4B8CB

Nuclease module of the yeast ccr4-not complex
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
233
structure length
233
Chain Sequence
QEMIPLKFFAVDEVSCQINQEGAPKDVVEKVLFVLNNVTLANLNNKVDELKKSLTPNYFSWFSTYLVTQRAKTEPNYHDLYSKVIVAMGSGLLHQFMVNVTLRQLFVLLSTKDEQAIDKKHLKNLASWLGCITLALNKPIKHKNIAFREMLIEAYKENRLEIVVPFVTKILQRASESKIFKPPNPWTVGILKLLIELNEKANWKLSLTFEVEVLLKSFNLTTKSLKPSNFINT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POLY(A) RIBONUCLEASE POP2
publication title Architecture of the Nuclease Module of the Yeast Ccr4-not Complex: The not1-Caf1-Ccr4 Interaction.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/cell cycle
total genus 80
structure length 233
sequence length 233
chains with identical sequence G, H, I
ec nomenclature
pdb deposition date 2012-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16415 CNOT1_CAF1_bind CCR4-NOT transcription complex subunit 1 CAF1-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4b8cB00
1UW4B 2I2OA 1H6KA 4IULA 4CEMA 3D3MA 2KZTA 3RK6A 4CT4A 1N52A 2GGFA 4C9BB 2NSZA 4LUNU 5ANRA 2IONA 2VSOE 2KZTB 1HU3A 3EIQC 2FULA 4JHJA 1H2VC 3FEXA 3JUIA 2IOSA 2ZU6B 4B8AA 2IU1A 4B8CB 4B89A 1N54A 2HM8A 1H2TC 4JHKA 2RG8A 4GMLA 2VSXE 4CRWA 2IOLA 3EIJA 3FEYA 1PAQA 1UG3A 1H2UA 4GMJA 3L6AA
chains in the Genus database with same CATH superfamily
4ANWA 5CMWA 3KEZA 5ENTD 1W3BA 4F6RD 2HR2A 1H6OA 2EQXA 4I9EA 4RSYA 3ASNE 3ZVVA 3FUEA 2J9QA 1JCSA 1X81A 4E85A 4U96D 2XEEA 4U8YD 5EILA 3L16A 2P9NG 3LYAA 4GZ6A 4Z68A 5AARA 1BU9A 3L82A 2HO1A 1H0AA 2WXFA 3VLEA 3FU5A 1QYMA 3NBNB 4HBDA 4L2YA 2OOEA 1H19A 4K03A 3L54A 1XGWA 1U3DA 3DSWA 4KYOB 1LD8A 4G24A 3JUIA 2AXUA 1NA0A 5FQ6A 3QWWA 2EINE 1WY6A 3T5VA 3QNKA 1O1RA 3AS8A 4JA9A 1ZU2A 2XCCA 3V31A 1SQMA 2XZDG 3E34A 2VQ2A 2WXNA 1X5BA 3AG2E 4KVOA 5AQBA 3CSTA 3CKBA 3FUHA 2EIKE 5B1AE 4JHRA 3S7JA 3UXGA 3AAAC 2WQ6A 1MX6A 4OAVB 4LRZA 4U63A 2RFMA 1D9SA 4B8AA 3UMVA 4B93B 3KS2A 1JUQA 5ENQD 2XEHA 5FIOA 1OCZE 4DX2A 3LY8A 1U2VG 2ETCA 5DBKA 3PEVB 4I1AA 4ANVA 4AOFA 4Y6CA 4GCNA 1FVFA 4BSZB 4GYOA 4N3CA 4NQ0A 3CHRA 4N39A 2WXPA 5LX8A 2VSOE 5IY5E 4XZ4A 3LKUA 3DXMG 2YHEA 2DWZA 5E76A 3MCXA 1Z5SC 3CHSA 4PS8A 4GB9A 5ENRD 5HS0A 1OXJA 3UM3A 1FCHA 4JHJA 3ZFWA 3QKYA 3ABME 3CR3A 3S7FA 4AP2A 3AG4E 5JJTA 3SO8A 2WPVA 1OWMA 3UI2A 2BF0X 1K1BA 1DCEA 3JUEA 4WNGA 1ZBPA 2XS1A 3FTUA 4DX5D 3Q79A 4BX8A 2LXLA 4URKA 4Q69A 1N9AA 2GROB 2GW1A 1E7VA 1HS6A 3SFYA 3I3NA 3PS6A 2R17C 2AVPA 1OY3D 1IXVA 1HXIA 3ZYQA 3HVEA 4I9CA 4AY6A 3FEYA 4IRUA 5CBNA 4UWGA 1H6KA 1XNFA 4U0ZA 2MHKA 2ETAA 4HOQA 3CVPA 3ZXPA 3LJNA 1UOHA 2ZGGA 5LOZA 2HE0A 2B6CA 4ILGA 4JB8P 3ML9A 5EYLA 4I43A 2IF4A 4U04A 4L7TA 1UW4B 3PUJA 3GYZA 3FTVA 3RK6A 5FT9A 5LFAA 3DSTA 4RQIA 4DUIA 3EIQC 5H7PA 2P9IG 3PDNA 4GTRA 4GCOA 1HH8A 3PNTB 4DK5A 5CEAA 5JHBA 2RKKA 2X6FA 3HXFA 2VSYA 1V54E 1Y8MA 4J8FA 2I2OA 2WXHA 3ZYKA 2J09A 2Y0BG 2AWIA 4BSXA 1N0QA 3I5PA 3E32A 1TNUA 1SW6A 1RZ4A 5AQ9A 3QJZA 3RKVA 3J5PA 1OWOA 2EILE 1OCCE 1N54A 4XI0A 3HXDA 3TG5A 4CCAA 3T9KA 4GMLA 5AN8A 3TWVA 5T8IA 1DCQA 1HFAA 4JZYA 1GW6A 3D9HA 3FTWA 3Q78A 1UJKA 1TNZA 2J49A 3RO2A 3F6QA 1Y6IA 4U8VD 4I6JA 5FZSA 2E0IA 2H6HA 1Q2ZA 2BKGA 1WDYA 4AXHA 1NZNA 1TNOA 1N4QA 1UN8A 2EIME 3EHQA 3D3MA 3QAQA 2DVWA 3VLFA 3NOGD 3BG0B 3B7SA 1BPOA 3CIAA 5D2MC 2WXIA 3FU6A 4FHJA 2QC9A 1TNBA 1KT0A 4BWRA 4BESA 4JHKA 4GU5A 2AJAA 2VTBB 3FUMA 3PNLB 4MLPA 2XGOA 3MKQB 4OYSA 5FZRA 2PM6A 3FU0A 4U07A 5FWQA 4ILIA 2R59A 4HFGA 3G2TA 4KXKB 3DBSA 2FO1E 3FUJA 4DX1A 5HI7A 3DEPA 4BERA 2VJ8A 3Q49B 4EBAA 2FULA 4F53A 5BW8C 3CVXA 2J07A 3B7RL 1IYGA 4JW1A 3D9JA 1PAQA 4JPSA 2AXZA 3SD5A 3URZA 2WXLA 4DX6D 4UI9C 2M63A 2LAIA 3QC1A 4I1MA 3QARA 3UUXA 1G3NB 1S0PA 3CVLA 1YCSB 2V0PA 3L22A 2P2CP 3ML8A 3D9OA 2A5EA 3ABKE 3CQCB 4B0ZA 3UT4A 3FTSA 4ATZD 2VTBA 2IFUA 1QBQA 5D66A 2NC9A 3MKQA 4R7LA 5JMND 3ZIMA 4AIFA 3NF1A 3NQPA 4UI9K 3UX4A 1E8YA 4BX9A 4HOUA 2NXPA 4K5BA 5AYWD 3Q4AB 4BTBA 3ZPJA 4YVOA 3FULA 5KJLA 2XGMA 3HXBA 5FINA 1WM5A 4DPRA 3LVQE 3AU5A 4BT9A 2X6IA 4LCTA 2KATA 3SFXA 3JQ0A 3W9GA 3Q5MA 1IHGA 3CVUA 2H6FA 2JLBA 1B89A 2I9CA 1IHBA 1N52A 4J0UA 2A4ZA 2VGEA 3O48A 5E75A 1E7UA 1L5JA 4KMOA 1JWGA 4EPZA 2CG2A 1SZAA 4MS6A 3CGHA 3C3QA 3MJWA 4CT0A 3MZLB 5FQ4A 1MJ0A 4MKTA 3D9PA 2FBNA 5ENOD 3E37A 3WXXA 4RLYA 5JA4D 3ZNGA 2LUHA 3QB2A 1IKND 2GRQB 4Q94A 1EDUA 3R9AB 4ABNA 3D9KA 3NZUA 3SFZA 3ESKA 1FT2A 2YINA 3AU4A 3EHRA 4DRXE 3CK9A 3FP3A 3BUAA 3U9WA 5G04J 5A7DB 4L9PA 4M3OA 2P9LG 3EDTB 5BXOA 3CV0A 2V4LA 3WG7E 4CDMA 4ZFHA 3RO3A 4OAUC 3DSUA 1HG5A 4KBQA 3ZKJA 2PNNA 3FUNA 4K5CA 4L23A 1ELRA 1NFIE 2XS8A 5CERB 4HOSA 3UPVA 2I6HA 1TN7A 4ZHBA 2ZXWE 2LXMA 2I1JA 3PZDA 3B7UX 4F1PA 4BTAA 3SZ7A 2XPIA 4U95D 1S70B 2XPYA 3Q7AA 3ASOE 4HXIA 4MBGA 2XGSA 3ONLA 2XZTG 3R7QA 5BUZA 1FT1A 3ZN3A 4A3VA 3Q15A 3QWPA 2PL2A 3MA5A 5EYPF 4U0SA 2AW6A 4GAAA 4TXPA 1SA4A 2P9KG 2WMOA 4NIKA 3DSXA 3MGBA 2Y3AA 3NB2A 1NI1A 2C2LA 3T5XA 3SNXA 4CEMA 2JEKA 3ZW3A 3CEQA 4FU3A 2WQHA 5BPPA 3FWVA 3TWXA 4G2VA 3LPZA 3X2QE 3S2AA 4I2ZA 5ARFA 4W9RA 4TV3A 5KNGA 4HLEA 5EDSA 3UTMA 5LCWJ 2ETBA 2F37A 1HE8A 5FTPA 1PY1A 5ENSD 2DZOA 1JCRA 3S7BA 3TL5A 4N3BA 4WNEA 4JL0A 3UT7A 4A63B 2Y1LE 4LSZE 1FVHA 1TNYA 3TG4A 4IYPA 1MHQA 3FFLA 3BG1B 5G2NA 3HIZA 3CK7A 5HKPA 3CHMA 3CHQA 3QOUA 1RW2A 3HYMB 4L1BA 3G2WA 3U66A 4FJYA 3RU0A 3ZYLA 3T8MA 3ZHEB 1EF1C 3C72A 4J8DA 1JWFA 4PH4B 2R03A 3ULQA 2PQRA 1A5EA 2KBXA 4UQYA 4Y6WA 1VDYA 3ASGA 3KEAA 4HNAD 1SZ9A 2CHZA 2R5SA 4HORA 5CCMA 2MOWA 4GTSA 4EQFA 5G05C 2I1KA 3KSLA 3KAEA 2EIJE 3CKCA 3TWUA 2J08A 1A17A 1BLXB 1BD8A 3L6AA 3RJVA 4IULA 3L9TA 4GPKA 4C9BB 2F8YA 3JXJA 2OCCE 5KJNA 1K3ZD 2J4BA 2ZIRA 3PEUB 3CVWA 3E30A 3GW4A 4XKCA 5EX0A 4FJZA 4OVVA 3IEGA 3RAUA 3ZHEA 4AJWA 4DLQA 4I1OB 5JJ6A 3SF4A 5G05J 4JXTA 4YNDA 4HRLA 3MX3A 4WAFA 4TRQA 2BEDA 2J8SD 5ANLA 4GA0A 1BI7B 3ZUVB 5AJLA 5AQAA 3SI5A 4OVUA 3UT8A 1NL4A 3TWQA 1EPUA 4GTVA 3RSEG 3UQ3A 5KJKA 2DBAA 1UJJA 4N5CA 2WM9A 4F1SA 5ARGA 4NRHB 1ZB1A 1E96B 4EZKA 5CMYA 4FLBA 2X6HA 4L2LA 4ME2A 4CDRA 5AJDA 4WWPA 3R9MA 3DRAA 2FO7A 4LG6A 3NZSA 4HQDA 2KM4A 3JYSA 3B95A 3NOCD 4JC8A 3GZSA 1H2TC 1EYHA 1N94A 1S63A 3EJNA 4CZ2D 3Q7FA 5FZQA 1E8ZA 2WXJA 4GPMA 1E8XA 4I2WA 2IY0C 1OWLA 3B13A 2VYIA 2WXKA 3C3RA 3FEXA 2XRZA 4EZJA 1Z3XA 2IU1A 4O1OA 2GRNB 5T3RA 2QYUA 3LJ3A 4X8QA 4O1PA 4GYWA 3ASFA 5AENA 4BT8A 5B1BE 3LVRE 4WWNA 3CSFA 2C0LA 3ASDA 4N5QA 4GTMA 1MZCA 4O6FA 3VTYA 2GRMA 1QZ2A 1OUVA 4XE0A 4ACKA 4FC8A 5KWDA 1UG3A 2IO3C 4AM9A 2NYJA 4EZLA 2IEJA 4LUNU 3MV3B 3HXEA 2KZTB 3PE3A 1HU3A 2MRIA 3DXKG 1P5QA 2WVIA 4C48B 1D8DA 2X38A 2WB2A 3C5RA 5ENNA 2R05A 3TGOA 3LDZA 5J90A 2MYOA 3E33A 5JHAA 4UWKA 3L13A 3L17A 4AY5A 3ZYMA 1HX8A 2YHCA 3U4TA 4D10C 3LY7A 4DI4A 3AG1E 4I6EA 2BUGA 4KZCA 2C0MA 4XX5A 3ONKA 3PH0C 4J8SA 4NURA 1UN9A 4CT4A 4RG9A 1TYQG 1JPLA 4HVBA 3T8KA 4WWOA 1K8KG 3Q73A 4WUYA 3UM1A 2R02A 2X6KA 2HM8A 4APOA 4PDXA 2DYSE 3W9FA 4DLOA 3S7DA 1TJCA 4K0RA 2RD0A 3DWLG 3JXIA 4CGWA 2FF4A 2KZTA 2CHWA 4PS3A 2LSVA 5B3SE 4CYMD 5C2YA 4HOTA 2VGYA 2H6IA 1H2UA 2RFAA 3TWRA 4ANXA 2DCPA 4F3VA 4U7EB 3OAWA 4FULA 4XEIG 4N2SA 3FY4A 4C0EA 3ZEFA 1O5MA 3GZ2A 2X6JA 3P2BA 2UY1B 2DIWA 4YDYA 3D9NA 4UWLA 3PZ1A 3CVNA 3Q75A 3RRMB 5CRUA 3ZU7B 2ZISA 3ABLE 1MX4A 4G11A 2CHXA 3LS8A 4DJAA 1N95A 3CQGB 3FUFA 4A3TA 4J7WA 4DX7D 5G04C 3PE4A 5CECB 2IJGX 3OXFA 3PRZA 4HLLA 5ANRA 3FH7A 2F0YA 1O1SA 1WAO1 3APDA 2IQCA 3U64A 5AIJA 2L6BA 2HYZA 4EECA 2V8SE 3PVLA 3B7TA 3FTYA 2Y69E 2QFCA 3UIPC 3APCA 2YNQA 3FUDA 2GGFA 2AXVA 4YVQC 3HDXA 2UY1A 2L0IA 3APFA 3FHEA 4A1SA 3IHYA 5CRVA 3HRAA 4G26A 1DC2A 2XQ0A 4HB5A 5KBAA 4G23A 3BU8A 4EHMA 4FHKA 1TJFA 5D0QD 4JEHA 3UM0A 5ITZF 1ELKA 3UIOC 2QY7A 4J8YA 4G25A 3FDHA 3FTZA 4GTOA 3CVYA 5LP0A 3CK8A 4GZ5A 4HI8A 3OTNA 1H6PA 4JD2G 4BY6A 4KT6B 3PZ3A 3V2OA 2VSXE 1SA5A 3RIBA 4UQZA 4EBAG 5LCWC 2OV8A 3O4ZA 5EKQD 3DSVA 5BNWA 1OWNA 2L0TB 4N3AA 4ILHB 1DVPA 3SY2A 1KLXA 2XEVA 4B89A 4GMJA 3N71A 5BT1A 5BV1A 4WNFA 5HRYA 1YMPA 3ZRHA 1LD7A 4PS7A 2PM7A 4XIFA 2P58C 3ULYA 2UWJG 3MYVA 3BEEA 5ENPD 3TWTA 2QZAA 4CDNA 1LTXA 1SVXA 2LO6A 3SBSA 3CHOA 2XRYA 4BEPA 3TWWA 3TAXA 3KD7A 2WXMA 4O60A 1OWPA 3FU3A 2IOSA 4F7AA 2KCKA 2BKKB 2GRPB 1N4PA 5KJMA 5EX3A 3G2VA 3HVEB 2B0OE 3HHMA 5AAOA 2LAHA 1IQRA 2DYRE 4GYYA 3SQVA 3J5QB 2WXRA 5G55A 2YQ8A 4DI3A 3PZ4A 2RG8A 2V4HC 1S64A 2IOLA 2OEVA 1E8WA 2LNIA 2JABA 3UKUG 4TXRA 1OT8A 4PUCA 5T4YA 4MRUA 5BXUA 1WG0A 5J08A 4CRWA 3EHNA 1K1AA 4IN3B 3LCAA 2WXQA 4XKBA 2ZGDA 4A1GA 4B94A 1V55E 3ZXSA 3HXCA 3UINC 2XCBA 4QQIA 4J6IA 5KCMA 5CEDB 4LEUA 5EN5D 2XHEA 4B8CB 1N4SA 3IHVA 3CVVA 4LERA 2XENA 3OXGA 5A23A 3V30A 4GMRA 4YDEA 1TN6A 3TJPA 2F8XK 4QFVA 3JQ1A 4E6HA 3MKRA 4BETA 3D9MA 4UUCA 4TUUA 3QWVA 3C98A 4H7XA 2H6GA 1LF8A 2GRLA 4HRNA 2FEZA 2X3MA 3SGHA 2FI7A 5CBOA 2CG3A 2PQNA 4GTTA 1IQUA 3G2UA 3EHMA 1O1TA 2P9SG 4GTQA 2KC7A 1KZPA 3CLJA 4TUMA 3B7BA 4XI9A 3G2SA 3NAWA 2IONA 3LEWA 4BFRA 4G8LA 4LNBA 5AQ7A 4KVMA 4UWHA 5EIBE 4TXQA 4K5AB 1QNFA 3UM2A 4RVBA 4JA7A 4WNDA 3Q9NC 3AJIA 1HO8A 1N4RA 4FADA 3TXNA 3BQOA 3PREA 4NACA 2VSNA 2VGXB 1PC2A 4ANUA 4I6GA 2XPZA 3DPDA 3IBEA 5FQ8A 2P9UG 4AEZC 2L9BA 3MV2B 3Q47B 1E90A 2OVBA 2Y4UA 3FTXA 1DNPA 1N0RA 3LXUX 4UQXA 2KCLA 3D9IA 3C3OA 1MQSA 3DPYA 3IXEA 3P1UA 1YYHA 2Y4TA 4V3IA 4AV7A 2IO2C 1KT1A 3LY9A 3U3WA 5BV0A 3DSSA 3UKRG 3Q9UC 3EU9A 1ELWA 2ONDA 1Z3YA 3CHPA 1NA3A 1HG2A 1HZ4A 3ISMC 5C1DA 5FJYA 2WXOA 4FA6A 3D9LA 2CFUA 2WXGA 2J4DA 4YDOA 5A6CA 2CFZA 3V2XA 2VGXA 3CVQA 5HQ8A 4AVXA 3KSQA 4HI9A 2NSZA 3PUKA 3ASHA 4A55A 3FH8A 2LSUA 4GA2A 4H7YA 3V79K 5CCLA 1OCRE 3R7RA 3VTXA 4FLHA 4GA1A 1MX2A 1TEZA 4GZ3A 2WMNA 4U8HA 2Q7FA 3FUKA 2V5FA 3JCKC 2OEWA 2OVFA 4P29A 1KPSB 1AWCB 3IV0A 4GZCA 4ATGA 4G1TA 2ILRA 1H2VC 2KXPC 1TN8A 1MYOA 4HRMB 1HF8A 3EU5A 1BI8B 4G8KA 3TWSA 4JEUA 3ESLA 4ACLA 3I4GA 3SHFA 1YA0A 1TR4A 2A5UA 4N2QA 3ENEA 3FUIA 1KZOA 4Q96A 3DEOA 3ZGQA 2V5QC 3AS4A 1U3CA 1N11A 2BTDA 2GRRB 4APFA 5JJ7A 4J8EA 4KZ0A 4M7CA 4GTPA 3I4RB 4FP7A 5EIDA 1QQEA 2WQ7A 4UWFA 4C0MA 2ZU6B 3AG3E 4LNGA 5DIZA 1D8EA 1NP7A 3HG0D 5D0OD 3VLDA 2PZIA 1JCQA 1OCOE 4CGVA 4UI9J 3K9IA 4GZDA 4YDWA 3AS5A 3QK0A 1INZA 3SBTB 3OXLA 3E4BA 3IKOB 3GZ1A 4U0UA 1AP7A 2P9PG 2KCVA 3ULEG 3TXMA 2R2LA 4JVSA 3RRNB 2E2EA 4HS2A 1Z6TA 3MEKA 5FQ7A 2L6JA 4I17A 5CHEE 3EUVA 5KNHD 3L08A 4LNUD 4RG6A 5M72A 3PZ2A 3RRUA 3FH5A 2DZNA 3QDNA 1FPPA 3EIJA 2QYJA
chains in the Genus database with same CATH topology
3G2TA 4OVUA 4KXKB 3UT8A 3DBSA 2LO6A 4ANWA 5CMWA 3KEZA 1W3BA 3SBSA 3CHOA 3FUJA 2HR2A 2XRYA 1EPUA 5HI7A 2EQXA 4I9EA 4RSYA 2VJ8A 3UQ3A 3ZVVA 3FUEA 3Q49B 2J9QA 4EBAA 5KJKA 2DBAA 3TAXA 1UJJA 4N5CA 2WM9A 4F1SA 4E85A 2FULA 3KD7A 2WXMA 4NRHB 5ARGA 4F53A 5BW8C 1OWPA 3CVXA 3L16A 3FU3A 2IOSA 2J07A 4F7AA 1E96B 3LYAA 4EZKA 4GZ6A 2KCKA 3B7RL 1IYGA 4JW1A 2HO1A 1H0AA 5CMYA 2WXFA 3D9JA 3VLEA 5KJMA 5EX3A 1PAQA 3G2VA 3HVEB 2X6HA 4FLBA 4JPSA 2AXZA 4L2LA 4ME2A 3FU5A 3SD5A 4CDRA 5AJDA 3URZA 2WXLA 4UI9C 4WWPA 4L2YA 2M63A 3HHMA 2LAHA 1IQRA 1H19A 2LAIA 2OOEA 4K03A 3QC1A 4I1MA 4GYYA 2FO7A 3L54A 1XGWA 3QARA 1U3DA 3NZSA 3UUXA 4KYOB 1S0PA 2KM4A 3CVLA 3JYSA 2WXRA 2V0PA 4G24A 5G55A 3JUIA 2AXUA 3L22A 1NA0A 5FQ6A 4JC8A 2YQ8A 3ML8A 3QWWA 3D9OA 4DI3A 1WY6A 3GZSA 3T5VA 1H2TC 3QNKA 3CQCB 3AS8A 4B0ZA 1EYHA 2RG8A 2XCCA 1ZU2A 3FTSA 2IFUA 3EJNA 4JA9A 3UT4A 2IOLA 2VTBA 1SQMA 1E8WA 2LNIA 2VQ2A 5FZQA 2NC9A 3MKQA 2WXNA 1X5BA 4R7LA 1E8ZA 2WXJA 4KVOA 3ZIMA 1E8XA 4AIFA 3NF1A 4I2WA 3CSTA 3NQPA 4PUCA 4UI9K 3UX4A 1OWLA 3B13A 3CKBA 2VYIA 2WXKA 1E8YA 3FEXA 3FUHA 5T4YA 4HOUA 4BX9A 2XRZA 4MRUA 2NXPA 1Z3XA 4EZJA 5AYWD 2IU1A 4JHRA 3S7JA 3Q4AB 4BTBA 5T3RA 4YVOA 3FULA 3ZPJA 5J08A 5KJLA 2XGMA 3LJ3A 4CRWA 4GYWA 3EHNA 4IN3B 3LCAA 2WXQA 3ASFA 5AENA 2WQ6A 4LRZA 4BT8A 4XKBA 1WM5A 3LVRE 4A1GA 4DPRA 3LVQE 4B94A 4WWNA 3AU5A 3CSFA 4BT9A 3ZXSA 4U63A 2X6IA 4LCTA 2C0LA 2KATA 2XCBA 3ASDA 4J6IA 5KCMA 3JQ0A 4B8AA 4O6FA 4LEUA 2XHEA 3Q5MA 1IHGA 1QZ2A 2GRMA 3UMVA 3VTYA 4B8CB 3CVUA 1OUVA 4XE0A 3KS2A 3IHVA 1JUQA 4FC8A 4ACKA 2JLBA 1B89A 1UG3A 3CVVA 4LERA 2I9CA 4AM9A 3OXGA 5A23A 4EZLA 1N52A 3LY8A 4LUNU 3MV3B 4J0UA 5DBKA 2KZTB 3PE3A 3TJPA 1HU3A 3PEVB 4I1AA 4ANVA 4AOFA 4Y6CA 2A4ZA 3O48A 5E75A 2MRIA 1E7UA 4GCNA 1FVFA 1P5QA 1L5JA 4GYOA 4KMOA 2WVIA 1JWGA 4QFVA 4EPZA 2CG2A 1SZAA 4MS6A 3CGHA 3MJWA 3JQ1A 4CT0A 4N3CA 3MZLB 4NQ0A 3CHRA 4E6HA 5FQ4A 3MKRA 3D9MA 4TUUA 4MKTA 3D9PA 2X38A 4N39A 3QWVA 2WB2A 2FBNA 3C98A 5ENNA 3TGOA 4H7XA 2WXPA 3WXXA 5LX8A 3LDZA 5J90A 1LF8A 2VSOE 2GRLA 5JHAA 4XZ4A 3LKUA 3L13A 4UWKA 3L17A 3QB2A 4AY5A 4Q94A 2FEZA 2YHEA 2X3MA 3ZYMA 1HX8A 5E76A 3SGHA 1EDUA 2FI7A 3R9AB 2CG3A 2PQNA 4ABNA 2YHCA 3D9KA 3MCXA 3U4TA 4D10C 3LY7A 3NZUA 3CHSA 4DI4A 4I6EA 3SFZA 1IQUA 2BUGA 3ESKA 3G2UA 4KZCA 3EHMA 2C0MA 4PS8A 4XX5A 3ONKA 2YINA 4GB9A 3PH0C 4J8SA 3AU4A 4NURA 1UN9A 2KC7A 4CT4A 4XI9A 3CLJA 3CK9A 3FP3A 3G2SA 4RG9A 2IONA 3LEWA 1JPLA 4BFRA 4HVBA 1FCHA 3U9WA 4WWOA 4JHJA 5G04J 5A7DB 4KVMA 4UWHA 4WUYA 3ZFWA 3QKYA 4M3OA 1QNFA 2X6KA 2HM8A 4APOA 4PDXA 4RVBA 4DLOA 4JA7A 3S7DA 3CR3A 3S7FA 1TJCA 4K0RA 3EDTB 4WNDA 3CV0A 2RD0A 4AP2A 1HO8A 2V4LA 4FADA 3TXNA 4CDMA 5JJTA 3PREA 3RO3A 4NACA 2WPVA 4CGWA 2FF4A 2KZTA 1OWMA 2CHWA 2VSNA 2VGXB 1PC2A 4PS3A 4ANUA 1HG5A 4KBQA 2BF0X 4I6GA 2XPZA 3DPDA 3FUNA 2LSVA 3IBEA 5FQ8A 4AEZC 4L23A 1ELRA 2L9BA 4WNGA 1ZBPA 5C2YA 4HOSA 4HOTA 2VGYA 3MV2B 3FTUA 3UPVA 2I6HA 3Q47B 4BX8A 1E90A 1H2UA 2I1JA 4ANXA 2DCPA 2OVBA 2Y4UA 3PZDA 3B7UX 3FTXA 1DNPA 3LXUX 4F3VA 4URKA 4Q69A 4UQXA 2GW1A 2KCLA 1E7VA 4BTAA 3D9IA 1HS6A 3SZ7A 3OAWA 4FULA 3I3NA 2XPIA 1MQSA 4N2SA 3FY4A 3PS6A 2R17C 3P1UA 2XPYA 4C0EA 2AVPA 3ZEFA 3GZ2A 2X6JA 2Y4TA 1HXIA 3ZYQA 3P2BA 3HVEA 4I9CA 4HXIA 4AY6A 4V3IA 2UY1B 4AV7A 3FEYA 2DIWA 4IRUA 2XGSA 1KT1A 3LY9A 3U3WA 3ONLA 3R7QA 3D9NA 4UWGA 5BV0A 4UWLA 1H6KA 5BUZA 3ZN3A 3CVNA 1XNFA 4U0ZA 4A3VA 3Q15A 3RRMB 3QWPA 2PL2A 3MA5A 2MHKA 1ELWA 2ONDA 1Z3YA 3CHPA 4G11A 2CHXA 3LS8A 4HOQA 1NA3A 1HG2A 4U0SA 3CVPA 2AW6A 4GAAA 1HZ4A 5C1DA 5FJYA 4DJAA 2WXOA 4FA6A 3D9LA 2WMOA 5LOZA 2CFUA 3CQGB 2WXGA 3FUFA 4A3TA 5G04C 2J4DA 4ILGA 3ML9A 3PE4A 5A6CA 4I43A 2CFZA 2IF4A 2Y3AA 3MGBA 4U04A 4L7TA 1UW4B 2VGXA 2IJGX 3GYZA 3PUJA 2C2LA 3CVQA 3FTVA 3SNXA 3T5XA 4CEMA 5HQ8A 3OXFA 3RK6A 2JEKA 4AVXA 5FT9A 3ZW3A 5LFAA 2NSZA 3PRZA 3PUKA 5ANRA 3ASHA 3FH7A 4A55A 3CEQA 4FU3A 3FH8A 3EIQC 2LSUA 2WQHA 3PDNA 1WAO1 3FWVA 4GA2A 4G2VA 3LPZA 5BPPA 3S2AA 4GCOA 4I2ZA 1HH8A 3APDA 5ARFA 2IQCA 3PNTB 4H7YA 4W9RA 4TV3A 3U64A 4DK5A 5AIJA 3R7RA 5CCLA 5JHBA 4HLEA 2HYZA 2X6FA 3VTXA 2V8SE 4EECA 5EDSA 5LCWJ 4FLHA 3PVLA 2VSYA 3B7TA 4GA1A 1TEZA 4GZ3A 2WMNA 3FTYA 1Y8MA 2QFCA 4U8HA 4J8FA 2Q7FA 3FUKA 1HE8A 2V5FA 2I2OA 3APCA 3JCKC 5FTPA 2YNQA 3FUDA 2OVFA 1PY1A 2WXHA 4P29A 3S7BA 2GGFA 3ZYKA 3TL5A 3IV0A 4GZCA 2J09A 4ATGA 4N3BA 4WNEA 4JL0A 3UT7A 2AXVA 4G1TA 2ILRA 4YVQC 1H2VC 2AWIA 1FVHA 3TG4A 3HDXA 2UY1A 4IYPA 4BSXA 1MHQA 2L0IA 3APFA 3FFLA 1HF8A 3FHEA 4A1SA 3BG1B 5G2NA 3HIZA 3CK7A 4JEUA 3IHYA 3I5PA 3ESLA 3CHMA 3CHQA 4ACLA 3QOUA 4G26A 3I4GA 2XQ0A 3HYMB 4L1BA 3SHFA 1YA0A 3G2WA 3U66A 4FJYA 3RU0A 3ZYLA 3T8MA 2A5UA 3ZHEB 1EF1C 4N2QA 3ENEA 3RKVA 3QJZA 4J8DA 3FUIA 1OWOA 1JWFA 4Q96A 4G23A 4PH4B 3ZGQA 3AS4A 3ULQA 4FHKA 1U3CA 2BTDA 2PQRA 1TJFA 5D0QD 4UQYA 4JEHA 1N54A 4XI0A 3TG5A 1ELKA 4CCAA 4Y6WA 4GMLA 5T8IA 1VDYA 3ASGA 4APFA 1HFAA 1SZ9A 2CHZA 2R5SA 4JZYA 4J8EA 4KZ0A 5JJ7A 2QY7A 4HORA 3I4RB 5CCMA 4FP7A 1GW6A 3FTWA 1QQEA 4G25A 1UJKA 2WQ7A 2MOWA 3FDHA 4EQFA 3FTZA 2I1KA 5G05C 4UWFA 3CVYA 2J49A 3KAEA 4C0MA 2ZU6B 3RO2A 5LP0A 3CKCA 5DIZA 1Y6IA 1NP7A 3CK8A 4GZ5A 5D0OD 3OTNA 3VLDA 4BY6A 4KT6B 4I6JA 2PZIA 2E0IA 2J08A 1A17A 2VSXE 5FZSA 3RIBA 4UQZA 4CGVA 4AXHA 4EBAG 4UI9J 3L6AA 5LCWC 3RJVA 1NZNA 2OV8A 1UN8A 4IULA 3K9IA 3O4ZA 4GZDA 3D3MA 4GPKA 3QAQA 5EKQD 3AS5A 3QK0A 4C9BB 3VLFA 5BNWA 1OWNA 1INZA 3BG0B 3B7SA 2L0TB 1BPOA 4N3AA 3SBTB 3CIAA 4ILHB 5KJNA 3OXLA 2J4BA 1DVPA 2WXIA 3E4BA 3FU6A 3PEUB 3CVWA 1KLXA 4FHJA 2XEVA 1KT0A 4B89A 4BWRA 3GW4A 4XKCA 5EX0A 3IKOB 3GZ1A 4JHKA 4FJZA 4OVVA 4GU5A 4GMJA 3IEGA 4U0UA 3N71A 2KCVA 5BT1A 3ZHEA 4AJWA 4DLQA 5BV1A 2VTBB 4WNFA 3TXMA 3ZRHA 3FUMA 3PNLB 4I1OB 4MLPA 4JVSA 4PS7A 5JJ6A 3SF4A 3RRNB 2PM7A 2XGOA 2E2EA 3MKQB 4HS2A 4XIFA 1Z6TA 3MEKA 4OYSA 2P58C 5G05J 5FQ7A 4JXTA 2L6JA 4I17A 5FZRA 2PM6A 3FU0A 5CHEE 4YNDA 2UWJG 3L08A 3MX3A 4WAFA 3MYVA 4RG6A 4TRQA 3BEEA 4U07A 5FWQA 5M72A 5ANLA 4GA0A 4ILIA 3RRUA 3FH5A 3QDNA 4CDNA 2R59A 5AJLA 3EIJA 3SI5A 4HFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UW4 B;  2I2O A;  1H6K A;  4IUL A;  4CEM A;  3D3M A;  2KZT A;  3RK6 A;  4CT4 A;  1N52 A;  2GGF A;  4C9B B;  2NSZ A;  4LUN U;  5ANR A;  2ION A;  2VSO E;  2KZT B;  1HU3 A;  3EIQ C;  2FUL A;  4JHJ A;  1H2V C;  3FEX A;  3JUI A;  2IOS A;  2ZU6 B;  4B8A A;  2IU1 A;  4B8C B;  4B89 A;  1N54 A;  2HM8 A;  1H2T C;  4JHK A;  2RG8 A;  4GML A;  2VSX E;  4CRW A;  2IOL A;  3EIJ A;  3FEY A;  1PAQ A;  1UG3 A;  1H2U A;  4GMJ A;  3L6A A; 
#chains in the Genus database with same CATH topology
 4ANW A;  5CMW A;  3KEZ A;  5ENT D;  1W3B A;  4F6R D;  2HR2 A;  1H6O A;  2EQX A;  4I9E A;  4RSY A;  3ASN E;  3ZVV A;  3FUE A;  2J9Q A;  1JCS A;  1X81 A;  4E85 A;  4U96 D;  2XEE A;  4U8Y D;  5EIL A;  3L16 A;  2P9N G;  3LYA A;  4GZ6 A;  4Z68 A;  5AAR A;  1BU9 A;  3L82 A;  2HO1 A;  1H0A A;  2WXF A;  3VLE A;  3FU5 A;  1QYM A;  3NBN B;  4HBD A;  4L2Y A;  2OOE A;  1H19 A;  4K03 A;  3L54 A;  1XGW A;  1U3D A;  3DSW A;  4KYO B;  1LD8 A;  4G24 A;  3JUI A;  2AXU A;  1NA0 A;  5FQ6 A;  3QWW A;  2EIN E;  1WY6 A;  3T5V A;  3QNK A;  1O1R A;  3AS8 A;  4JA9 A;  1ZU2 A;  2XCC A;  3V31 A;  1SQM A;  2XZD G;  3E34 A;  2VQ2 A;  2WXN A;  1X5B A;  3AG2 E;  4KVO A;  5AQB A;  3CST A;  3CKB A;  3FUH A;  2EIK E;  5B1A E;  4JHR A;  3S7J A;  3UXG A;  3AAA C;  2WQ6 A;  1MX6 A;  4OAV B;  4LRZ A;  4U63 A;  2RFM A;  1D9S A;  4B8A A;  3UMV A;  4B93 B;  3KS2 A;  1JUQ A;  5ENQ D;  2XEH A;  5FIO A;  1OCZ E;  4DX2 A;  3LY8 A;  1U2V G;  2ETC A;  5DBK A;  3PEV B;  4I1A A;  4ANV A;  4AOF A;  4Y6C A;  4GCN A;  1FVF A;  4BSZ B;  4GYO A;  4N3C A;  4NQ0 A;  3CHR A;  4N39 A;  2WXP A;  5LX8 A;  2VSO E;  5IY5 E;  4XZ4 A;  3LKU A;  3DXM G;  2YHE A;  2DWZ A;  5E76 A;  3MCX A;  1Z5S C;  3CHS A;  4PS8 A;  4GB9 A;  5ENR D;  5HS0 A;  1OXJ A;  3UM3 A;  1FCH A;  4JHJ A;  3ZFW A;  3QKY A;  3ABM E;  3CR3 A;  3S7F A;  4AP2 A;  3AG4 E;  5JJT A;  3SO8 A;  2WPV A;  1OWM A;  3UI2 A;  2BF0 X;  1K1B A;  1DCE A;  3JUE A;  4WNG A;  1ZBP A;  2XS1 A;  3FTU A;  4DX5 D;  3Q79 A;  4BX8 A;  2LXL A;  4URK A;  4Q69 A;  1N9A A;  2GRO B;  2GW1 A;  1E7V A;  1HS6 A;  3SFY A;  3I3N A;  3PS6 A;  2R17 C;  2AVP A;  1OY3 D;  1IXV A;  1HXI A;  3ZYQ A;  3HVE A;  4I9C A;  4AY6 A;  3FEY A;  4IRU A;  5CBN A;  4UWG A;  1H6K A;  1XNF A;  4U0Z A;  2MHK A;  2ETA A;  4HOQ A;  3CVP A;  3ZXP A;  3LJN A;  1UOH A;  2ZGG A;  5LOZ A;  2HE0 A;  2B6C A;  4ILG A;  4JB8 P;  3ML9 A;  5EYL A;  4I43 A;  2IF4 A;  4U04 A;  4L7T A;  1UW4 B;  3PUJ A;  3GYZ A;  3FTV A;  3RK6 A;  5FT9 A;  5LFA A;  3DST A;  4RQI A;  4DUI A;  3EIQ C;  5H7P A;  2P9I G;  3PDN A;  4GTR A;  4GCO A;  1HH8 A;  3PNT B;  4DK5 A;  5CEA A;  5JHB A;  2RKK A;  2X6F A;  3HXF A;  2VSY A;  1V54 E;  1Y8M A;  4J8F A;  2I2O A;  2WXH A;  3ZYK A;  2J09 A;  2Y0B G;  2AWI A;  4BSX A;  1N0Q A;  3I5P A;  3E32 A;  1TNU A;  1SW6 A;  1RZ4 A;  5AQ9 A;  3QJZ A;  3RKV A;  3J5P A;  1OWO A;  2EIL E;  1OCC E;  1N54 A;  4XI0 A;  3HXD A;  3TG5 A;  4CCA A;  3T9K A;  4GML A;  5AN8 A;  3TWV A;  5T8I A;  1DCQ A;  1HFA A;  4JZY A;  1GW6 A;  3D9H A;  3FTW A;  3Q78 A;  1UJK A;  1TNZ A;  2J49 A;  3RO2 A;  3F6Q A;  1Y6I A;  4U8V D;  4I6J A;  5FZS A;  2E0I A;  2H6H A;  1Q2Z A;  2BKG A;  1WDY A;  4AXH A;  1NZN A;  1TNO A;  1N4Q A;  1UN8 A;  2EIM E;  3EHQ A;  3D3M A;  3QAQ A;  2DVW A;  3VLF A;  3NOG D;  3BG0 B;  3B7S A;  1BPO A;  3CIA A;  5D2M C;  2WXI A;  3FU6 A;  4FHJ A;  2QC9 A;  1TNB A;  1KT0 A;  4BWR A;  4BES A;  4JHK A;  4GU5 A;  2AJA A;  2VTB B;  3FUM A;  3PNL B;  4MLP A;  2XGO A;  3MKQ B;  4OYS A;  5FZR A;  2PM6 A;  3FU0 A;  4U07 A;  5FWQ A;  4ILI A;  2R59 A;  4HFG A;  3G2T A;  4KXK B;  3DBS A;  2FO1 E;  3FUJ A;  4DX1 A;  5HI7 A;  3DEP A;  4BER A;  2VJ8 A;  3Q49 B;  4EBA A;  2FUL A;  4F53 A;  5BW8 C;  3CVX A;  2J07 A;  3B7R L;  1IYG A;  4JW1 A;  3D9J A;  1PAQ A;  4JPS A;  2AXZ A;  3SD5 A;  3URZ A;  2WXL A;  4DX6 D;  4UI9 C;  2M63 A;  2LAI A;  3QC1 A;  4I1M A;  3QAR A;  3UUX A;  1G3N B;  1S0P A;  3CVL A;  1YCS B;  2V0P A;  3L22 A;  2P2C P;  3ML8 A;  3D9O A;  2A5E A;  3ABK E;  3CQC B;  4B0Z A;  3UT4 A;  3FTS A;  4ATZ D;  2VTB A;  2IFU A;  1QBQ A;  5D66 A;  2NC9 A;  3MKQ A;  4R7L A;  5JMN D;  3ZIM A;  4AIF A;  3NF1 A;  3NQP A;  4UI9 K;  3UX4 A;  1E8Y A;  4BX9 A;  4HOU A;  2NXP A;  4K5B A;  5AYW D;  3Q4A B;  4BTB A;  3ZPJ A;  4YVO A;  3FUL A;  5KJL A;  2XGM A;  3HXB A;  5FIN A;  1WM5 A;  4DPR A;  3LVQ E;  3AU5 A;  4BT9 A;  2X6I A;  4LCT A;  2KAT A;  3SFX A;  3JQ0 A;  3W9G A;  3Q5M A;  1IHG A;  3CVU A;  2H6F A;  2JLB A;  1B89 A;  2I9C A;  1IHB A;  1N52 A;  4J0U A;  2A4Z A;  2VGE A;  3O48 A;  5E75 A;  1E7U A;  1L5J A;  4KMO A;  1JWG A;  4EPZ A;  2CG2 A;  1SZA A;  4MS6 A;  3CGH A;  3C3Q A;  3MJW A;  4CT0 A;  3MZL B;  5FQ4 A;  1MJ0 A;  4MKT A;  3D9P A;  2FBN A;  5ENO D;  3E37 A;  3WXX A;  4RLY A;  5JA4 D;  3ZNG A;  2LUH A;  3QB2 A;  1IKN D;  2GRQ B;  4Q94 A;  1EDU A;  3R9A B;  4ABN A;  3D9K A;  3NZU A;  3SFZ A;  3ESK A;  1FT2 A;  2YIN A;  3AU4 A;  3EHR A;  4DRX E;  3CK9 A;  3FP3 A;  3BUA A;  3U9W A;  5G04 J;  5A7D B;  4L9P A;  4M3O A;  2P9L G;  3EDT B;  5BXO A;  3CV0 A;  2V4L A;  3WG7 E;  4CDM A;  4ZFH A;  3RO3 A;  4OAU C;  3DSU A;  1HG5 A;  4KBQ A;  3ZKJ A;  2PNN A;  3FUN A;  4K5C A;  4L23 A;  1ELR A;  1NFI E;  2XS8 A;  5CER B;  4HOS A;  3UPV A;  2I6H A;  1TN7 A;  4ZHB A;  2ZXW E;  2LXM A;  2I1J A;  3PZD A;  3B7U X;  4F1P A;  4BTA A;  3SZ7 A;  2XPI A;  4U95 D;  1S70 B;  2XPY A;  3Q7A A;  3ASO E;  4HXI A;  4MBG A;  2XGS A;  3ONL A;  2XZT G;  3R7Q A;  5BUZ A;  1FT1 A;  3ZN3 A;  4A3V A;  3Q15 A;  3QWP A;  2PL2 A;  3MA5 A;  5EYP F;  4U0S A;  2AW6 A;  4GAA A;  4TXP A;  1SA4 A;  2P9K G;  2WMO A;  4NIK A;  3DSX A;  3MGB A;  2Y3A A;  3NB2 A;  1NI1 A;  2C2L A;  3T5X A;  3SNX A;  4CEM A;  2JEK A;  3ZW3 A;  3CEQ A;  4FU3 A;  2WQH A;  5BPP A;  3FWV A;  3TWX A;  4G2V A;  3LPZ A;  3X2Q E;  3S2A A;  4I2Z A;  5ARF A;  4W9R A;  4TV3 A;  5KNG A;  4HLE A;  5EDS A;  3UTM A;  5LCW J;  2ETB A;  2F37 A;  1HE8 A;  5FTP A;  1PY1 A;  5ENS D;  2DZO A;  1JCR A;  3S7B A;  3TL5 A;  4N3B A;  4WNE A;  4JL0 A;  3UT7 A;  4A63 B;  2Y1L E;  4LSZ E;  1FVH A;  1TNY A;  3TG4 A;  4IYP A;  1MHQ A;  3FFL A;  3BG1 B;  5G2N A;  3HIZ A;  3CK7 A;  5HKP A;  3CHM A;  3CHQ A;  3QOU A;  1RW2 A;  3HYM B;  4L1B A;  3G2W A;  3U66 A;  4FJY A;  3RU0 A;  3ZYL A;  3T8M A;  3ZHE B;  1EF1 C;  3C72 A;  4J8D A;  1JWF A;  4PH4 B;  2R03 A;  3ULQ A;  2PQR A;  1A5E A;  2KBX A;  4UQY A;  4Y6W A;  1VDY A;  3ASG A;  3KEA A;  4HNA D;  1SZ9 A;  2CHZ A;  2R5S A;  4HOR A;  5CCM A;  2MOW A;  4GTS A;  4EQF A;  5G05 C;  2I1K A;  3KSL A;  3KAE A;  2EIJ E;  3CKC A;  3TWU A;  2J08 A;  1A17 A;  1BLX B;  1BD8 A;  3L6A A;  3RJV A;  4IUL A;  3L9T A;  4GPK A;  4C9B B;  2F8Y A;  3JXJ A;  2OCC E;  5KJN A;  1K3Z D;  2J4B A;  2ZIR A;  3PEU B;  3CVW A;  3E30 A;  3GW4 A;  4XKC A;  5EX0 A;  4FJZ A;  4OVV A;  3IEG A;  3RAU A;  3ZHE A;  4AJW A;  4DLQ A;  4I1O B;  5JJ6 A;  3SF4 A;  5G05 J;  4JXT A;  4YND A;  4HRL A;  3MX3 A;  4WAF A;  4TRQ A;  2BED A;  2J8S D;  5ANL A;  4GA0 A;  1BI7 B;  3ZUV B;  5AJL A;  5AQA A;  3SI5 A;  4OVU A;  3UT8 A;  1NL4 A;  3TWQ A;  1EPU A;  4GTV A;  3RSE G;  3UQ3 A;  5KJK A;  2DBA A;  1UJJ A;  4N5C A;  2WM9 A;  4F1S A;  5ARG A;  4NRH B;  1ZB1 A;  1E96 B;  4EZK A;  5CMY A;  4FLB A;  2X6H A;  4L2L A;  4ME2 A;  4CDR A;  5AJD A;  4WWP A;  3R9M A;  3DRA A;  2FO7 A;  4LG6 A;  3NZS A;  4HQD A;  2KM4 A;  3JYS A;  3B95 A;  3NOC D;  4JC8 A;  3GZS A;  1H2T C;  1EYH A;  1N94 A;  1S63 A;  3EJN A;  4CZ2 D;  3Q7F A;  5FZQ A;  1E8Z A;  2WXJ A;  4GPM A;  1E8X A;  4I2W A;  2IY0 C;  1OWL A;  3B13 A;  2VYI A;  2WXK A;  3C3R A;  3FEX A;  2XRZ A;  4EZJ A;  1Z3X A;  2IU1 A;  4O1O A;  2GRN B;  5T3R A;  2QYU A;  3LJ3 A;  4X8Q A;  4O1P A;  4GYW A;  3ASF A;  5AEN A;  4BT8 A;  5B1B E;  3LVR E;  4WWN A;  3CSF A;  2C0L A;  3ASD A;  4N5Q A;  4GTM A;  1MZC A;  4O6F A;  3VTY A;  2GRM A;  1QZ2 A;  1OUV A;  4XE0 A;  4ACK A;  4FC8 A;  5KWD A;  1UG3 A;  2IO3 C;  4AM9 A;  2NYJ A;  4EZL A;  2IEJ A;  4LUN U;  3MV3 B;  3HXE A;  2KZT B;  3PE3 A;  1HU3 A;  2MRI A;  3DXK G;  1P5Q A;  2WVI A;  4C48 B;  1D8D A;  2X38 A;  2WB2 A;  3C5R A;  5ENN A;  2R05 A;  3TGO A;  3LDZ A;  5J90 A;  2MYO A;  3E33 A;  5JHA A;  4UWK A;  3L13 A;  3L17 A;  4AY5 A;  3ZYM A;  1HX8 A;  2YHC A;  3U4T A;  4D10 C;  3LY7 A;  4DI4 A;  3AG1 E;  4I6E A;  2BUG A;  4KZC A;  2C0M A;  4XX5 A;  3ONK A;  3PH0 C;  4J8S A;  4NUR A;  1UN9 A;  4CT4 A;  4RG9 A;  1TYQ G;  1JPL A;  4HVB A;  3T8K A;  4WWO A;  1K8K G;  3Q73 A;  4WUY A;  3UM1 A;  2R02 A;  2X6K A;  2HM8 A;  4APO A;  4PDX A;  2DYS E;  3W9F A;  4DLO A;  3S7D A;  1TJC A;  4K0R A;  2RD0 A;  3DWL G;  3JXI A;  4CGW A;  2FF4 A;  2KZT A;  2CHW A;  4PS3 A;  2LSV A;  5B3S E;  4CYM D;  5C2Y A;  4HOT A;  2VGY A;  2H6I A;  1H2U A;  2RFA A;  3TWR A;  4ANX A;  2DCP A;  4F3V A;  4U7E B;  3OAW A;  4FUL A;  4XEI G;  4N2S A;  3FY4 A;  4C0E A;  3ZEF A;  1O5M A;  3GZ2 A;  2X6J A;  3P2B A;  2UY1 B;  2DIW A;  4YDY A;  3D9N A;  4UWL A;  3PZ1 A;  3CVN A;  3Q75 A;  3RRM B;  5CRU A;  3ZU7 B;  2ZIS A;  3ABL E;  1MX4 A;  4G11 A;  2CHX A;  3LS8 A;  4DJA A;  1N95 A;  3CQG B;  3FUF A;  4A3T A;  4J7W A;  4DX7 D;  5G04 C;  3PE4 A;  5CEC B;  2IJG X;  3OXF A;  3PRZ A;  4HLL A;  5ANR A;  3FH7 A;  2F0Y A;  1O1S A;  1WAO 1;  3APD A;  2IQC A;  3U64 A;  5AIJ A;  2L6B A;  2HYZ A;  4EEC A;  2V8S E;  3PVL A;  3B7T A;  3FTY A;  2Y69 E;  2QFC A;  3UIP C;  3APC A;  2YNQ A;  3FUD A;  2GGF A;  2AXV A;  4YVQ C;  3HDX A;  2UY1 A;  2L0I A;  3APF A;  3FHE A;  4A1S A;  3IHY A;  5CRV A;  3HRA A;  4G26 A;  1DC2 A;  2XQ0 A;  4HB5 A;  5KBA A;  4G23 A;  3BU8 A;  4EHM A;  4FHK A;  1TJF A;  5D0Q D;  4JEH A;  3UM0 A;  5ITZ F;  1ELK A;  3UIO C;  2QY7 A;  4J8Y A;  4G25 A;  3FDH A;  3FTZ A;  4GTO A;  3CVY A;  5LP0 A;  3CK8 A;  4GZ5 A;  4HI8 A;  3OTN A;  1H6P A;  4JD2 G;  4BY6 A;  4KT6 B;  3PZ3 A;  3V2O A;  2VSX E;  1SA5 A;  3RIB A;  4UQZ A;  4EBA G;  5LCW C;  2OV8 A;  3O4Z A;  5EKQ D;  3DSV A;  5BNW A;  1OWN A;  2L0T B;  4N3A A;  4ILH B;  1DVP A;  3SY2 A;  1KLX A;  2XEV A;  4B89 A;  4GMJ A;  3N71 A;  5BT1 A;  5BV1 A;  4WNF A;  5HRY A;  1YMP A;  3ZRH A;  1LD7 A;  4PS7 A;  2PM7 A;  4XIF A;  2P58 C;  3ULY A;  2UWJ G;  3MYV A;  3BEE A;  5ENP D;  3TWT A;  2QZA A;  4CDN A;  1LTX A;  1SVX A;  2LO6 A;  3SBS A;  3CHO A;  2XRY A;  4BEP A;  3TWW A;  3TAX A;  3KD7 A;  2WXM A;  4O60 A;  1OWP A;  3FU3 A;  2IOS A;  4F7A A;  2KCK A;  2BKK B;  2GRP B;  1N4P A;  5KJM A;  5EX3 A;  3G2V A;  3HVE B;  2B0O E;  3HHM A;  5AAO A;  2LAH A;  1IQR A;  2DYR E;  4GYY A;  3SQV A;  3J5Q B;  2WXR A;  5G55 A;  2YQ8 A;  4DI3 A;  3PZ4 A;  2RG8 A;  2V4H C;  1S64 A;  2IOL A;  2OEV A;  1E8W A;  2LNI A;  2JAB A;  3UKU G;  4TXR A;  1OT8 A;  4PUC A;  5T4Y A;  4MRU A;  5BXU A;  1WG0 A;  5J08 A;  4CRW A;  3EHN A;  1K1A A;  4IN3 B;  3LCA A;  2WXQ A;  4XKB A;  2ZGD A;  4A1G A;  4B94 A;  1V55 E;  3ZXS A;  3HXC A;  3UIN C;  2XCB A;  4QQI A;  4J6I A;  5KCM A;  5CED B;  4LEU A;  5EN5 D;  2XHE A;  4B8C B;  1N4S A;  3IHV A;  3CVV A;  4LER A;  2XEN A;  3OXG A;  5A23 A;  3V30 A;  4GMR A;  4YDE A;  1TN6 A;  3TJP A;  2F8X K;  4QFV A;  3JQ1 A;  4E6H A;  3MKR A;  4BET A;  3D9M A;  4UUC A;  4TUU A;  3QWV A;  3C98 A;  4H7X A;  2H6G A;  1LF8 A;  2GRL A;  4HRN A;  2FEZ A;  2X3M A;  3SGH A;  2FI7 A;  5CBO A;  2CG3 A;  2PQN A;  4GTT A;  1IQU A;  3G2U A;  3EHM A;  1O1T A;  2P9S G;  4GTQ A;  2KC7 A;  1KZP A;  3CLJ A;  4TUM A;  3B7B A;  4XI9 A;  3G2S A;  3NAW A;  2ION A;  3LEW A;  4BFR A;  4G8L A;  4LNB A;  5AQ7 A;  4KVM A;  4UWH A;  5EIB E;  4TXQ A;  4K5A B;  1QNF A;  3UM2 A;  4RVB A;  4JA7 A;  4WND A;  3Q9N C;  3AJI A;  1HO8 A;  1N4R A;  4FAD A;  3TXN A;  3BQO A;  3PRE A;  4NAC A;  2VSN A;  2VGX B;  1PC2 A;  4ANU A;  4I6G A;  2XPZ A;  3DPD A;  3IBE A;  5FQ8 A;  2P9U G;  4AEZ C;  2L9B A;  3MV2 B;  3Q47 B;  1E90 A;  2OVB A;  2Y4U A;  3FTX A;  1DNP A;  1N0R A;  3LXU X;  4UQX A;  2KCL A;  3D9I A;  3C3O A;  1MQS A;  3DPY A;  3IXE A;  3P1U A;  1YYH A;  2Y4T A;  4V3I A;  4AV7 A;  2IO2 C;  1KT1 A;  3LY9 A;  3U3W A;  5BV0 A;  3DSS A;  3UKR G;  3Q9U C;  3EU9 A;  1ELW A;  2OND A;  1Z3Y A;  3CHP A;  1NA3 A;  1HG2 A;  1HZ4 A;  3ISM C;  5C1D A;  5FJY A;  2WXO A;  4FA6 A;  3D9L A;  2CFU A;  2WXG A;  2J4D A;  4YDO A;  5A6C A;  2CFZ A;  3V2X A;  2VGX A;  3CVQ A;  5HQ8 A;  4AVX A;  3KSQ A;  4HI9 A;  2NSZ A;  3PUK A;  3ASH A;  4A55 A;  3FH8 A;  2LSU A;  4GA2 A;  4H7Y A;  3V79 K;  5CCL A;  1OCR E;  3R7R A;  3VTX A;  4FLH A;  4GA1 A;  1MX2 A;  1TEZ A;  4GZ3 A;  2WMN A;  4U8H A;  2Q7F A;  3FUK A;  2V5F A;  3JCK C;  2OEW A;  2OVF A;  4P29 A;  1KPS B;  1AWC B;  3IV0 A;  4GZC A;  4ATG A;  4G1T A;  2ILR A;  1H2V C;  2KXP C;  1TN8 A;  1MYO A;  4HRM B;  1HF8 A;  3EU5 A;  1BI8 B;  4G8K A;  3TWS A;  4JEU A;  3ESL A;  4ACL A;  3I4G A;  3SHF A;  1YA0 A;  1TR4 A;  2A5U A;  4N2Q A;  3ENE A;  3FUI A;  1KZO A;  4Q96 A;  3DEO A;  3ZGQ A;  2V5Q C;  3AS4 A;  1U3C A;  1N11 A;  2BTD A;  2GRR B;  4APF A;  5JJ7 A;  4J8E A;  4KZ0 A;  4M7C A;  4GTP A;  3I4R B;  4FP7 A;  5EID A;  1QQE A;  2WQ7 A;  4UWF A;  4C0M A;  2ZU6 B;  3AG3 E;  4LNG A;  5DIZ A;  1D8E A;  1NP7 A;  3HG0 D;  5D0O D;  3VLD A;  2PZI A;  1JCQ A;  1OCO E;  4CGV A;  4UI9 J;  3K9I A;  4GZD A;  4YDW A;  3AS5 A;  3QK0 A;  1INZ A;  3SBT B;  3OXL A;  3E4B A;  3IKO B;  3GZ1 A;  4U0U A;  1AP7 A;  2P9P G;  2KCV A;  3ULE G;  3TXM A;  2R2L A;  4JVS A;  3RRN B;  2E2E A;  4HS2 A;  1Z6T A;  3MEK A;  5FQ7 A;  2L6J A;  4I17 A;  5CHE E;  3EUV A;  5KNH D;  3L08 A;  4LNU D;  4RG6 A;  5M72 A;  3PZ2 A;  3RRU A;  3FH5 A;  2DZN A;  3QDN A;  1FPP A;  3EIJ A;  2QYJ A; 
#chains in the Genus database with same CATH homology
 3G2T A;  4OVU A;  4KXK B;  3UT8 A;  3DBS A;  2LO6 A;  4ANW A;  5CMW A;  3KEZ A;  1W3B A;  3SBS A;  3CHO A;  3FUJ A;  2HR2 A;  2XRY A;  1EPU A;  5HI7 A;  2EQX A;  4I9E A;  4RSY A;  2VJ8 A;  3UQ3 A;  3ZVV A;  3FUE A;  3Q49 B;  2J9Q A;  4EBA A;  5KJK A;  2DBA A;  3TAX A;  1UJJ A;  4N5C A;  2WM9 A;  4F1S A;  4E85 A;  2FUL A;  3KD7 A;  2WXM A;  4NRH B;  5ARG A;  4F53 A;  5BW8 C;  1OWP A;  3CVX A;  3L16 A;  3FU3 A;  2IOS A;  2J07 A;  4F7A A;  1E96 B;  3LYA A;  4EZK A;  4GZ6 A;  2KCK A;  3B7R L;  1IYG A;  4JW1 A;  2HO1 A;  1H0A A;  5CMY A;  2WXF A;  3D9J A;  3VLE A;  5KJM A;  5EX3 A;  1PAQ A;  3G2V A;  3HVE B;  2X6H A;  4FLB A;  4JPS A;  2AXZ A;  4L2L A;  4ME2 A;  3FU5 A;  3SD5 A;  4CDR A;  5AJD A;  3URZ A;  2WXL A;  4UI9 C;  4WWP A;  4L2Y A;  2M63 A;  3HHM A;  2LAH A;  1IQR A;  1H19 A;  2LAI A;  2OOE A;  4K03 A;  3QC1 A;  4I1M A;  4GYY A;  2FO7 A;  3L54 A;  1XGW A;  3QAR A;  1U3D A;  3NZS A;  3UUX A;  4KYO B;  1S0P A;  2KM4 A;  3CVL A;  3JYS A;  2WXR A;  2V0P A;  4G24 A;  5G55 A;  3JUI A;  2AXU A;  3L22 A;  1NA0 A;  5FQ6 A;  4JC8 A;  2YQ8 A;  3ML8 A;  3QWW A;  3D9O A;  4DI3 A;  1WY6 A;  3GZS A;  3T5V A;  1H2T C;  3QNK A;  3CQC B;  3AS8 A;  4B0Z A;  1EYH A;  2RG8 A;  2XCC A;  1ZU2 A;  3FTS A;  2IFU A;  3EJN A;  4JA9 A;  3UT4 A;  2IOL A;  2VTB A;  1SQM A;  1E8W A;  2LNI A;  2VQ2 A;  5FZQ A;  2NC9 A;  3MKQ A;  2WXN A;  1X5B A;  4R7L A;  1E8Z A;  2WXJ A;  4KVO A;  3ZIM A;  1E8X A;  4AIF A;  3NF1 A;  4I2W A;  3CST A;  3NQP A;  4PUC A;  4UI9 K;  3UX4 A;  1OWL A;  3B13 A;  3CKB A;  2VYI A;  2WXK A;  1E8Y A;  3FEX A;  3FUH A;  5T4Y A;  4HOU A;  4BX9 A;  2XRZ A;  4MRU A;  2NXP A;  1Z3X A;  4EZJ A;  5AYW D;  2IU1 A;  4JHR A;  3S7J A;  3Q4A B;  4BTB A;  5T3R A;  4YVO A;  3FUL A;  3ZPJ A;  5J08 A;  5KJL A;  2XGM A;  3LJ3 A;  4CRW A;  4GYW A;  3EHN A;  4IN3 B;  3LCA A;  2WXQ A;  3ASF A;  5AEN A;  2WQ6 A;  4LRZ A;  4BT8 A;  4XKB A;  1WM5 A;  3LVR E;  4A1G A;  4DPR A;  3LVQ E;  4B94 A;  4WWN A;  3AU5 A;  3CSF A;  4BT9 A;  3ZXS A;  4U63 A;  2X6I A;  4LCT A;  2C0L A;  2KAT A;  2XCB A;  3ASD A;  4J6I A;  5KCM A;  3JQ0 A;  4B8A A;  4O6F A;  4LEU A;  2XHE A;  3Q5M A;  1IHG A;  1QZ2 A;  2GRM A;  3UMV A;  3VTY A;  4B8C B;  3CVU A;  1OUV A;  4XE0 A;  3KS2 A;  3IHV A;  1JUQ A;  4FC8 A;  4ACK A;  2JLB A;  1B89 A;  1UG3 A;  3CVV A;  4LER A;  2I9C A;  4AM9 A;  3OXG A;  5A23 A;  4EZL A;  1N52 A;  3LY8 A;  4LUN U;  3MV3 B;  4J0U A;  5DBK A;  2KZT B;  3PE3 A;  3TJP A;  1HU3 A;  3PEV B;  4I1A A;  4ANV A;  4AOF A;  4Y6C A;  2A4Z A;  3O48 A;  5E75 A;  2MRI A;  1E7U A;  4GCN A;  1FVF A;  1P5Q A;  1L5J A;  4GYO A;  4KMO A;  2WVI A;  1JWG A;  4QFV A;  4EPZ A;  2CG2 A;  1SZA A;  4MS6 A;  3CGH A;  3MJW A;  3JQ1 A;  4CT0 A;  4N3C A;  3MZL B;  4NQ0 A;  3CHR A;  4E6H A;  5FQ4 A;  3MKR A;  3D9M A;  4TUU A;  4MKT A;  3D9P A;  2X38 A;  4N39 A;  3QWV A;  2WB2 A;  2FBN A;  3C98 A;  5ENN A;  3TGO A;  4H7X A;  2WXP A;  3WXX A;  5LX8 A;  3LDZ A;  5J90 A;  1LF8 A;  2VSO E;  2GRL A;  5JHA A;  4XZ4 A;  3LKU A;  3L13 A;  4UWK A;  3L17 A;  3QB2 A;  4AY5 A;  4Q94 A;  2FEZ A;  2YHE A;  2X3M A;  3ZYM A;  1HX8 A;  5E76 A;  3SGH A;  1EDU A;  2FI7 A;  3R9A B;  2CG3 A;  2PQN A;  4ABN A;  2YHC A;  3D9K A;  3MCX A;  3U4T A;  4D10 C;  3LY7 A;  3NZU A;  3CHS A;  4DI4 A;  4I6E A;  3SFZ A;  1IQU A;  2BUG A;  3ESK A;  3G2U A;  4KZC A;  3EHM A;  2C0M A;  4PS8 A;  4XX5 A;  3ONK A;  2YIN A;  4GB9 A;  3PH0 C;  4J8S A;  3AU4 A;  4NUR A;  1UN9 A;  2KC7 A;  4CT4 A;  4XI9 A;  3CLJ A;  3CK9 A;  3FP3 A;  3G2S A;  4RG9 A;  2ION A;  3LEW A;  1JPL A;  4BFR A;  4HVB A;  1FCH A;  3U9W A;  4WWO A;  4JHJ A;  5G04 J;  5A7D B;  4KVM A;  4UWH A;  4WUY A;  3ZFW A;  3QKY A;  4M3O A;  1QNF A;  2X6K A;  2HM8 A;  4APO A;  4PDX A;  4RVB A;  4DLO A;  4JA7 A;  3S7D A;  3CR3 A;  3S7F A;  1TJC A;  4K0R A;  3EDT B;  4WND A;  3CV0 A;  2RD0 A;  4AP2 A;  1HO8 A;  2V4L A;  4FAD A;  3TXN A;  4CDM A;  5JJT A;  3PRE A;  3RO3 A;  4NAC A;  2WPV A;  4CGW A;  2FF4 A;  2KZT A;  1OWM A;  2CHW A;  2VSN A;  2VGX B;  1PC2 A;  4PS3 A;  4ANU A;  1HG5 A;  4KBQ A;  2BF0 X;  4I6G A;  2XPZ A;  3DPD A;  3FUN A;  2LSV A;  3IBE A;  5FQ8 A;  4AEZ C;  4L23 A;  1ELR A;  2L9B A;  4WNG A;  1ZBP A;  5C2Y A;  4HOS A;  4HOT A;  2VGY A;  3MV2 B;  3FTU A;  3UPV A;  2I6H A;  3Q47 B;  4BX8 A;  1E90 A;  1H2U A;  2I1J A;  4ANX A;  2DCP A;  2OVB A;  2Y4U A;  3PZD A;  3B7U X;  3FTX A;  1DNP A;  3LXU X;  4F3V A;  4URK A;  4Q69 A;  4UQX A;  2GW1 A;  2KCL A;  1E7V A;  4BTA A;  3D9I A;  1HS6 A;  3SZ7 A;  3OAW A;  4FUL A;  3I3N A;  2XPI A;  1MQS A;  4N2S A;  3FY4 A;  3PS6 A;  2R17 C;  3P1U A;  2XPY A;  4C0E A;  2AVP A;  3ZEF A;  3GZ2 A;  2X6J A;  2Y4T A;  1HXI A;  3ZYQ A;  3P2B A;  3HVE A;  4I9C A;  4HXI A;  4AY6 A;  4V3I A;  2UY1 B;  4AV7 A;  3FEY A;  2DIW A;  4IRU A;  2XGS A;  1KT1 A;  3LY9 A;  3U3W A;  3ONL A;  3R7Q A;  3D9N A;  4UWG A;  5BV0 A;  4UWL A;  1H6K A;  5BUZ A;  3ZN3 A;  3CVN A;  1XNF A;  4U0Z A;  4A3V A;  3Q15 A;  3RRM B;  3QWP A;  2PL2 A;  3MA5 A;  2MHK A;  1ELW A;  2OND A;  1Z3Y A;  3CHP A;  4G11 A;  2CHX A;  3LS8 A;  4HOQ A;  1NA3 A;  1HG2 A;  4U0S A;  3CVP A;  2AW6 A;  4GAA A;  1HZ4 A;  5C1D A;  5FJY A;  4DJA A;  2WXO A;  4FA6 A;  3D9L A;  2WMO A;  5LOZ A;  2CFU A;  3CQG B;  2WXG A;  3FUF A;  4A3T A;  5G04 C;  2J4D A;  4ILG A;  3ML9 A;  3PE4 A;  5A6C A;  4I43 A;  2CFZ A;  2IF4 A;  2Y3A A;  3MGB A;  4U04 A;  4L7T A;  1UW4 B;  2VGX A;  2IJG X;  3GYZ A;  3PUJ A;  2C2L A;  3CVQ A;  3FTV A;  3SNX A;  3T5X A;  4CEM A;  5HQ8 A;  3OXF A;  3RK6 A;  2JEK A;  4AVX A;  5FT9 A;  3ZW3 A;  5LFA A;  2NSZ A;  3PRZ A;  3PUK A;  5ANR A;  3ASH A;  3FH7 A;  4A55 A;  3CEQ A;  4FU3 A;  3FH8 A;  3EIQ C;  2LSU A;  2WQH A;  3PDN A;  1WAO 1;  3FWV A;  4GA2 A;  4G2V A;  3LPZ A;  5BPP A;  3S2A A;  4GCO A;  4I2Z A;  1HH8 A;  3APD A;  5ARF A;  2IQC A;  3PNT B;  4H7Y A;  4W9R A;  4TV3 A;  3U64 A;  4DK5 A;  5AIJ A;  3R7R A;  5CCL A;  5JHB A;  4HLE A;  2HYZ A;  2X6F A;  3VTX A;  2V8S E;  4EEC A;  5EDS A;  5LCW J;  4FLH A;  3PVL A;  2VSY A;  3B7T A;  4GA1 A;  1TEZ A;  4GZ3 A;  2WMN A;  3FTY A;  1Y8M A;  2QFC A;  4U8H A;  4J8F A;  2Q7F A;  3FUK A;  1HE8 A;  2V5F A;  2I2O A;  3APC A;  3JCK C;  5FTP A;  2YNQ A;  3FUD A;  2OVF A;  1PY1 A;  2WXH A;  4P29 A;  3S7B A;  2GGF A;  3ZYK A;  3TL5 A;  3IV0 A;  4GZC A;  2J09 A;  4ATG A;  4N3B A;  4WNE A;  4JL0 A;  3UT7 A;  2AXV A;  4G1T A;  2ILR A;  4YVQ C;  1H2V C;  2AWI A;  1FVH A;  3TG4 A;  3HDX A;  2UY1 A;  4IYP A;  4BSX A;  1MHQ A;  2L0I A;  3APF A;  3FFL A;  1HF8 A;  3FHE A;  4A1S A;  3BG1 B;  5G2N A;  3HIZ A;  3CK7 A;  4JEU A;  3IHY A;  3I5P A;  3ESL A;  3CHM A;  3CHQ A;  4ACL A;  3QOU A;  4G26 A;  3I4G A;  2XQ0 A;  3HYM B;  4L1B A;  3SHF A;  1YA0 A;  3G2W A;  3U66 A;  4FJY A;  3RU0 A;  3ZYL A;  3T8M A;  2A5U A;  3ZHE B;  1EF1 C;  4N2Q A;  3ENE A;  3RKV A;  3QJZ A;  4J8D A;  3FUI A;  1OWO A;  1JWF A;  4Q96 A;  4G23 A;  4PH4 B;  3ZGQ A;  3AS4 A;  3ULQ A;  4FHK A;  1U3C A;  2BTD A;  2PQR A;  1TJF A;  5D0Q D;  4UQY A;  4JEH A;  1N54 A;  4XI0 A;  3TG5 A;  1ELK A;  4CCA A;  4Y6W A;  4GML A;  5T8I A;  1VDY A;  3ASG A;  4APF A;  1HFA A;  1SZ9 A;  2CHZ A;  2R5S A;  4JZY A;  4J8E A;  4KZ0 A;  5JJ7 A;  2QY7 A;  4HOR A;  3I4R B;  5CCM A;  4FP7 A;  1GW6 A;  3FTW A;  1QQE A;  4G25 A;  1UJK A;  2WQ7 A;  2MOW A;  3FDH A;  4EQF A;  3FTZ A;  2I1K A;  5G05 C;  4UWF A;  3CVY A;  2J49 A;  3KAE A;  4C0M A;  2ZU6 B;  3RO2 A;  5LP0 A;  3CKC A;  5DIZ A;  1Y6I A;  1NP7 A;  3CK8 A;  4GZ5 A;  5D0O D;  3OTN A;  3VLD A;  4BY6 A;  4KT6 B;  4I6J A;  2PZI A;  2E0I A;  2J08 A;  1A17 A;  2VSX E;  5FZS A;  3RIB A;  4UQZ A;  4CGV A;  4AXH A;  4EBA G;  4UI9 J;  3L6A A;  5LCW C;  3RJV A;  1NZN A;  2OV8 A;  1UN8 A;  4IUL A;  3K9I A;  3O4Z A;  4GZD A;  3D3M A;  4GPK A;  3QAQ A;  5EKQ D;  3AS5 A;  3QK0 A;  4C9B B;  3VLF A;  5BNW A;  1OWN A;  1INZ A;  3BG0 B;  3B7S A;  2L0T B;  1BPO A;  4N3A A;  3SBT B;  3CIA A;  4ILH B;  5KJN A;  3OXL A;  2J4B A;  1DVP A;  2WXI A;  3E4B A;  3FU6 A;  3PEU B;  3CVW A;  1KLX A;  4FHJ A;  2XEV A;  1KT0 A;  4B89 A;  4BWR A;  3GW4 A;  4XKC A;  5EX0 A;  3IKO B;  3GZ1 A;  4JHK A;  4FJZ A;  4OVV A;  4GU5 A;  4GMJ A;  3IEG A;  4U0U A;  3N71 A;  2KCV A;  5BT1 A;  3ZHE A;  4AJW A;  4DLQ A;  5BV1 A;  2VTB B;  4WNF A;  3TXM A;  3ZRH A;  3FUM A;  3PNL B;  4I1O B;  4MLP A;  4JVS A;  4PS7 A;  5JJ6 A;  3SF4 A;  3RRN B;  2PM7 A;  2XGO A;  2E2E A;  3MKQ B;  4HS2 A;  4XIF A;  1Z6T A;  3MEK A;  4OYS A;  2P58 C;  5G05 J;  5FQ7 A;  4JXT A;  2L6J A;  4I17 A;  5FZR A;  2PM6 A;  3FU0 A;  5CHE E;  4YND A;  2UWJ G;  3L08 A;  3MX3 A;  4WAF A;  3MYV A;  4RG6 A;  4TRQ A;  3BEE A;  4U07 A;  5FWQ A;  5M72 A;  5ANL A;  4GA0 A;  4ILI A;  3RRU A;  3FH5 A;  3QDN A;  4CDN A;  2R59 A;  5AJL A;  3EIJ A;  3SI5 A;  4HFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...