1K1BA

Crystal structure of the ankyrin repeat domain of bcl-3: a unique member of the ikappab protein family
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
228
structure length
228
Chain Sequence
EDGDTPLHIAVVQGNLPAVHRLVNLFQQGGRELDIYNNLRQTPLHLAVITTLPSVVRLLVTAGASPMALDRHGQTAAHLACEHRSPTCLRALLDSAAPGTLDLEARNYDGLTALHVAVNTECQETVQLLLERGADIDAVDIKSGRSPLIHAVENNSLSMVQLLLQHGANVNAQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVIDILRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ankyrin repeat domain of Bcl-3: a unique member of the IkappaB protein family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords B-cell lymphoma 3-encoded protein
total genus 75
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2001-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1k1bA00
1SVXA 5CEDB 1YYHA 2F8XK 5ENPD 3HRAA 4BERA 2FO1E 4O1PA 4RLYA 3IXEA 2XZDG 4HLLA 5AAOA 5KNHD 1BI7B 2ZGGA 4C48B 3W9GA 4OAUC 4HQDA 1N0RA 4U8YD 4Z68A 5JA4D 4JB8P 4U95D 2XZTG 1MX4A 3B95A 3DEOA 3SO8A 2ZGDA 3ZKJA 1OY3D 4U96D 4G8LA 5CECB 3TWUA 1BI8B 1DC2A 3NOCD 5ENTD 5ENQD 5AQ9A 4QQIA 4F6RD 4BETA 1BLXB 4HI9A 1D9SA 4DX1A 4K5AB 4DX5D 4A63B 1N0QA 3T9KA 2XENA 2KBXA 3ZU7B 4NIKA 5JMND 1WG0A 2BKGA 3B7BA 2A5EA 3NOGD 2VGEA 1A5EA 4DX2A 4DX6D 1K3ZD 5CBNA 2XEHA 2XEEA 4CZ2D 2Y0BG 5AQBA 4BESA 2QYJA 4HB5A 1WDYA 2DZOA 2P2CP 3UI2A 3W9FA 3UXGA 1TR4A 4G8KA 3TWXA 5CEAA 3V30A 1K1BA 1N11A 4HI8A 3TWRA 3TWSA 3TWWA 2ETCA 4TUMA 2V5QC 4LNUD 3C5RA 3JXIA 1BU9A 5ITZF 2DZNA 5HS0A 4ZFHA 5ENRD 5EIBE 3T8KA 5KWDA 4BSZB 1OT8A 3V2XA 3AAAC 3J5PA 4ZHBA 4K5CA 2RFMA 5AQ7A 1MX6A 5ENOD 2J8SD 4GPMA 1IHBA 4HRNA 4LSZE 3LJNA 5EN5D 2QC9A 4QFVA 5AARA 1AP7A 1MJ0A 2Y1LE 4J8YA 5AQAA 3ZNGA 1YCSB 4K5BA 1BD8A 4DX7D 3AJIA 4ATZD 4GMRA 3HG0D 4O1OA 1S70B 1UOHA 3JUEA 5BXUA 2HE0A 3V31A 3EU9A 5CERB 1MYOA 5HKPA 2DWZA 3JXJA 1K1AA 2BKKB 4HRLA 3Q9NC 2JABA 1SW6A 4UUCA 3V2OA 3ZUVB 1IKND 1DCQA 4B93B 5BXOA 1QYMA 3UTMA 5CBOA 3DEPA 4DRXE 4OAVB 5EILA 5FIOA 2AJAA 2F8YA 3EHQA 2F37A 3TWVA 5D66A 5FINA 1MX2A 3NBNB 2DVWA 4BEPA 4HRMB 5KNGA 5ENSD 1G3NB 3D9HA 4O60A 4HBDA 2PNNA 3TWTA 5KBAA 3J5QB 4U8VD 2RFAA 3Q9UC 4F1PA 4YDWA 3TWQA 5HRYA 1IXVA 1YMPA 2V4HC 3EHRA 4N5QA 1NFIE 2NYJA 5EYPF 2ETAA 4J7WA 4DUIA 4LG6A 5AN8A 1AWCB 2ETBA 5EYLA 4HNAD 2MYOA 4CYMD 2L6BA 5EIDA 3V79K 4YDYA 3KEAA 2B0OE 3F6QA 2KXPC
chains in the Genus database with same CATH superfamily
3UM3A 4IYPA 4PS8A 4AY5A 2C0MA 4ANWA 2XPYA 2XPZA 5FZRA 4Z68A 2ILRA 3L13A 5FQ7A 1N4QA 4G8LA 4I43A 1ELKA 1U3DA 4HI9A 3BEEA 2VTBA 3FUEA 3SBTB 2XENA 1HF8A 2AXZA 3HXCA 3SHFA 3P2BA 1H2TC 3NZUA 1E8ZA 1K1BA 3ESKA 3AG1E 4L7TA 5CMYA 2XQ0A 1MHQA 3UPVA 4C9BB 1LD8A 2DZNA 3T8KA 2QFCA 4PDXA 4JC8A 3PZ2A 3J5PA 4LCTA 4HVBA 2GGFA 2RFMA 1HO8A 1A17A 1EYHA 3MA5A 3PE3A 5DIZA 3CVPA 4J8YA 4A55A 3HXEA 1K1AA 2WVIA 2BKKB 2JABA 2J9QA 2WXIA 3SFYA 2EILE 3FUNA 3FULA 3FTVA 2NC9A 1OWLA 5KJNA 1IYGA 3SQVA 2L6JA 2VYIA 3UIOC 5AN8A 3ABME 4DLOA 3IEGA 3FTYA 3NAWA 3LVRE 1BPOA 5E76A 5FQ4A 3PDNA 2EINE 2B0OE 3UQ3A 4RG6A 4RVBA 4JEHA 1ZU2A 3LCAA 5C2YA 2I2OA 3E34A 2L0IA 3DEOA 3D9NA 2P9IG 4I1MA 4F6RD 2WXLA 1WG0A 3C3OA 1K3ZD 3TG5A 4GU5A 4PH4B 2KATA 1KZPA 2WM9A 4FJZA 2CG2A 3JXIA 2PQRA 1U3CA 1UG3A 2GRNB 2E0IA 5ENOD 3L17A 3ABKE 4L1BA 1P5QA 3TL5A 4U0SA 2NSZA 3D9MA 2IOLA 3ZNGA 2PM6A 3Q47B 3HG0D 1S70B 2XGMA 5H7PA 4L9PA 1ZBPA 3GYZA 1N95A 4NRHB 1HX8A 2XGOA 4LUNU 3TAXA 3UMVA 3EHQA 4FHJA 1IHGA 5T3RA 4AIFA 4H7XA 4HBDA 3NB2A 2CFZA 5FWQA 3TXNA 3MJWA 4CT4A 5BT1A 3FEYA 4U7EB 3V79K 4L23A 3VLFA 4HOUA 3K9IA 5ENPD 3ZYKA 4HLLA 4AJWA 5EKQD 2EIME 3RRMB 2ZGGA 4XEIG 1N0RA 2XEVA 2OVBA 1FVFA 3TWUA 3LDZA 5E75A 3DRAA 5ENQD 4ILHB 3MGBA 1WAO1 4A63B 1KPSB 3ULYA 3PEUB 4GA0A 3PZ4A 1V55E 5G04C 2FULA 2CHWA 3LYAA 3FTUA 4JPSA 3KSLA 3V30A 4EZLA 3AS4A 2V5QC 3CVQA 3JCKC 1OXJA 1NL4A 4HOQA 5EX3A 3UT7A 2WXQA 2X6JA 1MX6A 3ZW3A 4FLBA 3UM0A 1H6PA 4HRNA 3C3QA 5T8IA 3R7QA 3PNTB 2J09A 2QY7A 4DX7D 4ATZD 3RKVA 2R17C 2PL2A 4Q69A 2J07A 4J8EA 3JYSA 2FI7A 1DCQA 3RAUA 2ZIRA 3SNXA 4DRXE 2XPIA 3VTXA 3OXLA 2H6FA 3QARA 3D9HA 2IJGX 2OEVA 4N5QA 2WXOA 3NQPA 4LG6A 3DSSA 2L6BA 1PAQA 4XE0A 3F6QA 5G05C 4LERA 1H19A 3KD7A 2P9NG 2WMNA 3HRAA 3DSTA 5KNHD 3NF1A 4MBGA 5JA4D 5G04J 3RIBA 4GTRA 2AW6A 5KJKA 2I1KA 2R03A 2KC7A 3NOCD 3O48A 1TNOA 4D10C 1OCOE 3CKBA 5JMND 1E8YA 4J6IA 2A5EA 3HXBA 4DX6D 4HFGA 2R2LA 2QYJA 1MZCA 2DZOA 3UXGA 3FTXA 4I1OB 2IOSA 3UUXA 3ZRHA 1TJFA 3Q49B 2VGYA 4GYYA 1OT8A 2AXVA 4I17A 4K5CA 3ASOE 4GMLA 5J08A 4TXPA 2M63A 3LY8A 2A4ZA 2Y1LE 3ENEA 1OWNA 5FQ8A 1JCSA 4BFRA 4P29A 5EDSA 3ZGQA 2R5SA 1MYOA 2Q7FA 3G2WA 1MQSA 4AP2A 2F37A 3UM2A 2YHEA 1KT1A 4NACA 1G3NB 2IFUA 4B89A 3FH5A 4EHMA 4I6GA 4J8FA 4ATGA 3LS8A 1H0AA 5BV0A 3HVEA 4G24A 5BV1A 1Z6TA 2XS1A 4GTMA 2XRZA 4FC8A 2F8XK 3PNLB 4YDEA 5FT9A 3IXEA 1BI7B 2XZTG 3SFZA 3ZKJA 3ZFWA 1LF8A 3EUVA 4JEUA 4A3TA 4RQIA 3Q7FA 1N4SA 1E7UA 2OV8A 1D8EA 3QDNA 3HHMA 4NIKA 5AQBA 4MRUA 3U64A 4Y6CA 2P2CP 3E30A 1NZNA 5CMWA 1S0PA 2IO2C 3BG0B 5BW8C 4B8AA 3T5VA 4NQ0A 1OCRE 1PY1A 5AARA 1TNUA 3DXKG 3OXFA 4C0EA 3JUEA 3GZSA 5CERB 3D9KA 3FUIA 5HKPA 2ZXWE 5JHBA 4ANXA 3QK0A 4Q94A 2X3MA 2KCVA 5CHEE 5J90A 1Z3XA 3CQGB 2L0TB 2JLBA 3P1UA 2R59A 4GTPA 2Y4UA 4F1PA 1YMPA 3FUDA 1QNFA 1SZ9A 3VLDA 2A5UA 3ASGA 2XHEA 5M72A 2P9KG 5FZSA 3EIJA 2ETBA 1RW2A 3ZHEA 2DCPA 4W9RA 5FZQA 2EQXA 5LX8A 4URKA 1SVXA 4EZJA 3G2TA 3LEWA 4F3VA 2J08A 3RRNB 1N4RA 3UT8A 1DC2A 1V54E 3TG4A 4KZ0A 3Q15A 3T9KA 3JQ0A 4TUUA 4FLHA 3QWWA 1B89A 3S2AA 4EBAA 2C0LA 1N11A 3LPZA 3ZYMA 3S7BA 3ASFA 3ONKA 1E8WA 1HU3A 3ML9A 3CVWA 3IHYA 2WQHA 2EIKE 3CR3A 3CVXA 2KZTB 3MCXA 2WXRA 4O1OA 3V31A 3C98A 3FTWA 5JHAA 3QAQA 1TNYA 5CBOA 2AJAA 5LP0A 3ML8A 3BQOA 2RFAA 4MKTA 4GZ6A 2GRLA 2NYJA 4AV7A 3E33A 2OVFA 2H6HA 3AG4E 5EYLA 4YVOA 3IV0A 1TJCA 2J49A 3CHMA 4BERA 4A1GA 4M3OA 1U2VG 1OY3D 1QQEA 2LSVA 1E96B 4E85A 1LTXA 4ANVA 4DPRA 4FHKA 2MRIA 3ZU7B 4KZCA 1UJJA 4GCOA 4UI9J 3CV0A 2KZTA 4WNEA 1WDYA 2Y3AA 5D0OD 3TWWA 2PZIA 4F1SA 1N52A 3D3MA 4FA6A 1IQUA 3QWPA 2H6IA 5CCMA 2DIWA 4KVMA 3CSFA 1Y8MA 4XX5A 1BD8A 1UN8A 4ME2A 4AXHA 3UINC 3ZVVA 3FUHA 2DWZA 4FJYA 3CVLA 3GZ1A 3SZ7A 3TXMA 3UKRG 2DVWA 4GTSA 5KNGA 1HXIA 2PNNA 3J5QB 4CT0A 2HO1A 4F7AA 3JQ1A 2F0YA 3AG3E 5EYPF 5EX0A 4J7WA 3S7DA 3ZXSA 3FH8A 2FEZA 3BG1B 1K8KG 3ASDA 4CDNA 4GZDA 4HOTA 1Q2ZA 3HDXA 4JHRA 4RSYA 1MX4A 2V8SE 4GA1A 1HH8A 3EDTB 4AOFA 4K5AB 3PRZA 2JEKA 1N0QA 3D9JA 5B1AE 1JPLA 3VLEA 1A5EA 4OYSA 4JVSA 1NI1A 3B13A 4GZ5A 3W9FA 1E90A 4G8KA 3PREA 4WWNA 4GYOA 4FU3A 4GYWA 3D9OA 3UIPC 4BSZB 5LCWJ 3AAAC 1HG5A 2B6CA 3APDA 4HOSA 4FP7A 5EN5D 2QYUA 4QFVA 3ULEG 4K5BA 5CRUA 3SF4A 5BUZA 3G2UA 1FT1A 2R02A 4G11A 2WB2A 5FINA 2WXPA 3CVVA 3DSXA 4BEPA 5KBAA 2LO6A 4HS2A 3UM1A 3OAWA 1H6OA 1ZB1A 2UY1B 4DI3A 4N3AA 2P58C 3FY4A 2GRMA 2GRQB 5HQ8A 4PUCA 4WNFA 2HYZA 4ABNA 5AJDA 5AAOA 4CDMA 1OCZE 2PM7A 2ZISA 4XZ4A 1HG2A 5AYWD 3MV2B 3L6AA 3E32A 4DX5D 3WG7E 2XEHA 3APCA 3MV3B 2IY0C 3MKQB 3S7JA 5BPPA 3I3NA 3TWRA 1GW6A 4LRZA 4UI9K 2UWJG 4XI0A 4ZFHA 2OEWA 1L5JA 3FP3A 3EHNA 3FUMA 2J8SD 3CIAA 5LCWC 2ONDA 3B7SA 4JXTA 3CGHA 3G2SA 1UOHA 3L22A 3TJPA 4H7YA 3RRUA 4KVOA 4HRLA 1N4PA 5BXOA 3DBSA 4U07A 1JUQA 2FO7A 5A23A 4AVXA 4JZYA 3QC1A 2QZAA 2V5FA 3RU0A 4U8VD 2YQ8A 1X81A 1LD7A 4U04A 4UWLA 3CHOA 3MX3A 4GTVA 4UI9C 4YVQC 2MYOA 1HZ4A 4LNBA 4HXIA 4CRWA 2MHKA 1QBQA 3U9WA 2VSOE 4BWRA 1YYHA 4GTTA 2AVPA 3SD5A 3FUJA 4OAUC 3IHVA 3I5PA 4U8YD 1ELRA 1RZ4A 4E6HA 2XGSA 1HS6A 3Q73A 3U3WA 5AIJA 4HORA 3QWVA 1NP7A 3U4TA 4BY6A 1O5MA 4QQIA 1FPPA 3CK9A 2WXNA 3KSQA 1UJKA 2ZU6B 4ANUA 1TYQG 4EECA 3L54A 3LXUX 1OWOA 5CBNA 4CZ2D 4HB5A 2P9PG 4KYOB 4B8CB 4UWFA 5D2MC 1KZOA 2RD0A 3BU8A 3DPDA 2LXLA 4TUMA 2YINA 1NA0A 4B0ZA 4K03A 3UKUG 4WWOA 2LXMA 3Q4AB 5AQ7A 4GPMA 3DWLG 4MS6A 4LSZE 4I1AA 1AP7A 2BEDA 1W3BA 4FULA 3PS6A 5A7DB 3AG2E 3LY7A 3JXJA 4C0MA 1DNPA 2XS8A 4UUCA 1JCRA 2F8YA 1DCEA 3FWVA 2XCBA 3R9AB 1TNBA 2LAHA 4K0RA 3CK7A 3CEQA 4YDWA 2WQ6A 3EHRA 3JUIA 1NFIE 4GCNA 1AWCB 3ASNE 4LNGA 2IU1A 1H2UA 4CYMD 5EIDA 3ULQA 3ZPJA 5ARGA 2PQNA 2H6GA 4O1PA 4RLYA 5AJLA 4XIFA 3FTSA 1BI8B 2WXKA 3GZ2A 5AQ9A 3Q7AA 3AS8A 5LOZA 1EF1C 3KS2A 2Y0BG 1XGWA 4BT8A 1S64A 3B7RL 2WQ7A 1FVHA 2V0PA 3TWSA 1UN9A 4BTBA 4MLPA 4UWGA 2OOEA 3FU0A 3R7RA 4CEMA 3RK6A 3SFXA 3GW4A 1OCCE 2BF0X 5KJMA 5B3SE 4HLEA 4BTAA 3C72A 3FU3A 1EDUA 3IKOB 1QZ2A 1JWFA 2FBNA 4WAFA 2DBAA 4R7LA 4FADA 3SBSA 5BXUA 4EQFA 3AU5A 5G2NA 1SW6A 3ZUVB 2Y69E 3T8MA 4UQYA 4OAVB 2EIJE 5FQ6A 5A6CA 2VTBB 5ENSD 5JJ7A 3WXXA 3HXDA 4IRUA 1N9AA 3D9PA 2L9BA 4APOA 5IY5E 4XI9A 4APFA 4DLQA 3LKUA 3OXGA 4I9CA 4N2SA 3D9IA 3MKQA 4GZ3A 4C48B 3T5XA 4HQDA 4GB9A 3CHSA 2IQCA 5ENTD 2IO3C 3OTNA 4BETA 3ZYQA 3QOUA 1SZAA 5CRVA 4BX9A 3BUAA 3ESLA 2XEEA 2Y4TA 1FT2A 4KBQA 1E7VA 5CEAA 4HI8A 1XNFA 4GPKA 4EZKA 2ETCA 3CQCB 2NXPA 1WY6A 3C5RA 3X2QE 1O1TA 2MOWA 2KCLA 1TNZA 3QNKA 1DVPA 3AS5A 3G2VA 3FH7A 3U66A 3CKCA 2I1JA 2QC9A 2YNQA 3FFLA 4I2ZA 4N2QA 3UX4A 3KAEA 1INZA 3QKYA 3UTMA 3DEPA 2IONA 3Q75A 3ZIMA 3MKRA 4ACLA 3PE4A 3TWQA 5HRYA 1IXVA 4GA2A 3HVEB 4TXRA 3EU5A 4GMJA 1JCQA 3TGOA 2GROB 4DUIA 3PZ1A 1NA3A 3C3RA 4N39A 4DJAA 3PH0C 4CCAA 5LFAA 4AEZC 5CEDB 3RSEG 4RG9A 2X6HA 2XZDG 2UY1A 4F53A 3VTYA 3DSWA 4A3VA 3B95A 3SO8A 2J4BA 2WXJA 4U96D 3NZSA 4XKCA 2P9UG 1H6KA 2OCCE 5G55A 5FJYA 2KBXA 5ANRA 2VGXA 2BKGA 2LSUA 1HE8A 2VGEA 4CDRA 3DSUA 2VJ8A 5DBKA 3UI2A 4TRQA 4AM9A 3B7TA 3MYVA 2DYSE 4BSXA 2I6HA 4N3BA 1O1SA 5KWDA 3D9LA 4DK5A 4KT6B 3URZA 4ZHBA 2VGXB 3DXMG 2GW1A 2LNIA 2P9LG 4L2LA 4U0UA 2X6FA 4I9EA 2R05A 3SI5A 5AQAA 4V3IA 4WWPA 4IN3B 3IBEA 1N54A 2HE0A 5KJLA 1TN7A 4I2WA 4ILIA 4YNDA 1D8DA 3NBNB 1Z3YA 2WMOA 4JHKA 5T4YA 4O60A 3E4BA 2IF4A 5C1DA 2V4HC 4JD2G 4UQXA 4G26A 3CHQA 4J8SA 3EHMA 3UT4A 5G05J 2WXMA 2VQ2A 4YDYA 3KEAA 4PS3A 4XKBA 3RJVA 2CHXA 3LJ3A 4U0ZA 1PC2A 4ACKA 3CK8A 3CSTA 4JW1A 2DYRE 2XRYA 3SGHA 5CCLA 1BLXB 1D9SA 4OVUA 2KCKA 4DI4A 1N94A 5ENNA 3EJNA 3PVLA 4J8DA 3QB2A 3KEZA 5ANLA 5ITZF 5HI7A 3CHRA 2YHCA 3HXFA 4EBAG 3PZDA 2E2EA 1S63A 2KM4A 4BX8A 1EPUA 3LJNA 5JJTA 4G25A 3RO3A 4B94A 3CVYA 3CLJA 2WXGA 3SY2A 3V2OA 1IKND 1Y6IA 3PUKA 4CGVA 1QYMA 4G23A 3QJZA 5FIOA 1HFAA 1OWPA 3TWTA 4G1TA 4Y6WA 1E8XA 1Z5SC 3L08A 4U8HA 2X6IA 2ETAA 3HIZA 2J4DA 2LAIA 3R9MA 5BNWA 5FTPA 2V4LA 3Q79A 5JJ6A 3N71A 3W9GA 3ASHA 4JB8P 1JWGA 4U95D 4PS7A 5CECB 2VSYA 3DSVA 4I6EA 4G2VA 4L2YA 1YA0A 3B7BA 3FEXA 2X38A 4DX2A 1OUVA 4KXKB 1FCHA 4WNDA 2WPVA 3ISMC 3B7UX 4IULA 4LNUD 5HS0A 5EIBE 3V2XA 2WXHA 1ELWA 4M7CA 1IHBA 3L82A 3MEKA 1H2VC 3ABLE 4UWKA 3APFA 2WXFA 4NURA 2I9CA 3AJIA 4EPZA 2AXUA 4X8QA 3S7FA 3Q9NC 4B93B 3FUKA 4GTQA 3Q5MA 1MX2A 2RG8A 2FF4A 1KLXA 4AY6A 4LEUA 2C2LA 2GRRB 4A1SA 3PZ3A 3L16A 3Q9UC 4JA7A 2XCCA 1OWMA 3FU6A 1KT0A 4KMOA 3PUJA 3O4ZA 5D0QD 3I4RB 3L9TA 2FO1E 5B1BE 4JL0A 2BUGA 4N5CA 2ZGDA 3FTZA 3Q78A 4BT9A 1SQMA 1SA4A 4DX1A 3CVUA 1WM5A 2BTDA 3LVQE 4I6JA 2LUHA 3NOGD 1X5BA 1TN8A 4Q96A 3CHPA 3FDHA 2GRPB 4BESA 2CFUA 2VSXE 1TR4A 3EIQC 3RO2A 2IEJA 3TWXA 3DPYA 2P9SG 4YDOA 4GAAA 1BU9A 2CHZA 3LY9A 4UWHA 5ENRD 4U63A 4N3CA 1UW4B 4TV3A 5AENA 4JHJA 4J0UA 2RKKA 4CGWA 3HYMB 1IQRA 2CG3A 1MJ0A 3AU4A 1TEZA 3I4GA 1YCSB 4O6FA 4WUYA 4GMRA 3EU9A 4GZCA 5KCMA 4UQZA 3FHEA 2AWIA 3CVNA 4GTOA 2X6KA 1VDYA 4JA9A 3ZYLA 4ILGA 4WNGA 5EILA 3TWVA 1SA5A 5D66A 3PEVB 3ONLA 4HRMB 3MZLB 2HR2A 1TN6A 3ZN3A 4TXQA 5ARFA 3ZEFA 3FU5A 4OVVA 3E37A 2VSNA 4HNAD 1O1RA 3ZXPA 3ZHEB 3FUFA 2KXPC 2HM8A
chains in the Genus database with same CATH topology
1SVXA 5CEDB 1YYHA 2F8XK 5ENPD 3HRAA 4BERA 2FO1E 4O1PA 4RLYA 3IXEA 2XZDG 4HLLA 5AAOA 5KNHD 1BI7B 2ZGGA 4C48B 3W9GA 4OAUC 4HQDA 1N0RA 4U8YD 4Z68A 5JA4D 4JB8P 4U95D 2XZTG 1MX4A 3B95A 3DEOA 3SO8A 2ZGDA 3ZKJA 1OY3D 4U96D 4G8LA 5CECB 3TWUA 1BI8B 1DC2A 3NOCD 5ENTD 5ENQD 5AQ9A 4QQIA 4F6RD 4BETA 1BLXB 4HI9A 1D9SA 4DX1A 4K5AB 4DX5D 4A63B 1N0QA 3T9KA 2XENA 2KBXA 3ZU7B 4NIKA 5JMND 1WG0A 2BKGA 3B7BA 2A5EA 3NOGD 2VGEA 1A5EA 4DX2A 4DX6D 1K3ZD 5CBNA 2XEHA 2XEEA 4CZ2D 2Y0BG 5AQBA 4BESA 2QYJA 4HB5A 1WDYA 2DZOA 2P2CP 3UI2A 3W9FA 3UXGA 1TR4A 4G8KA 3TWXA 5CEAA 3V30A 1K1BA 1N11A 4HI8A 3TWRA 3TWSA 3TWWA 2ETCA 4TUMA 2V5QC 4LNUD 3C5RA 3JXIA 1BU9A 5ITZF 2DZNA 5HS0A 4ZFHA 5ENRD 5EIBE 3T8KA 5KWDA 4BSZB 1OT8A 3V2XA 3AAAC 3J5PA 4ZHBA 4K5CA 2RFMA 5AQ7A 1MX6A 5ENOD 2J8SD 4GPMA 1IHBA 4HRNA 4LSZE 3LJNA 5EN5D 2QC9A 4QFVA 5AARA 1AP7A 1MJ0A 2Y1LE 4J8YA 5AQAA 3ZNGA 1YCSB 4K5BA 1BD8A 4DX7D 3AJIA 4ATZD 4GMRA 3HG0D 4O1OA 1S70B 1UOHA 3JUEA 5BXUA 2HE0A 3V31A 3EU9A 5CERB 1MYOA 5HKPA 2DWZA 3JXJA 1K1AA 2BKKB 4HRLA 3Q9NC 2JABA 1SW6A 4UUCA 3V2OA 3ZUVB 1IKND 1DCQA 4B93B 5BXOA 1QYMA 3UTMA 5CBOA 3DEPA 4DRXE 4OAVB 5EILA 5FIOA 2AJAA 2F8YA 3EHQA 2F37A 3TWVA 5D66A 5FINA 1MX2A 3NBNB 2DVWA 4BEPA 4HRMB 5KNGA 5ENSD 1G3NB 3D9HA 4O60A 4HBDA 2PNNA 3TWTA 5KBAA 3J5QB 4U8VD 2RFAA 3Q9UC 4F1PA 4YDWA 3TWQA 5HRYA 1IXVA 1YMPA 2V4HC 3EHRA 4N5QA 1NFIE 2NYJA 5EYPF 2ETAA 4J7WA 4DUIA 4LG6A 5AN8A 1AWCB 2ETBA 5EYLA 4HNAD 2MYOA 4CYMD 2L6BA 5EIDA 3V79K 4YDYA 3KEAA 2B0OE 3F6QA 2KXPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SVX A;  5CED B;  1YYH A;  2F8X K;  5ENP D;  3HRA A;  4BER A;  2FO1 E;  4O1P A;  4RLY A;  3IXE A;  2XZD G;  4HLL A;  5AAO A;  5KNH D;  1BI7 B;  2ZGG A;  4C48 B;  3W9G A;  4OAU C;  4HQD A;  1N0R A;  4U8Y D;  4Z68 A;  5JA4 D;  4JB8 P;  4U95 D;  2XZT G;  1MX4 A;  3B95 A;  3DEO A;  3SO8 A;  2ZGD A;  3ZKJ A;  1OY3 D;  4U96 D;  4G8L A;  5CEC B;  3TWU A;  1BI8 B;  1DC2 A;  3NOC D;  5ENT D;  5ENQ D;  5AQ9 A;  4QQI A;  4F6R D;  4BET A;  1BLX B;  4HI9 A;  1D9S A;  4DX1 A;  4K5A B;  4DX5 D;  4A63 B;  1N0Q A;  3T9K A;  2XEN A;  2KBX A;  3ZU7 B;  4NIK A;  5JMN D;  1WG0 A;  2BKG A;  3B7B A;  2A5E A;  3NOG D;  2VGE A;  1A5E A;  4DX2 A;  4DX6 D;  1K3Z D;  5CBN A;  2XEH A;  2XEE A;  4CZ2 D;  2Y0B G;  5AQB A;  4BES A;  2QYJ A;  4HB5 A;  1WDY A;  2DZO A;  2P2C P;  3UI2 A;  3W9F A;  3UXG A;  1TR4 A;  4G8K A;  3TWX A;  5CEA A;  3V30 A;  1K1B A;  1N11 A;  4HI8 A;  3TWR A;  3TWS A;  3TWW A;  2ETC A;  4TUM A;  2V5Q C;  4LNU D;  3C5R A;  3JXI A;  1BU9 A;  5ITZ F;  2DZN A;  5HS0 A;  4ZFH A;  5ENR D;  5EIB E;  3T8K A;  5KWD A;  4BSZ B;  1OT8 A;  3V2X A;  3AAA C;  3J5P A;  4ZHB A;  4K5C A;  2RFM A;  5AQ7 A;  1MX6 A;  5ENO D;  2J8S D;  4GPM A;  1IHB A;  4HRN A;  4LSZ E;  3LJN A;  5EN5 D;  2QC9 A;  4QFV A;  5AAR A;  1AP7 A;  1MJ0 A;  2Y1L E;  4J8Y A;  5AQA A;  3ZNG A;  1YCS B;  4K5B A;  1BD8 A;  4DX7 D;  3AJI A;  4ATZ D;  4GMR A;  3HG0 D;  4O1O A;  1S70 B;  1UOH A;  3JUE A;  5BXU A;  2HE0 A;  3V31 A;  3EU9 A;  5CER B;  1MYO A;  5HKP A;  2DWZ A;  3JXJ A;  1K1A A;  2BKK B;  4HRL A;  3Q9N C;  2JAB A;  1SW6 A;  4UUC A;  3V2O A;  3ZUV B;  1IKN D;  1DCQ A;  4B93 B;  5BXO A;  1QYM A;  3UTM A;  5CBO A;  3DEP A;  4DRX E;  4OAV B;  5EIL A;  5FIO A;  2AJA A;  2F8Y A;  3EHQ A;  2F37 A;  3TWV A;  5D66 A;  5FIN A;  1MX2 A;  3NBN B;  2DVW A;  4BEP A;  4HRM B;  5KNG A;  5ENS D;  1G3N B;  3D9H A;  4O60 A;  4HBD A;  2PNN A;  3TWT A;  5KBA A;  3J5Q B;  4U8V D;  2RFA A;  3Q9U C;  4F1P A;  4YDW A;  3TWQ A;  5HRY A;  1IXV A;  1YMP A;  2V4H C;  3EHR A;  4N5Q A;  1NFI E;  2NYJ A;  5EYP F;  2ETA A;  4J7W A;  4DUI A;  4LG6 A;  5AN8 A;  1AWC B;  2ETB A;  5EYL A;  4HNA D;  2MYO A;  4CYM D;  2L6B A;  5EID A;  3V79 K;  4YDY A;  3KEA A;  2B0O E;  3F6Q A;  2KXP C; 
#chains in the Genus database with same CATH topology
 3UM3 A;  4IYP A;  4PS8 A;  4AY5 A;  2C0M A;  4ANW A;  2XPY A;  2XPZ A;  5FZR A;  4Z68 A;  2ILR A;  3L13 A;  5FQ7 A;  1N4Q A;  4G8L A;  4I43 A;  1ELK A;  1U3D A;  4HI9 A;  3BEE A;  2VTB A;  3FUE A;  3SBT B;  2XEN A;  1HF8 A;  2AXZ A;  3HXC A;  3SHF A;  3P2B A;  1H2T C;  3NZU A;  1E8Z A;  1K1B A;  3ESK A;  3AG1 E;  4L7T A;  5CMY A;  2XQ0 A;  1MHQ A;  3UPV A;  4C9B B;  1LD8 A;  2DZN A;  3T8K A;  2QFC A;  4PDX A;  4JC8 A;  3PZ2 A;  3J5P A;  4LCT A;  4HVB A;  2GGF A;  2RFM A;  1HO8 A;  1A17 A;  1EYH A;  3MA5 A;  3PE3 A;  5DIZ A;  3CVP A;  4J8Y A;  4A55 A;  3HXE A;  1K1A A;  2WVI A;  2BKK B;  2JAB A;  2J9Q A;  2WXI A;  3SFY A;  2EIL E;  3FUN A;  3FUL A;  3FTV A;  2NC9 A;  1OWL A;  5KJN A;  1IYG A;  3SQV A;  2L6J A;  2VYI A;  3UIO C;  5AN8 A;  3ABM E;  4DLO A;  3IEG A;  3FTY A;  3NAW A;  3LVR E;  1BPO A;  5E76 A;  5FQ4 A;  3PDN A;  2EIN E;  2B0O E;  3UQ3 A;  4RG6 A;  4RVB A;  4JEH A;  1ZU2 A;  3LCA A;  5C2Y A;  2I2O A;  3E34 A;  2L0I A;  3DEO A;  3D9N A;  2P9I G;  4I1M A;  4F6R D;  2WXL A;  1WG0 A;  3C3O A;  1K3Z D;  3TG5 A;  4GU5 A;  4PH4 B;  2KAT A;  1KZP A;  2WM9 A;  4FJZ A;  2CG2 A;  3JXI A;  2PQR A;  1U3C A;  1UG3 A;  2GRN B;  2E0I A;  5ENO D;  3L17 A;  3ABK E;  4L1B A;  1P5Q A;  3TL5 A;  4U0S A;  2NSZ A;  3D9M A;  2IOL A;  3ZNG A;  2PM6 A;  3Q47 B;  3HG0 D;  1S70 B;  2XGM A;  5H7P A;  4L9P A;  1ZBP A;  3GYZ A;  1N95 A;  4NRH B;  1HX8 A;  2XGO A;  4LUN U;  3TAX A;  3UMV A;  3EHQ A;  4FHJ A;  1IHG A;  5T3R A;  4AIF A;  4H7X A;  4HBD A;  3NB2 A;  2CFZ A;  5FWQ A;  3TXN A;  3MJW A;  4CT4 A;  5BT1 A;  3FEY A;  4U7E B;  3V79 K;  4L23 A;  3VLF A;  4HOU A;  3K9I A;  5ENP D;  3ZYK A;  4HLL A;  4AJW A;  5EKQ D;  2EIM E;  3RRM B;  2ZGG A;  4XEI G;  1N0R A;  2XEV A;  2OVB A;  1FVF A;  3TWU A;  3LDZ A;  5E75 A;  3DRA A;  5ENQ D;  4ILH B;  3MGB A;  1WAO 1;  4A63 B;  1KPS B;  3ULY A;  3PEU B;  4GA0 A;  3PZ4 A;  1V55 E;  5G04 C;  2FUL A;  2CHW A;  3LYA A;  3FTU A;  4JPS A;  3KSL A;  3V30 A;  4EZL A;  3AS4 A;  2V5Q C;  3CVQ A;  3JCK C;  1OXJ A;  1NL4 A;  4HOQ A;  5EX3 A;  3UT7 A;  2WXQ A;  2X6J A;  1MX6 A;  3ZW3 A;  4FLB A;  3UM0 A;  1H6P A;  4HRN A;  3C3Q A;  5T8I A;  3R7Q A;  3PNT B;  2J09 A;  2QY7 A;  4DX7 D;  4ATZ D;  3RKV A;  2R17 C;  2PL2 A;  4Q69 A;  2J07 A;  4J8E A;  3JYS A;  2FI7 A;  1DCQ A;  3RAU A;  2ZIR A;  3SNX A;  4DRX E;  2XPI A;  3VTX A;  3OXL A;  2H6F A;  3QAR A;  3D9H A;  2IJG X;  2OEV A;  4N5Q A;  2WXO A;  3NQP A;  4LG6 A;  3DSS A;  2L6B A;  1PAQ A;  4XE0 A;  3F6Q A;  5G05 C;  4LER A;  1H19 A;  3KD7 A;  2P9N G;  2WMN A;  3HRA A;  3DST A;  5KNH D;  3NF1 A;  4MBG A;  5JA4 D;  5G04 J;  3RIB A;  4GTR A;  2AW6 A;  5KJK A;  2I1K A;  2R03 A;  2KC7 A;  3NOC D;  3O48 A;  1TNO A;  4D10 C;  1OCO E;  3CKB A;  5JMN D;  1E8Y A;  4J6I A;  2A5E A;  3HXB A;  4DX6 D;  4HFG A;  2R2L A;  2QYJ A;  1MZC A;  2DZO A;  3UXG A;  3FTX A;  4I1O B;  2IOS A;  3UUX A;  3ZRH A;  1TJF A;  3Q49 B;  2VGY A;  4GYY A;  1OT8 A;  2AXV A;  4I17 A;  4K5C A;  3ASO E;  4GML A;  5J08 A;  4TXP A;  2M63 A;  3LY8 A;  2A4Z A;  2Y1L E;  3ENE A;  1OWN A;  5FQ8 A;  1JCS A;  4BFR A;  4P29 A;  5EDS A;  3ZGQ A;  2R5S A;  1MYO A;  2Q7F A;  3G2W A;  1MQS A;  4AP2 A;  2F37 A;  3UM2 A;  2YHE A;  1KT1 A;  4NAC A;  1G3N B;  2IFU A;  4B89 A;  3FH5 A;  4EHM A;  4I6G A;  4J8F A;  4ATG A;  3LS8 A;  1H0A A;  5BV0 A;  3HVE A;  4G24 A;  5BV1 A;  1Z6T A;  2XS1 A;  4GTM A;  2XRZ A;  4FC8 A;  2F8X K;  3PNL B;  4YDE A;  5FT9 A;  3IXE A;  1BI7 B;  2XZT G;  3SFZ A;  3ZKJ A;  3ZFW A;  1LF8 A;  3EUV A;  4JEU A;  4A3T A;  4RQI A;  3Q7F A;  1N4S A;  1E7U A;  2OV8 A;  1D8E A;  3QDN A;  3HHM A;  4NIK A;  5AQB A;  4MRU A;  3U64 A;  4Y6C A;  2P2C P;  3E30 A;  1NZN A;  5CMW A;  1S0P A;  2IO2 C;  3BG0 B;  5BW8 C;  4B8A A;  3T5V A;  4NQ0 A;  1OCR E;  1PY1 A;  5AAR A;  1TNU A;  3DXK G;  3OXF A;  4C0E A;  3JUE A;  3GZS A;  5CER B;  3D9K A;  3FUI A;  5HKP A;  2ZXW E;  5JHB A;  4ANX A;  3QK0 A;  4Q94 A;  2X3M A;  2KCV A;  5CHE E;  5J90 A;  1Z3X A;  3CQG B;  2L0T B;  2JLB A;  3P1U A;  2R59 A;  4GTP A;  2Y4U A;  4F1P A;  1YMP A;  3FUD A;  1QNF A;  1SZ9 A;  3VLD A;  2A5U A;  3ASG A;  2XHE A;  5M72 A;  2P9K G;  5FZS A;  3EIJ A;  2ETB A;  1RW2 A;  3ZHE A;  2DCP A;  4W9R A;  5FZQ A;  2EQX A;  5LX8 A;  4URK A;  1SVX A;  4EZJ A;  3G2T A;  3LEW A;  4F3V A;  2J08 A;  3RRN B;  1N4R A;  3UT8 A;  1DC2 A;  1V54 E;  3TG4 A;  4KZ0 A;  3Q15 A;  3T9K A;  3JQ0 A;  4TUU A;  4FLH A;  3QWW A;  1B89 A;  3S2A A;  4EBA A;  2C0L A;  1N11 A;  3LPZ A;  3ZYM A;  3S7B A;  3ASF A;  3ONK A;  1E8W A;  1HU3 A;  3ML9 A;  3CVW A;  3IHY A;  2WQH A;  2EIK E;  3CR3 A;  3CVX A;  2KZT B;  3MCX A;  2WXR A;  4O1O A;  3V31 A;  3C98 A;  3FTW A;  5JHA A;  3QAQ A;  1TNY A;  5CBO A;  2AJA A;  5LP0 A;  3ML8 A;  3BQO A;  2RFA A;  4MKT A;  4GZ6 A;  2GRL A;  2NYJ A;  4AV7 A;  3E33 A;  2OVF A;  2H6H A;  3AG4 E;  5EYL A;  4YVO A;  3IV0 A;  1TJC A;  2J49 A;  3CHM A;  4BER A;  4A1G A;  4M3O A;  1U2V G;  1OY3 D;  1QQE A;  2LSV A;  1E96 B;  4E85 A;  1LTX A;  4ANV A;  4DPR A;  4FHK A;  2MRI A;  3ZU7 B;  4KZC A;  1UJJ A;  4GCO A;  4UI9 J;  3CV0 A;  2KZT A;  4WNE A;  1WDY A;  2Y3A A;  5D0O D;  3TWW A;  2PZI A;  4F1S A;  1N52 A;  3D3M A;  4FA6 A;  1IQU A;  3QWP A;  2H6I A;  5CCM A;  2DIW A;  4KVM A;  3CSF A;  1Y8M A;  4XX5 A;  1BD8 A;  1UN8 A;  4ME2 A;  4AXH A;  3UIN C;  3ZVV A;  3FUH A;  2DWZ A;  4FJY A;  3CVL A;  3GZ1 A;  3SZ7 A;  3TXM A;  3UKR G;  2DVW A;  4GTS A;  5KNG A;  1HXI A;  2PNN A;  3J5Q B;  4CT0 A;  2HO1 A;  4F7A A;  3JQ1 A;  2F0Y A;  3AG3 E;  5EYP F;  5EX0 A;  4J7W A;  3S7D A;  3ZXS A;  3FH8 A;  2FEZ A;  3BG1 B;  1K8K G;  3ASD A;  4CDN A;  4GZD A;  4HOT A;  1Q2Z A;  3HDX A;  4JHR A;  4RSY A;  1MX4 A;  2V8S E;  4GA1 A;  1HH8 A;  3EDT B;  4AOF A;  4K5A B;  3PRZ A;  2JEK A;  1N0Q A;  3D9J A;  5B1A E;  1JPL A;  3VLE A;  1A5E A;  4OYS A;  4JVS A;  1NI1 A;  3B13 A;  4GZ5 A;  3W9F A;  1E90 A;  4G8K A;  3PRE A;  4WWN A;  4GYO A;  4FU3 A;  4GYW A;  3D9O A;  3UIP C;  4BSZ B;  5LCW J;  3AAA C;  1HG5 A;  2B6C A;  3APD A;  4HOS A;  4FP7 A;  5EN5 D;  2QYU A;  4QFV A;  3ULE G;  4K5B A;  5CRU A;  3SF4 A;  5BUZ A;  3G2U A;  1FT1 A;  2R02 A;  4G11 A;  2WB2 A;  5FIN A;  2WXP A;  3CVV A;  3DSX A;  4BEP A;  5KBA A;  2LO6 A;  4HS2 A;  3UM1 A;  3OAW A;  1H6O A;  1ZB1 A;  2UY1 B;  4DI3 A;  4N3A A;  2P58 C;  3FY4 A;  2GRM A;  2GRQ B;  5HQ8 A;  4PUC A;  4WNF A;  2HYZ A;  4ABN A;  5AJD A;  5AAO A;  4CDM A;  1OCZ E;  2PM7 A;  2ZIS A;  4XZ4 A;  1HG2 A;  5AYW D;  3MV2 B;  3L6A A;  3E32 A;  4DX5 D;  3WG7 E;  2XEH A;  3APC A;  3MV3 B;  2IY0 C;  3MKQ B;  3S7J A;  5BPP A;  3I3N A;  3TWR A;  1GW6 A;  4LRZ A;  4UI9 K;  2UWJ G;  4XI0 A;  4ZFH A;  2OEW A;  1L5J A;  3FP3 A;  3EHN A;  3FUM A;  2J8S D;  3CIA A;  5LCW C;  2OND A;  3B7S A;  4JXT A;  3CGH A;  3G2S A;  1UOH A;  3L22 A;  3TJP A;  4H7Y A;  3RRU A;  4KVO A;  4HRL A;  1N4P A;  5BXO A;  3DBS A;  4U07 A;  1JUQ A;  2FO7 A;  5A23 A;  4AVX A;  4JZY A;  3QC1 A;  2QZA A;  2V5F A;  3RU0 A;  4U8V D;  2YQ8 A;  1X81 A;  1LD7 A;  4U04 A;  4UWL A;  3CHO A;  3MX3 A;  4GTV A;  4UI9 C;  4YVQ C;  2MYO A;  1HZ4 A;  4LNB A;  4HXI A;  4CRW A;  2MHK A;  1QBQ A;  3U9W A;  2VSO E;  4BWR A;  1YYH A;  4GTT A;  2AVP A;  3SD5 A;  3FUJ A;  4OAU C;  3IHV A;  3I5P A;  4U8Y D;  1ELR A;  1RZ4 A;  4E6H A;  2XGS A;  1HS6 A;  3Q73 A;  3U3W A;  5AIJ A;  4HOR A;  3QWV A;  1NP7 A;  3U4T A;  4BY6 A;  1O5M A;  4QQI A;  1FPP A;  3CK9 A;  2WXN A;  3KSQ A;  1UJK A;  2ZU6 B;  4ANU A;  1TYQ G;  4EEC A;  3L54 A;  3LXU X;  1OWO A;  5CBN A;  4CZ2 D;  4HB5 A;  2P9P G;  4KYO B;  4B8C B;  4UWF A;  5D2M C;  1KZO A;  2RD0 A;  3BU8 A;  3DPD A;  2LXL A;  4TUM A;  2YIN A;  1NA0 A;  4B0Z A;  4K03 A;  3UKU G;  4WWO A;  2LXM A;  3Q4A B;  5AQ7 A;  4GPM A;  3DWL G;  4MS6 A;  4LSZ E;  4I1A A;  1AP7 A;  2BED A;  1W3B A;  4FUL A;  3PS6 A;  5A7D B;  3AG2 E;  3LY7 A;  3JXJ A;  4C0M A;  1DNP A;  2XS8 A;  4UUC A;  1JCR A;  2F8Y A;  1DCE A;  3FWV A;  2XCB A;  3R9A B;  1TNB A;  2LAH A;  4K0R A;  3CK7 A;  3CEQ A;  4YDW A;  2WQ6 A;  3EHR A;  3JUI A;  1NFI E;  4GCN A;  1AWC B;  3ASN E;  4LNG A;  2IU1 A;  1H2U A;  4CYM D;  5EID A;  3ULQ A;  3ZPJ A;  5ARG A;  2PQN A;  2H6G A;  4O1P A;  4RLY A;  5AJL A;  4XIF A;  3FTS A;  1BI8 B;  2WXK A;  3GZ2 A;  5AQ9 A;  3Q7A A;  3AS8 A;  5LOZ A;  1EF1 C;  3KS2 A;  2Y0B G;  1XGW A;  4BT8 A;  1S64 A;  3B7R L;  2WQ7 A;  1FVH A;  2V0P A;  3TWS A;  1UN9 A;  4BTB A;  4MLP A;  4UWG A;  2OOE A;  3FU0 A;  3R7R A;  4CEM A;  3RK6 A;  3SFX A;  3GW4 A;  1OCC E;  2BF0 X;  5KJM A;  5B3S E;  4HLE A;  4BTA A;  3C72 A;  3FU3 A;  1EDU A;  3IKO B;  1QZ2 A;  1JWF A;  2FBN A;  4WAF A;  2DBA A;  4R7L A;  4FAD A;  3SBS A;  5BXU A;  4EQF A;  3AU5 A;  5G2N A;  1SW6 A;  3ZUV B;  2Y69 E;  3T8M A;  4UQY A;  4OAV B;  2EIJ E;  5FQ6 A;  5A6C A;  2VTB B;  5ENS D;  5JJ7 A;  3WXX A;  3HXD A;  4IRU A;  1N9A A;  3D9P A;  2L9B A;  4APO A;  5IY5 E;  4XI9 A;  4APF A;  4DLQ A;  3LKU A;  3OXG A;  4I9C A;  4N2S A;  3D9I A;  3MKQ A;  4GZ3 A;  4C48 B;  3T5X A;  4HQD A;  4GB9 A;  3CHS A;  2IQC A;  5ENT D;  2IO3 C;  3OTN A;  4BET A;  3ZYQ A;  3QOU A;  1SZA A;  5CRV A;  4BX9 A;  3BUA A;  3ESL A;  2XEE A;  2Y4T A;  1FT2 A;  4KBQ A;  1E7V A;  5CEA A;  4HI8 A;  1XNF A;  4GPK A;  4EZK A;  2ETC A;  3CQC B;  2NXP A;  1WY6 A;  3C5R A;  3X2Q E;  1O1T A;  2MOW A;  2KCL A;  1TNZ A;  3QNK A;  1DVP A;  3AS5 A;  3G2V A;  3FH7 A;  3U66 A;  3CKC A;  2I1J A;  2QC9 A;  2YNQ A;  3FFL A;  4I2Z A;  4N2Q A;  3UX4 A;  3KAE A;  1INZ A;  3QKY A;  3UTM A;  3DEP A;  2ION A;  3Q75 A;  3ZIM A;  3MKR A;  4ACL A;  3PE4 A;  3TWQ A;  5HRY A;  1IXV A;  4GA2 A;  3HVE B;  4TXR A;  3EU5 A;  4GMJ A;  1JCQ A;  3TGO A;  2GRO B;  4DUI A;  3PZ1 A;  1NA3 A;  3C3R A;  4N39 A;  4DJA A;  3PH0 C;  4CCA A;  5LFA A;  4AEZ C;  5CED B;  3RSE G;  4RG9 A;  2X6H A;  2XZD G;  2UY1 A;  4F53 A;  3VTY A;  3DSW A;  4A3V A;  3B95 A;  3SO8 A;  2J4B A;  2WXJ A;  4U96 D;  3NZS A;  4XKC A;  2P9U G;  1H6K A;  2OCC E;  5G55 A;  5FJY A;  2KBX A;  5ANR A;  2VGX A;  2BKG A;  2LSU A;  1HE8 A;  2VGE A;  4CDR A;  3DSU A;  2VJ8 A;  5DBK A;  3UI2 A;  4TRQ A;  4AM9 A;  3B7T A;  3MYV A;  2DYS E;  4BSX A;  2I6H A;  4N3B A;  1O1S A;  5KWD A;  3D9L A;  4DK5 A;  4KT6 B;  3URZ A;  4ZHB A;  2VGX B;  3DXM G;  2GW1 A;  2LNI A;  2P9L G;  4L2L A;  4U0U A;  2X6F A;  4I9E A;  2R05 A;  3SI5 A;  5AQA A;  4V3I A;  4WWP A;  4IN3 B;  3IBE A;  1N54 A;  2HE0 A;  5KJL A;  1TN7 A;  4I2W A;  4ILI A;  4YND A;  1D8D A;  3NBN B;  1Z3Y A;  2WMO A;  4JHK A;  5T4Y A;  4O60 A;  3E4B A;  2IF4 A;  5C1D A;  2V4H C;  4JD2 G;  4UQX A;  4G26 A;  3CHQ A;  4J8S A;  3EHM A;  3UT4 A;  5G05 J;  2WXM A;  2VQ2 A;  4YDY A;  3KEA A;  4PS3 A;  4XKB A;  3RJV A;  2CHX A;  3LJ3 A;  4U0Z A;  1PC2 A;  4ACK A;  3CK8 A;  3CST A;  4JW1 A;  2DYR E;  2XRY A;  3SGH A;  5CCL A;  1BLX B;  1D9S A;  4OVU A;  2KCK A;  4DI4 A;  1N94 A;  5ENN A;  3EJN A;  3PVL A;  4J8D A;  3QB2 A;  3KEZ A;  5ANL A;  5ITZ F;  5HI7 A;  3CHR A;  2YHC A;  3HXF A;  4EBA G;  3PZD A;  2E2E A;  1S63 A;  2KM4 A;  4BX8 A;  1EPU A;  3LJN A;  5JJT A;  4G25 A;  3RO3 A;  4B94 A;  3CVY A;  3CLJ A;  2WXG A;  3SY2 A;  3V2O A;  1IKN D;  1Y6I A;  3PUK A;  4CGV A;  1QYM A;  4G23 A;  3QJZ A;  5FIO A;  1HFA A;  1OWP A;  3TWT A;  4G1T A;  4Y6W A;  1E8X A;  1Z5S C;  3L08 A;  4U8H A;  2X6I A;  2ETA A;  3HIZ A;  2J4D A;  2LAI A;  3R9M A;  5BNW A;  5FTP A;  2V4L A;  3Q79 A;  5JJ6 A;  3N71 A;  3W9G A;  3ASH A;  4JB8 P;  1JWG A;  4U95 D;  4PS7 A;  5CEC B;  2VSY A;  3DSV A;  4I6E A;  4G2V A;  4L2Y A;  1YA0 A;  3B7B A;  3FEX A;  2X38 A;  4DX2 A;  1OUV A;  4KXK B;  1FCH A;  4WND A;  2WPV A;  3ISM C;  3B7U X;  4IUL A;  4LNU D;  5HS0 A;  5EIB E;  3V2X A;  2WXH A;  1ELW A;  4M7C A;  1IHB A;  3L82 A;  3MEK A;  1H2V C;  3ABL E;  4UWK A;  3APF A;  2WXF A;  4NUR A;  2I9C A;  3AJI A;  4EPZ A;  2AXU A;  4X8Q A;  3S7F A;  3Q9N C;  4B93 B;  3FUK A;  4GTQ A;  3Q5M A;  1MX2 A;  2RG8 A;  2FF4 A;  1KLX A;  4AY6 A;  4LEU A;  2C2L A;  2GRR B;  4A1S A;  3PZ3 A;  3L16 A;  3Q9U C;  4JA7 A;  2XCC A;  1OWM A;  3FU6 A;  1KT0 A;  4KMO A;  3PUJ A;  3O4Z A;  5D0Q D;  3I4R B;  3L9T A;  2FO1 E;  5B1B E;  4JL0 A;  2BUG A;  4N5C A;  2ZGD A;  3FTZ A;  3Q78 A;  4BT9 A;  1SQM A;  1SA4 A;  4DX1 A;  3CVU A;  1WM5 A;  2BTD A;  3LVQ E;  4I6J A;  2LUH A;  3NOG D;  1X5B A;  1TN8 A;  4Q96 A;  3CHP A;  3FDH A;  2GRP B;  4BES A;  2CFU A;  2VSX E;  1TR4 A;  3EIQ C;  3RO2 A;  2IEJ A;  3TWX A;  3DPY A;  2P9S G;  4YDO A;  4GAA A;  1BU9 A;  2CHZ A;  3LY9 A;  4UWH A;  5ENR D;  4U63 A;  4N3C A;  1UW4 B;  4TV3 A;  5AEN A;  4JHJ A;  4J0U A;  2RKK A;  4CGW A;  3HYM B;  1IQR A;  2CG3 A;  1MJ0 A;  3AU4 A;  1TEZ A;  3I4G A;  1YCS B;  4O6F A;  4WUY A;  4GMR A;  3EU9 A;  4GZC A;  5KCM A;  4UQZ A;  3FHE A;  2AWI A;  3CVN A;  4GTO A;  2X6K A;  1VDY A;  4JA9 A;  3ZYL A;  4ILG A;  4WNG A;  5EIL A;  3TWV A;  1SA5 A;  5D66 A;  3PEV B;  3ONL A;  4HRM B;  3MZL B;  2HR2 A;  1TN6 A;  3ZN3 A;  4TXQ A;  5ARF A;  3ZEF A;  3FU5 A;  4OVV A;  3E37 A;  2VSN A;  4HNA D;  1O1R A;  3ZXP A;  3ZHE B;  3FUF A;  2KXP C;  2HM8 A; 
#chains in the Genus database with same CATH homology
 1SVX A;  5CED B;  1YYH A;  2F8X K;  5ENP D;  3HRA A;  4BER A;  2FO1 E;  4O1P A;  4RLY A;  3IXE A;  2XZD G;  4HLL A;  5AAO A;  5KNH D;  1BI7 B;  2ZGG A;  4C48 B;  3W9G A;  4OAU C;  4HQD A;  1N0R A;  4U8Y D;  4Z68 A;  5JA4 D;  4JB8 P;  4U95 D;  2XZT G;  1MX4 A;  3B95 A;  3DEO A;  3SO8 A;  2ZGD A;  3ZKJ A;  1OY3 D;  4U96 D;  4G8L A;  5CEC B;  3TWU A;  1BI8 B;  1DC2 A;  3NOC D;  5ENT D;  5ENQ D;  5AQ9 A;  4QQI A;  4F6R D;  4BET A;  1BLX B;  4HI9 A;  1D9S A;  4DX1 A;  4K5A B;  4DX5 D;  4A63 B;  1N0Q A;  3T9K A;  2XEN A;  2KBX A;  3ZU7 B;  4NIK A;  5JMN D;  1WG0 A;  2BKG A;  3B7B A;  2A5E A;  3NOG D;  2VGE A;  1A5E A;  4DX2 A;  4DX6 D;  1K3Z D;  5CBN A;  2XEH A;  2XEE A;  4CZ2 D;  2Y0B G;  5AQB A;  4BES A;  2QYJ A;  4HB5 A;  1WDY A;  2DZO A;  2P2C P;  3UI2 A;  3W9F A;  3UXG A;  1TR4 A;  4G8K A;  3TWX A;  5CEA A;  3V30 A;  1K1B A;  1N11 A;  4HI8 A;  3TWR A;  3TWS A;  3TWW A;  2ETC A;  4TUM A;  2V5Q C;  4LNU D;  3C5R A;  3JXI A;  1BU9 A;  5ITZ F;  2DZN A;  5HS0 A;  4ZFH A;  5ENR D;  5EIB E;  3T8K A;  5KWD A;  4BSZ B;  1OT8 A;  3V2X A;  3AAA C;  3J5P A;  4ZHB A;  4K5C A;  2RFM A;  5AQ7 A;  1MX6 A;  5ENO D;  2J8S D;  4GPM A;  1IHB A;  4HRN A;  4LSZ E;  3LJN A;  5EN5 D;  2QC9 A;  4QFV A;  5AAR A;  1AP7 A;  1MJ0 A;  2Y1L E;  4J8Y A;  5AQA A;  3ZNG A;  1YCS B;  4K5B A;  1BD8 A;  4DX7 D;  3AJI A;  4ATZ D;  4GMR A;  3HG0 D;  4O1O A;  1S70 B;  1UOH A;  3JUE A;  5BXU A;  2HE0 A;  3V31 A;  3EU9 A;  5CER B;  1MYO A;  5HKP A;  2DWZ A;  3JXJ A;  1K1A A;  2BKK B;  4HRL A;  3Q9N C;  2JAB A;  1SW6 A;  4UUC A;  3V2O A;  3ZUV B;  1IKN D;  1DCQ A;  4B93 B;  5BXO A;  1QYM A;  3UTM A;  5CBO A;  3DEP A;  4DRX E;  4OAV B;  5EIL A;  5FIO A;  2AJA A;  2F8Y A;  3EHQ A;  2F37 A;  3TWV A;  5D66 A;  5FIN A;  1MX2 A;  3NBN B;  2DVW A;  4BEP A;  4HRM B;  5KNG A;  5ENS D;  1G3N B;  3D9H A;  4O60 A;  4HBD A;  2PNN A;  3TWT A;  5KBA A;  3J5Q B;  4U8V D;  2RFA A;  3Q9U C;  4F1P A;  4YDW A;  3TWQ A;  5HRY A;  1IXV A;  1YMP A;  2V4H C;  3EHR A;  4N5Q A;  1NFI E;  2NYJ A;  5EYP F;  2ETA A;  4J7W A;  4DUI A;  4LG6 A;  5AN8 A;  1AWC B;  2ETB A;  5EYL A;  4HNA D;  2MYO A;  4CYM D;  2L6B A;  5EID A;  3V79 K;  4YDY A;  3KEA A;  2B0O E;  3F6Q A;  2KXP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...