1K1BA

Crystal structure of the ankyrin repeat domain of bcl-3: a unique member of the ikappab protein family
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
228
structure length
228
Chain Sequence
EDGDTPLHIAVVQGNLPAVHRLVNLFQQGGRELDIYNNLRQTPLHLAVITTLPSVVRLLVTAGASPMALDRHGQTAAHLACEHRSPTCLRALLDSAAPGTLDLEARNYDGLTALHVAVNTECQETVQLLLERGADIDAVDIKSGRSPLIHAVENNSLSMVQLLLQHGANVNAQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVIDILRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords B-cell lymphoma 3-encoded protein
publication title Crystal structure of the ankyrin repeat domain of Bcl-3: a unique member of the IkappaB protein family.
pubmed doi rcsb
source organism Homo sapiens
total genus 75
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2001-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1k1bA00
3TWSA 2L6BA 5ENPD 1AWCB 3T9KA 4OAVB 3EHQA 4QFVA 1MX6A 1OT8A 4J8YA 4C48B 5KBAA 1S70B 1UOHA 1IHBA 1WDYA 4JB8P 4LSZE 2MYOA 5HKPA 4HI8A 3ZUVB 2A5EA 4U96D 1N0QA 1MX4A 3NOCD 4O1PA 3TWWA 5JMND 2XEHA 5BXUA 5AQAA 1YYHA 3J5QB 2JABA 2F37A 5HS0A 2XEEA 1BD8A 1K1AA 4HRMB 5AAOA 5BXOA 4OAUC 2QYJA 4HQDA 5AARA 5CEDB 3B7BA 4HNAD 4DX6D 3V79K 1TR4A 1BI8B 1N11A 3D9HA 1BU9A 4U95D 4CYMD 3ZNGA 1IKND 3Q9UC 4ZHBA 5JA4D 4G8LA 2DZOA 5ITZF 3TWRA 4J7WA 3DEOA 3EHRA 1SW6A 1NFIE 3NBNB 2Y1LE 4CZ2D 2RFMA 5HRYA 1A5EA 5AQ7A 2KBXA 1N0RA 5EYPF 4Z68A 2XZTG 3AJIA 4K5CA 5EIDA 2PNNA 3UI2A 3W9FA 2BKGA 5ENSD 1DC2A 2DWZA 1K1BA 1MYOA 3JXJA 3HG0D 5CECB 2B0OE 1IXVA 3J5PA 5FIOA 3ZKJA 4GMRA 4TUMA 2V5QC 2XZDG 2AJAA 4N5QA 5KWDA 3Q9NC 4ZFHA 3TWTA 3IXEA 3V2XA 2DZNA 5EILA 3DEPA 2VGEA 4K5AB 1YCSB 3ZU7B 3LJNA 4A63B 4U8VD 5KNHD 3V2OA 3SO8A 4DX1A 5CBOA 5CBNA 4G8KA 5EN5D 5FINA 1OY3D 5CERB 2P2CP 4GPMA 4YDWA 5EIBE 4QQIA 4HI9A 2DVWA 5ENTD 3HRAA 4HRLA 3AAAC 1DCQA 1YMPA 5ENQD 3EU9A 3UTMA 4BESA 2ETBA 4HB5A 4BETA 5CEAA 4K5BA 4O1OA 3TWUA 5ENOD 2ZGGA 4BSZB 3TWXA 2J8SD 2NYJA 5EYLA 3B95A 4UUCA 1BI7B 4YDYA 3V31A 2F8XK 1BLXB 2KXPC 3UXGA 2Y0BG 5AQ9A 2F8YA 4B93B 4DRXE 4ATZD 2RFAA 4U8YD 1WG0A 4LG6A 4HRNA 1QYMA 3JUEA 5AQBA 4DUIA 4DX5D 4HBDA 4BEPA 2QC9A 3F6QA 3JXIA 4RLYA 2XENA 1MJ0A 5D66A 3TWQA 2HE0A 3V30A 3T8KA 4HLLA 4NIKA 1MX2A 2FO1E 1D9SA 3NOGD 1K3ZD 4F1PA 4DX7D 2ETCA 5KNGA 1G3NB 4BERA 2BKKB 5AN8A 5ENRD 1SVXA 4DX2A 4O60A 3TWVA 3W9GA 2ZGDA 4F6RD 3KEAA 4LNUD 1AP7A 3C5RA 2V4HC 2ETAA
chains in the Genus database with same CATH superfamily
3UIOC 3SBSA 1TNBA 4GTTA 1AWCB 2GRQB 1MX6A 1S70B 4HORA 5HKPA 4IN3B 4J8SA 5FZRA 5JMND 4GTQA 4B8AA 1YYHA 3U3WA 3J5QB 1U2VG 3WG7E 1RZ4A 1X81A 3U9WA 4GA2A 2Y69E 4NURA 3AU5A 2DZOA 3FTSA 2EQXA 5G04C 4APOA 3JQ0A 2GW1A 3R7QA 3CV0A 3JQ1A 3Q7FA 4ACKA 2IY0C 3J5PA 1EYHA 2I1JA 3MEKA 5EILA 3SQVA 1WAO1 4LEUA 5EN5D 4GZCA 3LKUA 3FH7A 4CDRA 3G2UA 3TG5A 4ATGA 3EU9A 2KC7A 1HG2A 4AP2A 4MBGA 4U7EB 3URZA 2I9CA 2F8YA 3RRMB 3QKYA 2LSVA 3RSEG 2L9BA 2RD0A 4JVSA 2QC9A 3ASHA 1TNOA 1HH8A 2ZXWE 3PEUB 4GAAA 3DSUA 3PZ1A 3QK0A 4YNDA 1B89A 5JHAA 4JHRA 4AEZC 4AM9A 3KEZA 4FJYA 3K9IA 5ARGA 1X5BA 4QFVA 3HDXA 3AS5A 4JB8P 1NL4A 1S0PA 3D9LA 5FZSA 3FUMA 3ULYA 4U96D 3CVQA 3QWVA 3ZVVA 4JHJA 4TV3A 3U64A 3ASFA 4AOFA 3FEXA 2WXRA 1OCRE 1ELRA 3V79K 3D9HA 3P1UA 3T5XA 5J90A 2XCCA 3Q78A 3PNTB 4UWLA 2X6IA 4YVOA 3FWVA 4UI9J 1SW6A 4A1SA 5AQ7A 3L08A 4Q94A 1FVFA 3UT4A 3UQ3A 3HG0D 3G2WA 4WAFA 3KS2A 3FUIA 4A1GA 3AG2E 2DZNA 3FTVA 2VGEA 4G2VA 4AXHA 2EIME 3ZU7B 2J9QA 4WWNA 4XZ4A 1H6KA 4DX1A 5CERB 2GRMA 3FTWA 4EZLA 1N95A 2GRPB 4HI9A 2GROB 5LFAA 4JXTA 3IKOB 4CT4A 1OXJA 2WVIA 4O1OA 1LD7A 2ZGGA 3PE3A 1HS6A 1FT1A 4WNGA 4DJAA 4LG6A 1KLXA 3ZYKA 3VTYA 1QYMA 3SBTB 2ONDA 2HE0A 4GTMA 2OV8A 3V30A 4FULA 3B7SA 4HFGA 4BERA 1HU3A 2R5SA 2J4BA 4N3BA 3KEAA 2ETAA 1Y6IA 4FHKA 1NI1A 3RO2A 2VTBA 3MZLB 2RG8A 3L54A 5H7PA 3BEEA 4J0UA 2AVPA 4EPZA 4KZ0A 3TJPA 5HS0A 3GZSA 4LRZA 2VSXE 4KBQA 4HOSA 4I6EA 3DSWA 2PM6A 2QZAA 1KT0A 1N52A 4GU5A 2X6HA 1D8DA 2R02A 4B0ZA 4JA7A 3QWWA 2Y3AA 4JZYA 4L23A 3PUKA 4GTSA 3ISMC 3V2XA 3G2VA 3CVUA 5BPPA 2J08A 3HYMB 4OVUA 4BT9A 4B8CB 2EIKE 5DIZA 2ILRA 4CGWA 5FTPA 4G8KA 4HRLA 3UMVA 1IHGA 3UTMA 3CKCA 3PZ3A 4GB9A 3JCKC 2WXJA 2NXPA 2Y0BG 4I43A 3ZHEA 1HZ4A 2RFAA 4LCTA 1UG3A 5KJKA 3CGHA 4CGVA 4AIFA 5HQ8A 4BT8A 3MV2B 3O48A 5FZQA 3UIPC 3HIZA 1OWMA 2WQHA 5C1DA 4DLOA 1TNYA 5FQ4A 4L7TA 4PUCA 3ZFWA 3WXXA 4MRUA 3UT7A 4U0UA 4D10C 3PZ2A 1MQSA 1OWNA 4GTRA 3SFXA 3UKUG 1JWFA 3MV3B 4I1AA 4U95D 3DBSA 3AG4E 5EDSA 1E8WA 4Q96A 3EHRA 2Y1LE 4CZ2D 5EYPF 4K5CA 3EIQC 1SA5A 3E4BA 3KD7A 1L5JA 3CHQA 5B1AE 3ZIMA 4XE0A 1P5QA 5FQ7A 4GZ5A 3ENEA 4O6FA 3UM3A 4ZFHA 1O1TA 1NA3A 4N2SA 1N4QA 3MKQB 3EDTB 4H7YA 3S7DA 5CEAA 4UWHA 4DI4A 5AQ9A 3CSFA 2UY1A 2L6JA 3FTXA 3ABME 2WQ6A 4DX5D 4UQZA 3CQCB 3KAEA 4PS3A 2YHCA 5E75A 1FPPA 3FU5A 3AG1E 4KMOA 1MX2A 3MCXA 3LJ3A 3CVLA 4HXIA 2VSOE 2CHZA 4L9PA 1N4SA 4ANWA 5LCWJ 4KZCA 2RKKA 1KZOA 4J8YA 3OTNA 4U07A 2J07A 3FHEA 4OVVA 3SZ7A 4WWOA 3PRZA 3HVEA 3LEWA 2XEEA 1OWOA 4GCNA 3D9NA 3BQOA 5JJTA 2M63A 2R2LA 3I3NA 3ZEFA 3OXFA 3AJIA 5EX0A 2A4ZA 4WNEA 3DPDA 4FC8A 4TXRA 1IXVA 4U63A 2E2EA 2OVBA 3CK9A 1Z5SC 3DEPA 3RRUA 3DWLG 5HI7A 2HR2A 2OEVA 5AIJA 1YMPA 5BUZA 1N54A 2XHEA 2LXLA 3B95A 1ZU2A 4N3AA 4YDYA 2F8XK 1SA4A 4EBAG 4MKTA 3U4TA 3TG4A 4HRNA 3APFA 3SF4A 2AXZA 1YA0A 3T8KA 2WXGA 2MOWA 1O1SA 4AJWA 3DXKG 3E30A 5ENRD 3EHNA 2ZGDA 2WXKA 2Q7FA 3R7RA 5G04J 5DBKA 4ACLA 1TJCA 4GCOA 2WXNA 4HLEA 3LXUX 4GZ3A 2R03A 3BU8A 4O1PA 1HXIA 4UWGA 3VLDA 4GZDA 4X8QA 1BI8B 5LP0A 4CYMD 3ZNGA 2WB2A 4AVXA 3ZGQA 3LPZA 3DRAA 4YVQC 2P58C 4KXKB 4JD2G 1LF8A 3Q75A 2GRLA 5BV1A 1U3DA 4GTPA 5A7DB 4TRQA 1GW6A 2PQRA 4ILGA 3SFYA 2IONA 2P9SG 3V2OA 2I6HA 2PZIA 2AWIA 1H6OA 3Q7AA 3AAAC 4M7CA 4K5BA 3NF1A 3TWUA 3TWXA 1OUVA 3UT8A 3RIBA 4I17A 4K0RA 4B93B 1JWGA 4U8YD 4G11A 4BEPA 4IRUA 2IJGX 4JEUA 4BX9A 5B1BE 3MKRA 2KCVA 3B7UX 1D9SA 2P9PG 3FUEA 2IEJA 3C3OA 3IHYA 5B3SE 5JHBA 4DX2A 3ESLA 1EF1C 1UN8A 2LAHA 2FO7A 3JYSA 2F0YA 3RK6A 1INZA 5LX8A 3HHMA 2MYOA 1MX4A 2CG3A 3B7TA 4EZKA 4N3CA 4TUUA 5AAOA 2QYJA 2VSYA 1N11A 4JPSA 3ML8A 1H6PA 3Q9UC 4ZHBA 3SY2A 2KZTA 2VGYA 4LERA 2AXVA 2WXLA 2WXHA 1QNFA 2XZTG 5CHEE 3UI2A 1ZB1A 3U66A 3ASGA 1E7UA 4GMRA 4TUMA 5AENA 3LCAA 3X2QE 1DNPA 3TWTA 3CVWA 1H2UA 4N5CA 4RVBA 3PS6A 4LUNU 3AG3E 4EBAA 5KNHD 5C2YA 4FLHA 3HXEA 1LD8A 4QQIA 2DVWA 2C0LA 2BUGA 3HRAA 5D0QD 5BV0A 3P2BA 4BSZB 1Y8MA 3LVRE 1EDUA 2P9UG 5A23A 4HS2A 5AYWD 3FP3A 2ZIRA 4HBDA 2R59A 2KCKA 4EZJA 4HLLA 4RG6A 5T3RA 2FO1E 2ETCA 4GZ6A 4JL0A 2J4DA 2GRRB 4A55A 2IOLA 3E37A 4DK5A 4LSZE 1WDYA 1ELWA 1E8XA 4WNFA 3ZHEB 4FU3A 3Q73A 4OAUC 4CDNA 3TAXA 5AARA 4WWPA 4APFA 3MJWA 4BTAA 1IKND 2ZU6B 3D9KA 5G05C 2J09A 4I1OB 2LSUA 2WMNA 1NFIE 2IF4A 3UM0A 2YHEA 4F3VA 3FTYA 1MYOA 3G2TA 5CECB 4FADA 1PC2A 4PS7A 3DXMG 4JHKA 1JUQA 4RG9A 1LTXA 2YINA 3KSLA 5EKQD 4GTVA 3PREA 5CBNA 5EX3A 3QNKA 4Q69A 4G25A 4YDWA 3GW4A 1PY1A 5ENTD 4N39A 4WUYA 3OXGA 2FULA 3ML9A 4YDOA 3C3RA 3GYZA 2DYRE 3CIAA 3CVYA 3FH5A 3EIJA 1MJ0A 4XKBA 3E33A 1MHQA 4NACA 4IULA 4ME2A 5CRVA 2EINE 4TXPA 1OWLA 4F53A 4LNUD 3ASOE 1BPOA 1A17A 2XGSA 3AS4A 3T9KA 4G26A 1OT8A 4GYYA 1ELKA 3DPYA 4I1MA 5T4YA 4ABNA 3LY9A 4KVOA 1K1AA 5CEDB 4UWFA 4HNAD 4C0EA 3MX3A 3Q49B 1H2TC 3CHOA 4BFRA 3ULEG 4J7WA 2KCLA 3NBNB 1UJKA 5HRYA 2BKGA 4JW1A 4UQYA 5D2MC 3FU3A 5CRUA 5CMYA 2CHWA 2DIWA 2AJAA 3FUDA 4FA6A 4YDEA 4U8HA 3FU6A 1YCSB 4XX5A 1EPUA 1SZAA 4L2LA 3HVEB 4A63B 3L9TA 2X38A 3SO8A 4C0MA 2XS8A 3FH8A 3O4ZA 5G55A 5ENQD 3FTZA 4HB5A 4DPRA 3ZW3A 1OCOE 1XNFA 1VDYA 2XRZA 3D9IA 1S64A 3ONKA 2PQNA 4IYPA 5D66A 3T5VA 3ASDA 3LDZA 4EQFA 4GTOA 1K3ZD 2XEVA 2ZISA 3E32A 1E8ZA 3CHSA 2C2LA 4N2QA 2YQ8A 3SD5A 3T8MA 4F1SA 3NZSA 3TWSA 4F7AA 2L6BA 4UWKA 4OAVB 2VYIA 4XKCA 1Z6TA 3FY4A 3HXCA 4FLBA 1N0QA 3TWWA 2JLBA 4DLQA 4GPKA 5BXOA 3LY7A 3ZRHA 3D9PA 3CR3A 2BTDA 3LYAA 4J8EA 3APCA 5ITZF 5J08A 4LNGA 5FWQA 2KBXA 2OEWA 3W9FA 3FFLA 1DC2A 1KPSB 2H6IA 2V5QC 2XZDG 4MLPA 2VSNA 3QAQA 5BNWA 2WXOA 2CHXA 1IQRA 2X3MA 2FI7A 2KATA 1FCHA 2CG2A 4Y6WA 4TXQA 2WPVA 3FUHA 1Z3YA 3FUNA 1HE8A 4WNDA 2VGXA 1DCQA 1Q2ZA 3EU5A 2ETBA 3CVPA 2Y4UA 2J8SD 2WM9A 1DVPA 1BI7B 3UXGA 3QB2A 1JCSA 1WG0A 4AY5A 5AQBA 2GGFA 3F6QA 3RJVA 1E96B 4CEMA 5BT1A 2X6FA 4U0SA 2LXMA 3ZYMA 3Q15A 2UWJG 5KNGA 3FUKA 2BKKB 2QYUA 4O60A 3W9GA 4F6RD 4BY6A 4C9BB 3QOUA 3LVQE 2B6CA 4E85A 4GMJA 5AJDA 3FTUA 3L82A 3ZYQA 4C48B 4J6IA 4K03A 5AJLA 1O1RA 3ZUVB 3RAUA 5ANRA 3PE4A 3UPVA 2QFCA 3C98A 2L0TB 3CVXA 1H0AA 3FU0A 2F37A 3PUJA 4HQDA 3CQGB 4DI3A 4XI9A 3D9OA 2PL2A 2RFMA 5KWDA 1E7VA 2AXUA 3JXJA 5FJYA 4I9CA 1JCRA 4FP7A 1S63A 3I4GA 3Q9NC 2L0IA 3VLEA 1E8YA 1TN7A 3IV0A 1TYQG 1K8KG 1D8EA 5CMWA 3LJNA 3PZDA 5CBOA 3E34A 1NP7A 3NZUA 2YNQA 4MS6A 4BTBA 1TEZA 2KZTB 4B89A 5EYLA 5LOZA 1BLXB 3CLJA 1SQMA 3JXIA 5ANLA 4AY6A 3PNLB 3DSTA 3TWQA 4PS8A 4I2ZA 2QY7A 3NOGD 4CRWA 1OCCE 5JJ6A 4LNBA 4F1PA 3FEYA 4FJZA 1HG5A 4ILIA 1E90A 3CEQA 3PDNA 4KYOB 2CFUA 2KM4A 4RLYA 3R9AB 1RW2A 2OVFA 3LS8A 3HXBA 5ENPD 4OYSA 3DSSA 2X6JA 5KCMA 1O5MA 1UOHA 4CT0A 4BSXA 3NOCD 2XEHA 3NAWA 3PEVB 3D3MA 2JABA 2XPYA 3B7BA 3D9JA 2FEZA 1XGWA 2XPZA 3DSVA 2IFUA 1HF8A 4L1BA 4J8FA 3ZPJA 3MGBA 4E6HA 1OCZE 2PNNA 1KZPA 2Y4TA 5G2NA 4GYWA 3PZ4A 4JA9A 1HFAA 3C72A 2XQ0A 1H2VC 3SHFA 1UJJA 3I5PA 1TJFA 1TNUA 4K5AB 3HXFA 5FINA 3TXMA 4GPMA 3IHVA 2P9IG 2IQCA 4GYOA 2VTBB 2KXPC 1WY6A 3TGOA 3FULA 1HX8A 4W9RA 4I9EA 2C0MA 2P9LG 1TNZA 5G05J 5ARFA 2P9KG 5KJLA 2R05A 2LO6A 1WM5A 4XIFA 4NQ0A 4B94A 1IHBA 3JUIA 2HYZA 2WXPA 5M72A 2LAIA 3G2SA 4HVBA 2PM7A 2EILE 2WXQA 2JEKA 4A3VA 2WMOA 3UX4A 5JA4D 1U3CA 3AU4A 1NA0A 3DEOA 3DSXA 2GRNB 3L22A 1SZ9A 3B7RL 2DWZA 2NC9A 4EHMA 3HXDA 3ZKJA 4CDMA 3L16A 4PDXA 2BEDA 4RQIA 4EECA 4G1TA 4UI9C 3BUAA 1NZNA 2XGOA 3SI5A 5FT9A 2NYJA 3L13A 4UUCA 2WXFA 3TL5A 4DRXE 4J8DA 4DUIA 3Q47B 1V54E 3I4RB 2EIJE 3S7FA 3GZ1A 1G3NB 5AN8A 2V0PA 3OAWA 1SVXA 4HOTA 3C5RA 3ESKA 4JC8A 1JPLA 3EHQA 3QC1A 4GMLA 5KBAA 2FF4A 4JEHA 2WXMA 3TXNA 5CCLA 2DBAA 2IU1A 2MRIA 3RKVA 5KJNA 2X6KA 2V8SE 3UINC 3MYVA 1MZCA 3VTXA 3IBEA 1QBQA 3ONLA 4A3TA 4G8LA 3TWRA 2NSZA 3PH0C 2VQ2A 3LY8A 1N0RA 3D9MA 5CCMA 2AW6A 4M3OA 4XI0A 2UY1B 2V4LA 5FIOA 1ZBPA 3VLFA 2XS1A 3IXEA 3Q5MA 3QWPA 3QDNA 5A6CA 4HOQA 4ANXA 4U8VD 3CK7A 5T8IA 4U0ZA 3CVNA 4GA0A 3OXLA 4BETA 2H6HA 3S7JA 5ENOD 3FUFA 1PAQA 3C3QA 4XEIG 1UW4B 1DCEA 3ZXSA 4CCAA 3ZYLA 5KJMA 3BG0B 3QARA 2XENA 4UQXA 4BWRA 2CFZA 2IOSA 1IQUA 1OWPA 3CSTA 2HO1A 4NIKA 3IEGA 3UM1A 2I2OA 3QJZA 2V5FA 1N94A 3APDA 3RO3A 3TWVA 2P9NG 1AP7A 2VGXB 4H7XA 4DX7D 1KT1A 2XGMA 5E76A 3ZN3A 3BG1B 2VJ8A 4V3IA 4I6JA 3CKBA 1N4PA 1N4RA 4HI8A 4KT6B 3N71A 1FVHA 1N9AA 3L17A 2A5UA 4I6GA 4DX6D 1BU9A 1QQEA 3UKRG 2LNIA 3CHPA 3RRNB 4KVMA 1A5EA 3ASNE 3ULQA 5ENSD 1K1BA 3Q79A 1TN8A 3MA5A 2IO3C 2XRYA 3ABKE 4Y6CA 3SGHA 4BX8A 3ABLE 3ZXPA 2P2CP 5JJ7A 3NQPA 3S7BA 2I1KA 5BW8C 4RSYA 2OOEA 1Z3XA 3CHMA 2DYSE 4URKA 1TN6A 3JUEA 1QZ2A 5IY5E 4L2YA 2H6GA 2MHKA 1UN9A 2FBNA 3KSQA 2WQ7A 3GZ2A 5FQ8A 4ILHB 3FDHA 2V4HC 1IYGA 2BF0X 2H6FA 4G23A 3Q4AB 2A5EA 1V55E 1JCQA 5ENNA 5BXUA 1FT2A 5AQAA 4FHJA 1BD8A 4HRMB 3MKQA 4UI9K 4P29A 3SFZA 3UM2A 3EUVA 4AV7A 1TR4A 2OCCE 3UUXA 2WXIA 1HO8A 4GA1A 4Z68A 5EIDA 2R17C 3PVLA 5LCWC 2HM8A 3S2AA 2B0OE 4ANUA 1H19A 3CK8A 4R7LA 4N5QA 3NB2A 3EJNA 2IO2C 3AS8A 3SNXA 4U04A 4NRHB 1OY3D 2LUHA 2XCBA 4ANVA 5EIBE 3B13A 5D0OD 4BESA 3L6AA 2J49A 3CVVA 3V31A 4PH4B 4ATZD 3FUJA 3R9MA 3CHRA 4HOUA 3EHMA 4I2WA 2E0IA 3RU0A 5FQ6A 1W3BA 2XPIA 2DCPA 4G24A
chains in the Genus database with same CATH topology
3TWSA 2L6BA 5ENPD 1AWCB 3T9KA 4OAVB 3EHQA 4QFVA 1MX6A 1OT8A 4J8YA 4C48B 5KBAA 1S70B 1UOHA 1IHBA 1WDYA 4JB8P 4LSZE 2MYOA 5HKPA 4HI8A 3ZUVB 2A5EA 4U96D 1N0QA 1MX4A 3NOCD 4O1PA 3TWWA 5JMND 2XEHA 5BXUA 5AQAA 1YYHA 3J5QB 2JABA 2F37A 5HS0A 2XEEA 1BD8A 1K1AA 4HRMB 5AAOA 5BXOA 4OAUC 2QYJA 4HQDA 5AARA 5CEDB 3B7BA 4HNAD 4DX6D 3V79K 1TR4A 1BI8B 1N11A 3D9HA 1BU9A 4U95D 4CYMD 3ZNGA 1IKND 3Q9UC 4ZHBA 5JA4D 4G8LA 2DZOA 5ITZF 3TWRA 4J7WA 3DEOA 3EHRA 1SW6A 1NFIE 3NBNB 2Y1LE 4CZ2D 2RFMA 5HRYA 1A5EA 5AQ7A 2KBXA 1N0RA 5EYPF 4Z68A 2XZTG 3AJIA 4K5CA 5EIDA 2PNNA 3UI2A 3W9FA 2BKGA 5ENSD 1DC2A 2DWZA 1K1BA 1MYOA 3JXJA 3HG0D 5CECB 2B0OE 1IXVA 3J5PA 5FIOA 3ZKJA 4GMRA 4TUMA 2V5QC 2XZDG 2AJAA 4N5QA 5KWDA 3Q9NC 4ZFHA 3TWTA 3IXEA 3V2XA 2DZNA 5EILA 3DEPA 2VGEA 4K5AB 1YCSB 3ZU7B 3LJNA 4A63B 4U8VD 5KNHD 3V2OA 3SO8A 4DX1A 5CBOA 5CBNA 4G8KA 5EN5D 5FINA 1OY3D 5CERB 2P2CP 4GPMA 4YDWA 5EIBE 4QQIA 4HI9A 2DVWA 5ENTD 3HRAA 4HRLA 3AAAC 1DCQA 1YMPA 5ENQD 3EU9A 3UTMA 4BESA 2ETBA 4HB5A 4BETA 5CEAA 4K5BA 4O1OA 3TWUA 5ENOD 2ZGGA 4BSZB 3TWXA 2J8SD 2NYJA 5EYLA 3B95A 4UUCA 1BI7B 4YDYA 3V31A 2F8XK 1BLXB 2KXPC 3UXGA 2Y0BG 5AQ9A 2F8YA 4B93B 4DRXE 4ATZD 2RFAA 4U8YD 1WG0A 4LG6A 4HRNA 1QYMA 3JUEA 5AQBA 4DUIA 4DX5D 4HBDA 4BEPA 2QC9A 3F6QA 3JXIA 4RLYA 2XENA 1MJ0A 5D66A 3TWQA 2HE0A 3V30A 3T8KA 4HLLA 4NIKA 1MX2A 2FO1E 1D9SA 3NOGD 1K3ZD 4F1PA 4DX7D 2ETCA 5KNGA 1G3NB 4BERA 2BKKB 5AN8A 5ENRD 1SVXA 4DX2A 4O60A 3TWVA 3W9GA 2ZGDA 4F6RD 3KEAA 4LNUD 1AP7A 3C5RA 2V4HC 2ETAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TWS A;  2L6B A;  5ENP D;  1AWC B;  3T9K A;  4OAV B;  3EHQ A;  4QFV A;  1MX6 A;  1OT8 A;  4J8Y A;  4C48 B;  5KBA A;  1S70 B;  1UOH A;  1IHB A;  1WDY A;  4JB8 P;  4LSZ E;  2MYO A;  5HKP A;  4HI8 A;  3ZUV B;  2A5E A;  4U96 D;  1N0Q A;  1MX4 A;  3NOC D;  4O1P A;  3TWW A;  5JMN D;  2XEH A;  5BXU A;  5AQA A;  1YYH A;  3J5Q B;  2JAB A;  2F37 A;  5HS0 A;  2XEE A;  1BD8 A;  1K1A A;  4HRM B;  5AAO A;  5BXO A;  4OAU C;  2QYJ A;  4HQD A;  5AAR A;  5CED B;  3B7B A;  4HNA D;  4DX6 D;  3V79 K;  1TR4 A;  1BI8 B;  1N11 A;  3D9H A;  1BU9 A;  4U95 D;  4CYM D;  3ZNG A;  1IKN D;  3Q9U C;  4ZHB A;  5JA4 D;  4G8L A;  2DZO A;  5ITZ F;  3TWR A;  4J7W A;  3DEO A;  3EHR A;  1SW6 A;  1NFI E;  3NBN B;  2Y1L E;  4CZ2 D;  2RFM A;  5HRY A;  1A5E A;  5AQ7 A;  2KBX A;  1N0R A;  5EYP F;  4Z68 A;  2XZT G;  3AJI A;  4K5C A;  5EID A;  2PNN A;  3UI2 A;  3W9F A;  2BKG A;  5ENS D;  1DC2 A;  2DWZ A;  1K1B A;  1MYO A;  3JXJ A;  3HG0 D;  5CEC B;  2B0O E;  1IXV A;  3J5P A;  5FIO A;  3ZKJ A;  4GMR A;  4TUM A;  2V5Q C;  2XZD G;  2AJA A;  4N5Q A;  5KWD A;  3Q9N C;  4ZFH A;  3TWT A;  3IXE A;  3V2X A;  2DZN A;  5EIL A;  3DEP A;  2VGE A;  4K5A B;  1YCS B;  3ZU7 B;  3LJN A;  4A63 B;  4U8V D;  5KNH D;  3V2O A;  3SO8 A;  4DX1 A;  5CBO A;  5CBN A;  4G8K A;  5EN5 D;  5FIN A;  1OY3 D;  5CER B;  2P2C P;  4GPM A;  4YDW A;  5EIB E;  4QQI A;  4HI9 A;  2DVW A;  5ENT D;  3HRA A;  4HRL A;  3AAA C;  1DCQ A;  1YMP A;  5ENQ D;  3EU9 A;  3UTM A;  4BES A;  2ETB A;  4HB5 A;  4BET A;  5CEA A;  4K5B A;  4O1O A;  3TWU A;  5ENO D;  2ZGG A;  4BSZ B;  3TWX A;  2J8S D;  2NYJ A;  5EYL A;  3B95 A;  4UUC A;  1BI7 B;  4YDY A;  3V31 A;  2F8X K;  1BLX B;  2KXP C;  3UXG A;  2Y0B G;  5AQ9 A;  2F8Y A;  4B93 B;  4DRX E;  4ATZ D;  2RFA A;  4U8Y D;  1WG0 A;  4LG6 A;  4HRN A;  1QYM A;  3JUE A;  5AQB A;  4DUI A;  4DX5 D;  4HBD A;  4BEP A;  2QC9 A;  3F6Q A;  3JXI A;  4RLY A;  2XEN A;  1MJ0 A;  5D66 A;  3TWQ A;  2HE0 A;  3V30 A;  3T8K A;  4HLL A;  4NIK A;  1MX2 A;  2FO1 E;  1D9S A;  3NOG D;  1K3Z D;  4F1P A;  4DX7 D;  2ETC A;  5KNG A;  1G3N B;  4BER A;  2BKK B;  5AN8 A;  5ENR D;  1SVX A;  4DX2 A;  4O60 A;  3TWV A;  3W9G A;  2ZGD A;  4F6R D;  3KEA A;  4LNU D;  1AP7 A;  3C5R A;  2V4H C;  2ETA A; 
#chains in the Genus database with same CATH topology
 3UIO C;  3SBS A;  1TNB A;  4GTT A;  1AWC B;  2GRQ B;  1MX6 A;  1S70 B;  4HOR A;  5HKP A;  4IN3 B;  4J8S A;  5FZR A;  5JMN D;  4GTQ A;  4B8A A;  1YYH A;  3U3W A;  3J5Q B;  1U2V G;  3WG7 E;  1RZ4 A;  1X81 A;  3U9W A;  4GA2 A;  2Y69 E;  4NUR A;  3AU5 A;  2DZO A;  3FTS A;  2EQX A;  5G04 C;  4APO A;  3JQ0 A;  2GW1 A;  3R7Q A;  3CV0 A;  3JQ1 A;  3Q7F A;  4ACK A;  2IY0 C;  3J5P A;  1EYH A;  2I1J A;  3MEK A;  5EIL A;  3SQV A;  1WAO 1;  4LEU A;  5EN5 D;  4GZC A;  3LKU A;  3FH7 A;  4CDR A;  3G2U A;  3TG5 A;  4ATG A;  3EU9 A;  2KC7 A;  1HG2 A;  4AP2 A;  4MBG A;  4U7E B;  3URZ A;  2I9C A;  2F8Y A;  3RRM B;  3QKY A;  2LSV A;  3RSE G;  2L9B A;  2RD0 A;  4JVS A;  2QC9 A;  3ASH A;  1TNO A;  1HH8 A;  2ZXW E;  3PEU B;  4GAA A;  3DSU A;  3PZ1 A;  3QK0 A;  4YND A;  1B89 A;  5JHA A;  4JHR A;  4AEZ C;  4AM9 A;  3KEZ A;  4FJY A;  3K9I A;  5ARG A;  1X5B A;  4QFV A;  3HDX A;  3AS5 A;  4JB8 P;  1NL4 A;  1S0P A;  3D9L A;  5FZS A;  3FUM A;  3ULY A;  4U96 D;  3CVQ A;  3QWV A;  3ZVV A;  4JHJ A;  4TV3 A;  3U64 A;  3ASF A;  4AOF A;  3FEX A;  2WXR A;  1OCR E;  1ELR A;  3V79 K;  3D9H A;  3P1U A;  3T5X A;  5J90 A;  2XCC A;  3Q78 A;  3PNT B;  4UWL A;  2X6I A;  4YVO A;  3FWV A;  4UI9 J;  1SW6 A;  4A1S A;  5AQ7 A;  3L08 A;  4Q94 A;  1FVF A;  3UT4 A;  3UQ3 A;  3HG0 D;  3G2W A;  4WAF A;  3KS2 A;  3FUI A;  4A1G A;  3AG2 E;  2DZN A;  3FTV A;  2VGE A;  4G2V A;  4AXH A;  2EIM E;  3ZU7 B;  2J9Q A;  4WWN A;  4XZ4 A;  1H6K A;  4DX1 A;  5CER B;  2GRM A;  3FTW A;  4EZL A;  1N95 A;  2GRP B;  4HI9 A;  2GRO B;  5LFA A;  4JXT A;  3IKO B;  4CT4 A;  1OXJ A;  2WVI A;  4O1O A;  1LD7 A;  2ZGG A;  3PE3 A;  1HS6 A;  1FT1 A;  4WNG A;  4DJA A;  4LG6 A;  1KLX A;  3ZYK A;  3VTY A;  1QYM A;  3SBT B;  2OND A;  2HE0 A;  4GTM A;  2OV8 A;  3V30 A;  4FUL A;  3B7S A;  4HFG A;  4BER A;  1HU3 A;  2R5S A;  2J4B A;  4N3B A;  3KEA A;  2ETA A;  1Y6I A;  4FHK A;  1NI1 A;  3RO2 A;  2VTB A;  3MZL B;  2RG8 A;  3L54 A;  5H7P A;  3BEE A;  4J0U A;  2AVP A;  4EPZ A;  4KZ0 A;  3TJP A;  5HS0 A;  3GZS A;  4LRZ A;  2VSX E;  4KBQ A;  4HOS A;  4I6E A;  3DSW A;  2PM6 A;  2QZA A;  1KT0 A;  1N52 A;  4GU5 A;  2X6H A;  1D8D A;  2R02 A;  4B0Z A;  4JA7 A;  3QWW A;  2Y3A A;  4JZY A;  4L23 A;  3PUK A;  4GTS A;  3ISM C;  3V2X A;  3G2V A;  3CVU A;  5BPP A;  2J08 A;  3HYM B;  4OVU A;  4BT9 A;  4B8C B;  2EIK E;  5DIZ A;  2ILR A;  4CGW A;  5FTP A;  4G8K A;  4HRL A;  3UMV A;  1IHG A;  3UTM A;  3CKC A;  3PZ3 A;  4GB9 A;  3JCK C;  2WXJ A;  2NXP A;  2Y0B G;  4I43 A;  3ZHE A;  1HZ4 A;  2RFA A;  4LCT A;  1UG3 A;  5KJK A;  3CGH A;  4CGV A;  4AIF A;  5HQ8 A;  4BT8 A;  3MV2 B;  3O48 A;  5FZQ A;  3UIP C;  3HIZ A;  1OWM A;  2WQH A;  5C1D A;  4DLO A;  1TNY A;  5FQ4 A;  4L7T A;  4PUC A;  3ZFW A;  3WXX A;  4MRU A;  3UT7 A;  4U0U A;  4D10 C;  3PZ2 A;  1MQS A;  1OWN A;  4GTR A;  3SFX A;  3UKU G;  1JWF A;  3MV3 B;  4I1A A;  4U95 D;  3DBS A;  3AG4 E;  5EDS A;  1E8W A;  4Q96 A;  3EHR A;  2Y1L E;  4CZ2 D;  5EYP F;  4K5C A;  3EIQ C;  1SA5 A;  3E4B A;  3KD7 A;  1L5J A;  3CHQ A;  5B1A E;  3ZIM A;  4XE0 A;  1P5Q A;  5FQ7 A;  4GZ5 A;  3ENE A;  4O6F A;  3UM3 A;  4ZFH A;  1O1T A;  1NA3 A;  4N2S A;  1N4Q A;  3MKQ B;  3EDT B;  4H7Y A;  3S7D A;  5CEA A;  4UWH A;  4DI4 A;  5AQ9 A;  3CSF A;  2UY1 A;  2L6J A;  3FTX A;  3ABM E;  2WQ6 A;  4DX5 D;  4UQZ A;  3CQC B;  3KAE A;  4PS3 A;  2YHC A;  5E75 A;  1FPP A;  3FU5 A;  3AG1 E;  4KMO A;  1MX2 A;  3MCX A;  3LJ3 A;  3CVL A;  4HXI A;  2VSO E;  2CHZ A;  4L9P A;  1N4S A;  4ANW A;  5LCW J;  4KZC A;  2RKK A;  1KZO A;  4J8Y A;  3OTN A;  4U07 A;  2J07 A;  3FHE A;  4OVV A;  3SZ7 A;  4WWO A;  3PRZ A;  3HVE A;  3LEW A;  2XEE A;  1OWO A;  4GCN A;  3D9N A;  3BQO A;  5JJT A;  2M63 A;  2R2L A;  3I3N A;  3ZEF A;  3OXF A;  3AJI A;  5EX0 A;  2A4Z A;  4WNE A;  3DPD A;  4FC8 A;  4TXR A;  1IXV A;  4U63 A;  2E2E A;  2OVB A;  3CK9 A;  1Z5S C;  3DEP A;  3RRU A;  3DWL G;  5HI7 A;  2HR2 A;  2OEV A;  5AIJ A;  1YMP A;  5BUZ A;  1N54 A;  2XHE A;  2LXL A;  3B95 A;  1ZU2 A;  4N3A A;  4YDY A;  2F8X K;  1SA4 A;  4EBA G;  4MKT A;  3U4T A;  3TG4 A;  4HRN A;  3APF A;  3SF4 A;  2AXZ A;  1YA0 A;  3T8K A;  2WXG A;  2MOW A;  1O1S A;  4AJW A;  3DXK G;  3E30 A;  5ENR D;  3EHN A;  2ZGD A;  2WXK A;  2Q7F A;  3R7R A;  5G04 J;  5DBK A;  4ACL A;  1TJC A;  4GCO A;  2WXN A;  4HLE A;  3LXU X;  4GZ3 A;  2R03 A;  3BU8 A;  4O1P A;  1HXI A;  4UWG A;  3VLD A;  4GZD A;  4X8Q A;  1BI8 B;  5LP0 A;  4CYM D;  3ZNG A;  2WB2 A;  4AVX A;  3ZGQ A;  3LPZ A;  3DRA A;  4YVQ C;  2P58 C;  4KXK B;  4JD2 G;  1LF8 A;  3Q75 A;  2GRL A;  5BV1 A;  1U3D A;  4GTP A;  5A7D B;  4TRQ A;  1GW6 A;  2PQR A;  4ILG A;  3SFY A;  2ION A;  2P9S G;  3V2O A;  2I6H A;  2PZI A;  2AWI A;  1H6O A;  3Q7A A;  3AAA C;  4M7C A;  4K5B A;  3NF1 A;  3TWU A;  3TWX A;  1OUV A;  3UT8 A;  3RIB A;  4I17 A;  4K0R A;  4B93 B;  1JWG A;  4U8Y D;  4G11 A;  4BEP A;  4IRU A;  2IJG X;  4JEU A;  4BX9 A;  5B1B E;  3MKR A;  2KCV A;  3B7U X;  1D9S A;  2P9P G;  3FUE A;  2IEJ A;  3C3O A;  3IHY A;  5B3S E;  5JHB A;  4DX2 A;  3ESL A;  1EF1 C;  1UN8 A;  2LAH A;  2FO7 A;  3JYS A;  2F0Y A;  3RK6 A;  1INZ A;  5LX8 A;  3HHM A;  2MYO A;  1MX4 A;  2CG3 A;  3B7T A;  4EZK A;  4N3C A;  4TUU A;  5AAO A;  2QYJ A;  2VSY A;  1N11 A;  4JPS A;  3ML8 A;  1H6P A;  3Q9U C;  4ZHB A;  3SY2 A;  2KZT A;  2VGY A;  4LER A;  2AXV A;  2WXL A;  2WXH A;  1QNF A;  2XZT G;  5CHE E;  3UI2 A;  1ZB1 A;  3U66 A;  3ASG A;  1E7U A;  4GMR A;  4TUM A;  5AEN A;  3LCA A;  3X2Q E;  1DNP A;  3TWT A;  3CVW A;  1H2U A;  4N5C A;  4RVB A;  3PS6 A;  4LUN U;  3AG3 E;  4EBA A;  5KNH D;  5C2Y A;  4FLH A;  3HXE A;  1LD8 A;  4QQI A;  2DVW A;  2C0L A;  2BUG A;  3HRA A;  5D0Q D;  5BV0 A;  3P2B A;  4BSZ B;  1Y8M A;  3LVR E;  1EDU A;  2P9U G;  5A23 A;  4HS2 A;  5AYW D;  3FP3 A;  2ZIR A;  4HBD A;  2R59 A;  2KCK A;  4EZJ A;  4HLL A;  4RG6 A;  5T3R A;  2FO1 E;  2ETC A;  4GZ6 A;  4JL0 A;  2J4D A;  2GRR B;  4A55 A;  2IOL A;  3E37 A;  4DK5 A;  4LSZ E;  1WDY A;  1ELW A;  1E8X A;  4WNF A;  3ZHE B;  4FU3 A;  3Q73 A;  4OAU C;  4CDN A;  3TAX A;  5AAR A;  4WWP A;  4APF A;  3MJW A;  4BTA A;  1IKN D;  2ZU6 B;  3D9K A;  5G05 C;  2J09 A;  4I1O B;  2LSU A;  2WMN A;  1NFI E;  2IF4 A;  3UM0 A;  2YHE A;  4F3V A;  3FTY A;  1MYO A;  3G2T A;  5CEC B;  4FAD A;  1PC2 A;  4PS7 A;  3DXM G;  4JHK A;  1JUQ A;  4RG9 A;  1LTX A;  2YIN A;  3KSL A;  5EKQ D;  4GTV A;  3PRE A;  5CBN A;  5EX3 A;  3QNK A;  4Q69 A;  4G25 A;  4YDW A;  3GW4 A;  1PY1 A;  5ENT D;  4N39 A;  4WUY A;  3OXG A;  2FUL A;  3ML9 A;  4YDO A;  3C3R A;  3GYZ A;  2DYR E;  3CIA A;  3CVY A;  3FH5 A;  3EIJ A;  1MJ0 A;  4XKB A;  3E33 A;  1MHQ A;  4NAC A;  4IUL A;  4ME2 A;  5CRV A;  2EIN E;  4TXP A;  1OWL A;  4F53 A;  4LNU D;  3ASO E;  1BPO A;  1A17 A;  2XGS A;  3AS4 A;  3T9K A;  4G26 A;  1OT8 A;  4GYY A;  1ELK A;  3DPY A;  4I1M A;  5T4Y A;  4ABN A;  3LY9 A;  4KVO A;  1K1A A;  5CED B;  4UWF A;  4HNA D;  4C0E A;  3MX3 A;  3Q49 B;  1H2T C;  3CHO A;  4BFR A;  3ULE G;  4J7W A;  2KCL A;  3NBN B;  1UJK A;  5HRY A;  2BKG A;  4JW1 A;  4UQY A;  5D2M C;  3FU3 A;  5CRU A;  5CMY A;  2CHW A;  2DIW A;  2AJA A;  3FUD A;  4FA6 A;  4YDE A;  4U8H A;  3FU6 A;  1YCS B;  4XX5 A;  1EPU A;  1SZA A;  4L2L A;  3HVE B;  4A63 B;  3L9T A;  2X38 A;  3SO8 A;  4C0M A;  2XS8 A;  3FH8 A;  3O4Z A;  5G55 A;  5ENQ D;  3FTZ A;  4HB5 A;  4DPR A;  3ZW3 A;  1OCO E;  1XNF A;  1VDY A;  2XRZ A;  3D9I A;  1S64 A;  3ONK A;  2PQN A;  4IYP A;  5D66 A;  3T5V A;  3ASD A;  3LDZ A;  4EQF A;  4GTO A;  1K3Z D;  2XEV A;  2ZIS A;  3E32 A;  1E8Z A;  3CHS A;  2C2L A;  4N2Q A;  2YQ8 A;  3SD5 A;  3T8M A;  4F1S A;  3NZS A;  3TWS A;  4F7A A;  2L6B A;  4UWK A;  4OAV B;  2VYI A;  4XKC A;  1Z6T A;  3FY4 A;  3HXC A;  4FLB A;  1N0Q A;  3TWW A;  2JLB A;  4DLQ A;  4GPK A;  5BXO A;  3LY7 A;  3ZRH A;  3D9P A;  3CR3 A;  2BTD A;  3LYA A;  4J8E A;  3APC A;  5ITZ F;  5J08 A;  4LNG A;  5FWQ A;  2KBX A;  2OEW A;  3W9F A;  3FFL A;  1DC2 A;  1KPS B;  2H6I A;  2V5Q C;  2XZD G;  4MLP A;  2VSN A;  3QAQ A;  5BNW A;  2WXO A;  2CHX A;  1IQR A;  2X3M A;  2FI7 A;  2KAT A;  1FCH A;  2CG2 A;  4Y6W A;  4TXQ A;  2WPV A;  3FUH A;  1Z3Y A;  3FUN A;  1HE8 A;  4WND A;  2VGX A;  1DCQ A;  1Q2Z A;  3EU5 A;  2ETB A;  3CVP A;  2Y4U A;  2J8S D;  2WM9 A;  1DVP A;  1BI7 B;  3UXG A;  3QB2 A;  1JCS A;  1WG0 A;  4AY5 A;  5AQB A;  2GGF A;  3F6Q A;  3RJV A;  1E96 B;  4CEM A;  5BT1 A;  2X6F A;  4U0S A;  2LXM A;  3ZYM A;  3Q15 A;  2UWJ G;  5KNG A;  3FUK A;  2BKK B;  2QYU A;  4O60 A;  3W9G A;  4F6R D;  4BY6 A;  4C9B B;  3QOU A;  3LVQ E;  2B6C A;  4E85 A;  4GMJ A;  5AJD A;  3FTU A;  3L82 A;  3ZYQ A;  4C48 B;  4J6I A;  4K03 A;  5AJL A;  1O1R A;  3ZUV B;  3RAU A;  5ANR A;  3PE4 A;  3UPV A;  2QFC A;  3C98 A;  2L0T B;  3CVX A;  1H0A A;  3FU0 A;  2F37 A;  3PUJ A;  4HQD A;  3CQG B;  4DI3 A;  4XI9 A;  3D9O A;  2PL2 A;  2RFM A;  5KWD A;  1E7V A;  2AXU A;  3JXJ A;  5FJY A;  4I9C A;  1JCR A;  4FP7 A;  1S63 A;  3I4G A;  3Q9N C;  2L0I A;  3VLE A;  1E8Y A;  1TN7 A;  3IV0 A;  1TYQ G;  1K8K G;  1D8E A;  5CMW A;  3LJN A;  3PZD A;  5CBO A;  3E34 A;  1NP7 A;  3NZU A;  2YNQ A;  4MS6 A;  4BTB A;  1TEZ A;  2KZT B;  4B89 A;  5EYL A;  5LOZ A;  1BLX B;  3CLJ A;  1SQM A;  3JXI A;  5ANL A;  4AY6 A;  3PNL B;  3DST A;  3TWQ A;  4PS8 A;  4I2Z A;  2QY7 A;  3NOG D;  4CRW A;  1OCC E;  5JJ6 A;  4LNB A;  4F1P A;  3FEY A;  4FJZ A;  1HG5 A;  4ILI A;  1E90 A;  3CEQ A;  3PDN A;  4KYO B;  2CFU A;  2KM4 A;  4RLY A;  3R9A B;  1RW2 A;  2OVF A;  3LS8 A;  3HXB A;  5ENP D;  4OYS A;  3DSS A;  2X6J A;  5KCM A;  1O5M A;  1UOH A;  4CT0 A;  4BSX A;  3NOC D;  2XEH A;  3NAW A;  3PEV B;  3D3M A;  2JAB A;  2XPY A;  3B7B A;  3D9J A;  2FEZ A;  1XGW A;  2XPZ A;  3DSV A;  2IFU A;  1HF8 A;  4L1B A;  4J8F A;  3ZPJ A;  3MGB A;  4E6H A;  1OCZ E;  2PNN A;  1KZP A;  2Y4T A;  5G2N A;  4GYW A;  3PZ4 A;  4JA9 A;  1HFA A;  3C72 A;  2XQ0 A;  1H2V C;  3SHF A;  1UJJ A;  3I5P A;  1TJF A;  1TNU A;  4K5A B;  3HXF A;  5FIN A;  3TXM A;  4GPM A;  3IHV A;  2P9I G;  2IQC A;  4GYO A;  2VTB B;  2KXP C;  1WY6 A;  3TGO A;  3FUL A;  1HX8 A;  4W9R A;  4I9E A;  2C0M A;  2P9L G;  1TNZ A;  5G05 J;  5ARF A;  2P9K G;  5KJL A;  2R05 A;  2LO6 A;  1WM5 A;  4XIF A;  4NQ0 A;  4B94 A;  1IHB A;  3JUI A;  2HYZ A;  2WXP A;  5M72 A;  2LAI A;  3G2S A;  4HVB A;  2PM7 A;  2EIL E;  2WXQ A;  2JEK A;  4A3V A;  2WMO A;  3UX4 A;  5JA4 D;  1U3C A;  3AU4 A;  1NA0 A;  3DEO A;  3DSX A;  2GRN B;  3L22 A;  1SZ9 A;  3B7R L;  2DWZ A;  2NC9 A;  4EHM A;  3HXD A;  3ZKJ A;  4CDM A;  3L16 A;  4PDX A;  2BED A;  4RQI A;  4EEC A;  4G1T A;  4UI9 C;  3BUA A;  1NZN A;  2XGO A;  3SI5 A;  5FT9 A;  2NYJ A;  3L13 A;  4UUC A;  2WXF A;  3TL5 A;  4DRX E;  4J8D A;  4DUI A;  3Q47 B;  1V54 E;  3I4R B;  2EIJ E;  3S7F A;  3GZ1 A;  1G3N B;  5AN8 A;  2V0P A;  3OAW A;  1SVX A;  4HOT A;  3C5R A;  3ESK A;  4JC8 A;  1JPL A;  3EHQ A;  3QC1 A;  4GML A;  5KBA A;  2FF4 A;  4JEH A;  2WXM A;  3TXN A;  5CCL A;  2DBA A;  2IU1 A;  2MRI A;  3RKV A;  5KJN A;  2X6K A;  2V8S E;  3UIN C;  3MYV A;  1MZC A;  3VTX A;  3IBE A;  1QBQ A;  3ONL A;  4A3T A;  4G8L A;  3TWR A;  2NSZ A;  3PH0 C;  2VQ2 A;  3LY8 A;  1N0R A;  3D9M A;  5CCM A;  2AW6 A;  4M3O A;  4XI0 A;  2UY1 B;  2V4L A;  5FIO A;  1ZBP A;  3VLF A;  2XS1 A;  3IXE A;  3Q5M A;  3QWP A;  3QDN A;  5A6C A;  4HOQ A;  4ANX A;  4U8V D;  3CK7 A;  5T8I A;  4U0Z A;  3CVN A;  4GA0 A;  3OXL A;  4BET A;  2H6H A;  3S7J A;  5ENO D;  3FUF A;  1PAQ A;  3C3Q A;  4XEI G;  1UW4 B;  1DCE A;  3ZXS A;  4CCA A;  3ZYL A;  5KJM A;  3BG0 B;  3QAR A;  2XEN A;  4UQX A;  4BWR A;  2CFZ A;  2IOS A;  1IQU A;  1OWP A;  3CST A;  2HO1 A;  4NIK A;  3IEG A;  3UM1 A;  2I2O A;  3QJZ A;  2V5F A;  1N94 A;  3APD A;  3RO3 A;  3TWV A;  2P9N G;  1AP7 A;  2VGX B;  4H7X A;  4DX7 D;  1KT1 A;  2XGM A;  5E76 A;  3ZN3 A;  3BG1 B;  2VJ8 A;  4V3I A;  4I6J A;  3CKB A;  1N4P A;  1N4R A;  4HI8 A;  4KT6 B;  3N71 A;  1FVH A;  1N9A A;  3L17 A;  2A5U A;  4I6G A;  4DX6 D;  1BU9 A;  1QQE A;  3UKR G;  2LNI A;  3CHP A;  3RRN B;  4KVM A;  1A5E A;  3ASN E;  3ULQ A;  5ENS D;  1K1B A;  3Q79 A;  1TN8 A;  3MA5 A;  2IO3 C;  2XRY A;  3ABK E;  4Y6C A;  3SGH A;  4BX8 A;  3ABL E;  3ZXP A;  2P2C P;  5JJ7 A;  3NQP A;  3S7B A;  2I1K A;  5BW8 C;  4RSY A;  2OOE A;  1Z3X A;  3CHM A;  2DYS E;  4URK A;  1TN6 A;  3JUE A;  1QZ2 A;  5IY5 E;  4L2Y A;  2H6G A;  2MHK A;  1UN9 A;  2FBN A;  3KSQ A;  2WQ7 A;  3GZ2 A;  5FQ8 A;  4ILH B;  3FDH A;  2V4H C;  1IYG A;  2BF0 X;  2H6F A;  4G23 A;  3Q4A B;  2A5E A;  1V55 E;  1JCQ A;  5ENN A;  5BXU A;  1FT2 A;  5AQA A;  4FHJ A;  1BD8 A;  4HRM B;  3MKQ A;  4UI9 K;  4P29 A;  3SFZ A;  3UM2 A;  3EUV A;  4AV7 A;  1TR4 A;  2OCC E;  3UUX A;  2WXI A;  1HO8 A;  4GA1 A;  4Z68 A;  5EID A;  2R17 C;  3PVL A;  5LCW C;  2HM8 A;  3S2A A;  2B0O E;  4ANU A;  1H19 A;  3CK8 A;  4R7L A;  4N5Q A;  3NB2 A;  3EJN A;  2IO2 C;  3AS8 A;  3SNX A;  4U04 A;  4NRH B;  1OY3 D;  2LUH A;  2XCB A;  4ANV A;  5EIB E;  3B13 A;  5D0O D;  4BES A;  3L6A A;  2J49 A;  3CVV A;  3V31 A;  4PH4 B;  4ATZ D;  3FUJ A;  3R9M A;  3CHR A;  4HOU A;  3EHM A;  4I2W A;  2E0I A;  3RU0 A;  5FQ6 A;  1W3B A;  2XPI A;  2DCP A;  4G24 A; 
#chains in the Genus database with same CATH homology
 3TWS A;  2L6B A;  5ENP D;  1AWC B;  3T9K A;  4OAV B;  3EHQ A;  4QFV A;  1MX6 A;  1OT8 A;  4J8Y A;  4C48 B;  5KBA A;  1S70 B;  1UOH A;  1IHB A;  1WDY A;  4JB8 P;  4LSZ E;  2MYO A;  5HKP A;  4HI8 A;  3ZUV B;  2A5E A;  4U96 D;  1N0Q A;  1MX4 A;  3NOC D;  4O1P A;  3TWW A;  5JMN D;  2XEH A;  5BXU A;  5AQA A;  1YYH A;  3J5Q B;  2JAB A;  2F37 A;  5HS0 A;  2XEE A;  1BD8 A;  1K1A A;  4HRM B;  5AAO A;  5BXO A;  4OAU C;  2QYJ A;  4HQD A;  5AAR A;  5CED B;  3B7B A;  4HNA D;  4DX6 D;  3V79 K;  1TR4 A;  1BI8 B;  1N11 A;  3D9H A;  1BU9 A;  4U95 D;  4CYM D;  3ZNG A;  1IKN D;  3Q9U C;  4ZHB A;  5JA4 D;  4G8L A;  2DZO A;  5ITZ F;  3TWR A;  4J7W A;  3DEO A;  3EHR A;  1SW6 A;  1NFI E;  3NBN B;  2Y1L E;  4CZ2 D;  2RFM A;  5HRY A;  1A5E A;  5AQ7 A;  2KBX A;  1N0R A;  5EYP F;  4Z68 A;  2XZT G;  3AJI A;  4K5C A;  5EID A;  2PNN A;  3UI2 A;  3W9F A;  2BKG A;  5ENS D;  1DC2 A;  2DWZ A;  1K1B A;  1MYO A;  3JXJ A;  3HG0 D;  5CEC B;  2B0O E;  1IXV A;  3J5P A;  5FIO A;  3ZKJ A;  4GMR A;  4TUM A;  2V5Q C;  2XZD G;  2AJA A;  4N5Q A;  5KWD A;  3Q9N C;  4ZFH A;  3TWT A;  3IXE A;  3V2X A;  2DZN A;  5EIL A;  3DEP A;  2VGE A;  4K5A B;  1YCS B;  3ZU7 B;  3LJN A;  4A63 B;  4U8V D;  5KNH D;  3V2O A;  3SO8 A;  4DX1 A;  5CBO A;  5CBN A;  4G8K A;  5EN5 D;  5FIN A;  1OY3 D;  5CER B;  2P2C P;  4GPM A;  4YDW A;  5EIB E;  4QQI A;  4HI9 A;  2DVW A;  5ENT D;  3HRA A;  4HRL A;  3AAA C;  1DCQ A;  1YMP A;  5ENQ D;  3EU9 A;  3UTM A;  4BES A;  2ETB A;  4HB5 A;  4BET A;  5CEA A;  4K5B A;  4O1O A;  3TWU A;  5ENO D;  2ZGG A;  4BSZ B;  3TWX A;  2J8S D;  2NYJ A;  5EYL A;  3B95 A;  4UUC A;  1BI7 B;  4YDY A;  3V31 A;  2F8X K;  1BLX B;  2KXP C;  3UXG A;  2Y0B G;  5AQ9 A;  2F8Y A;  4B93 B;  4DRX E;  4ATZ D;  2RFA A;  4U8Y D;  1WG0 A;  4LG6 A;  4HRN A;  1QYM A;  3JUE A;  5AQB A;  4DUI A;  4DX5 D;  4HBD A;  4BEP A;  2QC9 A;  3F6Q A;  3JXI A;  4RLY A;  2XEN A;  1MJ0 A;  5D66 A;  3TWQ A;  2HE0 A;  3V30 A;  3T8K A;  4HLL A;  4NIK A;  1MX2 A;  2FO1 E;  1D9S A;  3NOG D;  1K3Z D;  4F1P A;  4DX7 D;  2ETC A;  5KNG A;  1G3N B;  4BER A;  2BKK B;  5AN8 A;  5ENR D;  1SVX A;  4DX2 A;  4O60 A;  3TWV A;  3W9G A;  2ZGD A;  4F6R D;  3KEA A;  4LNU D;  1AP7 A;  3C5R A;  2V4H C;  2ETA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...