1K1BA

Crystal structure of the ankyrin repeat domain of bcl-3: a unique member of the ikappab protein family
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
228
structure length
228
Chain Sequence
EDGDTPLHIAVVQGNLPAVHRLVNLFQQGGRELDIYNNLRQTPLHLAVITTLPSVVRLLVTAGASPMALDRHGQTAAHLACEHRSPTCLRALLDSAAPGTLDLEARNYDGLTALHVAVNTECQETVQLLLERGADIDAVDIKSGRSPLIHAVENNSLSMVQLLLQHGANVNAQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVIDILRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords B-cell lymphoma 3-encoded protein
publication title Crystal structure of the ankyrin repeat domain of Bcl-3: a unique member of the IkappaB protein family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 75
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2001-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1k1bA00
3EHQA 5ITZF 3W9FA 3EHRA 3C5RA 4HRNA 1TR4A 2BKGA 4QQIA 2ETCA 5HRYA 5KBAA 3B95A 5KNHD 4HB5A 1MJ0A 4B93B 2MYOA 3TWVA 2XENA 4DRXE 5HKPA 5ENQD 3J5QB 3KEAA 3D9HA 1OY3D 1UOHA 4HNAD 4G8KA 3ZU7B 3AAAC 3JXJA 4JB8P 5FINA 1MX4A 2QC9A 4HBDA 4QFVA 2V5QC 4BEPA 2ZGGA 5EN5D 3TWRA 1N11A 5ENTD 4CYMD 2L6BA 3UXGA 4TUMA 4U8YD 3B7BA 1YCSB 5CECB 5CBOA 3V79K 4BSZB 4HQDA 4BERA 5CEAA 5ENOD 5ENSD 5AAOA 5EIBE 4K5BA 4HLLA 4CZ2D 5AQ7A 2Y1LE 4YDWA 2B0OE 4BETA 2F37A 5FIOA 3TWTA 4RLYA 4ATZD 4OAVB 4N5QA 4U8VD 3V30A 2NYJA 4GPMA 4BESA 2XZTG 3J5PA 1WG0A 3W9GA 4GMRA 4A63B 1BU9A 1K1BA 1OT8A 2BKKB 4F1PA 1BI8B 3F6QA 5ENRD 5JA4D 3UTMA 4K5AB 2RFAA 2PNNA 1N0QA 3IXEA 3SO8A 1YMPA 4O60A 3DEOA 4U95D 3TWSA 2KBXA 5BXUA 4F6RD 3ZUVB 1SVXA 3TWWA 3NBNB 5KWDA 2Y0BG 1AWCB 1DC2A 4C48B 5CBNA 3V2XA 2HE0A 1YYHA 1BD8A 3AJIA 4DX2A 5CEDB 1SW6A 3V31A 3TWUA 1QYMA 2ZGDA 2JABA 4K5CA 1N0RA 1BLXB 2VGEA 3TWXA 5CERB 1K3ZD 2QYJA 3T9KA 4NIKA 2RFMA 3NOGD 3UI2A 5AARA 3EU9A 1S70B 1WDYA 4J8YA 4U96D 4J7WA 1G3NB 2DWZA 1MX6A 5BXOA 5EIDA 2ETAA 1MYOA 5EILA 4DX1A 3JXIA 2AJAA 4HRMB 4ZHBA 4HRLA 1IXVA 4Z68A 4HI8A 2P2CP 1IKND 5HS0A 3Q9NC 2DZNA 5EYLA 5AN8A 4HI9A 5AQAA 1DCQA 4G8LA 2DZOA 3ZKJA 2DVWA 3DEPA 4OAUC 5EYPF 5ENPD 3LJNA 2J8SD 4DX5D 1AP7A 4YDYA 3HG0D 2F8YA 1K1AA 1BI7B 4LSZE 5AQBA 4O1PA 4ZFHA 2F8XK 5JMND 1A5EA 3NOCD 2ETBA 1MX2A 2KXPC 5KNGA 3T8KA 2XEEA 4DX7D 3V2OA 4LG6A 1D9SA 4UUCA 3ZNGA 2XEHA 5D66A 4DUIA 1NFIE 4LNUD 2A5EA 2XZDG 5AQ9A 3JUEA 3TWQA 2FO1E 3Q9UC 1IHBA 3HRAA 2V4HC 4DX6D 4O1OA
chains in the Genus database with same CATH superfamily
5ITZF 2XRYA 3C98A 3PZDA 3ZW3A 2V0PA 4FLHA 4MBGA 4CEMA 4AM9A 2ZIRA 5FINA 2QC9A 5BW8C 1D8DA 4GA1A 2IF4A 3C72A 2VJ8A 3B7BA 2P9UG 1TEZA 4BSZB 4N5CA 3UIPC 2B0OE 4BETA 3TWTA 1H6KA 4RLYA 2XZTG 1NZNA 3BUAA 4FP7A 1LTXA 3L6AA 1NP7A 4AY6A 2WXOA 1ELKA 5C1DA 2WMNA 4G23A 2RKKA 2WXQA 1B89A 2UWJG 4Q96A 4GTQA 3RKVA 3LXUX 3T9KA 1VDYA 2J4DA 3UI2A 3D9NA 2GRNB 1WDYA 3Q5MA 1KT1A 2J07A 3TXNA 2DWZA 2JLBA 3G2SA 3S7DA 3N71A 4B0ZA 3UQ3A 3CK8A 3APFA 3VLEA 4I1OB 5CMYA 3Q4AB 1A17A 4A55A 2R59A 2GW1A 2XZDG 3UIOC 4N2QA 2V8SE 4AXHA 5LX8A 2DYSE 4ATGA 4GYYA 3O4ZA 4B8CB 1MX4A 3SBTB 4GTMA 4L2YA 4GZ3A 1YCSB 2X6HA 2FULA 3LYAA 4G11A 1N4PA 1FT2A 3FULA 5JHAA 3HXCA 3NZSA 3K9IA 1IQUA 3UKUG 4H7YA 3UT4A 2X3MA 1BU9A 4JEHA 3JUIA 5A6CA 3OXGA 2MRIA 2YINA 1YMPA 3DEOA 3LPZA 4HS2A 3SFZA 2JEKA 3KSLA 2WXMA 4BY6A 3EUVA 4Y6WA 1SW6A 2X6JA 3AG3E 3TWXA 1K3ZD 2RFMA 1HH8A 3FWVA 3D9MA 4W9RA 5EIDA 2OEVA 4L23A 1MYOA 2VSXE 3CVQA 4DJAA 3MV3B 2VSOE 3DSVA 4I1MA 4AIFA 1OWMA 4YDEA 4DI4A 4HI9A 2XPZA 4G26A 1EDUA 2IOLA 3ISMC 3ML8A 2J8SD 4RSYA 3FU0A 4NQ0A 5AJDA 3CK9A 3BQOA 3AG2E 3FU5A 5C2YA 5AQ9A 4DX6D 4LCTA 3CK7A 1OXJA 2LAIA 1E7UA 3U4TA 4HB5A 4B93B 1FVHA 5BPPA 4G8KA 3PZ2A 2GRRB 4KYOB 4GU5A 4J8EA 2CFUA 3PEUB 2R02A 3V79K 1N94A 4Q69A 4BFRA 2XS1A 1HX8A 3S7FA 2YHCA 3V30A 4A63B 1H2UA 2CG2A 2WXIA 5IY5E 3LJ3A 3IXEA 4JA7A 4PS8A 1H0AA 3Q73A 3TWWA 1SQMA 5G04C 3CKBA 4U04A 2MOWA 4I9CA 2H6GA 3I4RB 2EINE 2KZTB 3V31A 1XGWA 4FLBA 4HXIA 1QQEA 2HYZA 4Y6CA 4HOUA 3CIAA 2X6FA 2DIWA 5CRUA 3L54A 3QWWA 4JVSA 3NAWA 2NSZA 4L2LA 3FU3A 2AJAA 4RG9A 1ZBPA 4F53A 4ACKA 4U07A 4FJZA 2DVWA 3DEPA 3UMVA 5FZQA 3X2QE 3QOUA 5AQBA 1TNZA 5JMND 2ETBA 3ZYMA 2XEHA 2IU1A 1IHBA 2R2LA 1H6PA 3Q15A 4TUUA 1TYQG 3U9WA 1OCZE 5KCMA 2YQ8A 4XX5A 1JCQA 2A5UA 1N11A 2VSYA 2WVIA 2FBNA 3ZHEA 3MX3A 2L0TB 4CDNA 4CT4A 1UW4B 5ENOD 2WXRA 3S7BA 5AAOA 5EIBE 4ILIA 2GRPB 3S7JA 5FIOA 4E6HA 3DPDA 5FQ7A 4UWKA 4MLPA 4G1TA 3UUXA 2RFAA 4JD2G 3ZXPA 2NC9A 5E76A 4BSXA 1K8KG 3JCKC 4F6RD 1SVXA 4AP2A 4LEUA 3CVLA 3VLDA 3ZIMA 4HVBA 3C3OA 2FI7A 2CHWA 4GTRA 4X8QA 3B7UX 3GZSA 3Q47B 1HF8A 5J90A 3NOGD 2IY0C 4J8DA 3ESKA 4J8YA 4EHMA 1SA5A 3QARA 3LY7A 4LERA 3LDZA 4KZCA 4WWPA 3UPVA 5EDSA 1TJFA 4M3OA 5AQAA 3SBSA 3L22A 3FP3A 1U3CA 2FO7A 3ENEA 4J8SA 3KD7A 5BV1A 1E90A 4RVBA 1X81A 2A5EA 3JQ1A 2H6HA 4J8FA 3BEEA 4FHKA 2LSUA 3ZFWA 5M72A 1L5JA 3B7SA 2WXGA 2NXPA 4APOA 3MEKA 3ASDA 4HBDA 3I4GA 2ZGGA 4PH4B 4H7XA 4BERA 2VGXA 1MZCA 3HXEA 3UM1A 3CHOA 4ATZD 4N5QA 5D0QD 3W9GA 2PL2A 1FCHA 3IEGA 4GTSA 3CVPA 4K5AB 4LRZA 2RG8A 3ASGA 3D9LA 4KMOA 4MRUA 3FUNA 3CHPA 1DC2A 3GW4A 4RQIA 2HE0A 1H2TC 2Y3AA 4EPZA 5FZRA 3IV0A 2OV8A 3FUHA 1N4QA 2J9QA 5AARA 4U7EB 2WXJA 2ETAA 1E7VA 3JXIA 3D9OA 3B7RL 1O5MA 3PRZA 2AWIA 4HLEA 4WWOA 3AU5A 3DSXA 3IHVA 2DBAA 3UX4A 5G05J 5KJKA 4JW1A 5KJNA 4O1PA 3URZA 5EX3A 1IHGA 3ONKA 4CRWA 3CQGB 2XPYA 3HRAA 2R03A 5CMWA 1NA3A 1TR4A 5A7DB 3IBEA 4JHKA 4N3AA 5HKPA 3ZYKA 1JCSA 2AVPA 1E8WA 2PQRA 2V5QC 1RZ4A 2QZAA 5CCMA 3JYSA 5FJYA 1E96B 4HLLA 1JUQA 2VQ2A 3QAQA 2NYJA 4JPSA 4KVOA 3Q79A 4GZ6A 3UTMA 4GZCA 1UN9A 3SO8A 3FTSA 4L7TA 2I6HA 4WNFA 1N52A 1PC2A 4GYOA 4U95D 3MYVA 2Y0BG 3IHYA 5AJLA 1E8YA 1NI1A 3L17A 2JABA 3FFLA 1N0RA 3VLFA 3UKRG 2VGXB 2VTBA 4NIKA 4I17A 3TJPA 2OVFA 2C0LA 1MX6A 2BUGA 5AENA 3CVNA 4GYWA 2PM7A 5CRVA 4U0UA 2P2CP 5AN8A 3EHNA 4AY5A 3ASNE 4ANVA 3HG0D 2B6CA 1EPUA 2F8XK 1A5EA 1UN8A 4YVOA 1N4SA 3V2OA 3ZNGA 3DSWA 4UWFA 3FUKA 3PDNA 3PUJA 3QC1A 3W9FA 5B3SE 4ANUA 2BKGA 4FULA 4QQIA 2ETCA 4PUCA 3B95A 4C0EA 4ABNA 5ENQD 3J5QB 4N2SA 4BT8A 4EZLA 2XCCA 4BEPA 2CFZA 5CECB 3DXMG 4GPKA 4CZ2D 1U2VG 3ASHA 2GROB 1ZU2A 3DSSA 2WXHA 3ASOE 4EQFA 4GMLA 4I6EA 4BX9A 1N9AA 2KZTA 1HS6A 2FF4A 2KBXA 3ABLE 3TWSA 2WQ7A 1AWCB 2X6IA 3D9PA 1YYHA 4I43A 4N39A 2GRQB 1BPOA 3ZRHA 2AW6A 1LF8A 1DNPA 4N3CA 4FU3A 3TGOA 3Q7FA 4J7WA 1HU3A 1N4RA 3R7RA 5BXOA 1KT0A 5LCWC 3L16A 2KCVA 1D8EA 2HM8A 1IXVA 4HI8A 3KS2A 1X5BA 2BF0X 4HORA 5EYPF 2F8YA 1EF1C 1K1AA 5J08A 3G2VA 4PS7A 3NOCD 2WMOA 4LUNU 4LNUD 3NF1A 1MQSA 2IQCA 3AG4E 3EHQA 2VTBB 2XHEA 5DIZA 2PM6A 2IOSA 4RG6A 4PDXA 1ELWA 3ZN3A 4R7LA 2L9BA 1S63A 1OWNA 5B1AE 3FUDA 2V5FA 1MHQA 1TJCA 3FUFA 3TWRA 2C2LA 4DPRA 4FADA 3ABME 2A4ZA 3FH8A 4K5BA 1OCOE 3ZGQA 3CEQA 3CVVA 3CVUA 4M7CA 3F6QA 4CGVA 2WXPA 3SNXA 4GMJA 2R17C 2ZGDA 4JHRA 2PZIA 1BLXB 2VGEA 3PS6A 3AS4A 2P9PG 1OCRE 4IULA 3QNKA 2EQXA 1O1SA 5LCWJ 1TNYA 4K0RA 1AP7A 3Q49B 3FEYA 5FT9A 1MX2A 1KLXA 3KEZA 3Q9UC 4KVMA 4O1OA 4DI3A 2H6FA 4HRNA 2CHXA 5KBAA 5LP0A 3PE4A 3FH7A 3ULEG 2EIJE 3D9KA 1V54E 1OY3D 1UOHA 3AAAC 3JXJA 3HDXA 3CGHA 3CVXA 3LS8A 5EN5D 3LVRE 4GTPA 4NACA 4A1SA 4PS3A 4GZDA 4IRUA 4GB9A 1OT8A 3Q7AA 3BG1B 1BI8B 4GTVA 3ZEFA 1S0PA 2QY7A 5FZSA 2PNNA 1N0QA 3RSEG 4WWNA 3FTYA 3HVEA 5G55A 1JPLA 5HQ8A 4UWHA 2KCLA 3RAUA 3IKOB 3CSTA 3AJIA 4HFGA 5CEDB 3EHMA 3LKUA 3OXFA 4JEUA 2CG3A 4EZJA 4XEIG 2CHZA 4IN3B 2LO6A 2QYJA 4ME2A 4GCOA 4I2ZA 2IONA 4HRMB 3LEWA 4AEZC 3WG7E 4G8LA 3TG5A 1Y8MA 4EBAG 4AJWA 3B7TA 1HFAA 2QFCA 2EIME 2HR2A 5BUZA 3DPYA 1Z3YA 3GYZA 1NFIE 5FQ6A 2FO1E 1YA0A 1JWGA 5HS0A 3VTXA 5ARGA 2QYUA 3CQCB 5HRYA 2L0IA 2EILE 4IYPA 1MJ0A 3TWVA 1OWLA 4UWLA 2Y4TA 5G05C 2VGYA 3U3WA 3MCXA 4JB8P 1ELRA 4GA2A 2E0IA 5ENTD 3RO3A 3APCA 5BV0A 4HQDA 5JHBA 3U66A 3SGHA 5AQ7A 2Y1LE 3L9TA 4UWGA 2KC7A 4GPMA 3EIQC 3EU5A 3TAXA 5ENRD 4I6JA 4XE0A 3E32A 1DCEA 4EBAA 4P29A 5CCLA 3VTYA 4YDOA 3UT7A 2WPVA 3SF4A 5T4YA 3UINC 1RW2A 3HXBA 2LSVA 3RK6A 4LNBA 4FJYA 1PAQA 1OCCE 1WAO1 1TN7A 3MKQA 1TN6A 2LXMA 4I6GA 2IJGX 3SQVA 3CHSA 4C9BB 1NA0A 2MHKA 3GZ1A 5EYLA 2OOEA 2ZISA 3FEXA 3RJVA 3QB2A 4UQYA 3L08A 3L13A 3HVEB 3ESLA 5B1BE 3QDNA 3HXFA 2AXUA 4F1SA 2WXLA 5KNGA 3T8KA 1D9SA 3PVLA 5KJLA 2C0MA 1TNUA 3C5RA 3NZUA 1U3DA 2BEDA 4AOFA 4WAFA 2MYOA 4I2WA 3AU4A 3R9MA 3D9HA 4QFVA 2OEWA 4TRQA 3FTZA 2WXNA 5ANRA 2L6BA 3UXGA 4TUMA 1DVPA 5CBOA 3DXKG 3CHMA 2AXVA 4BX8A 3CVWA 1FT1A 1WG0A 5JJ6A 4YNDA 2AXZA 4L9PA 1W3BA 4KT6B 2EIKE 3RU0A 2HO1A 3LVQE 3E33A 4ILGA 3DBSA 4CT0A 1V55E 5E75A 4I1AA 3I5PA 3ZPJA 3FTVA 3NBNB 1H19A 1O1TA 2XGSA 5CBNA 4UI9C 1BD8A 3UT8A 2GRMA 5CERB 5AYWD 5FWQA 1ZB1A 1PY1A 1WY6A 4I9EA 1G3NB 2I2OA 3E34A 4JA9A 1E8ZA 2KATA 1SZ9A 4Z68A 1IKND 5FQ4A 2LUHA 5D2MC 3EIJA 4OAUC 4XKBA 2I1KA 1HG2A 3CSFA 4MKTA 2XRZA 4MS6A 1UJJA 3FU6A 3AS5A 3ONLA 3T5XA 3JUEA 2WQHA 4CDMA 3FTXA 5ENPD 3MKQB 3RRMB 2XPIA 4NURA 4A1GA 4E85A 4DRXE 2E2EA 2UY1A 4J6IA 1FVFA 2ILRA 3G2WA 3SD5A 4U8YD 4ANXA 4V3IA 3FY4A 5AIJA 4BTAA 5LOZA 1EYHA 2I9CA 2XCBA 2F37A 4U0SA 3FUJA 4KBQA 4CDRA 5A23A 3OXLA 4WNGA 4EZKA 4U8HA 1IYGA 4G24A 3PZ3A 2ZU6B 3QKYA 5JJTA 3PE3A 3MKRA 3FDHA 5KWDA 4C48B 2WXKA 1HZ4A 4DX2A 4XI0A 1QYMA 4UI9J 5T3RA 3ZYLA 4FC8A 3PEVB 1Z6TA 1S70B 3G2UA 3DRAA 1IQRA 4ZHBA 3CLJA 1SZAA 3FUEA 3LCAA 4KZ0A 4CGWA 3B13A 3TL5A 2WM9A 2WXFA 3PH0C 4YDYA 1BI7B 4BTBA 4KXKB 1XNFA 2L6JA 1SA4A 4G25A 2J09A 3KAEA 3KSQA 2OCCE 3R7QA 2LAHA 4DUIA 3I3NA 4GTTA 3TWQA 3AS8A 3PREA 2V4HC 1KPSB 5BT1A 2IO3C 4ANWA 5KJMA 3CKCA 1KZPA 2I1JA 3PZ4A 4HNAD 4WNEA 4GAAA 4ACLA 2GRLA 3JQ0A 4FA6A 3FHEA 1KZOA 2DYRE 3PNTB 4ILHB 3CVYA 5D0OD 2VSNA 4BESA 3J5PA 5FQ8A 1K1BA 3HIZA 3SHFA 3ML9A 5ARFA 3AG1E 3CHQA 3NB2A 3NQPA 1TNOA 5FTPA 4B8AA 2IEJA 3ABKE 3E37A 2M63A 5BXUA 2IO2C 3ZUVB 2UY1B 1QZ2A 3TWUA 4J0UA 4K5CA 4GTOA 1JWFA 3FH5A 1E8XA 4U96D 2YNQA 1FPPA 3DWLG 5EILA 1LD7A 4A3VA 1UG3A 1QBQA 5G2NA 2DZNA 3ZXSA 2DZOA 3RIBA 3ZYQA 4ZFHA 2XEEA 4LG6A 3PZ1A 2FEZA 2WQ6A 3EHRA 4LNGA 2X38A 5KNHD 4JHJA 1P5QA 2Q7FA 3KEAA 3ZU7B 3L82A 2WB2A 2Y4UA 5CEAA 1O1RA 4JC8A 4O6FA 5CHEE 5ENSD 4B89A 3C3RA 4U8VD 2LNIA 3SFXA 3HYMB 1WM5A 5JA4D 3BU8A 4O60A 3R9AB 2P9SG 4TV3A 3S2AA 4DLQA 1Z5SC 1HXIA 3ZVVA 3D9IA 4F7AA 2X6KA 4G2VA 3CHRA 1H2VC 2F0YA 3O48A 3EU9A 1HE8A 3ULYA 2ZXWE 1HO8A 3HXDA 4DX1A 3APDA 1JCRA 2R5SA 3D3MA 2Y69E 4D10C 3Q9NC 3UM0A 4DX5D 2P9KG 3LJNA 2H6IA 3DSUA 4Q94A 3FTUA 4OYSA 4BWRA 5T8IA 4LSZE 5ANLA 3T5VA 4URKA 1S64A 2GGFA 1Z3XA 3RRNB 1OWOA 4F3VA 5DBKA 3UM2A 1Y6IA 3PUKA 4U63A 2P9NG 3D9JA 1HG5A 2R05A 5ENNA 3FUIA 1UJKA 3EDTB 2KCKA 2XGMA 2P58C 4APFA 4XI9A 2DCPA 5G04J 1H6OA 2YHEA 3MGBA 5EX0A 3CR3A 4AVXA 5JJ7A 3CV0A 3QK0A 3QJZA 4F1PA 3E4BA 2ONDA 3SI5A 3TG4A 2KM4A 3OTNA 4OVUA 1LD8A 3P1UA 3P2BA 4WUYA 3SZ7A 4JZYA 3Q75A 3V2XA 3BG0B 4UI9K 3SY2A 2PQNA 2IFUA 1INZA 2J08A 5EKQD 2BTDA 2J49A 4HRLA 1N54A 3LY9A 4L1BA 4YVQC 3ZKJA 5HI7A 3ULQA 3TXMA 3HHMA 1OUVA 1QNFA 4GCNA 2LXLA 3T8MA 2V4LA 2KXPC 4DX7D 4C0MA 3MJWA 4UQZA 2VYIA 3FUMA 4EECA 3SFYA 4XZ4A 3OAWA 1GW6A 3E30A 2XENA 2XGOA 3MV2B 4A3TA 3U64A 4BT9A 4HOTA 2RD0A 3QWPA 4CYMD 2P9IG 1N95A 3Q78A 4GA0A 4WNDA 4JL0A 3RRUA 4FHJA 4OVVA 4YDWA 2OVBA 4OAVB 4GMRA 2J4BA 5LFAA 1TN8A 2BKKB 3ZHEB 4XKCA 4HOQA 4AV7A 5H7PA 1OWPA 1Q2ZA 3C3QA 3DSTA 3G2TA 4B94A 3FTWA 2XS8A 3QWVA 4DLOA 3LY8A 2XQ0A 3ASFA 4N3BA 4TXPA 3RO2A 3UM3A 3PNLB 4TXRA 4TXQA 3WXXA 4HOSA 2P9LG 4JXTA 3MZLB 4U0ZA 3MA5A 1DCQA 4CCAA 4UQXA 4DK5A 3GZ2A 4GZ5A 4K03A 4XIFA 1TNBA 2XEVA 1NL4A 4UUCA 5D66A 4NRHB 5BNWA 3EJNA
chains in the Genus database with same CATH topology
3EHQA 5ITZF 3W9FA 3EHRA 3C5RA 4HRNA 1TR4A 2BKGA 4QQIA 2ETCA 5HRYA 5KBAA 3B95A 5KNHD 4HB5A 1MJ0A 4B93B 2MYOA 3TWVA 2XENA 4DRXE 5HKPA 5ENQD 3J5QB 3KEAA 3D9HA 1OY3D 1UOHA 4HNAD 4G8KA 3ZU7B 3AAAC 3JXJA 4JB8P 5FINA 1MX4A 2QC9A 4HBDA 4QFVA 2V5QC 4BEPA 2ZGGA 5EN5D 3TWRA 1N11A 5ENTD 4CYMD 2L6BA 3UXGA 4TUMA 4U8YD 3B7BA 1YCSB 5CECB 5CBOA 3V79K 4BSZB 4HQDA 4BERA 5CEAA 5ENOD 5ENSD 5AAOA 5EIBE 4K5BA 4HLLA 4CZ2D 5AQ7A 2Y1LE 4YDWA 2B0OE 4BETA 2F37A 5FIOA 3TWTA 4RLYA 4ATZD 4OAVB 4N5QA 4U8VD 3V30A 2NYJA 4GPMA 4BESA 2XZTG 3J5PA 1WG0A 3W9GA 4GMRA 4A63B 1BU9A 1K1BA 1OT8A 2BKKB 4F1PA 1BI8B 3F6QA 5ENRD 5JA4D 3UTMA 4K5AB 2RFAA 2PNNA 1N0QA 3IXEA 3SO8A 1YMPA 4O60A 3DEOA 4U95D 3TWSA 2KBXA 5BXUA 4F6RD 3ZUVB 1SVXA 3TWWA 3NBNB 5KWDA 2Y0BG 1AWCB 1DC2A 4C48B 5CBNA 3V2XA 2HE0A 1YYHA 1BD8A 3AJIA 4DX2A 5CEDB 1SW6A 3V31A 3TWUA 1QYMA 2ZGDA 2JABA 4K5CA 1N0RA 1BLXB 2VGEA 3TWXA 5CERB 1K3ZD 2QYJA 3T9KA 4NIKA 2RFMA 3NOGD 3UI2A 5AARA 3EU9A 1S70B 1WDYA 4J8YA 4U96D 4J7WA 1G3NB 2DWZA 1MX6A 5BXOA 5EIDA 2ETAA 1MYOA 5EILA 4DX1A 3JXIA 2AJAA 4HRMB 4ZHBA 4HRLA 1IXVA 4Z68A 4HI8A 2P2CP 1IKND 5HS0A 3Q9NC 2DZNA 5EYLA 5AN8A 4HI9A 5AQAA 1DCQA 4G8LA 2DZOA 3ZKJA 2DVWA 3DEPA 4OAUC 5EYPF 5ENPD 3LJNA 2J8SD 4DX5D 1AP7A 4YDYA 3HG0D 2F8YA 1K1AA 1BI7B 4LSZE 5AQBA 4O1PA 4ZFHA 2F8XK 5JMND 1A5EA 3NOCD 2ETBA 1MX2A 2KXPC 5KNGA 3T8KA 2XEEA 4DX7D 3V2OA 4LG6A 1D9SA 4UUCA 3ZNGA 2XEHA 5D66A 4DUIA 1NFIE 4LNUD 2A5EA 2XZDG 5AQ9A 3JUEA 3TWQA 2FO1E 3Q9UC 1IHBA 3HRAA 2V4HC 4DX6D 4O1OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EHQ A;  5ITZ F;  3W9F A;  3EHR A;  3C5R A;  4HRN A;  1TR4 A;  2BKG A;  4QQI A;  2ETC A;  5HRY A;  5KBA A;  3B95 A;  5KNH D;  4HB5 A;  1MJ0 A;  4B93 B;  2MYO A;  3TWV A;  2XEN A;  4DRX E;  5HKP A;  5ENQ D;  3J5Q B;  3KEA A;  3D9H A;  1OY3 D;  1UOH A;  4HNA D;  4G8K A;  3ZU7 B;  3AAA C;  3JXJ A;  4JB8 P;  5FIN A;  1MX4 A;  2QC9 A;  4HBD A;  4QFV A;  2V5Q C;  4BEP A;  2ZGG A;  5EN5 D;  3TWR A;  1N11 A;  5ENT D;  4CYM D;  2L6B A;  3UXG A;  4TUM A;  4U8Y D;  3B7B A;  1YCS B;  5CEC B;  5CBO A;  3V79 K;  4BSZ B;  4HQD A;  4BER A;  5CEA A;  5ENO D;  5ENS D;  5AAO A;  5EIB E;  4K5B A;  4HLL A;  4CZ2 D;  5AQ7 A;  2Y1L E;  4YDW A;  2B0O E;  4BET A;  2F37 A;  5FIO A;  3TWT A;  4RLY A;  4ATZ D;  4OAV B;  4N5Q A;  4U8V D;  3V30 A;  2NYJ A;  4GPM A;  4BES A;  2XZT G;  3J5P A;  1WG0 A;  3W9G A;  4GMR A;  4A63 B;  1BU9 A;  1K1B A;  1OT8 A;  2BKK B;  4F1P A;  1BI8 B;  3F6Q A;  5ENR D;  5JA4 D;  3UTM A;  4K5A B;  2RFA A;  2PNN A;  1N0Q A;  3IXE A;  3SO8 A;  1YMP A;  4O60 A;  3DEO A;  4U95 D;  3TWS A;  2KBX A;  5BXU A;  4F6R D;  3ZUV B;  1SVX A;  3TWW A;  3NBN B;  5KWD A;  2Y0B G;  1AWC B;  1DC2 A;  4C48 B;  5CBN A;  3V2X A;  2HE0 A;  1YYH A;  1BD8 A;  3AJI A;  4DX2 A;  5CED B;  1SW6 A;  3V31 A;  3TWU A;  1QYM A;  2ZGD A;  2JAB A;  4K5C A;  1N0R A;  1BLX B;  2VGE A;  3TWX A;  5CER B;  1K3Z D;  2QYJ A;  3T9K A;  4NIK A;  2RFM A;  3NOG D;  3UI2 A;  5AAR A;  3EU9 A;  1S70 B;  1WDY A;  4J8Y A;  4U96 D;  4J7W A;  1G3N B;  2DWZ A;  1MX6 A;  5BXO A;  5EID A;  2ETA A;  1MYO A;  5EIL A;  4DX1 A;  3JXI A;  2AJA A;  4HRM B;  4ZHB A;  4HRL A;  1IXV A;  4Z68 A;  4HI8 A;  2P2C P;  1IKN D;  5HS0 A;  3Q9N C;  2DZN A;  5EYL A;  5AN8 A;  4HI9 A;  5AQA A;  1DCQ A;  4G8L A;  2DZO A;  3ZKJ A;  2DVW A;  3DEP A;  4OAU C;  5EYP F;  5ENP D;  3LJN A;  2J8S D;  4DX5 D;  1AP7 A;  4YDY A;  3HG0 D;  2F8Y A;  1K1A A;  1BI7 B;  4LSZ E;  5AQB A;  4O1P A;  4ZFH A;  2F8X K;  5JMN D;  1A5E A;  3NOC D;  2ETB A;  1MX2 A;  2KXP C;  5KNG A;  3T8K A;  2XEE A;  4DX7 D;  3V2O A;  4LG6 A;  1D9S A;  4UUC A;  3ZNG A;  2XEH A;  5D66 A;  4DUI A;  1NFI E;  4LNU D;  2A5E A;  2XZD G;  5AQ9 A;  3JUE A;  3TWQ A;  2FO1 E;  3Q9U C;  1IHB A;  3HRA A;  2V4H C;  4DX6 D;  4O1O A; 
#chains in the Genus database with same CATH topology
 5ITZ F;  2XRY A;  3C98 A;  3PZD A;  3ZW3 A;  2V0P A;  4FLH A;  4MBG A;  4CEM A;  4AM9 A;  2ZIR A;  5FIN A;  2QC9 A;  5BW8 C;  1D8D A;  4GA1 A;  2IF4 A;  3C72 A;  2VJ8 A;  3B7B A;  2P9U G;  1TEZ A;  4BSZ B;  4N5C A;  3UIP C;  2B0O E;  4BET A;  3TWT A;  1H6K A;  4RLY A;  2XZT G;  1NZN A;  3BUA A;  4FP7 A;  1LTX A;  3L6A A;  1NP7 A;  4AY6 A;  2WXO A;  1ELK A;  5C1D A;  2WMN A;  4G23 A;  2RKK A;  2WXQ A;  1B89 A;  2UWJ G;  4Q96 A;  4GTQ A;  3RKV A;  3LXU X;  3T9K A;  1VDY A;  2J4D A;  3UI2 A;  3D9N A;  2GRN B;  1WDY A;  3Q5M A;  1KT1 A;  2J07 A;  3TXN A;  2DWZ A;  2JLB A;  3G2S A;  3S7D A;  3N71 A;  4B0Z A;  3UQ3 A;  3CK8 A;  3APF A;  3VLE A;  4I1O B;  5CMY A;  3Q4A B;  1A17 A;  4A55 A;  2R59 A;  2GW1 A;  2XZD G;  3UIO C;  4N2Q A;  2V8S E;  4AXH A;  5LX8 A;  2DYS E;  4ATG A;  4GYY A;  3O4Z A;  4B8C B;  1MX4 A;  3SBT B;  4GTM A;  4L2Y A;  4GZ3 A;  1YCS B;  2X6H A;  2FUL A;  3LYA A;  4G11 A;  1N4P A;  1FT2 A;  3FUL A;  5JHA A;  3HXC A;  3NZS A;  3K9I A;  1IQU A;  3UKU G;  4H7Y A;  3UT4 A;  2X3M A;  1BU9 A;  4JEH A;  3JUI A;  5A6C A;  3OXG A;  2MRI A;  2YIN A;  1YMP A;  3DEO A;  3LPZ A;  4HS2 A;  3SFZ A;  2JEK A;  3KSL A;  2WXM A;  4BY6 A;  3EUV A;  4Y6W A;  1SW6 A;  2X6J A;  3AG3 E;  3TWX A;  1K3Z D;  2RFM A;  1HH8 A;  3FWV A;  3D9M A;  4W9R A;  5EID A;  2OEV A;  4L23 A;  1MYO A;  2VSX E;  3CVQ A;  4DJA A;  3MV3 B;  2VSO E;  3DSV A;  4I1M A;  4AIF A;  1OWM A;  4YDE A;  4DI4 A;  4HI9 A;  2XPZ A;  4G26 A;  1EDU A;  2IOL A;  3ISM C;  3ML8 A;  2J8S D;  4RSY A;  3FU0 A;  4NQ0 A;  5AJD A;  3CK9 A;  3BQO A;  3AG2 E;  3FU5 A;  5C2Y A;  5AQ9 A;  4DX6 D;  4LCT A;  3CK7 A;  1OXJ A;  2LAI A;  1E7U A;  3U4T A;  4HB5 A;  4B93 B;  1FVH A;  5BPP A;  4G8K A;  3PZ2 A;  2GRR B;  4KYO B;  4GU5 A;  4J8E A;  2CFU A;  3PEU B;  2R02 A;  3V79 K;  1N94 A;  4Q69 A;  4BFR A;  2XS1 A;  1HX8 A;  3S7F A;  2YHC A;  3V30 A;  4A63 B;  1H2U A;  2CG2 A;  2WXI A;  5IY5 E;  3LJ3 A;  3IXE A;  4JA7 A;  4PS8 A;  1H0A A;  3Q73 A;  3TWW A;  1SQM A;  5G04 C;  3CKB A;  4U04 A;  2MOW A;  4I9C A;  2H6G A;  3I4R B;  2EIN E;  2KZT B;  3V31 A;  1XGW A;  4FLB A;  4HXI A;  1QQE A;  2HYZ A;  4Y6C A;  4HOU A;  3CIA A;  2X6F A;  2DIW A;  5CRU A;  3L54 A;  3QWW A;  4JVS A;  3NAW A;  2NSZ A;  4L2L A;  3FU3 A;  2AJA A;  4RG9 A;  1ZBP A;  4F53 A;  4ACK A;  4U07 A;  4FJZ A;  2DVW A;  3DEP A;  3UMV A;  5FZQ A;  3X2Q E;  3QOU A;  5AQB A;  1TNZ A;  5JMN D;  2ETB A;  3ZYM A;  2XEH A;  2IU1 A;  1IHB A;  2R2L A;  1H6P A;  3Q15 A;  4TUU A;  1TYQ G;  3U9W A;  1OCZ E;  5KCM A;  2YQ8 A;  4XX5 A;  1JCQ A;  2A5U A;  1N11 A;  2VSY A;  2WVI A;  2FBN A;  3ZHE A;  3MX3 A;  2L0T B;  4CDN A;  4CT4 A;  1UW4 B;  5ENO D;  2WXR A;  3S7B A;  5AAO A;  5EIB E;  4ILI A;  2GRP B;  3S7J A;  5FIO A;  4E6H A;  3DPD A;  5FQ7 A;  4UWK A;  4MLP A;  4G1T A;  3UUX A;  2RFA A;  4JD2 G;  3ZXP A;  2NC9 A;  5E76 A;  4BSX A;  1K8K G;  3JCK C;  4F6R D;  1SVX A;  4AP2 A;  4LEU A;  3CVL A;  3VLD A;  3ZIM A;  4HVB A;  3C3O A;  2FI7 A;  2CHW A;  4GTR A;  4X8Q A;  3B7U X;  3GZS A;  3Q47 B;  1HF8 A;  5J90 A;  3NOG D;  2IY0 C;  4J8D A;  3ESK A;  4J8Y A;  4EHM A;  1SA5 A;  3QAR A;  3LY7 A;  4LER A;  3LDZ A;  4KZC A;  4WWP A;  3UPV A;  5EDS A;  1TJF A;  4M3O A;  5AQA A;  3SBS A;  3L22 A;  3FP3 A;  1U3C A;  2FO7 A;  3ENE A;  4J8S A;  3KD7 A;  5BV1 A;  1E90 A;  4RVB A;  1X81 A;  2A5E A;  3JQ1 A;  2H6H A;  4J8F A;  3BEE A;  4FHK A;  2LSU A;  3ZFW A;  5M72 A;  1L5J A;  3B7S A;  2WXG A;  2NXP A;  4APO A;  3MEK A;  3ASD A;  4HBD A;  3I4G A;  2ZGG A;  4PH4 B;  4H7X A;  4BER A;  2VGX A;  1MZC A;  3HXE A;  3UM1 A;  3CHO A;  4ATZ D;  4N5Q A;  5D0Q D;  3W9G A;  2PL2 A;  1FCH A;  3IEG A;  4GTS A;  3CVP A;  4K5A B;  4LRZ A;  2RG8 A;  3ASG A;  3D9L A;  4KMO A;  4MRU A;  3FUN A;  3CHP A;  1DC2 A;  3GW4 A;  4RQI A;  2HE0 A;  1H2T C;  2Y3A A;  4EPZ A;  5FZR A;  3IV0 A;  2OV8 A;  3FUH A;  1N4Q A;  2J9Q A;  5AAR A;  4U7E B;  2WXJ A;  2ETA A;  1E7V A;  3JXI A;  3D9O A;  3B7R L;  1O5M A;  3PRZ A;  2AWI A;  4HLE A;  4WWO A;  3AU5 A;  3DSX A;  3IHV A;  2DBA A;  3UX4 A;  5G05 J;  5KJK A;  4JW1 A;  5KJN A;  4O1P A;  3URZ A;  5EX3 A;  1IHG A;  3ONK A;  4CRW A;  3CQG B;  2XPY A;  3HRA A;  2R03 A;  5CMW A;  1NA3 A;  1TR4 A;  5A7D B;  3IBE A;  4JHK A;  4N3A A;  5HKP A;  3ZYK A;  1JCS A;  2AVP A;  1E8W A;  2PQR A;  2V5Q C;  1RZ4 A;  2QZA A;  5CCM A;  3JYS A;  5FJY A;  1E96 B;  4HLL A;  1JUQ A;  2VQ2 A;  3QAQ A;  2NYJ A;  4JPS A;  4KVO A;  3Q79 A;  4GZ6 A;  3UTM A;  4GZC A;  1UN9 A;  3SO8 A;  3FTS A;  4L7T A;  2I6H A;  4WNF A;  1N52 A;  1PC2 A;  4GYO A;  4U95 D;  3MYV A;  2Y0B G;  3IHY A;  5AJL A;  1E8Y A;  1NI1 A;  3L17 A;  2JAB A;  3FFL A;  1N0R A;  3VLF A;  3UKR G;  2VGX B;  2VTB A;  4NIK A;  4I17 A;  3TJP A;  2OVF A;  2C0L A;  1MX6 A;  2BUG A;  5AEN A;  3CVN A;  4GYW A;  2PM7 A;  5CRV A;  4U0U A;  2P2C P;  5AN8 A;  3EHN A;  4AY5 A;  3ASN E;  4ANV A;  3HG0 D;  2B6C A;  1EPU A;  2F8X K;  1A5E A;  1UN8 A;  4YVO A;  1N4S A;  3V2O A;  3ZNG A;  3DSW A;  4UWF A;  3FUK A;  3PDN A;  3PUJ A;  3QC1 A;  3W9F A;  5B3S E;  4ANU A;  2BKG A;  4FUL A;  4QQI A;  2ETC A;  4PUC A;  3B95 A;  4C0E A;  4ABN A;  5ENQ D;  3J5Q B;  4N2S A;  4BT8 A;  4EZL A;  2XCC A;  4BEP A;  2CFZ A;  5CEC B;  3DXM G;  4GPK A;  4CZ2 D;  1U2V G;  3ASH A;  2GRO B;  1ZU2 A;  3DSS A;  2WXH A;  3ASO E;  4EQF A;  4GML A;  4I6E A;  4BX9 A;  1N9A A;  2KZT A;  1HS6 A;  2FF4 A;  2KBX A;  3ABL E;  3TWS A;  2WQ7 A;  1AWC B;  2X6I A;  3D9P A;  1YYH A;  4I43 A;  4N39 A;  2GRQ B;  1BPO A;  3ZRH A;  2AW6 A;  1LF8 A;  1DNP A;  4N3C A;  4FU3 A;  3TGO A;  3Q7F A;  4J7W A;  1HU3 A;  1N4R A;  3R7R A;  5BXO A;  1KT0 A;  5LCW C;  3L16 A;  2KCV A;  1D8E A;  2HM8 A;  1IXV A;  4HI8 A;  3KS2 A;  1X5B A;  2BF0 X;  4HOR A;  5EYP F;  2F8Y A;  1EF1 C;  1K1A A;  5J08 A;  3G2V A;  4PS7 A;  3NOC D;  2WMO A;  4LUN U;  4LNU D;  3NF1 A;  1MQS A;  2IQC A;  3AG4 E;  3EHQ A;  2VTB B;  2XHE A;  5DIZ A;  2PM6 A;  2IOS A;  4RG6 A;  4PDX A;  1ELW A;  3ZN3 A;  4R7L A;  2L9B A;  1S63 A;  1OWN A;  5B1A E;  3FUD A;  2V5F A;  1MHQ A;  1TJC A;  3FUF A;  3TWR A;  2C2L A;  4DPR A;  4FAD A;  3ABM E;  2A4Z A;  3FH8 A;  4K5B A;  1OCO E;  3ZGQ A;  3CEQ A;  3CVV A;  3CVU A;  4M7C A;  3F6Q A;  4CGV A;  2WXP A;  3SNX A;  4GMJ A;  2R17 C;  2ZGD A;  4JHR A;  2PZI A;  1BLX B;  2VGE A;  3PS6 A;  3AS4 A;  2P9P G;  1OCR E;  4IUL A;  3QNK A;  2EQX A;  1O1S A;  5LCW J;  1TNY A;  4K0R A;  1AP7 A;  3Q49 B;  3FEY A;  5FT9 A;  1MX2 A;  1KLX A;  3KEZ A;  3Q9U C;  4KVM A;  4O1O A;  4DI3 A;  2H6F A;  4HRN A;  2CHX A;  5KBA A;  5LP0 A;  3PE4 A;  3FH7 A;  3ULE G;  2EIJ E;  3D9K A;  1V54 E;  1OY3 D;  1UOH A;  3AAA C;  3JXJ A;  3HDX A;  3CGH A;  3CVX A;  3LS8 A;  5EN5 D;  3LVR E;  4GTP A;  4NAC A;  4A1S A;  4PS3 A;  4GZD A;  4IRU A;  4GB9 A;  1OT8 A;  3Q7A A;  3BG1 B;  1BI8 B;  4GTV A;  3ZEF A;  1S0P A;  2QY7 A;  5FZS A;  2PNN A;  1N0Q A;  3RSE G;  4WWN A;  3FTY A;  3HVE A;  5G55 A;  1JPL A;  5HQ8 A;  4UWH A;  2KCL A;  3RAU A;  3IKO B;  3CST A;  3AJI A;  4HFG A;  5CED B;  3EHM A;  3LKU A;  3OXF A;  4JEU A;  2CG3 A;  4EZJ A;  4XEI G;  2CHZ A;  4IN3 B;  2LO6 A;  2QYJ A;  4ME2 A;  4GCO A;  4I2Z A;  2ION A;  4HRM B;  3LEW A;  4AEZ C;  3WG7 E;  4G8L A;  3TG5 A;  1Y8M A;  4EBA G;  4AJW A;  3B7T A;  1HFA A;  2QFC A;  2EIM E;  2HR2 A;  5BUZ A;  3DPY A;  1Z3Y A;  3GYZ A;  1NFI E;  5FQ6 A;  2FO1 E;  1YA0 A;  1JWG A;  5HS0 A;  3VTX A;  5ARG A;  2QYU A;  3CQC B;  5HRY A;  2L0I A;  2EIL E;  4IYP A;  1MJ0 A;  3TWV A;  1OWL A;  4UWL A;  2Y4T A;  5G05 C;  2VGY A;  3U3W A;  3MCX A;  4JB8 P;  1ELR A;  4GA2 A;  2E0I A;  5ENT D;  3RO3 A;  3APC A;  5BV0 A;  4HQD A;  5JHB A;  3U66 A;  3SGH A;  5AQ7 A;  2Y1L E;  3L9T A;  4UWG A;  2KC7 A;  4GPM A;  3EIQ C;  3EU5 A;  3TAX A;  5ENR D;  4I6J A;  4XE0 A;  3E32 A;  1DCE A;  4EBA A;  4P29 A;  5CCL A;  3VTY A;  4YDO A;  3UT7 A;  2WPV A;  3SF4 A;  5T4Y A;  3UIN C;  1RW2 A;  3HXB A;  2LSV A;  3RK6 A;  4LNB A;  4FJY A;  1PAQ A;  1OCC E;  1WAO 1;  1TN7 A;  3MKQ A;  1TN6 A;  2LXM A;  4I6G A;  2IJG X;  3SQV A;  3CHS A;  4C9B B;  1NA0 A;  2MHK A;  3GZ1 A;  5EYL A;  2OOE A;  2ZIS A;  3FEX A;  3RJV A;  3QB2 A;  4UQY A;  3L08 A;  3L13 A;  3HVE B;  3ESL A;  5B1B E;  3QDN A;  3HXF A;  2AXU A;  4F1S A;  2WXL A;  5KNG A;  3T8K A;  1D9S A;  3PVL A;  5KJL A;  2C0M A;  1TNU A;  3C5R A;  3NZU A;  1U3D A;  2BED A;  4AOF A;  4WAF A;  2MYO A;  4I2W A;  3AU4 A;  3R9M A;  3D9H A;  4QFV A;  2OEW A;  4TRQ A;  3FTZ A;  2WXN A;  5ANR A;  2L6B A;  3UXG A;  4TUM A;  1DVP A;  5CBO A;  3DXK G;  3CHM A;  2AXV A;  4BX8 A;  3CVW A;  1FT1 A;  1WG0 A;  5JJ6 A;  4YND A;  2AXZ A;  4L9P A;  1W3B A;  4KT6 B;  2EIK E;  3RU0 A;  2HO1 A;  3LVQ E;  3E33 A;  4ILG A;  3DBS A;  4CT0 A;  1V55 E;  5E75 A;  4I1A A;  3I5P A;  3ZPJ A;  3FTV A;  3NBN B;  1H19 A;  1O1T A;  2XGS A;  5CBN A;  4UI9 C;  1BD8 A;  3UT8 A;  2GRM A;  5CER B;  5AYW D;  5FWQ A;  1ZB1 A;  1PY1 A;  1WY6 A;  4I9E A;  1G3N B;  2I2O A;  3E34 A;  4JA9 A;  1E8Z A;  2KAT A;  1SZ9 A;  4Z68 A;  1IKN D;  5FQ4 A;  2LUH A;  5D2M C;  3EIJ A;  4OAU C;  4XKB A;  2I1K A;  1HG2 A;  3CSF A;  4MKT A;  2XRZ A;  4MS6 A;  1UJJ A;  3FU6 A;  3AS5 A;  3ONL A;  3T5X A;  3JUE A;  2WQH A;  4CDM A;  3FTX A;  5ENP D;  3MKQ B;  3RRM B;  2XPI A;  4NUR A;  4A1G A;  4E85 A;  4DRX E;  2E2E A;  2UY1 A;  4J6I A;  1FVF A;  2ILR A;  3G2W A;  3SD5 A;  4U8Y D;  4ANX A;  4V3I A;  3FY4 A;  5AIJ A;  4BTA A;  5LOZ A;  1EYH A;  2I9C A;  2XCB A;  2F37 A;  4U0S A;  3FUJ A;  4KBQ A;  4CDR A;  5A23 A;  3OXL A;  4WNG A;  4EZK A;  4U8H A;  1IYG A;  4G24 A;  3PZ3 A;  2ZU6 B;  3QKY A;  5JJT A;  3PE3 A;  3MKR A;  3FDH A;  5KWD A;  4C48 B;  2WXK A;  1HZ4 A;  4DX2 A;  4XI0 A;  1QYM A;  4UI9 J;  5T3R A;  3ZYL A;  4FC8 A;  3PEV B;  1Z6T A;  1S70 B;  3G2U A;  3DRA A;  1IQR A;  4ZHB A;  3CLJ A;  1SZA A;  3FUE A;  3LCA A;  4KZ0 A;  4CGW A;  3B13 A;  3TL5 A;  2WM9 A;  2WXF A;  3PH0 C;  4YDY A;  1BI7 B;  4BTB A;  4KXK B;  1XNF A;  2L6J A;  1SA4 A;  4G25 A;  2J09 A;  3KAE A;  3KSQ A;  2OCC E;  3R7Q A;  2LAH A;  4DUI A;  3I3N A;  4GTT A;  3TWQ A;  3AS8 A;  3PRE A;  2V4H C;  1KPS B;  5BT1 A;  2IO3 C;  4ANW A;  5KJM A;  3CKC A;  1KZP A;  2I1J A;  3PZ4 A;  4HNA D;  4WNE A;  4GAA A;  4ACL A;  2GRL A;  3JQ0 A;  4FA6 A;  3FHE A;  1KZO A;  2DYR E;  3PNT B;  4ILH B;  3CVY A;  5D0O D;  2VSN A;  4BES A;  3J5P A;  5FQ8 A;  1K1B A;  3HIZ A;  3SHF A;  3ML9 A;  5ARF A;  3AG1 E;  3CHQ A;  3NB2 A;  3NQP A;  1TNO A;  5FTP A;  4B8A A;  2IEJ A;  3ABK E;  3E37 A;  2M63 A;  5BXU A;  2IO2 C;  3ZUV B;  2UY1 B;  1QZ2 A;  3TWU A;  4J0U A;  4K5C A;  4GTO A;  1JWF A;  3FH5 A;  1E8X A;  4U96 D;  2YNQ A;  1FPP A;  3DWL G;  5EIL A;  1LD7 A;  4A3V A;  1UG3 A;  1QBQ A;  5G2N A;  2DZN A;  3ZXS A;  2DZO A;  3RIB A;  3ZYQ A;  4ZFH A;  2XEE A;  4LG6 A;  3PZ1 A;  2FEZ A;  2WQ6 A;  3EHR A;  4LNG A;  2X38 A;  5KNH D;  4JHJ A;  1P5Q A;  2Q7F A;  3KEA A;  3ZU7 B;  3L82 A;  2WB2 A;  2Y4U A;  5CEA A;  1O1R A;  4JC8 A;  4O6F A;  5CHE E;  5ENS D;  4B89 A;  3C3R A;  4U8V D;  2LNI A;  3SFX A;  3HYM B;  1WM5 A;  5JA4 D;  3BU8 A;  4O60 A;  3R9A B;  2P9S G;  4TV3 A;  3S2A A;  4DLQ A;  1Z5S C;  1HXI A;  3ZVV A;  3D9I A;  4F7A A;  2X6K A;  4G2V A;  3CHR A;  1H2V C;  2F0Y A;  3O48 A;  3EU9 A;  1HE8 A;  3ULY A;  2ZXW E;  1HO8 A;  3HXD A;  4DX1 A;  3APD A;  1JCR A;  2R5S A;  3D3M A;  2Y69 E;  4D10 C;  3Q9N C;  3UM0 A;  4DX5 D;  2P9K G;  3LJN A;  2H6I A;  3DSU A;  4Q94 A;  3FTU A;  4OYS A;  4BWR A;  5T8I A;  4LSZ E;  5ANL A;  3T5V A;  4URK A;  1S64 A;  2GGF A;  1Z3X A;  3RRN B;  1OWO A;  4F3V A;  5DBK A;  3UM2 A;  1Y6I A;  3PUK A;  4U63 A;  2P9N G;  3D9J A;  1HG5 A;  2R05 A;  5ENN A;  3FUI A;  1UJK A;  3EDT B;  2KCK A;  2XGM A;  2P58 C;  4APF A;  4XI9 A;  2DCP A;  5G04 J;  1H6O A;  2YHE A;  3MGB A;  5EX0 A;  3CR3 A;  4AVX A;  5JJ7 A;  3CV0 A;  3QK0 A;  3QJZ A;  4F1P A;  3E4B A;  2OND A;  3SI5 A;  3TG4 A;  2KM4 A;  3OTN A;  4OVU A;  1LD8 A;  3P1U A;  3P2B A;  4WUY A;  3SZ7 A;  4JZY A;  3Q75 A;  3V2X A;  3BG0 B;  4UI9 K;  3SY2 A;  2PQN A;  2IFU A;  1INZ A;  2J08 A;  5EKQ D;  2BTD A;  2J49 A;  4HRL A;  1N54 A;  3LY9 A;  4L1B A;  4YVQ C;  3ZKJ A;  5HI7 A;  3ULQ A;  3TXM A;  3HHM A;  1OUV A;  1QNF A;  4GCN A;  2LXL A;  3T8M A;  2V4L A;  2KXP C;  4DX7 D;  4C0M A;  3MJW A;  4UQZ A;  2VYI A;  3FUM A;  4EEC A;  3SFY A;  4XZ4 A;  3OAW A;  1GW6 A;  3E30 A;  2XEN A;  2XGO A;  3MV2 B;  4A3T A;  3U64 A;  4BT9 A;  4HOT A;  2RD0 A;  3QWP A;  4CYM D;  2P9I G;  1N95 A;  3Q78 A;  4GA0 A;  4WND A;  4JL0 A;  3RRU A;  4FHJ A;  4OVV A;  4YDW A;  2OVB A;  4OAV B;  4GMR A;  2J4B A;  5LFA A;  1TN8 A;  2BKK B;  3ZHE B;  4XKC A;  4HOQ A;  4AV7 A;  5H7P A;  1OWP A;  1Q2Z A;  3C3Q A;  3DST A;  3G2T A;  4B94 A;  3FTW A;  2XS8 A;  3QWV A;  4DLO A;  3LY8 A;  2XQ0 A;  3ASF A;  4N3B A;  4TXP A;  3RO2 A;  3UM3 A;  3PNL B;  4TXR A;  4TXQ A;  3WXX A;  4HOS A;  2P9L G;  4JXT A;  3MZL B;  4U0Z A;  3MA5 A;  1DCQ A;  4CCA A;  4UQX A;  4DK5 A;  3GZ2 A;  4GZ5 A;  4K03 A;  4XIF A;  1TNB A;  2XEV A;  1NL4 A;  4UUC A;  5D66 A;  4NRH B;  5BNW A;  3EJN A; 
#chains in the Genus database with same CATH homology
 3EHQ A;  5ITZ F;  3W9F A;  3EHR A;  3C5R A;  4HRN A;  1TR4 A;  2BKG A;  4QQI A;  2ETC A;  5HRY A;  5KBA A;  3B95 A;  5KNH D;  4HB5 A;  1MJ0 A;  4B93 B;  2MYO A;  3TWV A;  2XEN A;  4DRX E;  5HKP A;  5ENQ D;  3J5Q B;  3KEA A;  3D9H A;  1OY3 D;  1UOH A;  4HNA D;  4G8K A;  3ZU7 B;  3AAA C;  3JXJ A;  4JB8 P;  5FIN A;  1MX4 A;  2QC9 A;  4HBD A;  4QFV A;  2V5Q C;  4BEP A;  2ZGG A;  5EN5 D;  3TWR A;  1N11 A;  5ENT D;  4CYM D;  2L6B A;  3UXG A;  4TUM A;  4U8Y D;  3B7B A;  1YCS B;  5CEC B;  5CBO A;  3V79 K;  4BSZ B;  4HQD A;  4BER A;  5CEA A;  5ENO D;  5ENS D;  5AAO A;  5EIB E;  4K5B A;  4HLL A;  4CZ2 D;  5AQ7 A;  2Y1L E;  4YDW A;  2B0O E;  4BET A;  2F37 A;  5FIO A;  3TWT A;  4RLY A;  4ATZ D;  4OAV B;  4N5Q A;  4U8V D;  3V30 A;  2NYJ A;  4GPM A;  4BES A;  2XZT G;  3J5P A;  1WG0 A;  3W9G A;  4GMR A;  4A63 B;  1BU9 A;  1K1B A;  1OT8 A;  2BKK B;  4F1P A;  1BI8 B;  3F6Q A;  5ENR D;  5JA4 D;  3UTM A;  4K5A B;  2RFA A;  2PNN A;  1N0Q A;  3IXE A;  3SO8 A;  1YMP A;  4O60 A;  3DEO A;  4U95 D;  3TWS A;  2KBX A;  5BXU A;  4F6R D;  3ZUV B;  1SVX A;  3TWW A;  3NBN B;  5KWD A;  2Y0B G;  1AWC B;  1DC2 A;  4C48 B;  5CBN A;  3V2X A;  2HE0 A;  1YYH A;  1BD8 A;  3AJI A;  4DX2 A;  5CED B;  1SW6 A;  3V31 A;  3TWU A;  1QYM A;  2ZGD A;  2JAB A;  4K5C A;  1N0R A;  1BLX B;  2VGE A;  3TWX A;  5CER B;  1K3Z D;  2QYJ A;  3T9K A;  4NIK A;  2RFM A;  3NOG D;  3UI2 A;  5AAR A;  3EU9 A;  1S70 B;  1WDY A;  4J8Y A;  4U96 D;  4J7W A;  1G3N B;  2DWZ A;  1MX6 A;  5BXO A;  5EID A;  2ETA A;  1MYO A;  5EIL A;  4DX1 A;  3JXI A;  2AJA A;  4HRM B;  4ZHB A;  4HRL A;  1IXV A;  4Z68 A;  4HI8 A;  2P2C P;  1IKN D;  5HS0 A;  3Q9N C;  2DZN A;  5EYL A;  5AN8 A;  4HI9 A;  5AQA A;  1DCQ A;  4G8L A;  2DZO A;  3ZKJ A;  2DVW A;  3DEP A;  4OAU C;  5EYP F;  5ENP D;  3LJN A;  2J8S D;  4DX5 D;  1AP7 A;  4YDY A;  3HG0 D;  2F8Y A;  1K1A A;  1BI7 B;  4LSZ E;  5AQB A;  4O1P A;  4ZFH A;  2F8X K;  5JMN D;  1A5E A;  3NOC D;  2ETB A;  1MX2 A;  2KXP C;  5KNG A;  3T8K A;  2XEE A;  4DX7 D;  3V2O A;  4LG6 A;  1D9S A;  4UUC A;  3ZNG A;  2XEH A;  5D66 A;  4DUI A;  1NFI E;  4LNU D;  2A5E A;  2XZD G;  5AQ9 A;  3JUE A;  3TWQ A;  2FO1 E;  3Q9U C;  1IHB A;  3HRA A;  2V4H C;  4DX6 D;  4O1O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...