4B8CB

Nuclease module of the yeast ccr4-not complex
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
233
structure length
233
Chain Sequence
QEMIPLKFFAVDEVSCQINQEGAPKDVVEKVLFVLNNVTLANLNNKVDELKKSLTPNYFSWFSTYLVTQRAKTEPNYHDLYSKVIVAMGSGLLHQFMVNVTLRQLFVLLSTKDEQAIDKKHLKNLASWLGCITLALNKPIKHKNIAFREMLIEAYKENRLEIVVPFVTKILQRASESKIFKPPNPWTVGILKLLIELNEKANWKLSLTFEVEVLLKSFNLTTKSLKPSNFINT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/cell cycle
molecule keywords POLY(A) RIBONUCLEASE POP2
publication title Architecture of the Nuclease Module of the Yeast Ccr4-not Complex: The not1-Caf1-Ccr4 Interaction.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 80
structure length 233
sequence length 233
chains with identical sequence G, H, I
ec nomenclature
pdb deposition date 2012-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16415 CNOT1_CAF1_bind CCR4-NOT transcription complex subunit 1 CAF1-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4b8cB00
2GGFA 2RG8A 2NSZA 3FEXA 5ANRA 4GMLA 2VSXE 4CEMA 2I2OA 2IONA 4C9BB 4IULA 3D3MA 1H2VC 3JUIA 4B89A 4B8CB 1UG3A 4JHJA 1PAQA 4CRWA 1HU3A 2IOSA 2ZU6B 4B8AA 4GMJA 4CT4A 2KZTB 2HM8A 3EIQC 1H2TC 1H6KA 2VSOE 3FEYA 1N54A 2FULA 2IOLA 3L6AA 3RK6A 1H2UA 2KZTA 1N52A 3EIJA 2IU1A 1UW4B 4JHKA 4LUNU
chains in the Genus database with same CATH superfamily
3D9NA 4XEIG 2VYIA 3R7RA 1IHGA 5T3RA 2H6HA 2VTBA 3IBEA 4G11A 1Y8MA 1TNOA 3CVVA 1E96B 3CHMA 5AYWD 5E75A 4U63A 3LY7A 3HXDA 3QC1A 4PS7A 2GRRB 2YHCA 3ML9A 5KNHD 3FUDA 3P1UA 2YINA 2MHKA 2X6IA 4GZDA 4IRUA 2KATA 1MX2A 4JVSA 2R05A 3U9WA 2J4DA 1LF8A 3ESLA 2KBXA 5JJTA 4GTSA 3T9KA 1U3DA 5ENQD 5AJLA 4A55A 5KCMA 4RVBA 2BTDA 4F3VA 2WPVA 3DEPA 4DX6D 4I6EA 3S7JA 2GGFA 2PM6A 3D3MA 3FWVA 2IO3C 1EYHA 3AS4A 3UTMA 4FULA 2XENA 1BI7B 3V2XA 1XNFA 1N9AA 1WM5A 2NC9A 2HO1A 1D8EA 1X5BA 2C2LA 4QFVA 2CFUA 3DEOA 4NRHB 3NBNB 2HE0A 2X38A 3SFZA 4ATZD 4B8CB 2XZTG 2IOSA 4GYOA 2LSUA 2Q7FA 4BT8A 4F53A 3ZYLA 4DI4A 4FLBA 2OOEA 3AG4E 3FTUA 2DVWA 2P9NG 4A1GA 5B3SE 3FTSA 4PS8A 3UUXA 3QOUA 2EIKE 3HHMA 3VLEA 4HRLA 2J9QA 5CEAA 3O48A 3TWXA 3OAWA 3EIQC 5ITZF 1OWLA 5FQ4A 3SI5A 4N3CA 2WMNA 1OCOE 3FP3A 4EBAA 4BX9A 1BU9A 2FI7A 2J8SD 2GRNB 3B7RL 4N3AA 1TN6A 4Q94A 3G2UA 4OVUA 3E34A 4A63B 2OVBA 1KT1A 4UI9C 2PQRA 3FUMA 4GYYA 3KD7A 3B7SA 4FJYA 3I4GA 3DXKG 3SQVA 4DLQA 3ZVVA 3ONKA 3KEAA 4UI9K 3S2AA 4RSYA 3FH5A 2L6JA 3CKCA 4WNFA 1N54A 4WNEA 4JC8A 4J8DA 5ENTD 4J6IA 1G3NB 3CK9A 4GAAA 3JXIA 1OWNA 4E85A 4EPZA 3PS6A 1U2VG 4IYPA 3JUEA 3UM0A 4U7EB 4A3TA 3TAXA 4GYWA 3DSSA 1E8XA 2H6IA 2X6HA 4CGVA 2I6HA 3L08A 2OCCE 4K0RA 3MKQB 5HRYA 1H6PA 2R02A 2JABA 2E2EA 3APDA 3NB2A 3CSTA 2WXOA 2X6KA 4GTMA 2WXMA 1DCQA 3PUKA 3JXJA 2R17C 3NQPA 4QQIA 2GROB 5FZQA 2J07A 1ELRA 4I9CA 5ENOD 4FHJA 1DNPA 3CVLA 5D0OD 3Q4AB 4MRUA 3C3OA 5J90A 4I2WA 4MBGA 3MV2B 2WVIA 4N3BA 5EX3A 1LD8A 3D9LA 4FA6A 3CVPA 5FZRA 1O1RA 4H7YA 4LRZA 4OVVA 1AWCB 3OXLA 5KJLA 4W9RA 4BTBA 3CK8A 3PZ4A 2X3MA 3R9AB 2I9CA 4AVXA 3BQOA 3B7UX 3G2VA 5BW8C 3D9HA 4UWGA 2PZIA 2UY1B 4I1MA 1RZ4A 4L2YA 5FINA 1HF8A 4YDWA 3NZUA 4UWLA 5CMWA 5ENRD 2AVPA 4Y6CA 5BV0A 1TNBA 4F1PA 4DK5A 4U0SA 3CHOA 4M7CA 2NXPA 4UQXA 3FH7A 2VGXB 4BERA 3CQGB 3ZW3A 5M72A 4URKA 1Z3YA 1Q2ZA 2MRIA 3FULA 3JUIA 4EZKA 4EQFA 2ETBA 2QZAA 1INZA 4F6RD 2ZGDA 4Y6WA 1N4PA 4NURA 3NF1A 3PNTB 1FCHA 2IO2C 2KCVA 3UPVA 3D9KA 3CVQA 4G26A 3V31A 1HZ4A 2H6GA 3NAWA 3ABME 4BETA 2Y1LE 4ME2A 5B1BE 2M63A 3L22A 3V2OA 3SNXA 3BU8A 2AW6A 2FO1E 4ZFHA 3FUHA 2FF4A 3MKQA 3CVWA 4I43A 1N0QA 2WQ6A 4L23A 3AG2E 1OT8A 5ENPD 4KVOA 5BNWA 1QQEA 1IYGA 4B93B 3Q9NC 1D8DA 3APFA 3L13A 1UJJA 3FTYA 2RKKA 3QJZA 4B89A 3LS8A 2R2LA 2GRPB 4D10C 2WXPA 3RU0A 4DX2A 4I1OB 1S70B 4JHKA 3ML8A 3FH8A 3E33A 4BY6A 3CVYA 3ZXPA 3HIZA 4X8QA 4LNGA 3ZYKA 4ATGA 2FO7A 5G05C 5D2MC 2CHWA 2QFCA 3UIOC 3U66A 3TXNA 1BI8B 2UY1A 3DSVA 3LEWA 3L54A 3UT8A 4A1SA 4YDOA 3RKVA 4ANXA 2AXUA 4YVQC 3LJNA 3I3NA 4GTQA 5AENA 4GA1A 4G8KA 1DC2A 4NQ0A 2R03A 1H6KA 1O1SA 4LNBA 1Z6TA 2FULA 4C48B 3S7BA 3VTYA 2LNIA 2VGXA 5CRVA 3FUJA 4KMOA 3SFXA 4CYMD 4TXRA 3B7BA 3EDTB 1WY6A 1UOHA 3FTVA 1HXIA 5A7DB 3ABLE 2XS8A 2V5FA 3DSXA 2WXNA 4DX5D 3PE4A 1YA0A 1MX4A 4CRWA 4M3OA 4WNDA 4KXKB 2C0MA 2HM8A 2V4HC 1HFAA 3GYZA 1IKND 3ASGA 4C0EA 2Y4TA 4EHMA 2IQCA 4JB8P 1S63A 3LY8A 4XZ4A 1U3CA 5ENSD 4CT0A 2ZIRA 2EIJE 4HXIA 3MGBA 2LSVA 4AM9A 5D66A 1YCSB 1TJCA 4U8VD 4F1SA 3FUNA 3FUKA 4LUNU 4XE0A 4XKBA 1MHQA 4HI8A 2IONA 4MLPA 1JWFA 1SA5A 3VLFA 5FWQA 1EF1C 4MS6A 4JEHA 2A5EA 4ANVA 3U3WA 3HYMB 1IXVA 4DI3A 1LD7A 2P9SG 2P9PG 5CCMA 3ASHA 4GA2A 3HVEA 4K5CA 3T8KA 4FP7A 1L5JA 1K3ZD 1MJ0A 1PAQA 4AXHA 3CVNA 4JL0A 1TNYA 3FU3A 3FEYA 1LTXA 3L82A 4OYSA 1HE8A 4WWOA 3TGOA 4MKTA 2Y69E 3FTWA 4FC8A 2CHXA 3CVUA 2QC9A 2CG2A 2P9KG 5G04C 3FU6A 2BUGA 4NIKA 3UT4A 4GTRA 2CG3A 4JA9A 5AN8A 1ELWA 5KWDA 4G23A 3E30A 2BKGA 3Q78A 2IEJA 4Z68A 3Q73A 1E8ZA 2Y0BG 1NP7A 1H2VC 2EINE 5FT9A 3L9TA 2WM9A 3B7TA 5T4YA 4H7XA 4BSZB 4E6HA 3DPDA 2NYJA 1UN9A 2VSNA 1O1TA 1QYMA 4GMLA 1QZ2A 3HXEA 1H0AA 5B1AE 4GTOA 5LCWC 3Q75A 3RRNB 3U4TA 5AQBA 4HQDA 4OAUC 1PY1A 3OXFA 4ILGA 4LG6A 2XPYA 1IQRA 3FTXA 3QB2A 3GZ1A 2LXMA 4DX7D 3W9GA 5KJKA 3BG1B 5BPPA 2LAIA 2LO6A 4I2ZA 2EIME 1HU3A 3HDXA 2PL2A 1JPLA 2GRQB 2VSOE 5JHAA 3IKOB 1MX6A 3KSLA 2R59A 3DSWA 3Q49B 3CV0A 1FT1A 2OEWA 3X2QE 2DCPA 5KJNA 1HG5A 2DYSE 2ZU6B 4RLYA 2VGYA 4GA0A 3Q7FA 4L9PA 4WNGA 1SQMA 3BUAA 2LXLA 3SY2A 3ZU7B 3RO2A 4LERA 3RSEG 3C3QA 3PDNA 1H19A 3DPYA 3J5PA 4AP2A 4B8AA 3LDZA 2XGOA 5JJ7A 1ELKA 4O1OA 3QWWA 5CMYA 2Y3AA 3CK7A 3G2WA 3UI2A 4OAVB 2XGMA 2ILRA 1N95A 3SBTB 3BG0B 4EZJA 1TR4A 2B6CA 1JCQA 3MCXA 2KXPC 1KT0A 1W3BA 2QY7A 3IV0A 4LSZE 3UQ3A 4HOSA 3MYVA 2ONDA 4L7TA 3ZYQA 4U04A 5BXOA 3G2SA 3OXGA 4GCNA 1HS6A 2RFMA 1TNUA 4APOA 2I1JA 3EHNA 3RK6A 4U07A 4CCAA 2KCKA 1SW6A 3E32A 3ZPJA 1ZBPA 4KZ0A 4HB5A 2RD0A 3FEXA 3CVXA 4YNDA 4AJWA 1NA0A 4PS3A 1OY3D 1ZB1A 4AOFA 3MZLB 4J8YA 2GW1A 4AV7A 3S7FA 2OV8A 4DUIA 4TXPA 5EYLA 5EYPF 3UINC 5ANLA 4GMJA 1EPUA 3AG3E 3RO3A 4GZCA 3TXMA 3K9IA 2PM7A 1UN8A 3W9FA 2EILE 1N4QA 5CHEE 4HOUA 2PNNA 3Q5MA 1B89A 2WXJA 3TG5A 3E37A 2J09A 1O5MA 4HI9A 4I17A 3Q79A 2DBAA 2DYRE 5DIZA 4U8YD 4ANWA 2BEDA 3SD5A 1BLXB 3UMVA 4APFA 3BEEA 4ACLA 4UQZA 4JEUA 3MA5A 4K03A 2XEEA 4HFGA 5KJMA 3URZA 3ZXSA 1YYHA 4N2SA 3DXMG 4U0ZA 3NZSA 1XGWA 1NI1A 2WQ7A 4PDXA 1NL4A 4EECA 4O6FA 3TWQA 3KS2A 2HYZA 5KBAA 4N5QA 3NOGD 2L0TB 3CLJA 4CEMA 4G8LA 2V0PA 4DPRA 2MOWA 2L6BA 5HKPA 3Q7AA 2PQNA 4JZYA 4YVOA 3ZRHA 5C2YA 2WXRA 1WAO1 5HQ8A 3AAAC 2WMOA 3ASDA 5LP0A 4JW1A 3WXXA 3EU5A 4HLLA 4O1PA 3IHVA 3MX3A 2GRLA 1E8WA 3FTZA 5HI7A 4CT4A 1NFIE 5BV1A 2KM4A 4KT6B 3UKUG 1FT2A 3HVEB 3JCKC 1H2UA 3EHMA 1RW2A 3HXCA 3ASNE 3CIAA 2P2CP 2XEVA 2E0IA 2XZDG 5ANRA 4GPKA 2XEHA 3RJVA 5CERB 1SZAA 3C72A 3QKYA 4UWFA 4G25A 5JJ6A 5CBOA 2YHEA 2ZISA 3FDHA 3ULQA 4JHRA 2WXLA 2P9LG 4TRQA 4GZ3A 3Q47B 1HO8A 4U8HA 4DRXE 4I1AA 4KVMA 2A5UA 3TJPA 4BSXA 2DIWA 2LAHA 1Z3XA 5FZSA 4Q69A 1IHBA 3ZYMA 4HRMB 1OCZE 4J0UA 3ASFA 4HS2A 1N11A 2XPZA 3LY9A 3JQ0A 3EIJA 2X6FA 3CHRA 2WXGA 2WQHA 2F0YA 4CDRA 4FJZA 3D9MA 4JXTA 5ARFA 4FADA 5G05J 4GZ5A 2ETAA 1VDYA 4J8SA 3AG1E 1JCSA 5CBNA 3CHSA 5A23A 4FLHA 1EDUA 2CFZA 4I6JA 3GW4A 4GPMA 2MYOA 3HG0D 3TL5A 4HOQA 4BESA 1OUVA 3ZFWA 1OWMA 4Q96A 3ULYA 4ZHBA 1GW6A 3PEUB 2XS1A 5J08A 1Y6IA 3LPZA 3CEQA 2AJAA 4U96D 4KZCA 3I4RB 2YQ8A 4GTPA 3B13A 3DSUA 1JUQA 4RG6A 2OVFA 3FY4A 1E90A 3I5PA 5FQ6A 2BF0X 3AJIA 3G2TA 1DVPA 3MJWA 1P5QA 2XQ0A 2F8YA 3LXUX 3SHFA 4YDEA 5DBKA 5EIBE 3LVRE 2X6JA 3QAQA 4XKCA 4DX1A 5FQ8A 2J4BA 2WXIA 2FEZA 3L17A 3AS8A 3PNLB 1K1AA 4GCOA 3N71A 3WG7E 3ASOE 3AU5A 3TWVA 5CEDB 4GZ6A 3RRMB 3CSFA 3EHRA 2F37A 4J8EA 5G2NA 5C1DA 5AJDA 5AQ7A 5CRUA 5EN5D 1UW4B 3D9IA 5ARGA 5JA4D 3VLDA 3LCAA 3KEZA 5G55A 1A17A 4JPSA 3JYSA 1MQSA 5AQAA 3DBSA 3L16A 1KPSB 3LKUA 2V5QC 1H6OA 4UQYA 5EILA 3SFYA 2IY0C 3SZ7A 3F6QA 2RG8A 3ESKA 4C0MA 2KC7A 4K5AB 4N39A 2XCBA 1V55E 1TN7A 4CDMA 4GTVA 3T5VA 2VSYA 3JQ1A 3ABKE 4J8FA 2A4ZA 3EHQA 2IFUA 4WUYA 3UXGA 1NA3A 2P9UG 3D9JA 1N0RA 3EU9A 4BT9A 1QBQA 4PUCA 1S0PA 3TWWA 2OEVA 2QYJA 3ONLA 1FPPA 2XGSA 4FHKA 5G04J 1TYQG 3UM1A 5CECB 5LFAA 4GB9A 4EBAG 2KZTA 3CHPA 3FUFA 3D9PA 3KAEA 4ABNA 1SA4A 3QDNA 3RAUA 4PH4B 2YNQA 5FIOA 3EJNA 4GU5A 4ILIA 2H6FA 2XPIA 3T8MA 5AAOA 3TWTA 5EKQD 4WWNA 2XRZA 1N4RA 1JCRA 5BT1A 4G24A 2V4LA 3UT7A 5E76A 3UKRG 4R7LA 5LCWJ 4U0UA 3LJ3A 2J49A 1ZU2A 2L0IA 3R9MA 4AY5A 4UWKA 2I1KA 3E4BA 4TUUA 3T5XA 4RG9A 3PZ3A 5AARA 1N94A 3HXFA 4UI9J 3TWSA 4N2QA 1BD8A 3OTNA 4CGWA 1AP7A 3UX4A 4WWPA 5FTPA 2ZGGA 2F8XK 5KNGA 2WB2A 5AIJA 1UJKA 1TJFA 3PVLA 5LX8A 3IXEA 4N5CA 3P2BA 2IF4A 3O4ZA 2WXQA 3ZKJA 1OCRE 2IU1A 3R7QA 2AXZA 1IQUA 4B0ZA 3FU0A 4L1BA 3UM2A 4IULA 4IN3B 4HORA 3ZIMA 4O60A 1OWOA 4F7AA 1K8KG 3FFLA 1HX8A 5JMND 4P29A 4L2LA 3TWRA 5AQ9A 2J08A 3AS5A 2NSZA 4C9BB 3LYAA 1SZ9A 2DZOA 4AIFA 4JHJA 3TG4A 3Q9UC 1JWGA 4TXQA 3V30A 1FVFA 4HRNA 5EIDA 3ZHEB 4KYOB 3SBSA 5ENNA 3PZ2A 2P9IG 4JD2G 3V79K 3IEGA 1PC2A 3PREA 3PUJA 3B95A 1BPOA 2IJGX 3ZNGA 4G2VA 1E7VA 4TV3A 5A6CA 4TUMA 1KLXA 1OXJA 4U95D 1H2TC 4V3IA 5EDSA 1N52A 2JEKA 3CHQA 3UIPC 1E8YA 3HXBA 1WG0A 4G1TA 3ZGQA 2I2OA 4HVBA 3PH0C 5BUZA 3SO8A 1TEZA 2B0OE 4ANUA 3IHYA 2JLBA 3MV3B 2XCCA 4HLEA 3FUIA 3QWVA 2KCLA 1S64A 4I6GA 2DWZA 4CDNA 2WXHA 3MEKA 3FUEA 3MKRA 2EQXA 4NACA 4J7WA 1OCCE 1HH8A 1QNFA 4RQIA 3DSTA 1KZOA 1OWPA 4I9EA 2AWIA 3PE3A 4CZ2D 4LNUD 4DLOA 1SVXA 4HOTA 3QWPA 2WXKA 3HRAA 2VTBB 3SF4A 5H7PA 4AY6A 4BFRA 3CR3A 4FU3A 1TNZA 4XI0A 1WDYA 2DZNA 5BXUA 2IOLA 2AXVA 3FU5A 2VGEA 4BX8A 3VTXA 1TN8A 1NZNA 4GTTA 3FHEA 4ILHB 4KBQA 3APCA 4A3VA 2XHEA 4XX5A 4YDYA 5HS0A 3U64A 5IY5E 2QYUA 3QARA 5FJYA 3KSQA 2LUHA 1KZPA 2L9BA 1X81A 3ENEA 3ZN3A 1D9SA 5LOZA 2Y4UA 3CQCB 4XI9A 3CGHA 3C5RA 2HR2A 3UM3A 4EZLA 2CHZA 4WAFA 3S7DA 3ZHEA 1FVHA 3ULEG 4ACKA 2BKKB 3PRZA 3QNKA 2WXFA 3SGHA 2VQ2A 1A5EA 2UWJG 4JA7A 4AEZC 4BTAA 3NOCD 4LEUA 3C98A 1MYOA 2V8SE 3EUVA 1DCEA 4XIFA 2XRYA 5FQ7A 3PEVB 3ZUVB 3AU4A 2VSXE 3TWUA 5T8IA 5D0QD 3ZEFA 4BEPA 1HG2A 2RFAA 4GMRA 4UUCA 2VJ8A 3GZSA 3GZ2A 2ZXWE 3LVQE 4B94A 3DWLG 2R5SA 5EX0A 3DRAA 3RRUA 1Z5SC 2C0LA 4DJAA 3D9OA 1K1BA 1UG3A 4BWRA 4HNAD 3Q15A 2KZTB 5CCLA 5JHBA 3QK0A 1YMPA 2GRMA 3L6AA 1V54E 4LCTA 3RIBA 3CKBA 1MZCA 4K5BA 1N4SA 4HBDA 4UWHA 3PZ1A 3C3RA 2ETCA 2FBNA 2P58C 3ISMC 3PZDA 3J5QB 1E7UA
chains in the Genus database with same CATH topology
3D9NA 3R7RA 2VYIA 4PH4B 2YNQA 3ZPJA 1IHGA 3APFA 1ZBPA 4KZ0A 3L13A 3EJNA 4GU5A 5T3RA 2RD0A 3FEXA 2VTBA 1UJJA 3FTYA 4ILIA 3CVXA 4YNDA 4AJWA 3IBEA 4G11A 1NA0A 3QJZA 4B89A 2XPIA 1Y8MA 4PS3A 3T8MA 3CVVA 1E96B 4AOFA 5EKQD 3MZLB 4WWNA 3CHMA 2GW1A 2XRZA 5AYWD 3LS8A 5E75A 4U63A 4D10C 2WXPA 3RU0A 4AV7A 3S7FA 4I1OB 4JHKA 2OV8A 3ML8A 3FH8A 3LY7A 3QC1A 4BY6A 3CVYA 4PS7A 3HIZA 5BT1A 4G24A 3ZYKA 4ATGA 2YHCA 2FO7A 3ML9A 2V4LA 5G05C 3UT7A 2CHWA 3FUDA 5ANLA 5E76A 3P1UA 2YINA 2MHKA 4GMJA 2QFCA 4R7LA 2X6IA 5LCWJ 4U0UA 4GZDA 3LJ3A 1EPUA 3U66A 2J49A 1ZU2A 3TXNA 3RO3A 4IRUA 4GZCA 3TXMA 2L0IA 2UY1A 3LEWA 2KATA 3K9IA 3L54A 2PM7A 4AY5A 3UT8A 1UN8A 4JVSA 4UWKA 4A1SA 3U9WA 3RKVA 4ANXA 2J4DA 2I1KA 3E4BA 4TUUA 5CHEE 1LF8A 2AXUA 4HOUA 4YVQC 3T5XA 3ESLA 3VTXA 3I3NA 4RG9A 5JJTA 5AENA 4GA1A 3Q5MA 1B89A 2WXJA 3TG5A 1U3DA 2J09A 4NQ0A 1H6KA 1Z6TA 2FULA 4I17A 4UI9J 5AJLA 3S7BA 2DBAA 5DIZA 3VTYA 4A55A 5KCMA 4ANWA 4RVBA 2BTDA 3SD5A 2LNIA 4N2QA 4F3VA 2WPVA 3OTNA 4CGWA 3UMVA 4I6EA 4APFA 3BEEA 3S7JA 2GGFA 3UX4A 2VGXA 2PM6A 4WWPA 4ACLA 4UQZA 5FTPA 4JEUA 3MA5A 5AIJA 1UJKA 4K03A 2WB2A 3D3MA 3FWVA 3FUJA 4HFGA 1EYHA 3AS4A 1TJFA 3PVLA 4FULA 4KMOA 3URZA 3ZXSA 5KJMA 5LX8A 4N5CA 3EDTB 3P2BA 4N2SA 2IF4A 3O4ZA 1WY6A 1XNFA 4U0ZA 3FTVA 1HXIA 3NZSA 2WXQA 1XGWA 5A7DB 2WQ7A 1WM5A 4PDXA 2IU1A 2NC9A 2V5FA 2HO1A 1X5BA 4O6FA 3R7QA 4EECA 2AXZA 2C2LA 3KS2A 4QFVA 2CFUA 2HYZA 2WXNA 1IQUA 4NRHB 2L0TB 3PE4A 4B0ZA 3FU0A 3CLJA 4L1BA 4CEMA 2X38A 3SFZA 4IULA 4IN3B 2V0PA 4DPRA 2MOWA 1YA0A 4HORA 4B8CB 3ZIMA 4CRWA 1OWOA 4M3OA 2IOSA 4WNDA 4KXKB 4GYOA 4F7AA 2PQNA 2C0MA 2HM8A 2LSUA 1HFAA 3GYZA 2Q7FA 4JZYA 4BT8A 4YVOA 3ZYLA 4F53A 3ASGA 3FFLA 4DI4A 4C0EA 3ZRHA 2Y4TA 4FLBA 1HX8A 2OOEA 5C2YA 3FTUA 2IQCA 4A1GA 2WXRA 1WAO1 5HQ8A 4P29A 4L2LA 3LY8A 2J08A 3FTSA 4PS8A 2WMOA 3ASDA 3AS5A 4XZ4A 5LP0A 4JW1A 3UUXA 3WXXA 2NSZA 3QOUA 3HHMA 1U3CA 4C9BB 3IHVA 3LYAA 4CT0A 3VLEA 3MX3A 1SZ9A 2GRLA 4AIFA 4JHJA 2J9QA 4HXIA 3O48A 1E8WA 3TG4A 3FTZA 3OAWA 5HI7A 3MGBA 4CT4A 2LSVA 5BV1A 3EIQC 1OWLA 5FQ4A 3SI5A 2KM4A 4AM9A 1JWGA 4N3CA 4KT6B 3HVEB 3JCKC 1TJCA 1H2UA 2WMNA 1FVFA 3FP3A 4F1SA 3EHMA 3FUNA 3FUKA 3ZHEB 4EBAA 3CIAA 4KYOB 2XEVA 4LUNU 3SBSA 5ENNA 2E0IA 4BX9A 2FI7A 3B7RL 4N3AA 5ANRA 4GPKA 4XE0A 3RJVA 4XKBA 1MHQA 2IONA 4MLPA 1JWFA 4Q94A 1SZAA 3G2UA 4OVUA 3QKYA 4UWFA 3IEGA 3VLFA 4G25A 1PC2A 5JJ6A 2OVBA 3PREA 2YHEA 5FWQA 1EF1C 1KT1A 4UI9C 2PQRA 4MS6A 3FUMA 4JEHA 4GYYA 3PUJA 3FDHA 4ANVA 3KD7A 3B7SA 3U3WA 3HYMB 3ULQA 4DI3A 4JHRA 2WXLA 4FJYA 5CCMA 3I4GA 3ASHA 4TRQA 4GA2A 3HVEA 3Q47B 1HO8A 1BPOA 4GZ3A 3ZVVA 2IJGX 4DLQA 4U8HA 4G2VA 1E7VA 4I1AA 4KVMA 3ONKA 4TV3A 2A5UA 4FP7A 3TJPA 5A6CA 4UI9K 4BSXA 3S2AA 2DIWA 2LAHA 4RSYA 1L5JA 1Z3XA 5FZSA 4Q69A 3FH5A 1PAQA 3ZYMA 1KLXA 2L6JA 4AXHA 4J0UA 3CVNA 3ASFA 3CKCA 4JL0A 1H2TC 4HS2A 4WNFA 3FU3A 2XPZA 1N54A 3FEYA 3LY9A 4JC8A 4V3IA 4OYSA 1HE8A 4J8DA 4WNEA 4WWOA 3JQ0A 4J6IA 1N52A 3EIJA 3CK9A 2JEKA 4GAAA 1OWNA 4E85A 3CHQA 2X6FA 3CHRA 1E8YA 4EPZA 3TGOA 2WXGA 2WQHA 3PS6A 4G1TA 4IYPA 4MKTA 4CDRA 3ZGQA 4FJZA 3FTWA 2I2OA 4FC8A 2CHXA 4A3TA 4HVBA 3D9MA 4JXTA 3TAXA 3CVUA 3PH0C 5BUZA 2CG2A 4GYWA 5G04C 3FU6A 1TEZA 2BUGA 5ARFA 4FADA 3UT4A 5G05J 1E8XA 4GZ5A 2X6HA 4ANUA 3IHYA 4CGVA 2JLBA 3MV3B 2I6HA 2XCCA 4HLEA 3FUIA 3QWVA 2CG3A 4JA9A 2KCLA 3L08A 1ELWA 1VDYA 4J8SA 4K0RA 3MKQB 4G23A 3CHSA 2E2EA 4I6GA 3APDA 5A23A 4CDNA 2WXHA 3MEKA 3FUEA 3MKRA 3CSTA 2EQXA 4FLHA 2WXOA 2X6KA 1E8ZA 4NACA 2WXMA 1EDUA 2CFZA 1NP7A 1HH8A 1H2VC 4I6JA 5FT9A 3GW4A 1QNFA 3PUKA 2R17C 1OWPA 3NQPA 2WM9A 3TL5A 4HOQA 5FZQA 4I9EA 1OUVA 3B7TA 2AWIA 3ZFWA 2J07A 5T4YA 1ELRA 3PE3A 4I9CA 1OWMA 4DLOA 4Q96A 4HOTA 3QWPA 4FHJA 1DNPA 4H7XA 2WXKA 2VTBB 3CVLA 4E6HA 1GW6A 3DPDA 3PEUB 1UN9A 5D0OD 2VSNA 3Q4AB 5J08A 1Y6IA 3SF4A 4MRUA 3LPZA 3CEQA 4I2WA 5J90A 4GMLA 1QZ2A 1H0AA 4AY6A 3MV2B 4BFRA 3CR3A 4KZCA 3I4RB 4FU3A 5LCWC 2YQ8A 4XI0A 2WVIA 4N3BA 3RRNB 3U4TA 5EX3A 3B13A 1JUQA 3D9LA 2IOLA 4RG6A 2OVFA 1PY1A 2AXVA 3FY4A 3OXFA 1E90A 3FU5A 3I5PA 5FQ6A 2BF0X 4ILGA 4FA6A 4BX8A 2XPYA 3G2TA 1IQRA 1DVPA 3CVPA 3FTXA 1NZNA 3MJWA 3QB2A 3GZ1A 1P5QA 5FZRA 2XQ0A 3FHEA 3LXUX 4H7YA 4LRZA 4OVVA 4ILHB 3SHFA 4KBQA 5DBKA 3OXLA 5KJLA 3LVRE 4W9RA 4BTBA 3APCA 4A3VA 3CK8A 3BG1B 5KJKA 5BPPA 2X3MA 2LAIA 2LO6A 2XHEA 2I9CA 4I2ZA 3R9AB 4AVXA 3B7UX 2X6JA 3G2VA 4XX5A 5BW8C 3U64A 3QAQA 4XKCA 4UWGA 1HU3A 3HDXA 5FQ8A 2PZIA 3QARA 2PL2A 2UY1B 5FJYA 2J4BA 1JPLA 2VSOE 2L9BA 4I1MA 3ENEA 2WXIA 2FEZA 4L2YA 3ZN3A 3L17A 5LOZA 2Y4UA 3AS8A 3CQCB 4XI9A 3IKOB 5JHAA 3PNLB 3CGHA 4GCOA 2R59A 2HR2A 4EZLA 3N71A 2CHZA 3Q49B 1HF8A 3CV0A 4WAFA 3S7DA 5EDSA 3ZHEA 3NZUA 1FVHA 3AU5A 4UWLA 5CMWA 2AVPA 4ACKA 3QNKA 3PRZA 4Y6CA 2DCPA 2WXFA 5BV0A 5KJNA 3SGHA 2VQ2A 4GZ6A 3RRMB 2UWJG 1HG5A 4JA7A 4AEZC 2ZU6B 3CSFA 4DK5A 4BTAA 2VGYA 4U0SA 3CHOA 4J8EA 4GA0A 4LEUA 3C98A 2V8SE 5G2NA 2NXPA 4UQXA 5C1DA 4WNGA 3FH7A 5AJDA 1SQMA 2VGXB 3CQGB 1UW4B 4XIFA 2XRYA 3D9IA 3ZW3A 5M72A 4URKA 1Z3YA 5ARGA 5FQ7A 3PEVB 3VLDA 2MRIA 3LCAA 3KEZA 3RO2A 3AU4A 2VSXE 4LERA 3PDNA 1H19A 3FULA 3JUIA 4EZKA 5G55A 1A17A 4JPSA 3JYSA 1MQSA 4AP2A 4B8AA 3LDZA 5T8IA 4EQFA 2XGOA 5D0QD 3ZEFA 3DBSA 1HG2A 5JJ7A 1ELKA 1INZA 3L16A 3QWWA 2VJ8A 4Y6WA 5CMYA 2Y3AA 3CK7A 3G2WA 3GZSA 3LKUA 3GZ2A 3LVQE 4B94A 4UQYA 4NURA 3NF1A 3SZ7A 2R5SA 3PNTB 2RG8A 5EX0A 1FCHA 3RRUA 2C0LA 4DJAA 2KCVA 3ESKA 4C0MA 2KC7A 3UPVA 2XGMA 2ILRA 3SBTB 3D9KA 3D9OA 3BG0B 4EZJA 4N39A 3CVQA 4G26A 3MCXA 1UG3A 2XCBA 4BWRA 1KT0A 3Q15A 2KZTB 1HZ4A 4CDMA 5CCLA 1W3BA 5JHBA 3QK0A 2QY7A 2GRMA 3T5VA 3L6AA 2VSYA 3IV0A 3UQ3A 3JQ1A 4ME2A 4LCTA 2M63A 4J8FA 3RIBA 3L22A 4HOSA 3MYVA 2A4ZA 2ONDA 3SNXA 3CKBA 2AW6A 2IFUA 4WUYA 3FUHA 2FF4A 4L7TA 3MKQA 3ZYQA 1NA3A 3D9JA 4U04A 4BT9A 3CVWA 3G2SA 3OXGA 4PUCA 4GCNA 1S0PA 4UWHA 1HS6A 3ONLA 4I43A 2XGSA 4APOA 4FHKA 4L23A 5G04J 2WQ6A 2FBNA 2P58C 2I1JA 5LFAA 3EHNA 4GB9A 4U07A 3PZDA 3RK6A 4EBAG 4CCAA 2KZTA 3CHPA 3FUFA 3D9PA 4KVOA 5BNWA 1E7UA 2KCKA 3KAEA 1QQEA 1IYGA 4ABNA 3QDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GGF A;  2RG8 A;  2NSZ A;  3FEX A;  5ANR A;  4GML A;  2VSX E;  4CEM A;  2I2O A;  2ION A;  4C9B B;  4IUL A;  3D3M A;  1H2V C;  3JUI A;  4B89 A;  4B8C B;  1UG3 A;  4JHJ A;  1PAQ A;  4CRW A;  1HU3 A;  2IOS A;  2ZU6 B;  4B8A A;  4GMJ A;  4CT4 A;  2KZT B;  2HM8 A;  3EIQ C;  1H2T C;  1H6K A;  2VSO E;  3FEY A;  1N54 A;  2FUL A;  2IOL A;  3L6A A;  3RK6 A;  1H2U A;  2KZT A;  1N52 A;  3EIJ A;  2IU1 A;  1UW4 B;  4JHK A;  4LUN U; 
#chains in the Genus database with same CATH topology
 3D9N A;  4XEI G;  2VYI A;  3R7R A;  1IHG A;  5T3R A;  2H6H A;  2VTB A;  3IBE A;  4G11 A;  1Y8M A;  1TNO A;  3CVV A;  1E96 B;  3CHM A;  5AYW D;  5E75 A;  4U63 A;  3LY7 A;  3HXD A;  3QC1 A;  4PS7 A;  2GRR B;  2YHC A;  3ML9 A;  5KNH D;  3FUD A;  3P1U A;  2YIN A;  2MHK A;  2X6I A;  4GZD A;  4IRU A;  2KAT A;  1MX2 A;  4JVS A;  2R05 A;  3U9W A;  2J4D A;  1LF8 A;  3ESL A;  2KBX A;  5JJT A;  4GTS A;  3T9K A;  1U3D A;  5ENQ D;  5AJL A;  4A55 A;  5KCM A;  4RVB A;  2BTD A;  4F3V A;  2WPV A;  3DEP A;  4DX6 D;  4I6E A;  3S7J A;  2GGF A;  2PM6 A;  3D3M A;  3FWV A;  2IO3 C;  1EYH A;  3AS4 A;  3UTM A;  4FUL A;  2XEN A;  1BI7 B;  3V2X A;  1XNF A;  1N9A A;  1WM5 A;  2NC9 A;  2HO1 A;  1D8E A;  1X5B A;  2C2L A;  4QFV A;  2CFU A;  3DEO A;  4NRH B;  3NBN B;  2HE0 A;  2X38 A;  3SFZ A;  4ATZ D;  4B8C B;  2XZT G;  2IOS A;  4GYO A;  2LSU A;  2Q7F A;  4BT8 A;  4F53 A;  3ZYL A;  4DI4 A;  4FLB A;  2OOE A;  3AG4 E;  3FTU A;  2DVW A;  2P9N G;  4A1G A;  5B3S E;  3FTS A;  4PS8 A;  3UUX A;  3QOU A;  2EIK E;  3HHM A;  3VLE A;  4HRL A;  2J9Q A;  5CEA A;  3O48 A;  3TWX A;  3OAW A;  3EIQ C;  5ITZ F;  1OWL A;  5FQ4 A;  3SI5 A;  4N3C A;  2WMN A;  1OCO E;  3FP3 A;  4EBA A;  4BX9 A;  1BU9 A;  2FI7 A;  2J8S D;  2GRN B;  3B7R L;  4N3A A;  1TN6 A;  4Q94 A;  3G2U A;  4OVU A;  3E34 A;  4A63 B;  2OVB A;  1KT1 A;  4UI9 C;  2PQR A;  3FUM A;  4GYY A;  3KD7 A;  3B7S A;  4FJY A;  3I4G A;  3DXK G;  3SQV A;  4DLQ A;  3ZVV A;  3ONK A;  3KEA A;  4UI9 K;  3S2A A;  4RSY A;  3FH5 A;  2L6J A;  3CKC A;  4WNF A;  1N54 A;  4WNE A;  4JC8 A;  4J8D A;  5ENT D;  4J6I A;  1G3N B;  3CK9 A;  4GAA A;  3JXI A;  1OWN A;  4E85 A;  4EPZ A;  3PS6 A;  1U2V G;  4IYP A;  3JUE A;  3UM0 A;  4U7E B;  4A3T A;  3TAX A;  4GYW A;  3DSS A;  1E8X A;  2H6I A;  2X6H A;  4CGV A;  2I6H A;  3L08 A;  2OCC E;  4K0R A;  3MKQ B;  5HRY A;  1H6P A;  2R02 A;  2JAB A;  2E2E A;  3APD A;  3NB2 A;  3CST A;  2WXO A;  2X6K A;  4GTM A;  2WXM A;  1DCQ A;  3PUK A;  3JXJ A;  2R17 C;  3NQP A;  4QQI A;  2GRO B;  5FZQ A;  2J07 A;  1ELR A;  4I9C A;  5ENO D;  4FHJ A;  1DNP A;  3CVL A;  5D0O D;  3Q4A B;  4MRU A;  3C3O A;  5J90 A;  4I2W A;  4MBG A;  3MV2 B;  2WVI A;  4N3B A;  5EX3 A;  1LD8 A;  3D9L A;  4FA6 A;  3CVP A;  5FZR A;  1O1R A;  4H7Y A;  4LRZ A;  4OVV A;  1AWC B;  3OXL A;  5KJL A;  4W9R A;  4BTB A;  3CK8 A;  3PZ4 A;  2X3M A;  3R9A B;  2I9C A;  4AVX A;  3BQO A;  3B7U X;  3G2V A;  5BW8 C;  3D9H A;  4UWG A;  2PZI A;  2UY1 B;  4I1M A;  1RZ4 A;  4L2Y A;  5FIN A;  1HF8 A;  4YDW A;  3NZU A;  4UWL A;  5CMW A;  5ENR D;  2AVP A;  4Y6C A;  5BV0 A;  1TNB A;  4F1P A;  4DK5 A;  4U0S A;  3CHO A;  4M7C A;  2NXP A;  4UQX A;  3FH7 A;  2VGX B;  4BER A;  3CQG B;  3ZW3 A;  5M72 A;  4URK A;  1Z3Y A;  1Q2Z A;  2MRI A;  3FUL A;  3JUI A;  4EZK A;  4EQF A;  2ETB A;  2QZA A;  1INZ A;  4F6R D;  2ZGD A;  4Y6W A;  1N4P A;  4NUR A;  3NF1 A;  3PNT B;  1FCH A;  2IO2 C;  2KCV A;  3UPV A;  3D9K A;  3CVQ A;  4G26 A;  3V31 A;  1HZ4 A;  2H6G A;  3NAW A;  3ABM E;  4BET A;  2Y1L E;  4ME2 A;  5B1B E;  2M63 A;  3L22 A;  3V2O A;  3SNX A;  3BU8 A;  2AW6 A;  2FO1 E;  4ZFH A;  3FUH A;  2FF4 A;  3MKQ A;  3CVW A;  4I43 A;  1N0Q A;  2WQ6 A;  4L23 A;  3AG2 E;  1OT8 A;  5ENP D;  4KVO A;  5BNW A;  1QQE A;  1IYG A;  4B93 B;  3Q9N C;  1D8D A;  3APF A;  3L13 A;  1UJJ A;  3FTY A;  2RKK A;  3QJZ A;  4B89 A;  3LS8 A;  2R2L A;  2GRP B;  4D10 C;  2WXP A;  3RU0 A;  4DX2 A;  4I1O B;  1S70 B;  4JHK A;  3ML8 A;  3FH8 A;  3E33 A;  4BY6 A;  3CVY A;  3ZXP A;  3HIZ A;  4X8Q A;  4LNG A;  3ZYK A;  4ATG A;  2FO7 A;  5G05 C;  5D2M C;  2CHW A;  2QFC A;  3UIO C;  3U66 A;  3TXN A;  1BI8 B;  2UY1 A;  3DSV A;  3LEW A;  3L54 A;  3UT8 A;  4A1S A;  4YDO A;  3RKV A;  4ANX A;  2AXU A;  4YVQ C;  3LJN A;  3I3N A;  4GTQ A;  5AEN A;  4GA1 A;  4G8K A;  1DC2 A;  4NQ0 A;  2R03 A;  1H6K A;  1O1S A;  4LNB A;  1Z6T A;  2FUL A;  4C48 B;  3S7B A;  3VTY A;  2LNI A;  2VGX A;  5CRV A;  3FUJ A;  4KMO A;  3SFX A;  4CYM D;  4TXR A;  3B7B A;  3EDT B;  1WY6 A;  1UOH A;  3FTV A;  1HXI A;  5A7D B;  3ABL E;  2XS8 A;  2V5F A;  3DSX A;  2WXN A;  4DX5 D;  3PE4 A;  1YA0 A;  1MX4 A;  4CRW A;  4M3O A;  4WND A;  4KXK B;  2C0M A;  2HM8 A;  2V4H C;  1HFA A;  3GYZ A;  1IKN D;  3ASG A;  4C0E A;  2Y4T A;  4EHM A;  2IQC A;  4JB8 P;  1S63 A;  3LY8 A;  4XZ4 A;  1U3C A;  5ENS D;  4CT0 A;  2ZIR A;  2EIJ E;  4HXI A;  3MGB A;  2LSV A;  4AM9 A;  5D66 A;  1YCS B;  1TJC A;  4U8V D;  4F1S A;  3FUN A;  3FUK A;  4LUN U;  4XE0 A;  4XKB A;  1MHQ A;  4HI8 A;  2ION A;  4MLP A;  1JWF A;  1SA5 A;  3VLF A;  5FWQ A;  1EF1 C;  4MS6 A;  4JEH A;  2A5E A;  4ANV A;  3U3W A;  3HYM B;  1IXV A;  4DI3 A;  1LD7 A;  2P9S G;  2P9P G;  5CCM A;  3ASH A;  4GA2 A;  3HVE A;  4K5C A;  3T8K A;  4FP7 A;  1L5J A;  1K3Z D;  1MJ0 A;  1PAQ A;  4AXH A;  3CVN A;  4JL0 A;  1TNY A;  3FU3 A;  3FEY A;  1LTX A;  3L82 A;  4OYS A;  1HE8 A;  4WWO A;  3TGO A;  4MKT A;  2Y69 E;  3FTW A;  4FC8 A;  2CHX A;  3CVU A;  2QC9 A;  2CG2 A;  2P9K G;  5G04 C;  3FU6 A;  2BUG A;  4NIK A;  3UT4 A;  4GTR A;  2CG3 A;  4JA9 A;  5AN8 A;  1ELW A;  5KWD A;  4G23 A;  3E30 A;  2BKG A;  3Q78 A;  2IEJ A;  4Z68 A;  3Q73 A;  1E8Z A;  2Y0B G;  1NP7 A;  1H2V C;  2EIN E;  5FT9 A;  3L9T A;  2WM9 A;  3B7T A;  5T4Y A;  4H7X A;  4BSZ B;  4E6H A;  3DPD A;  2NYJ A;  1UN9 A;  2VSN A;  1O1T A;  1QYM A;  4GML A;  1QZ2 A;  3HXE A;  1H0A A;  5B1A E;  4GTO A;  5LCW C;  3Q75 A;  3RRN B;  3U4T A;  5AQB A;  4HQD A;  4OAU C;  1PY1 A;  3OXF A;  4ILG A;  4LG6 A;  2XPY A;  1IQR A;  3FTX A;  3QB2 A;  3GZ1 A;  2LXM A;  4DX7 D;  3W9G A;  5KJK A;  3BG1 B;  5BPP A;  2LAI A;  2LO6 A;  4I2Z A;  2EIM E;  1HU3 A;  3HDX A;  2PL2 A;  1JPL A;  2GRQ B;  2VSO E;  5JHA A;  3IKO B;  1MX6 A;  3KSL A;  2R59 A;  3DSW A;  3Q49 B;  3CV0 A;  1FT1 A;  2OEW A;  3X2Q E;  2DCP A;  5KJN A;  1HG5 A;  2DYS E;  2ZU6 B;  4RLY A;  2VGY A;  4GA0 A;  3Q7F A;  4L9P A;  4WNG A;  1SQM A;  3BUA A;  2LXL A;  3SY2 A;  3ZU7 B;  3RO2 A;  4LER A;  3RSE G;  3C3Q A;  3PDN A;  1H19 A;  3DPY A;  3J5P A;  4AP2 A;  4B8A A;  3LDZ A;  2XGO A;  5JJ7 A;  1ELK A;  4O1O A;  3QWW A;  5CMY A;  2Y3A A;  3CK7 A;  3G2W A;  3UI2 A;  4OAV B;  2XGM A;  2ILR A;  1N95 A;  3SBT B;  3BG0 B;  4EZJ A;  1TR4 A;  2B6C A;  1JCQ A;  3MCX A;  2KXP C;  1KT0 A;  1W3B A;  2QY7 A;  3IV0 A;  4LSZ E;  3UQ3 A;  4HOS A;  3MYV A;  2OND A;  4L7T A;  3ZYQ A;  4U04 A;  5BXO A;  3G2S A;  3OXG A;  4GCN A;  1HS6 A;  2RFM A;  1TNU A;  4APO A;  2I1J A;  3EHN A;  3RK6 A;  4U07 A;  4CCA A;  2KCK A;  1SW6 A;  3E32 A;  3ZPJ A;  1ZBP A;  4KZ0 A;  4HB5 A;  2RD0 A;  3FEX A;  3CVX A;  4YND A;  4AJW A;  1NA0 A;  4PS3 A;  1OY3 D;  1ZB1 A;  4AOF A;  3MZL B;  4J8Y A;  2GW1 A;  4AV7 A;  3S7F A;  2OV8 A;  4DUI A;  4TXP A;  5EYL A;  5EYP F;  3UIN C;  5ANL A;  4GMJ A;  1EPU A;  3AG3 E;  3RO3 A;  4GZC A;  3TXM A;  3K9I A;  2PM7 A;  1UN8 A;  3W9F A;  2EIL E;  1N4Q A;  5CHE E;  4HOU A;  2PNN A;  3Q5M A;  1B89 A;  2WXJ A;  3TG5 A;  3E37 A;  2J09 A;  1O5M A;  4HI9 A;  4I17 A;  3Q79 A;  2DBA A;  2DYR E;  5DIZ A;  4U8Y D;  4ANW A;  2BED A;  3SD5 A;  1BLX B;  3UMV A;  4APF A;  3BEE A;  4ACL A;  4UQZ A;  4JEU A;  3MA5 A;  4K03 A;  2XEE A;  4HFG A;  5KJM A;  3URZ A;  3ZXS A;  1YYH A;  4N2S A;  3DXM G;  4U0Z A;  3NZS A;  1XGW A;  1NI1 A;  2WQ7 A;  4PDX A;  1NL4 A;  4EEC A;  4O6F A;  3TWQ A;  3KS2 A;  2HYZ A;  5KBA A;  4N5Q A;  3NOG D;  2L0T B;  3CLJ A;  4CEM A;  4G8L A;  2V0P A;  4DPR A;  2MOW A;  2L6B A;  5HKP A;  3Q7A A;  2PQN A;  4JZY A;  4YVO A;  3ZRH A;  5C2Y A;  2WXR A;  1WAO 1;  5HQ8 A;  3AAA C;  2WMO A;  3ASD A;  5LP0 A;  4JW1 A;  3WXX A;  3EU5 A;  4HLL A;  4O1P A;  3IHV A;  3MX3 A;  2GRL A;  1E8W A;  3FTZ A;  5HI7 A;  4CT4 A;  1NFI E;  5BV1 A;  2KM4 A;  4KT6 B;  3UKU G;  1FT2 A;  3HVE B;  3JCK C;  1H2U A;  3EHM A;  1RW2 A;  3HXC A;  3ASN E;  3CIA A;  2P2C P;  2XEV A;  2E0I A;  2XZD G;  5ANR A;  4GPK A;  2XEH A;  3RJV A;  5CER B;  1SZA A;  3C72 A;  3QKY A;  4UWF A;  4G25 A;  5JJ6 A;  5CBO A;  2YHE A;  2ZIS A;  3FDH A;  3ULQ A;  4JHR A;  2WXL A;  2P9L G;  4TRQ A;  4GZ3 A;  3Q47 B;  1HO8 A;  4U8H A;  4DRX E;  4I1A A;  4KVM A;  2A5U A;  3TJP A;  4BSX A;  2DIW A;  2LAH A;  1Z3X A;  5FZS A;  4Q69 A;  1IHB A;  3ZYM A;  4HRM B;  1OCZ E;  4J0U A;  3ASF A;  4HS2 A;  1N11 A;  2XPZ A;  3LY9 A;  3JQ0 A;  3EIJ A;  2X6F A;  3CHR A;  2WXG A;  2WQH A;  2F0Y A;  4CDR A;  4FJZ A;  3D9M A;  4JXT A;  5ARF A;  4FAD A;  5G05 J;  4GZ5 A;  2ETA A;  1VDY A;  4J8S A;  3AG1 E;  1JCS A;  5CBN A;  3CHS A;  5A23 A;  4FLH A;  1EDU A;  2CFZ A;  4I6J A;  3GW4 A;  4GPM A;  2MYO A;  3HG0 D;  3TL5 A;  4HOQ A;  4BES A;  1OUV A;  3ZFW A;  1OWM A;  4Q96 A;  3ULY A;  4ZHB A;  1GW6 A;  3PEU B;  2XS1 A;  5J08 A;  1Y6I A;  3LPZ A;  3CEQ A;  2AJA A;  4U96 D;  4KZC A;  3I4R B;  2YQ8 A;  4GTP A;  3B13 A;  3DSU A;  1JUQ A;  4RG6 A;  2OVF A;  3FY4 A;  1E90 A;  3I5P A;  5FQ6 A;  2BF0 X;  3AJI A;  3G2T A;  1DVP A;  3MJW A;  1P5Q A;  2XQ0 A;  2F8Y A;  3LXU X;  3SHF A;  4YDE A;  5DBK A;  5EIB E;  3LVR E;  2X6J A;  3QAQ A;  4XKC A;  4DX1 A;  5FQ8 A;  2J4B A;  2WXI A;  2FEZ A;  3L17 A;  3AS8 A;  3PNL B;  1K1A A;  4GCO A;  3N71 A;  3WG7 E;  3ASO E;  3AU5 A;  3TWV A;  5CED B;  4GZ6 A;  3RRM B;  3CSF A;  3EHR A;  2F37 A;  4J8E A;  5G2N A;  5C1D A;  5AJD A;  5AQ7 A;  5CRU A;  5EN5 D;  1UW4 B;  3D9I A;  5ARG A;  5JA4 D;  3VLD A;  3LCA A;  3KEZ A;  5G55 A;  1A17 A;  4JPS A;  3JYS A;  1MQS A;  5AQA A;  3DBS A;  3L16 A;  1KPS B;  3LKU A;  2V5Q C;  1H6O A;  4UQY A;  5EIL A;  3SFY A;  2IY0 C;  3SZ7 A;  3F6Q A;  2RG8 A;  3ESK A;  4C0M A;  2KC7 A;  4K5A B;  4N39 A;  2XCB A;  1V55 E;  1TN7 A;  4CDM A;  4GTV A;  3T5V A;  2VSY A;  3JQ1 A;  3ABK E;  4J8F A;  2A4Z A;  3EHQ A;  2IFU A;  4WUY A;  3UXG A;  1NA3 A;  2P9U G;  3D9J A;  1N0R A;  3EU9 A;  4BT9 A;  1QBQ A;  4PUC A;  1S0P A;  3TWW A;  2OEV A;  2QYJ A;  3ONL A;  1FPP A;  2XGS A;  4FHK A;  5G04 J;  1TYQ G;  3UM1 A;  5CEC B;  5LFA A;  4GB9 A;  4EBA G;  2KZT A;  3CHP A;  3FUF A;  3D9P A;  3KAE A;  4ABN A;  1SA4 A;  3QDN A;  3RAU A;  4PH4 B;  2YNQ A;  5FIO A;  3EJN A;  4GU5 A;  4ILI A;  2H6F A;  2XPI A;  3T8M A;  5AAO A;  3TWT A;  5EKQ D;  4WWN A;  2XRZ A;  1N4R A;  1JCR A;  5BT1 A;  4G24 A;  2V4L A;  3UT7 A;  5E76 A;  3UKR G;  4R7L A;  5LCW J;  4U0U A;  3LJ3 A;  2J49 A;  1ZU2 A;  2L0I A;  3R9M A;  4AY5 A;  4UWK A;  2I1K A;  3E4B A;  4TUU A;  3T5X A;  4RG9 A;  3PZ3 A;  5AAR A;  1N94 A;  3HXF A;  4UI9 J;  3TWS A;  4N2Q A;  1BD8 A;  3OTN A;  4CGW A;  1AP7 A;  3UX4 A;  4WWP A;  5FTP A;  2ZGG A;  2F8X K;  5KNG A;  2WB2 A;  5AIJ A;  1UJK A;  1TJF A;  3PVL A;  5LX8 A;  3IXE A;  4N5C A;  3P2B A;  2IF4 A;  3O4Z A;  2WXQ A;  3ZKJ A;  1OCR E;  2IU1 A;  3R7Q A;  2AXZ A;  1IQU A;  4B0Z A;  3FU0 A;  4L1B A;  3UM2 A;  4IUL A;  4IN3 B;  4HOR A;  3ZIM A;  4O60 A;  1OWO A;  4F7A A;  1K8K G;  3FFL A;  1HX8 A;  5JMN D;  4P29 A;  4L2L A;  3TWR A;  5AQ9 A;  2J08 A;  3AS5 A;  2NSZ A;  4C9B B;  3LYA A;  1SZ9 A;  2DZO A;  4AIF A;  4JHJ A;  3TG4 A;  3Q9U C;  1JWG A;  4TXQ A;  3V30 A;  1FVF A;  4HRN A;  5EID A;  3ZHE B;  4KYO B;  3SBS A;  5ENN A;  3PZ2 A;  2P9I G;  4JD2 G;  3V79 K;  3IEG A;  1PC2 A;  3PRE A;  3PUJ A;  3B95 A;  1BPO A;  2IJG X;  3ZNG A;  4G2V A;  1E7V A;  4TV3 A;  5A6C A;  4TUM A;  1KLX A;  1OXJ A;  4U95 D;  1H2T C;  4V3I A;  5EDS A;  1N52 A;  2JEK A;  3CHQ A;  3UIP C;  1E8Y A;  3HXB A;  1WG0 A;  4G1T A;  3ZGQ A;  2I2O A;  4HVB A;  3PH0 C;  5BUZ A;  3SO8 A;  1TEZ A;  2B0O E;  4ANU A;  3IHY A;  2JLB A;  3MV3 B;  2XCC A;  4HLE A;  3FUI A;  3QWV A;  2KCL A;  1S64 A;  4I6G A;  2DWZ A;  4CDN A;  2WXH A;  3MEK A;  3FUE A;  3MKR A;  2EQX A;  4NAC A;  4J7W A;  1OCC E;  1HH8 A;  1QNF A;  4RQI A;  3DST A;  1KZO A;  1OWP A;  4I9E A;  2AWI A;  3PE3 A;  4CZ2 D;  4LNU D;  4DLO A;  1SVX A;  4HOT A;  3QWP A;  2WXK A;  3HRA A;  2VTB B;  3SF4 A;  5H7P A;  4AY6 A;  4BFR A;  3CR3 A;  4FU3 A;  1TNZ A;  4XI0 A;  1WDY A;  2DZN A;  5BXU A;  2IOL A;  2AXV A;  3FU5 A;  2VGE A;  4BX8 A;  3VTX A;  1TN8 A;  1NZN A;  4GTT A;  3FHE A;  4ILH B;  4KBQ A;  3APC A;  4A3V A;  2XHE A;  4XX5 A;  4YDY A;  5HS0 A;  3U64 A;  5IY5 E;  2QYU A;  3QAR A;  5FJY A;  3KSQ A;  2LUH A;  1KZP A;  2L9B A;  1X81 A;  3ENE A;  3ZN3 A;  1D9S A;  5LOZ A;  2Y4U A;  3CQC B;  4XI9 A;  3CGH A;  3C5R A;  2HR2 A;  3UM3 A;  4EZL A;  2CHZ A;  4WAF A;  3S7D A;  3ZHE A;  1FVH A;  3ULE G;  4ACK A;  2BKK B;  3PRZ A;  3QNK A;  2WXF A;  3SGH A;  2VQ2 A;  1A5E A;  2UWJ G;  4JA7 A;  4AEZ C;  4BTA A;  3NOC D;  4LEU A;  3C98 A;  1MYO A;  2V8S E;  3EUV A;  1DCE A;  4XIF A;  2XRY A;  5FQ7 A;  3PEV B;  3ZUV B;  3AU4 A;  2VSX E;  3TWU A;  5T8I A;  5D0Q D;  3ZEF A;  4BEP A;  1HG2 A;  2RFA A;  4GMR A;  4UUC A;  2VJ8 A;  3GZS A;  3GZ2 A;  2ZXW E;  3LVQ E;  4B94 A;  3DWL G;  2R5S A;  5EX0 A;  3DRA A;  3RRU A;  1Z5S C;  2C0L A;  4DJA A;  3D9O A;  1K1B A;  1UG3 A;  4BWR A;  4HNA D;  3Q15 A;  2KZT B;  5CCL A;  5JHB A;  3QK0 A;  1YMP A;  2GRM A;  3L6A A;  1V54 E;  4LCT A;  3RIB A;  3CKB A;  1MZC A;  4K5B A;  1N4S A;  4HBD A;  4UWH A;  3PZ1 A;  3C3R A;  2ETC A;  2FBN A;  2P58 C;  3ISM C;  3PZD A;  3J5Q B;  1E7U A; 
#chains in the Genus database with same CATH homology
 3D9N A;  3R7R A;  2VYI A;  4PH4 B;  2YNQ A;  3ZPJ A;  1IHG A;  3APF A;  1ZBP A;  4KZ0 A;  3L13 A;  3EJN A;  4GU5 A;  5T3R A;  2RD0 A;  3FEX A;  2VTB A;  1UJJ A;  3FTY A;  4ILI A;  3CVX A;  4YND A;  4AJW A;  3IBE A;  4G11 A;  1NA0 A;  3QJZ A;  4B89 A;  2XPI A;  1Y8M A;  4PS3 A;  3T8M A;  3CVV A;  1E96 B;  4AOF A;  5EKQ D;  3MZL B;  4WWN A;  3CHM A;  2GW1 A;  2XRZ A;  5AYW D;  3LS8 A;  5E75 A;  4U63 A;  4D10 C;  2WXP A;  3RU0 A;  4AV7 A;  3S7F A;  4I1O B;  4JHK A;  2OV8 A;  3ML8 A;  3FH8 A;  3LY7 A;  3QC1 A;  4BY6 A;  3CVY A;  4PS7 A;  3HIZ A;  5BT1 A;  4G24 A;  3ZYK A;  4ATG A;  2YHC A;  2FO7 A;  3ML9 A;  2V4L A;  5G05 C;  3UT7 A;  2CHW A;  3FUD A;  5ANL A;  5E76 A;  3P1U A;  2YIN A;  2MHK A;  4GMJ A;  2QFC A;  4R7L A;  2X6I A;  5LCW J;  4U0U A;  4GZD A;  3LJ3 A;  1EPU A;  3U66 A;  2J49 A;  1ZU2 A;  3TXN A;  3RO3 A;  4IRU A;  4GZC A;  3TXM A;  2L0I A;  2UY1 A;  3LEW A;  2KAT A;  3K9I A;  3L54 A;  2PM7 A;  4AY5 A;  3UT8 A;  1UN8 A;  4JVS A;  4UWK A;  4A1S A;  3U9W A;  3RKV A;  4ANX A;  2J4D A;  2I1K A;  3E4B A;  4TUU A;  5CHE E;  1LF8 A;  2AXU A;  4HOU A;  4YVQ C;  3T5X A;  3ESL A;  3VTX A;  3I3N A;  4RG9 A;  5JJT A;  5AEN A;  4GA1 A;  3Q5M A;  1B89 A;  2WXJ A;  3TG5 A;  1U3D A;  2J09 A;  4NQ0 A;  1H6K A;  1Z6T A;  2FUL A;  4I17 A;  4UI9 J;  5AJL A;  3S7B A;  2DBA A;  5DIZ A;  3VTY A;  4A55 A;  5KCM A;  4ANW A;  4RVB A;  2BTD A;  3SD5 A;  2LNI A;  4N2Q A;  4F3V A;  2WPV A;  3OTN A;  4CGW A;  3UMV A;  4I6E A;  4APF A;  3BEE A;  3S7J A;  2GGF A;  3UX4 A;  2VGX A;  2PM6 A;  4WWP A;  4ACL A;  4UQZ A;  5FTP A;  4JEU A;  3MA5 A;  5AIJ A;  1UJK A;  4K03 A;  2WB2 A;  3D3M A;  3FWV A;  3FUJ A;  4HFG A;  1EYH A;  3AS4 A;  1TJF A;  3PVL A;  4FUL A;  4KMO A;  3URZ A;  3ZXS A;  5KJM A;  5LX8 A;  4N5C A;  3EDT B;  3P2B A;  4N2S A;  2IF4 A;  3O4Z A;  1WY6 A;  1XNF A;  4U0Z A;  3FTV A;  1HXI A;  3NZS A;  2WXQ A;  1XGW A;  5A7D B;  2WQ7 A;  1WM5 A;  4PDX A;  2IU1 A;  2NC9 A;  2V5F A;  2HO1 A;  1X5B A;  4O6F A;  3R7Q A;  4EEC A;  2AXZ A;  2C2L A;  3KS2 A;  4QFV A;  2CFU A;  2HYZ A;  2WXN A;  1IQU A;  4NRH B;  2L0T B;  3PE4 A;  4B0Z A;  3FU0 A;  3CLJ A;  4L1B A;  4CEM A;  2X38 A;  3SFZ A;  4IUL A;  4IN3 B;  2V0P A;  4DPR A;  2MOW A;  1YA0 A;  4HOR A;  4B8C B;  3ZIM A;  4CRW A;  1OWO A;  4M3O A;  2IOS A;  4WND A;  4KXK B;  4GYO A;  4F7A A;  2PQN A;  2C0M A;  2HM8 A;  2LSU A;  1HFA A;  3GYZ A;  2Q7F A;  4JZY A;  4BT8 A;  4YVO A;  3ZYL A;  4F53 A;  3ASG A;  3FFL A;  4DI4 A;  4C0E A;  3ZRH A;  2Y4T A;  4FLB A;  1HX8 A;  2OOE A;  5C2Y A;  3FTU A;  2IQC A;  4A1G A;  2WXR A;  1WAO 1;  5HQ8 A;  4P29 A;  4L2L A;  3LY8 A;  2J08 A;  3FTS A;  4PS8 A;  2WMO A;  3ASD A;  3AS5 A;  4XZ4 A;  5LP0 A;  4JW1 A;  3UUX A;  3WXX A;  2NSZ A;  3QOU A;  3HHM A;  1U3C A;  4C9B B;  3IHV A;  3LYA A;  4CT0 A;  3VLE A;  3MX3 A;  1SZ9 A;  2GRL A;  4AIF A;  4JHJ A;  2J9Q A;  4HXI A;  3O48 A;  1E8W A;  3TG4 A;  3FTZ A;  3OAW A;  5HI7 A;  3MGB A;  4CT4 A;  2LSV A;  5BV1 A;  3EIQ C;  1OWL A;  5FQ4 A;  3SI5 A;  2KM4 A;  4AM9 A;  1JWG A;  4N3C A;  4KT6 B;  3HVE B;  3JCK C;  1TJC A;  1H2U A;  2WMN A;  1FVF A;  3FP3 A;  4F1S A;  3EHM A;  3FUN A;  3FUK A;  3ZHE B;  4EBA A;  3CIA A;  4KYO B;  2XEV A;  4LUN U;  3SBS A;  5ENN A;  2E0I A;  4BX9 A;  2FI7 A;  3B7R L;  4N3A A;  5ANR A;  4GPK A;  4XE0 A;  3RJV A;  4XKB A;  1MHQ A;  2ION A;  4MLP A;  1JWF A;  4Q94 A;  1SZA A;  3G2U A;  4OVU A;  3QKY A;  4UWF A;  3IEG A;  3VLF A;  4G25 A;  1PC2 A;  5JJ6 A;  2OVB A;  3PRE A;  2YHE A;  5FWQ A;  1EF1 C;  1KT1 A;  4UI9 C;  2PQR A;  4MS6 A;  3FUM A;  4JEH A;  4GYY A;  3PUJ A;  3FDH A;  4ANV A;  3KD7 A;  3B7S A;  3U3W A;  3HYM B;  3ULQ A;  4DI3 A;  4JHR A;  2WXL A;  4FJY A;  5CCM A;  3I4G A;  3ASH A;  4TRQ A;  4GA2 A;  3HVE A;  3Q47 B;  1HO8 A;  1BPO A;  4GZ3 A;  3ZVV A;  2IJG X;  4DLQ A;  4U8H A;  4G2V A;  1E7V A;  4I1A A;  4KVM A;  3ONK A;  4TV3 A;  2A5U A;  4FP7 A;  3TJP A;  5A6C A;  4UI9 K;  4BSX A;  3S2A A;  2DIW A;  2LAH A;  4RSY A;  1L5J A;  1Z3X A;  5FZS A;  4Q69 A;  3FH5 A;  1PAQ A;  3ZYM A;  1KLX A;  2L6J A;  4AXH A;  4J0U A;  3CVN A;  3ASF A;  3CKC A;  4JL0 A;  1H2T C;  4HS2 A;  4WNF A;  3FU3 A;  2XPZ A;  1N54 A;  3FEY A;  3LY9 A;  4JC8 A;  4V3I A;  4OYS A;  1HE8 A;  4J8D A;  4WNE A;  4WWO A;  3JQ0 A;  4J6I A;  1N52 A;  3EIJ A;  3CK9 A;  2JEK A;  4GAA A;  1OWN A;  4E85 A;  3CHQ A;  2X6F A;  3CHR A;  1E8Y A;  4EPZ A;  3TGO A;  2WXG A;  2WQH A;  3PS6 A;  4G1T A;  4IYP A;  4MKT A;  4CDR A;  3ZGQ A;  4FJZ A;  3FTW A;  2I2O A;  4FC8 A;  2CHX A;  4A3T A;  4HVB A;  3D9M A;  4JXT A;  3TAX A;  3CVU A;  3PH0 C;  5BUZ A;  2CG2 A;  4GYW A;  5G04 C;  3FU6 A;  1TEZ A;  2BUG A;  5ARF A;  4FAD A;  3UT4 A;  5G05 J;  1E8X A;  4GZ5 A;  2X6H A;  4ANU A;  3IHY A;  4CGV A;  2JLB A;  3MV3 B;  2I6H A;  2XCC A;  4HLE A;  3FUI A;  3QWV A;  2CG3 A;  4JA9 A;  2KCL A;  3L08 A;  1ELW A;  1VDY A;  4J8S A;  4K0R A;  3MKQ B;  4G23 A;  3CHS A;  2E2E A;  4I6G A;  3APD A;  5A23 A;  4CDN A;  2WXH A;  3MEK A;  3FUE A;  3MKR A;  3CST A;  2EQX A;  4FLH A;  2WXO A;  2X6K A;  1E8Z A;  4NAC A;  2WXM A;  1EDU A;  2CFZ A;  1NP7 A;  1HH8 A;  1H2V C;  4I6J A;  5FT9 A;  3GW4 A;  1QNF A;  3PUK A;  2R17 C;  1OWP A;  3NQP A;  2WM9 A;  3TL5 A;  4HOQ A;  5FZQ A;  4I9E A;  1OUV A;  3B7T A;  2AWI A;  3ZFW A;  2J07 A;  5T4Y A;  1ELR A;  3PE3 A;  4I9C A;  1OWM A;  4DLO A;  4Q96 A;  4HOT A;  3QWP A;  4FHJ A;  1DNP A;  4H7X A;  2WXK A;  2VTB B;  3CVL A;  4E6H A;  1GW6 A;  3DPD A;  3PEU B;  1UN9 A;  5D0O D;  2VSN A;  3Q4A B;  5J08 A;  1Y6I A;  3SF4 A;  4MRU A;  3LPZ A;  3CEQ A;  4I2W A;  5J90 A;  4GML A;  1QZ2 A;  1H0A A;  4AY6 A;  3MV2 B;  4BFR A;  3CR3 A;  4KZC A;  3I4R B;  4FU3 A;  5LCW C;  2YQ8 A;  4XI0 A;  2WVI A;  4N3B A;  3RRN B;  3U4T A;  5EX3 A;  3B13 A;  1JUQ A;  3D9L A;  2IOL A;  4RG6 A;  2OVF A;  1PY1 A;  2AXV A;  3FY4 A;  3OXF A;  1E90 A;  3FU5 A;  3I5P A;  5FQ6 A;  2BF0 X;  4ILG A;  4FA6 A;  4BX8 A;  2XPY A;  3G2T A;  1IQR A;  1DVP A;  3CVP A;  3FTX A;  1NZN A;  3MJW A;  3QB2 A;  3GZ1 A;  1P5Q A;  5FZR A;  2XQ0 A;  3FHE A;  3LXU X;  4H7Y A;  4LRZ A;  4OVV A;  4ILH B;  3SHF A;  4KBQ A;  5DBK A;  3OXL A;  5KJL A;  3LVR E;  4W9R A;  4BTB A;  3APC A;  4A3V A;  3CK8 A;  3BG1 B;  5KJK A;  5BPP A;  2X3M A;  2LAI A;  2LO6 A;  2XHE A;  2I9C A;  4I2Z A;  3R9A B;  4AVX A;  3B7U X;  2X6J A;  3G2V A;  4XX5 A;  5BW8 C;  3U64 A;  3QAQ A;  4XKC A;  4UWG A;  1HU3 A;  3HDX A;  5FQ8 A;  2PZI A;  3QAR A;  2PL2 A;  2UY1 B;  5FJY A;  2J4B A;  1JPL A;  2VSO E;  2L9B A;  4I1M A;  3ENE A;  2WXI A;  2FEZ A;  4L2Y A;  3ZN3 A;  3L17 A;  5LOZ A;  2Y4U A;  3AS8 A;  3CQC B;  4XI9 A;  3IKO B;  5JHA A;  3PNL B;  3CGH A;  4GCO A;  2R59 A;  2HR2 A;  4EZL A;  3N71 A;  2CHZ A;  3Q49 B;  1HF8 A;  3CV0 A;  4WAF A;  3S7D A;  5EDS A;  3ZHE A;  3NZU A;  1FVH A;  3AU5 A;  4UWL A;  5CMW A;  2AVP A;  4ACK A;  3QNK A;  3PRZ A;  4Y6C A;  2DCP A;  2WXF A;  5BV0 A;  5KJN A;  3SGH A;  2VQ2 A;  4GZ6 A;  3RRM B;  2UWJ G;  1HG5 A;  4JA7 A;  4AEZ C;  2ZU6 B;  3CSF A;  4DK5 A;  4BTA A;  2VGY A;  4U0S A;  3CHO A;  4J8E A;  4GA0 A;  4LEU A;  3C98 A;  2V8S E;  5G2N A;  2NXP A;  4UQX A;  5C1D A;  4WNG A;  3FH7 A;  5AJD A;  1SQM A;  2VGX B;  3CQG B;  1UW4 B;  4XIF A;  2XRY A;  3D9I A;  3ZW3 A;  5M72 A;  4URK A;  1Z3Y A;  5ARG A;  5FQ7 A;  3PEV B;  3VLD A;  2MRI A;  3LCA A;  3KEZ A;  3RO2 A;  3AU4 A;  2VSX E;  4LER A;  3PDN A;  1H19 A;  3FUL A;  3JUI A;  4EZK A;  5G55 A;  1A17 A;  4JPS A;  3JYS A;  1MQS A;  4AP2 A;  4B8A A;  3LDZ A;  5T8I A;  4EQF A;  2XGO A;  5D0Q D;  3ZEF A;  3DBS A;  1HG2 A;  5JJ7 A;  1ELK A;  1INZ A;  3L16 A;  3QWW A;  2VJ8 A;  4Y6W A;  5CMY A;  2Y3A A;  3CK7 A;  3G2W A;  3GZS A;  3LKU A;  3GZ2 A;  3LVQ E;  4B94 A;  4UQY A;  4NUR A;  3NF1 A;  3SZ7 A;  2R5S A;  3PNT B;  2RG8 A;  5EX0 A;  1FCH A;  3RRU A;  2C0L A;  4DJA A;  2KCV A;  3ESK A;  4C0M A;  2KC7 A;  3UPV A;  2XGM A;  2ILR A;  3SBT B;  3D9K A;  3D9O A;  3BG0 B;  4EZJ A;  4N39 A;  3CVQ A;  4G26 A;  3MCX A;  1UG3 A;  2XCB A;  4BWR A;  1KT0 A;  3Q15 A;  2KZT B;  1HZ4 A;  4CDM A;  5CCL A;  1W3B A;  5JHB A;  3QK0 A;  2QY7 A;  2GRM A;  3T5V A;  3L6A A;  2VSY A;  3IV0 A;  3UQ3 A;  3JQ1 A;  4ME2 A;  4LCT A;  2M63 A;  4J8F A;  3RIB A;  3L22 A;  4HOS A;  3MYV A;  2A4Z A;  2OND A;  3SNX A;  3CKB A;  2AW6 A;  2IFU A;  4WUY A;  3FUH A;  2FF4 A;  4L7T A;  3MKQ A;  3ZYQ A;  1NA3 A;  3D9J A;  4U04 A;  4BT9 A;  3CVW A;  3G2S A;  3OXG A;  4PUC A;  4GCN A;  1S0P A;  4UWH A;  1HS6 A;  3ONL A;  4I43 A;  2XGS A;  4APO A;  4FHK A;  4L23 A;  5G04 J;  2WQ6 A;  2FBN A;  2P58 C;  2I1J A;  5LFA A;  3EHN A;  4GB9 A;  4U07 A;  3PZD A;  3RK6 A;  4EBA G;  4CCA A;  2KZT A;  3CHP A;  3FUF A;  3D9P A;  4KVO A;  5BNW A;  1E7U A;  2KCK A;  3KAE A;  1QQE A;  1IYG A;  4ABN A;  3QDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...