3RAUA

Crystal structure of the hd-ptp bro1 domain
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
358
structure length
358
Chain Sequence
VPRMPMIWLDLKEAGDFHFQPAVKKFVLKNYGENPEAYNEELKKLELLRQNAVRVPRDFEGCSVLRKYLGQLHYLQSRVPMGSGQEAAVPVTWTEIFSGKSVAHEDIKYEQACILYNLGALHSMLGAMDKRVSEEGMKVSCTHFQCAAGAFAYLREHFPQAYSVDMSRQILTLNVNLMLGQAQECLLEKSMLDNRKSFLVARISAQVVDYYKEACRALENPDTASLLGRIQKDWKKLVQMKIYYFAAVAHLHMGKQAEEQQKFGERVAYFQSALDKLNEAIKLAKGQPDTVQDALRFTMDVIGGKYNSAKKDNDFIYHEAVPALDTLQPVKGAPLVKPLPVNPTDPAVTGPDIFAKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Tyrosine-protein phosphatase non-receptor type 23
publication title The Phe105 Loop of Alix Bro1 Domain Plays a Key Role in HIV-1 Release.
pubmed doi rcsb
source organism Homo sapiens
total genus 143
structure length 358
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2011-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.280 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat alix/aip1 like domains 3rauA00
2OEVA 1ZB1A 3C3OA 3RAUA 5CRUA 5CRVA 2XS8A 3C3RA 3UM0A 3UM1A 3UM3A 3ULYA 2R03A 3ZXPA 3UM2A 3C3QA 2R05A 2XS1A 2R02A 3R9MA 2OEWA
chains in the Genus database with same CATH superfamily
2JEKA 4KVOA 5CMWA 1ZU2A 2EIME 3PVLA 4U8VD 1MX2A 4I2ZA 5EDSA 2DIWA 4AOFA 4UUCA 5BXUA 1UG3A 4EBAA 2RFMA 2YNQA 3AU5A 5ANRA 3SNXA 3ZHEA 1K8KG 4EHMA 4JHJA 1K1AA 2JABA 3C3QA 3UT7A 4M7CA 3QARA 4I6JA 1ELWA 2CFUA 1P5QA 3CQGB 4HRNA 2XRZA 4C9BB 4GA1A 4GTSA 3FUHA 2GRNB 4KVMA 1TYQG 2WXJA 1X81A 4BEPA 4B94A 4F53A 2WXKA 1OWNA 4JHKA 2RKKA 3U9WA 5ENTD 3PNTB 5HKPA 3JQ0A 2OVBA 2QZAA 2R59A 2LO6A 2OCCE 2MOWA 2XQ0A 3FU5A 3QDNA 2LSVA 1QBQA 3LS8A 3CR3A 4BFRA 3I4RB 4BX9A 1Z5SC 3UPVA 3UKRG 3G2VA 2B0OE 2ZIRA 3NZSA 4FP7A 1AWCB 4EQFA 4GTQA 2FO1E 4A1SA 2C0MA 1XGWA 3FEYA 3MV3B 3E4BA 2F37A 2OEVA 2B6CA 5LOZA 4YVQC 1PAQA 3FWVA 2XHEA 4UQZA 3NOCD 3OTNA 3BQOA 4K5CA 4XI9A 3SO8A 3ZFWA 1OCCE 3QKYA 1N52A 2IOSA 1MJ0A 3S7BA 1H19A 3T5VA 3ZXSA 3DXMG 2BKKB 3LYAA 4U8YD 1FT2A 4ILIA 2V0PA 3QB2A 3L22A 2C2LA 4FA6A 3JQ1A 5G04J 3TGOA 3PS6A 3AS5A 3D9HA 2IY0C 2LXMA 3NQPA 2WVIA 1IYGA 4GMLA 4IRUA 3DEPA 1U3CA 4JPSA 3PE3A 3QWVA 4TXQA 3MEKA 3ZYKA 2A4ZA 3B7TA 1OCOE 5BW8C 2PM7A 1MZCA 3ASNE 4LRZA 1KZOA 2ZISA 5FZQA 3EU5A 2AXUA 3CKCA 3CHQA 5AQ7A 2QC9A 5AAOA 4ANWA 4JHRA 4APOA 1W3BA 5ENNA 2HM8A 4FLBA 3RO2A 4CYMD 4GB9A 3RSEG 5G05C 3EDTB 3SZ7A 1U2VG 2IJGX 3SD5A 4GMJA 2C0LA 3MV2B 2LAHA 1FVHA 1E8XA 4DI3A 4BT9A 2JLBA 4HLLA 2BEDA 5LP0A 1TJCA 1YCSB 4F7AA 4L1BA 4MRUA 5AN8A 3CVUA 4EBAG 5LCWJ 4BERA 5KBAA 4RG6A 4ABNA 4TUMA 4PS3A 3VTXA 3AG2E 3LVRE 4NQ0A 4N2SA 3BG0B 4Q69A 4O1PA 2QY7A 4F1SA 3ABME 2P9IG 4C0EA 1SVXA 3QWPA 3FULA 4GZDA 4BESA 3KEAA 1Y6IA 5KCMA 1HF8A 3B7UX 4APFA 3QNKA 3ESKA 5AJDA 1HE8A 5CCMA 4WWNA 3CHRA 4FHJA 4PH4B 1NZNA 1QNFA 1DC2A 3U64A 3DWLG 2CHXA 4G23A 3FTWA 3FUNA 4L7TA 5JMND 2KBXA 4RG9A 3RU0A 5A6CA 2WXRA 3TXNA 4AM9A 4DUIA 5T8IA 2WXMA 4C48B 2P9LG 2WXFA 4J6IA 2AWIA 3N71A 3FH8A 5AENA 2YHCA 3PREA 1QYMA 2FO7A 2VQ2A 3UIPC 3ZVVA 1JCRA 2UY1A 1KPSB 2J07A 2XPZA 2NC9A 2OOEA 3J5PA 3AS8A 4B8AA 3MCXA 3EIJA 1JWFA 3D9PA 4F1PA 5BNWA 3Q9UC 1UN9A 5EX0A 3URZA 1AP7A 3CHMA 1H6OA 4B0ZA 4F3VA 4YDEA 5ENRD 5G04C 4JA9A 3AG3E 3LJ3A 4TXRA 1N95A 1BI7B 2PZIA 2Y3AA 1IQUA 2GRRB 5ENSD 2YQ8A 4DPRA 4AY5A 4CZ2D 3WXXA 4U07A 3B7SA 5KJNA 3ABKE 4OYSA 3L54A 1S0PA 4U95D 3PZ4A 3DSSA 3FUDA 2I1KA 3T5XA 3JYSA 4ACKA 4JZYA 1FCHA 2IF4A 3CHSA 4A55A 2KCLA 3PEUB 3HXFA 1JCSA 4K5BA 3I5PA 4K5AB 4CRWA 5BV1A 2XS8A 3UIOC 4Q96A 4RLYA 3EHRA 4FC8A 4IULA 3SBTB 2EIKE 4BSZB 2VGXA 3D9JA 1UJKA 2FBNA 3HDXA 1BPOA 2L6BA 5E75A 3QC1A 2QYUA 5D66A 2X6JA 1JWGA 1N9AA 2XENA 3TXMA 5AYWD 1NL4A 2XEEA 3G2SA 3Q7FA 3ONKA 3HXBA 3CK7A 4NACA 4ATZD 4HI8A 3GZSA 3NBNB 5BPPA 4HOSA 4G8LA 3DSXA 1ZBPA 4UI9K 5T3RA 3RKVA 3Q47B 3L82A 1X5BA 3L17A 1GW6A 5HQ8A 4EZLA 2J49A 4OAUC 3UKUG 3DSVA 3CQCB 4GA0A 3OXGA 3D9LA 3HXCA 5CRUA 2DYRE 2HR2A 2H6FA 4G1TA 5IY5E 4TXPA 3OAWA 4CT0A 5EYPF 2XZDG 4J0UA 4WUYA 3UINC 3TWSA 3FEXA 1N0RA 3O48A 4LUNU 5EILA 3TWVA 4ZHBA 1E7VA 2XCBA 1O1SA 4ANUA 3SGHA 4E6HA 4JD2G 3TG5A 3GZ2A 1JCQA 4IYPA 3V2OA 2CHWA 4XE0A 1S63A 2WXIA 2Y4UA 1DVPA 3DXKG 2RFAA 4UWGA 3LY9A 4HBDA 4JEHA 2KATA 5CECB 2P9PG 4F6RD 3SBSA 3R7QA 4CDMA 4I2WA 4AV7A 4FJZA 3V2XA 4MS6A 4OVUA 1HXIA 3VLFA 1LD8A 4HOTA 5EKQD 5B1BE 4IN3B 3TWUA 2ETCA 5B3SE 2ZGDA 1KT1A 5G05J 1B89A 1ELKA 4OVVA 2VTBA 3ZU7B 3IEGA 4HRMB 5ENOD 2AVPA 2DWZA 4ATGA 4TUUA 3SF4A 1E8ZA 3E32A 3GW4A 2LUHA 3CGHA 2H6GA 4LSZE 2F8YA 3EUVA 4DRXE 3FDHA 2XGSA 3Q79A 4DX7D 2OVFA 4NIKA 3ZUVB 4N3AA 5D0OD 1NFIE 1HFAA 3CVLA 3UT8A 2X3MA 5CHEE 2PM6A 3GZ1A 1HH8A 3FUEA 1L5JA 4L2LA 3S7FA 4AY6A 4J8EA 4JXTA 4AEZC 5B1AE 1A17A 1D8EA 4WNEA 4GYOA 2PQNA 4ME2A 1D9SA 1XNFA 5HRYA 2EIJE 3CSTA 5KWDA 4DJAA 4U63A 2IEJA 3Q49B 4JW1A 3SFZA 3DSTA 4UQXA 1SA4A 2Y0BG 3TJPA 1QQEA 5KJLA 1OXJA 1SA5A 2XPIA 3E30A 1EPUA 5JJ6A 3AG1E 3JUIA 1A5EA 4UWLA 4G2VA 3ZNGA 3CVVA 2J08A 4N5CA 3G2TA 3ULYA 3QJZA 1TNBA 4O6FA 3ZPJA 2GRPB 5J08A 3QK0A 4HFGA 4XKBA 4XIFA 3R9AB 3J5QB 2KZTA 3FH7A 3C98A 3W9GA 3HXEA 2ZU6B 2P9NG 2QFCA 4XKCA 4DX6D 3U3WA 3HIZA 3B95A 4HB5A 4KZCA 3DPYA 4ZFHA 1G3NB 1E96B 4R7LA 3CIAA 5DIZA 3RRUA 3Q15A 1YMPA 5ITZF 2VJ8A 3FTXA 4RVBA 4FLHA 5AIJA 3UQ3A 1WM5A 3CHOA 2FULA 1WAO1 2OEWA 3FUKA 3FU6A 4BTAA 4HS2A 2LNIA 2YINA 5CEDB 2VGEA 3B7RL 1BD8A 3CSFA 4FHKA 4GZ5A 3ZN3A 5FJYA 2J09A 2R03A 2VSYA 1NA3A 3FTYA 3PUJA 2WXOA 4I17A 3SHFA 4J8FA 1OCZE 2KXPC 3ULQA 1PC2A 3JUEA 3FUJA 4PDXA 3Q7AA 4L9PA 1V55E 4X8QA 1OUVA 1OCRE 2VGXB 4Q94A 1OY3D 1HO8A 3FTUA 5AQAA 5LX8A 3VLEA 3RRMB 1TN6A 4AP2A 4A3TA 3CVQA 3DPDA 3E37A 3FUFA 3SFXA 3KSQA 3JXJA 4XI0A 3UM0A 1SW6A 1KT0A 4G24A 5JA4D 2AW6A 5EYLA 3CV0A 2XEVA 5CCLA 4ILHB 2ETAA 2L0IA 5FQ6A 2X6IA 2VSXE 4G11A 3ABLE 1LD7A 4N5QA 4A1GA 3CEQA 2WXNA 3KSLA 2WXGA 2DCPA 1SZAA 4WNFA 2WXPA 1Z6TA 4WWPA 1N0QA 3SI5A 3DSWA 4LERA 5FTPA 5CEAA 3CK9A 4NRHB 2V4HC 4EECA 5D0QD 1HG2A 1SZ9A 1N11A 4U7EB 1NP7A 2NYJA 4HOUA 3OXFA 4GTPA 3RAUA 3Q73A 3AG4E 3UX4A 4GMRA 2CHZA 5C2YA 3RO3A 1MYOA 4BSXA 1MX6A 1O5MA 1PY1A 4RQIA 2KCVA 4M3OA 3IXEA 4URKA 4KMOA 4G25A 1K1BA 3Q75A 4KBQA 3D9IA 4B89A 3G2WA 4GA2A 3PZ2A 4U04A 1NI1A 3CKBA 1KZPA 3P1UA 3UM1A 5FIOA 1H2VC 1OWPA 4TRQA 3SFYA 4DLQA 2I1JA 3D9MA 4U96D 2IO3C 3TWWA 4EZJA 2VTBB 3LY8A 4HNAD 3ISMC 5FINA 2GRQB 4FADA 2GRMA 3CK8A 4YDOA 2I6HA 3MX3A 2AXZA 5A23A 3ZHEB 1H2UA 1HG5A 4CCAA 4HORA 3UM2A 4JB8P 3FTZA 2GROB 1ELRA 1LTXA 4B93B 1JPLA 2VSNA 4CDRA 2R2LA 1TNUA 3C3RA 4G26A 4E85A 1N4PA 4XEIG 5AJLA 4UQYA 4I6EA 3B13A 4I9CA 1WDYA 4MKTA 2V5QC 2WMOA 4L23A 2I9CA 3CVYA 2ONDA 3HG0D 5FZSA 3OXLA 2IFUA 2J4BA 3JCKC 3LJNA 3E34A 1H0AA 4LNUD 3HVEA 1N54A 4WWOA 5CBNA 2J9QA 4CGWA 3S2AA 5EIBE 5D2MC 3TL5A 2FEZA 3Q9NC 4YDWA 3FY4A 4YDYA 3PH0C 4HVBA 3IV0A 2Q7FA 5JHBA 5BT1A 2L0TB 4GTTA 1O1RA 5FT9A 2KM4A 4ILGA 1IQRA 2R17C 4DI4A 4V3IA 4XZ4A 4J8DA 2BKGA 3QAQA 2DZNA 5C1DA 2M63A 2WQ7A 4JL0A 4L2YA 4GZCA 1H2TC 3IHYA 2PQRA 2X6FA 3ZXPA 2KZTB 4O1OA 2EINE 4C0MA 3Q4AB 3PUKA 1OWOA 3AU4A 4LNGA 3T9KA 3UUXA 4I6GA 4GYWA 5FZRA 4PS7A 2BF0X 2Y69E 3L08A 3DBSA 1OT8A 4DX1A 4I43A 1N94A 1O1TA 4WNDA 5J90A 3S7DA 5CRVA 1K3ZD 3FTVA 3V79K 4UWHA 4DLOA 5AQBA 2IU1A 3ONLA 4Y6CA 4DK5A 5EIDA 3TWRA 4XX5A 1LF8A 3MA5A 3RJVA 2L6JA 5EN5D 4JA7A 2GGFA 2BTDA 1U3DA 3U66A 5G2NA 3V30A 5KJKA 1HX8A 3DEOA 1OWMA 3D3MA 3KAEA 3RRNB 3L6AA 3O4ZA 4CGVA 4ACLA 3NF1A 4KYOB 2ZGGA 1BU9A 5FQ8A 1IHBA 1TN8A 5HS0A 3MKRA 1TNZA 3LVQE 4AJWA 2F8XK 2WQHA 3NOGD 4J8SA 4QQIA 3CVXA 3T8KA 4U8HA 4LEUA 2PL2A 4GYYA 4H7YA 1OWLA 2P9SG 5ENPD 2WM9A 3EU9A 4DX2A 3CVWA 2KC7A 2VYIA 3QWWA 3ZEFA 1E7UA 2MRIA 3ASDA 4KXKB 3LEWA 4FU3A 3PRZA 1BI8B 2WXQA 3QOUA 4I1MA 2DBAA 2IONA 3FH5A 3KEZA 1Q2ZA 2OV8A 3TWQA 2XEHA 3HYMB 3MKQA 4G8KA 5JJTA 1UW4B 4CEMA 5LFAA 2CG2A 3W9FA 4U0SA 2IOLA 3BG1B 3DRAA 2ETBA 4J8YA 4N3CA 3MZLB 3CLJA 3ML9A 2UY1B 3EHQA 3TWTA 2ZXWE 2R02A 3AS4A 3R9MA 1UN8A 4GCNA 4GZ6A 2FF4A 2WB2A 3F6QA 4UI9C 2XRYA 2WMNA 2A5EA 1Y8MA 1WY6A 1FVFA 2RG8A 5DBKA 3R7RA 1EDUA 4P29A 3TWXA 3ENEA 4YVOA 3LY7A 2FI7A 3DSUA 3MGBA 3Q5MA 4K0RA 4GZ3A 1JUQA 2XCCA 3Q78A 2P2CP 4OAVB 5HI7A 2AXVA 4KT6B 3I3NA 3B7BA 4BY6A 4Z68A 5BV0A 2LSUA 4H7XA 2RD0A 3LXUX 3APCA 5CERB 1V54E 3ASGA 2HYZA 2X6HA 3APDA 4B8CB 1TJFA 4I1OB 1RW2A 3EIQC 5AQ9A 1Z3YA 2F0YA 3PNLB 3NB2A 3L13A 2CG3A 1EF1C 4HOQA 3UM3A 3NAWA 1VDYA 3VLDA 4GAAA 2PNNA 3ZW3A 2J4DA 1FPPA 2XS1A 1QZ2A 4U0ZA 2QYJA 3ZRHA 5A7DB 2DZOA 4AVXA 2WXHA 2YHEA 4HLEA 3HVEB 1KLXA 4D10C 2XGOA 2J8SD 3BUAA 3FP3A 1TNOA 4GCOA 5FWQA 3LKUA 2WQ6A 1WG0A 3VTYA 1E8YA 3GYZA 2X38A 5JJ7A 1TNYA 3U4TA 3WG7E 1MX4A 4Y6WA 3ZKJA 5H7PA 4EPZA 4O60A 3MYVA 2Y1LE 3PDNA 3PE4A 1MQSA 2DYSE 4PS8A 2XGMA 4FULA 3BU8A 2EQXA 4EZKA 3RIBA 4BTBA 3TAXA 3ZYMA 5KJMA 3LCAA 1NA0A 4LNBA 3ASOE 2NXPA 3AAAC 4MLPA 1ZB1A 1RZ4A 5AARA 1TEZA 5FQ4A 3SQVA 4BT8A 1YYHA 1DNPA 3ASFA 4N39A 3HRAA 2XZTG 3IHVA 4JC8A 1D8DA 2MYOA 4RSYA 1IHGA 3ZIMA 3CHPA 1DCQA 3LDZA 2R5SA 2I2OA 5KNHD 2XPYA 1MHQA 4A63B 4JEUA 3HHMA 5JHAA 1N4SA 1TN7A 2V5FA 3EHMA 4AXHA 4ANXA 4GPKA 3FFLA 1UOHA 3LPZA 3FUMA 5FQ7A 3C72A 2X6KA 1YA0A 1HZ4A 1HS6A 3C5RA 4YNDA 4J7WA 3NZUA 2R05A 3PZDA 2E0IA 2EILE 4WAFA 3IKOB 3L16A 3BEEA 4HI9A 2HE0A 2P9UG 4GTMA 2P9KG 4HXIA 4GU5A 2CFZA 3AJIA 2Y4TA 3KS2A 1DCEA 1E90A 4A3VA 3FU0A 2H6IA 3ZYLA 4BETA 3V31A 4ANVA 2VGYA 4UWFA 3I4GA 3D9NA 3PEVB 4LG6A 4BWRA 4PUCA 3PZ3A 3D9KA 4QFVA 3X2QE 5M72A 4BX8A 4I1AA 3UI2A 3FTSA 3P2BA 3ULEG 1N4QA 5G55A 5EX3A 4W9RA 2H6HA 1EYHA 4U0UA 1E8WA 2L9BA 3APFA 4TV3A 2P58C 4CDNA 3FHEA 5ANLA 5T4YA 4WNGA 5E76A 3UT4A 3ZGQA 3S7JA 1HU3A 5LCWC 3L9TA 4N2QA 1N4RA 3CVPA 3MKQB 3ESLA 3ASHA 3EHNA 5ENQD 3MJWA 3JXIA 3TG4A 3UTMA 4GPMA 3FU3A 2HO1A 4CT4A 4N3BA 3IBEA 4FJYA 1INZA 2ILRA 2V4LA 4LCTA 4GTRA 1UJJA 5ARFA 2LAIA 4UI9J 2E2EA 3D9OA 4K03A 5BUZA 3CVNA 4GTVA 4HQDA 1H6KA 4NURA 1FT1A 1IKND 2KCKA 4AIFA 3EJNA 3SY2A 2A5UA 3K9IA 3ML8A 3C3OA 2IO2C 5BXOA 1S64A 2IQCA 3ZYQA 1H6PA 3PZ1A 2MHKA 3RK6A 1Z3XA 2DVWA 3KD7A 1SQMA 3UXGA 5KNGA 2V8SE 4DX5D 2VSOE 5CMYA 4GTOA 3FUIA 4HRLA 3E33A 4UWKA 4KZ0A 3HXDA 2GW1A 4I9EA 4MBGA 3T8MA 3UMVA 2LXLA 2WPVA 2AJAA 1IXVA 1TR4A 2NSZA 1BLXB 2UWJG 2GRLA 5ARGA 3G2UA 2BUGA 2WXLA 5CBOA 1S70B 4JVSA
chains in the Genus database with same CATH topology
2OEVA 1ZB1A 3C3OA 3RAUA 5CRUA 2OJQA 5CRVA 2XS8A 3C3RA 3UM0A 3UM1A 4JIOA 3UM3A 3ULYA 2R03A 3ZXPA 2OEXA 3UM2A 3C3QA 2R05A 2XS1A 2R02A 3R9MA 2OEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OEV A;  1ZB1 A;  3C3O A;  3RAU A;  5CRU A;  5CRV A;  2XS8 A;  3C3R A;  3UM0 A;  3UM1 A;  3UM3 A;  3ULY A;  2R03 A;  3ZXP A;  3UM2 A;  3C3Q A;  2R05 A;  2XS1 A;  2R02 A;  3R9M A;  2OEW A; 
#chains in the Genus database with same CATH topology
 2JEK A;  4KVO A;  5CMW A;  1ZU2 A;  2EIM E;  3PVL A;  4U8V D;  1MX2 A;  4I2Z A;  5EDS A;  2DIW A;  4AOF A;  4UUC A;  5BXU A;  1UG3 A;  4EBA A;  2RFM A;  2YNQ A;  3AU5 A;  5ANR A;  3SNX A;  3ZHE A;  1K8K G;  4EHM A;  4JHJ A;  1K1A A;  2JAB A;  3C3Q A;  3UT7 A;  4M7C A;  3QAR A;  4I6J A;  1ELW A;  2CFU A;  1P5Q A;  3CQG B;  4HRN A;  2XRZ A;  4C9B B;  4GA1 A;  4GTS A;  3FUH A;  2GRN B;  4KVM A;  1TYQ G;  2WXJ A;  1X81 A;  4BEP A;  4B94 A;  4F53 A;  2WXK A;  1OWN A;  4JHK A;  2RKK A;  3U9W A;  5ENT D;  3PNT B;  5HKP A;  3JQ0 A;  2OVB A;  2QZA A;  2R59 A;  2LO6 A;  2OCC E;  2MOW A;  2XQ0 A;  3FU5 A;  3QDN A;  2LSV A;  1QBQ A;  3LS8 A;  3CR3 A;  4BFR A;  3I4R B;  4BX9 A;  1Z5S C;  3UPV A;  3UKR G;  3G2V A;  2B0O E;  2ZIR A;  3NZS A;  4FP7 A;  1AWC B;  4EQF A;  4GTQ A;  2FO1 E;  4A1S A;  2C0M A;  1XGW A;  3FEY A;  3MV3 B;  3E4B A;  2F37 A;  2OEV A;  2B6C A;  5LOZ A;  4YVQ C;  1PAQ A;  3FWV A;  2XHE A;  4UQZ A;  3NOC D;  3OTN A;  3BQO A;  4K5C A;  4XI9 A;  3SO8 A;  3ZFW A;  1OCC E;  3QKY A;  1N52 A;  2IOS A;  1MJ0 A;  3S7B A;  1H19 A;  3T5V A;  3ZXS A;  3DXM G;  2BKK B;  3LYA A;  4U8Y D;  1FT2 A;  4ILI A;  2V0P A;  3QB2 A;  3L22 A;  2C2L A;  4FA6 A;  3JQ1 A;  5G04 J;  3TGO A;  3PS6 A;  3AS5 A;  3D9H A;  2IY0 C;  2LXM A;  3NQP A;  2WVI A;  1IYG A;  4GML A;  4IRU A;  3DEP A;  1U3C A;  4JPS A;  3PE3 A;  3QWV A;  4TXQ A;  3MEK A;  3ZYK A;  2A4Z A;  3B7T A;  1OCO E;  5BW8 C;  2PM7 A;  1MZC A;  3ASN E;  4LRZ A;  1KZO A;  2ZIS A;  5FZQ A;  3EU5 A;  2AXU A;  3CKC A;  3CHQ A;  5AQ7 A;  2QC9 A;  5AAO A;  4ANW A;  4JHR A;  4APO A;  1W3B A;  5ENN A;  2HM8 A;  4FLB A;  3RO2 A;  4CYM D;  4GB9 A;  3RSE G;  5G05 C;  3EDT B;  3SZ7 A;  1U2V G;  2IJG X;  3SD5 A;  4GMJ A;  2C0L A;  3MV2 B;  2LAH A;  1FVH A;  1E8X A;  4DI3 A;  4BT9 A;  2JLB A;  4HLL A;  2BED A;  5LP0 A;  1TJC A;  1YCS B;  4F7A A;  4L1B A;  4MRU A;  5AN8 A;  3CVU A;  4EBA G;  5LCW J;  4BER A;  5KBA A;  4RG6 A;  4ABN A;  4TUM A;  4PS3 A;  3VTX A;  3AG2 E;  3LVR E;  4NQ0 A;  4N2S A;  3BG0 B;  4Q69 A;  4O1P A;  2QY7 A;  4F1S A;  3ABM E;  2P9I G;  4C0E A;  1SVX A;  3QWP A;  3FUL A;  4GZD A;  4BES A;  3KEA A;  1Y6I A;  5KCM A;  1HF8 A;  3B7U X;  4APF A;  3QNK A;  3ESK A;  5AJD A;  1HE8 A;  5CCM A;  4WWN A;  3CHR A;  4FHJ A;  4PH4 B;  1NZN A;  1QNF A;  1DC2 A;  3U64 A;  3DWL G;  2CHX A;  4G23 A;  3FTW A;  3FUN A;  4L7T A;  5JMN D;  2KBX A;  4RG9 A;  3RU0 A;  5A6C A;  2WXR A;  3TXN A;  4AM9 A;  4DUI A;  5T8I A;  2WXM A;  4C48 B;  2P9L G;  2WXF A;  4J6I A;  2AWI A;  3N71 A;  3FH8 A;  5AEN A;  2YHC A;  3PRE A;  1QYM A;  2FO7 A;  2VQ2 A;  3UIP C;  3ZVV A;  1JCR A;  2UY1 A;  1KPS B;  2J07 A;  2XPZ A;  2NC9 A;  2OOE A;  3J5P A;  3AS8 A;  4B8A A;  3MCX A;  3EIJ A;  1JWF A;  3D9P A;  4F1P A;  5BNW A;  3Q9U C;  1UN9 A;  5EX0 A;  3URZ A;  1AP7 A;  3CHM A;  1H6O A;  4B0Z A;  4F3V A;  4YDE A;  5ENR D;  5G04 C;  4JA9 A;  3AG3 E;  3LJ3 A;  4TXR A;  1N95 A;  1BI7 B;  2PZI A;  2Y3A A;  1IQU A;  2GRR B;  5ENS D;  2YQ8 A;  4DPR A;  4AY5 A;  4CZ2 D;  3WXX A;  4U07 A;  3B7S A;  5KJN A;  3ABK E;  4OYS A;  3L54 A;  1S0P A;  4U95 D;  3PZ4 A;  3DSS A;  3FUD A;  2I1K A;  3T5X A;  3JYS A;  4ACK A;  4JZY A;  1FCH A;  2IF4 A;  3CHS A;  4A55 A;  2KCL A;  3PEU B;  3HXF A;  1JCS A;  4K5B A;  3I5P A;  4K5A B;  4CRW A;  5BV1 A;  2XS8 A;  3UIO C;  4Q96 A;  4RLY A;  3EHR A;  4FC8 A;  4IUL A;  3SBT B;  2EIK E;  4BSZ B;  2VGX A;  3D9J A;  1UJK A;  2FBN A;  3HDX A;  1BPO A;  2L6B A;  5E75 A;  3QC1 A;  2QYU A;  5D66 A;  2X6J A;  1JWG A;  1N9A A;  2XEN A;  3TXM A;  5AYW D;  1NL4 A;  2XEE A;  3G2S A;  3Q7F A;  3ONK A;  3HXB A;  3CK7 A;  4NAC A;  4ATZ D;  4HI8 A;  3GZS A;  3NBN B;  5BPP A;  4HOS A;  4G8L A;  3DSX A;  1ZBP A;  4UI9 K;  5T3R A;  3RKV A;  3Q47 B;  3L82 A;  1X5B A;  3L17 A;  1GW6 A;  5HQ8 A;  4EZL A;  2J49 A;  4OAU C;  3UKU G;  3DSV A;  3CQC B;  4GA0 A;  3OXG A;  3D9L A;  3HXC A;  5CRU A;  2DYR E;  2HR2 A;  2H6F A;  4G1T A;  5IY5 E;  4TXP A;  3OAW A;  4CT0 A;  5EYP F;  2XZD G;  4J0U A;  4WUY A;  3UIN C;  3TWS A;  3FEX A;  1N0R A;  3O48 A;  4LUN U;  5EIL A;  3TWV A;  4ZHB A;  1E7V A;  2XCB A;  1O1S A;  4ANU A;  3SGH A;  4E6H A;  4JD2 G;  3TG5 A;  3GZ2 A;  1JCQ A;  4IYP A;  3V2O A;  2CHW A;  4XE0 A;  1S63 A;  2WXI A;  2Y4U A;  1DVP A;  3DXK G;  2RFA A;  4UWG A;  3LY9 A;  4HBD A;  4JEH A;  2KAT A;  5CEC B;  2P9P G;  4F6R D;  3SBS A;  3R7Q A;  4CDM A;  4I2W A;  4AV7 A;  4FJZ A;  3V2X A;  4MS6 A;  4OVU A;  1HXI A;  3VLF A;  1LD8 A;  4HOT A;  5EKQ D;  5B1B E;  4IN3 B;  3TWU A;  2ETC A;  5B3S E;  2ZGD A;  1KT1 A;  5G05 J;  1B89 A;  1ELK A;  4OVV A;  2VTB A;  3ZU7 B;  3IEG A;  4HRM B;  5ENO D;  2AVP A;  2DWZ A;  4ATG A;  4TUU A;  3SF4 A;  1E8Z A;  3E32 A;  3GW4 A;  2LUH A;  3CGH A;  2H6G A;  4LSZ E;  2F8Y A;  3EUV A;  4DRX E;  3FDH A;  2XGS A;  3Q79 A;  4DX7 D;  2OVF A;  4NIK A;  3ZUV B;  4N3A A;  5D0O D;  1NFI E;  1HFA A;  3CVL A;  3UT8 A;  2X3M A;  5CHE E;  2PM6 A;  3GZ1 A;  1HH8 A;  3FUE A;  1L5J A;  4L2L A;  3S7F A;  4AY6 A;  4J8E A;  4JXT A;  4AEZ C;  5B1A E;  1A17 A;  1D8E A;  4WNE A;  4GYO A;  2PQN A;  4ME2 A;  1D9S A;  1XNF A;  5HRY A;  2EIJ E;  3CST A;  5KWD A;  4DJA A;  4U63 A;  2IEJ A;  3Q49 B;  4JW1 A;  3SFZ A;  3DST A;  4UQX A;  1SA4 A;  2Y0B G;  3TJP A;  1QQE A;  5KJL A;  1OXJ A;  1SA5 A;  2XPI A;  3E30 A;  1EPU A;  5JJ6 A;  3AG1 E;  3JUI A;  1A5E A;  4UWL A;  4G2V A;  3ZNG A;  3CVV A;  2J08 A;  4N5C A;  3G2T A;  3ULY A;  3QJZ A;  1TNB A;  4O6F A;  3ZPJ A;  2GRP B;  5J08 A;  3QK0 A;  4HFG A;  4XKB A;  4XIF A;  3R9A B;  3J5Q B;  2KZT A;  3FH7 A;  3C98 A;  3W9G A;  3HXE A;  2ZU6 B;  2P9N G;  2QFC A;  4XKC A;  4DX6 D;  3U3W A;  3HIZ A;  3B95 A;  4HB5 A;  4KZC A;  3DPY A;  4ZFH A;  1G3N B;  1E96 B;  4R7L A;  3CIA A;  5DIZ A;  3RRU A;  3Q15 A;  1YMP A;  5ITZ F;  2VJ8 A;  3FTX A;  4RVB A;  4FLH A;  5AIJ A;  3UQ3 A;  1WM5 A;  3CHO A;  2FUL A;  1WAO 1;  2OEW A;  3FUK A;  3FU6 A;  4BTA A;  4HS2 A;  2LNI A;  2YIN A;  5CED B;  2VGE A;  3B7R L;  1BD8 A;  3CSF A;  4FHK A;  4GZ5 A;  3ZN3 A;  5FJY A;  2J09 A;  2R03 A;  2VSY A;  1NA3 A;  3FTY A;  3PUJ A;  2WXO A;  4I17 A;  3SHF A;  4J8F A;  1OCZ E;  2KXP C;  3ULQ A;  1PC2 A;  3JUE A;  3FUJ A;  4PDX A;  3Q7A A;  4L9P A;  1V55 E;  4X8Q A;  1OUV A;  1OCR E;  2VGX B;  4Q94 A;  1OY3 D;  1HO8 A;  3FTU A;  5AQA A;  5LX8 A;  3VLE A;  3RRM B;  1TN6 A;  4AP2 A;  4A3T A;  3CVQ A;  3DPD A;  3E37 A;  3FUF A;  3SFX A;  3KSQ A;  3JXJ A;  4XI0 A;  3UM0 A;  1SW6 A;  1KT0 A;  4G24 A;  5JA4 D;  2AW6 A;  5EYL A;  3CV0 A;  2XEV A;  5CCL A;  4ILH B;  2ETA A;  2L0I A;  5FQ6 A;  2X6I A;  2VSX E;  4G11 A;  3ABL E;  1LD7 A;  4N5Q A;  4A1G A;  3CEQ A;  2WXN A;  3KSL A;  2WXG A;  2DCP A;  1SZA A;  4WNF A;  2WXP A;  1Z6T A;  4WWP A;  1N0Q A;  3SI5 A;  3DSW A;  4LER A;  5FTP A;  5CEA A;  3CK9 A;  4NRH B;  2V4H C;  4EEC A;  5D0Q D;  1HG2 A;  1SZ9 A;  1N11 A;  4U7E B;  1NP7 A;  2NYJ A;  4HOU A;  3OXF A;  4GTP A;  3RAU A;  3Q73 A;  3AG4 E;  3UX4 A;  4GMR A;  2CHZ A;  5C2Y A;  3RO3 A;  1MYO A;  4BSX A;  1MX6 A;  1O5M A;  1PY1 A;  4RQI A;  2KCV A;  4M3O A;  3IXE A;  4URK A;  4KMO A;  4G25 A;  1K1B A;  3Q75 A;  4KBQ A;  3D9I A;  4B89 A;  3G2W A;  4GA2 A;  3PZ2 A;  4U04 A;  1NI1 A;  3CKB A;  1KZP A;  3P1U A;  3UM1 A;  5FIO A;  1H2V C;  1OWP A;  4TRQ A;  3SFY A;  4DLQ A;  2I1J A;  3D9M A;  4U96 D;  2IO3 C;  3TWW A;  4EZJ A;  2VTB B;  3LY8 A;  4HNA D;  3ISM C;  5FIN A;  2GRQ B;  4FAD A;  2GRM A;  3CK8 A;  4YDO A;  2I6H A;  3MX3 A;  2AXZ A;  5A23 A;  3ZHE B;  1H2U A;  1HG5 A;  4CCA A;  4HOR A;  3UM2 A;  4JB8 P;  3FTZ A;  2GRO B;  1ELR A;  1LTX A;  4B93 B;  1JPL A;  2VSN A;  4CDR A;  2R2L A;  1TNU A;  3C3R A;  4G26 A;  4E85 A;  1N4P A;  4XEI G;  5AJL A;  4UQY A;  4I6E A;  3B13 A;  4I9C A;  1WDY A;  4MKT A;  2V5Q C;  2WMO A;  4L23 A;  2I9C A;  3CVY A;  2OND A;  3HG0 D;  5FZS A;  3OXL A;  2IFU A;  2J4B A;  3JCK C;  3LJN A;  3E34 A;  1H0A A;  4LNU D;  3HVE A;  1N54 A;  4WWO A;  5CBN A;  2J9Q A;  4CGW A;  3S2A A;  5EIB E;  5D2M C;  3TL5 A;  2FEZ A;  3Q9N C;  4YDW A;  3FY4 A;  4YDY A;  3PH0 C;  4HVB A;  3IV0 A;  2Q7F A;  5JHB A;  5BT1 A;  2L0T B;  4GTT A;  1O1R A;  5FT9 A;  2KM4 A;  4ILG A;  1IQR A;  2R17 C;  4DI4 A;  4V3I A;  4XZ4 A;  4J8D A;  2BKG A;  3QAQ A;  2DZN A;  5C1D A;  2M63 A;  2WQ7 A;  4JL0 A;  4L2Y A;  4GZC A;  1H2T C;  3IHY A;  2PQR A;  2X6F A;  3ZXP A;  2KZT B;  4O1O A;  2EIN E;  4C0M A;  3Q4A B;  3PUK A;  1OWO A;  3AU4 A;  4LNG A;  3T9K A;  3UUX A;  4I6G A;  4GYW A;  5FZR A;  4PS7 A;  2BF0 X;  2Y69 E;  3L08 A;  3DBS A;  1OT8 A;  4DX1 A;  4I43 A;  1N94 A;  1O1T A;  4WND A;  5J90 A;  3S7D A;  5CRV A;  1K3Z D;  3FTV A;  3V79 K;  4UWH A;  4DLO A;  5AQB A;  2IU1 A;  3ONL A;  4Y6C A;  4DK5 A;  5EID A;  3TWR A;  4XX5 A;  1LF8 A;  3MA5 A;  3RJV A;  2L6J A;  5EN5 D;  4JA7 A;  2GGF A;  2BTD A;  1U3D A;  3U66 A;  5G2N A;  3V30 A;  5KJK A;  1HX8 A;  3DEO A;  1OWM A;  3D3M A;  3KAE A;  3RRN B;  3L6A A;  3O4Z A;  4CGV A;  4ACL A;  3NF1 A;  4KYO B;  2ZGG A;  1BU9 A;  5FQ8 A;  1IHB A;  1TN8 A;  5HS0 A;  3MKR A;  1TNZ A;  3LVQ E;  4AJW A;  2F8X K;  2WQH A;  3NOG D;  4J8S A;  4QQI A;  3CVX A;  3T8K A;  4U8H A;  4LEU A;  2PL2 A;  4GYY A;  4H7Y A;  1OWL A;  2P9S G;  5ENP D;  2WM9 A;  3EU9 A;  4DX2 A;  3CVW A;  2KC7 A;  2VYI A;  3QWW A;  3ZEF A;  1E7U A;  2MRI A;  3ASD A;  4KXK B;  3LEW A;  4FU3 A;  3PRZ A;  1BI8 B;  2WXQ A;  3QOU A;  4I1M A;  2DBA A;  2ION A;  3FH5 A;  3KEZ A;  1Q2Z A;  2OV8 A;  3TWQ A;  2XEH A;  3HYM B;  3MKQ A;  4G8K A;  5JJT A;  1UW4 B;  4CEM A;  5LFA A;  2CG2 A;  3W9F A;  4U0S A;  2IOL A;  3BG1 B;  3DRA A;  2ETB A;  4J8Y A;  4N3C A;  3MZL B;  3CLJ A;  3ML9 A;  2UY1 B;  3EHQ A;  3TWT A;  2ZXW E;  2R02 A;  3AS4 A;  3R9M A;  1UN8 A;  4GCN A;  4GZ6 A;  2FF4 A;  2WB2 A;  3F6Q A;  4UI9 C;  2XRY A;  2WMN A;  2A5E A;  1Y8M A;  1WY6 A;  1FVF A;  2RG8 A;  5DBK A;  3R7R A;  1EDU A;  4P29 A;  3TWX A;  3ENE A;  4YVO A;  3LY7 A;  2FI7 A;  3DSU A;  3MGB A;  3Q5M A;  4K0R A;  4GZ3 A;  1JUQ A;  2XCC A;  3Q78 A;  2P2C P;  4OAV B;  5HI7 A;  2AXV A;  4KT6 B;  3I3N A;  3B7B A;  4BY6 A;  4Z68 A;  5BV0 A;  2LSU A;  4H7X A;  2RD0 A;  3LXU X;  3APC A;  5CER B;  1V54 E;  3ASG A;  2HYZ A;  2X6H A;  3APD A;  4B8C B;  1TJF A;  4I1O B;  1RW2 A;  3EIQ C;  5AQ9 A;  1Z3Y A;  2F0Y A;  3PNL B;  3NB2 A;  3L13 A;  2CG3 A;  1EF1 C;  4HOQ A;  3UM3 A;  3NAW A;  1VDY A;  3VLD A;  4GAA A;  2PNN A;  3ZW3 A;  2J4D A;  1FPP A;  2XS1 A;  1QZ2 A;  4U0Z A;  2QYJ A;  3ZRH A;  5A7D B;  2DZO A;  4AVX A;  2WXH A;  2YHE A;  4HLE A;  3HVE B;  1KLX A;  4D10 C;  2XGO A;  2J8S D;  3BUA A;  3FP3 A;  1TNO A;  4GCO A;  5FWQ A;  3LKU A;  2WQ6 A;  1WG0 A;  3VTY A;  1E8Y A;  3GYZ A;  2X38 A;  5JJ7 A;  1TNY A;  3U4T A;  3WG7 E;  1MX4 A;  4Y6W A;  3ZKJ A;  5H7P A;  4EPZ A;  4O60 A;  3MYV A;  2Y1L E;  3PDN A;  3PE4 A;  1MQS A;  2DYS E;  4PS8 A;  2XGM A;  4FUL A;  3BU8 A;  2EQX A;  4EZK A;  3RIB A;  4BTB A;  3TAX A;  3ZYM A;  5KJM A;  3LCA A;  1NA0 A;  4LNB A;  3ASO E;  2NXP A;  3AAA C;  4MLP A;  1ZB1 A;  1RZ4 A;  5AAR A;  1TEZ A;  5FQ4 A;  3SQV A;  4BT8 A;  1YYH A;  1DNP A;  3ASF A;  4N39 A;  3HRA A;  2XZT G;  3IHV A;  4JC8 A;  1D8D A;  2MYO A;  4RSY A;  1IHG A;  3ZIM A;  3CHP A;  1DCQ A;  3LDZ A;  2R5S A;  2I2O A;  5KNH D;  2XPY A;  1MHQ A;  4A63 B;  4JEU A;  3HHM A;  5JHA A;  1N4S A;  1TN7 A;  2V5F A;  3EHM A;  4AXH A;  4ANX A;  4GPK A;  3FFL A;  1UOH A;  3LPZ A;  3FUM A;  5FQ7 A;  3C72 A;  2X6K A;  1YA0 A;  1HZ4 A;  1HS6 A;  3C5R A;  4YND A;  4J7W A;  3NZU A;  2R05 A;  3PZD A;  2E0I A;  2EIL E;  4WAF A;  3IKO B;  3L16 A;  3BEE A;  4HI9 A;  2HE0 A;  2P9U G;  4GTM A;  2P9K G;  4HXI A;  4GU5 A;  2CFZ A;  3AJI A;  2Y4T A;  3KS2 A;  1DCE A;  1E90 A;  4A3V A;  3FU0 A;  2H6I A;  3ZYL A;  4BET A;  3V31 A;  4ANV A;  2VGY A;  4UWF A;  3I4G A;  3D9N A;  3PEV B;  4LG6 A;  4BWR A;  4PUC A;  3PZ3 A;  3D9K A;  4QFV A;  3X2Q E;  5M72 A;  4BX8 A;  4I1A A;  3UI2 A;  3FTS A;  3P2B A;  3ULE G;  1N4Q A;  5G55 A;  5EX3 A;  4W9R A;  2H6H A;  1EYH A;  4U0U A;  1E8W A;  2L9B A;  3APF A;  4TV3 A;  2P58 C;  4CDN A;  3FHE A;  5ANL A;  5T4Y A;  4WNG A;  5E76 A;  3UT4 A;  3ZGQ A;  3S7J A;  1HU3 A;  5LCW C;  3L9T A;  4N2Q A;  1N4R A;  3CVP A;  3MKQ B;  3ESL A;  3ASH A;  3EHN A;  5ENQ D;  3MJW A;  3JXI A;  3TG4 A;  3UTM A;  4GPM A;  3FU3 A;  2HO1 A;  4CT4 A;  4N3B A;  3IBE A;  4FJY A;  1INZ A;  2ILR A;  2V4L A;  4LCT A;  4GTR A;  1UJJ A;  5ARF A;  2LAI A;  4UI9 J;  2E2E A;  3D9O A;  4K03 A;  5BUZ A;  3CVN A;  4GTV A;  4HQD A;  1H6K A;  4NUR A;  1FT1 A;  1IKN D;  2KCK A;  4AIF A;  3EJN A;  3SY2 A;  2A5U A;  3K9I A;  3ML8 A;  3C3O A;  2IO2 C;  5BXO A;  1S64 A;  2IQC A;  3ZYQ A;  1H6P A;  3PZ1 A;  2MHK A;  3RK6 A;  1Z3X A;  2DVW A;  3KD7 A;  1SQM A;  3UXG A;  5KNG A;  2V8S E;  4DX5 D;  2VSO E;  5CMY A;  4GTO A;  3FUI A;  4HRL A;  3E33 A;  4UWK A;  4KZ0 A;  3HXD A;  2GW1 A;  4I9E A;  4MBG A;  3T8M A;  3UMV A;  2LXL A;  2WPV A;  2AJA A;  1IXV A;  1TR4 A;  2NSZ A;  1BLX B;  2UWJ G;  2GRL A;  5ARG A;  3G2U A;  2BUG A;  2WXL A;  5CBO A;  1S70 B;  4JVS A; 
#chains in the Genus database with same CATH homology
 2OEV A;  1ZB1 A;  3C3O A;  3RAU A;  5CRU A;  2OJQ A;  5CRV A;  2XS8 A;  3C3R A;  3UM0 A;  3UM1 A;  4JIO A;  3UM3 A;  3ULY A;  2R03 A;  3ZXP A;  2OEX A;  3UM2 A;  3C3Q A;  2R05 A;  2XS1 A;  2R02 A;  3R9M A;  2OEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...