7 B;  4TV3 A;  4QQI A;  3B13 A;  2J4D A;  5EX0 A;  4A55 A;  2CHW A;  3UM2 A;  5CMW A;  5HQ8 A;  4HFG A;  3VLD A;  1S64 A;  2F8Y A;  3DRA A;  4I2W A;  3MX3 A;  1OT8 A;  4ATG A;  3OXG A;  3UM0 A;  3ZNG A;  3FH8 A;  4NRH B;  4APO A;  3CQG B;  1Z3Y A;  3LY7 A;  5CCL A;  3B95 A;  1LF8 A;  1KT1 A;  3U9W A;  2IOS A;  3FUI A;  3RO2 A;  4ZFH A;  5A23 A;  3URZ A;  2DZN A;  3DSX A;  4TXP A;  4XKC A;  3ZKJ A;  1K3Z D;  5CRV A;  3FUE A;  2P9U G;  3ZPJ A;  3F6Q A;  2GRN B;  3ZVV A;  3L6A A;  2CHX A;  1FT1 A;  1OCC E;  3APF A;  4GYY A;  3CVW A;  4BSX A;  2CG3 A;  3Q49 B;  1LD8 A;  4XZ4 A;  4NIK A;  3C3R A;  3Q47 B;  4GTS A;  4GYW A;  3MV3 B;  4DPR A;  5CBO A;  3L9T A;  3MKQ A;  3JXJ A;  2P9I G;  4AV7 A;  2GRL A;  3DBS A;  3FTU A;  4LUN U;  3LVQ E;  3QJZ A;  3AG3 E;  4N2S A;  2VSX E;  3APD A;  3HIZ A;  4U95 D;  3KAE A;  3FY4 A;  2XCC A;  3VLE A;  2X6H A;  4IYP A;  1ELR A;  3SO8 A;  1BPO A;  2IEJ A;  4WWN A;  3FEX A;  2KCL A;  4G8K A;  3B7T A;  3V79 K;  1EDU A;  2R5S A;  4BX8 A;  1UJK A;  3PRZ A;  1TEZ A;  1TNO A;  2GRO B;  4A1S A;  4UWK A;  2V4H C;  2VGE A;  4PS3 A;  4AM9 A;  3NAW A;  4FLH A;  4FA6 A;  1NA3 A;  3QB2 A;  4JPS A;  2L6B A;  3ZYL A;  3FUD A;  5DIZ A;  1NI1 A;  1SQM A;  1H19 A;  2HE0 A;  3L22 A;  3T8M A;  4RLY A;  1HG2 A;  4EBA A;  3E37 A;  2AXU A;  1H2U A;  1YCS B;  4L2L A;  5C1D A;  3UKR G;  2AXZ A;  4GTT A;  5ENP D;  5LP0 A;  4O6F A;  3LY9 A;  4W9R A;  3PZD A;  5D66 A;  4LER A;  3TXM A;  4XE0 A;  1TN7 A;  3Q15 A;  1OCO E;  4GA0 A;  2CHZ A;  3OXL A;  2VSN A;  5AQA A;  4ANX A;  2J49 A;  5FQ4 A;  2A5U A;  3HXC A;  4V3I A;  2C0L A;  3PNL B;  5KJK A;  3P2B A;  1BI8 B;  2R02 A;  2Y0B G;  2J9Q A;  2ETB A;  1FVH A;  3LPZ A;  3FDH A;  2A4Z A;  5HS0 A;  3MJW A;  3AS5 A;  4Q94 A;  2JLB A;  3NB2 A;  5B1A E;  1A5E A;  3LCA A;  3IBE A;  3ZW3 A;  1OXJ A;  3HDX A;  3FH5 A;  2VSY A;  4CRW A;  4UI9 K;  1X5B A;  5FJY A;  4CEM A;  3C3Q A;  1NP7 A;  3UIP C;  4N2Q A;  1N4S A;  4D10 C;  3ZXS A;  5HKP A;  4E6H A;  4OAU C;  5G05 C;  1KPS B;  4BER A;  4GYO A;  4U8V D;  3PUJ A;  3CK9 A;  2DYS E;  1SVX A;  2V5F A;  4OVV A;  4I6E A;  3CKC A;  2OV8 A;  4GTR A;  4K5A B;  3K9I A;  2VGX B;  4HBD A;  1UG3 A;  5AQB A;  4DX2 A;  5BUZ A;  4XKB A;  3IEG A;  4Q96 A;  2DWZ A;  1ZB1 A;  1B89 A;  1JPL A;  2XRY A;  3G2U A;  5FZS A;  4UWF A;  3PDN A;  1E8X A;  1JCQ A;  4WAF A;  2XHE A;  2X6K A;  1JUQ A;  1KT0 A;  4B93 B;  4BSZ B;  3S7J A;  1PY1 A;  4ANW A;  3G2V A;  2Y3A A;  3UX4 A;  3CVN A;  5KJM A;  1E96 B;  2LO6 A;  4UI9 C;  4GPK A;  3QWW A;  1WM5 A;  2ZGD A;  4HOQ A;  1Y6I A;  1N0R A;  2DIW A;  4PH4 B;  3TXN A;  3ULE G;  2A5E A;  3PUK A;  3UPV A;  4NQ0 A;  3FUN A;  3E30 A;  3QWV A;  4DLO A;  4HQD A;  3CHQ A;  2NXP A;  4KT6 B;  2AW6 A;  5JJ6 A;  3EHM A;  3ZUV B;  4RVB A;  5ANR A;  5ARF A;  3TWX A;  2IY0 C;  3LJ3 A;  3D9K A;  2R03 A;  2WXJ A;  4N39 A;  3ZHE B;  5ENS D;  3LDZ A;  4AY6 A;  1Z3X A;  2KZT A;  2XEE A;  3FTW A;  2R59 A;  4JEU A;  3Q73 A;  5AJD A;  4XI9 A;  3UM3 A;  2J08 A;  4I1A A;  5ITZ F;  3NF1 A;  3Q7F A;  2X3M A;  2JEK A;  4HOS A;  5FQ7 A;  2GRQ B;  3DPY A;  5B1B E;  1TJF A;  1SZA A;  1P5Q A;  5BT1 A;  2P9S G;  3FFL A;  4JEH A;  4U7E B;  2LAI A;  2EIN E;  2KXP C;  5BV1 A;  5E76 A;  2LXM A;  4HLE A;  2ETC A;  2PQR A;  1H6O A;  4O60 A;  3ASH A;  1MX4 A;  3RRM B;  2XGS A;  3LJN A;  5EDS A;  2PNN A;  1W3B A;  2Q7F A;  3G2S A;  3KD7 A;  3FUK A;  3AG1 E;  3FTV A;  4TUU A;  3JQ0 A;  3JYS A;  4AIF A;  4N3C A;  3HXD A;  4GPM A;  4CT0 A;  1G3N B;  4WNF A;  2RD0 A;  2M63 A;  3G2W A;  2WQH A;  3RU0 A;  1KZP A;  2UWJ G;  1OWO A;  2J8S D;  3HHM A;  1HU3 A;  3JUI A;  4XEI G;  5AJL A;  5AQ9 A;  2AWI A;  3T8K A;  5FT9 A;  4ABN A;  2CFU A;  4APF A;  1PAQ A;  2RFM A;  2C0M A;  4HNA D;  1IQR A;  1DC2 A;  2WXO A;  4HS2 A;  4JA7 A;  2DBA A;  3ZYK A;  1JWF A;  2AXV A;  2IO2 C;  3APC A;  4I43 A;  4UWL A;  3BG1 B;  1QNF A;  3PNT B;  1Z6T A;  4FJY A;  2IJG X;  2XZT G;  2WXK A;  3R7Q A;  4B0Z A;  3CVL A;  4YDE A;  3RIB A;  3LEW A;  4ANU A;  1N0Q A;  4HB5 A;  3NZU A;  3UTM A;  2I1J A;  4GA1 A;  5D0O D;  5FZQ A;  2J09 A;  1A17 A;  4N5Q A;  2LUH A;  3E4B A;  5EKQ D;  3U3W A;  3ULQ A;  4BT9 A;  2Y69 E;  2Y1L E;  4R7L A;  1E7U A;  5G55 A;  1Y8M A;  4UWH A;  4EZL A;  4I9C A;  5BXU A;  5H7P A;  3HVE A;  5CMY A;  2WXF A;  3I3N A;  3LKU A;  4OVU A;  4LEU A;  4CGV A;  3VTY A;  1E8Z A;  1HZ4 A;  1NL4 A;  3FTS A;  4J8Y A;  4FP7 A;  5FQ8 A;  3L08 A;  3ISM C;  3ASD A;  3G2T A;  5BW8 C;  3R9M A;  4EBA G;  1ZU2 A;  4KXK B;  4PDX A;  5ARG A;  2FBN A;  2EIM E;  2KCK A;  3MKQ B;  4JHK A;  2XPZ A;  5CCM A;  3ASG A;  3TWU A;  2XEV A;  3PEU B;  5ENT D;  3EU9 A;  4XI0 A;  4F53 A;  4LSZ E;  3JXI A;  2PZI A;  2DYR E;  2X6F A;  3B7R L;  4Y6W A;  3BUA A;  3C98 A;  1HG5 A;  2UY1 B;  4U8Y D;  2PM6 A;  1JWG A;  3ASF A;  3QAR A;  2BED A;  3SFY A;  3Q9U C;  2FO1 E;  1KLX A;  3SFX A;  1UN9 A;  2WXL A;  4G2V A;  4DRX E;  3EIJ A;  4HOR A;  2VQ2 A;  3UKU G;  5G2N A;  4F1P A;  4X8Q A;  1N54 A;  3PS6 A;  3IXE A;  1UW4 B;  2QFC A;  3QAQ A;  3J5P A;  4DX7 D;  3CK7 A;  4JHR A;  4ACK A;  3SY2 A;  3CIA A;  2BTD A;  4ILG A;  3D3M A;  2P9N G;  1BLX B;  3HG0 D;  3V2X A;  4RSY A;  2WXP A;  1MX6 A;  2YHC A;  4AOF A;  2I6H A;  2LNI A;  2GW1 A;  4GZ6 A;  3ZIM A;  1OWM A;  3ESK A;  1Q2Z A;  4KYO B;  3T5X A;  4AEZ C;  4YDW A;  2P9L G;  3TWW A;  3ZYM A;  3UUX A;  4UI9 J;  1VDY A;  4HXI A;  5CBN A;  3KSQ A;  3D9O A;  5KWD A;  1ZBP A;  1K8K G;  3GZS A;  5EYL A;  3CVQ A;  5JHB A;  4CDM A;  5D0Q D;  3T9K A;  1N11 A;  2NYJ A;  1U3C A;  5BV0 A;  4GZC A;  1N9A A;  2WMO A;  4KZC A;  3JCK C;  4DI4 A;  3MZL B;  4GAA A;  3HXF A;  5AYW D;  2Y4U A;  1E8W A;  1MQS A;  2BUG A;  3OXF A;  4BFR A;  3EUV A;  2DCP A;  4GMR A;  4M3O A;  1DNP A;  1INZ A;  5JMN D;  3WXX A;  1SZ9 A;  4GCO A;  2R17 C;  3FP3 A;  4FHK A;  3E33 A;  1S0P A;  3DXM G;  3QNK A;  3BG0 B;  1O1T A;  3DSW A;  2WXR A;  3CVP A;  1TNB A;  3QC1 A;  4JB8 P;  5KBA A;  5M72 A;  3RJV A;  3CVV A;  1HF8 A;  3Q7A A;  4F1S A;  3AU4 A;  3B7S A;  5IY5 E;  3GW4 A;  1RZ4 A;  3EU5 A;  2KM4 A;  4F6R D;  2KC7 A;  4UWG A;  4ILH B;  3S2A A;  2BKG A;  4TXR A;  2MRI A;  2VGY A;  3NQP A;  4AP2 A;  3QOU A;  2IF4 A;  3Q78 A;  2WXG A;  2VJ8 A;  2R2L A;  2OND A;  1V54 E;  2BKK B;  2JAB A;  4G8L A;  2LXL A;  3KEA A;  3DSV A;  3ZYQ A;  1OWL A;  4OAV B;  4BX9 A;  3CV0 A;  3L82 A;  1OWN A;  4KMO A;  5LCW C;  4CDN A;  3UQ3 A;  2EIK E;  4JA9 A;  3DWL G;  2J4B A;  1JCS A;  4DX6 D;  4PS8 A;  4KVM A;  3EJN A;  2GRM A;  4FHJ A;  3VTX A;  2GGF A;  4J8D A;  3FWV A;  5LCW J;  3FUL A;  1HX8 A;  4J7W A;  4GMJ A;  2FF4 A;  4HOT A;  4MS6 A;  3ZHE A;  2LSV A;  4LNB A;  1NZN A;  1FVF A;  3R9A B;  4BY6 A;  3FUM A;  4TUM A;  3CQC B;  3O4Z A;  4KBQ A;  2F37 A;  2ILR A;  4HRN A;  4DUI A;  5KJL A;  5D2M C;  4GZ3 A;  3ML8 A;  1UN8 A;  5KJN A;  4I1O B;  3C72 A;  4U8H A;  1BD8 A;  5AIJ A;  1IKN D;  4CYM D;  4BEP A;  2IQC A;  2F0Y A;  2V0P A;  3SI5 A;  2XS1 A;  3Q9N C;  2L0T B;  4I6J A;  2P9P G;  3QWP A;  1FPP A;  3FUJ A;  4DJA A;  3EHR A;  1LTX A;  4WUY A;  4YDY A;  3ZN3 A;  2XGM A;  1EYH A;  2FI7 A;  3TG5 A;  4ATZ D;  4G11 A;  4J0U A;  2J07 A;  4LG6 A;  1H6K A;  1FCH A;  2HM8 A;  2C2L A;  3I5P A;  1TNU A;  3ASO E;  2XCB A;  4LRZ A;  3TJP A;  3FU5 A;  3UIN C;  3AAA C;  3UIO C;  5AEN A;  5KCM A;  3RAU A;  4P29 A;  3FH7 A;  3DEO A;  4EEC A;  4TRQ A;  1O5M A;  3CVU A;  4E85 A;  4UUC A;  5EYP F;  5EX3 A;  3CHM A;  1TNZ A;  2L9B A;  1L5J A;  3MKR A;  1WAO 1;  3D9I A;  3LVR E;  5BPP A;  4EZK A;  4AY5 A;  3EDT B;  4L7T A;  3SBT B;  1D9S A;  3X2Q E;  4KZ0 A;  2OVF A;  1HE8 A;  5EN5 D;  3ZEF A;  1MJ0 A;  3RKV A;  4K5C A;  2H6G A;  4RG6 A;  3UM1 A;  3BQO A;  3PZ2 A;  4U04 A;  2H6I A;  2VTB B;  1PC2 A;  4I1M A;  4AVX A;  3TAX A;  3T5V A;  3NBN B;  4DX1 A;  1H0A A;  5FTP A;  3IHY A;  3LY8 A;  2F8X K;  1MZC A;  1LD7 A;  3RSE G;  3WG7 E;  3GYZ A;  1N4R A;  4B8A A;  4EZJ A;  4GTP A;  2WB2 A;  1ELK A;  3NOC D;  3ONK A;  3DSS A;  2WXI A;  4GZD A;  3CKB A;  3ABM E;  1U2V G;  5T3R A;  3D9P A;  3AS8 A;  2IOL A;  5EIL A;  4I9E A;  5HI7 A;  4K03 A;  2B0O E;  4JL0 A;  4RQI A;  3ZFW A;  3UI2 A;  3ONL A;  3CVY A;  3LS8 A;  1JCR A;  2WXN A;  5LX8 A;  2BF0 X;  4JC8 A;  4U0U A;  3FTY A;  4U63 A;  2OVB A;  4A1G A;  4FU3 A;  4HRL A;  3CEQ A;  1XGW A;  4YVO A;  2HYZ A;  1UJJ A;  3FUF A;  2WQ7 A;  4L9P A;  3CHS A;  3CK8 A;  2RG8 A;  2KCV A;  2XPY A;  5BXO A;  4PUC A;  1OUV A;  3W9G A;  3N71 A;  4CDR A;  2GRR B;  4KVO A;  2VSO E;  1HXI A;  5AN8 A;  3DPD A;  1WDY A;  4UQZ A;  4U0Z A;  3S7B A;  4GTM A;  4G26 A;  2ZU6 B;  2OEW A;  2E0I A;  4BT8 A;  3V30 A;  2YHE A;  3HXB A;  1D8D A;  2XEH A;  2XPI A;  3PEV B;  4B8C B;  4JZY A;  4OYS A;  4BES A;  5DBK A;  4GCN A;  4A3T A;  3FTZ A;  5JJT A;  4YVQ C;  2ION A;  3Q5M A;  1GW6 A;  4ME2 A;  5ANL A;  2XZD G;  3UT4 A;  1U3D A;  4URK A;  2AJA A;  2YQ8 A;  2QYJ A;  5LOZ A;  3DXK G;  4DK5 A;  4WWP A;  5KNH D;  5KNG A;  3ESL A;  3BEE A;  4NAC A;  4H7X A;  2ZGG A;  4HOU A;  3CHP A;  4GTQ A;  2DZO A;  1EF1 C;  4GU5 A;  4HVB A;  1H6P A;  5A7D B;  1QQE A;  4G1T A;  5T4Y A;  4GB9 A;  4MBG A;  4GZ5 A;  3RRN B;  1NFI E;  5G05 J;  1D8E A;  3P1U A;  5EID A;  3TGO A;  4N5C A;  4XX5 A;  2XS8 A;  4C0M A;  3OTN A;  4HRM B;  3AU5 A;  2MOW A;  1HFA A;  3UXG A;  2I9C A;  2IO3 C;  2L0I A;  2PQN A;  3RRU A;  5LFA A;  1E7V A;  3FTX A;  1OCZ E;  3D9J A;  3Q4A B;  3E34 A;  1N4P A;  3PZ4 A;  4L2Y A;  3ZGQ A;  3SBS A;  2PL2 A;  3U64 A;  4DI3 A;  4F3V A;  2V4L A;  3CST A;  4C48 B;  3L13 A;  1O1R A;  3FU0 A;  2P58 C;  4JXT A;  3Q75 A;  3SZ7 A;  3VLF A;  4C0E A;  4FC8 A;  3JUE A;  3FUH A;  1E8Y A;  4NUR A;  3ASN E;  1HO8 A;  3UT8 A;  1TYQ G;  2WXM A;  4GA2 A;  3NOG D;  2B6C A;  4N3A A;  3KS2 A;  5A6C A;  5J90 A;  3GZ2 A;  2QC9 A;  3ZU7 B;  2LSU A;  4IUL A;  2DVW A;  3FU6 A;  3FHE A;  4FLB A;  3ZRH A;  1HS6 A;  4PS7 A;  2QY7 A;  1NA0 A;  4BTB A;  2Y4T A;  1QZ2 A;  4I2Z A;  3FU3 A;  2FEZ A;  2H6F A;  3OAW A;  4CCA A;  3CVX A;  2OCC E;  1QYM A;  2P2C P;  2XRZ A;  2CFZ A;  3SD5 A;  5BNW A;  4CZ2 D;  4JHJ A;  3AG4 E;  2WMN A;  2NSZ A;  1X81 A;  3IV0 A;  1S70 B;  4Q69 A;  1SA5 A;  3HXE A;  1UOH A;  3V31 A;  1H2V C;  2X6I A;  5JHA A;  2HO1 A;  3B7B A;  3KSL A;  3GZ1 A;  3TWQ A;  5AAR A;  4FUL A;  3D9L A;  1N95 A;  1Z5S C;  3EHQ A;  4GML A;  5CEA A;  1IHG A;  3SNX A;  3MYV A;  3ML9 A;  3AG2 E;  2I2O A;  4WNG A;  3ULY A;  4YND A;  3U66 A;  2X38 A;  3DST A;  4JD2 G;  1OWP A;  5G04 C;  1QBQ A;  4FJZ A;  1BU9 A;  4LNG A;  4EHM A;  4ANV A;  3I4R B;  5CED B;  3V2O A;  2IU1 A;  2AVP A;  4JW1 A;  4Y6C A;  2RFA A;  3D9H A;  1OY3 D;  3IKO B;  3D9N A;  2FO7 A;  3ABK E;  3PE4 A;  3PRE A;  4RG9 A;  3SFZ A;  4ZHB A;  4A3V A;  4L23 A;  2EIL E;  4N3B A;  3PVL A;  4EPZ A;  1N52 A;  4UQY A;  4BTA A;  2WM9 A;  2GRP B;  3HRA A;  2QZA A;  5B3S E;  3B7U X;  4BWR A;  3QK0 A;  2HR2 A;  2UY1 A; 
#chains in the Genus database with same CATH homology
 2OEX A;  2R02 A;  2OEV A;  4JIO A;  3C3Q A;  2R05 A;  2OJQ A;  3UM0 A;  2OEW A;  2R03 A;  3RAU A;  2XS8 A;  3C3R A;  1ZB1 A;  5CRV A;  5CRU A;  3R9M A;  3C3O A;  2XS1 A;  3UM1 A;  3UM2 A;  3UM3 A;  3ULY A;  3ZXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...