2IONA

Crystal structure of the c-terminal ma3 domain of pdcd4 (mouse); form2
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
129
structure length
129
Chain Sequence
QPVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIVMVLESTGESAFKMILDLLKSLWKSSTITIDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Antitumor protein
molecule keywords Programmed Cell Death 4, Pdcd4
publication title Structural basis for inhibition of translation by the tumor suppressor pdcd4.
pubmed doi rcsb
source organism Mus musculus
total genus 55
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2006-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02847 MA3 MA3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2ionA00
4C9BB 1H2TC 4GMJA 1N54A 3FEYA 2FULA 1H2VC 4B89A 4CEMA 2IOSA 2VSOE 1H2UA 3EIQC 3L6AA 2RG8A 4JHJA 2HM8A 1HU3A 1H6KA 2IONA 1UG3A 2KZTA 4B8AA 1N52A 2IU1A 4IULA 3FEXA 2ZU6B 1UW4B 2GGFA 2VSXE 4B8CB 4GMLA 2KZTB 3JUIA 4LUNU 5ANRA 2IOLA 4CT4A 1PAQA 2NSZA 4CRWA 2I2OA 4JHKA 3EIJA 3D3MA 3RK6A
chains in the Genus database with same CATH superfamily
4JB8P 3Q4AB 1ZB1A 3TWTA 1FT1A 4HOSA 2BKGA 2I6HA 3HXEA 1H19A 1SA4A 3HDXA 2L6JA 3Q5MA 2CHXA 3TJPA 3UT4A 4G24A 3EHNA 4WWNA 4BETA 3E37A 5E76A 1NA0A 2CFZA 4DI4A 4F53A 3HYMB 3ONKA 4LCTA 3KD7A 1TYQG 1TN7A 2PM6A 1N95A 2X38A 4KZCA 3ZXSA 4UWGA 4A63B 4JHRA 1JWFA 1FT2A 2XHEA 3D3MA 5G04C 4C9BB 3ONLA 2VSOE 4GTRA 3NZUA 4JHJA 3CSTA 3CVWA 3ASOE 2CHZA 3KSLA 4GMLA 4L9PA 4G1TA 3LDZA 2L6BA 3MCXA 4GZ3A 3FUHA 2ZXWE 2X6KA 4KMOA 3LJ3A 4N2SA 2NC9A 3DSXA 4BWRA 3UKRG 3ZUVB 4TUUA 2WXKA 2DWZA 4C48B 3MEKA 2I1KA 5BT1A 2X3MA 2C0LA 3EHMA 3APCA 4GPKA 3V30A 2IJGX 1TNOA 4GA1A 3VTYA 3W9FA 1BPOA 3SBTB 1UW4B 3DBSA 3IV0A 3CLJA 4ME2A 4HOQA 2LXLA 4FU3A 2ZGGA 3O48A 2BEDA 4HNAD 2HYZA 5ANLA 3SI5A 3AAAC 3FUNA 4GA2A 1O5MA 2X6FA 4UQYA 5KJKA 4A55A 3RAUA 2ZISA 3CIAA 3TWRA 4OAUC 3NBNB 3CV0A 3AG4E 3AS5A 2PNNA 4AIFA 1ELRA 1INZA 1B89A 2IEJA 4F7AA 3CK8A 2P9IG 5BNWA 2E0IA 3QAQA 4UWFA 3FY4A 4PS3A 5D0OD 2P9LG 3OXGA 2R59A 3TXMA 3L08A 3HXBA 3MKQA 1UOHA 1S70B 2FF4A 4IRUA 4LG6A 4I43A 5AQAA 4KZ0A 4YDEA 1QQEA 2ZU6B 4GA0A 3FUIA 1H6PA 4A1SA 4U0ZA 4LSZE 4ACKA 2EIKE 5FJYA 5JHAA 2WXLA 4OVVA 1OWNA 2XRYA 5BPPA 3TL5A 2LNIA 3UTMA 4G2VA 3SO8A 3R7RA 3J5QB 1MX2A 4PS7A 1UG3A 2FEZA 4E6HA 3TWVA 1EPUA 4PH4B 4JEUA 3ML8A 2XEHA 2V4HC 2OCCE 3S7JA 3CVXA 4E85A 5AARA 3DWLG 4ANXA 4FHKA 4GMJA 3RK6A 3LY9A 3PZ1A 1KT0A 5AQ7A 2H6GA 3FDHA 2R2LA 3QNKA 4QQIA 2VTBB 2MOWA 2OVBA 5ENTD 5EYPF 3ZHEB 4L7TA 1BLXB 2QZAA 4CCAA 3QWPA 2XCBA 3ZYMA 1L5JA 5IY5E 5HRYA 2DZOA 2DYSE 1D9SA 3TWQA 3ZYLA 2PZIA 4OYSA 3HXCA 3ZFWA 3FWVA 3DSVA 4L2YA 4K5BA 1H2VC 4BX9A 5BV1A 1O1RA 1TR4A 4U8VD 3SHFA 2V8SE 3CVLA 5FQ4A 4XIFA 4LUNU 3FH5A 4G11A 3NOCD 3P1UA 2ETBA 2WQ7A 1MZCA 4UWHA 5HS0A 4A3VA 3E33A 3Q78A 4RVBA 3NAWA 3EUVA 3Q15A 3ESKA 3SZ7A 3TWSA 3Q9UC 4GYOA 5T8IA 1LF8A 3CKBA 5ITZF 2QC9A 4I1OB 3UIPC 4GTOA 1JWGA 4UI9C 3PREA 4JC8A 5EX0A 3V79K 4ILGA 4DLOA 4FHJA 4EZLA 3MGBA 5A23A 3ASDA 4HFGA 5C1DA 4HS2A 1SQMA 2VSXE 3JUIA 3D9JA 1DNPA 5BXUA 1DCQA 2FULA 2JEKA 2IOSA 4KBQA 5ENNA 2GRRB 4BTAA 1Z5SC 1DCEA 3LCAA 3PDNA 2YQ8A 3PZDA 2UY1B 3HXDA 3FUEA 2VGYA 5BV0A 1OWOA 3ZPJA 4V3IA 4G26A 4FADA 4JXTA 1SZAA 4HRNA 3GZSA 4JEHA 1HH8A 2X6IA 5G2NA 3PVLA 4CRWA 3EHQA 3S2AA 3C3OA 2KCLA 3LYAA 3Q49B 1AP7A 3ASFA 2R5SA 3PZ2A 3O4ZA 1HS6A 3SFXA 3MZLB 5DBKA 4XZ4A 4GTVA 2FO7A 3D9KA 3QWVA 3OXFA 3ENEA 4J8EA 4W9RA 4BFRA 2YHEA 1H2TC 2GRNB 3ULQA 4AEZC 4O6FA 1JUQA 3U64A 2WXHA 4ATGA 1BI8B 3SY2A 4BERA 4WWPA 1JCQA 3UUXA 3KEZA 4U07A 1OCCE 4Y6WA 1MQSA 4KYOB 2J4DA 2LUHA 3UM3A 2AXZA 4GZ6A 3PNTB 3JUEA 1NZNA 4YDWA 4OAVB 3RKVA 3WXXA 4NURA 2KZTB 2YHCA 2LSUA 3UPVA 4DX1A 1O1TA 3FUKA 3PZ4A 4G8LA 3JQ0A 4HLEA 1E90A 3FTUA 3D9IA 4L1BA 4AOFA 1OCRE 4DJAA 3IKOB 2AWIA 2RD0A 3LEWA 2R02A 4RSYA 1OT8A 5HI7A 1YA0A 2J09A 2CG2A 5ENSD 4I6JA 3ESLA 2WXJA 3FEYA 2JLBA 4WNFA 1KLXA 4CYMD 3HXFA 5KJNA 1K1BA 4I1AA 2Y1LE 5ENPD 3LY7A 3FU6A 3QK0A 2XCCA 2XRZA 4WNGA 2VGXA 2MHKA 3FFLA 2BTDA 4GTMA 3D9NA 2A5EA 3ZVVA 4EBAG 2J9QA 3UIOC 3W9GA 2WXIA 5ARFA 4D10C 1E8WA 4DUIA 3L6AA 5CERB 1SZ9A 3L54A 3EU9A 3CVYA 5B1BE 3AG3E 2B6CA 2J07A 2IF4A 4K5AB 2VGEA 2GRPB 3R9MA 1MJ0A 1Z3YA 3TWUA 2F0YA 3L17A 1OCZE 2J49A 4X8QA 3E4BA 3ZYQA 4JZYA 1K1AA 1MX6A 4PDXA 1IQRA 4M7CA 2XZDG 1TJCA 1N94A 3TXNA 4L23A 2IU1A 4Y6CA 2DIWA 2VSNA 4XKCA 4UQZA 1ELKA 4GB9A 2EILE 5EYLA 4AV7A 2OEVA 3FTWA 3U4TA 3Q73A 4MBGA 3QB2A 4I2WA 2KCKA 3DXMG 1WDYA 3QC1A 1BI7B 4CDNA 2LO6A 2QY7A 4B8CB 4AY6A 3ZXPA 3UM1A 5LX8A 3TWXA 3E32A 4U96D 3DXKG 5H7PA 2GRQB 2EIJE 2FBNA 1SVXA 4EECA 1XGWA 2LAHA 3CVQA 4BY6A 5FQ7A 3DEPA 3QDNA 3CQGB 3ABME 2GGFA 4K5CA 3UQ3A 4EQFA 2I2OA 2WXPA 4YDYA 3BUAA 2AVPA 1E8YA 3Q79A 1VDYA 3UM0A 3UKUG 1ZU2A 2R05A 5EIDA 3J5PA 2WMNA 5FQ8A 4I9EA 2AW6A 2IY0C 3FP3A 5FIOA 4Q94A 1Y8MA 3APDA 4AJWA 3PE3A 4I1MA 1YCSB 3PNLB 1WM5A 2NYJA 2WXRA 2IO2C 1HXIA 4FLHA 1UJJA 3ISMC 2IONA 1OXJA 3FTYA 3FEXA 3UX4A 2Q7FA 4C0MA 1EDUA 5JJ7A 1K3ZD 2GW1A 4HOUA 5ANRA 2FO1E 5EDSA 2WXNA 3EIJA 1WG0A 3U9WA 1BD8A 3HG0D 3Q75A 4JPSA 2H6IA 2XS8A 5EN5D 1N0RA 3KS2A 2M63A 3EJNA 4J8YA 4RQIA 1HF8A 5AAOA 5CEDB 1KZOA 3OXLA 5B3SE 5KNGA 1TNBA 3AU5A 4U7EB 4FLBA 2MRIA 1FVHA 2R17C 1KT1A 3D9OA 5AQ9A 1N0QA 2XENA 3I4RB 2X6HA 5LOZA 2QYUA 3FUJA 4U8YD 4U04A 3UT7A 4F1PA 3L16A 1TJFA 3CK7A 4UWLA 3AG1E 4R7LA 1HFAA 3CVVA 3Q7AA 5CHEE 3IXEA 1EF1C 3SD5A 3MV3B 1X81A 2NXPA 1K8KG 2RG8A 3RRNB 4UUCA 3CHOA 4BESA 3N71A 5BXOA 3GW4A 2P9PG 2WQ6A 1X5BA 3HHMA 5CMYA 4JD2G 3P2BA 2Y69E 3KSQA 3E30A 2DCPA 3D9LA 3MX3A 4U0UA 5D66A 3VLDA 2EINE 2JABA 1TN6A 2ZIRA 4ILIA 5AJDA 3MKRA 3EHRA 4YDOA 3BG1B 4APOA 4IN3B 4N3AA 3MJWA 1OWMA 3UT8A 3RU0A 4UI9K 3L13A 3G2TA 2J4BA 1XNFA 3SFZA 3PEUB 1IKND 3U66A 4HI8A 1E8XA 5BUZA 4JL0A 1PC2A 4J0UA 2L0TB 4UQXA 3HVEA 5LCWJ 1TNZA 3BG0B 1PAQA 1QNFA 4UI9J 3CEQA 4H7YA 3PH0C 5ENOD 4B93B 3FTZA 3WG7E 4JVSA 5ARGA 4G25A 2ILRA 4XI9A 3HRAA 3L9TA 4TRQA 3GYZA 4C0EA 3DRAA 4AP2A 2XEVA 3RO3A 1D8DA 2AJAA 2V5FA 4RG6A 4F1SA 5KWDA 2WXOA 4KXKB 1S0PA 2Y3AA 3SNXA 1S64A 4TXRA 4GTPA 3VTXA 2WXFA 1OUVA 3PUJA 3ZNGA 3LJNA 3IEGA 4LERA 2YINA 3EDTB 3FH7A 3T8KA 3AG2E 3C3QA 3APFA 4XI0A 2VGXB 3C3RA 3QWWA 2GRLA 3DPYA 1FVFA 3V2OA 4XX5A 1LD8A 4XE0A 4WNDA 4BSXA 4MRUA 4BTBA 3X2QE 3CKCA 5CBOA 4UWKA 3B7UX 3JQ1A 3JCKC 3UINC 1V55E 1HZ4A 2LSVA 4MS6A 3ZN3A 2VTBA 1HG5A 2L0IA 3VLFA 3B7SA 1S63A 5CEAA 4U8HA 2YNQA 3AU4A 3S7DA 5M72A 5J90A 4HORA 3ZHEA 4CZ2D 3Q7FA 4GTTA 1JPLA 2CHWA 2WXMA 1NP7A 4U95D 4AVXA 2WB2A 4GZDA 5G05J 2P9NG 5JHBA 2BUGA 4DX2A 3CVUA 2LAIA 4N39A 2RFMA 2WVIA 4BT8A 2DZNA 4I9CA 3CHSA 5FZQA 2IO3C 4WAFA 3RIBA 2HR2A 2P58C 2VJ8A 3C72A 3T5XA 3EU5A 4Q96A 4BEPA 5FWQA 3DSSA 3C98A 1N4SA 2I9CA 5A7DB 2V0PA 1G3NB 1HX8A 4GTQA 1H2UA 4EZKA 2KCVA 5JJ6A 4IYPA 2WXGA 1H6KA 4A3TA 3LKUA 5CMWA 1A17A 1WY6A 3LVRE 5ENRD 3PRZA 2P9UG 2IOLA 4CT4A 2XGMA 2P2CP 1N9AA 5KBAA 3ML9A 3FHEA 2PM7A 4XEIG 3TG5A 4K0RA 3OAWA 2LXMA 4FP7A 3LXUX 3NZSA 5CRVA 1YMPA 3CHPA 4WWOA 4HOTA 3VLEA 2XPZA 5JJTA 4NACA 3L22A 5KNHD 4URKA 3NOGD 2ONDA 1RW2A 2KXPC 3UMVA 4B94A 5FZRA 3B7TA 2VYIA 4GTSA 2XPYA 4DI3A 3TWWA 3I4GA 3URZA 2GRMA 4LNBA 2Y4TA 4FJZA 3FULA 4F3VA 2NSZA 1MX4A 4F6RD 4O1PA 5EIBE 3SFYA 4A1GA 1WAO1 1N54A 5AN8A 2IFUA 4ILHB 1NFIE 3S7BA 1HU3A 1UN8A 2HE0A 3MKQB 2OVFA 4IULA 1H0AA 4AY5A 5AQBA 1ELWA 2ETAA 1IYGA 1W3BA 2WMOA 5G04J 3FTXA 4LEUA 3SF4A 4BX8A 1E7VA 3ZGQA 4FULA 2RKKA 4WUYA 5KJLA 2BF0X 3CHQA 3QOUA 3JXIA 1TNUA 3CHMA 2F37A 1Z3XA 1KZPA 4GAAA 4TV3A 3RJVA 2I1JA 1MHQA 1A5EA 4DK5A 5CECB 4KVMA 3Q9NC 3DSWA 2OEWA 5BW8C 3NB2A 2XGOA 3BQOA 5EILA 1IHGA 4U0SA 2P9SG 4I2ZA 3I5PA 3T8MA 4EPZA 3DSTA 3G2UA 1LD7A 2AXUA 4J8SA 1UJKA 3T9KA 2WM9A 1OWLA 4CDRA 3BU8A 4LNGA 3ZRHA 3Q47B 2KZTA 4LRZA 5B1AE 4GU5A 1DVPA 1TN8A 4FJYA 2H6FA 1NI1A 5FQ6A 2RFAA 3CVNA 1JCSA 5CBNA 5FZSA 4H7XA 4HI9A 5C2YA 3ZYKA 2KM4A 2GROB 4AXHA 3CK9A 4GZCA 4M3OA 4EBAA 5J08A 3B7BA 4XKBA 3TG4A 3R9AB 4O1OA 2PQRA 1DC2A 4N3CA 4NQ0A 4HVBA 3SGHA 3S7FA 1GW6A 3HVEB 3V2XA 3AS8A 1TNYA 2AXVA 2J08A 4YVOA 5HQ8A 3ABKE 3ASGA 4CT0A 3CR3A 1OCOE 1QBQA 4FA6A 4YVQC 3IBEA 4ABNA 4LNUD 1N4PA 1HG2A 2XS1A 2DYRE 1QYMA 4RLYA 3L82A 1NA3A 4GYYA 3C5RA 5ENQD 5T4YA 4HBDA 4I6EA 1E7UA 4DRXE 5D0QD 4J7WA 3AS4A 3ASNE 5AYWD 4AM9A 3RRMB 5LFAA 4HQDA 3KAEA 4GYWA 5CCMA 5CRUA 4TXQA 3QARA 4JA7A 3PUKA 4FC8A 5HKPA 4DX5D 3K9IA 3LVQE 1P5QA 3FUFA 2OV8A 4TUMA 4GMRA 4TXPA 3B95A 4N2QA 1D8EA 2PQNA 2R03A 5DIZA 3PE4A 3FTVA 2HO1A 3U3WA 4JW1A 2ZGDA 4DLQA 4HRLA 4NRHB 1TEZA 3ZEFA 1FPPA 2C2LA 2V4LA 2A4ZA 5KCMA 4ANWA 1Y6IA 2F8XK 3ZW3A 4OVUA 4JA9A 1RZ4A 3ZIMA 1ZBPA 3PS6A 1SW6A 4YNDA 3GZ1A 5FT9A 3DSUA 1E96B 4GCOA 3TAXA 2B0OE 4GZ5A 2UWJG 1OWPA 3LS8A 2MYOA 4I6GA 4JHKA 3NF1A 2VQ2A 4B89A 2ETCA 2BKKB 3EIQC 2H6HA 4CGVA 1AWCB 4ANUA 2WQHA 4G8KA 4EZJA 3JXJA 1V54E 2E2EA 5FTPA 5EX3A 3SQVA 4DX7D 3MYVA 1IQUA 1U3CA 3D9MA 1HE8A 2F8YA 4KT6B 3CGHA 3B7RL 4CGWA 1HO8A 3PEVB 4B8AA 4ZHBA 5LCWC 2CG3A 4NIKA 5KJMA 4HXIA 4G23A 2V5QC 2KC7A 1YYHA 5E75A 4CEMA 3V31A 3B13A 4DPRA 1E8ZA 3IHYA 4GPMA 1U3DA 3CSFA 1Q2ZA 1MYOA 4ANVA 4HLLA 3SBSA 1JCRA 2X6JA 3D9PA 3FTSA 2CFUA 2DVWA 5A6CA 3GZ2A 4KVOA 3CQCB 1KPSB 2Y4UA 3FU0A 3MV2B 4PUCA 4HRMB 5CCLA 4Z68A 2J8SD 3LY8A 3FUMA 2Y0BG 1EYHA 1IHBA 2L9BA 3FU3A 3QJZA 4PS8A 2QFCA 2WPVA 4L2LA 3R7QA 4J8FA 3PZ3A 5T3RA 4U63A 1Z6TA 2IQCA 3MA5A 4N5QA 2KATA 1N52A 3D9HA 3CVPA 3UXGA 2PL2A 3KEAA 2KBXA 3JYSA 2XQ0A 5D2MC 1FCHA 5AIJA 3TGOA 1OY3D 3RRUA 2C0MA 1NL4A 3ULEG 2XZTG 4GCNA 3UM2A 1IXVA 3NQPA 4ACLA 4ATZD 4J6IA 1SA5A 1N4RA 2FI7A 3HIZA 3G2VA 4N3BA 2EIME 3DEOA 3RO2A 4HB5A 2OOEA 5G05C 4DX6D 4P29A 1LTXA 2QYJA 5AENA 2DBAA 1PY1A 3I3NA 4MKTA 3LPZA 4ZFHA 4MLPA 3G2WA 2XEEA 1H6OA 3FUDA 3CHRA 3FH8A 4CDMA 3AJIA 3T5VA 5LP0A 4EHMA 3F6QA 5FINA 1BU9A 3DPDA 4BSZB 3UI2A 4QFVA 4BT9A 1U2VG 3ULYA 4J8DA 2WXQA 4N5CA 3FU5A 2XPIA 3ABLE 3E34A 1UN9A 3ZKJA 3QKYA 5JMND 5EKQD 4APFA 3OTNA 5G55A 3ASHA 2VSYA 2P9KG 3G2SA 4I17A 4RG9A 4B0ZA 3ZU7B 1N4QA 1O1SA 3RSEG 5AJLA 2EQXA 2A5UA 2HM8A 4K03A 4O60A 1N11A 4Q69A 2XGSA 3IHVA 2UY1A 5JA4D 3BEEA 4WNEA 1QZ2A
chains in the Genus database with same CATH topology
4XKBA 2KCLA 3LYAA 3TG4A 3Q49B 2DCPA 3D9LA 3Q4AB 4HOSA 3R9AB 3ASFA 2I6HA 2R5SA 3MX3A 4U0UA 1H19A 3O4ZA 3VLDA 1HS6A 3MZLB 5DBKA 2PQRA 4XZ4A 4N3CA 3HDXA 4NQ0A 2FO7A 2L6JA 4HVBA 3SGHA 3D9KA 3S7FA 3QWVA 3Q5MA 1GW6A 2CHXA 4ILIA 3TJPA 3HVEB 5AJDA 3MKRA 3UT4A 3AS8A 2AXVA 2J08A 4G24A 3EHNA 3ENEA 3OXFA 4J8EA 4WWNA 4YVOA 5HQ8A 4W9RA 4BFRA 2YHEA 1H2TC 3BG1B 4APOA 4IN3B 4N3AA 5E76A 3MJWA 1OWMA 3ASGA 3ULQA 3UT8A 1NA0A 3RU0A 4UI9K 3L13A 2CFZA 4AEZC 3G2TA 4DI4A 4F53A 2J4BA 1XNFA 3HYMB 4O6FA 1JUQA 3ONKA 3SFZA 3U64A 4CT0A 3PEUB 2WXHA 4LCTA 3KD7A 3U66A 4ATGA 4KZCA 3ZXSA 2PM6A 2X38A 1E8XA 3CR3A 5BUZA 4FA6A 4JL0A 4YVQC 1PC2A 4J0UA 2L0TB 4UQXA 4WWPA 3HVEA 3UUXA 3IBEA 4ABNA 5LCWJ 3KEZA 4U07A 3BG0B 4UWGA 1HG2A 1PAQA 4JHRA 1JWFA 1QNFA 4Y6WA 1MQSA 2XHEA 1NA3A 4GYYA 4KYOB 3D3MA 5G04C 5T4YA 4UI9J 4C9BB 2J4DA 3CEQA 3ONLA 1E7UA 4I6EA 4H7YA 2VSOE 5D0QD 3PH0C 3NZUA 2AXZA 3AS4A 4JHJA 3FTZA 4GZ6A 3PNTB 4JVSA 5AYWD 4AM9A 1NZNA 3CSTA 3RRMB 5LFAA 3KAEA 4GYWA 5ARGA 3CVWA 4G25A 5CCMA 2CHZA 3RKVA 3WXXA 4NURA 3QARA 4GMLA 4JA7A 2KZTB 2YHCA 2LSUA 3UPVA 4G1TA 3FUKA 3LDZA 3PUKA 2ILRA 3MCXA 4FC8A 4XI9A 4GZ3A 3K9IA 3LVQE 4TRQA 3GYZA 1P5QA 4C0EA 3FUHA 3FUFA 2OV8A 4AP2A 2X6KA 2XEVA 3RO3A 4KMOA 3JQ0A 2V5FA 3LJ3A 4HLEA 4RG6A 4F1SA 1E90A 2WXOA 3FTUA 3D9IA 4N2SA 2NC9A 4KXKB 1S0PA 4L1BA 4AOFA 4DJAA 2Y3AA 4BWRA 3SNXA 3IKOB 4N2QA 4TUUA 2WXKA 2AWIA 2RD0A 3LEWA 3MEKA 2I1KA 4RSYA 3VTXA 2PQNA 5BT1A 2WXFA 1OUVA 5HI7A 2X3MA 3PUJA 5DIZA 3PE4A 2C0LA 3FTVA 2HO1A 3U3WA 1YA0A 2J09A 2CG2A 4JW1A 3EHMA 4I6JA 3ESLA 3APCA 2WXJA 4GPKA 3IEGA 4LERA 3FEYA 2JLBA 2YINA 4WNFA 1KLXA 3EDTB 4DLQA 2IJGX 4NRHB 3FH7A 1TEZA 4GA1A 3VTYA 3APFA 1BPOA 3SBTB 4XI0A 2VGXB 1UW4B 3QWWA 5KJNA 2GRLA 4I1AA 3ZEFA 2C2LA 2V4LA 1FVFA 2A4ZA 5KCMA 3LY7A 3DBSA 3IV0A 4ANWA 3FU6A 4XX5A 3CLJA 1Y6IA 4ME2A 4HOQA 3ZW3A 4OVUA 4XE0A 4WNDA 4BSXA 4FU3A 4JA9A 4MRUA 4BTBA 3QK0A 3CKCA 3ZIMA 2XCCA 2XRZA 3O48A 4UWKA 3B7UX 3JQ1A 1ZBPA 3PS6A 2HYZA 5ANLA 3JCKC 4WNGA 3SI5A 2VGXA 3FUNA 4GA2A 2X6FA 2MHKA 4UQYA 4YNDA 1HZ4A 4A55A 2LSVA 4MS6A 3ZN3A 5KJKA 1HG5A 2L0IA 2VTBA 3VLFA 3GZ1A 5FT9A 1E96B 3FFLA 3CIAA 4GCOA 3TAXA 2BTDA 3D9NA 3B7SA 3ZVVA 4GZ5A 4U8HA 4EBAG 2UWJG 1OWPA 2J9QA 3LS8A 2YNQA 3CV0A 3AU4A 3AS5A 3S7DA 5M72A 5J90A 4HORA 3ZHEA 2WXIA 4I6GA 4JHKA 3NF1A 5ARFA 4D10C 2VQ2A 4AIFA 1ELRA 1INZA 1E8WA 1B89A 4B89A 4F7AA 3CK8A 3EIQC 3L6AA 1JPLA 2CHWA 2WXMA 4CGVA 5BNWA 1NP7A 1SZ9A 4ANUA 2E0IA 2WQHA 3L54A 3QAQA 4AVXA 3CVYA 2WB2A 4UWFA 4GZDA 3FY4A 2J07A 2IF4A 5G05J 4PS3A 4EZJA 5D0OD 5JHBA 2BUGA 2E2EA 5FTPA 5EX3A 3CVUA 2LAIA 4N39A 1Z3YA 3OXGA 3MYVA 2R59A 2WVIA 3L17A 3TXMA 3L08A 4BT8A 1IQUA 1U3CA 3D9MA 3MKQA 1HE8A 2J49A 4KT6B 3CGHA 3B7RL 4I9CA 3E4BA 3CHSA 3ZYQA 2FF4A 4IRUA 4JZYA 1HO8A 4I43A 4CGWA 4PDXA 1IQRA 5FZQA 3PEVB 4KZ0A 4WAFA 3RIBA 1TJCA 2HR2A 3TXNA 4B8AA 4L23A 2IU1A 1QQEA 2ZU6B 4GA0A 3FUIA 4Y6CA 2DIWA 5LCWC 2P58C 2VJ8A 2VSNA 4XKCA 4A1SA 3T5XA 2CG3A 4Q96A 4UQZA 1ELKA 4U0ZA 4ACKA 5JHAA 5FJYA 5FWQA 5KJMA 4GB9A 2WXLA 4OVVA 3C98A 4HXIA 2I9CA 1OWNA 4AV7A 4G23A 2XRYA 5A7DB 5BPPA 2V0PA 2KC7A 3FTWA 3TL5A 3U4TA 2LNIA 1HX8A 4G2VA 3QB2A 4I2WA 5E75A 4CEMA 1H2UA 3B13A 4EZKA 2KCKA 2KCVA 5JJ6A 1E8ZA 3IHYA 3QC1A 4DPRA 3R7RA 4CDNA 4IYPA 2LO6A 2WXGA 1H6KA 4PS7A 4A3TA 1UG3A 2FEZA 4E6HA 1U3DA 3CSFA 3LKUA 1EPUA 5CMWA 1A17A 4ANVA 4PH4B 2QY7A 3SBSA 2X6JA 3D9PA 3ML8A 4JEUA 1WY6A 3FTSA 3LVRE 4B8CB 4AY6A 3PRZA 3S7JA 2CFUA 2IOLA 4CT4A 5LX8A 5A6CA 2XGMA 3GZ2A 3CQCB 4KVOA 3CVXA 3ML9A 2Y4UA 3FHEA 4E85A 2PM7A 3TG5A 3FU0A 4ANXA 3MV2B 4FHKA 4GMJA 4K0RA 3RK6A 4PUCA 3OAWA 5CCLA 2FBNA 3LY9A 4FP7A 3LXUX 3LY8A 3NZSA 4EECA 1XGWA 1KT0A 2LAHA 3CVQA 3FUMA 3FDHA 3CHPA 4WWOA 5FQ7A 4BY6A 3VLEA 3QDNA 4HOTA 3CQGB 2XPZA 3QNKA 2GGFA 5JJTA 3UQ3A 1EYHA 2MOWA 2VTBB 2OVBA 4NACA 2L9BA 3L22A 3FU3A 4URKA 4EQFA 3QJZA 2ONDA 4PS8A 2I2OA 2WXPA 3UMVA 4B94A 5FZRA 2QFCA 3B7TA 2AVPA 2VYIA 2WPVA 2XPYA 4L2LA 1E8YA 3R7QA 4J8FA 3ZHEB 1VDYA 4DI3A 4L7TA 3I4GA 4CCAA 1ZU2A 5T3RA 4U63A 2WMNA 1Z6TA 2IQCA 2XCBA 3MA5A 3QWPA 5FQ8A 3ZYMA 1L5JA 4I9EA 2AW6A 2KATA 3FP3A 1N52A 3URZA 2GRMA 2Y4TA 4FJZA 3FULA 3ZYLA 2PZIA 4Q94A 4F3VA 1Y8MA 3APDA 4OYSA 4AJWA 3CVPA 2NSZA 3PE3A 4I1MA 2PL2A 3ZFWA 3FWVA 3PNLB 1WM5A 3JYSA 2WXRA 4A1GA 2XQ0A 4L2YA 1WAO1 1N54A 1H2VC 1FCHA 1HXIA 4FLHA 4BX9A 5AIJA 5BV1A 3TGOA 2IFUA 4ILHB 3S7BA 1HU3A 3RRUA 1UN8A 1UJJA 3MKQB 2IONA 3SHFA 2C0MA 2OVFA 3FTYA 1H0AA 4IULA 3FEXA 3UX4A 2Q7FA 4C0MA 1EDUA 2V8SE 3CVLA 5FQ4A 5JJ7A 4GCNA 4XIFA 2GW1A 4HOUA 4LUNU 3NQPA 5ANRA 3FH5A 4ACLA 4G11A 3P1UA 4J6IA 5EDSA 2WQ7A 2WXNA 4UWHA 4AY5A 4A3VA 3EIJA 1ELWA 2FI7A 3HIZA 4RVBA 3U9WA 1IYGA 1W3BA 2WMOA 3G2VA 3FTXA 3Q15A 4LEUA 4N3BA 5G04J 3ESKA 4JPSA 3SF4A 3SZ7A 4BX8A 1E7VA 4GYOA 3ZGQA 4FULA 5T8IA 1LF8A 3CKBA 3KS2A 2OOEA 5G05C 3RO2A 4WUYA 5KJLA 2BF0X 3CHQA 3QOUA 2M63A 3EJNA 4P29A 3CHMA 1HF8A 5AENA 1Z3XA 4TV3A 4GAAA 2DBAA 3RJVA 1PY1A 3I3NA 4I1OB 2I1JA 3OXLA 1MHQA 4MKTA 3LPZA 4DK5A 1JWGA 4UI9C 4MLPA 3G2WA 3AU5A 3PREA 4KVMA 4FLBA 2MRIA 1FVHA 4JC8A 2R17C 3FUDA 1KT1A 4ILGA 5EX0A 3CHRA 3FH8A 4FHJA 4CDMA 4DLOA 4EZLA 3MGBA 3T5VA 5A23A 5BW8C 3ASDA 3D9OA 4HFGA 5LP0A 2XGOA 5C1DA 4HS2A 1IHGA 3DPDA 1SQMA 2VSXE 3I4RB 4QFVA 4U0SA 4BT9A 4I2ZA 3JUIA 4J8DA 2X6HA 3I5PA 5LOZA 3T8MA 3FUJA 2WXQA 4EPZA 3D9JA 3G2UA 2AXUA 4J8SA 1DNPA 4U04A 4N5CA 3UT7A 1UJKA 3FU5A 2XPIA 2WM9A 2FULA 3L16A 1OWLA 1UN9A 2JEKA 2IOSA 4CDRA 4KBQA 1TJFA 3CK7A 3QKYA 5ENNA 3ZRHA 4BTAA 3Q47B 4UWLA 5EKQD 4APFA 2KZTA 4LRZA 4R7LA 3OTNA 5G55A 1HFAA 3LCAA 3ASHA 3CVVA 3PDNA 4GU5A 2YQ8A 2VSYA 3PZDA 2UY1B 5CHEE 3G2SA 1DVPA 4I17A 4RG9A 3FUEA 2VGYA 4B0ZA 1EF1C 3SD5A 4FJYA 3MV3B 5FQ6A 5BV0A 2NXPA 5AJLA 2EQXA 2RG8A 1OWOA 3CVNA 2A5UA 2HM8A 4K03A 5FZSA 3ZPJA 3RRNB 3CHOA 4H7XA 4V3IA 4G26A 5C2YA 3N71A 4Q69A 3ZYKA 2KM4A 3GW4A 2XGSA 4JXTA 4FADA 3IHVA 2WQ6A 1SZAA 4AXHA 2UY1A 1X5BA 3CK9A 3GZSA 4JEHA 4GZCA 4M3OA 1HH8A 2X6IA 3HHMA 5CMYA 3BEEA 5G2NA 3P2BA 3PVLA 4EBAA 4WNEA 5J08A 4CRWA 3S2AA 1QZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C9B B;  1H2T C;  4GMJ A;  1N54 A;  3FEY A;  2FUL A;  1H2V C;  4B89 A;  4CEM A;  2IOS A;  2VSO E;  1H2U A;  3EIQ C;  3L6A A;  2RG8 A;  4JHJ A;  2HM8 A;  1HU3 A;  1H6K A;  2ION A;  1UG3 A;  2KZT A;  4B8A A;  1N52 A;  2IU1 A;  4IUL A;  3FEX A;  2ZU6 B;  1UW4 B;  2GGF A;  2VSX E;  4B8C B;  4GML A;  2KZT B;  3JUI A;  4LUN U;  5ANR A;  2IOL A;  4CT4 A;  1PAQ A;  2NSZ A;  4CRW A;  2I2O A;  4JHK A;  3EIJ A;  3D3M A;  3RK6 A; 
#chains in the Genus database with same CATH topology
 4JB8 P;  3Q4A B;  1ZB1 A;  3TWT A;  1FT1 A;  4HOS A;  2BKG A;  2I6H A;  3HXE A;  1H19 A;  1SA4 A;  3HDX A;  2L6J A;  3Q5M A;  2CHX A;  3TJP A;  3UT4 A;  4G24 A;  3EHN A;  4WWN A;  4BET A;  3E37 A;  5E76 A;  1NA0 A;  2CFZ A;  4DI4 A;  4F53 A;  3HYM B;  3ONK A;  4LCT A;  3KD7 A;  1TYQ G;  1TN7 A;  2PM6 A;  1N95 A;  2X38 A;  4KZC A;  3ZXS A;  4UWG A;  4A63 B;  4JHR A;  1JWF A;  1FT2 A;  2XHE A;  3D3M A;  5G04 C;  4C9B B;  3ONL A;  2VSO E;  4GTR A;  3NZU A;  4JHJ A;  3CST A;  3CVW A;  3ASO E;  2CHZ A;  3KSL A;  4GML A;  4L9P A;  4G1T A;  3LDZ A;  2L6B A;  3MCX A;  4GZ3 A;  3FUH A;  2ZXW E;  2X6K A;  4KMO A;  3LJ3 A;  4N2S A;  2NC9 A;  3DSX A;  4BWR A;  3UKR G;  3ZUV B;  4TUU A;  2WXK A;  2DWZ A;  4C48 B;  3MEK A;  2I1K A;  5BT1 A;  2X3M A;  2C0L A;  3EHM A;  3APC A;  4GPK A;  3V30 A;  2IJG X;  1TNO A;  4GA1 A;  3VTY A;  3W9F A;  1BPO A;  3SBT B;  1UW4 B;  3DBS A;  3IV0 A;  3CLJ A;  4ME2 A;  4HOQ A;  2LXL A;  4FU3 A;  2ZGG A;  3O48 A;  2BED A;  4HNA D;  2HYZ A;  5ANL A;  3SI5 A;  3AAA C;  3FUN A;  4GA2 A;  1O5M A;  2X6F A;  4UQY A;  5KJK A;  4A55 A;  3RAU A;  2ZIS A;  3CIA A;  3TWR A;  4OAU C;  3NBN B;  3CV0 A;  3AG4 E;  3AS5 A;  2PNN A;  4AIF A;  1ELR A;  1INZ A;  1B89 A;  2IEJ A;  4F7A A;  3CK8 A;  2P9I G;  5BNW A;  2E0I A;  3QAQ A;  4UWF A;  3FY4 A;  4PS3 A;  5D0O D;  2P9L G;  3OXG A;  2R59 A;  3TXM A;  3L08 A;  3HXB A;  3MKQ A;  1UOH A;  1S70 B;  2FF4 A;  4IRU A;  4LG6 A;  4I43 A;  5AQA A;  4KZ0 A;  4YDE A;  1QQE A;  2ZU6 B;  4GA0 A;  3FUI A;  1H6P A;  4A1S A;  4U0Z A;  4LSZ E;  4ACK A;  2EIK E;  5FJY A;  5JHA A;  2WXL A;  4OVV A;  1OWN A;  2XRY A;  5BPP A;  3TL5 A;  2LNI A;  3UTM A;  4G2V A;  3SO8 A;  3R7R A;  3J5Q B;  1MX2 A;  4PS7 A;  1UG3 A;  2FEZ A;  4E6H A;  3TWV A;  1EPU A;  4PH4 B;  4JEU A;  3ML8 A;  2XEH A;  2V4H C;  2OCC E;  3S7J A;  3CVX A;  4E85 A;  5AAR A;  3DWL G;  4ANX A;  4FHK A;  4GMJ A;  3RK6 A;  3LY9 A;  3PZ1 A;  1KT0 A;  5AQ7 A;  2H6G A;  3FDH A;  2R2L A;  3QNK A;  4QQI A;  2VTB B;  2MOW A;  2OVB A;  5ENT D;  5EYP F;  3ZHE B;  4L7T A;  1BLX B;  2QZA A;  4CCA A;  3QWP A;  2XCB A;  3ZYM A;  1L5J A;  5IY5 E;  5HRY A;  2DZO A;  2DYS E;  1D9S A;  3TWQ A;  3ZYL A;  2PZI A;  4OYS A;  3HXC A;  3ZFW A;  3FWV A;  3DSV A;  4L2Y A;  4K5B A;  1H2V C;  4BX9 A;  5BV1 A;  1O1R A;  1TR4 A;  4U8V D;  3SHF A;  2V8S E;  3CVL A;  5FQ4 A;  4XIF A;  4LUN U;  3FH5 A;  4G11 A;  3NOC D;  3P1U A;  2ETB A;  2WQ7 A;  1MZC A;  4UWH A;  5HS0 A;  4A3V A;  3E33 A;  3Q78 A;  4RVB A;  3NAW A;  3EUV A;  3Q15 A;  3ESK A;  3SZ7 A;  3TWS A;  3Q9U C;  4GYO A;  5T8I A;  1LF8 A;  3CKB A;  5ITZ F;  2QC9 A;  4I1O B;  3UIP C;  4GTO A;  1JWG A;  4UI9 C;  3PRE A;  4JC8 A;  5EX0 A;  3V79 K;  4ILG A;  4DLO A;  4FHJ A;  4EZL A;  3MGB A;  5A23 A;  3ASD A;  4HFG A;  5C1D A;  4HS2 A;  1SQM A;  2VSX E;  3JUI A;  3D9J A;  1DNP A;  5BXU A;  1DCQ A;  2FUL A;  2JEK A;  2IOS A;  4KBQ A;  5ENN A;  2GRR B;  4BTA A;  1Z5S C;  1DCE A;  3LCA A;  3PDN A;  2YQ8 A;  3PZD A;  2UY1 B;  3HXD A;  3FUE A;  2VGY A;  5BV0 A;  1OWO A;  3ZPJ A;  4V3I A;  4G26 A;  4FAD A;  4JXT A;  1SZA A;  4HRN A;  3GZS A;  4JEH A;  1HH8 A;  2X6I A;  5G2N A;  3PVL A;  4CRW A;  3EHQ A;  3S2A A;  3C3O A;  2KCL A;  3LYA A;  3Q49 B;  1AP7 A;  3ASF A;  2R5S A;  3PZ2 A;  3O4Z A;  1HS6 A;  3SFX A;  3MZL B;  5DBK A;  4XZ4 A;  4GTV A;  2FO7 A;  3D9K A;  3QWV A;  3OXF A;  3ENE A;  4J8E A;  4W9R A;  4BFR A;  2YHE A;  1H2T C;  2GRN B;  3ULQ A;  4AEZ C;  4O6F A;  1JUQ A;  3U64 A;  2WXH A;  4ATG A;  1BI8 B;  3SY2 A;  4BER A;  4WWP A;  1JCQ A;  3UUX A;  3KEZ A;  4U07 A;  1OCC E;  4Y6W A;  1MQS A;  4KYO B;  2J4D A;  2LUH A;  3UM3 A;  2AXZ A;  4GZ6 A;  3PNT B;  3JUE A;  1NZN A;  4YDW A;  4OAV B;  3RKV A;  3WXX A;  4NUR A;  2KZT B;  2YHC A;  2LSU A;  3UPV A;  4DX1 A;  1O1T A;  3FUK A;  3PZ4 A;  4G8L A;  3JQ0 A;  4HLE A;  1E90 A;  3FTU A;  3D9I A;  4L1B A;  4AOF A;  1OCR E;  4DJA A;  3IKO B;  2AWI A;  2RD0 A;  3LEW A;  2R02 A;  4RSY A;  1OT8 A;  5HI7 A;  1YA0 A;  2J09 A;  2CG2 A;  5ENS D;  4I6J A;  3ESL A;  2WXJ A;  3FEY A;  2JLB A;  4WNF A;  1KLX A;  4CYM D;  3HXF A;  5KJN A;  1K1B A;  4I1A A;  2Y1L E;  5ENP D;  3LY7 A;  3FU6 A;  3QK0 A;  2XCC A;  2XRZ A;  4WNG A;  2VGX A;  2MHK A;  3FFL A;  2BTD A;  4GTM A;  3D9N A;  2A5E A;  3ZVV A;  4EBA G;  2J9Q A;  3UIO C;  3W9G A;  2WXI A;  5ARF A;  4D10 C;  1E8W A;  4DUI A;  3L6A A;  5CER B;  1SZ9 A;  3L54 A;  3EU9 A;  3CVY A;  5B1B E;  3AG3 E;  2B6C A;  2J07 A;  2IF4 A;  4K5A B;  2VGE A;  2GRP B;  3R9M A;  1MJ0 A;  1Z3Y A;  3TWU A;  2F0Y A;  3L17 A;  1OCZ E;  2J49 A;  4X8Q A;  3E4B A;  3ZYQ A;  4JZY A;  1K1A A;  1MX6 A;  4PDX A;  1IQR A;  4M7C A;  2XZD G;  1TJC A;  1N94 A;  3TXN A;  4L23 A;  2IU1 A;  4Y6C A;  2DIW A;  2VSN A;  4XKC A;  4UQZ A;  1ELK A;  4GB9 A;  2EIL E;  5EYL A;  4AV7 A;  2OEV A;  3FTW A;  3U4T A;  3Q73 A;  4MBG A;  3QB2 A;  4I2W A;  2KCK A;  3DXM G;  1WDY A;  3QC1 A;  1BI7 B;  4CDN A;  2LO6 A;  2QY7 A;  4B8C B;  4AY6 A;  3ZXP A;  3UM1 A;  5LX8 A;  3TWX A;  3E32 A;  4U96 D;  3DXK G;  5H7P A;  2GRQ B;  2EIJ E;  2FBN A;  1SVX A;  4EEC A;  1XGW A;  2LAH A;  3CVQ A;  4BY6 A;  5FQ7 A;  3DEP A;  3QDN A;  3CQG B;  3ABM E;  2GGF A;  4K5C A;  3UQ3 A;  4EQF A;  2I2O A;  2WXP A;  4YDY A;  3BUA A;  2AVP A;  1E8Y A;  3Q79 A;  1VDY A;  3UM0 A;  3UKU G;  1ZU2 A;  2R05 A;  5EID A;  3J5P A;  2WMN A;  5FQ8 A;  4I9E A;  2AW6 A;  2IY0 C;  3FP3 A;  5FIO A;  4Q94 A;  1Y8M A;  3APD A;  4AJW A;  3PE3 A;  4I1M A;  1YCS B;  3PNL B;  1WM5 A;  2NYJ A;  2WXR A;  2IO2 C;  1HXI A;  4FLH A;  1UJJ A;  3ISM C;  2ION A;  1OXJ A;  3FTY A;  3FEX A;  3UX4 A;  2Q7F A;  4C0M A;  1EDU A;  5JJ7 A;  1K3Z D;  2GW1 A;  4HOU A;  5ANR A;  2FO1 E;  5EDS A;  2WXN A;  3EIJ A;  1WG0 A;  3U9W A;  1BD8 A;  3HG0 D;  3Q75 A;  4JPS A;  2H6I A;  2XS8 A;  5EN5 D;  1N0R A;  3KS2 A;  2M63 A;  3EJN A;  4J8Y A;  4RQI A;  1HF8 A;  5AAO A;  5CED B;  1KZO A;  3OXL A;  5B3S E;  5KNG A;  1TNB A;  3AU5 A;  4U7E B;  4FLB A;  2MRI A;  1FVH A;  2R17 C;  1KT1 A;  3D9O A;  5AQ9 A;  1N0Q A;  2XEN A;  3I4R B;  2X6H A;  5LOZ A;  2QYU A;  3FUJ A;  4U8Y D;  4U04 A;  3UT7 A;  4F1P A;  3L16 A;  1TJF A;  3CK7 A;  4UWL A;  3AG1 E;  4R7L A;  1HFA A;  3CVV A;  3Q7A A;  5CHE E;  3IXE A;  1EF1 C;  3SD5 A;  3MV3 B;  1X81 A;  2NXP A;  1K8K G;  2RG8 A;  3RRN B;  4UUC A;  3CHO A;  4BES A;  3N71 A;  5BXO A;  3GW4 A;  2P9P G;  2WQ6 A;  1X5B A;  3HHM A;  5CMY A;  4JD2 G;  3P2B A;  2Y69 E;  3KSQ A;  3E30 A;  2DCP A;  3D9L A;  3MX3 A;  4U0U A;  5D66 A;  3VLD A;  2EIN E;  2JAB A;  1TN6 A;  2ZIR A;  4ILI A;  5AJD A;  3MKR A;  3EHR A;  4YDO A;  3BG1 B;  4APO A;  4IN3 B;  4N3A A;  3MJW A;  1OWM A;  3UT8 A;  3RU0 A;  4UI9 K;  3L13 A;  3G2T A;  2J4B A;  1XNF A;  3SFZ A;  3PEU B;  1IKN D;  3U66 A;  4HI8 A;  1E8X A;  5BUZ A;  4JL0 A;  1PC2 A;  4J0U A;  2L0T B;  4UQX A;  3HVE A;  5LCW J;  1TNZ A;  3BG0 B;  1PAQ A;  1QNF A;  4UI9 J;  3CEQ A;  4H7Y A;  3PH0 C;  5ENO D;  4B93 B;  3FTZ A;  3WG7 E;  4JVS A;  5ARG A;  4G25 A;  2ILR A;  4XI9 A;  3HRA A;  3L9T A;  4TRQ A;  3GYZ A;  4C0E A;  3DRA A;  4AP2 A;  2XEV A;  3RO3 A;  1D8D A;  2AJA A;  2V5F A;  4RG6 A;  4F1S A;  5KWD A;  2WXO A;  4KXK B;  1S0P A;  2Y3A A;  3SNX A;  1S64 A;  4TXR A;  4GTP A;  3VTX A;  2WXF A;  1OUV A;  3PUJ A;  3ZNG A;  3LJN A;  3IEG A;  4LER A;  2YIN A;  3EDT B;  3FH7 A;  3T8K A;  3AG2 E;  3C3Q A;  3APF A;  4XI0 A;  2VGX B;  3C3R A;  3QWW A;  2GRL A;  3DPY A;  1FVF A;  3V2O A;  4XX5 A;  1LD8 A;  4XE0 A;  4WND A;  4BSX A;  4MRU A;  4BTB A;  3X2Q E;  3CKC A;  5CBO A;  4UWK A;  3B7U X;  3JQ1 A;  3JCK C;  3UIN C;  1V55 E;  1HZ4 A;  2LSV A;  4MS6 A;  3ZN3 A;  2VTB A;  1HG5 A;  2L0I A;  3VLF A;  3B7S A;  1S63 A;  5CEA A;  4U8H A;  2YNQ A;  3AU4 A;  3S7D A;  5M72 A;  5J90 A;  4HOR A;  3ZHE A;  4CZ2 D;  3Q7F A;  4GTT A;  1JPL A;  2CHW A;  2WXM A;  1NP7 A;  4U95 D;  4AVX A;  2WB2 A;  4GZD A;  5G05 J;  2P9N G;  5JHB A;  2BUG A;  4DX2 A;  3CVU A;  2LAI A;  4N39 A;  2RFM A;  2WVI A;  4BT8 A;  2DZN A;  4I9C A;  3CHS A;  5FZQ A;  2IO3 C;  4WAF A;  3RIB A;  2HR2 A;  2P58 C;  2VJ8 A;  3C72 A;  3T5X A;  3EU5 A;  4Q96 A;  4BEP A;  5FWQ A;  3DSS A;  3C98 A;  1N4S A;  2I9C A;  5A7D B;  2V0P A;  1G3N B;  1HX8 A;  4GTQ A;  1H2U A;  4EZK A;  2KCV A;  5JJ6 A;  4IYP A;  2WXG A;  1H6K A;  4A3T A;  3LKU A;  5CMW A;  1A17 A;  1WY6 A;  3LVR E;  5ENR D;  3PRZ A;  2P9U G;  2IOL A;  4CT4 A;  2XGM A;  2P2C P;  1N9A A;  5KBA A;  3ML9 A;  3FHE A;  2PM7 A;  4XEI G;  3TG5 A;  4K0R A;  3OAW A;  2LXM A;  4FP7 A;  3LXU X;  3NZS A;  5CRV A;  1YMP A;  3CHP A;  4WWO A;  4HOT A;  3VLE A;  2XPZ A;  5JJT A;  4NAC A;  3L22 A;  5KNH D;  4URK A;  3NOG D;  2OND A;  1RW2 A;  2KXP C;  3UMV A;  4B94 A;  5FZR A;  3B7T A;  2VYI A;  4GTS A;  2XPY A;  4DI3 A;  3TWW A;  3I4G A;  3URZ A;  2GRM A;  4LNB A;  2Y4T A;  4FJZ A;  3FUL A;  4F3V A;  2NSZ A;  1MX4 A;  4F6R D;  4O1P A;  5EIB E;  3SFY A;  4A1G A;  1WAO 1;  1N54 A;  5AN8 A;  2IFU A;  4ILH B;  1NFI E;  3S7B A;  1HU3 A;  1UN8 A;  2HE0 A;  3MKQ B;  2OVF A;  4IUL A;  1H0A A;  4AY5 A;  5AQB A;  1ELW A;  2ETA A;  1IYG A;  1W3B A;  2WMO A;  5G04 J;  3FTX A;  4LEU A;  3SF4 A;  4BX8 A;  1E7V A;  3ZGQ A;  4FUL A;  2RKK A;  4WUY A;  5KJL A;  2BF0 X;  3CHQ A;  3QOU A;  3JXI A;  1TNU A;  3CHM A;  2F37 A;  1Z3X A;  1KZP A;  4GAA A;  4TV3 A;  3RJV A;  2I1J A;  1MHQ A;  1A5E A;  4DK5 A;  5CEC B;  4KVM A;  3Q9N C;  3DSW A;  2OEW A;  5BW8 C;  3NB2 A;  2XGO A;  3BQO A;  5EIL A;  1IHG A;  4U0S A;  2P9S G;  4I2Z A;  3I5P A;  3T8M A;  4EPZ A;  3DST A;  3G2U A;  1LD7 A;  2AXU A;  4J8S A;  1UJK A;  3T9K A;  2WM9 A;  1OWL A;  4CDR A;  3BU8 A;  4LNG A;  3ZRH A;  3Q47 B;  2KZT A;  4LRZ A;  5B1A E;  4GU5 A;  1DVP A;  1TN8 A;  4FJY A;  2H6F A;  1NI1 A;  5FQ6 A;  2RFA A;  3CVN A;  1JCS A;  5CBN A;  5FZS A;  4H7X A;  4HI9 A;  5C2Y A;  3ZYK A;  2KM4 A;  2GRO B;  4AXH A;  3CK9 A;  4GZC A;  4M3O A;  4EBA A;  5J08 A;  3B7B A;  4XKB A;  3TG4 A;  3R9A B;  4O1O A;  2PQR A;  1DC2 A;  4N3C A;  4NQ0 A;  4HVB A;  3SGH A;  3S7F A;  1GW6 A;  3HVE B;  3V2X A;  3AS8 A;  1TNY A;  2AXV A;  2J08 A;  4YVO A;  5HQ8 A;  3ABK E;  3ASG A;  4CT0 A;  3CR3 A;  1OCO E;  1QBQ A;  4FA6 A;  4YVQ C;  3IBE A;  4ABN A;  4LNU D;  1N4P A;  1HG2 A;  2XS1 A;  2DYR E;  1QYM A;  4RLY A;  3L82 A;  1NA3 A;  4GYY A;  3C5R A;  5ENQ D;  5T4Y A;  4HBD A;  4I6E A;  1E7U A;  4DRX E;  5D0Q D;  4J7W A;  3AS4 A;  3ASN E;  5AYW D;  4AM9 A;  3RRM B;  5LFA A;  4HQD A;  3KAE A;  4GYW A;  5CCM A;  5CRU A;  4TXQ A;  3QAR A;  4JA7 A;  3PUK A;  4FC8 A;  5HKP A;  4DX5 D;  3K9I A;  3LVQ E;  1P5Q A;  3FUF A;  2OV8 A;  4TUM A;  4GMR A;  4TXP A;  3B95 A;  4N2Q A;  1D8E A;  2PQN A;  2R03 A;  5DIZ A;  3PE4 A;  3FTV A;  2HO1 A;  3U3W A;  4JW1 A;  2ZGD A;  4DLQ A;  4HRL A;  4NRH B;  1TEZ A;  3ZEF A;  1FPP A;  2C2L A;  2V4L A;  2A4Z A;  5KCM A;  4ANW A;  1Y6I A;  2F8X K;  3ZW3 A;  4OVU A;  4JA9 A;  1RZ4 A;  3ZIM A;  1ZBP A;  3PS6 A;  1SW6 A;  4YND A;  3GZ1 A;  5FT9 A;  3DSU A;  1E96 B;  4GCO A;  3TAX A;  2B0O E;  4GZ5 A;  2UWJ G;  1OWP A;  3LS8 A;  2MYO A;  4I6G A;  4JHK A;  3NF1 A;  2VQ2 A;  4B89 A;  2ETC A;  2BKK B;  3EIQ C;  2H6H A;  4CGV A;  1AWC B;  4ANU A;  2WQH A;  4G8K A;  4EZJ A;  3JXJ A;  1V54 E;  2E2E A;  5FTP A;  5EX3 A;  3SQV A;  4DX7 D;  3MYV A;  1IQU A;  1U3C A;  3D9M A;  1HE8 A;  2F8Y A;  4KT6 B;  3CGH A;  3B7R L;  4CGW A;  1HO8 A;  3PEV B;  4B8A A;  4ZHB A;  5LCW C;  2CG3 A;  4NIK A;  5KJM A;  4HXI A;  4G23 A;  2V5Q C;  2KC7 A;  1YYH A;  5E75 A;  4CEM A;  3V31 A;  3B13 A;  4DPR A;  1E8Z A;  3IHY A;  4GPM A;  1U3D A;  3CSF A;  1Q2Z A;  1MYO A;  4ANV A;  4HLL A;  3SBS A;  1JCR A;  2X6J A;  3D9P A;  3FTS A;  2CFU A;  2DVW A;  5A6C A;  3GZ2 A;  4KVO A;  3CQC B;  1KPS B;  2Y4U A;  3FU0 A;  3MV2 B;  4PUC A;  4HRM B;  5CCL A;  4Z68 A;  2J8S D;  3LY8 A;  3FUM A;  2Y0B G;  1EYH A;  1IHB A;  2L9B A;  3FU3 A;  3QJZ A;  4PS8 A;  2QFC A;  2WPV A;  4L2L A;  3R7Q A;  4J8F A;  3PZ3 A;  5T3R A;  4U63 A;  1Z6T A;  2IQC A;  3MA5 A;  4N5Q A;  2KAT A;  1N52 A;  3D9H A;  3CVP A;  3UXG A;  2PL2 A;  3KEA A;  2KBX A;  3JYS A;  2XQ0 A;  5D2M C;  1FCH A;  5AIJ A;  3TGO A;  1OY3 D;  3RRU A;  2C0M A;  1NL4 A;  3ULE G;  2XZT G;  4GCN A;  3UM2 A;  1IXV A;  3NQP A;  4ACL A;  4ATZ D;  4J6I A;  1SA5 A;  1N4R A;  2FI7 A;  3HIZ A;  3G2V A;  4N3B A;  2EIM E;  3DEO A;  3RO2 A;  4HB5 A;  2OOE A;  5G05 C;  4DX6 D;  4P29 A;  1LTX A;  2QYJ A;  5AEN A;  2DBA A;  1PY1 A;  3I3N A;  4MKT A;  3LPZ A;  4ZFH A;  4MLP A;  3G2W A;  2XEE A;  1H6O A;  3FUD A;  3CHR A;  3FH8 A;  4CDM A;  3AJI A;  3T5V A;  5LP0 A;  4EHM A;  3F6Q A;  5FIN A;  1BU9 A;  3DPD A;  4BSZ B;  3UI2 A;  4QFV A;  4BT9 A;  1U2V G;  3ULY A;  4J8D A;  2WXQ A;  4N5C A;  3FU5 A;  2XPI A;  3ABL E;  3E34 A;  1UN9 A;  3ZKJ A;  3QKY A;  5JMN D;  5EKQ D;  4APF A;  3OTN A;  5G55 A;  3ASH A;  2VSY A;  2P9K G;  3G2S A;  4I17 A;  4RG9 A;  4B0Z A;  3ZU7 B;  1N4Q A;  1O1S A;  3RSE G;  5AJL A;  2EQX A;  2A5U A;  2HM8 A;  4K03 A;  4O60 A;  1N11 A;  4Q69 A;  2XGS A;  3IHV A;  2UY1 A;  5JA4 D;  3BEE A;  4WNE A;  1QZ2 A; 
#chains in the Genus database with same CATH homology
 4XKB A;  2KCL A;  3LYA A;  3TG4 A;  3Q49 B;  2DCP A;  3D9L A;  3Q4A B;  4HOS A;  3R9A B;  3ASF A;  2I6H A;  2R5S A;  3MX3 A;  4U0U A;  1H19 A;  3O4Z A;  3VLD A;  1HS6 A;  3MZL B;  5DBK A;  2PQR A;  4XZ4 A;  4N3C A;  3HDX A;  4NQ0 A;  2FO7 A;  2L6J A;  4HVB A;  3SGH A;  3D9K A;  3S7F A;  3QWV A;  3Q5M A;  1GW6 A;  2CHX A;  4ILI A;  3TJP A;  3HVE B;  5AJD A;  3MKR A;  3UT4 A;  3AS8 A;  2AXV A;  2J08 A;  4G24 A;  3EHN A;  3ENE A;  3OXF A;  4J8E A;  4WWN A;  4YVO A;  5HQ8 A;  4W9R A;  4BFR A;  2YHE A;  1H2T C;  3BG1 B;  4APO A;  4IN3 B;  4N3A A;  5E76 A;  3MJW A;  1OWM A;  3ASG A;  3ULQ A;  3UT8 A;  1NA0 A;  3RU0 A;  4UI9 K;  3L13 A;  2CFZ A;  4AEZ C;  3G2T A;  4DI4 A;  4F53 A;  2J4B A;  1XNF A;  3HYM B;  4O6F A;  1JUQ A;  3ONK A;  3SFZ A;  3U64 A;  4CT0 A;  3PEU B;  2WXH A;  4LCT A;  3KD7 A;  3U66 A;  4ATG A;  4KZC A;  3ZXS A;  2PM6 A;  2X38 A;  1E8X A;  3CR3 A;  5BUZ A;  4FA6 A;  4JL0 A;  4YVQ C;  1PC2 A;  4J0U A;  2L0T B;  4UQX A;  4WWP A;  3HVE A;  3UUX A;  3IBE A;  4ABN A;  5LCW J;  3KEZ A;  4U07 A;  3BG0 B;  4UWG A;  1HG2 A;  1PAQ A;  4JHR A;  1JWF A;  1QNF A;  4Y6W A;  1MQS A;  2XHE A;  1NA3 A;  4GYY A;  4KYO B;  3D3M A;  5G04 C;  5T4Y A;  4UI9 J;  4C9B B;  2J4D A;  3CEQ A;  3ONL A;  1E7U A;  4I6E A;  4H7Y A;  2VSO E;  5D0Q D;  3PH0 C;  3NZU A;  2AXZ A;  3AS4 A;  4JHJ A;  3FTZ A;  4GZ6 A;  3PNT B;  4JVS A;  5AYW D;  4AM9 A;  1NZN A;  3CST A;  3RRM B;  5LFA A;  3KAE A;  4GYW A;  5ARG A;  3CVW A;  4G25 A;  5CCM A;  2CHZ A;  3RKV A;  3WXX A;  4NUR A;  3QAR A;  4GML A;  4JA7 A;  2KZT B;  2YHC A;  2LSU A;  3UPV A;  4G1T A;  3FUK A;  3LDZ A;  3PUK A;  2ILR A;  3MCX A;  4FC8 A;  4XI9 A;  4GZ3 A;  3K9I A;  3LVQ E;  4TRQ A;  3GYZ A;  1P5Q A;  4C0E A;  3FUH A;  3FUF A;  2OV8 A;  4AP2 A;  2X6K A;  2XEV A;  3RO3 A;  4KMO A;  3JQ0 A;  2V5F A;  3LJ3 A;  4HLE A;  4RG6 A;  4F1S A;  1E90 A;  2WXO A;  3FTU A;  3D9I A;  4N2S A;  2NC9 A;  4KXK B;  1S0P A;  4L1B A;  4AOF A;  4DJA A;  2Y3A A;  4BWR A;  3SNX A;  3IKO B;  4N2Q A;  4TUU A;  2WXK A;  2AWI A;  2RD0 A;  3LEW A;  3MEK A;  2I1K A;  4RSY A;  3VTX A;  2PQN A;  5BT1 A;  2WXF A;  1OUV A;  5HI7 A;  2X3M A;  3PUJ A;  5DIZ A;  3PE4 A;  2C0L A;  3FTV A;  2HO1 A;  3U3W A;  1YA0 A;  2J09 A;  2CG2 A;  4JW1 A;  3EHM A;  4I6J A;  3ESL A;  3APC A;  2WXJ A;  4GPK A;  3IEG A;  4LER A;  3FEY A;  2JLB A;  2YIN A;  4WNF A;  1KLX A;  3EDT B;  4DLQ A;  2IJG X;  4NRH B;  3FH7 A;  1TEZ A;  4GA1 A;  3VTY A;  3APF A;  1BPO A;  3SBT B;  4XI0 A;  2VGX B;  1UW4 B;  3QWW A;  5KJN A;  2GRL A;  4I1A A;  3ZEF A;  2C2L A;  2V4L A;  1FVF A;  2A4Z A;  5KCM A;  3LY7 A;  3DBS A;  3IV0 A;  4ANW A;  3FU6 A;  4XX5 A;  3CLJ A;  1Y6I A;  4ME2 A;  4HOQ A;  3ZW3 A;  4OVU A;  4XE0 A;  4WND A;  4BSX A;  4FU3 A;  4JA9 A;  4MRU A;  4BTB A;  3QK0 A;  3CKC A;  3ZIM A;  2XCC A;  2XRZ A;  3O48 A;  4UWK A;  3B7U X;  3JQ1 A;  1ZBP A;  3PS6 A;  2HYZ A;  5ANL A;  3JCK C;  4WNG A;  3SI5 A;  2VGX A;  3FUN A;  4GA2 A;  2X6F A;  2MHK A;  4UQY A;  4YND A;  1HZ4 A;  4A55 A;  2LSV A;  4MS6 A;  3ZN3 A;  5KJK A;  1HG5 A;  2L0I A;  2VTB A;  3VLF A;  3GZ1 A;  5FT9 A;  1E96 B;  3FFL A;  3CIA A;  4GCO A;  3TAX A;  2BTD A;  3D9N A;  3B7S A;  3ZVV A;  4GZ5 A;  4U8H A;  4EBA G;  2UWJ G;  1OWP A;  2J9Q A;  3LS8 A;  2YNQ A;  3CV0 A;  3AU4 A;  3AS5 A;  3S7D A;  5M72 A;  5J90 A;  4HOR A;  3ZHE A;  2WXI A;  4I6G A;  4JHK A;  3NF1 A;  5ARF A;  4D10 C;  2VQ2 A;  4AIF A;  1ELR A;  1INZ A;  1E8W A;  1B89 A;  4B89 A;  4F7A A;  3CK8 A;  3EIQ C;  3L6A A;  1JPL A;  2CHW A;  2WXM A;  4CGV A;  5BNW A;  1NP7 A;  1SZ9 A;  4ANU A;  2E0I A;  2WQH A;  3L54 A;  3QAQ A;  4AVX A;  3CVY A;  2WB2 A;  4UWF A;  4GZD A;  3FY4 A;  2J07 A;  2IF4 A;  5G05 J;  4PS3 A;  4EZJ A;  5D0O D;  5JHB A;  2BUG A;  2E2E A;  5FTP A;  5EX3 A;  3CVU A;  2LAI A;  4N39 A;  1Z3Y A;  3OXG A;  3MYV A;  2R59 A;  2WVI A;  3L17 A;  3TXM A;  3L08 A;  4BT8 A;  1IQU A;  1U3C A;  3D9M A;  3MKQ A;  1HE8 A;  2J49 A;  4KT6 B;  3CGH A;  3B7R L;  4I9C A;  3E4B A;  3CHS A;  3ZYQ A;  2FF4 A;  4IRU A;  4JZY A;  1HO8 A;  4I43 A;  4CGW A;  4PDX A;  1IQR A;  5FZQ A;  3PEV B;  4KZ0 A;  4WAF A;  3RIB A;  1TJC A;  2HR2 A;  3TXN A;  4B8A A;  4L23 A;  2IU1 A;  1QQE A;  2ZU6 B;  4GA0 A;  3FUI A;  4Y6C A;  2DIW A;  5LCW C;  2P58 C;  2VJ8 A;  2VSN A;  4XKC A;  4A1S A;  3T5X A;  2CG3 A;  4Q96 A;  4UQZ A;  1ELK A;  4U0Z A;  4ACK A;  5JHA A;  5FJY A;  5FWQ A;  5KJM A;  4GB9 A;  2WXL A;  4OVV A;  3C98 A;  4HXI A;  2I9C A;  1OWN A;  4AV7 A;  4G23 A;  2XRY A;  5A7D B;  5BPP A;  2V0P A;  2KC7 A;  3FTW A;  3TL5 A;  3U4T A;  2LNI A;  1HX8 A;  4G2V A;  3QB2 A;  4I2W A;  5E75 A;  4CEM A;  1H2U A;  3B13 A;  4EZK A;  2KCK A;  2KCV A;  5JJ6 A;  1E8Z A;  3IHY A;  3QC1 A;  4DPR A;  3R7R A;  4CDN A;  4IYP A;  2LO6 A;  2WXG A;  1H6K A;  4PS7 A;  4A3T A;  1UG3 A;  2FEZ A;  4E6H A;  1U3D A;  3CSF A;  3LKU A;  1EPU A;  5CMW A;  1A17 A;  4ANV A;  4PH4 B;  2QY7 A;  3SBS A;  2X6J A;  3D9P A;  3ML8 A;  4JEU A;  1WY6 A;  3FTS A;  3LVR E;  4B8C B;  4AY6 A;  3PRZ A;  3S7J A;  2CFU A;  2IOL A;  4CT4 A;  5LX8 A;  5A6C A;  2XGM A;  3GZ2 A;  3CQC B;  4KVO A;  3CVX A;  3ML9 A;  2Y4U A;  3FHE A;  4E85 A;  2PM7 A;  3TG5 A;  3FU0 A;  4ANX A;  3MV2 B;  4FHK A;  4GMJ A;  4K0R A;  3RK6 A;  4PUC A;  3OAW A;  5CCL A;  2FBN A;  3LY9 A;  4FP7 A;  3LXU X;  3LY8 A;  3NZS A;  4EEC A;  1XGW A;  1KT0 A;  2LAH A;  3CVQ A;  3FUM A;  3FDH A;  3CHP A;  4WWO A;  5FQ7 A;  4BY6 A;  3VLE A;  3QDN A;  4HOT A;  3CQG B;  2XPZ A;  3QNK A;  2GGF A;  5JJT A;  3UQ3 A;  1EYH A;  2MOW A;  2VTB B;  2OVB A;  4NAC A;  2L9B A;  3L22 A;  3FU3 A;  4URK A;  4EQF A;  3QJZ A;  2OND A;  4PS8 A;  2I2O A;  2WXP A;  3UMV A;  4B94 A;  5FZR A;  2QFC A;  3B7T A;  2AVP A;  2VYI A;  2WPV A;  2XPY A;  4L2L A;  1E8Y A;  3R7Q A;  4J8F A;  3ZHE B;  1VDY A;  4DI3 A;  4L7T A;  3I4G A;  4CCA A;  1ZU2 A;  5T3R A;  4U63 A;  2WMN A;  1Z6T A;  2IQC A;  2XCB A;  3MA5 A;  3QWP A;  5FQ8 A;  3ZYM A;  1L5J A;  4I9E A;  2AW6 A;  2KAT A;  3FP3 A;  1N52 A;  3URZ A;  2GRM A;  2Y4T A;  4FJZ A;  3FUL A;  3ZYL A;  2PZI A;  4Q94 A;  4F3V A;  1Y8M A;  3APD A;  4OYS A;  4AJW A;  3CVP A;  2NSZ A;  3PE3 A;  4I1M A;  2PL2 A;  3ZFW A;  3FWV A;  3PNL B;  1WM5 A;  3JYS A;  2WXR A;  4A1G A;  2XQ0 A;  4L2Y A;  1WAO 1;  1N54 A;  1H2V C;  1FCH A;  1HXI A;  4FLH A;  4BX9 A;  5AIJ A;  5BV1 A;  3TGO A;  2IFU A;  4ILH B;  3S7B A;  1HU3 A;  3RRU A;  1UN8 A;  1UJJ A;  3MKQ B;  2ION A;  3SHF A;  2C0M A;  2OVF A;  3FTY A;  1H0A A;  4IUL A;  3FEX A;  3UX4 A;  2Q7F A;  4C0M A;  1EDU A;  2V8S E;  3CVL A;  5FQ4 A;  5JJ7 A;  4GCN A;  4XIF A;  2GW1 A;  4HOU A;  4LUN U;  3NQP A;  5ANR A;  3FH5 A;  4ACL A;  4G11 A;  3P1U A;  4J6I A;  5EDS A;  2WQ7 A;  2WXN A;  4UWH A;  4AY5 A;  4A3V A;  3EIJ A;  1ELW A;  2FI7 A;  3HIZ A;  4RVB A;  3U9W A;  1IYG A;  1W3B A;  2WMO A;  3G2V A;  3FTX A;  3Q15 A;  4LEU A;  4N3B A;  5G04 J;  3ESK A;  4JPS A;  3SF4 A;  3SZ7 A;  4BX8 A;  1E7V A;  4GYO A;  3ZGQ A;  4FUL A;  5T8I A;  1LF8 A;  3CKB A;  3KS2 A;  2OOE A;  5G05 C;  3RO2 A;  4WUY A;  5KJL A;  2BF0 X;  3CHQ A;  3QOU A;  2M63 A;  3EJN A;  4P29 A;  3CHM A;  1HF8 A;  5AEN A;  1Z3X A;  4TV3 A;  4GAA A;  2DBA A;  3RJV A;  1PY1 A;  3I3N A;  4I1O B;  2I1J A;  3OXL A;  1MHQ A;  4MKT A;  3LPZ A;  4DK5 A;  1JWG A;  4UI9 C;  4MLP A;  3G2W A;  3AU5 A;  3PRE A;  4KVM A;  4FLB A;  2MRI A;  1FVH A;  4JC8 A;  2R17 C;  3FUD A;  1KT1 A;  4ILG A;  5EX0 A;  3CHR A;  3FH8 A;  4FHJ A;  4CDM A;  4DLO A;  4EZL A;  3MGB A;  3T5V A;  5A23 A;  5BW8 C;  3ASD A;  3D9O A;  4HFG A;  5LP0 A;  2XGO A;  5C1D A;  4HS2 A;  1IHG A;  3DPD A;  1SQM A;  2VSX E;  3I4R B;  4QFV A;  4U0S A;  4BT9 A;  4I2Z A;  3JUI A;  4J8D A;  2X6H A;  3I5P A;  5LOZ A;  3T8M A;  3FUJ A;  2WXQ A;  4EPZ A;  3D9J A;  3G2U A;  2AXU A;  4J8S A;  1DNP A;  4U04 A;  4N5C A;  3UT7 A;  1UJK A;  3FU5 A;  2XPI A;  2WM9 A;  2FUL A;  3L16 A;  1OWL A;  1UN9 A;  2JEK A;  2IOS A;  4CDR A;  4KBQ A;  1TJF A;  3CK7 A;  3QKY A;  5ENN A;  3ZRH A;  4BTA A;  3Q47 B;  4UWL A;  5EKQ D;  4APF A;  2KZT A;  4LRZ A;  4R7L A;  3OTN A;  5G55 A;  1HFA A;  3LCA A;  3ASH A;  3CVV A;  3PDN A;  4GU5 A;  2YQ8 A;  2VSY A;  3PZD A;  2UY1 B;  5CHE E;  3G2S A;  1DVP A;  4I17 A;  4RG9 A;  3FUE A;  2VGY A;  4B0Z A;  1EF1 C;  3SD5 A;  4FJY A;  3MV3 B;  5FQ6 A;  5BV0 A;  2NXP A;  5AJL A;  2EQX A;  2RG8 A;  1OWO A;  3CVN A;  2A5U A;  2HM8 A;  4K03 A;  5FZS A;  3ZPJ A;  3RRN B;  3CHO A;  4H7X A;  4V3I A;  4G26 A;  5C2Y A;  3N71 A;  4Q69 A;  3ZYK A;  2KM4 A;  3GW4 A;  2XGS A;  4JXT A;  4FAD A;  3IHV A;  2WQ6 A;  1SZA A;  4AXH A;  2UY1 A;  1X5B A;  3CK9 A;  3GZS A;  4JEH A;  4GZC A;  4M3O A;  1HH8 A;  2X6I A;  3HHM A;  5CMY A;  3BEE A;  5G2N A;  3P2B A;  3PVL A;  4EBA A;  4WNE A;  5J08 A;  4CRW A;  3S2A A;  1QZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...