3RAUA

Crystal structure of the hd-ptp bro1 domain
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
358
structure length
358
Chain Sequence
VPRMPMIWLDLKEAGDFHFQPAVKKFVLKNYGENPEAYNEELKKLELLRQNAVRVPRDFEGCSVLRKYLGQLHYLQSRVPMGSGQEAAVPVTWTEIFSGKSVAHEDIKYEQACILYNLGALHSMLGAMDKRVSEEGMKVSCTHFQCAAGAFAYLREHFPQAYSVDMSRQILTLNVNLMLGQAQECLLEKSMLDNRKSFLVARISAQVVDYYKEACRALENPDTASLLGRIQKDWKKLVQMKIYYFAAVAHLHMGKQAEEQQKFGERVAYFQSALDKLNEAIKLAKGQPDTVQDALRFTMDVIGGKYNSAKKDNDFIYHEAVPALDTLQPVKGAPLVKPLPVNPTDPAVTGPDIFAKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein phosphatase non-receptor type 23
publication title The Phe105 Loop of Alix Bro1 Domain Plays a Key Role in HIV-1 Release.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 143
structure length 358
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2011-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.280 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat alix/aip1 like domains 3rauA00
3C3OA 3C3RA 5CRUA 3R9MA 3UM3A 1ZB1A 3RAUA 2XS8A 2R05A 2R03A 2XS1A 2OEVA 3UM0A 3UM2A 3ULYA 2OEWA 3C3QA 2R02A 3UM1A 3ZXPA 5CRVA
chains in the Genus database with same CATH superfamily
2VSNA 5BNWA 4JHKA 3LCAA 3QAQA 3SO8A 4CCAA 5ENNA 4XZ4A 2FF4A 4GA2A 4HOTA 5JHBA 5HKPA 4M7CA 1TNYA 3QB2A 2X6FA 4V3IA 2I9CA 3B7SA 4RSYA 4MLPA 2WM9A 3C5RA 2R17C 1TNOA 2H6IA 4NIKA 3SQVA 3NQPA 3RIBA 1SQMA 5FZSA 3DEOA 1QBQA 4I17A 5G04C 4BX9A 3PUKA 3T5VA 4HOUA 3TL5A 3QDNA 1JCSA 1YYHA 2WXNA 2R5SA 3PREA 5KJKA 4MKTA 3S7JA 5HI7A 5EYPF 1MJ0A 2VGEA 4G2VA 4U8VD 3RAUA 3ZGQA 3APDA 3FTSA 2IF4A 3DSVA 4TV3A 2V0PA 3OXFA 2AW6A 4ABNA 2WXPA 2ILRA 1LD8A 1WM5A 5KNHD 2PM6A 1TNBA 4UWGA 4J8EA 1E8XA 4I1AA 2BUGA 3UPVA 4GMLA 5BXOA 3JXIA 3D3MA 3ZRHA 3MCXA 3TAXA 3B13A 3KSLA 2RG8A 3FULA 4UWKA 5FTPA 1VDYA 4I1MA 3CV0A 1NA0A 4HXIA 1BU9A 3LVRE 2P9UG 4J0UA 4GMRA 3KSQA 4UI9K 4LEUA 4U7EB 4AXHA 3MEKA 3EHRA 4GTTA 5M72A 2IONA 4KVOA 4WNEA 4HI8A 4GU5A 5CEAA 3BU8A 4GMJA 4XEIG 3VTYA 1UN9A 3L82A 4JPSA 1IQUA 2L6JA 3SBTB 4HS2A 5CMYA 3FDHA 4CGWA 3JCKC 3TWVA 1ZU2A 2AWIA 3T5XA 4YDOA 1RZ4A 5LCWJ 1GW6A 3FTWA 5AQAA 3APFA 5JJ7A 3TWUA 1O5MA 3SD5A 4FULA 3UT4A 3ZHEA 2IO2C 5ANRA 2LNIA 1K3ZD 2DZNA 1IXVA 4ZFHA 3CVWA 4TXPA 2RFAA 4EHMA 1EF1C 2XRZA 3UKRG 3URZA 3RKVA 2V4HC 1SZ9A 2GRMA 1U3CA 4TXRA 2XS8A 1L5JA 3AJIA 1X5BA 5D2MC 5EYLA 3EHNA 3ENEA 3PZ1A 3AG1E 5FQ6A 2WPVA 4A1GA 4EECA 3T9KA 3IEGA 3HRAA 4E85A 1OWPA 3TWWA 4A1SA 1MHQA 3EU9A 4UI9C 3D9LA 4QFVA 2KCKA 3LY9A 4UQYA 5KJNA 2WXMA 1N54A 2P2CP 2OEWA 3DEPA 1TYQG 3L54A 1SA5A 2XHEA 3TG5A 3E4BA 2IU1A 3HVEB 5A23A 1UN8A 4GTSA 4O1PA 3T8KA 3QK0A 4BERA 3U9WA 2OEVA 1HG5A 3EJNA 4KZ0A 4HRMB 1N95A 2XPYA 2J07A 4HRNA 1NFIE 4I9CA 3UIPC 4UQXA 2XZTG 3GZSA 4HBDA 4XI9A 4I1OB 2CHZA 5ENPD 3VLFA 3B7UX 5G05C 1E7UA 3VLEA 4PH4B 4CZ2D 4HOQA 3PEVB 4DI3A 2WQ6A 1UJKA 2EINE 2L6BA 3C3QA 5FT9A 3ZU7B 2NSZA 4CYMD 3FTZA 4CRWA 3J5QB 2WXJA 3NAWA 4Y6CA 2DCPA 4HI9A 4OAUC 3KEZA 4AJWA 4RG6A 3ZIMA 2WQHA 5D0QD 1PY1A 2XCCA 3TWSA 3AAAC 3FUKA 1XGWA 4HLEA 2VSXE 3JYSA 4I6JA 2KCLA 4DX7D 5KNGA 1DCEA 3E33A 1Z3YA 3PE4A 3IBEA 2Y4UA 4FLBA 4PS8A 1JCRA 3FUDA 3UM3A 2IEJA 5AQ9A 2XCBA 3JQ1A 1DNPA 4G8KA 4FJZA 2X6IA 4LRZA 3SF4A 2KZTB 2LAIA 1N4QA 4FHKA 1FVHA 2WXRA 4AIFA 4ILGA 1KZPA 3LVQE 5FWQA 3VTXA 3CK8A 3K9IA 4G25A 1LF8A 4GTRA 4KMOA 4YNDA 3CKBA 1OWOA 4X8QA 3WXXA 2KM4A 4N5CA 1KLXA 1N9AA 3DBSA 3IHVA 3DRAA 2YINA 4HOSA 2XPIA 4GTVA 1E96B 1SZAA 3ZN3A 4I6EA 3D9NA 3FU0A 2VGXA 5ANLA 4KXKB 3FUNA 1DVPA 3FU3A 2X38A 3LY8A 1S63A 2J4BA 3CHSA 2ETAA 3L17A 1OXJA 3Q78A 2CFZA 4GPKA 2WXOA 1HZ4A 1XNFA 1EPUA 4FHJA 4N3BA 3Q79A 3DSXA 3I4GA 2IOSA 3BG0B 1IHGA 3UX4A 4L23A 3PZ4A 1Q2ZA 4N3AA 1Z5SC 3PZ2A 2WB2A 2VSOE 4GZ3A 2F8XK 3HXCA 3FUHA 3MX3A 4YVOA 5JMND 3TXMA 1TJCA 2AXUA 2H6GA 4MBGA 4GCOA 3NZSA 3SY2A 3ABLE 5JJTA 2P9NG 4GZ6A 4CDRA 2CG2A 1SA4A 3JUEA 5EILA 5DBKA 2QYUA 3Q47B 3PUJA 5BV0A 3U66A 3ASHA 2H6FA 3QWVA 2JLBA 4HORA 3D9KA 3B95A 4U0UA 2LSUA 5AYWD 1IHBA 4Y6WA 4HRLA 1MX6A 4WUYA 2P9KG 4TRQA 2MRIA 3PZ3A 2GRRB 4JZYA 3OTNA 1K8KG 4J8YA 5FQ8A 3FU5A 3CKCA 3CHQA 3SNXA 2RD0A 1INZA 1V55E 4LERA 1NL4A 5G04J 2AVPA 3ASGA 3S7DA 1HS6A 5CRUA 1FT1A 4KBQA 3ZUVB 1QNFA 3RRMB 1KZOA 4CT4A 3PS6A 3FP3A 3I4RB 3HHMA 4G24A 4L2YA 2PZIA 2WXKA 3MZLB 2R03A 3V79K 2ZXWE 4B0ZA 4XE0A 2E2EA 4CT0A 2WXHA 1TEZA 2J8SD 3ZKJA 4JD2G 2B0OE 3R9AB 5AN8A 1OT8A 2R59A 3ISMC 3UTMA 3FWVA 4WAFA 2FO7A 1YMPA 3FEXA 1HXIA 3W9GA 2DIWA 5HQ8A 2RFMA 3QWPA 2XEEA 3FUEA 4JHRA 4GYYA 3Q9UC 4DX6D 4U04A 3TJPA 4K5BA 4AY5A 2I2OA 3R9MA 3LJ3A 3LPZA 3ONKA 2DYRE 2J4DA 4H7XA 4K5CA 2Y3AA 1V54E 4BWRA 1FVFA 3CLJA 1OCRE 2IFUA 4RQIA 2FEZA 2VYIA 3U3WA 3HDXA 2DZOA 3P1UA 5EX3A 2P9LG 4G11A 5CEDB 1UW4B 3C72A 5C2YA 4A3VA 4TUUA 3Q49B 2UY1A 4MRUA 5T8IA 1H2UA 2IO3C 1N0RA 1Y6IA 3UM2A 4O60A 1U2VG 2HM8A 2EIKE 2OOEA 3CQGB 3UINC 2FO1E 3G2TA 3AS5A 4I6GA 3TWXA 4EZKA 1UJJA 5CCLA 2QC9A 2X6KA 1KT1A 5BT1A 3OXGA 4GB9A 4ZHBA 2PQNA 4IN3B 3ULYA 3V2OA 5G2NA 2X6HA 2R02A 1JUQA 4MS6A 3EHQA 4TUMA 2XRYA 1W3BA 4N5QA 4EZJA 4TXQA 5AQ7A 4LNUD 1NP7A 3FUMA 3RRNB 4F53A 2M63A 5CMWA 1U3DA 2XGMA 1KT0A 3ABKE 1H6PA 2CFUA 1P5QA 2VTBB 3CK9A 4FA6A 3ZEFA 1OCZE 4EZLA 3CHMA 3CR3A 2X3MA 4K5AB 3CHOA 3FTUA 4L9PA 4IRUA 4XKCA 4JL0A 4WNDA 4JA7A 3UM0A 5KBAA 4UQZA 4ME2A 4JEHA 3FTVA 3D9IA 4GTQA 1O1TA 1JWGA 2FULA 2A4ZA 2Y1LE 2LAHA 3SGHA 3ASOE 4UI9J 4G26A 3T8MA 4RVBA 4U96D 3X2QE 3S7FA 3FH5A 5IY5E 3DSWA 5KJMA 1SW6A 2I6HA 2IJGX 4B8AA 1TR4A 4DK5A 5ENOD 3DWLG 2QYJA 4AM9A 2ZGGA 1X81A 3B7RL 5JJ6A 4JW1A 3IHYA 4NACA 2X6JA 4FJYA 4BSXA 2XS1A 4FADA 2WXLA 3PH0C 3VLDA 4YDYA 3SFYA 4I2ZA 4BY6A 5AJLA 3IKOB 1FT2A 3G2WA 5G05J 3UUXA 4FC8A 4CDNA 3TG4A 5CERB 3F6QA 5FZRA 2RKKA 4Q94A 1ZB1A 4ATGA 1LD7A 4U8HA 5FQ4A 2C0LA 1K1BA 2AXVA 4FU3A 3NF1A 2OVFA 1E7VA 2WXGA 4AY6A 3D9HA 5ARGA 3ZFWA 1FCHA 5J08A 5E76A 3ZXPA 5CCMA 4AVXA 5BPPA 3OAWA 5CBOA 4UWLA 3LDZA 2VJ8A 1JPLA 4GTPA 1NZNA 4F7AA 4OVUA 2FBNA 3DSUA 5AIJA 5LFAA 4CEMA 4GYOA 3JUIA 4DX1A 3NZUA 3EHMA 1H19A 2NC9A 3ZNGA 5EIBE 5ITZF 1TJFA 2OVBA 1TNUA 3MV3B 4C0EA 4UWHA 3APCA 3B7TA 3BG1B 3TWTA 3RK6A 2IOLA 4O1OA 3L9TA 5C1DA 3CIAA 2R05A 1G3NB 3HXEA 1D8DA 2KCVA 4DX2A 4APOA 3ZW3A 5E75A 3ZYKA 3HXDA 2XEVA 2OCCE 2QZAA 4UWFA 3J5PA 4BSZB 4XIFA 3N71A 4ANUA 3KEAA 4W9RA 3CGHA 3CQCB 2IY0C 4JEUA 4DPRA 3ESKA 4FP7A 4HLLA 2GRNB 3L13A 4J8DA 2WQ7A 2L0TB 1PAQA 4C48B 3UMVA 3AG4E 1IQRA 2NXPA 2EIME 5B3SE 3E37A 4IULA 3ZHEB 3RSEG 3C98A 3TGOA 3PE3A 3ML8A 5EDSA 1E8ZA 3QWWA 1N11A 5CECB 4DLQA 2GW1A 4OYSA 1MX4A 4PS7A 2L0IA 4RLYA 5A7DB 3QARA 3AG3E 4UUCA 2F37A 3Q4AB 1JCQA 3UT8A 5EN5D 3SHFA 4I43A 5EKQD 5FJYA 4XX5A 3L6AA 1UG3A 3LJNA 3G2UA 4U0SA 2VGYA 1NI1A 1OUVA 2ZU6B 5CBNA 3E34A 2XEHA 2CG3A 2ZGDA 3UM1A 2R2LA 3P2BA 4HB5A 5FINA 3I3NA 1MYOA 3FY4A 4HQDA 5AENA 2P9PG 3ZPJA 3HXFA 3Q15A 5AQBA 1N94A 4EBAG 4BETA 4G1TA 4J8SA 1YCSB 3MKQB 1BI8B 3IV0A 2GRQB 3EU5A 4HNAD 2MYOA 3DSTA 1H2VC 2XENA 3Q5MA 4JVSA 4F1PA 2HR2A 3ZYLA 4WNGA 1BD8A 2ETBA 4RG9A 3RO3A 2KXPC 2Y4TA 3BEEA 4BTAA 3CK7A 5KCMA 4H7YA 4ILIA 5JHAA 4URKA 2PM7A 2PQRA 5BXUA 4KYOB 5FZQA 3BQOA 5EIDA 3C3OA 3EIJA 4DX5D 2P9IG 1EDUA 1H0AA 1WDYA 2DVWA 4DLOA 2FI7A 3CVVA 2CHWA 3Q7AA 3FUJA 2WXQA 4HFGA 4Q69A 4XKBA 3MYVA 3ASDA 1HH8A 3HIZA 4BFRA 3LY7A 2H6HA 1A5EA 2JEKA 3FUFA 2VTBA 5BV1A 3UQ3A 1D8EA 2A5EA 4E6HA 2DYSE 1BPOA 1NA3A 3OXLA 4B93B 4Z68A 4D10C 2YQ8A 2I1KA 3ZYMA 3S2AA 5ENQD 1HFAA 5HS0A 4CDMA 1OWNA 5CRVA 1OY3D 1SVXA 1QZ2A 2YHEA 3BUAA 4HVBA 3RU0A 1ELWA 2LO6A 2OV8A 3UIOC 2YHCA 4N39A 1O1SA 4NURA 4KZCA 3CHRA 4K0RA 4AP2A 3LS8A 2IQCA 4BTBA 1AWCB 3QJZA 3V30A 1OCOE 1H6OA 1UOHA 3W9FA 5G55A 3CVYA 1QQEA 2QFCA 4J7WA 2VGXB 1WY6A 2XQ0A 3QC1A 4N2SA 3GZ1A 1N4SA 4YDWA 5J90A 4J8FA 5JA4D 4LUNU 1ELKA 2E0IA 5BW8C 5HRYA 4ACLA 2AJAA 1LTXA 1YA0A 2HE0A 2BF0X 1EYHA 3CSFA 3HVEA 4JA9A 1HX8A 1H2TC 4J6IA 3FHEA 4Q96A 4JHJA 1BLXB 3GYZA 5D0OD 4B8CB 3U64A 4DUIA 4LNGA 2LSVA 4BESA 2I1JA 3CHPA 1S70B 4GTMA 3SFXA 4U0ZA 1N4RA 2BKKB 4N3CA 5B1BE 1MZCA 2MOWA 3ASFA 3MJWA 3KS2A 4U63A 3ESLA 1HG2A 3L22A 4M3OA 3E32A 3AU4A 2LXMA 1JWFA 4L7TA 2V5FA 1MX2A 4JC8A 3GW4A 3UT7A 3JXJA 1N4PA 2F8YA 4OAVB 3UKUG 2HYZA 3EDTB 3HYMB 4C9BB 2NYJA 5ENRD 3V31A 5BUZA 4N2QA 1HF8A 2EILE 3FH8A 3PVLA 2WMNA 5FQ7A 3FH7A 3MA5A 3HG0D 4PS3A 3TWRA 1N52A 4U95D 2BTDA 1OWLA 1RW2A 3V2XA 3FTXA 4G23A 5KWDA 3ULEG 2GGFA 3LEWA 4GZCA 4BT8A 2KBXA 3AU5A 3TXNA 2ONDA 4PUCA 2KZTA 3MGBA 4ATZD 3EIQC 4WWOA 1B89A 4NQ0A 3O48A 5AAOA 3KAEA 3WG7E 5ENTD 1OWMA 3C3RA 2P9SG 3MKRA 3AS8A 4P29A 1E90A 2KATA 2GRLA 4KVMA 2DWZA 1WG0A 3D9PA 2ZIRA 4AV7A 3QKYA 3LYAA 4C0MA 3CVUA 2J09A 5LCWC 2J08A 3ML9A 3AS4A 2VSYA 3Q9NC 4LNBA 5T4YA 3PNTB 1A17A 5B1AE 2EQXA 3QNKA 4YVQC 4EPZA 2GROB 1TNZA 4ACKA 1TN8A 3LXUX 1HU3A 3NOGD 3KD7A 2UY1B 3DXMG 3SZ7A 4ILHB 2QY7A 3FFLA 3NB2A 2L9BA 3PEUB 1E8WA 3TWQA 4L1BA 3ZYQA 4BT9A 3ULQA 3MKQA 3L08A 1S64A 2AXZA 2C0MA 4G8LA 4AEZC 3NOCD 2XZDG 3SBSA 4NRHB 1BI7B 4F6RD 3RRUA 2KC7A 4B94A 4APFA 3AG2E 3CVQA 3I5PA 5H7PA 1O1RA 3ONLA 4DRXE 4AOFA 4U07A 1Z3XA 4I2WA 1KPSB 4WNFA 4ANXA 2WXFA 3ABME 2PNNA 5ENSD 4ANVA 4ANWA 2PL2A 4PDXA 4U8YD 4WWPA 4EQFA 2B6CA 3L16A 4R7LA 1MQSA 2LXLA 1WAO1 2VQ2A 2XPZA 3S7BA 3JQ0A 4GAAA 2V8SE 2Y69E 4F3VA 5FIOA 3CEQA 3Q7FA 4GZDA 3D9MA 3DXKG 3EUVA 4GCNA 2F0YA 1DCQA 2HO1A 2Y0BG 3CVLA 3CVPA 1ELRA 4GYWA 4L2LA 3E30A 2WXIA 3SI5A 1Z6TA 2BEDA 2J9QA 4A3TA 4O6FA 2WVIA 4IYPA 2V4LA 1HE8A 3R7RA 4KT6B 2YNQA 3GZ2A 4GPMA 4JXTA 3QOUA 4I9EA 2GRPB 3PRZA 4GA0A 4GZ5A 1FPPA 2DBAA 4F1SA 2LUHA 3IXEA 5AJDA 5LP0A 1N0QA 4DJAA 3PNLB 4GA1A 5KJLA 1HO8A 2XGOA 2EIJE 1ZBPA 4QQIA 5T3RA 1TN6A 3O4ZA 2JABA 3PDNA 3PZDA 1DC2A 3CVNA 3Q73A 4YDEA 3NBNB 3U4TA 3DSSA 3FU6A 3DPDA 1OCCE 4WWNA 3ZXSA 3RJVA 2ETCA 3UXGA 3FEYA 1IYGA 4GTOA 2C2LA 2P58C 3CSTA 4LG6A 4EBAA 2UWJG 5LX8A 3UI2A 1QYMA 2V5QC 1IKND 2WMOA 5DIZA 3FUIA 1AP7A 3DPYA 5CHEE 4A63B 4CGVA 5EX0A 5A6CA 1Y8MA 4B89A 4LCTA 5AARA 4LSZE 4DI4A 2BKGA 2XGSA 2J49A 2A5UA 3ZVVA 1K1AA 4FLHA 3D9JA 3ASNE 4JB8P 3D9OA 2Q7FA 4XI0A 3SFZA 3HXBA 3LKUA 3RO2A 3G2SA 3G2VA 2CHXA 3Q75A 4K03A 5D66A 3FTYA 5ARFA 2ZISA 5LOZA 3MV2B 4A55A 3R7QA 1PC2A 3CVXA 2MHKA 1S0PA 3B7BA 1D9SA 1H6KA 4OVVA 1E8YA 1TN7A 4BX8A 4BEPA
chains in the Genus database with same CATH topology
3C3OA 3C3RA 5CRUA 3R9MA 2OJQA 3UM3A 1ZB1A 3RAUA 2XS8A 2R05A 2R03A 2XS1A 2OEVA 2OEXA 3UM0A 3UM2A 3ULYA 2OEWA 3C3QA 4JIOA 2R02A 3UM1A 3ZXPA 5CRVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C3O A;  3C3R A;  5CRU A;  3R9M A;  3UM3 A;  1ZB1 A;  3RAU A;  2XS8 A;  2R05 A;  2R03 A;  2XS1 A;  2OEV A;  3UM0 A;  3UM2 A;  3ULY A;  2OEW A;  3C3Q A;  2R02 A;  3UM1 A;  3ZXP A;  5CRV A; 
#chains in the Genus database with same CATH topology
 2VSN A;  5BNW A;  4JHK A;  3LCA A;  3QAQ A;  3SO8 A;  4CCA A;  5ENN A;  4XZ4 A;  2FF4 A;  4GA2 A;  4HOT A;  5JHB A;  5HKP A;  4M7C A;  1TNY A;  3QB2 A;  2X6F A;  4V3I A;  2I9C A;  3B7S A;  4RSY A;  4MLP A;  2WM9 A;  3C5R A;  2R17 C;  1TNO A;  2H6I A;  4NIK A;  3SQV A;  3NQP A;  3RIB A;  1SQM A;  5FZS A;  3DEO A;  1QBQ A;  4I17 A;  5G04 C;  4BX9 A;  3PUK A;  3T5V A;  4HOU A;  3TL5 A;  3QDN A;  1JCS A;  1YYH A;  2WXN A;  2R5S A;  3PRE A;  5KJK A;  4MKT A;  3S7J A;  5HI7 A;  5EYP F;  1MJ0 A;  2VGE A;  4G2V A;  4U8V D;  3RAU A;  3ZGQ A;  3APD A;  3FTS A;  2IF4 A;  3DSV A;  4TV3 A;  2V0P A;  3OXF A;  2AW6 A;  4ABN A;  2WXP A;  2ILR A;  1LD8 A;  1WM5 A;  5KNH D;  2PM6 A;  1TNB A;  4UWG A;  4J8E A;  1E8X A;  4I1A A;  2BUG A;  3UPV A;  4GML A;  5BXO A;  3JXI A;  3D3M A;  3ZRH A;  3MCX A;  3TAX A;  3B13 A;  3KSL A;  2RG8 A;  3FUL A;  4UWK A;  5FTP A;  1VDY A;  4I1M A;  3CV0 A;  1NA0 A;  4HXI A;  1BU9 A;  3LVR E;  2P9U G;  4J0U A;  4GMR A;  3KSQ A;  4UI9 K;  4LEU A;  4U7E B;  4AXH A;  3MEK A;  3EHR A;  4GTT A;  5M72 A;  2ION A;  4KVO A;  4WNE A;  4HI8 A;  4GU5 A;  5CEA A;  3BU8 A;  4GMJ A;  4XEI G;  3VTY A;  1UN9 A;  3L82 A;  4JPS A;  1IQU A;  2L6J A;  3SBT B;  4HS2 A;  5CMY A;  3FDH A;  4CGW A;  3JCK C;  3TWV A;  1ZU2 A;  2AWI A;  3T5X A;  4YDO A;  1RZ4 A;  5LCW J;  1GW6 A;  3FTW A;  5AQA A;  3APF A;  5JJ7 A;  3TWU A;  1O5M A;  3SD5 A;  4FUL A;  3UT4 A;  3ZHE A;  2IO2 C;  5ANR A;  2LNI A;  1K3Z D;  2DZN A;  1IXV A;  4ZFH A;  3CVW A;  4TXP A;  2RFA A;  4EHM A;  1EF1 C;  2XRZ A;  3UKR G;  3URZ A;  3RKV A;  2V4H C;  1SZ9 A;  2GRM A;  1U3C A;  4TXR A;  2XS8 A;  1L5J A;  3AJI A;  1X5B A;  5D2M C;  5EYL A;  3EHN A;  3ENE A;  3PZ1 A;  3AG1 E;  5FQ6 A;  2WPV A;  4A1G A;  4EEC A;  3T9K A;  3IEG A;  3HRA A;  4E85 A;  1OWP A;  3TWW A;  4A1S A;  1MHQ A;  3EU9 A;  4UI9 C;  3D9L A;  4QFV A;  2KCK A;  3LY9 A;  4UQY A;  5KJN A;  2WXM A;  1N54 A;  2P2C P;  2OEW A;  3DEP A;  1TYQ G;  3L54 A;  1SA5 A;  2XHE A;  3TG5 A;  3E4B A;  2IU1 A;  3HVE B;  5A23 A;  1UN8 A;  4GTS A;  4O1P A;  3T8K A;  3QK0 A;  4BER A;  3U9W A;  2OEV A;  1HG5 A;  3EJN A;  4KZ0 A;  4HRM B;  1N95 A;  2XPY A;  2J07 A;  4HRN A;  1NFI E;  4I9C A;  3UIP C;  4UQX A;  2XZT G;  3GZS A;  4HBD A;  4XI9 A;  4I1O B;  2CHZ A;  5ENP D;  3VLF A;  3B7U X;  5G05 C;  1E7U A;  3VLE A;  4PH4 B;  4CZ2 D;  4HOQ A;  3PEV B;  4DI3 A;  2WQ6 A;  1UJK A;  2EIN E;  2L6B A;  3C3Q A;  5FT9 A;  3ZU7 B;  2NSZ A;  4CYM D;  3FTZ A;  4CRW A;  3J5Q B;  2WXJ A;  3NAW A;  4Y6C A;  2DCP A;  4HI9 A;  4OAU C;  3KEZ A;  4AJW A;  4RG6 A;  3ZIM A;  2WQH A;  5D0Q D;  1PY1 A;  2XCC A;  3TWS A;  3AAA C;  3FUK A;  1XGW A;  4HLE A;  2VSX E;  3JYS A;  4I6J A;  2KCL A;  4DX7 D;  5KNG A;  1DCE A;  3E33 A;  1Z3Y A;  3PE4 A;  3IBE A;  2Y4U A;  4FLB A;  4PS8 A;  1JCR A;  3FUD A;  3UM3 A;  2IEJ A;  5AQ9 A;  2XCB A;  3JQ1 A;  1DNP A;  4G8K A;  4FJZ A;  2X6I A;  4LRZ A;  3SF4 A;  2KZT B;  2LAI A;  1N4Q A;  4FHK A;  1FVH A;  2WXR A;  4AIF A;  4ILG A;  1KZP A;  3LVQ E;  5FWQ A;  3VTX A;  3CK8 A;  3K9I A;  4G25 A;  1LF8 A;  4GTR A;  4KMO A;  4YND A;  3CKB A;  1OWO A;  4X8Q A;  3WXX A;  2KM4 A;  4N5C A;  1KLX A;  1N9A A;  3DBS A;  3IHV A;  3DRA A;  2YIN A;  4HOS A;  2XPI A;  4GTV A;  1E96 B;  1SZA A;  3ZN3 A;  4I6E A;  3D9N A;  3FU0 A;  2VGX A;  5ANL A;  4KXK B;  3FUN A;  1DVP A;  3FU3 A;  2X38 A;  3LY8 A;  1S63 A;  2J4B A;  3CHS A;  2ETA A;  3L17 A;  1OXJ A;  3Q78 A;  2CFZ A;  4GPK A;  2WXO A;  1HZ4 A;  1XNF A;  1EPU A;  4FHJ A;  4N3B A;  3Q79 A;  3DSX A;  3I4G A;  2IOS A;  3BG0 B;  1IHG A;  3UX4 A;  4L23 A;  3PZ4 A;  1Q2Z A;  4N3A A;  1Z5S C;  3PZ2 A;  2WB2 A;  2VSO E;  4GZ3 A;  2F8X K;  3HXC A;  3FUH A;  3MX3 A;  4YVO A;  5JMN D;  3TXM A;  1TJC A;  2AXU A;  2H6G A;  4MBG A;  4GCO A;  3NZS A;  3SY2 A;  3ABL E;  5JJT A;  2P9N G;  4GZ6 A;  4CDR A;  2CG2 A;  1SA4 A;  3JUE A;  5EIL A;  5DBK A;  2QYU A;  3Q47 B;  3PUJ A;  5BV0 A;  3U66 A;  3ASH A;  2H6F A;  3QWV A;  2JLB A;  4HOR A;  3D9K A;  3B95 A;  4U0U A;  2LSU A;  5AYW D;  1IHB A;  4Y6W A;  4HRL A;  1MX6 A;  4WUY A;  2P9K G;  4TRQ A;  2MRI A;  3PZ3 A;  2GRR B;  4JZY A;  3OTN A;  1K8K G;  4J8Y A;  5FQ8 A;  3FU5 A;  3CKC A;  3CHQ A;  3SNX A;  2RD0 A;  1INZ A;  1V55 E;  4LER A;  1NL4 A;  5G04 J;  2AVP A;  3ASG A;  3S7D A;  1HS6 A;  5CRU A;  1FT1 A;  4KBQ A;  3ZUV B;  1QNF A;  3RRM B;  1KZO A;  4CT4 A;  3PS6 A;  3FP3 A;  3I4R B;  3HHM A;  4G24 A;  4L2Y A;  2PZI A;  2WXK A;  3MZL B;  2R03 A;  3V79 K;  2ZXW E;  4B0Z A;  4XE0 A;  2E2E A;  4CT0 A;  2WXH A;  1TEZ A;  2J8S D;  3ZKJ A;  4JD2 G;  2B0O E;  3R9A B;  5AN8 A;  1OT8 A;  2R59 A;  3ISM C;  3UTM A;  3FWV A;  4WAF A;  2FO7 A;  1YMP A;  3FEX A;  1HXI A;  3W9G A;  2DIW A;  5HQ8 A;  2RFM A;  3QWP A;  2XEE A;  3FUE A;  4JHR A;  4GYY A;  3Q9U C;  4DX6 D;  4U04 A;  3TJP A;  4K5B A;  4AY5 A;  2I2O A;  3R9M A;  3LJ3 A;  3LPZ A;  3ONK A;  2DYR E;  2J4D A;  4H7X A;  4K5C A;  2Y3A A;  1V54 E;  4BWR A;  1FVF A;  3CLJ A;  1OCR E;  2IFU A;  4RQI A;  2FEZ A;  2VYI A;  3U3W A;  3HDX A;  2DZO A;  3P1U A;  5EX3 A;  2P9L G;  4G11 A;  5CED B;  1UW4 B;  3C72 A;  5C2Y A;  4A3V A;  4TUU A;  3Q49 B;  2UY1 A;  4MRU A;  5T8I A;  1H2U A;  2IO3 C;  1N0R A;  1Y6I A;  3UM2 A;  4O60 A;  1U2V G;  2HM8 A;  2EIK E;  2OOE A;  3CQG B;  3UIN C;  2FO1 E;  3G2T A;  3AS5 A;  4I6G A;  3TWX A;  4EZK A;  1UJJ A;  5CCL A;  2QC9 A;  2X6K A;  1KT1 A;  5BT1 A;  3OXG A;  4GB9 A;  4ZHB A;  2PQN A;  4IN3 B;  3ULY A;  3V2O A;  5G2N A;  2X6H A;  2R02 A;  1JUQ A;  4MS6 A;  3EHQ A;  4TUM A;  2XRY A;  1W3B A;  4N5Q A;  4EZJ A;  4TXQ A;  5AQ7 A;  4LNU D;  1NP7 A;  3FUM A;  3RRN B;  4F53 A;  2M63 A;  5CMW A;  1U3D A;  2XGM A;  1KT0 A;  3ABK E;  1H6P A;  2CFU A;  1P5Q A;  2VTB B;  3CK9 A;  4FA6 A;  3ZEF A;  1OCZ E;  4EZL A;  3CHM A;  3CR3 A;  2X3M A;  4K5A B;  3CHO A;  3FTU A;  4L9P A;  4IRU A;  4XKC A;  4JL0 A;  4WND A;  4JA7 A;  3UM0 A;  5KBA A;  4UQZ A;  4ME2 A;  4JEH A;  3FTV A;  3D9I A;  4GTQ A;  1O1T A;  1JWG A;  2FUL A;  2A4Z A;  2Y1L E;  2LAH A;  3SGH A;  3ASO E;  4UI9 J;  4G26 A;  3T8M A;  4RVB A;  4U96 D;  3X2Q E;  3S7F A;  3FH5 A;  5IY5 E;  3DSW A;  5KJM A;  1SW6 A;  2I6H A;  2IJG X;  4B8A A;  1TR4 A;  4DK5 A;  5ENO D;  3DWL G;  2QYJ A;  4AM9 A;  2ZGG A;  1X81 A;  3B7R L;  5JJ6 A;  4JW1 A;  3IHY A;  4NAC A;  2X6J A;  4FJY A;  4BSX A;  2XS1 A;  4FAD A;  2WXL A;  3PH0 C;  3VLD A;  4YDY A;  3SFY A;  4I2Z A;  4BY6 A;  5AJL A;  3IKO B;  1FT2 A;  3G2W A;  5G05 J;  3UUX A;  4FC8 A;  4CDN A;  3TG4 A;  5CER B;  3F6Q A;  5FZR A;  2RKK A;  4Q94 A;  1ZB1 A;  4ATG A;  1LD7 A;  4U8H A;  5FQ4 A;  2C0L A;  1K1B A;  2AXV A;  4FU3 A;  3NF1 A;  2OVF A;  1E7V A;  2WXG A;  4AY6 A;  3D9H A;  5ARG A;  3ZFW A;  1FCH A;  5J08 A;  5E76 A;  3ZXP A;  5CCM A;  4AVX A;  5BPP A;  3OAW A;  5CBO A;  4UWL A;  3LDZ A;  2VJ8 A;  1JPL A;  4GTP A;  1NZN A;  4F7A A;  4OVU A;  2FBN A;  3DSU A;  5AIJ A;  5LFA A;  4CEM A;  4GYO A;  3JUI A;  4DX1 A;  3NZU A;  3EHM A;  1H19 A;  2NC9 A;  3ZNG A;  5EIB E;  5ITZ F;  1TJF A;  2OVB A;  1TNU A;  3MV3 B;  4C0E A;  4UWH A;  3APC A;  3B7T A;  3BG1 B;  3TWT A;  3RK6 A;  2IOL A;  4O1O A;  3L9T A;  5C1D A;  3CIA A;  2R05 A;  1G3N B;  3HXE A;  1D8D A;  2KCV A;  4DX2 A;  4APO A;  3ZW3 A;  5E75 A;  3ZYK A;  3HXD A;  2XEV A;  2OCC E;  2QZA A;  4UWF A;  3J5P A;  4BSZ B;  4XIF A;  3N71 A;  4ANU A;  3KEA A;  4W9R A;  3CGH A;  3CQC B;  2IY0 C;  4JEU A;  4DPR A;  3ESK A;  4FP7 A;  4HLL A;  2GRN B;  3L13 A;  4J8D A;  2WQ7 A;  2L0T B;  1PAQ A;  4C48 B;  3UMV A;  3AG4 E;  1IQR A;  2NXP A;  2EIM E;  5B3S E;  3E37 A;  4IUL A;  3ZHE B;  3RSE G;  3C98 A;  3TGO A;  3PE3 A;  3ML8 A;  5EDS A;  1E8Z A;  3QWW A;  1N11 A;  5CEC B;  4DLQ A;  2GW1 A;  4OYS A;  1MX4 A;  4PS7 A;  2L0I A;  4RLY A;  5A7D B;  3QAR A;  3AG3 E;  4UUC A;  2F37 A;  3Q4A B;  1JCQ A;  3UT8 A;  5EN5 D;  3SHF A;  4I43 A;  5EKQ D;  5FJY A;  4XX5 A;  3L6A A;  1UG3 A;  3LJN A;  3G2U A;  4U0S A;  2VGY A;  1NI1 A;  1OUV A;  2ZU6 B;  5CBN A;  3E34 A;  2XEH A;  2CG3 A;  2ZGD A;  3UM1 A;  2R2L A;  3P2B A;  4HB5 A;  5FIN A;  3I3N A;  1MYO A;  3FY4 A;  4HQD A;  5AEN A;  2P9P G;  3ZPJ A;  3HXF A;  3Q15 A;  5AQB A;  1N94 A;  4EBA G;  4BET A;  4G1T A;  4J8S A;  1YCS B;  3MKQ B;  1BI8 B;  3IV0 A;  2GRQ B;  3EU5 A;  4HNA D;  2MYO A;  3DST A;  1H2V C;  2XEN A;  3Q5M A;  4JVS A;  4F1P A;  2HR2 A;  3ZYL A;  4WNG A;  1BD8 A;  2ETB A;  4RG9 A;  3RO3 A;  2KXP C;  2Y4T A;  3BEE A;  4BTA A;  3CK7 A;  5KCM A;  4H7Y A;  4ILI A;  5JHA A;  4URK A;  2PM7 A;  2PQR A;  5BXU A;  4KYO B;  5FZQ A;  3BQO A;  5EID A;  3C3O A;  3EIJ A;  4DX5 D;  2P9I G;  1EDU A;  1H0A A;  1WDY A;  2DVW A;  4DLO A;  2FI7 A;  3CVV A;  2CHW A;  3Q7A A;  3FUJ A;  2WXQ A;  4HFG A;  4Q69 A;  4XKB A;  3MYV A;  3ASD A;  1HH8 A;  3HIZ A;  4BFR A;  3LY7 A;  2H6H A;  1A5E A;  2JEK A;  3FUF A;  2VTB A;  5BV1 A;  3UQ3 A;  1D8E A;  2A5E A;  4E6H A;  2DYS E;  1BPO A;  1NA3 A;  3OXL A;  4B93 B;  4Z68 A;  4D10 C;  2YQ8 A;  2I1K A;  3ZYM A;  3S2A A;  5ENQ D;  1HFA A;  5HS0 A;  4CDM A;  1OWN A;  5CRV A;  1OY3 D;  1SVX A;  1QZ2 A;  2YHE A;  3BUA A;  4HVB A;  3RU0 A;  1ELW A;  2LO6 A;  2OV8 A;  3UIO C;  2YHC A;  4N39 A;  1O1S A;  4NUR A;  4KZC A;  3CHR A;  4K0R A;  4AP2 A;  3LS8 A;  2IQC A;  4BTB A;  1AWC B;  3QJZ A;  3V30 A;  1OCO E;  1H6O A;  1UOH A;  3W9F A;  5G55 A;  3CVY A;  1QQE A;  2QFC A;  4J7W A;  2VGX B;  1WY6 A;  2XQ0 A;  3QC1 A;  4N2S A;  3GZ1 A;  1N4S A;  4YDW A;  5J90 A;  4J8F A;  5JA4 D;  4LUN U;  1ELK A;  2E0I A;  5BW8 C;  5HRY A;  4ACL A;  2AJA A;  1LTX A;  1YA0 A;  2HE0 A;  2BF0 X;  1EYH A;  3CSF A;  3HVE A;  4JA9 A;  1HX8 A;  1H2T C;  4J6I A;  3FHE A;  4Q96 A;  4JHJ A;  1BLX B;  3GYZ A;  5D0O D;  4B8C B;  3U64 A;  4DUI A;  4LNG A;  2LSV A;  4BES A;  2I1J A;  3CHP A;  1S70 B;  4GTM A;  3SFX A;  4U0Z A;  1N4R A;  2BKK B;  4N3C A;  5B1B E;  1MZC A;  2MOW A;  3ASF A;  3MJW A;  3KS2 A;  4U63 A;  3ESL A;  1HG2 A;  3L22 A;  4M3O A;  3E32 A;  3AU4 A;  2LXM A;  1JWF A;  4L7T A;  2V5F A;  1MX2 A;  4JC8 A;  3GW4 A;  3UT7 A;  3JXJ A;  1N4P A;  2F8Y A;  4OAV B;  3UKU G;  2HYZ A;  3EDT B;  3HYM B;  4C9B B;  2NYJ A;  5ENR D;  3V31 A;  5BUZ A;  4N2Q A;  1HF8 A;  2EIL E;  3FH8 A;  3PVL A;  2WMN A;  5FQ7 A;  3FH7 A;  3MA5 A;  3HG0 D;  4PS3 A;  3TWR A;  1N52 A;  4U95 D;  2BTD A;  1OWL A;  1RW2 A;  3V2X A;  3FTX A;  4G23 A;  5KWD A;  3ULE G;  2GGF A;  3LEW A;  4GZC A;  4BT8 A;  2KBX A;  3AU5 A;  3TXN A;  2OND A;  4PUC A;  2KZT A;  3MGB A;  4ATZ D;  3EIQ C;  4WWO A;  1B89 A;  4NQ0 A;  3O48 A;  5AAO A;  3KAE A;  3WG7 E;  5ENT D;  1OWM A;  3C3R A;  2P9S G;  3MKR A;  3AS8 A;  4P29 A;  1E90 A;  2KAT A;  2GRL A;  4KVM A;  2DWZ A;  1WG0 A;  3D9P A;  2ZIR A;  4AV7 A;  3QKY A;  3LYA A;  4C0M A;  3CVU A;  2J09 A;  5LCW C;  2J08 A;  3ML9 A;  3AS4 A;  2VSY A;  3Q9N C;  4LNB A;  5T4Y A;  3PNT B;  1A17 A;  5B1A E;  2EQX A;  3QNK A;  4YVQ C;  4EPZ A;  2GRO B;  1TNZ A;  4ACK A;  1TN8 A;  3LXU X;  1HU3 A;  3NOG D;  3KD7 A;  2UY1 B;  3DXM G;  3SZ7 A;  4ILH B;  2QY7 A;  3FFL A;  3NB2 A;  2L9B A;  3PEU B;  1E8W A;  3TWQ A;  4L1B A;  3ZYQ A;  4BT9 A;  3ULQ A;  3MKQ A;  3L08 A;  1S64 A;  2AXZ A;  2C0M A;  4G8L A;  4AEZ C;  3NOC D;  2XZD G;  3SBS A;  4NRH B;  1BI7 B;  4F6R D;  3RRU A;  2KC7 A;  4B94 A;  4APF A;  3AG2 E;  3CVQ A;  3I5P A;  5H7P A;  1O1R A;  3ONL A;  4DRX E;  4AOF A;  4U07 A;  1Z3X A;  4I2W A;  1KPS B;  4WNF A;  4ANX A;  2WXF A;  3ABM E;  2PNN A;  5ENS D;  4ANV A;  4ANW A;  2PL2 A;  4PDX A;  4U8Y D;  4WWP A;  4EQF A;  2B6C A;  3L16 A;  4R7L A;  1MQS A;  2LXL A;  1WAO 1;  2VQ2 A;  2XPZ A;  3S7B A;  3JQ0 A;  4GAA A;  2V8S E;  2Y69 E;  4F3V A;  5FIO A;  3CEQ A;  3Q7F A;  4GZD A;  3D9M A;  3DXK G;  3EUV A;  4GCN A;  2F0Y A;  1DCQ A;  2HO1 A;  2Y0B G;  3CVL A;  3CVP A;  1ELR A;  4GYW A;  4L2L A;  3E30 A;  2WXI A;  3SI5 A;  1Z6T A;  2BED A;  2J9Q A;  4A3T A;  4O6F A;  2WVI A;  4IYP A;  2V4L A;  1HE8 A;  3R7R A;  4KT6 B;  2YNQ A;  3GZ2 A;  4GPM A;  4JXT A;  3QOU A;  4I9E A;  2GRP B;  3PRZ A;  4GA0 A;  4GZ5 A;  1FPP A;  2DBA A;  4F1S A;  2LUH A;  3IXE A;  5AJD A;  5LP0 A;  1N0Q A;  4DJA A;  3PNL B;  4GA1 A;  5KJL A;  1HO8 A;  2XGO A;  2EIJ E;  1ZBP A;  4QQI A;  5T3R A;  1TN6 A;  3O4Z A;  2JAB A;  3PDN A;  3PZD A;  1DC2 A;  3CVN A;  3Q73 A;  4YDE A;  3NBN B;  3U4T A;  3DSS A;  3FU6 A;  3DPD A;  1OCC E;  4WWN A;  3ZXS A;  3RJV A;  2ETC A;  3UXG A;  3FEY A;  1IYG A;  4GTO A;  2C2L A;  2P58 C;  3CST A;  4LG6 A;  4EBA A;  2UWJ G;  5LX8 A;  3UI2 A;  1QYM A;  2V5Q C;  1IKN D;  2WMO A;  5DIZ A;  3FUI A;  1AP7 A;  3DPY A;  5CHE E;  4A63 B;  4CGV A;  5EX0 A;  5A6C A;  1Y8M A;  4B89 A;  4LCT A;  5AAR A;  4LSZ E;  4DI4 A;  2BKG A;  2XGS A;  2J49 A;  2A5U A;  3ZVV A;  1K1A A;  4FLH A;  3D9J A;  3ASN E;  4JB8 P;  3D9O A;  2Q7F A;  4XI0 A;  3SFZ A;  3HXB A;  3LKU A;  3RO2 A;  3G2S A;  3G2V A;  2CHX A;  3Q75 A;  4K03 A;  5D66 A;  3FTY A;  5ARF A;  2ZIS A;  5LOZ A;  3MV2 B;  4A55 A;  3R7Q A;  1PC2 A;  3CVX A;  2MHK A;  1S0P A;  3B7B A;  1D9S A;  1H6K A;  4OVV A;  1E8Y A;  1TN7 A;  4BX8 A;  4BEP A; 
#chains in the Genus database with same CATH homology
 3C3O A;  3C3R A;  5CRU A;  3R9M A;  2OJQ A;  3UM3 A;  1ZB1 A;  3RAU A;  2XS8 A;  2R05 A;  2R03 A;  2XS1 A;  2OEV A;  2OEX A;  3UM0 A;  3UM2 A;  3ULY A;  2OEW A;  3C3Q A;  4JIO A;  2R02 A;  3UM1 A;  3ZXP A;  5CRV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...