3RAUA

Crystal structure of the hd-ptp bro1 domain
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
358
structure length
358
Chain Sequence
b'VPRMPMIWLDLKEAGDFHFQPAVKKFVLKNYGENPEAYNEELKKLELLRQNAVRVPRDFEGCSVLRKYLGQLHYLQSRVPMGSGQEAAVPVTWTEIFSGKSVAHEDIKYEQACILYNLGALHSMLGAMDKRVSEEGMKVSCTHFQCAAGAFAYLREHFPQAYSVDMSRQILTLNVNLMLGQAQECLLEKSMLDNRKSFLVARISAQVVDYYKEACRALENPDTASLLGRIQKDWKKLVQMKIYYFAAVAHLHMGKQAEEQQKFGERVAYFQSALDKLNEAIKLAKGQPDTVQDALRFTMDVIGGKYNSAKKDNDFIYHEAVPALDTLQPVKGAPLVKPLPVNPTDPAVTGPDIFAKLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein phosphatase non-receptor type 23
publication title The Phe105 Loop of Alix Bro1 Domain Plays a Key Role in HIV-1 Release.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 143
structure length 358
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2011-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.280 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat alix/aip1 like domains 3rauA00
3ULYA 3ZXPA 3C3RA 3UM0A 3C3QA 1ZB1A 5CRUA 3RAUA 2OEWA 3UM1A 2R03A 2XS1A 2XS8A 3UM3A 3UM2A 2R02A 5CRVA 2R05A 2OEVA 3C3OA 3R9MA
chains in the Genus database with same CATH superfamily
2BUGA 2OV8A 2ONDA 4U07A 3B7SA 4URKA 3SY2A 1XNFA 4HI8A 2X6KA 2WXPA 3NB2A 5BNWA 4TXQA 5FINA 2LXMA 1KZPA 2DVWA 2E0IA 4U04A 1TNZA 4BETA 4PS3A 4WAFA 4UQXA 2WXJA 4IRUA 4KYOB 4HLEA 2C0MA 3ZVVA 3PDNA 5C2YA 1DCEA 3FU5A 3P1UA 5JHBA 4UWHA 3C3OA 2J4DA 4EPZA 3CV0A 1HH8A 4O60A 3ZGQA 1NL4A 1DNPA 4LCTA 2XZTG 3Q7FA 2FO1E 4HRLA 1H6OA 3RKVA 4E6HA 2EIJE 2I2OA 2LO6A 4DUIA 3C98A 3FU3A 3L82A 2A4ZA 5ARFA 3AU5A 3ULYA 3ABME 2PNNA 5EX0A 4WNGA 3ASOE 3O4ZA 3R7QA 1HG5A 3JQ0A 4J8DA 3LY9A 4JXTA 3UM1A 1N4PA 4HS2A 1H2UA 1H19A 1XGWA 3D9KA 4RLYA 3FUMA 3FY4A 4EBAG 2IEJA 5AJLA 2HO1A 4UQZA 3FFLA 2EINE 4UWLA 3R9AB 4AOFA 1OWLA 2WXKA 3FTWA 4AY5A 3I3NA 2GRNB 4GCNA 4LSZE 4F7AA 2WMNA 3FUJA 4JHJA 5KNGA 4I1AA 2VTBA 5CRVA 4OAVB 4F53A 3OAWA 1FT2A 5EDSA 1YMPA 3V79K 1HF8A 4GMLA 4Z68A 4DI4A 3CGHA 4WNDA 4JHRA 2WXFA 1IQUA 1SZAA 3B7TA 4HQDA 2NXPA 2WVIA 1PY1A 3BG1B 3JCKC 4HFGA 3I5PA 5ANRA 4KT6B 3UXGA 4UWGA 3ZW3A 2XPZA 3B95A 2QC9A 5FZSA 3MX3A 4APOA 3RSEG 1TEZA 1U2VG 2L0TB 3R9MA 2GGFA 4ILIA 3FUNA 1D8DA 1O1TA 4GZCA 5B3SE 3E37A 3QJZA 2WPVA 3LKUA 2VGEA 1TJCA 3UMVA 1ELKA 4D10C 4U63A 4GA1A 3TG5A 3HRAA 2P9LG 3UQ3A 4GZDA 4U0UA 2J09A 1JWGA 4DPRA 2VGYA 4AIFA 2X6FA 3ZYMA 4ANXA 4FLHA 1BI8B 2GRQB 1W3BA 3PZ4A 3TWWA 4JW1A 3D9MA 2KM4A 3PNTB 2J08A 3SHFA 3LVQE 4W9RA 3CKBA 3MJWA 2WQHA 4XI0A 3Q73A 1K3ZD 4YDWA 4WUYA 3D9PA 3L13A 1NFIE 2L0IA 4G1TA 2J49A 2JLBA 1OCOE 3G2SA 5KWDA 4F1SA 1HFAA 4XZ4A 3EIJA 1SW6A 3O48A 5EYLA 1V54E 3AU4A 2MOWA 4A1SA 3PREA 3MKQA 4HI9A 4R7LA 3E34A 3RU0A 2BTDA 3LXUX 2F0YA 5CMYA 4BWRA 2FULA 1HXIA 4N2SA 4GYWA 1OWNA 3G2WA 1E8WA 3RIBA 5FIOA 1TN7A 4M3OA 5BXOA 4BT9A 1UN8A 5BXUA 4NIKA 1K1AA 3I4RB 2XRZA 3CSFA 5BW8C 3EHRA 2UY1A 4EQFA 3ML8A 3Q47B 3LEWA 1WAO1 4G11A 4NQ0A 1FT1A 4NACA 2XEHA 4ANUA 3DSWA 2I6HA 2XEVA 1NP7A 2XGOA 3FTUA 3CHSA 4J7WA 4HOQA 3ZU7B 3UX4A 3X2QE 3Q78A 1EDUA 4C0EA 3PNLB 1K1BA 2KZTA 3DSUA 1QNFA 3FUKA 3HXFA 4N3CA 3IBEA 3Q4AB 3R7RA 4FA6A 3HVEA 1WG0A 3ASDA 2XCBA 2GRLA 4J8YA 3CVYA 3E33A 2FBNA 3L16A 3ESKA 4CDRA 2I1KA 4J8SA 4HOUA 4PS7A 1N0QA 5LX8A 5CCLA 3AG3E 1EYHA 4CT0A 3U66A 4JA7A 3QAQA 2X38A 3UT8A 4GTPA 1N52A 3QKYA 4J8FA 1H2VC 3EUVA 4K0RA 1N11A 3ISMC 3MYVA 5KJKA 3TXNA 3KSQA 3APDA 4ZHBA 3SFXA 5AQAA 3PZ2A 3FH5A 2F37A 5A6CA 2ZGDA 4WWNA 4A1GA 4JHKA 2AWIA 3VTYA 4RVBA 4I6GA 2LUHA 4CT4A 1X5BA 3ZRHA 3UIPC 2RFAA 3W9GA 3HDXA 3NF1A 2OVFA 1TN8A 1EF1C 4FADA 3APFA 4U8VD 2X3MA 3LJNA 3TWTA 2PQNA 4ABNA 3CHMA 4JEUA 3P2BA 3IV0A 5AYWD 5EILA 4GYYA 3EU5A 1IHBA 5FQ7A 4HOSA 3RO3A 1ZU2A 3UI2A 3RRMB 4C48B 4KXKB 3ML9A 5BUZA 1HZ4A 2A5UA 3QWWA 3FTXA 2WQ6A 3CQGB 4XI9A 3SGHA 2WXMA 4RSYA 3FTVA 5AN8A 3L6AA 3ENEA 2FF4A 2FI7A 4U95D 3U4TA 2YHCA 3DPDA 5T4YA 4I1MA 2CHZA 3MKRA 2VQ2A 4G8KA 4EZJA 4N5CA 1U3CA 3FU6A 3FTYA 1Y6IA 3ZFWA 4ACLA 3CVWA 5G04C 4L9PA 1ELRA 3T5XA 3HHMA 2RKKA 5ANLA 4JD2G 4APFA 1RW2A 4G2VA 4HORA 3IXEA 3FUDA 3CVXA 5FQ6A 3QC1A 3CVLA 2CG2A 5HS0A 2DCPA 5JA4D 4Q96A 1S70B 3ONLA 1H6PA 2HM8A 2QZAA 5LCWJ 2LSVA 2Y4UA 1D8EA 3DSXA 2RFMA 3UT7A 4XEIG 4F6RD 1HX8A 3CHPA 4HRNA 4Q69A 3L08A 2V0PA 2WB2A 2LAHA 3DBSA 3KEAA 3CLJA 3DPYA 3NQPA 5J08A 4I43A 1OXJA 5KJMA 4U96D 4FHKA 4JC8A 3BQOA 3D3MA 4FLBA 1OCRE 3RAUA 1UJJA 4GA2A 3TWUA 2WQ7A 1A5EA 1LD8A 1HE8A 1IYGA 3IHYA 3PS6A 3T5VA 2ZXWE 4MS6A 1O5MA 3GW4A 1E96B 1Z5SC 3EHNA 4Y6CA 4AY6A 1N4RA 1INZA 3BEEA 4DLOA 1Z6TA 5EYPF 4BT8A 4GAAA 4GTTA 3T9KA 4A3TA 3MZLB 3SFYA 4BEPA 2P58C 4LRZA 5A7DB 4HB5A 2DYRE 5FZRA 3C3QA 1ZB1A 1DVPA 2B0OE 3V2XA 3G2UA 4JA9A 2ZGGA 2IJGX 4L2LA 3CHOA 4M7CA 3ZNGA 4A55A 1TNYA 2GRRB 4YNDA 5CHEE 5G2NA 3T8KA 3AG2E 2VSXE 1SA5A 3QB2A 1NA3A 3NZSA 2V4HC 2VSOE 2PQRA 4UQYA 1SQMA 3V2OA 2KC7A 4GA0A 5AQBA 5HKPA 4UI9J 5CECB 3NOGD 4BX9A 2CFZA 2ETCA 4NRHB 1V55E 3ASFA 4WWOA 2QYUA 3KEZA 1N94A 5BV0A 2ZIRA 3DSSA 4AM9A 4BSZB 2DZNA 4G25A 1KT0A 3D9OA 3IEGA 3PEVB 3URZA 1BI7B 4TV3A 3EU9A 4MBGA 4BTAA 3QARA 3CIAA 1OT8A 3G2TA 2KCVA 5JJ6A 1RZ4A 4TRQA 4LNUD 1OCZE 4X8QA 4FP7A 4HLLA 3HXEA 4CRWA 4ZFHA 1YCSB 3D9JA 3ZKJA 1BPOA 2PL2A 2XRYA 1TNOA 4EZKA 2I9CA 5J90A 2AW6A 2NYJA 4DX5D 5M72A 5EX3A 3ASHA 5ENPD 1OUVA 4RQIA 2Q7FA 4GTVA 4P29A 2DZOA 3FUIA 4LUNU 2LSUA 2HYZA 3KD7A 4PS8A 2J07A 3IHVA 4HNAD 1MX2A 5H7PA 1JUQA 1TN6A 3V30A 3ZUVB 1K8KG 2Y4TA 4EZLA 2WXQA 1NZNA 3TG4A 2MRIA 2PZIA 2VGXA 4ANWA 3SZ7A 3RRNB 2AXUA 3FTSA 4EHMA 2IY0C 3Q79A 4HVBA 1E7UA 3ZEFA 3D9LA 4ATZD 4A63B 3IKOB 1B89A 5KCMA 1LD7A 3HXDA 5FT9A 5FWQA 3PUKA 3KSLA 3JUEA 3SQVA 2BKKB 4GU5A 1FCHA 3DXKG 2F8YA 3TJPA 4CGVA 4GPKA 5ENRD 2MHKA 3MV3B 3GZ2A 3F6QA 4WWPA 4KMOA 1P5QA 3U3WA 2YQ8A 3E30A 3UUXA 4G23A 4B0ZA 3QWVA 3OTNA 4LNBA 3TWXA 3UM0A 2WXLA 3WXXA 1MQSA 1WDYA 3PE4A 3RJVA 2VTBB 2QFCA 4MLPA 3UINC 4Q94A 1GW6A 2CHXA 4JZYA 4XKBA 2LNIA 2H6FA 3LVRE 3Q75A 3FHEA 1E8XA 1UN9A 5KBAA 3ONKA 3FULA 1HS6A 3TWQA 1QQEA 5ITZF 3T8MA 3PZ3A 1TJFA 1DC2A 1DCQA 1ELWA 2I1JA 1OWPA 4AEZC 3ZYLA 2WXIA 4FJYA 2L9BA 4MRUA 2H6GA 3QDNA 5G05C 4FHJA 3HYMB 3JQ1A 4BTBA 2F8XK 3VLDA 3K9IA 3QK0A 3CKCA 1H2TC 3Q9NC 3DSVA 2X6IA 3ASGA 1JCQA 4WNEA 3ZHEA 2XZDG 3EJNA 3LYAA 2EQXA 1N0RA 3CSTA 5AQ7A 2WM9A 4IULA 3CR3A 3B7UX 3APCA 4GPMA 3S7FA 1AP7A 1O1SA 4JB8P 4G24A 1IXVA 5D0OD 3VLFA 3N71A 3LDZA 2E2EA 4G8LA 1UJKA 3LJ3A 4BERA 3CVQA 4GYOA 4PH4B 5CEAA 3ZXSA 3B7BA 2WXGA 3NBNB 4CYMD 1BD8A 4F1PA 3DRAA 4OAUC 4FJZA 4I2ZA 2EIKE 2OCCE 4WNFA 3AS8A 3CHRA 3ZIMA 1E7VA 2IOSA 4CDMA 2R59A 4GTMA 5BV1A 4LG6A 4GMJA 2R02A 1JCSA 5T3RA 2R05A 2JABA 3FEYA 4J6IA 4Y6WA 3RK6A 3MA5A 3CK7A 2A5EA 2WXNA 3MKQB 1SZ9A 5LP0A 3PUJA 3BU8A 3SBTB 3V31A 5DBKA 3FWVA 4G26A 2VYIA 5G04J 3LPZA 3C5RA 1JCRA 1E90A 4ACKA 1KLXA 2QY7A 2L6JA 2PM7A 1LTXA 2RG8A 2R03A 2UY1B 2AXZA 4TUMA 3DEOA 4HXIA 2BEDA 3E4BA 4DX2A 5BPPA 4IN3B 5FJYA 1E8ZA 4U7EB 3S7BA 2V5FA 2VSNA 2ILRA 4E85A 4GZ3A 3CVNA 4I17A 1S0PA 2KZTB 2MYOA 1HO8A 5JJTA 5CERB 3HVEB 4DRXE 5AAOA 4BY6A 3PVLA 1TNUA 1MX4A 3UKRG 5EKQD 3TAXA 2KATA 3ZYQA 1MHQA 5G55A 2ETAA 2P9PG 2J9QA 1N54A 4YVQC 2OOEA 3PRZA 3ULQA 4F3VA 4U8HA 4GZ6A 5AJDA 3L22A 2PM6A 3EIQC 4I2WA 2H6HA 2XS8A 1SVXA 2KCLA 5ENOD 3MEKA 3FH7A 4LNGA 1O1RA 3HXCA 2R17C 2ZISA 1AWCB 5HQ8A 3VLEA 4N2QA 5E75A 4UWFA 2XCCA 4IYPA 2ZU6B 4CGWA 2P9NG 4GTOA 4DK5A 3I4GA 5LCWC 2Y69E 4UI9K 4YDOA 3RRUA 3ZPJA 4I9EA 1OWMA 5B1BE 2LXLA 3HXBA 3FTZA 4ATGA 4MKTA 4N3AA 1HG2A 2XPIA 1KZOA 2C2LA 3UM3A 2HR2A 5EN5D 4U0ZA 3JUIA 5ENSD 2WMOA 4DX7D 2WXHA 3L9TA 5CEDB 3Q7AA 1E8YA 4CCAA 4O1OA 2X6JA 2FO7A 3FH8A 2XPYA 4GTRA 2WXOA 4CDNA 2V5QC 3VTXA 3HIZA 1UG3A 2Y0BG 4BFRA 2IFUA 4XKCA 1TYQG 4B8CB 2IONA 3KAEA 5CCMA 3FU0A 1EPUA 1YYHA 4AV7A 4BSXA 4GMRA 3GZ1A 1SA4A 1KPSB 4DJAA 3NOCD 3QWPA 4HOTA 1FPPA 5JMND 2Y3AA 4NURA 4N39A 5HI7A 2GROB 2XEEA 1BLXB 2KCKA 1KT1A 1NA0A 2OEWA 2P9KG 4AP2A 4XE0A 3LCAA 4GTQA 4HRMB 4O1PA 2XGSA 2LAIA 3TL5A 4I9CA 2J8SD 2XGMA 3ASNE 2IU1A 2IQCA 3SF4A 1TR4A 2XENA 2OEVA 1WY6A 3FDHA 3BUAA 3DSTA 1Z3XA 1D9SA 3CK8A 3SFZA 4ME2A 4YVOA 3ZN3A 3GYZA 5KJNA 4FULA 4XIFA 3U64A 4N5QA 5EIDA 3QOUA 5FQ4A 3PE3A 5BT1A 3S7JA 5FTPA 1WM5A 4UI9C 3FP3A 3Q9UC 3FUHA 1A17A 4PUCA 2HE0A 2XQ0A 3Q49B 3UM2A 4OYSA 2V8SE 3JXJA 4K03A 3EHMA 3D9NA 3L17A 4KZCA 1Y8MA 1G3NB 5ENNA 1N9AA 1IKND 3C72A 4N3BA 3AJIA 4FU3A 2YINA 4JL0A 4L7TA 3GZSA 3TXMA 3UTMA 1L5JA 3DWLG 4UUCA 3J5QB 3CVPA 2CHWA 2KXPC 5ENQD 5JJ7A 2C0LA 2CG3A 3SBSA 4JEHA 2GRPB 5LFAA 1JWFA 2X6HA 4QFVA 4K5AB 1H0AA 1N95A 3S2AA 4K5CA 3L54A 2FEZA 4LERA 5D0QD 3D9HA 5E76A 4OVVA 4AVXA 4C0MA 3J5PA 4HBDA 1OY3D 5AQ9A 3DXMG 3EHQA 3D9IA 3W9FA 2IF4A 2AVPA 1JPLA 4KVMA 2EILE 1H6KA 2P9SG 3EDTB 4UWKA 2DIWA 2BF0X 5CMWA 3JXIA 4TUUA 1QZ2A 3Q15A 5AIJA 3S7DA 4LEUA 4FC8A 4V3IA 4DLQA 5D66A 1MZCA 1U3DA 2EIME 2M63A 5EIBE 1OWOA 3ZXPA 2YNQA 3DEPA 4B93B 5G05J 5FZQA 3FEXA 1N4QA 1FVHA 2UWJG 3ULEG 4EBAA 4GTSA 2AXVA 2IO3C 2RD0A 2JEKA 4L2YA 1QYMA 2KBXA 3CQCB 3LY7A 3NZUA 1ZBPA 3CHQA 3LY8A 4L1BA 4GZ5A 2VSYA 2QYJA 4JVSA 3G2VA 2Y1LE 3SNXA 3AG1E 1S64A 5A23A 5C1DA 4B8AA 4H7XA 2YHEA 2DYSE 4DX6D 2AJAA 3ABKE 2NSZA 2DWZA 2XHEA 4B94A 4AJWA 3B7RL 2IO2C 2R2LA 3KS2A 5ARGA 3QNKA 5FQ8A 2ETBA 2V4LA 1QBQA 3PZDA 3MV2B 2IOLA 4L23A 2BKGA 3UT4A 3TWRA 4J8EA 5CBNA 1Q2ZA 4YDEA 3AS5A 3U9WA 4I6JA 4OVUA 2GW1A 2VGXB 3SI5A 2GRMA 3FUEA 4GCOA 5KJLA 3Q5MA 3CVUA 4A3VA 4RG6A 1VDYA 3AG4E 3CK9A 1PAQA 4DX1A 4B89A 1UW4B 4ILGA 2VJ8A 1OCCE 3ABLE 4K5BA 4CEMA 4J0UA 4TXPA 4U8YD 2NC9A 3MCXA 4QQIA 1TNBA 3C3RA 4TXRA 5AARA 3HG0D 4JPSA 5JHAA 3PZ1A 3OXGA 4BESA 3E32A 1IHGA 3AS4A 3CEQA 1X81A 5LOZA 5KNHD 1IQRA 2J4BA 3NAWA 1LF8A 3PH0C 3AAAC 4I1OB 4AXHA 2WXRA 1S63A 2P9IG 3B13A 5CBOA 4XX5A 3UIOC 1Z3YA 2R5SA 1FVFA 4KVOA 5AENA 2CFUA 2OVBA 4U0SA 4C9BB 3TWVA 4YDYA 5T8IA 3SO8A 5ENTD 4ILHB 4O6FA 3WG7E 4CZ2D 5B1AE 1NI1A 2XS1A 3UPVA 3BG0B 4RG9A 3MGBA 3ZYKA 2L6BA 1HU3A 5DIZA 3ESLA 1UOHA 1YA0A 3OXFA 3TGOA 3LS8A 5IY5E 3JYSA 2P9UG 3FUFA 1PC2A 5HRYA 4PDXA 5CRUA 2H6IA 1MYOA 4BX8A 4H7YA 4I6EA 3OXLA 2B6CA 3RO2A 4KZ0A 3UKUG 3PEUB 1BU9A 4ANVA 1MX6A 1MJ0A 4DI3A 2P2CP 3ZHEB 3SD5A 4EECA 5D2MC 4KBQA 2DBAA 3TWSA 3CVVA 1N4SA 4GB9A
chains in the Genus database with same CATH topology
3ULYA 3ZXPA 3C3RA 3UM0A 3C3QA 1ZB1A 5CRUA 3RAUA 2OEWA 3UM1A 2R03A 2XS1A 2XS8A 2OEXA 4JIOA 3UM3A 3UM2A 2R02A 5CRVA 2R05A 2OEVA 3C3OA 2OJQA 3R9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ULY A;  3ZXP A;  3C3R A;  3UM0 A;  3C3Q A;  1ZB1 A;  5CRU A;  3RAU A;  2OEW A;  3UM1 A;  2R03 A;  2XS1 A;  2XS8 A;  3UM3 A;  3UM2 A;  2R02 A;  5CRV A;  2R05 A;  2OEV A;  3C3O A;  3R9M A; 
#chains in the Genus database with same CATH topology
 2BUG A;  2OV8 A;  2OND A;  4U07 A;  3B7S A;  4URK A;  3SY2 A;  1XNF A;  4HI8 A;  2X6K A;  2WXP A;  3NB2 A;  5BNW A;  4TXQ A;  5FIN A;  2LXM A;  1KZP A;  2DVW A;  2E0I A;  4U04 A;  1TNZ A;  4BET A;  4PS3 A;  4WAF A;  4UQX A;  2WXJ A;  4IRU A;  4KYO B;  4HLE A;  2C0M A;  3ZVV A;  3PDN A;  5C2Y A;  1DCE A;  3FU5 A;  3P1U A;  5JHB A;  4UWH A;  3C3O A;  2J4D A;  4EPZ A;  3CV0 A;  1HH8 A;  4O60 A;  3ZGQ A;  1NL4 A;  1DNP A;  4LCT A;  2XZT G;  3Q7F A;  2FO1 E;  4HRL A;  1H6O A;  3RKV A;  4E6H A;  2EIJ E;  2I2O A;  2LO6 A;  4DUI A;  3C98 A;  3FU3 A;  3L82 A;  2A4Z A;  5ARF A;  3AU5 A;  3ULY A;  3ABM E;  2PNN A;  5EX0 A;  4WNG A;  3ASO E;  3O4Z A;  3R7Q A;  1HG5 A;  3JQ0 A;  4J8D A;  3LY9 A;  4JXT A;  3UM1 A;  1N4P A;  4HS2 A;  1H2U A;  1H19 A;  1XGW A;  3D9K A;  4RLY A;  3FUM A;  3FY4 A;  4EBA G;  2IEJ A;  5AJL A;  2HO1 A;  4UQZ A;  3FFL A;  2EIN E;  4UWL A;  3R9A B;  4AOF A;  1OWL A;  2WXK A;  3FTW A;  4AY5 A;  3I3N A;  2GRN B;  4GCN A;  4LSZ E;  4F7A A;  2WMN A;  3FUJ A;  4JHJ A;  5KNG A;  4I1A A;  2VTB A;  5CRV A;  4OAV B;  4F53 A;  3OAW A;  1FT2 A;  5EDS A;  1YMP A;  3V79 K;  1HF8 A;  4GML A;  4Z68 A;  4DI4 A;  3CGH A;  4WND A;  4JHR A;  2WXF A;  1IQU A;  1SZA A;  3B7T A;  4HQD A;  2NXP A;  2WVI A;  1PY1 A;  3BG1 B;  3JCK C;  4HFG A;  3I5P A;  5ANR A;  4KT6 B;  3UXG A;  4UWG A;  3ZW3 A;  2XPZ A;  3B95 A;  2QC9 A;  5FZS A;  3MX3 A;  4APO A;  3RSE G;  1TEZ A;  1U2V G;  2L0T B;  3R9M A;  2GGF A;  4ILI A;  3FUN A;  1D8D A;  1O1T A;  4GZC A;  5B3S E;  3E37 A;  3QJZ A;  2WPV A;  3LKU A;  2VGE A;  1TJC A;  3UMV A;  1ELK A;  4D10 C;  4U63 A;  4GA1 A;  3TG5 A;  3HRA A;  2P9L G;  3UQ3 A;  4GZD A;  4U0U A;  2J09 A;  1JWG A;  4DPR A;  2VGY A;  4AIF A;  2X6F A;  3ZYM A;  4ANX A;  4FLH A;  1BI8 B;  2GRQ B;  1W3B A;  3PZ4 A;  3TWW A;  4JW1 A;  3D9M A;  2KM4 A;  3PNT B;  2J08 A;  3SHF A;  3LVQ E;  4W9R A;  3CKB A;  3MJW A;  2WQH A;  4XI0 A;  3Q73 A;  1K3Z D;  4YDW A;  4WUY A;  3D9P A;  3L13 A;  1NFI E;  2L0I A;  4G1T A;  2J49 A;  2JLB A;  1OCO E;  3G2S A;  5KWD A;  4F1S A;  1HFA A;  4XZ4 A;  3EIJ A;  1SW6 A;  3O48 A;  5EYL A;  1V54 E;  3AU4 A;  2MOW A;  4A1S A;  3PRE A;  3MKQ A;  4HI9 A;  4R7L A;  3E34 A;  3RU0 A;  2BTD A;  3LXU X;  2F0Y A;  5CMY A;  4BWR A;  2FUL A;  1HXI A;  4N2S A;  4GYW A;  1OWN A;  3G2W A;  1E8W A;  3RIB A;  5FIO A;  1TN7 A;  4M3O A;  5BXO A;  4BT9 A;  1UN8 A;  5BXU A;  4NIK A;  1K1A A;  3I4R B;  2XRZ A;  3CSF A;  5BW8 C;  3EHR A;  2UY1 A;  4EQF A;  3ML8 A;  3Q47 B;  3LEW A;  1WAO 1;  4G11 A;  4NQ0 A;  1FT1 A;  4NAC A;  2XEH A;  4ANU A;  3DSW A;  2I6H A;  2XEV A;  1NP7 A;  2XGO A;  3FTU A;  3CHS A;  4J7W A;  4HOQ A;  3ZU7 B;  3UX4 A;  3X2Q E;  3Q78 A;  1EDU A;  4C0E A;  3PNL B;  1K1B A;  2KZT A;  3DSU A;  1QNF A;  3FUK A;  3HXF A;  4N3C A;  3IBE A;  3Q4A B;  3R7R A;  4FA6 A;  3HVE A;  1WG0 A;  3ASD A;  2XCB A;  2GRL A;  4J8Y A;  3CVY A;  3E33 A;  2FBN A;  3L16 A;  3ESK A;  4CDR A;  2I1K A;  4J8S A;  4HOU A;  4PS7 A;  1N0Q A;  5LX8 A;  5CCL A;  3AG3 E;  1EYH A;  4CT0 A;  3U66 A;  4JA7 A;  3QAQ A;  2X38 A;  3UT8 A;  4GTP A;  1N52 A;  3QKY A;  4J8F A;  1H2V C;  3EUV A;  4K0R A;  1N11 A;  3ISM C;  3MYV A;  5KJK A;  3TXN A;  3KSQ A;  3APD A;  4ZHB A;  3SFX A;  5AQA A;  3PZ2 A;  3FH5 A;  2F37 A;  5A6C A;  2ZGD A;  4WWN A;  4A1G A;  4JHK A;  2AWI A;  3VTY A;  4RVB A;  4I6G A;  2LUH A;  4CT4 A;  1X5B A;  3ZRH A;  3UIP C;  2RFA A;  3W9G A;  3HDX A;  3NF1 A;  2OVF A;  1TN8 A;  1EF1 C;  4FAD A;  3APF A;  4U8V D;  2X3M A;  3LJN A;  3TWT A;  2PQN A;  4ABN A;  3CHM A;  4JEU A;  3P2B A;  3IV0 A;  5AYW D;  5EIL A;  4GYY A;  3EU5 A;  1IHB A;  5FQ7 A;  4HOS A;  3RO3 A;  1ZU2 A;  3UI2 A;  3RRM B;  4C48 B;  4KXK B;  3ML9 A;  5BUZ A;  1HZ4 A;  2A5U A;  3QWW A;  3FTX A;  2WQ6 A;  3CQG B;  4XI9 A;  3SGH A;  2WXM A;  4RSY A;  3FTV A;  5AN8 A;  3L6A A;  3ENE A;  2FF4 A;  2FI7 A;  4U95 D;  3U4T A;  2YHC A;  3DPD A;  5T4Y A;  4I1M A;  2CHZ A;  3MKR A;  2VQ2 A;  4G8K A;  4EZJ A;  4N5C A;  1U3C A;  3FU6 A;  3FTY A;  1Y6I A;  3ZFW A;  4ACL A;  3CVW A;  5G04 C;  4L9P A;  1ELR A;  3T5X A;  3HHM A;  2RKK A;  5ANL A;  4JD2 G;  4APF A;  1RW2 A;  4G2V A;  4HOR A;  3IXE A;  3FUD A;  3CVX A;  5FQ6 A;  3QC1 A;  3CVL A;  2CG2 A;  5HS0 A;  2DCP A;  5JA4 D;  4Q96 A;  1S70 B;  3ONL A;  1H6P A;  2HM8 A;  2QZA A;  5LCW J;  2LSV A;  2Y4U A;  1D8E A;  3DSX A;  2RFM A;  3UT7 A;  4XEI G;  4F6R D;  1HX8 A;  3CHP A;  4HRN A;  4Q69 A;  3L08 A;  2V0P A;  2WB2 A;  2LAH A;  3DBS A;  3KEA A;  3CLJ A;  3DPY A;  3NQP A;  5J08 A;  4I43 A;  1OXJ A;  5KJM A;  4U96 D;  4FHK A;  4JC8 A;  3BQO A;  3D3M A;  4FLB A;  1OCR E;  3RAU A;  1UJJ A;  4GA2 A;  3TWU A;  2WQ7 A;  1A5E A;  1LD8 A;  1HE8 A;  1IYG A;  3IHY A;  3PS6 A;  3T5V A;  2ZXW E;  4MS6 A;  1O5M A;  3GW4 A;  1E96 B;  1Z5S C;  3EHN A;  4Y6C A;  4AY6 A;  1N4R A;  1INZ A;  3BEE A;  4DLO A;  1Z6T A;  5EYP F;  4BT8 A;  4GAA A;  4GTT A;  3T9K A;  4A3T A;  3MZL B;  3SFY A;  4BEP A;  2P58 C;  4LRZ A;  5A7D B;  4HB5 A;  2DYR E;  5FZR A;  3C3Q A;  1ZB1 A;  1DVP A;  2B0O E;  3V2X A;  3G2U A;  4JA9 A;  2ZGG A;  2IJG X;  4L2L A;  3CHO A;  4M7C A;  3ZNG A;  4A55 A;  1TNY A;  2GRR B;  4YND A;  5CHE E;  5G2N A;  3T8K A;  3AG2 E;  2VSX E;  1SA5 A;  3QB2 A;  1NA3 A;  3NZS A;  2V4H C;  2VSO E;  2PQR A;  4UQY A;  1SQM A;  3V2O A;  2KC7 A;  4GA0 A;  5AQB A;  5HKP A;  4UI9 J;  5CEC B;  3NOG D;  4BX9 A;  2CFZ A;  2ETC A;  4NRH B;  1V55 E;  3ASF A;  4WWO A;  2QYU A;  3KEZ A;  1N94 A;  5BV0 A;  2ZIR A;  3DSS A;  4AM9 A;  4BSZ B;  2DZN A;  4G25 A;  1KT0 A;  3D9O A;  3IEG A;  3PEV B;  3URZ A;  1BI7 B;  4TV3 A;  3EU9 A;  4MBG A;  4BTA A;  3QAR A;  3CIA A;  1OT8 A;  3G2T A;  2KCV A;  5JJ6 A;  1RZ4 A;  4TRQ A;  4LNU D;  1OCZ E;  4X8Q A;  4FP7 A;  4HLL A;  3HXE A;  4CRW A;  4ZFH A;  1YCS B;  3D9J A;  3ZKJ A;  1BPO A;  2PL2 A;  2XRY A;  1TNO A;  4EZK A;  2I9C A;  5J90 A;  2AW6 A;  2NYJ A;  4DX5 D;  5M72 A;  5EX3 A;  3ASH A;  5ENP D;  1OUV A;  4RQI A;  2Q7F A;  4GTV A;  4P29 A;  2DZO A;  3FUI A;  4LUN U;  2LSU A;  2HYZ A;  3KD7 A;  4PS8 A;  2J07 A;  3IHV A;  4HNA D;  1MX2 A;  5H7P A;  1JUQ A;  1TN6 A;  3V30 A;  3ZUV B;  1K8K G;  2Y4T A;  4EZL A;  2WXQ A;  1NZN A;  3TG4 A;  2MRI A;  2PZI A;  2VGX A;  4ANW A;  3SZ7 A;  3RRN B;  2AXU A;  3FTS A;  4EHM A;  2IY0 C;  3Q79 A;  4HVB A;  1E7U A;  3ZEF A;  3D9L A;  4ATZ D;  4A63 B;  3IKO B;  1B89 A;  5KCM A;  1LD7 A;  3HXD A;  5FT9 A;  5FWQ A;  3PUK A;  3KSL A;  3JUE A;  3SQV A;  2BKK B;  4GU5 A;  1FCH A;  3DXK G;  2F8Y A;  3TJP A;  4CGV A;  4GPK A;  5ENR D;  2MHK A;  3MV3 B;  3GZ2 A;  3F6Q A;  4WWP A;  4KMO A;  1P5Q A;  3U3W A;  2YQ8 A;  3E30 A;  3UUX A;  4G23 A;  4B0Z A;  3QWV A;  3OTN A;  4LNB A;  3TWX A;  3UM0 A;  2WXL A;  3WXX A;  1MQS A;  1WDY A;  3PE4 A;  3RJV A;  2VTB B;  2QFC A;  4MLP A;  3UIN C;  4Q94 A;  1GW6 A;  2CHX A;  4JZY A;  4XKB A;  2LNI A;  2H6F A;  3LVR E;  3Q75 A;  3FHE A;  1E8X A;  1UN9 A;  5KBA A;  3ONK A;  3FUL A;  1HS6 A;  3TWQ A;  1QQE A;  5ITZ F;  3T8M A;  3PZ3 A;  1TJF A;  1DC2 A;  1DCQ A;  1ELW A;  2I1J A;  1OWP A;  4AEZ C;  3ZYL A;  2WXI A;  4FJY A;  2L9B A;  4MRU A;  2H6G A;  3QDN A;  5G05 C;  4FHJ A;  3HYM B;  3JQ1 A;  4BTB A;  2F8X K;  3VLD A;  3K9I A;  3QK0 A;  3CKC A;  1H2T C;  3Q9N C;  3DSV A;  2X6I A;  3ASG A;  1JCQ A;  4WNE A;  3ZHE A;  2XZD G;  3EJN A;  3LYA A;  2EQX A;  1N0R A;  3CST A;  5AQ7 A;  2WM9 A;  4IUL A;  3CR3 A;  3B7U X;  3APC A;  4GPM A;  3S7F A;  1AP7 A;  1O1S A;  4JB8 P;  4G24 A;  1IXV A;  5D0O D;  3VLF A;  3N71 A;  3LDZ A;  2E2E A;  4G8L A;  1UJK A;  3LJ3 A;  4BER A;  3CVQ A;  4GYO A;  4PH4 B;  5CEA A;  3ZXS A;  3B7B A;  2WXG A;  3NBN B;  4CYM D;  1BD8 A;  4F1P A;  3DRA A;  4OAU C;  4FJZ A;  4I2Z A;  2EIK E;  2OCC E;  4WNF A;  3AS8 A;  3CHR A;  3ZIM A;  1E7V A;  2IOS A;  4CDM A;  2R59 A;  4GTM A;  5BV1 A;  4LG6 A;  4GMJ A;  2R02 A;  1JCS A;  5T3R A;  2R05 A;  2JAB A;  3FEY A;  4J6I A;  4Y6W A;  3RK6 A;  3MA5 A;  3CK7 A;  2A5E A;  2WXN A;  3MKQ B;  1SZ9 A;  5LP0 A;  3PUJ A;  3BU8 A;  3SBT B;  3V31 A;  5DBK A;  3FWV A;  4G26 A;  2VYI A;  5G04 J;  3LPZ A;  3C5R A;  1JCR A;  1E90 A;  4ACK A;  1KLX A;  2QY7 A;  2L6J A;  2PM7 A;  1LTX A;  2RG8 A;  2R03 A;  2UY1 B;  2AXZ A;  4TUM A;  3DEO A;  4HXI A;  2BED A;  3E4B A;  4DX2 A;  5BPP A;  4IN3 B;  5FJY A;  1E8Z A;  4U7E B;  3S7B A;  2V5F A;  2VSN A;  2ILR A;  4E85 A;  4GZ3 A;  3CVN A;  4I17 A;  1S0P A;  2KZT B;  2MYO A;  1HO8 A;  5JJT A;  5CER B;  3HVE B;  4DRX E;  5AAO A;  4BY6 A;  3PVL A;  1TNU A;  1MX4 A;  3UKR G;  5EKQ D;  3TAX A;  2KAT A;  3ZYQ A;  1MHQ A;  5G55 A;  2ETA A;  2P9P G;  2J9Q A;  1N54 A;  4YVQ C;  2OOE A;  3PRZ A;  3ULQ A;  4F3V A;  4U8H A;  4GZ6 A;  5AJD A;  3L22 A;  2PM6 A;  3EIQ C;  4I2W A;  2H6H A;  2XS8 A;  1SVX A;  2KCL A;  5ENO D;  3MEK A;  3FH7 A;  4LNG A;  1O1R A;  3HXC A;  2R17 C;  2ZIS A;  1AWC B;  5HQ8 A;  3VLE A;  4N2Q A;  5E75 A;  4UWF A;  2XCC A;  4IYP A;  2ZU6 B;  4CGW A;  2P9N G;  4GTO A;  4DK5 A;  3I4G A;  5LCW C;  2Y69 E;  4UI9 K;  4YDO A;  3RRU A;  3ZPJ A;  4I9E A;  1OWM A;  5B1B E;  2LXL A;  3HXB A;  3FTZ A;  4ATG A;  4MKT A;  4N3A A;  1HG2 A;  2XPI A;  1KZO A;  2C2L A;  3UM3 A;  2HR2 A;  5EN5 D;  4U0Z A;  3JUI A;  5ENS D;  2WMO A;  4DX7 D;  2WXH A;  3L9T A;  5CED B;  3Q7A A;  1E8Y A;  4CCA A;  4O1O A;  2X6J A;  2FO7 A;  3FH8 A;  2XPY A;  4GTR A;  2WXO A;  4CDN A;  2V5Q C;  3VTX A;  3HIZ A;  1UG3 A;  2Y0B G;  4BFR A;  2IFU A;  4XKC A;  1TYQ G;  4B8C B;  2ION A;  3KAE A;  5CCM A;  3FU0 A;  1EPU A;  1YYH A;  4AV7 A;  4BSX A;  4GMR A;  3GZ1 A;  1SA4 A;  1KPS B;  4DJA A;  3NOC D;  3QWP A;  4HOT A;  1FPP A;  5JMN D;  2Y3A A;  4NUR A;  4N39 A;  5HI7 A;  2GRO B;  2XEE A;  1BLX B;  2KCK A;  1KT1 A;  1NA0 A;  2OEW A;  2P9K G;  4AP2 A;  4XE0 A;  3LCA A;  4GTQ A;  4HRM B;  4O1P A;  2XGS A;  2LAI A;  3TL5 A;  4I9C A;  2J8S D;  2XGM A;  3ASN E;  2IU1 A;  2IQC A;  3SF4 A;  1TR4 A;  2XEN A;  2OEV A;  1WY6 A;  3FDH A;  3BUA A;  3DST A;  1Z3X A;  1D9S A;  3CK8 A;  3SFZ A;  4ME2 A;  4YVO A;  3ZN3 A;  3GYZ A;  5KJN A;  4FUL A;  4XIF A;  3U64 A;  4N5Q A;  5EID A;  3QOU A;  5FQ4 A;  3PE3 A;  5BT1 A;  3S7J A;  5FTP A;  1WM5 A;  4UI9 C;  3FP3 A;  3Q9U C;  3FUH A;  1A17 A;  4PUC A;  2HE0 A;  2XQ0 A;  3Q49 B;  3UM2 A;  4OYS A;  2V8S E;  3JXJ A;  4K03 A;  3EHM A;  3D9N A;  3L17 A;  4KZC A;  1Y8M A;  1G3N B;  5ENN A;  1N9A A;  1IKN D;  3C72 A;  4N3B A;  3AJI A;  4FU3 A;  2YIN A;  4JL0 A;  4L7T A;  3GZS A;  3TXM A;  3UTM A;  1L5J A;  3DWL G;  4UUC A;  3J5Q B;  3CVP A;  2CHW A;  2KXP C;  5ENQ D;  5JJ7 A;  2C0L A;  2CG3 A;  3SBS A;  4JEH A;  2GRP B;  5LFA A;  1JWF A;  2X6H A;  4QFV A;  4K5A B;  1H0A A;  1N95 A;  3S2A A;  4K5C A;  3L54 A;  2FEZ A;  4LER A;  5D0Q D;  3D9H A;  5E76 A;  4OVV A;  4AVX A;  4C0M A;  3J5P A;  4HBD A;  1OY3 D;  5AQ9 A;  3DXM G;  3EHQ A;  3D9I A;  3W9F A;  2IF4 A;  2AVP A;  1JPL A;  4KVM A;  2EIL E;  1H6K A;  2P9S G;  3EDT B;  4UWK A;  2DIW A;  2BF0 X;  5CMW A;  3JXI A;  4TUU A;  1QZ2 A;  3Q15 A;  5AIJ A;  3S7D A;  4LEU A;  4FC8 A;  4V3I A;  4DLQ A;  5D66 A;  1MZC A;  1U3D A;  2EIM E;  2M63 A;  5EIB E;  1OWO A;  3ZXP A;  2YNQ A;  3DEP A;  4B93 B;  5G05 J;  5FZQ A;  3FEX A;  1N4Q A;  1FVH A;  2UWJ G;  3ULE G;  4EBA A;  4GTS A;  2AXV A;  2IO3 C;  2RD0 A;  2JEK A;  4L2Y A;  1QYM A;  2KBX A;  3CQC B;  3LY7 A;  3NZU A;  1ZBP A;  3CHQ A;  3LY8 A;  4L1B A;  4GZ5 A;  2VSY A;  2QYJ A;  4JVS A;  3G2V A;  2Y1L E;  3SNX A;  3AG1 E;  1S64 A;  5A23 A;  5C1D A;  4B8A A;  4H7X A;  2YHE A;  2DYS E;  4DX6 D;  2AJA A;  3ABK E;  2NSZ A;  2DWZ A;  2XHE A;  4B94 A;  4AJW A;  3B7R L;  2IO2 C;  2R2L A;  3KS2 A;  5ARG A;  3QNK A;  5FQ8 A;  2ETB A;  2V4L A;  1QBQ A;  3PZD A;  3MV2 B;  2IOL A;  4L23 A;  2BKG A;  3UT4 A;  3TWR A;  4J8E A;  5CBN A;  1Q2Z A;  4YDE A;  3AS5 A;  3U9W A;  4I6J A;  4OVU A;  2GW1 A;  2VGX B;  3SI5 A;  2GRM A;  3FUE A;  4GCO A;  5KJL A;  3Q5M A;  3CVU A;  4A3V A;  4RG6 A;  1VDY A;  3AG4 E;  3CK9 A;  1PAQ A;  4DX1 A;  4B89 A;  1UW4 B;  4ILG A;  2VJ8 A;  1OCC E;  3ABL E;  4K5B A;  4CEM A;  4J0U A;  4TXP A;  4U8Y D;  2NC9 A;  3MCX A;  4QQI A;  1TNB A;  3C3R A;  4TXR A;  5AAR A;  3HG0 D;  4JPS A;  5JHA A;  3PZ1 A;  3OXG A;  4BES A;  3E32 A;  1IHG A;  3AS4 A;  3CEQ A;  1X81 A;  5LOZ A;  5KNH D;  1IQR A;  2J4B A;  3NAW A;  1LF8 A;  3PH0 C;  3AAA C;  4I1O B;  4AXH A;  2WXR A;  1S63 A;  2P9I G;  3B13 A;  5CBO A;  4XX5 A;  3UIO C;  1Z3Y A;  2R5S A;  1FVF A;  4KVO A;  5AEN A;  2CFU A;  2OVB A;  4U0S A;  4C9B B;  3TWV A;  4YDY A;  5T8I A;  3SO8 A;  5ENT D;  4ILH B;  4O6F A;  3WG7 E;  4CZ2 D;  5B1A E;  1NI1 A;  2XS1 A;  3UPV A;  3BG0 B;  4RG9 A;  3MGB A;  3ZYK A;  2L6B A;  1HU3 A;  5DIZ A;  3ESL A;  1UOH A;  1YA0 A;  3OXF A;  3TGO A;  3LS8 A;  5IY5 E;  3JYS A;  2P9U G;  3FUF A;  1PC2 A;  5HRY A;  4PDX A;  5CRU A;  2H6I A;  1MYO A;  4BX8 A;  4H7Y A;  4I6E A;  3OXL A;  2B6C A;  3RO2 A;  4KZ0 A;  3UKU G;  3PEU B;  1BU9 A;  4ANV A;  1MX6 A;  1MJ0 A;  4DI3 A;  2P2C P;  3ZHE B;  3SD5 A;  4EEC A;  5D2M C;  4KBQ A;  2DBA A;  3TWS A;  3CVV A;  1N4S A;  4GB9 A; 
#chains in the Genus database with same CATH homology
 3ULY A;  3ZXP A;  3C3R A;  3UM0 A;  3C3Q A;  1ZB1 A;  5CRU A;  3RAU A;  2OEW A;  3UM1 A;  2R03 A;  2XS1 A;  2XS8 A;  2OEX A;  4JIO A;  3UM3 A;  3UM2 A;  2R02 A;  5CRV A;  2R05 A;  2OEV A;  3C3O A;  2OJQ A;  3R9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...