2IONA

Crystal structure of the c-terminal ma3 domain of pdcd4 (mouse); form2
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
129
structure length
129
Chain Sequence
QPVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIVMVLESTGESAFKMILDLLKSLWKSSTITIDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Programmed Cell Death 4, Pdcd4
publication title Structural basis for inhibition of translation by the tumor suppressor pdcd4.
pubmed doi rcsb
source organism Mus musculus
molecule tags Antitumor protein
total genus 55
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2006-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02847 MA3 MA3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2ionA00
2IU1A 1H2TC 4GMJA 4JHJA 1N52A 1UG3A 1HU3A 2IOSA 1H6KA 3FEXA 3L6AA 1PAQA 2IONA 4IULA 2I2OA 4GMLA 2VSXE 2VSOE 2GGFA 3FEYA 2HM8A 2KZTA 2RG8A 2FULA 4CEMA 1H2VC 2IOLA 4B8AA 2NSZA 3EIQC 5ANRA 4B8CB 1UW4B 2KZTB 3D3MA 1N54A 4LUNU 3JUIA 4CRWA 2ZU6B 3EIJA 1H2UA 4JHKA 4B89A 4C9BB 3RK6A 4CT4A
chains in the Genus database with same CATH superfamily
4BEPA 4UQZA 3ZXPA 5AJDA 1AWCB 3DPDA 3QAQA 2A5EA 3RRUA 3UIPC 4JPSA 3J5PA 1KZOA 1S63A 2DZOA 1UN9A 1QYMA 4LNUD 4HQDA 3CK7A 2FI7A 1H2UA 2WB2A 2DBAA 2IJGX 3CK9A 1MX6A 3SFZA 1N95A 4CDNA 5CMYA 1MJ0A 5BPPA 5CERB 3UI2A 2P9LG 4AEZC 2VGEA 3SBTB 1WAO1 2VSNA 5JHAA 3NBNB 2GRMA 2GW1A 4CT4A 2P9SG 5G04J 2J4DA 3QJZA 2WXJA 3FTUA 1KPSB 3L08A 4G23A 2KZTA 4I6GA 4ANVA 3C5RA 2WPVA 4LUNU 1DCEA 2P9PG 3MEKA 4JC8A 5AIJA 4O1OA 1YA0A 4EHMA 3DSUA 3FTSA 5KJMA 5ANLA 3ZGQA 1FVHA 3TXMA 5FQ8A 2A4ZA 3ZHEA 5FZRA 2WMNA 5FIOA 2WQHA 4BX9A 4BT8A 2EQXA 1KZPA 4EBAG 4KVOA 3AU5A 4UWGA 2Y4UA 3MV3B 2GROB 3DPYA 3EHNA 3HDXA 3ABKE 3T5VA 5FINA 4FP7A 4XEIG 3NQPA 4U8HA 3CVWA 3CVYA 4JHKA 3Q5MA 1TNBA 2LSVA 3S7FA 5AQ9A 3TWVA 3Q78A 3AS8A 1HZ4A 4MKTA 2E0IA 3JXJA 2X6FA 3PNLB 4CZ2D 4DUIA 2CG3A 3ZXSA 1N11A 1JCRA 3ML8A 4WNEA 1YCSB 2WXLA 3R9MA 4KMOA 4AM9A 2FEZA 4UWKA 2MOWA 1DCQA 5M72A 1TNOA 3VLEA 3NAWA 4L1BA 2UWJG 3FFLA 3QARA 2CFZA 4YDYA 5ENRD 1E90A 4N2QA 3FTVA 4J7WA 1A5EA 3JQ1A 3BUAA 3SI5A 3BEEA 3HRAA 1E8YA 1TJCA 2QY7A 3X2QE 2J07A 3RO2A 4HNAD 4YDEA 3FUDA 1MQSA 1LD8A 5CECB 1NA3A 4GA2A 5ARGA 1DNPA 4Q94A 2L6JA 3PH0C 3CHSA 3PDNA 2JLBA 4DX6D 4OAVB 4K5CA 3MYVA 5ITZF 4ANUA 4I9CA 3LPZA 3FUMA 3RRMB 5E75A 4P29A 3VLFA 3CKBA 5CEDB 2ZGGA 3MKQB 1W3BA 4UI9J 3AJIA 4ZFHA 4TV3A 1Z3XA 1N52A 2XZTG 2WXIA 4CDRA 3L13A 3CSTA 4GA1A 1B89A 3SZ7A 1H2VC 2CFUA 3BQOA 4DX7D 3V2OA 2V4LA 2NXPA 4WWPA 2VGXA 4E85A 3CVXA 3G2VA 4RSYA 1LTXA 3DXKG 3UX4A 3IV0A 3SNXA 3SGHA 2VSOE 4K0RA 3D9MA 3SD5A 2ETCA 4BTAA 3WG7E 4LSZE 4HBDA 3RKVA 1HG5A 3F6QA 1UN8A 2I1JA 4FC8A 3DSTA 4J8FA 2J08A 2LUHA 1QQEA 3C3QA 1TNYA 4NACA 2FULA 5KJLA 4EZLA 2EIME 3D9IA 1JCSA 2EIJE 1HX8A 5KBAA 4XKCA 2VTBB 1WY6A 2RFAA 1FPPA 4AV7A 4MBGA 2DZNA 1JPLA 2YQ8A 3QNKA 4JA9A 3DXMG 3O48A 2Y0BG 4F6RD 4JXTA 3KSLA 4CYMD 1JCQA 4XI0A 2J09A 3DEPA 4FHKA 3SHFA 2P9UG 4HOTA 3CEQA 3QDNA 2RG8A 3BG1B 4FLHA 5ENNA 1U2VG 4G8KA 4M7CA 2XGOA 4C48B 3V30A 2FF4A 3FTXA 3FDHA 4I2WA 2BEDA 1IQRA 4YVQC 5LCWC 2RFMA 4PS7A 5JJTA 1H6PA 2XPIA 2ZIRA 3JYSA 4CCAA 3JUIA 5LX8A 3ZU7B 2BKGA 2HE0A 3U64A 3E4BA 1BD8A 3I4RB 3DRAA 2R02A 3AG3E 5B1AE 3UKUG 4UI9K 1QNFA 1HG2A 1XNFA 4CRWA 3CGHA 2ETBA 3R9AB 2XCCA 5AJLA 5KNGA 3PNTB 1ELRA 3V2XA 3GW4A 3EHMA 3B7TA 3ESKA 3ZYQA 2XGMA 4GYYA 3ZKJA 3D3MA 5ARFA 4N3CA 2ZU6B 2ETAA 4EPZA 3RAUA 3CQGB 4A1SA 4WWNA 3RJVA 4UQYA 4FLBA 2XEVA 4O60A 2JABA 2OCCE 1BLXB 3L9TA 3FU5A 5CRVA 5EX0A 3IEGA 4DJAA 4A3VA 5J08A 3E37A 1Z3YA 2DIWA 4GAAA 4DX2A 4G8LA 2PL2A 3Q7AA 1QBQA 3TJPA 1EF1C 1O5MA 2Q7FA 4ILHB 3FU3A 2X38A 3APDA 2AW6A 3L82A 4A1GA 3T8MA 1Y6IA 4AY5A 2WXNA 1HS6A 3SY2A 1OY3D 2NYJA 4ACLA 1FT2A 3QC1A 4O6FA 3MA5A 2V8SE 4G25A 4HVBA 1AP7A 3Q4AB 4APFA 1MZCA 4JZYA 3PREA 2XHEA 3ASNE 4C0MA 4OVUA 3ENEA 4ABNA 1E96B 3C3RA 1GW6A 2EINE 3D9JA 3PZ1A 3LEWA 1Z6TA 3LCAA 4I1AA 3LYAA 4ZHBA 3ZVVA 4ATGA 3J5QB 3TWWA 3U4TA 4L2LA 2KCLA 5HQ8A 1SZAA 2EIKE 3KS2A 4U0SA 3MX3A 4I9EA 4I6EA 2A5UA 4HOUA 4GPKA 1SQMA 4K03A 2IF4A 5BT1A 4BERA 4LG6A 5CBNA 2WXFA 3D9NA 3ASHA 2R5SA 2OVBA 2F8XK 3EU5A 2XENA 4LERA 1EDUA 4I17A 1X5BA 3ABME 4IYPA 5AN8A 5ENOD 3IHYA 4JB8P 2V4HC 3HXEA 3QWWA 3VTXA 4N5CA 4TXPA 4BETA 5FJYA 1N4RA 4X8QA 1OCOE 4JHRA 5BV1A 2VYIA 3UM0A 3ZYKA 5BUZA 4N5QA 5LCWJ 4AP2A 2H6FA 4WWOA 3D9KA 3TXNA 2QC9A 3CIAA 4G2VA 3QWVA 3G2SA 2IOLA 2WXKA 4HOQA 4URKA 2WMOA 4CT0A 2XQ0A 1TN7A 2WQ6A 4WNGA 4YDOA 4EQFA 2WVIA 2J49A 3ABLE 5CHEE 4B93B 4LNBA 2AXZA 3ONKA 3SFYA 1IHBA 3FUEA 3RIBA 5EX3A 2MHKA 3KSQA 4U8YD 2H6IA 2GRPB 4ME2A 3U3WA 2BTDA 2IO3C 3FY4A 3EUVA 3TG5A 3TL5A 4GTPA 3UM1A 3VTYA 4I6JA 2X6HA 3AG1E 1H6OA 4FJYA 4A55A 1BPOA 3V31A 3C98A 4OAUC 4J8DA 1Q2ZA 5FT9A 2PM7A 3LJ3A 1SZ9A 2I6HA 4TXQA 2XRYA 3RO3A 2R05A 5BV0A 4JEUA 3UM2A 2XZDG 4GU5A 3ZNGA 3TGOA 4F53A 3V79K 4RQIA 4DI4A 5ENPD 3CHRA 3OXGA 2KM4A 3HVEB 1KT0A 4DRXE 4GTQA 4BWRA 2QZAA 1MYOA 5EYLA 1N4PA 3CHMA 1OWMA 1ELWA 3E30A 3WXXA 3R7RA 4G24A 3G2TA 1D8EA 3DSXA 3ASDA 3ISMC 4F3VA 4CDMA 4PS3A 2HR2A 4HXIA 3FH5A 1K1AA 3TAXA 4HORA 1O1RA 2B0OE 3S7DA 3D9PA 3AG4E 3B7RL 2L6BA 3FTWA 4G1TA 1RW2A 3PVLA 1U3DA 4EZJA 1H19A 5FWQA 3TWTA 2IQCA 3T5XA 4MS6A 5AAOA 3K9IA 2AXVA 5BXOA 3Q75A 5FQ6A 5C2YA 1O1SA 3FEYA 4BFRA 4RLYA 1EPUA 2PQNA 4GZCA 4A63B 2IY0C 3PE3A 3C72A 1OCCE 3FU0A 4WNFA 3LVRE 4JHJA 3LS8A 4M3OA 2GRLA 3MGBA 1D9SA 1UJKA 1K1BA 3EU9A 2WXGA 3DBSA 2HM8A 5CCMA 3FUJA 4ATZD 4AJWA 1E8ZA 4B8CB 3ZHEB 4GB9A 1TN8A 2RD0A 5KCMA 3TWRA 3ULYA 4PUCA 4B89A 1NP7A 3KEAA 3S7BA 1S64A 4AOFA 2AWIA 4U63A 3TWXA 4RG9A 2WXHA 1YYHA 3L17A 4CEMA 2XRZA 2ZGDA 4DX5D 2PNNA 1MX4A 1INZA 4UWFA 4GZ5A 2P9NG 2HO1A 2ZISA 3CK8A 3BU8A 4FULA 4JVSA 1K3ZD 2R03A 3FH7A 1NA0A 4EZKA 2QYJA 2C0LA 1NL4A 2ONDA 4R7LA 3N71A 5KJNA 4U95D 4XZ4A 4U96D 2Y1LE 3KD7A 4W9RA 5BNWA 4GYWA 5E76A 2HYZA 4HI9A 2J9QA 3L16A 3OXFA 5A7DB 5FZQA 5CRUA 5HI7A 2IFUA 1NI1A 4UWHA 3S2AA 2LAIA 5LFAA 2VSYA 5T4YA 3ZFWA 4H7YA 4GTOA 1WM5A 3B95A 1OWPA 1Z5SC 3SQVA 3D9LA 4PH4B 1HH8A 4KXKB 4CGWA 2OVFA 4XX5A 4JA7A 1MHQA 4OYSA 2V5QC 2X3MA 2FBNA 3B13A 3ZRHA 4N3AA 3JCKC 1N4SA 1IHGA 2BKKB 1ELKA 2I1KA 1VDYA 2R17C 2MRIA 3ASOE 4NIKA 4U07A 4D10C 4BSXA 5IY5E 3CHOA 3NB2A 1JWGA 4GYOA 4KVMA 4FHJA 5T8IA 1HE8A 3DSVA 1S0PA 4WNDA 3TG4A 4J6IA 1TNUA 3FTZA 3AS4A 3ZEFA 3Q49B 2XCBA 4DLOA 3B7UX 3FUHA 2R59A 2KATA 2VGXB 2X6JA 5EKQD 2XEHA 3HXBA 2IEJA 2GGFA 3I4GA 4C0EA 4MLPA 2L9BA 2P9KG 4GA0A 4AVXA 3Q79A 3UTMA 3HXFA 4XI9A 2B6CA 5KWDA 4DI3A 4XE0A 4QQIA 3UQ3A 3FEXA 4A3TA 4APOA 5FTPA 3HIZA 3UUXA 3ZYMA 4GTSA 4AY6A 2V5FA 2J4BA 2WXQA 1HU3A 3UXGA 3O4ZA 4I1OB 2Y4TA 1N94A 2CHXA 3T8KA 5EIDA 3G2UA 2NSZA 4OVVA 2WXPA 2ZXWE 5ENQD 3GZSA 3E34A 4HRMB 3CVLA 3QKYA 1NFIE 2JEKA 4ILIA 4GTMA 3MCXA 3CVNA 3Q7FA 4UQXA 3SF4A 3CVVA 4F1PA 2FO1E 2E2EA 3NF1A 4ILGA 5KJKA 1E8WA 1BI8B 1LF8A 4E6HA 4LCTA 4GPMA 3HVEA 4NURA 4U0UA 3E33A 3FU6A 3FTYA 5G05C 3CKCA 1HO8A 2UY1B 3MZLB 3IBEA 5D0QD 1QZ2A 4HRNA 1N54A 2RKKA 4O1PA 4GTTA 3FUFA 4C9BB 2KCVA 2VQ2A 3SFXA 1E7UA 1PC2A 4L9PA 3L22A 1D8DA 2CHWA 3SO8A 2F37A 1WG0A 2QFCA 3UPVA 2C0MA 4FADA 1TN6A 1A17A 4KZ0A 3QOUA 4J8EA 5B1BE 4J8YA 2P58C 3RSEG 3EHRA 3FUIA 3MV2B 4N2SA 3CVUA 3LXUX 2FO7A 5EYPF 3D9OA 3APCA 2F0YA 1IKND 2WXRA 4FA6A 3MKQA 1HXIA 5H7PA 5FQ7A 5AENA 1TR4A 1V54E 1SA5A 3OTNA 1MX2A 5BXUA 4RVBA 1YMPA 3HYMB 1BU9A 2BUGA 3I3NA 3VLDA 3OAWA 5JJ6A 4XIFA 3ASGA 1N0QA 4UUCA 2KXPC 2PM6A 4WAFA 2CG2A 2WM9A 3RK6A 2WQ7A 3PUKA 5CMWA 4B94A 3URZA 1FCHA 1OUVA 1UOHA 3Q47B 4KBQA 3LY9A 1NZNA 2X6KA 1Y8MA 1X81A 4G11A 5AQBA 1OWOA 4L23A 4QFVA 2IOSA 3Q9NC 3ULQA 3NOGD 1OCZE 2GRRB 4BESA 3FP3A 2L0IA 3DWLG 3U9WA 2WXMA 4FU3A 3EIQC 2LAHA 5J90A 5EN5D 3EIJA 2VTBA 3LKUA 3ZIMA 4HB5A 2LXMA 5A6CA 1SVXA 4GMJA 2PZIA 1BI7B 2OOEA 2NC9A 3MKRA 4GMLA 4KT6B 3CVQA 2YHEA 2ILRA 2J8SD 5CBOA 3W9GA 5AQAA 4HOSA 4BY6A 3GZ2A 4IRUA 4BTBA 1WDYA 4MRUA 4HI8A 4YVOA 1TYQG 2X6IA 3G2WA 3PEUB 2LNIA 3CHPA 5EDSA 3ESLA 1PY1A 4L2YA 3HXDA 4NRHB 3PE4A 3PRZA 5AYWD 4ANXA 1E7VA 3ONLA 5T3RA 4J0UA 4V3IA 3Q73A 4ANWA 1OWNA 3W9FA 3AS5A 3CHQA 4EBAA 4NQ0A 4K5BA 4HFGA 5HRYA 4LRZA 3DEOA 4HRLA 5EILA 4GMRA 4B8AA 4LEUA 3I5PA 4GTVA 3FWVA 1JUQA 4TUMA 3UMVA 3P1UA 4HLLA 5C1DA 2KCKA 1UG3A 5G05J 4AIFA 2IONA 3CLJA 1SW6A 3JUEA 3B7BA 3PUJA 3ULEG 2KZTB 4GZ6A 4JEHA 1U3CA 1P5QA 4HS2A 5LOZA 3CR3A 4XKBA 3QB2A 4DX1A 4BSZB 2DYRE 3S7JA 3BG0B 1L5JA 2YHCA 1FT1A 2I9CA 3PEVB 5KNHD 1IYGA 5HKPA 3FUNA 2XS1A 1ZBPA 4DLQA 3ASFA 4U8VD 4JL0A 3UT8A 4CGVA 3APFA 3HG0D 4GCNA 3LJNA 3FULA 3OXLA 3SBSA 2F8YA 2L0TB 4DK5A 2OEVA 2P2CP 1OWLA 4UWLA 2GRQB 1IQUA 4N39A 2BF0X 3RRNB 4RG6A 1K8KG 3TWQA 4I1MA 5B3SE 3R7QA 1IXVA 3IKOB 3LY8A 5BW8C 2VGYA 5AARA 3LDZA 5ANRA 3C3OA 4EECA 3GYZA 4JD2G 3AAAC 1OT8A 3LY7A 4WUYA 3IHVA 5A23A 2OV8A 5DIZA 5LP0A 4TRQA 2PQRA 3UT4A 1SA4A 1N9AA 2V0PA 3EJNA 2CHZA 3PZ4A 3PS6A 3P2BA 3DSSA 4GZ3A 4PS8A 4ACKA 2WXOA 5FZSA 2KC7A 1ZB1A 4U0ZA 1O1TA 2R2LA 4HLEA 4FJZA 4B0ZA 5D0OD 3CVPA 1H0AA 4IULA 2VSXE 4N3BA 1N0RA 3D9HA 3UT7A 1FVFA 3UKRG 3FHEA 4KZCA 1HF8A 3ZPJA 3E32A 3L54A 1DVPA 1XGWA 4BT9A 5G04C 2UY1A 2Y69E 3NZUA 4I2ZA 2AVPA 2YNQA 3U66A 1UJJA 2C2LA 5D66A 3DSWA 3PZDA 5G2NA 2P9IG 3HXCA 5JHBA 3IXEA 2LXLA 3ML9A 2XEEA 5D2MC 2XPYA 5FQ4A 2IU1A 5ENSD 2H6HA 2DYSE 3B7SA 4GCOA 5CCLA 2DVWA 4IN3B 1EYHA 4G26A 5G55A 1UW4B 3PZ3A 4GTRA 3UINC 5ENTD 1G3NB 3NOCD 1TNZA 3FH8A 1TJFA 4YDWA 1ZU2A 2GRNB 1H6KA 2QYUA 1LD7A 4DPRA 3CQCB 2DWZA 4I43A 4Q69A 5JMND 3EHQA 2LSUA 2EILE 3UM3A 3QK0A 2XGSA 4KYOB 4H7XA 3CV0A 4TXRA 4F7AA 3CSFA 3L6AA 3ZUVB 3QWPA 1E8XA 3GZ1A 3UIOC 1S70B 2IO2C 5AQ7A 4YNDA 4BX8A 2Y3AA 2KBXA 3AG2E 4LNGA 2YINA 1KT1A 3ZN3A 4TUUA 1V55E 2I2OA 4U04A 4K5AB 2XPZA 4Y6CA 3KEZA 3RU0A 4L7TA 4Y6WA 2DCPA 3TWUA 4Q96A 1TEZA 2MYOA 2AXUA 2XS8A 1H2TC 3PZ2A 3T9KA 4PDXA 1PAQA 3ZYLA 1RZ4A 3NZSA 5JA4D 3AU4A 2M63A 1N4QA 3Q9UC 5HS0A 4GZDA 4J8SA 2AJAA 5DBKA 5CEAA 1DC2A 3KAEA 1OCRE 1OXJA 4F1SA 4U7EB 4JW1A 3HHMA 3JQ0A 1JWFA 2H6GA 3LVQE 5JJ7A 3FUKA 3ZW3A 2OEWA 3TWSA 2LO6A 3EDTB 3MJWA 4AXHA 1KLXA 3Q15A 5EIBE 4UI9C 2VJ8A 1HFAA 4Z68A 3JXIA
chains in the Genus database with same CATH topology
1NP7A 2XCCA 5A6CA 5AJLA 4UQZA 4GMJA 2PZIA 2OOEA 3PNTB 5AJDA 1ELRA 2NC9A 3DPDA 3S7BA 3GW4A 3QAQA 4AOFA 3MKRA 4GMLA 3RRUA 4KT6B 2AWIA 3CVQA 2YHEA 3EHMA 4JPSA 4U63A 2ILRA 3B7TA 3ESKA 4RG9A 3ZYQA 2WXHA 2XGMA 4GYYA 3L17A 4CEMA 1UN9A 2XRZA 3D3MA 1INZA 5ARFA 4UWFA 4GZ5A 4N3CA 3CK7A 2FI7A 2ZU6B 4HOSA 1H2UA 2HO1A 2WB2A 3CK8A 4BY6A 3GZ2A 4IRUA 2DBAA 2IJGX 4BTBA 4FULA 4JVSA 4MRUA 4EPZA 4YVOA 3CQGB 4A1SA 3CK9A 4WWNA 3SFZA 2X6IA 3RJVA 3G2WA 4CDNA 3PEUB 4UQYA 4FLBA 5CMYA 2LNIA 3CHPA 2XEVA 5EDSA 3FH7A 5BPPA 3ESLA 1PY1A 1NA0A 4EZKA 4L2YA 4NRHB 2C0LA 3PE4A 3FU5A 3PRZA 5AYWD 4ANXA 5EX0A 1E7VA 3IEGA 4DJAA 3ONLA 5T3RA 4AEZC 4J0UA 4A3VA 4V3IA 5J08A 2ONDA 4R7LA 3N71A 5KJNA 3SBTB 4XZ4A 1WAO1 2VSNA 4ANWA 5JHAA 2GRMA 1Z3YA 2DIWA 2GW1A 3KD7A 4GAAA 4CT4A 2PL2A 5G04J 1OWNA 4W9RA 2J4DA 3QJZA 3TJPA 2WXJA 5BNWA 3AS5A 3CHQA 3FTUA 1EF1C 4EBAA 4GYWA 2Q7FA 5E76A 4NQ0A 4ILHB 4HFGA 3FU3A 2X38A 3L08A 2HYZA 4G23A 2KZTA 2J9QA 3APDA 3L16A 3OXFA 4LRZA 5FZQA 5A7DB 2AW6A 4A1GA 3T8MA 4I6GA 2IFUA 1Y6IA 5HI7A 4B8AA 4AY5A 4LEUA 3I5PA 4ANVA 4UWHA 2WXNA 1HS6A 3S2AA 2WPVA 3FWVA 4LUNU 1JUQA 2LAIA 3UMVA 3MEKA 4JC8A 5AIJA 5LFAA 2VSYA 5T4YA 3ZFWA 3P1UA 4H7YA 4ACLA 1YA0A 5C1DA 2KCKA 3QC1A 1UG3A 4O6FA 3FTSA 5G05J 3MA5A 5KJMA 5ANLA 2V8SE 3ZGQA 4AIFA 4G25A 2IONA 1FVHA 3Q4AB 3TXMA 3CLJA 1WM5A 4APFA 4HVBA 5FQ8A 1OWPA 2A4ZA 3D9LA 3ZHEA 5FZRA 4PH4B 1HH8A 2WMNA 3PUJA 4KXKB 4JZYA 3PREA 2WQHA 2XHEA 4BX9A 2KZTB 4BT8A 4GZ6A 4CGWA 4C0MA 4JEHA 2OVFA 4XX5A 1U3CA 4JA7A 1MHQA 4OVUA 4OYSA 1P5QA 2EQXA 2X3MA 3ENEA 2FBNA 4ABNA 4HS2A 1E96B 5LOZA 4EBAG 3B13A 3ZRHA 4KVOA 1GW6A 3CR3A 3JCKC 3QB2A 4N3AA 4XKBA 3D9JA 3LEWA 1IHGA 1Z6TA 3AU5A 4UWGA 2Y4UA 3MV3B 3LCAA 3S7JA 3BG0B 1L5JA 2YHCA 3EHNA 3HDXA 1ELKA 4I1AA 3LYAA 2I9CA 3T5VA 3PEVB 3ZVVA 4FP7A 4ATGA 2I1KA 1VDYA 2R17C 1IYGA 2MRIA 3NQPA 3U4TA 3FUNA 4L2LA 2KCLA 5HQ8A 4U8HA 4U07A 3CVWA 3CVYA 1ZBPA 4D10C 3ASFA 4JHKA 4DLQA 3Q5MA 1SZAA 4JL0A 4BSXA 2LSVA 3CHOA 3KS2A 4U0SA 3MX3A 3S7FA 3UT8A 3APFA 4CGVA 1JWGA 4GCNA 3AS8A 1HZ4A 4GYOA 4I9EA 3FULA 3OXLA 4KVMA 4MKTA 4FHJA 5T8IA 3SBSA 1HE8A 2E0IA 2X6FA 3PNLB 1S0PA 2L0TB 4I6EA 2CG3A 4WNDA 3ZXSA 4DK5A 2A5UA 4J6IA 3TG4A 1OWLA 3ML8A 4WNEA 2WXLA 4UWLA 3FTZA 3AS4A 4HOUA 3ZEFA 4GPKA 1SQMA 4K03A 3Q49B 1IQUA 4N39A 2BF0X 3RRNB 4KMOA 2IF4A 4AM9A 5BT1A 2FEZA 4RG6A 4UWKA 2MOWA 2XCBA 2WXFA 3D9NA 4I1MA 3ASHA 4DLOA 5M72A 2R5SA 3R7QA 3VLEA 3IKOB 2OVBA 3B7UX 3LY8A 3FUHA 2R59A 2KATA 2VGXB 5BW8C 2VGYA 2X6JA 4L1BA 5EKQD 2UWJG 3FFLA 3QARA 2CFZA 4APOA 4LERA 1EDUA 1E90A 4N2QA 3FTVA 3JQ1A 4I17A 1X5BA 2GGFA 4IYPA 3SI5A 3IHYA 3I4GA 3BEEA 4C0EA 3LDZA 3QWWA 1E8YA 4MLPA 3VTXA 4N5CA 2L9BA 4GA0A 5ANRA 1TJCA 2QY7A 4AVXA 4EECA 5FJYA 3GYZA 2J07A 3RO2A 4JHRA 5BV1A 4XI9A 2VYIA 3LY7A 4WUYA 3IHVA 3FUDA 5A23A 4DI3A 2OV8A 5DIZA 4XE0A 3ZYKA 5BUZA 5LP0A 1MQSA 1NA3A 4TRQA 4GA2A 3UQ3A 5LCWJ 2PQRA 3FEXA 4AP2A 3UT4A 5ARGA 1DNPA 4Q94A 4WWOA 2V0PA 2L6JA 3D9KA 3EJNA 2CHZA 3PH0C 3TXNA 4A3TA 3CIAA 3PS6A 3P2BA 3CHSA 3PDNA 3HIZA 4G2VA 2JLBA 4GZ3A 5FTPA 3QWVA 3G2SA 4PS8A 4ACKA 2IOLA 3UUXA 2WXOA 2WXKA 5FZSA 3ZYMA 4HOQA 2KC7A 4AY6A 4U0ZA 2V5FA 3MYVA 4URKA 2WMOA 2J4BA 4CT0A 2XQ0A 4ANUA 4HLEA 4FJZA 4I9CA 4B0ZA 2WQ6A 2WXQA 5D0OD 3LPZA 1HU3A 3CVPA 3FUMA 3O4ZA 4I1OB 3RRMB 5E75A 4WNGA 1H0AA 4IULA 2Y4TA 4P29A 3VLFA 2VSXE 4EQFA 2WVIA 3CKBA 2CHXA 2J49A 5CHEE 4N3BA 3MKQB 3UT7A 3G2UA 1FVFA 2NSZA 4OVVA 2WXPA 2AXZA 3ONKA 1W3BA 4UI9J 3FHEA 3GZSA 3FUEA 4KZCA 3RIBA 1HF8A 5EX3A 3ZPJA 2MHKA 3L54A 1DVPA 1XGWA 4BT9A 3CVLA 3QKYA 4TV3A 5G04C 1Z3XA 1N52A 2JEKA 4ILIA 3MCXA 2UY1A 2WXIA 4ME2A 3U3WA 3CVNA 3NZUA 4UQXA 3SF4A 3CVVA 4CDRA 2BTDA 4I2ZA 3L13A 3CSTA 4GA1A 2AVPA 1B89A 2YNQA 3FY4A 3SZ7A 3U66A 3TG5A 1UJJA 2C2LA 3TL5A 3VTYA 4I6JA 2E2EA 3PZDA 1H2VC 2CFUA 3NF1A 2X6HA 5G2NA 4FJYA 4A55A 5JHBA 1BPOA 4ILGA 3C98A 4J8DA 2V4LA 5KJKA 1E8WA 2NXPA 1LF8A 4WWPA 5FT9A 3ML9A 4E6HA 4LCTA 2PM7A 2VGXA 3HVEA 4E85A 2XPYA 5FQ4A 4NURA 4U0UA 3CVXA 3FU6A 2IU1A 3G2VA 4RSYA 3FTYA 3UX4A 3IV0A 3B7SA 3SNXA 4GCOA 3SGHA 5G05C 3CKCA 1HO8A 3LJ3A 1SZ9A 5CCLA 2VSOE 2I6HA 4IN3B 2UY1B 2XRYA 4K0RA 1EYHA 4G26A 3MZLB 3RO3A 3D9MA 3IBEA 5D0QD 3SD5A 1QZ2A 5G55A 1UW4B 4BTAA 1N54A 5BV0A 4JEUA 3FUFA 4C9BB 4GU5A 3RKVA 1HG5A 3TGOA 2KCVA 2VQ2A 4F53A 1UN8A 1E7UA 4DI4A 1PC2A 3CHRA 3FH8A 1TJFA 1ZU2A 3OXGA 1H6KA 2KM4A 3HVEB 3L22A 4DPRA 2I1JA 1KT0A 4FC8A 4J8FA 2J08A 2CHWA 1QQEA 3CQCB 2QFCA 4BWRA 3UPVA 4I43A 2C0MA 4NACA 4Q69A 2FULA 4FADA 1A17A 5KJLA 4KZ0A 4EZLA 2LSUA 3QOUA 4J8EA 3CHMA 3D9IA 2P58C 1OWMA 3FUIA 1ELWA 1HX8A 3MV2B 4XKCA 4N2SA 3QK0A 2XGSA 4KYOB 3CVUA 2VTBB 1WY6A 3LXUX 3CV0A 2FO7A 4H7XA 3D9OA 3WXXA 3APCA 4AV7A 3R7RA 3CSFA 4F7AA 4G24A 3L6AA 2WXRA 3G2TA 4FA6A 3MKQA 1HXIA 1E8XA 3GZ1A 3QWPA 5FQ7A 1JPLA 2YQ8A 3ASDA 5AENA 3QNKA 4JA9A 3O48A 4YNDA 4F3VA 3OTNA 4BX8A 4CDMA 4JXTA 2Y3AA 4PS3A 2HR2A 4XI0A 4HXIA 3FH5A 2J09A 4RVBA 3TAXA 4FHKA 3HYMB 2BUGA 2YINA 4HORA 1KT1A 3ZN3A 3SHFA 4HOTA 4TUUA 3CEQA 3I3NA 3VLDA 2I2OA 3OAWA 4U04A 2XPZA 4Y6CA 3KEZA 3RU0A 3QDNA 5JJ6A 3S7DA 4L7TA 2RG8A 4XIFA 3D9PA 3ASGA 3B7RL 3BG1B 4FLHA 3FTWA 4G1TA 5ENNA 4Y6WA 3PVLA 2PM6A 2DCPA 4WAFA 1U3DA 2CG2A 4EZJA 2XGOA 4Q96A 1TEZA 2WM9A 3RK6A 1H19A 2AXUA 5FWQA 2WQ7A 2FF4A 2IQCA 3FTXA 3T5XA 3FDHA 1H2TC 3PUKA 5CMWA 4MS6A 3K9IA 2AXVA 4I2WA 1IQRA 4YVQC 4PDXA 4B94A 5LCWC 5FQ6A 1PAQA 3URZA 4PS7A 5C2YA 5JJTA 3ZYLA 3NZSA 1FCHA 3AU4A 3FEYA 2M63A 4BFRA 1OUVA 1EPUA 3Q47B 4GZDA 4KBQA 4J8SA 2XPIA 3JYSA 2PQNA 5DBKA 4CCAA 4GZCA 3JUIA 3KAEA 3LY9A 3PE3A 5LX8A 4F1SA 1NZNA 2X6KA 1Y8MA 4G11A 3FU0A 4WNFA 3LVRE 4JW1A 3HHMA 1OWOA 4L23A 4QFVA 3JQ0A 4JHJA 1JWFA 3LS8A 2IOSA 4M3OA 2GRLA 3MGBA 3ULQA 3U64A 1UJKA 2WXGA 3FP3A 3E4BA 2L0IA 3LVQE 5JJ7A 3DBSA 3FUKA 3ZW3A 2HM8A 3I4RB 3U9WA 5CCMA 2LO6A 3EDTB 2WXMA 3FUJA 4AJWA 4FU3A 3MJWA 1E8ZA 4B8CB 3EIQC 2LAHA 5J90A 4AXHA 3ZHEB 4GB9A 1KLXA 2RD0A 1QNFA 4UI9K 1HG2A 1XNFA 3Q15A 5KCMA 4CRWA 4UI9C 3CGHA 2VJ8A 3EIJA 4PUCA 1HFAA 4B89A 2VTBA 3LKUA 3ZIMA 3R9AB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IU1 A;  1H2T C;  4GMJ A;  4JHJ A;  1N52 A;  1UG3 A;  1HU3 A;  2IOS A;  1H6K A;  3FEX A;  3L6A A;  1PAQ A;  2ION A;  4IUL A;  2I2O A;  4GML A;  2VSX E;  2VSO E;  2GGF A;  3FEY A;  2HM8 A;  2KZT A;  2RG8 A;  2FUL A;  4CEM A;  1H2V C;  2IOL A;  4B8A A;  2NSZ A;  3EIQ C;  5ANR A;  4B8C B;  1UW4 B;  2KZT B;  3D3M A;  1N54 A;  4LUN U;  3JUI A;  4CRW A;  2ZU6 B;  3EIJ A;  1H2U A;  4JHK A;  4B89 A;  4C9B B;  3RK6 A;  4CT4 A; 
#chains in the Genus database with same CATH topology
 4BEP A;  4UQZ A;  3ZXP A;  5AJD A;  1AWC B;  3DPD A;  3QAQ A;  2A5E A;  3RRU A;  3UIP C;  4JPS A;  3J5P A;  1KZO A;  1S63 A;  2DZO A;  1UN9 A;  1QYM A;  4LNU D;  4HQD A;  3CK7 A;  2FI7 A;  1H2U A;  2WB2 A;  2DBA A;  2IJG X;  3CK9 A;  1MX6 A;  3SFZ A;  1N95 A;  4CDN A;  5CMY A;  1MJ0 A;  5BPP A;  5CER B;  3UI2 A;  2P9L G;  4AEZ C;  2VGE A;  3SBT B;  1WAO 1;  2VSN A;  5JHA A;  3NBN B;  2GRM A;  2GW1 A;  4CT4 A;  2P9S G;  5G04 J;  2J4D A;  3QJZ A;  2WXJ A;  3FTU A;  1KPS B;  3L08 A;  4G23 A;  2KZT A;  4I6G A;  4ANV A;  3C5R A;  2WPV A;  4LUN U;  1DCE A;  2P9P G;  3MEK A;  4JC8 A;  5AIJ A;  4O1O A;  1YA0 A;  4EHM A;  3DSU A;  3FTS A;  5KJM A;  5ANL A;  3ZGQ A;  1FVH A;  3TXM A;  5FQ8 A;  2A4Z A;  3ZHE A;  5FZR A;  2WMN A;  5FIO A;  2WQH A;  4BX9 A;  4BT8 A;  2EQX A;  1KZP A;  4EBA G;  4KVO A;  3AU5 A;  4UWG A;  2Y4U A;  3MV3 B;  2GRO B;  3DPY A;  3EHN A;  3HDX A;  3ABK E;  3T5V A;  5FIN A;  4FP7 A;  4XEI G;  3NQP A;  4U8H A;  3CVW A;  3CVY A;  4JHK A;  3Q5M A;  1TNB A;  2LSV A;  3S7F A;  5AQ9 A;  3TWV A;  3Q78 A;  3AS8 A;  1HZ4 A;  4MKT A;  2E0I A;  3JXJ A;  2X6F A;  3PNL B;  4CZ2 D;  4DUI A;  2CG3 A;  3ZXS A;  1N11 A;  1JCR A;  3ML8 A;  4WNE A;  1YCS B;  2WXL A;  3R9M A;  4KMO A;  4AM9 A;  2FEZ A;  4UWK A;  2MOW A;  1DCQ A;  5M72 A;  1TNO A;  3VLE A;  3NAW A;  4L1B A;  2UWJ G;  3FFL A;  3QAR A;  2CFZ A;  4YDY A;  5ENR D;  1E90 A;  4N2Q A;  3FTV A;  4J7W A;  1A5E A;  3JQ1 A;  3BUA A;  3SI5 A;  3BEE A;  3HRA A;  1E8Y A;  1TJC A;  2QY7 A;  3X2Q E;  2J07 A;  3RO2 A;  4HNA D;  4YDE A;  3FUD A;  1MQS A;  1LD8 A;  5CEC B;  1NA3 A;  4GA2 A;  5ARG A;  1DNP A;  4Q94 A;  2L6J A;  3PH0 C;  3CHS A;  3PDN A;  2JLB A;  4DX6 D;  4OAV B;  4K5C A;  3MYV A;  5ITZ F;  4ANU A;  4I9C A;  3LPZ A;  3FUM A;  3RRM B;  5E75 A;  4P29 A;  3VLF A;  3CKB A;  5CED B;  2ZGG A;  3MKQ B;  1W3B A;  4UI9 J;  3AJI A;  4ZFH A;  4TV3 A;  1Z3X A;  1N52 A;  2XZT G;  2WXI A;  4CDR A;  3L13 A;  3CST A;  4GA1 A;  1B89 A;  3SZ7 A;  1H2V C;  2CFU A;  3BQO A;  4DX7 D;  3V2O A;  2V4L A;  2NXP A;  4WWP A;  2VGX A;  4E85 A;  3CVX A;  3G2V A;  4RSY A;  1LTX A;  3DXK G;  3UX4 A;  3IV0 A;  3SNX A;  3SGH A;  2VSO E;  4K0R A;  3D9M A;  3SD5 A;  2ETC A;  4BTA A;  3WG7 E;  4LSZ E;  4HBD A;  3RKV A;  1HG5 A;  3F6Q A;  1UN8 A;  2I1J A;  4FC8 A;  3DST A;  4J8F A;  2J08 A;  2LUH A;  1QQE A;  3C3Q A;  1TNY A;  4NAC A;  2FUL A;  5KJL A;  4EZL A;  2EIM E;  3D9I A;  1JCS A;  2EIJ E;  1HX8 A;  5KBA A;  4XKC A;  2VTB B;  1WY6 A;  2RFA A;  1FPP A;  4AV7 A;  4MBG A;  2DZN A;  1JPL A;  2YQ8 A;  3QNK A;  4JA9 A;  3DXM G;  3O48 A;  2Y0B G;  4F6R D;  4JXT A;  3KSL A;  4CYM D;  1JCQ A;  4XI0 A;  2J09 A;  3DEP A;  4FHK A;  3SHF A;  2P9U G;  4HOT A;  3CEQ A;  3QDN A;  2RG8 A;  3BG1 B;  4FLH A;  5ENN A;  1U2V G;  4G8K A;  4M7C A;  2XGO A;  4C48 B;  3V30 A;  2FF4 A;  3FTX A;  3FDH A;  4I2W A;  2BED A;  1IQR A;  4YVQ C;  5LCW C;  2RFM A;  4PS7 A;  5JJT A;  1H6P A;  2XPI A;  2ZIR A;  3JYS A;  4CCA A;  3JUI A;  5LX8 A;  3ZU7 B;  2BKG A;  2HE0 A;  3U64 A;  3E4B A;  1BD8 A;  3I4R B;  3DRA A;  2R02 A;  3AG3 E;  5B1A E;  3UKU G;  4UI9 K;  1QNF A;  1HG2 A;  1XNF A;  4CRW A;  3CGH A;  2ETB A;  3R9A B;  2XCC A;  5AJL A;  5KNG A;  3PNT B;  1ELR A;  3V2X A;  3GW4 A;  3EHM A;  3B7T A;  3ESK A;  3ZYQ A;  2XGM A;  4GYY A;  3ZKJ A;  3D3M A;  5ARF A;  4N3C A;  2ZU6 B;  2ETA A;  4EPZ A;  3RAU A;  3CQG B;  4A1S A;  4WWN A;  3RJV A;  4UQY A;  4FLB A;  2XEV A;  4O60 A;  2JAB A;  2OCC E;  1BLX B;  3L9T A;  3FU5 A;  5CRV A;  5EX0 A;  3IEG A;  4DJA A;  4A3V A;  5J08 A;  3E37 A;  1Z3Y A;  2DIW A;  4GAA A;  4DX2 A;  4G8L A;  2PL2 A;  3Q7A A;  1QBQ A;  3TJP A;  1EF1 C;  1O5M A;  2Q7F A;  4ILH B;  3FU3 A;  2X38 A;  3APD A;  2AW6 A;  3L82 A;  4A1G A;  3T8M A;  1Y6I A;  4AY5 A;  2WXN A;  1HS6 A;  3SY2 A;  1OY3 D;  2NYJ A;  4ACL A;  1FT2 A;  3QC1 A;  4O6F A;  3MA5 A;  2V8S E;  4G25 A;  4HVB A;  1AP7 A;  3Q4A B;  4APF A;  1MZC A;  4JZY A;  3PRE A;  2XHE A;  3ASN E;  4C0M A;  4OVU A;  3ENE A;  4ABN A;  1E96 B;  3C3R A;  1GW6 A;  2EIN E;  3D9J A;  3PZ1 A;  3LEW A;  1Z6T A;  3LCA A;  4I1A A;  3LYA A;  4ZHB A;  3ZVV A;  4ATG A;  3J5Q B;  3TWW A;  3U4T A;  4L2L A;  2KCL A;  5HQ8 A;  1SZA A;  2EIK E;  3KS2 A;  4U0S A;  3MX3 A;  4I9E A;  4I6E A;  2A5U A;  4HOU A;  4GPK A;  1SQM A;  4K03 A;  2IF4 A;  5BT1 A;  4BER A;  4LG6 A;  5CBN A;  2WXF A;  3D9N A;  3ASH A;  2R5S A;  2OVB A;  2F8X K;  3EU5 A;  2XEN A;  4LER A;  1EDU A;  4I17 A;  1X5B A;  3ABM E;  4IYP A;  5AN8 A;  5ENO D;  3IHY A;  4JB8 P;  2V4H C;  3HXE A;  3QWW A;  3VTX A;  4N5C A;  4TXP A;  4BET A;  5FJY A;  1N4R A;  4X8Q A;  1OCO E;  4JHR A;  5BV1 A;  2VYI A;  3UM0 A;  3ZYK A;  5BUZ A;  4N5Q A;  5LCW J;  4AP2 A;  2H6F A;  4WWO A;  3D9K A;  3TXN A;  2QC9 A;  3CIA A;  4G2V A;  3QWV A;  3G2S A;  2IOL A;  2WXK A;  4HOQ A;  4URK A;  2WMO A;  4CT0 A;  2XQ0 A;  1TN7 A;  2WQ6 A;  4WNG A;  4YDO A;  4EQF A;  2WVI A;  2J49 A;  3ABL E;  5CHE E;  4B93 B;  4LNB A;  2AXZ A;  3ONK A;  3SFY A;  1IHB A;  3FUE A;  3RIB A;  5EX3 A;  2MHK A;  3KSQ A;  4U8Y D;  2H6I A;  2GRP B;  4ME2 A;  3U3W A;  2BTD A;  2IO3 C;  3FY4 A;  3EUV A;  3TG5 A;  3TL5 A;  4GTP A;  3UM1 A;  3VTY A;  4I6J A;  2X6H A;  3AG1 E;  1H6O A;  4FJY A;  4A55 A;  1BPO A;  3V31 A;  3C98 A;  4OAU C;  4J8D A;  1Q2Z A;  5FT9 A;  2PM7 A;  3LJ3 A;  1SZ9 A;  2I6H A;  4TXQ A;  2XRY A;  3RO3 A;  2R05 A;  5BV0 A;  4JEU A;  3UM2 A;  2XZD G;  4GU5 A;  3ZNG A;  3TGO A;  4F53 A;  3V79 K;  4RQI A;  4DI4 A;  5ENP D;  3CHR A;  3OXG A;  2KM4 A;  3HVE B;  1KT0 A;  4DRX E;  4GTQ A;  4BWR A;  2QZA A;  1MYO A;  5EYL A;  1N4P A;  3CHM A;  1OWM A;  1ELW A;  3E30 A;  3WXX A;  3R7R A;  4G24 A;  3G2T A;  1D8E A;  3DSX A;  3ASD A;  3ISM C;  4F3V A;  4CDM A;  4PS3 A;  2HR2 A;  4HXI A;  3FH5 A;  1K1A A;  3TAX A;  4HOR A;  1O1R A;  2B0O E;  3S7D A;  3D9P A;  3AG4 E;  3B7R L;  2L6B A;  3FTW A;  4G1T A;  1RW2 A;  3PVL A;  1U3D A;  4EZJ A;  1H19 A;  5FWQ A;  3TWT A;  2IQC A;  3T5X A;  4MS6 A;  5AAO A;  3K9I A;  2AXV A;  5BXO A;  3Q75 A;  5FQ6 A;  5C2Y A;  1O1S A;  3FEY A;  4BFR A;  4RLY A;  1EPU A;  2PQN A;  4GZC A;  4A63 B;  2IY0 C;  3PE3 A;  3C72 A;  1OCC E;  3FU0 A;  4WNF A;  3LVR E;  4JHJ A;  3LS8 A;  4M3O A;  2GRL A;  3MGB A;  1D9S A;  1UJK A;  1K1B A;  3EU9 A;  2WXG A;  3DBS A;  2HM8 A;  5CCM A;  3FUJ A;  4ATZ D;  4AJW A;  1E8Z A;  4B8C B;  3ZHE B;  4GB9 A;  1TN8 A;  2RD0 A;  5KCM A;  3TWR A;  3ULY A;  4PUC A;  4B89 A;  1NP7 A;  3KEA A;  3S7B A;  1S64 A;  4AOF A;  2AWI A;  4U63 A;  3TWX A;  4RG9 A;  2WXH A;  1YYH A;  3L17 A;  4CEM A;  2XRZ A;  2ZGD A;  4DX5 D;  2PNN A;  1MX4 A;  1INZ A;  4UWF A;  4GZ5 A;  2P9N G;  2HO1 A;  2ZIS A;  3CK8 A;  3BU8 A;  4FUL A;  4JVS A;  1K3Z D;  2R03 A;  3FH7 A;  1NA0 A;  4EZK A;  2QYJ A;  2C0L A;  1NL4 A;  2OND A;  4R7L A;  3N71 A;  5KJN A;  4U95 D;  4XZ4 A;  4U96 D;  2Y1L E;  3KD7 A;  4W9R A;  5BNW A;  4GYW A;  5E76 A;  2HYZ A;  4HI9 A;  2J9Q A;  3L16 A;  3OXF A;  5A7D B;  5FZQ A;  5CRU A;  5HI7 A;  2IFU A;  1NI1 A;  4UWH A;  3S2A A;  2LAI A;  5LFA A;  2VSY A;  5T4Y A;  3ZFW A;  4H7Y A;  4GTO A;  1WM5 A;  3B95 A;  1OWP A;  1Z5S C;  3SQV A;  3D9L A;  4PH4 B;  1HH8 A;  4KXK B;  4CGW A;  2OVF A;  4XX5 A;  4JA7 A;  1MHQ A;  4OYS A;  2V5Q C;  2X3M A;  2FBN A;  3B13 A;  3ZRH A;  4N3A A;  3JCK C;  1N4S A;  1IHG A;  2BKK B;  1ELK A;  2I1K A;  1VDY A;  2R17 C;  2MRI A;  3ASO E;  4NIK A;  4U07 A;  4D10 C;  4BSX A;  5IY5 E;  3CHO A;  3NB2 A;  1JWG A;  4GYO A;  4KVM A;  4FHJ A;  5T8I A;  1HE8 A;  3DSV A;  1S0P A;  4WND A;  3TG4 A;  4J6I A;  1TNU A;  3FTZ A;  3AS4 A;  3ZEF A;  3Q49 B;  2XCB A;  4DLO A;  3B7U X;  3FUH A;  2R59 A;  2KAT A;  2VGX B;  2X6J A;  5EKQ D;  2XEH A;  3HXB A;  2IEJ A;  2GGF A;  3I4G A;  4C0E A;  4MLP A;  2L9B A;  2P9K G;  4GA0 A;  4AVX A;  3Q79 A;  3UTM A;  3HXF A;  4XI9 A;  2B6C A;  5KWD A;  4DI3 A;  4XE0 A;  4QQI A;  3UQ3 A;  3FEX A;  4A3T A;  4APO A;  5FTP A;  3HIZ A;  3UUX A;  3ZYM A;  4GTS A;  4AY6 A;  2V5F A;  2J4B A;  2WXQ A;  1HU3 A;  3UXG A;  3O4Z A;  4I1O B;  2Y4T A;  1N94 A;  2CHX A;  3T8K A;  5EID A;  3G2U A;  2NSZ A;  4OVV A;  2WXP A;  2ZXW E;  5ENQ D;  3GZS A;  3E34 A;  4HRM B;  3CVL A;  3QKY A;  1NFI E;  2JEK A;  4ILI A;  4GTM A;  3MCX A;  3CVN A;  3Q7F A;  4UQX A;  3SF4 A;  3CVV A;  4F1P A;  2FO1 E;  2E2E A;  3NF1 A;  4ILG A;  5KJK A;  1E8W A;  1BI8 B;  1LF8 A;  4E6H A;  4LCT A;  4GPM A;  3HVE A;  4NUR A;  4U0U A;  3E33 A;  3FU6 A;  3FTY A;  5G05 C;  3CKC A;  1HO8 A;  2UY1 B;  3MZL B;  3IBE A;  5D0Q D;  1QZ2 A;  4HRN A;  1N54 A;  2RKK A;  4O1P A;  4GTT A;  3FUF A;  4C9B B;  2KCV A;  2VQ2 A;  3SFX A;  1E7U A;  1PC2 A;  4L9P A;  3L22 A;  1D8D A;  2CHW A;  3SO8 A;  2F37 A;  1WG0 A;  2QFC A;  3UPV A;  2C0M A;  4FAD A;  1TN6 A;  1A17 A;  4KZ0 A;  3QOU A;  4J8E A;  5B1B E;  4J8Y A;  2P58 C;  3RSE G;  3EHR A;  3FUI A;  3MV2 B;  4N2S A;  3CVU A;  3LXU X;  2FO7 A;  5EYP F;  3D9O A;  3APC A;  2F0Y A;  1IKN D;  2WXR A;  4FA6 A;  3MKQ A;  1HXI A;  5H7P A;  5FQ7 A;  5AEN A;  1TR4 A;  1V54 E;  1SA5 A;  3OTN A;  1MX2 A;  5BXU A;  4RVB A;  1YMP A;  3HYM B;  1BU9 A;  2BUG A;  3I3N A;  3VLD A;  3OAW A;  5JJ6 A;  4XIF A;  3ASG A;  1N0Q A;  4UUC A;  2KXP C;  2PM6 A;  4WAF A;  2CG2 A;  2WM9 A;  3RK6 A;  2WQ7 A;  3PUK A;  5CMW A;  4B94 A;  3URZ A;  1FCH A;  1OUV A;  1UOH A;  3Q47 B;  4KBQ A;  3LY9 A;  1NZN A;  2X6K A;  1Y8M A;  1X81 A;  4G11 A;  5AQB A;  1OWO A;  4L23 A;  4QFV A;  2IOS A;  3Q9N C;  3ULQ A;  3NOG D;  1OCZ E;  2GRR B;  4BES A;  3FP3 A;  2L0I A;  3DWL G;  3U9W A;  2WXM A;  4FU3 A;  3EIQ C;  2LAH A;  5J90 A;  5EN5 D;  3EIJ A;  2VTB A;  3LKU A;  3ZIM A;  4HB5 A;  2LXM A;  5A6C A;  1SVX A;  4GMJ A;  2PZI A;  1BI7 B;  2OOE A;  2NC9 A;  3MKR A;  4GML A;  4KT6 B;  3CVQ A;  2YHE A;  2ILR A;  2J8S D;  5CBO A;  3W9G A;  5AQA A;  4HOS A;  4BY6 A;  3GZ2 A;  4IRU A;  4BTB A;  1WDY A;  4MRU A;  4HI8 A;  4YVO A;  1TYQ G;  2X6I A;  3G2W A;  3PEU B;  2LNI A;  3CHP A;  5EDS A;  3ESL A;  1PY1 A;  4L2Y A;  3HXD A;  4NRH B;  3PE4 A;  3PRZ A;  5AYW D;  4ANX A;  1E7V A;  3ONL A;  5T3R A;  4J0U A;  4V3I A;  3Q73 A;  4ANW A;  1OWN A;  3W9F A;  3AS5 A;  3CHQ A;  4EBA A;  4NQ0 A;  4K5B A;  4HFG A;  5HRY A;  4LRZ A;  3DEO A;  4HRL A;  5EIL A;  4GMR A;  4B8A A;  4LEU A;  3I5P A;  4GTV A;  3FWV A;  1JUQ A;  4TUM A;  3UMV A;  3P1U A;  4HLL A;  5C1D A;  2KCK A;  1UG3 A;  5G05 J;  4AIF A;  2ION A;  3CLJ A;  1SW6 A;  3JUE A;  3B7B A;  3PUJ A;  3ULE G;  2KZT B;  4GZ6 A;  4JEH A;  1U3C A;  1P5Q A;  4HS2 A;  5LOZ A;  3CR3 A;  4XKB A;  3QB2 A;  4DX1 A;  4BSZ B;  2DYR E;  3S7J A;  3BG0 B;  1L5J A;  2YHC A;  1FT1 A;  2I9C A;  3PEV B;  5KNH D;  1IYG A;  5HKP A;  3FUN A;  2XS1 A;  1ZBP A;  4DLQ A;  3ASF A;  4U8V D;  4JL0 A;  3UT8 A;  4CGV A;  3APF A;  3HG0 D;  4GCN A;  3LJN A;  3FUL A;  3OXL A;  3SBS A;  2F8Y A;  2L0T B;  4DK5 A;  2OEV A;  2P2C P;  1OWL A;  4UWL A;  2GRQ B;  1IQU A;  4N39 A;  2BF0 X;  3RRN B;  4RG6 A;  1K8K G;  3TWQ A;  4I1M A;  5B3S E;  3R7Q A;  1IXV A;  3IKO B;  3LY8 A;  5BW8 C;  2VGY A;  5AAR A;  3LDZ A;  5ANR A;  3C3O A;  4EEC A;  3GYZ A;  4JD2 G;  3AAA C;  1OT8 A;  3LY7 A;  4WUY A;  3IHV A;  5A23 A;  2OV8 A;  5DIZ A;  5LP0 A;  4TRQ A;  2PQR A;  3UT4 A;  1SA4 A;  1N9A A;  2V0P A;  3EJN A;  2CHZ A;  3PZ4 A;  3PS6 A;  3P2B A;  3DSS A;  4GZ3 A;  4PS8 A;  4ACK A;  2WXO A;  5FZS A;  2KC7 A;  1ZB1 A;  4U0Z A;  1O1T A;  2R2L A;  4HLE A;  4FJZ A;  4B0Z A;  5D0O D;  3CVP A;  1H0A A;  4IUL A;  2VSX E;  4N3B A;  1N0R A;  3D9H A;  3UT7 A;  1FVF A;  3UKR G;  3FHE A;  4KZC A;  1HF8 A;  3ZPJ A;  3E32 A;  3L54 A;  1DVP A;  1XGW A;  4BT9 A;  5G04 C;  2UY1 A;  2Y69 E;  3NZU A;  4I2Z A;  2AVP A;  2YNQ A;  3U66 A;  1UJJ A;  2C2L A;  5D66 A;  3DSW A;  3PZD A;  5G2N A;  2P9I G;  3HXC A;  5JHB A;  3IXE A;  2LXL A;  3ML9 A;  2XEE A;  5D2M C;  2XPY A;  5FQ4 A;  2IU1 A;  5ENS D;  2H6H A;  2DYS E;  3B7S A;  4GCO A;  5CCL A;  2DVW A;  4IN3 B;  1EYH A;  4G26 A;  5G55 A;  1UW4 B;  3PZ3 A;  4GTR A;  3UIN C;  5ENT D;  1G3N B;  3NOC D;  1TNZ A;  3FH8 A;  1TJF A;  4YDW A;  1ZU2 A;  2GRN B;  1H6K A;  2QYU A;  1LD7 A;  4DPR A;  3CQC B;  2DWZ A;  4I43 A;  4Q69 A;  5JMN D;  3EHQ A;  2LSU A;  2EIL E;  3UM3 A;  3QK0 A;  2XGS A;  4KYO B;  4H7X A;  3CV0 A;  4TXR A;  4F7A A;  3CSF A;  3L6A A;  3ZUV B;  3QWP A;  1E8X A;  3GZ1 A;  3UIO C;  1S70 B;  2IO2 C;  5AQ7 A;  4YND A;  4BX8 A;  2Y3A A;  2KBX A;  3AG2 E;  4LNG A;  2YIN A;  1KT1 A;  3ZN3 A;  4TUU A;  1V55 E;  2I2O A;  4U04 A;  4K5A B;  2XPZ A;  4Y6C A;  3KEZ A;  3RU0 A;  4L7T A;  4Y6W A;  2DCP A;  3TWU A;  4Q96 A;  1TEZ A;  2MYO A;  2AXU A;  2XS8 A;  1H2T C;  3PZ2 A;  3T9K A;  4PDX A;  1PAQ A;  3ZYL A;  1RZ4 A;  3NZS A;  5JA4 D;  3AU4 A;  2M63 A;  1N4Q A;  3Q9U C;  5HS0 A;  4GZD A;  4J8S A;  2AJA A;  5DBK A;  5CEA A;  1DC2 A;  3KAE A;  1OCR E;  1OXJ A;  4F1S A;  4U7E B;  4JW1 A;  3HHM A;  3JQ0 A;  1JWF A;  2H6G A;  3LVQ E;  5JJ7 A;  3FUK A;  3ZW3 A;  2OEW A;  3TWS A;  2LO6 A;  3EDT B;  3MJW A;  4AXH A;  1KLX A;  3Q15 A;  5EIB E;  4UI9 C;  2VJ8 A;  1HFA A;  4Z68 A;  3JXI A; 
#chains in the Genus database with same CATH homology
 1NP7 A;  2XCC A;  5A6C A;  5AJL A;  4UQZ A;  4GMJ A;  2PZI A;  2OOE A;  3PNT B;  5AJD A;  1ELR A;  2NC9 A;  3DPD A;  3S7B A;  3GW4 A;  3QAQ A;  4AOF A;  3MKR A;  4GML A;  3RRU A;  4KT6 B;  2AWI A;  3CVQ A;  2YHE A;  3EHM A;  4JPS A;  4U63 A;  2ILR A;  3B7T A;  3ESK A;  4RG9 A;  3ZYQ A;  2WXH A;  2XGM A;  4GYY A;  3L17 A;  4CEM A;  1UN9 A;  2XRZ A;  3D3M A;  1INZ A;  5ARF A;  4UWF A;  4GZ5 A;  4N3C A;  3CK7 A;  2FI7 A;  2ZU6 B;  4HOS A;  1H2U A;  2HO1 A;  2WB2 A;  3CK8 A;  4BY6 A;  3GZ2 A;  4IRU A;  2DBA A;  2IJG X;  4BTB A;  4FUL A;  4JVS A;  4MRU A;  4EPZ A;  4YVO A;  3CQG B;  4A1S A;  3CK9 A;  4WWN A;  3SFZ A;  2X6I A;  3RJV A;  3G2W A;  4CDN A;  3PEU B;  4UQY A;  4FLB A;  5CMY A;  2LNI A;  3CHP A;  2XEV A;  5EDS A;  3FH7 A;  5BPP A;  3ESL A;  1PY1 A;  1NA0 A;  4EZK A;  4L2Y A;  4NRH B;  2C0L A;  3PE4 A;  3FU5 A;  3PRZ A;  5AYW D;  4ANX A;  5EX0 A;  1E7V A;  3IEG A;  4DJA A;  3ONL A;  5T3R A;  4AEZ C;  4J0U A;  4A3V A;  4V3I A;  5J08 A;  2OND A;  4R7L A;  3N71 A;  5KJN A;  3SBT B;  4XZ4 A;  1WAO 1;  2VSN A;  4ANW A;  5JHA A;  2GRM A;  1Z3Y A;  2DIW A;  2GW1 A;  3KD7 A;  4GAA A;  4CT4 A;  2PL2 A;  5G04 J;  1OWN A;  4W9R A;  2J4D A;  3QJZ A;  3TJP A;  2WXJ A;  5BNW A;  3AS5 A;  3CHQ A;  3FTU A;  1EF1 C;  4EBA A;  4GYW A;  2Q7F A;  5E76 A;  4NQ0 A;  4ILH B;  4HFG A;  3FU3 A;  2X38 A;  3L08 A;  2HYZ A;  4G23 A;  2KZT A;  2J9Q A;  3APD A;  3L16 A;  3OXF A;  4LRZ A;  5FZQ A;  5A7D B;  2AW6 A;  4A1G A;  3T8M A;  4I6G A;  2IFU A;  1Y6I A;  5HI7 A;  4B8A A;  4AY5 A;  4LEU A;  3I5P A;  4ANV A;  4UWH A;  2WXN A;  1HS6 A;  3S2A A;  2WPV A;  3FWV A;  4LUN U;  1JUQ A;  2LAI A;  3UMV A;  3MEK A;  4JC8 A;  5AIJ A;  5LFA A;  2VSY A;  5T4Y A;  3ZFW A;  3P1U A;  4H7Y A;  4ACL A;  1YA0 A;  5C1D A;  2KCK A;  3QC1 A;  1UG3 A;  4O6F A;  3FTS A;  5G05 J;  3MA5 A;  5KJM A;  5ANL A;  2V8S E;  3ZGQ A;  4AIF A;  4G25 A;  2ION A;  1FVH A;  3Q4A B;  3TXM A;  3CLJ A;  1WM5 A;  4APF A;  4HVB A;  5FQ8 A;  1OWP A;  2A4Z A;  3D9L A;  3ZHE A;  5FZR A;  4PH4 B;  1HH8 A;  2WMN A;  3PUJ A;  4KXK B;  4JZY A;  3PRE A;  2WQH A;  2XHE A;  4BX9 A;  2KZT B;  4BT8 A;  4GZ6 A;  4CGW A;  4C0M A;  4JEH A;  2OVF A;  4XX5 A;  1U3C A;  4JA7 A;  1MHQ A;  4OVU A;  4OYS A;  1P5Q A;  2EQX A;  2X3M A;  3ENE A;  2FBN A;  4ABN A;  4HS2 A;  1E96 B;  5LOZ A;  4EBA G;  3B13 A;  3ZRH A;  4KVO A;  1GW6 A;  3CR3 A;  3JCK C;  3QB2 A;  4N3A A;  4XKB A;  3D9J A;  3LEW A;  1IHG A;  1Z6T A;  3AU5 A;  4UWG A;  2Y4U A;  3MV3 B;  3LCA A;  3S7J A;  3BG0 B;  1L5J A;  2YHC A;  3EHN A;  3HDX A;  1ELK A;  4I1A A;  3LYA A;  2I9C A;  3T5V A;  3PEV B;  3ZVV A;  4FP7 A;  4ATG A;  2I1K A;  1VDY A;  2R17 C;  1IYG A;  2MRI A;  3NQP A;  3U4T A;  3FUN A;  4L2L A;  2KCL A;  5HQ8 A;  4U8H A;  4U07 A;  3CVW A;  3CVY A;  1ZBP A;  4D10 C;  3ASF A;  4JHK A;  4DLQ A;  3Q5M A;  1SZA A;  4JL0 A;  4BSX A;  2LSV A;  3CHO A;  3KS2 A;  4U0S A;  3MX3 A;  3S7F A;  3UT8 A;  3APF A;  4CGV A;  1JWG A;  4GCN A;  3AS8 A;  1HZ4 A;  4GYO A;  4I9E A;  3FUL A;  3OXL A;  4KVM A;  4MKT A;  4FHJ A;  5T8I A;  3SBS A;  1HE8 A;  2E0I A;  2X6F A;  3PNL B;  1S0P A;  2L0T B;  4I6E A;  2CG3 A;  4WND A;  3ZXS A;  4DK5 A;  2A5U A;  4J6I A;  3TG4 A;  1OWL A;  3ML8 A;  4WNE A;  2WXL A;  4UWL A;  3FTZ A;  3AS4 A;  4HOU A;  3ZEF A;  4GPK A;  1SQM A;  4K03 A;  3Q49 B;  1IQU A;  4N39 A;  2BF0 X;  3RRN B;  4KMO A;  2IF4 A;  4AM9 A;  5BT1 A;  2FEZ A;  4RG6 A;  4UWK A;  2MOW A;  2XCB A;  2WXF A;  3D9N A;  4I1M A;  3ASH A;  4DLO A;  5M72 A;  2R5S A;  3R7Q A;  3VLE A;  3IKO B;  2OVB A;  3B7U X;  3LY8 A;  3FUH A;  2R59 A;  2KAT A;  2VGX B;  5BW8 C;  2VGY A;  2X6J A;  4L1B A;  5EKQ D;  2UWJ G;  3FFL A;  3QAR A;  2CFZ A;  4APO A;  4LER A;  1EDU A;  1E90 A;  4N2Q A;  3FTV A;  3JQ1 A;  4I17 A;  1X5B A;  2GGF A;  4IYP A;  3SI5 A;  3IHY A;  3I4G A;  3BEE A;  4C0E A;  3LDZ A;  3QWW A;  1E8Y A;  4MLP A;  3VTX A;  4N5C A;  2L9B A;  4GA0 A;  5ANR A;  1TJC A;  2QY7 A;  4AVX A;  4EEC A;  5FJY A;  3GYZ A;  2J07 A;  3RO2 A;  4JHR A;  5BV1 A;  4XI9 A;  2VYI A;  3LY7 A;  4WUY A;  3IHV A;  3FUD A;  5A23 A;  4DI3 A;  2OV8 A;  5DIZ A;  4XE0 A;  3ZYK A;  5BUZ A;  5LP0 A;  1MQS A;  1NA3 A;  4TRQ A;  4GA2 A;  3UQ3 A;  5LCW J;  2PQR A;  3FEX A;  4AP2 A;  3UT4 A;  5ARG A;  1DNP A;  4Q94 A;  4WWO A;  2V0P A;  2L6J A;  3D9K A;  3EJN A;  2CHZ A;  3PH0 C;  3TXN A;  4A3T A;  3CIA A;  3PS6 A;  3P2B A;  3CHS A;  3PDN A;  3HIZ A;  4G2V A;  2JLB A;  4GZ3 A;  5FTP A;  3QWV A;  3G2S A;  4PS8 A;  4ACK A;  2IOL A;  3UUX A;  2WXO A;  2WXK A;  5FZS A;  3ZYM A;  4HOQ A;  2KC7 A;  4AY6 A;  4U0Z A;  2V5F A;  3MYV A;  4URK A;  2WMO A;  2J4B A;  4CT0 A;  2XQ0 A;  4ANU A;  4HLE A;  4FJZ A;  4I9C A;  4B0Z A;  2WQ6 A;  2WXQ A;  5D0O D;  3LPZ A;  1HU3 A;  3CVP A;  3FUM A;  3O4Z A;  4I1O B;  3RRM B;  5E75 A;  4WNG A;  1H0A A;  4IUL A;  2Y4T A;  4P29 A;  3VLF A;  2VSX E;  4EQF A;  2WVI A;  3CKB A;  2CHX A;  2J49 A;  5CHE E;  4N3B A;  3MKQ B;  3UT7 A;  3G2U A;  1FVF A;  2NSZ A;  4OVV A;  2WXP A;  2AXZ A;  3ONK A;  1W3B A;  4UI9 J;  3FHE A;  3GZS A;  3FUE A;  4KZC A;  3RIB A;  1HF8 A;  5EX3 A;  3ZPJ A;  2MHK A;  3L54 A;  1DVP A;  1XGW A;  4BT9 A;  3CVL A;  3QKY A;  4TV3 A;  5G04 C;  1Z3X A;  1N52 A;  2JEK A;  4ILI A;  3MCX A;  2UY1 A;  2WXI A;  4ME2 A;  3U3W A;  3CVN A;  3NZU A;  4UQX A;  3SF4 A;  3CVV A;  4CDR A;  2BTD A;  4I2Z A;  3L13 A;  3CST A;  4GA1 A;  2AVP A;  1B89 A;  2YNQ A;  3FY4 A;  3SZ7 A;  3U66 A;  3TG5 A;  1UJJ A;  2C2L A;  3TL5 A;  3VTY A;  4I6J A;  2E2E A;  3PZD A;  1H2V C;  2CFU A;  3NF1 A;  2X6H A;  5G2N A;  4FJY A;  4A55 A;  5JHB A;  1BPO A;  4ILG A;  3C98 A;  4J8D A;  2V4L A;  5KJK A;  1E8W A;  2NXP A;  1LF8 A;  4WWP A;  5FT9 A;  3ML9 A;  4E6H A;  4LCT A;  2PM7 A;  2VGX A;  3HVE A;  4E85 A;  2XPY A;  5FQ4 A;  4NUR A;  4U0U A;  3CVX A;  3FU6 A;  2IU1 A;  3G2V A;  4RSY A;  3FTY A;  3UX4 A;  3IV0 A;  3B7S A;  3SNX A;  4GCO A;  3SGH A;  5G05 C;  3CKC A;  1HO8 A;  3LJ3 A;  1SZ9 A;  5CCL A;  2VSO E;  2I6H A;  4IN3 B;  2UY1 B;  2XRY A;  4K0R A;  1EYH A;  4G26 A;  3MZL B;  3RO3 A;  3D9M A;  3IBE A;  5D0Q D;  3SD5 A;  1QZ2 A;  5G55 A;  1UW4 B;  4BTA A;  1N54 A;  5BV0 A;  4JEU A;  3FUF A;  4C9B B;  4GU5 A;  3RKV A;  1HG5 A;  3TGO A;  2KCV A;  2VQ2 A;  4F53 A;  1UN8 A;  1E7U A;  4DI4 A;  1PC2 A;  3CHR A;  3FH8 A;  1TJF A;  1ZU2 A;  3OXG A;  1H6K A;  2KM4 A;  3HVE B;  3L22 A;  4DPR A;  2I1J A;  1KT0 A;  4FC8 A;  4J8F A;  2J08 A;  2CHW A;  1QQE A;  3CQC B;  2QFC A;  4BWR A;  3UPV A;  4I43 A;  2C0M A;  4NAC A;  4Q69 A;  2FUL A;  4FAD A;  1A17 A;  5KJL A;  4KZ0 A;  4EZL A;  2LSU A;  3QOU A;  4J8E A;  3CHM A;  3D9I A;  2P58 C;  1OWM A;  3FUI A;  1ELW A;  1HX8 A;  3MV2 B;  4XKC A;  4N2S A;  3QK0 A;  2XGS A;  4KYO B;  3CVU A;  2VTB B;  1WY6 A;  3LXU X;  3CV0 A;  2FO7 A;  4H7X A;  3D9O A;  3WXX A;  3APC A;  4AV7 A;  3R7R A;  3CSF A;  4F7A A;  4G24 A;  3L6A A;  2WXR A;  3G2T A;  4FA6 A;  3MKQ A;  1HXI A;  1E8X A;  3GZ1 A;  3QWP A;  5FQ7 A;  1JPL A;  2YQ8 A;  3ASD A;  5AEN A;  3QNK A;  4JA9 A;  3O48 A;  4YND A;  4F3V A;  3OTN A;  4BX8 A;  4CDM A;  4JXT A;  2Y3A A;  4PS3 A;  2HR2 A;  4XI0 A;  4HXI A;  3FH5 A;  2J09 A;  4RVB A;  3TAX A;  4FHK A;  3HYM B;  2BUG A;  2YIN A;  4HOR A;  1KT1 A;  3ZN3 A;  3SHF A;  4HOT A;  4TUU A;  3CEQ A;  3I3N A;  3VLD A;  2I2O A;  3OAW A;  4U04 A;  2XPZ A;  4Y6C A;  3KEZ A;  3RU0 A;  3QDN A;  5JJ6 A;  3S7D A;  4L7T A;  2RG8 A;  4XIF A;  3D9P A;  3ASG A;  3B7R L;  3BG1 B;  4FLH A;  3FTW A;  4G1T A;  5ENN A;  4Y6W A;  3PVL A;  2PM6 A;  2DCP A;  4WAF A;  1U3D A;  2CG2 A;  4EZJ A;  2XGO A;  4Q96 A;  1TEZ A;  2WM9 A;  3RK6 A;  1H19 A;  2AXU A;  5FWQ A;  2WQ7 A;  2FF4 A;  2IQC A;  3FTX A;  3T5X A;  3FDH A;  1H2T C;  3PUK A;  5CMW A;  4MS6 A;  3K9I A;  2AXV A;  4I2W A;  1IQR A;  4YVQ C;  4PDX A;  4B94 A;  5LCW C;  5FQ6 A;  1PAQ A;  3URZ A;  4PS7 A;  5C2Y A;  5JJT A;  3ZYL A;  3NZS A;  1FCH A;  3AU4 A;  3FEY A;  2M63 A;  4BFR A;  1OUV A;  1EPU A;  3Q47 B;  4GZD A;  4KBQ A;  4J8S A;  2XPI A;  3JYS A;  2PQN A;  5DBK A;  4CCA A;  4GZC A;  3JUI A;  3KAE A;  3LY9 A;  3PE3 A;  5LX8 A;  4F1S A;  1NZN A;  2X6K A;  1Y8M A;  4G11 A;  3FU0 A;  4WNF A;  3LVR E;  4JW1 A;  3HHM A;  1OWO A;  4L23 A;  4QFV A;  3JQ0 A;  4JHJ A;  1JWF A;  3LS8 A;  2IOS A;  4M3O A;  2GRL A;  3MGB A;  3ULQ A;  3U64 A;  1UJK A;  2WXG A;  3FP3 A;  3E4B A;  2L0I A;  3LVQ E;  5JJ7 A;  3DBS A;  3FUK A;  3ZW3 A;  2HM8 A;  3I4R B;  3U9W A;  5CCM A;  2LO6 A;  3EDT B;  2WXM A;  3FUJ A;  4AJW A;  4FU3 A;  3MJW A;  1E8Z A;  4B8C B;  3EIQ C;  2LAH A;  5J90 A;  4AXH A;  3ZHE B;  4GB9 A;  1KLX A;  2RD0 A;  1QNF A;  4UI9 K;  1HG2 A;  1XNF A;  3Q15 A;  5KCM A;  4CRW A;  4UI9 C;  3CGH A;  2VJ8 A;  3EIJ A;  4PUC A;  1HFA A;  4B89 A;  2VTB A;  3LKU A;  3ZIM A;  3R9A B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...