3RAUA

Crystal structure of the hd-ptp bro1 domain
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
358
structure length
358
Chain Sequence
VPRMPMIWLDLKEAGDFHFQPAVKKFVLKNYGENPEAYNEELKKLELLRQNAVRVPRDFEGCSVLRKYLGQLHYLQSRVPMGSGQEAAVPVTWTEIFSGKSVAHEDIKYEQACILYNLGALHSMLGAMDKRVSEEGMKVSCTHFQCAAGAFAYLREHFPQAYSVDMSRQILTLNVNLMLGQAQECLLEKSMLDNRKSFLVARISAQVVDYYKEACRALENPDTASLLGRIQKDWKKLVQMKIYYFAAVAHLHMGKQAEEQQKFGERVAYFQSALDKLNEAIKLAKGQPDTVQDALRFTMDVIGGKYNSAKKDNDFIYHEAVPALDTLQPVKGAPLVKPLPVNPTDPAVTGPDIFAKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Phe105 Loop of Alix Bro1 Domain Plays a Key Role in HIV-1 Release.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Tyrosine-protein phosphatase non-receptor type 23
total genus 143
structure length 358
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2011-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.280 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat alix/aip1 like domains 3rauA00
3C3RA 2R02A 5CRVA 2XS1A 5CRUA 3UM1A 3C3QA 3UM3A 2R05A 3UM0A 3UM2A 1ZB1A 3C3OA 3RAUA 3R9MA 2R03A 3ZXPA 2OEWA 2OEVA 2XS8A 3ULYA
chains in the Genus database with same CATH superfamily
2QC9A 4IYPA 2AXVA 3GZ1A 5LFAA 3NB2A 4ANUA 3C3QA 4UQXA 3TWRA 1KPSB 3S2AA 3ZRHA 4AVXA 5J90A 3D9LA 5B1AE 4DX1A 4PDXA 4J6IA 3ENEA 3JQ0A 2QYUA 3CQGB 4AIFA 2P9KG 4BWRA 2WMOA 5ENPD 4I6EA 1YMPA 5A6CA 2VSYA 1OT8A 4A3TA 2P9NG 3LS8A 2CHZA 3FULA 3FH7A 3R7RA 3JYSA 2IONA 2YINA 3LXUX 4UI9K 3EHRA 4U8HA 2WXIA 4GMLA 5BUZA 2OV8A 2ZU6B 3C3OA 5HS0A 4OAUC 4CEMA 4ANVA 3SQVA 4FHKA 4E85A 5CRVA 3U9WA 5AN8A 4HOTA 2P2CP 3I4GA 5DBKA 1HX8A 3S7JA 1H6OA 1SZ9A 3ONLA 4U0UA 4JB8P 1N4SA 2IEJA 2EQXA 3I5PA 3MKQA 5KJMA 1SZAA 3ZEFA 3NZSA 4IRUA 3NOCD 5CCMA 4CT0A 2WB2A 2LXMA 3HXDA 5CRUA 4B8AA 3ZHEA 3U66A 3CIAA 5KNHD 3AJIA 3EIQC 2R59A 3MV2B 2VSNA 2IQCA 3CHMA 4DX2A 3NOGD 3JUEA 1ELRA 3CV0A 1N4QA 4G2VA 3ZPJA 4K5CA 3VLEA 3TWQA 4NIKA 3B95A 4LG6A 4RG6A 4NRHB 1YA0A 2XRZA 4EPZA 4M3OA 4XEIG 1H0AA 5KJNA 3CR3A 4KT6B 4RQIA 4HXIA 1Z3YA 1JUQA 3SBSA 4GAAA 3FU3A 3SGHA 2J09A 1LD7A 2Q7FA 5LCWC 4U95D 2FBNA 3ZVVA 2AXUA 3E4BA 5EYLA 4Q69A 1E7UA 3V2XA 2F8YA 4CDRA 1TN6A 3UM1A 1ELWA 4JHKA 3PH0C 3Q73A 4BTAA 3TG4A 1PAQA 3KSQA 1SQMA 4UWLA 1EDUA 4XI0A 3TXMA 4YVQC 3CEQA 4GA2A 2DZOA 3SY2A 2GRQB 3TWSA 5C2YA 3ZXPA 2WMNA 2XCCA 3FUJA 4I9CA 3OXLA 2JEKA 3CK9A 4AY6A 3ZFWA 3PEVB 3G2SA 3Q7FA 5AQ9A 2H6HA 2UY1A 2VSXE 3VTYA 3P2BA 3UINC 4XKBA 3LJNA 4RG9A 4ANXA 1IQUA 4MLPA 3C72A 4R7LA 1E7VA 3L54A 3ZYKA 2CFUA 5E75A 3FU6A 1DVPA 1K1BA 4MRUA 3RSEG 3CHRA 2J08A 3NBNB 2H6IA 2LUHA 3SI5A 3DXMG 2I1KA 3TGOA 3ABME 1GW6A 3QOUA 3SNXA 3Q9UC 3CHPA 4UI9J 2C0LA 4GZ5A 3FUIA 2NC9A 3V31A 4JA7A 3RKVA 4G11A 2VQ2A 3FU5A 4LRZA 1XGWA 3L22A 3NQPA 4J8DA 4GTMA 3KSLA 3Q7AA 3ASFA 3UIOC 2JLBA 2KM4A 3J5PA 4YNDA 5EILA 5KNGA 3PDNA 2VGYA 1H2VC 2GROB 4DLQA 3APCA 4GCNA 4HI9A 4I1OB 1KT1A 3EUVA 3MX3A 3JXJA 2XPZA 3RK6A 1D9SA 3FTSA 1E8YA 4FHJA 3IHYA 2NYJA 3EU5A 3FH5A 4I17A 3ASOE 3RIBA 5ANLA 2C0MA 1BD8A 2ZGGA 3HVEA 2QFCA 5CHEE 4BETA 2J4DA 3MKRA 3FH8A 2LAHA 1BI8B 3ML8A 2EINE 2RKKA 1JPLA 3B7UX 3DSTA 4LUNU 4WNGA 5AQ7A 1WG0A 2XGSA 3ABLE 5LX8A 5CECB 1NL4A 5KJKA 1FT2A 3FTUA 3ESKA 4F1PA 1N4PA 3PEUB 4KZ0A 2KZTB 3HYMB 3DRAA 2YHEA 3Q15A 4LCTA 1MQSA 1DC2A 3LY7A 5AAOA 2MHKA 3B7RL 2R2LA 4HVBA 3VTXA 4UWGA 5BT1A 3TWTA 3OTNA 4HLLA 3BEEA 1K1AA 1N9AA 2WXKA 4GZCA 5T4YA 3QWPA 4JD2G 4B8CB 1MZCA 2Y0BG 4F7AA 1OUVA 4OYSA 1MHQA 5JJ6A 3PRZA 2R03A 3MEKA 5FINA 4RSYA 4F6RD 5ENOD 5FZQA 2DIWA 4I1AA 3APFA 5JJ7A 4O6FA 4BEPA 1SA5A 4XI9A 3SD5A 3MV3B 1Q2ZA 3HVEB 2WXQA 3OXFA 4L9PA 5FQ8A 3SF4A 3MKQB 4K5AB 5HQ8A 5AQAA 2F8XK 2MYOA 1KZOA 4JVSA 2XZDG 4PS3A 4YDOA 1U3CA 1BPOA 5BXUA 5ENQD 4WWPA 3CGHA 2PM7A 1A5EA 4V3IA 3ASHA 3TAXA 4GMRA 3HXCA 2BF0X 3LDZA 4I9EA 2ZXWE 3UKUG 3ASNE 4ACKA 1TN7A 1PC2A 1TNOA 2DVWA 3R9MA 3QARA 4GA1A 4KZCA 2RFAA 3T5XA 4UWHA 1SW6A 3AG3E 1PY1A 2ETCA 5C1DA 1BI7B 3ZXSA 1HXIA 1HU3A 2YHCA 4C9BB 4BSXA 2DCPA 5CMYA 3AG4E 5LCWJ 3F6QA 2Y4TA 3I3NA 4GTTA 2NSZA 2KCLA 1JWFA 3KS2A 5EIDA 1NA0A 4PS7A 4GZ6A 3ZKJA 2X6HA 3FEYA 3NAWA 3FDHA 3CVPA 4GTSA 1QBQA 3QWVA 3QK0A 1TNZA 3ISMC 2CG3A 4TRQA 2L6BA 1NFIE 1G3NB 1OCZE 3D9JA 3CVQA 2BKKB 4ZFHA 3Q75A 3HHMA 3ZIMA 4L7TA 1FPPA 1N52A 1OWOA 3E32A 3RRUA 3FFLA 2WXHA 5HI7A 2H6GA 3J5QB 3K9IA 4C0EA 2OCCE 4O1OA 4CDMA 1INZA 3QKYA 2DBAA 4CRWA 3T8MA 2A4ZA 4G24A 4UI9C 4IULA 3FY4A 3KD7A 3PUKA 3CVXA 2WXOA 3NZUA 2WPVA 3ZNGA 4K5BA 1H2UA 1FVFA 4XKCA 4G25A 1DCQA 5HKPA 1SVXA 4TXRA 5ARFA 5FTPA 5FQ4A 1TJCA 1ZBPA 4HQDA 3EHNA 3DXKG 4UQYA 2KC7A 5FQ7A 1XNFA 5G04C 4URKA 2PZIA 4EBAA 5CCLA 4N3AA 3T8KA 4GB9A 2XGOA 3DSSA 4FADA 5KBAA 3PREA 3BUAA 2R02A 3APDA 3HXBA 3V2OA 1HZ4A 4P29A 1Y8MA 1IKND 3OXGA 3SHFA 1SA4A 4EZLA 2XEEA 4F1SA 3DBSA 4QFVA 4K0RA 3HXEA 3BG0B 4O60A 3Q4AB 4G26A 5EYPF 1QZ2A 2JABA 4U63A 4WNDA 3ZGQA 2WXFA 4AY5A 4GTRA 1UN9A 4PH4B 4GTQA 5CERB 2P9IG 4U8YD 4BT8A 4JZYA 2R17C 4PUCA 1EPUA 4EECA 4NACA 4WAFA 3GW4A 2VYIA 1IXVA 1KZPA 3IKOB 3UM2A 3D9NA 4J8YA 3PUJA 3N71A 3QC1A 3L17A 5D0QD 2ZIRA 4DK5A 4A3VA 2VJ8A 1OY3D 3G2TA 4XZ4A 2AJAA 2RG8A 3UMVA 2XENA 5ARGA 1H6KA 2FF4A 3EIJA 2WXGA 3UQ3A 4HBDA 4K03A 3C98A 3Q47B 4YDYA 4BTBA 2EILE 1JWGA 5B3SE 3R7QA 3FU0A 4EHMA 3RO3A 1YYHA 4MKTA 3URZA 4AJWA 4AEZC 2VTBA 2L6JA 2J4BA 3OAWA 3D9HA 4J8EA 4N39A 3B13A 4AXHA 2FO1E 2XRYA 2ZISA 1UG3A 2IOSA 4I6JA 1N4RA 3JCKC 1MX4A 2AXZA 4ILGA 4U0SA 2BKGA 3FTYA 4LNUD 2Y1LE 3TWWA 3L08A 1HH8A 1O1RA 2F37A 2XGMA 3ASGA 2QY7A 2IU1A 1TNBA 5JA4D 1O5MA 2V5QC 1UJJA 2IY0C 4EZKA 1RW2A 1Z6TA 1ZB1A 1E8ZA 3HXFA 1TJFA 5A7DB 1TR4A 2AW6A 2FI7A 2VGXA 1VDYA 3VLDA 4Y6WA 1UN8A 1HG2A 1TEZA 4GZDA 3MJWA 4JEHA 5KWDA 1IYGA 2X6FA 3D9PA 1LTXA 4FLHA 2GRMA 3TJPA 3C3RA 5E76A 2PL2A 3AS4A 1OCCE 2M63A 4PS8A 4B0ZA 2VGEA 4APFA 1N95A 4HLEA 3PZ3A 3JQ1A 3SZ7A 4XE0A 4DI4A 3PZ4A 2KATA 2WQ6A 3MGBA 4JL0A 4TXPA 4DRXE 1DNPA 4OAVB 3T9KA 3FUHA 1NZNA 3V30A 5H7PA 4BT9A 3KEAA 1DCEA 1O1SA 1V55E 3DWLG 4NURA 3CVVA 4XIFA 4U8VD 2I2OA 5BNWA 2KBXA 3PZDA 2V8SE 3UKRG 3CHSA 4HB5A 4A1SA 4FA6A 4J8SA 4GYWA 4LEUA 2ETAA 4FU3A 4DLOA 1X5BA 4GTOA 3MYVA 4A63B 3LKUA 3NF1A 4HRNA 3G2UA 2I1JA 1JCQA 3ULEG 4H7XA 2P9LG 3CKBA 3PS6A 3HG0D 3P1UA 5BV1A 3MA5A 4UWKA 5AYWD 2DYSE 4D10C 2V5FA 4DX6D 1H2TC 4FC8A 2Y69E 2L9BA 4MBGA 3MCXA 3T5VA 3SO8A 1B89A 3FTZA 3PNLB 2LNIA 4KXKB 3LVQE 5M72A 4TXQA 4G8LA 2XZTG 1UJKA 1IHGA 4YVOA 1QYMA 5CEAA 2V4HC 5FZSA 3MZLB 4KMOA 5EDSA 3AG1E 3U64A 3GYZA 3FTVA 2F0YA 4F53A 1Y6IA 2EIME 1EYHA 3AG2E 3S7FA 2CG2A 1LD8A 4U04A 4HRMB 3PZ2A 3E33A 3ZW3A 3DPDA 3ABKE 3CVWA 1HF8A 3ZYQA 1OXJA 4B94A 3ZN3A 2PQRA 1S64A 3L6AA 2IFUA 1OCOE 5AJDA 3TG5A 3CVLA 4AV7A 2FULA 5KJLA 5AIJA 4CYMD 3SBTB 3CK7A 4I6GA 2PNNA 1FCHA 2E2EA 4DX7D 1FVHA 1V54E 1WDYA 3B7BA 3ESLA 2WXPA 3R9AB 4HFGA 4CZ2D 2GRNB 1HFAA 2DWZA 4FJZA 5ENSD 3LPZA 2VSOE 3QNKA 3PZ1A 3DSVA 1E8XA 1RZ4A 3ZUVB 2PQNA 4KBQA 4G23A 1FT1A 3EU9A 2XS1A 4L2LA 1AWCB 3CSFA 5D66A 3O48A 2HO1A 4C0MA 3TWUA 4OVVA 2VGXB 4N2QA 3TXNA 1W3BA 2C2LA 4G8KA 3PE3A 4HNAD 5JHBA 1QQEA 4ACLA 2WXRA 3ULYA 3ULQA 4HRLA 1X81A 3LCAA 4GYYA 2OVBA 3FEXA 1HE8A 3UI2A 3X2QE 3QB2A 4ME2A 4FJYA 3BU8A 4J8FA 3FP3A 3UT8A 4BSZB 4LSZE 2IJGX 4DX5D 3E34A 2IO3C 4HOUA 2FEZA 5ENTD 2V4LA 1HG5A 2GRPB 3AAAC 3HIZA 3L16A 5FJYA 4HI8A 4DI3A 4Z68A 5ITZF 3L82A 3L9TA 2LSUA 3LJ3A 3KEZA 2HR2A 5G2NA 2IOLA 5T3RA 4TUMA 3ZYLA 4N3CA 2MOWA 3HDXA 5D0OD 1E90A 3UPVA 4JHJA 4LNBA 3TL5A 4HOQA 3RAUA 3FUKA 3VLFA 4GPKA 2A5EA 4WUYA 4CT4A 1K3ZD 2V0PA 4EQFA 2WXMA 3QDNA 4TV3A 2WQ7A 3DSWA 1KT0A 4N3BA 3U4TA 5T8IA 1IHBA 3AS5A 2KCVA 1NP7A 4LERA 4O1PA 2P9UG 3Q78A 4CCAA 4B89A 4BESA 1TN8A 2Y4UA 2J9QA 2UY1B 4UWFA 4DJAA 1N0QA 3UIPC 3W9GA 2WQHA 4AM9A 4C48B 4WNEA 4LNGA 3FUMA 3FTXA 1N54A 4WWNA 5EX0A 5LOZA 3UXGA 3BQOA 1P5QA 3PVLA 4BERA 4AP2A 5BXOA 2J8SD 5AARA 4GZ3A 3CVUA 3WG7E 3U3WA 2BTDA 3CVYA 2P58C 5D2MC 4ATZD 3G2VA 4KVMA 2WVIA 2ILRA 4Y6CA 3Q79A 5HRYA 2B6CA 3PE4A 2X6IA 5BPPA 2WXJA 1QNFA 2I6HA 2R05A 4ANWA 3UX4A 3CSTA 5CBOA 4FP7A 3AS8A 3D3MA 3QWWA 3CHQA 1TNUA 2NXPA 1H6PA 3E37A 5ENNA 3E30A 3ZYMA 3UT7A 4GPMA 2X3MA 3WXXA 1L5JA 4GU5A 3D9OA 1BU9A 3B7TA 4GYOA 4WNFA 2CFZA 1E8WA 1YCSB 4H7YA 4GMJA 2ETBA 4RLYA 1NI1A 4A1GA 5FZRA 2XPIA 4G1TA 3AU4A 5EKQD 2YNQA 5G55A 2AWIA 1AP7A 2KCKA 4I1MA 1N94A 1Z3XA 3FHEA 3DPYA 2BUGA 2X6JA 3S7BA 5ANRA 2IF4A 4I2WA 1ELKA 2QYJA 4B93B 4L2YA 2CHXA 3S7DA 4JA9A 4J7WA 3Q5MA 4FULA 2DZNA 4JC8A 2LO6A 2A5UA 5KCMA 4FLBA 3G2WA 3IHVA 3LY8A 2XHEA 5EX3A 3RU0A 4L1BA 3EDTB 1BLXB 2RD0A 1OWLA 4YDWA 4A55A 2BEDA 2XS8A 1S63A 2AVPA 2GRRB 1MJ0A 2GRLA 3TWVA 2WXNA 5AJLA 3TWXA 5LP0A 3ZHEB 4W9RA 1N0RA 4X8QA 1K8KG 5JMND 3FTWA 3UM0A 3PNTB 4L23A 4IN3B 3JXIA 2XPYA 2EIKE 1ZU2A 4BX9A 4EZJA 4DPRA 2ONDA 3CQCB 2WM9A 4GA0A 4ATGA 1H19A 4DUIA 2L0TB 1OWPA 4BFRA 1WY6A 4N5QA 2XQ0A 4U96D 3CVNA 1UOHA 4I43A 4MS6A 2YQ8A 5G05C 1LF8A 2CHWA 1NA3A 4Q96A 5JHAA 3LYAA 3RJVA 4ILIA 2RFMA 3FUEA 1E96B 3HRAA 1A17A 2X6KA 2Y3AA 1OCRE 5DIZA 4ZHBA 3ML9A 4UUCA 2IO2C 3EHMA 5G04J 1OWNA 4J0UA 4XX5A 5CEDB 4WWOA 2P9PG 2J07A 4BX8A 3GZSA 4JEUA 3LEWA 4NQ0A 4M7CA 1WM5A 3QJZA 3AU5A 1TYQG 2HYZA 3JUIA 4APOA 3Q9NC 3V79K 1TNYA 2KZTA 4ABNA 1IQRA 1Z5SC 1HS6A 3DEPA 2VTBB 1MX6A 5BV0A 4EBAG 4E6HA 4I2ZA 3D9MA 1JCRA 4CDNA 2FO7A 1N11A 4U0ZA 2KXPC 1KLXA 5ENRD 2X38A 2OEWA 3EJNA 5J08A 2GW1A 2EIJE 2LSVA 1D8DA 4F3VA 4GCOA 2B0OE 3CLJA 3W9FA 2GGFA 3BG1B 4JW1A 3UUXA 5G05J 3IEGA 5FQ6A 3ZU7B 4JPSA 4CGVA 5CBNA 4AOFA 3LVRE 5FT9A 2HM8A 3IBEA 4TUUA 4QQIA 5EN5D 4HS2A 4HORA 3IXEA 3CK8A 4Q94A 3EHQA 2J49A 4GTVA 3ASDA 4GTPA 1O1TA 5BW8C 4KYOB 3D9IA 4YDEA 5FWQA 1S70B 3UTMA 2P9SG 5CMWA 3LY9A 1OWMA 3C5RA 1JCSA 3O4ZA 3QAQA 1U2VG 2OEVA 4U07A 2OOEA 2WXLA 2LAIA 2H6FA 3SFYA 2QZAA 3B7SA 2HE0A 4OVUA 3SFZA 3RO2A 3CHOA 2XEVA 1WAO1 1D8EA 1MX2A 2UWJG 3UT4A 3D9KA 3L13A 3GZ2A 2OVFA 4N2SA 3FUFA 1UW4B 3IV0A 2MRIA 4ILHB 4CGWA 5EIBE 5B1BE 2DYRE 5IY5E 4UQZA 5A23A 3CKCA 3UM3A 1U3DA 5AQBA 4BY6A 3DSXA 1S0PA 3RRMB 3DSUA 3KAEA 2PM6A 2XCBA 5FIOA 4JHRA 2L0IA 1MYOA 2XEHA 2R5SA 2I9CA 4N5CA 3SFXA 4U7EB 2ZGDA 5AENA 4RVBA 4JXTA 3FWVA 1EF1C 4KVOA 3ONKA 3DEOA 2E0IA 2LXLA 3FUDA 1HO8A 3I4RB 3FUNA 3RRNB 3Q49B 4HOSA 5JJTA
chains in the Genus database with same CATH topology
3C3RA 2R02A 5CRVA 4JIOA 2XS1A 5CRUA 3UM1A 3C3QA 3UM3A 2OEXA 2R05A 3UM0A 3UM2A 1ZB1A 3C3OA 3RAUA 3R9MA 2R03A 3ZXPA 2OEWA 2OEVA 2XS8A 2OJQA 3ULYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C3R A;  2R02 A;  5CRV A;  2XS1 A;  5CRU A;  3UM1 A;  3C3Q A;  3UM3 A;  2R05 A;  3UM0 A;  3UM2 A;  1ZB1 A;  3C3O A;  3RAU A;  3R9M A;  2R03 A;  3ZXP A;  2OEW A;  2OEV A;  2XS8 A;  3ULY A; 
#chains in the Genus database with same CATH topology
 2QC9 A;  4IYP A;  2AXV A;  3GZ1 A;  5LFA A;  3NB2 A;  4ANU A;  3C3Q A;  4UQX A;  3TWR A;  1KPS B;  3S2A A;  3ZRH A;  4AVX A;  5J90 A;  3D9L A;  5B1A E;  4DX1 A;  4PDX A;  4J6I A;  3ENE A;  3JQ0 A;  2QYU A;  3CQG B;  4AIF A;  2P9K G;  4BWR A;  2WMO A;  5ENP D;  4I6E A;  1YMP A;  5A6C A;  2VSY A;  1OT8 A;  4A3T A;  2P9N G;  3LS8 A;  2CHZ A;  3FUL A;  3FH7 A;  3R7R A;  3JYS A;  2ION A;  2YIN A;  3LXU X;  4UI9 K;  3EHR A;  4U8H A;  2WXI A;  4GML A;  5BUZ A;  2OV8 A;  2ZU6 B;  3C3O A;  5HS0 A;  4OAU C;  4CEM A;  4ANV A;  3SQV A;  4FHK A;  4E85 A;  5CRV A;  3U9W A;  5AN8 A;  4HOT A;  2P2C P;  3I4G A;  5DBK A;  1HX8 A;  3S7J A;  1H6O A;  1SZ9 A;  3ONL A;  4U0U A;  4JB8 P;  1N4S A;  2IEJ A;  2EQX A;  3I5P A;  3MKQ A;  5KJM A;  1SZA A;  3ZEF A;  3NZS A;  4IRU A;  3NOC D;  5CCM A;  4CT0 A;  2WB2 A;  2LXM A;  3HXD A;  5CRU A;  4B8A A;  3ZHE A;  3U66 A;  3CIA A;  5KNH D;  3AJI A;  3EIQ C;  2R59 A;  3MV2 B;  2VSN A;  2IQC A;  3CHM A;  4DX2 A;  3NOG D;  3JUE A;  1ELR A;  3CV0 A;  1N4Q A;  4G2V A;  3ZPJ A;  4K5C A;  3VLE A;  3TWQ A;  4NIK A;  3B95 A;  4LG6 A;  4RG6 A;  4NRH B;  1YA0 A;  2XRZ A;  4EPZ A;  4M3O A;  4XEI G;  1H0A A;  5KJN A;  3CR3 A;  4KT6 B;  4RQI A;  4HXI A;  1Z3Y A;  1JUQ A;  3SBS A;  4GAA A;  3FU3 A;  3SGH A;  2J09 A;  1LD7 A;  2Q7F A;  5LCW C;  4U95 D;  2FBN A;  3ZVV A;  2AXU A;  3E4B A;  5EYL A;  4Q69 A;  1E7U A;  3V2X A;  2F8Y A;  4CDR A;  1TN6 A;  3UM1 A;  1ELW A;  4JHK A;  3PH0 C;  3Q73 A;  4BTA A;  3TG4 A;  1PAQ A;  3KSQ A;  1SQM A;  4UWL A;  1EDU A;  4XI0 A;  3TXM A;  4YVQ C;  3CEQ A;  4GA2 A;  2DZO A;  3SY2 A;  2GRQ B;  3TWS A;  5C2Y A;  3ZXP A;  2WMN A;  2XCC A;  3FUJ A;  4I9C A;  3OXL A;  2JEK A;  3CK9 A;  4AY6 A;  3ZFW A;  3PEV B;  3G2S A;  3Q7F A;  5AQ9 A;  2H6H A;  2UY1 A;  2VSX E;  3VTY A;  3P2B A;  3UIN C;  4XKB A;  3LJN A;  4RG9 A;  4ANX A;  1IQU A;  4MLP A;  3C72 A;  4R7L A;  1E7V A;  3L54 A;  3ZYK A;  2CFU A;  5E75 A;  3FU6 A;  1DVP A;  1K1B A;  4MRU A;  3RSE G;  3CHR A;  2J08 A;  3NBN B;  2H6I A;  2LUH A;  3SI5 A;  3DXM G;  2I1K A;  3TGO A;  3ABM E;  1GW6 A;  3QOU A;  3SNX A;  3Q9U C;  3CHP A;  4UI9 J;  2C0L A;  4GZ5 A;  3FUI A;  2NC9 A;  3V31 A;  4JA7 A;  3RKV A;  4G11 A;  2VQ2 A;  3FU5 A;  4LRZ A;  1XGW A;  3L22 A;  3NQP A;  4J8D A;  4GTM A;  3KSL A;  3Q7A A;  3ASF A;  3UIO C;  2JLB A;  2KM4 A;  3J5P A;  4YND A;  5EIL A;  5KNG A;  3PDN A;  2VGY A;  1H2V C;  2GRO B;  4DLQ A;  3APC A;  4GCN A;  4HI9 A;  4I1O B;  1KT1 A;  3EUV A;  3MX3 A;  3JXJ A;  2XPZ A;  3RK6 A;  1D9S A;  3FTS A;  1E8Y A;  4FHJ A;  3IHY A;  2NYJ A;  3EU5 A;  3FH5 A;  4I17 A;  3ASO E;  3RIB A;  5ANL A;  2C0M A;  1BD8 A;  2ZGG A;  3HVE A;  2QFC A;  5CHE E;  4BET A;  2J4D A;  3MKR A;  3FH8 A;  2LAH A;  1BI8 B;  3ML8 A;  2EIN E;  2RKK A;  1JPL A;  3B7U X;  3DST A;  4LUN U;  4WNG A;  5AQ7 A;  1WG0 A;  2XGS A;  3ABL E;  5LX8 A;  5CEC B;  1NL4 A;  5KJK A;  1FT2 A;  3FTU A;  3ESK A;  4F1P A;  1N4P A;  3PEU B;  4KZ0 A;  2KZT B;  3HYM B;  3DRA A;  2YHE A;  3Q15 A;  4LCT A;  1MQS A;  1DC2 A;  3LY7 A;  5AAO A;  2MHK A;  3B7R L;  2R2L A;  4HVB A;  3VTX A;  4UWG A;  5BT1 A;  3TWT A;  3OTN A;  4HLL A;  3BEE A;  1K1A A;  1N9A A;  2WXK A;  4GZC A;  5T4Y A;  3QWP A;  4JD2 G;  4B8C B;  1MZC A;  2Y0B G;  4F7A A;  1OUV A;  4OYS A;  1MHQ A;  5JJ6 A;  3PRZ A;  2R03 A;  3MEK A;  5FIN A;  4RSY A;  4F6R D;  5ENO D;  5FZQ A;  2DIW A;  4I1A A;  3APF A;  5JJ7 A;  4O6F A;  4BEP A;  1SA5 A;  4XI9 A;  3SD5 A;  3MV3 B;  1Q2Z A;  3HVE B;  2WXQ A;  3OXF A;  4L9P A;  5FQ8 A;  3SF4 A;  3MKQ B;  4K5A B;  5HQ8 A;  5AQA A;  2F8X K;  2MYO A;  1KZO A;  4JVS A;  2XZD G;  4PS3 A;  4YDO A;  1U3C A;  1BPO A;  5BXU A;  5ENQ D;  4WWP A;  3CGH A;  2PM7 A;  1A5E A;  4V3I A;  3ASH A;  3TAX A;  4GMR A;  3HXC A;  2BF0 X;  3LDZ A;  4I9E A;  2ZXW E;  3UKU G;  3ASN E;  4ACK A;  1TN7 A;  1PC2 A;  1TNO A;  2DVW A;  3R9M A;  3QAR A;  4GA1 A;  4KZC A;  2RFA A;  3T5X A;  4UWH A;  1SW6 A;  3AG3 E;  1PY1 A;  2ETC A;  5C1D A;  1BI7 B;  3ZXS A;  1HXI A;  1HU3 A;  2YHC A;  4C9B B;  4BSX A;  2DCP A;  5CMY A;  3AG4 E;  5LCW J;  3F6Q A;  2Y4T A;  3I3N A;  4GTT A;  2NSZ A;  2KCL A;  1JWF A;  3KS2 A;  5EID A;  1NA0 A;  4PS7 A;  4GZ6 A;  3ZKJ A;  2X6H A;  3FEY A;  3NAW A;  3FDH A;  3CVP A;  4GTS A;  1QBQ A;  3QWV A;  3QK0 A;  1TNZ A;  3ISM C;  2CG3 A;  4TRQ A;  2L6B A;  1NFI E;  1G3N B;  1OCZ E;  3D9J A;  3CVQ A;  2BKK B;  4ZFH A;  3Q75 A;  3HHM A;  3ZIM A;  4L7T A;  1FPP A;  1N52 A;  1OWO A;  3E32 A;  3RRU A;  3FFL A;  2WXH A;  5HI7 A;  2H6G A;  3J5Q B;  3K9I A;  4C0E A;  2OCC E;  4O1O A;  4CDM A;  1INZ A;  3QKY A;  2DBA A;  4CRW A;  3T8M A;  2A4Z A;  4G24 A;  4UI9 C;  4IUL A;  3FY4 A;  3KD7 A;  3PUK A;  3CVX A;  2WXO A;  3NZU A;  2WPV A;  3ZNG A;  4K5B A;  1H2U A;  1FVF A;  4XKC A;  4G25 A;  1DCQ A;  5HKP A;  1SVX A;  4TXR A;  5ARF A;  5FTP A;  5FQ4 A;  1TJC A;  1ZBP A;  4HQD A;  3EHN A;  3DXK G;  4UQY A;  2KC7 A;  5FQ7 A;  1XNF A;  5G04 C;  4URK A;  2PZI A;  4EBA A;  5CCL A;  4N3A A;  3T8K A;  4GB9 A;  2XGO A;  3DSS A;  4FAD A;  5KBA A;  3PRE A;  3BUA A;  2R02 A;  3APD A;  3HXB A;  3V2O A;  1HZ4 A;  4P29 A;  1Y8M A;  1IKN D;  3OXG A;  3SHF A;  1SA4 A;  4EZL A;  2XEE A;  4F1S A;  3DBS A;  4QFV A;  4K0R A;  3HXE A;  3BG0 B;  4O60 A;  3Q4A B;  4G26 A;  5EYP F;  1QZ2 A;  2JAB A;  4U63 A;  4WND A;  3ZGQ A;  2WXF A;  4AY5 A;  4GTR A;  1UN9 A;  4PH4 B;  4GTQ A;  5CER B;  2P9I G;  4U8Y D;  4BT8 A;  4JZY A;  2R17 C;  4PUC A;  1EPU A;  4EEC A;  4NAC A;  4WAF A;  3GW4 A;  2VYI A;  1IXV A;  1KZP A;  3IKO B;  3UM2 A;  3D9N A;  4J8Y A;  3PUJ A;  3N71 A;  3QC1 A;  3L17 A;  5D0Q D;  2ZIR A;  4DK5 A;  4A3V A;  2VJ8 A;  1OY3 D;  3G2T A;  4XZ4 A;  2AJA A;  2RG8 A;  3UMV A;  2XEN A;  5ARG A;  1H6K A;  2FF4 A;  3EIJ A;  2WXG A;  3UQ3 A;  4HBD A;  4K03 A;  3C98 A;  3Q47 B;  4YDY A;  4BTB A;  2EIL E;  1JWG A;  5B3S E;  3R7Q A;  3FU0 A;  4EHM A;  3RO3 A;  1YYH A;  4MKT A;  3URZ A;  4AJW A;  4AEZ C;  2VTB A;  2L6J A;  2J4B A;  3OAW A;  3D9H A;  4J8E A;  4N39 A;  3B13 A;  4AXH A;  2FO1 E;  2XRY A;  2ZIS A;  1UG3 A;  2IOS A;  4I6J A;  1N4R A;  3JCK C;  1MX4 A;  2AXZ A;  4ILG A;  4U0S A;  2BKG A;  3FTY A;  4LNU D;  2Y1L E;  3TWW A;  3L08 A;  1HH8 A;  1O1R A;  2F37 A;  2XGM A;  3ASG A;  2QY7 A;  2IU1 A;  1TNB A;  5JA4 D;  1O5M A;  2V5Q C;  1UJJ A;  2IY0 C;  4EZK A;  1RW2 A;  1Z6T A;  1ZB1 A;  1E8Z A;  3HXF A;  1TJF A;  5A7D B;  1TR4 A;  2AW6 A;  2FI7 A;  2VGX A;  1VDY A;  3VLD A;  4Y6W A;  1UN8 A;  1HG2 A;  1TEZ A;  4GZD A;  3MJW A;  4JEH A;  5KWD A;  1IYG A;  2X6F A;  3D9P A;  1LTX A;  4FLH A;  2GRM A;  3TJP A;  3C3R A;  5E76 A;  2PL2 A;  3AS4 A;  1OCC E;  2M63 A;  4PS8 A;  4B0Z A;  2VGE A;  4APF A;  1N95 A;  4HLE A;  3PZ3 A;  3JQ1 A;  3SZ7 A;  4XE0 A;  4DI4 A;  3PZ4 A;  2KAT A;  2WQ6 A;  3MGB A;  4JL0 A;  4TXP A;  4DRX E;  1DNP A;  4OAV B;  3T9K A;  3FUH A;  1NZN A;  3V30 A;  5H7P A;  4BT9 A;  3KEA A;  1DCE A;  1O1S A;  1V55 E;  3DWL G;  4NUR A;  3CVV A;  4XIF A;  4U8V D;  2I2O A;  5BNW A;  2KBX A;  3PZD A;  2V8S E;  3UKR G;  3CHS A;  4HB5 A;  4A1S A;  4FA6 A;  4J8S A;  4GYW A;  4LEU A;  2ETA A;  4FU3 A;  4DLO A;  1X5B A;  4GTO A;  3MYV A;  4A63 B;  3LKU A;  3NF1 A;  4HRN A;  3G2U A;  2I1J A;  1JCQ A;  3ULE G;  4H7X A;  2P9L G;  3CKB A;  3PS6 A;  3HG0 D;  3P1U A;  5BV1 A;  3MA5 A;  4UWK A;  5AYW D;  2DYS E;  4D10 C;  2V5F A;  4DX6 D;  1H2T C;  4FC8 A;  2Y69 E;  2L9B A;  4MBG A;  3MCX A;  3T5V A;  3SO8 A;  1B89 A;  3FTZ A;  3PNL B;  2LNI A;  4KXK B;  3LVQ E;  5M72 A;  4TXQ A;  4G8L A;  2XZT G;  1UJK A;  1IHG A;  4YVO A;  1QYM A;  5CEA A;  2V4H C;  5FZS A;  3MZL B;  4KMO A;  5EDS A;  3AG1 E;  3U64 A;  3GYZ A;  3FTV A;  2F0Y A;  4F53 A;  1Y6I A;  2EIM E;  1EYH A;  3AG2 E;  3S7F A;  2CG2 A;  1LD8 A;  4U04 A;  4HRM B;  3PZ2 A;  3E33 A;  3ZW3 A;  3DPD A;  3ABK E;  3CVW A;  1HF8 A;  3ZYQ A;  1OXJ A;  4B94 A;  3ZN3 A;  2PQR A;  1S64 A;  3L6A A;  2IFU A;  1OCO E;  5AJD A;  3TG5 A;  3CVL A;  4AV7 A;  2FUL A;  5KJL A;  5AIJ A;  4CYM D;  3SBT B;  3CK7 A;  4I6G A;  2PNN A;  1FCH A;  2E2E A;  4DX7 D;  1FVH A;  1V54 E;  1WDY A;  3B7B A;  3ESL A;  2WXP A;  3R9A B;  4HFG A;  4CZ2 D;  2GRN B;  1HFA A;  2DWZ A;  4FJZ A;  5ENS D;  3LPZ A;  2VSO E;  3QNK A;  3PZ1 A;  3DSV A;  1E8X A;  1RZ4 A;  3ZUV B;  2PQN A;  4KBQ A;  4G23 A;  1FT1 A;  3EU9 A;  2XS1 A;  4L2L A;  1AWC B;  3CSF A;  5D66 A;  3O48 A;  2HO1 A;  4C0M A;  3TWU A;  4OVV A;  2VGX B;  4N2Q A;  3TXN A;  1W3B A;  2C2L A;  4G8K A;  3PE3 A;  4HNA D;  5JHB A;  1QQE A;  4ACL A;  2WXR A;  3ULY A;  3ULQ A;  4HRL A;  1X81 A;  3LCA A;  4GYY A;  2OVB A;  3FEX A;  1HE8 A;  3UI2 A;  3X2Q E;  3QB2 A;  4ME2 A;  4FJY A;  3BU8 A;  4J8F A;  3FP3 A;  3UT8 A;  4BSZ B;  4LSZ E;  2IJG X;  4DX5 D;  3E34 A;  2IO3 C;  4HOU A;  2FEZ A;  5ENT D;  2V4L A;  1HG5 A;  2GRP B;  3AAA C;  3HIZ A;  3L16 A;  5FJY A;  4HI8 A;  4DI3 A;  4Z68 A;  5ITZ F;  3L82 A;  3L9T A;  2LSU A;  3LJ3 A;  3KEZ A;  2HR2 A;  5G2N A;  2IOL A;  5T3R A;  4TUM A;  3ZYL A;  4N3C A;  2MOW A;  3HDX A;  5D0O D;  1E90 A;  3UPV A;  4JHJ A;  4LNB A;  3TL5 A;  4HOQ A;  3RAU A;  3FUK A;  3VLF A;  4GPK A;  2A5E A;  4WUY A;  4CT4 A;  1K3Z D;  2V0P A;  4EQF A;  2WXM A;  3QDN A;  4TV3 A;  2WQ7 A;  3DSW A;  1KT0 A;  4N3B A;  3U4T A;  5T8I A;  1IHB A;  3AS5 A;  2KCV A;  1NP7 A;  4LER A;  4O1P A;  2P9U G;  3Q78 A;  4CCA A;  4B89 A;  4BES A;  1TN8 A;  2Y4U A;  2J9Q A;  2UY1 B;  4UWF A;  4DJA A;  1N0Q A;  3UIP C;  3W9G A;  2WQH A;  4AM9 A;  4C48 B;  4WNE A;  4LNG A;  3FUM A;  3FTX A;  1N54 A;  4WWN A;  5EX0 A;  5LOZ A;  3UXG A;  3BQO A;  1P5Q A;  3PVL A;  4BER A;  4AP2 A;  5BXO A;  2J8S D;  5AAR A;  4GZ3 A;  3CVU A;  3WG7 E;  3U3W A;  2BTD A;  3CVY A;  2P58 C;  5D2M C;  4ATZ D;  3G2V A;  4KVM A;  2WVI A;  2ILR A;  4Y6C A;  3Q79 A;  5HRY A;  2B6C A;  3PE4 A;  2X6I A;  5BPP A;  2WXJ A;  1QNF A;  2I6H A;  2R05 A;  4ANW A;  3UX4 A;  3CST A;  5CBO A;  4FP7 A;  3AS8 A;  3D3M A;  3QWW A;  3CHQ A;  1TNU A;  2NXP A;  1H6P A;  3E37 A;  5ENN A;  3E30 A;  3ZYM A;  3UT7 A;  4GPM A;  2X3M A;  3WXX A;  1L5J A;  4GU5 A;  3D9O A;  1BU9 A;  3B7T A;  4GYO A;  4WNF A;  2CFZ A;  1E8W A;  1YCS B;  4H7Y A;  4GMJ A;  2ETB A;  4RLY A;  1NI1 A;  4A1G A;  5FZR A;  2XPI A;  4G1T A;  3AU4 A;  5EKQ D;  2YNQ A;  5G55 A;  2AWI A;  1AP7 A;  2KCK A;  4I1M A;  1N94 A;  1Z3X A;  3FHE A;  3DPY A;  2BUG A;  2X6J A;  3S7B A;  5ANR A;  2IF4 A;  4I2W A;  1ELK A;  2QYJ A;  4B93 B;  4L2Y A;  2CHX A;  3S7D A;  4JA9 A;  4J7W A;  3Q5M A;  4FUL A;  2DZN A;  4JC8 A;  2LO6 A;  2A5U A;  5KCM A;  4FLB A;  3G2W A;  3IHV A;  3LY8 A;  2XHE A;  5EX3 A;  3RU0 A;  4L1B A;  3EDT B;  1BLX B;  2RD0 A;  1OWL A;  4YDW A;  4A55 A;  2BED A;  2XS8 A;  1S63 A;  2AVP A;  2GRR B;  1MJ0 A;  2GRL A;  3TWV A;  2WXN A;  5AJL A;  3TWX A;  5LP0 A;  3ZHE B;  4W9R A;  1N0R A;  4X8Q A;  1K8K G;  5JMN D;  3FTW A;  3UM0 A;  3PNT B;  4L23 A;  4IN3 B;  3JXI A;  2XPY A;  2EIK E;  1ZU2 A;  4BX9 A;  4EZJ A;  4DPR A;  2OND A;  3CQC B;  2WM9 A;  4GA0 A;  4ATG A;  1H19 A;  4DUI A;  2L0T B;  1OWP A;  4BFR A;  1WY6 A;  4N5Q A;  2XQ0 A;  4U96 D;  3CVN A;  1UOH A;  4I43 A;  4MS6 A;  2YQ8 A;  5G05 C;  1LF8 A;  2CHW A;  1NA3 A;  4Q96 A;  5JHA A;  3LYA A;  3RJV A;  4ILI A;  2RFM A;  3FUE A;  1E96 B;  3HRA A;  1A17 A;  2X6K A;  2Y3A A;  1OCR E;  5DIZ A;  4ZHB A;  3ML9 A;  4UUC A;  2IO2 C;  3EHM A;  5G04 J;  1OWN A;  4J0U A;  4XX5 A;  5CED B;  4WWO A;  2P9P G;  2J07 A;  4BX8 A;  3GZS A;  4JEU A;  3LEW A;  4NQ0 A;  4M7C A;  1WM5 A;  3QJZ A;  3AU5 A;  1TYQ G;  2HYZ A;  3JUI A;  4APO A;  3Q9N C;  3V79 K;  1TNY A;  2KZT A;  4ABN A;  1IQR A;  1Z5S C;  1HS6 A;  3DEP A;  2VTB B;  1MX6 A;  5BV0 A;  4EBA G;  4E6H A;  4I2Z A;  3D9M A;  1JCR A;  4CDN A;  2FO7 A;  1N11 A;  4U0Z A;  2KXP C;  1KLX A;  5ENR D;  2X38 A;  2OEW A;  3EJN A;  5J08 A;  2GW1 A;  2EIJ E;  2LSV A;  1D8D A;  4F3V A;  4GCO A;  2B0O E;  3CLJ A;  3W9F A;  2GGF A;  3BG1 B;  4JW1 A;  3UUX A;  5G05 J;  3IEG A;  5FQ6 A;  3ZU7 B;  4JPS A;  4CGV A;  5CBN A;  4AOF A;  3LVR E;  5FT9 A;  2HM8 A;  3IBE A;  4TUU A;  4QQI A;  5EN5 D;  4HS2 A;  4HOR A;  3IXE A;  3CK8 A;  4Q94 A;  3EHQ A;  2J49 A;  4GTV A;  3ASD A;  4GTP A;  1O1T A;  5BW8 C;  4KYO B;  3D9I A;  4YDE A;  5FWQ A;  1S70 B;  3UTM A;  2P9S G;  5CMW A;  3LY9 A;  1OWM A;  3C5R A;  1JCS A;  3O4Z A;  3QAQ A;  1U2V G;  2OEV A;  4U07 A;  2OOE A;  2WXL A;  2LAI A;  2H6F A;  3SFY A;  2QZA A;  3B7S A;  2HE0 A;  4OVU A;  3SFZ A;  3RO2 A;  3CHO A;  2XEV A;  1WAO 1;  1D8E A;  1MX2 A;  2UWJ G;  3UT4 A;  3D9K A;  3L13 A;  3GZ2 A;  2OVF A;  4N2S A;  3FUF A;  1UW4 B;  3IV0 A;  2MRI A;  4ILH B;  4CGW A;  5EIB E;  5B1B E;  2DYR E;  5IY5 E;  4UQZ A;  5A23 A;  3CKC A;  3UM3 A;  1U3D A;  5AQB A;  4BY6 A;  3DSX A;  1S0P A;  3RRM B;  3DSU A;  3KAE A;  2PM6 A;  2XCB A;  5FIO A;  4JHR A;  2L0I A;  1MYO A;  2XEH A;  2R5S A;  2I9C A;  4N5C A;  3SFX A;  4U7E B;  2ZGD A;  5AEN A;  4RVB A;  4JXT A;  3FWV A;  1EF1 C;  4KVO A;  3ONK A;  3DEO A;  2E0I A;  2LXL A;  3FUD A;  1HO8 A;  3I4R B;  3FUN A;  3RRN B;  3Q49 B;  4HOS A;  5JJT A; 
#chains in the Genus database with same CATH homology
 3C3R A;  2R02 A;  5CRV A;  4JIO A;  2XS1 A;  5CRU A;  3UM1 A;  3C3Q A;  3UM3 A;  2OEX A;  2R05 A;  3UM0 A;  3UM2 A;  1ZB1 A;  3C3O A;  3RAU A;  3R9M A;  2R03 A;  3ZXP A;  2OEW A;  2OEV A;  2XS8 A;  2OJQ A;  3ULY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...