1K1BA

Crystal structure of the ankyrin repeat domain of bcl-3: a unique member of the ikappab protein family
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
228
structure length
228
Chain Sequence
b'EDGDTPLHIAVVQGNLPAVHRLVNLFQQGGRELDIYNNLRQTPLHLAVITTLPSVVRLLVTAGASPMALDRHGQTAAHLACEHRSPTCLRALLDSAAPGTLDLEARNYDGLTALHVAVNTECQETVQLLLERGADIDAVDIKSGRSPLIHAVENNSLSMVQLLLQHGANVNAQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVIDILRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords B-cell lymphoma 3-encoded protein
publication title Crystal structure of the ankyrin repeat domain of Bcl-3: a unique member of the IkappaB protein family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 75
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2001-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1k1bA00
4DUIA 5BXOA 5EN5D 2KBXA 5AQAA 2ZGGA 1IKND 2F8YA 3TWQA 4CYMD 4HI9A 4DX6D 5ITZF 5CBOA 2RFMA 4QFVA 5EYPF 3TWWA 5ENSD 3ZKJA 5JA4D 1SW6A 2BKGA 2ETBA 2BKKB 3LJNA 3TWRA 4BETA 4B93B 5AQ9A 4U95D 4DX1A 4ATZD 5EYLA 2VGEA 3TWXA 1MJ0A 4J8YA 2J8SD 3F6QA 4UUCA 4Z68A 3UXGA 5CERB 3TWUA 3D9HA 3Q9UC 1SVXA 3JXJA 1OY3D 3EHRA 1YYHA 3ZUVB 4O1PA 2DVWA 4OAVB 4HLLA 2HE0A 3Q9NC 4HRMB 4K5BA 1AP7A 3ZU7B 3JXIA 4HBDA 1QYMA 4HRLA 5KNHD 1AWCB 2ETAA 2PNNA 5ENOD 4CZ2D 5ENQD 1IXVA 4U96D 3TWSA 1WG0A 3V31A 1MYOA 5AN8A 1MX6A 2KXPC 2XEEA 4HI8A 1DCQA 3JUEA 3T8KA 4U8VD 5HRYA 3KEAA 2P2CP 4F1PA 5ENRD 4ZHBA 5CECB 1BLXB 3B95A 4A63B 1OT8A 3NBNB 4DRXE 1MX4A 2V4HC 3V30A 4O60A 5BXUA 1BD8A 3T9KA 1UOHA 1YCSB 3V2XA 3DEPA 4G8LA 4NIKA 1D9SA 3TWTA 5KWDA 3IXEA 1NFIE 3SO8A 2ETCA 5EILA 3J5QB 2Y1LE 4HRNA 4LSZE 4QQIA 4GPMA 1TR4A 2JABA 5EIDA 5KNGA 2RFAA 1WDYA 1K3ZD 2ZGDA 1S70B 2DWZA 3DEOA 4YDYA 5CBNA 4N5QA 3V2OA 1K1AA 5AQ7A 5AQBA 3UTMA 2AJAA 3NOCD 1N0QA 2MYOA 3AAAC 5AAOA 4BERA 5EIBE 2QC9A 4BSZB 1BI8B 2DZOA 1BU9A 2A5EA 1MX2A 2F37A 4LG6A 4YDWA 3UI2A 4RLYA 1K1BA 5JMND 2XENA 1N0RA 5AARA 5HKPA 1G3NB 2V5QC 2XZTG 3NOGD 3TWVA 4F6RD 5CEAA 4LNUD 5HS0A 4BEPA 4DX7D 4ZFHA 4K5AB 1BI7B 1IHBA 3EU9A 3W9GA 4HQDA 2FO1E 1A5EA 2NYJA 2DZNA 1N11A 2L6BA 3EHQA 4JB8P 5ENPD 4DX5D 4HNAD 3C5RA 4OAUC 2B0OE 5FIOA 4J7WA 2XEHA 2QYJA 2XZDG 4G8KA 4GMRA 4HB5A 3HRAA 5ENTD 1DC2A 4BESA 2F8XK 3ZNGA 1YMPA 4TUMA 3HG0D 3J5PA 4O1OA 3B7BA 3AJIA 4K5CA 2Y0BG 5KBAA 4U8YD 5D66A 3W9FA 5CEDB 4C48B 3V79K 4DX2A 5FINA
chains in the Genus database with same CATH superfamily
5EN5D 3QC1A 3QWWA 4UWKA 3Q73A 1H6KA 5EYPF 2LNIA 1ZB1A 4B93B 4DX1A 1E7UA 4GZDA 3MGBA 5LX8A 2OEVA 4RVBA 3JXJA 1OY3D 2EIJE 3C3OA 3FU6A 4B0ZA 2OCCE 2J49A 1AWCB 4GTVA 1MYOA 4E85A 3JUEA 3ZRHA 2WB2A 3MV3B 3T9KA 1O1SA 4J0UA 3ESKA 3PNTB 4C9BB 3L08A 3SGHA 3MEKA 3NZUA 2DIWA 3PVLA 5KJLA 1OCCE 2XCBA 4I6EA 2P9PG 3Q47B 4GYYA 3OXGA 5D2MC 3LJ3A 3WXXA 1HXIA 3P2BA 2V0PA 4HOSA 5A6CA 1TN6A 2WXIA 3D9IA 3S2AA 2R05A 4X8QA 5JMND 2R03A 1E8ZA 1Y8MA 2WMOA 5JJTA 4F6RD 2VSOE 4GCNA 2RD0A 2X6IA 3EUVA 3L22A 1JCSA 4G8KA 3EIQC 3KAEA 2MHKA 4ANUA 5T3RA 2Y0BG 3RAUA 3RIBA 2A4ZA 3PS6A 2LXMA 3FHEA 3LJNA 3SY2A 2V8SE 1FT1A 3CK7A 4C0EA 1MJ0A 1A17A 2H6FA 2H6IA 4GU5A 3DSVA 4K5BA 2PZIA 1H19A 3HXEA 4GAAA 4URKA 2PM7A 5AN8A 2L0TB 3T8KA 3C3RA 3D9OA 2XQ0A 3N71A 4C0MA 2NSZA 2X6FA 2WXHA 4FULA 4O60A 4MKTA 3CVXA 2KC7A 3NAWA 2WXRA 2LAHA 4PH4B 3ULEG 4A55A 4LCTA 3HXDA 5JJ6A 4I2WA 4AIFA 2IOSA 4GYWA 3CHMA 4JA9A 3UTMA 1SA5A 2QYUA 2WXKA 2P58C 4GTMA 4MS6A 4A3VA 1E8WA 1DCEA 1Z6TA 2P9IG 4RLYA 4YDEA 4HFGA 4R7LA 4FLHA 4ILGA 4EZJA 4JXTA 2XZTG 3CHQA 1ELWA 4EZLA 3W9GA 4EBAG 3QK0A 3EHQA 4BTBA 2XZDG 3GZ1A 4FA6A 3LDZA 4XE0A 3KEZA 1YMPA 3D9JA 4WNFA 4C48B 1WY6A 5D0OD 2LUHA 2L6JA 1OXJA 1OUVA 2BKKB 4CDRA 3PZ3A 4F1SA 5EYLA 4U8HA 3NB2A 4P29A 1P5QA 3EDTB 3ZIMA 2J08A 3AU5A 1SA4A 2VQ2A 2WQHA 3TGOA 3TWUA 3HXFA 4OVUA 3Q9UC 1ELRA 3ZEFA 3Q9NC 3Q5MA 3PZ4A 4GZ6A 1HZ4A 1S0PA 2R59A 5KCMA 2KCLA 3LEWA 4GYOA 2IEJA 2WXLA 4AJWA 4Q94A 3BG0B 3V30A 5BXUA 3L9TA 4KVOA 3PZ1A 3ZHEA 3IXEA 3QOUA 3B13A 1DVPA 3P1UA 1N94A 3UX4A 2EIKE 4JEHA 1D8DA 3G2WA 3FU5A 5AAOA 5EIBE 2HO1A 4MLPA 4U63A 3Q49B 4D10C 4TV3A 2XGOA 2XRYA 3PDNA 1A5EA 4WNGA 4GA0A 5DBKA 2WXJA 3FUFA 4GMRA 2OEWA 3QJZA 3ZNGA 1JWGA 4L1BA 3FTUA 4HS2A 1DNPA 2I9CA 4EECA 1IKND 3ZKJA 4I1AA 4L2YA 3T8MA 1INZA 3SFXA 1UW4B 4I6GA 3FUNA 5AENA 2PL2A 2AWIA 3BG1B 2H6HA 4HRMB 1NA3A 4KMOA 3ABKE 2C2LA 2P9LG 4EZKA 3FDHA 2CG2A 3FTVA 3TL5A 4A63B 1OT8A 3NBNB 1TN8A 4DI4A 3V2XA 3HXCA 1NL4A 4GPKA 2PQRA 4GPMA 1TR4A 3KS2A 3CGHA 4WWPA 4H7YA 4GB9A 1FT2A 4YDYA 1O5MA 3V2OA 2VGXB 3NOCD 3ZFWA 1OCZE 4CCAA 4GCOA 1EYHA 1FPPA 3UT4A 3TXMA 3LXUX 2IY0C 3PZ2A 1X81A 1JUQA 4N3AA 4EBAA 1Q2ZA 4A3TA 5E75A 4JD2G 1DC2A 4FHKA 3SD5A 2WXPA 4J8FA 4JC8A 4U8YD 3W9FA 5CEDB 4TXQA 4NACA 3AS4A 3U3WA 3FTWA 5JJ7A 2RFMA 1N4SA 4U95D 4TXRA 2WXOA 3EIJA 4YVQC 3MKQB 3F6QA 3R9MA 4UI9J 2HE0A 3UM0A 1NP7A 5HQ8A 4IRUA 5ENOD 5D0QD 1TJCA 3LVRE 3FU3A 3HHMA 5EX3A 2XEVA 3UKUG 1EPUA 1ZU2A 4G8LA 3FUIA 3HYMB 2I6HA 3G2UA 1H6PA 3KSLA 3RRUA 5AIJA 2WVIA 4APOA 3S7JA 1K1AA 4DLQA 4BWRA 1FVHA 4BERA 1GW6A 3RU0A 3FTXA 3ULYA 4N39A 4JHJA 5C2YA 4JHRA 4CRWA 2HR2A 4AV7A 5CEAA 2IJGX 2EILE 3AG1E 1WAO1 4XKBA 3TJPA 3FFLA 2QYJA 4GA2A 4BESA 2WQ6A 3CVLA 2R2LA 1FVFA 5FQ4A 3DXKG 4O1OA 5KBAA 3TXNA 2XHEA 4PS7A 4RG6A 4KZ0A 2YINA 3DSWA 1JPLA 4UI9K 4F53A 2OOEA 4G23A 3S7FA 2J8SD 3D9PA 3MJWA 4BTAA 4WWOA 4BX9A 3IV0A 4OAVB 3APFA 3FUKA 2MOWA 2ETAA 3BQOA 3JYSA 1E90A 5CMWA 1WG0A 4CT0A 2YHEA 4AEZC 3VLDA 3KEAA 1IHGA 5CCMA 1PAQA 4JA7A 3CHOA 1H2VC 1OWNA 3MCXA 3QWPA 2X6JA 1W3BA 2WXFA 1D9SA 1NFIE 3HVEA 4L9PA 3SO8A 4LSZE 4B8AA 2E0IA 5KNGA 2RFAA 4PS3A 4TXPA 4XEIG 2OVBA 5CCLA 2ZISA 2I1JA 5CBNA 3SHFA 3RRMB 1NI1A 2WM9A 2FF4A 5KJNA 3RO2A 4DI3A 1TYQG 2E2EA 5FWQA 3QKYA 2XPIA 5ARFA 1G3NB 2V5QC 3NOGD 3TWVA 4Q69A 4U04A 3ABME 3EU9A 4B94A 2KCVA 4OAUC 2WXNA 4TUMA 1HFAA 3AS8A 2OVFA 5JHBA 3ULQA 2XS1A 3NQPA 2IONA 4HXIA 5G04J 5CBOA 3E4BA 5JA4D 5KWDA 3ZW3A 4FP7A 2JEKA 4KYOB 4CT4A 3NZSA 5JHAA 3D9HA 3JCKC 2CG3A 2XS8A 4B8CB 1KZPA 1QYMA 1IQUA 1TEZA 3MYVA 1IXVA 1HG5A 4B89A 2I1KA 1SQMA 3IHYA 2KXPC 3SF4A 1H2UA 2P9KG 3JUIA 3R7QA 4YVOA 1D8EA 1YCSB 1RW2A 3UT8A 3CSFA 3GYZA 3Q4AB 4QQIA 4XKCA 2JABA 3CSTA 2VTBA 5LCWJ 3DSTA 3UINC 2VGYA 5AQBA 1YA0A 3ONLA 3LCAA 4U0ZA 3UM1A 2LAIA 2YNQA 5AJLA 4DPRA 5FQ8A 2IQCA 3UI2A 4Y6CA 4EQFA 4PUCA 2J4BA 2GRMA 5AARA 2VJ8A 2CHXA 4HOQA 3FEYA 4GMJA 1BI7B 2FEZA 4GTRA 4O6FA 4N2QA 2JLBA 3SI5A 2ONDA 3K9IA 4YDOA 1HO8A 4MRUA 2Y69E 5D66A 2GRRB 3RJVA 1MZCA 3QWVA 3O48A 3L16A 3IBEA 3BU8A 1KPSB 4Y6WA 3L54A 3ZVVA 3E34A 3EHRA 3FUMA 3MKRA 2LSUA 4LERA 4XI0A 4LUNU 1KT1A 4Q96A 4J8EA 4PS8A 4EHMA 3LYAA 3C3QA 4UQXA 5ENQD 3OAWA 4U96D 3TWSA 2XEEA 3D9NA 4FJZA 1EDUA 2R17C 3TG4A 4EPZA 2WXMA 3R7RA 5FTPA 2KZTA 2IU1A 5CHEE 3D9MA 2MRIA 4NRHB 1Z3YA 4I17A 3Q15A 1N95A 3J5QB 4HRNA 4HLEA 2V5FA 3CHRA 2F0YA 4FHJA 5G2NA 4PDXA 1U3DA 1L5JA 4JPSA 2AJAA 3U4TA 3Q75A 4GZ3A 4WUYA 1RZ4A 1N4RA 1N0RA 4HVBA 4GZ5A 2CFZA 4F7AA 1QNFA 4CGWA 4LNUD 4ANVA 4DJAA 4G25A 4HQDA 4AP2A 2NYJA 5ENPD 4DX5D 3C5RA 4I9EA 3ENEA 5M72A 5BV0A 1HU3A 1OCOE 5E76A 3V79K 3QARA 2RG8A 1NA0A 4GTQA 1V54E 4J8SA 4UI9C 4AVXA 5AQ9A 1IQRA 3O4ZA 3B7UX 4ACLA 5HI7A 5G05J 3I3NA 1X5BA 3UXGA 2YHCA 2DVWA 3SBTB 3ZHEB 2ZIRA 1AP7A 3CVPA 2X6HA 4HBDA 2M63A 3UKRG 3DWLG 5H7PA 5BPPA 2GRPB 3MX3A 4F1PA 1FCHA 3CKCA 2DBAA 3CV0A 2NXPA 2AXVA 3T5VA 2DYSE 3I5PA 3APCA 2QY7A 5EIDA 2H6GA 3FTZA 1S70B 3CVUA 3PUJA 2FI7A 4AM9A 4JL0A 1JCQA 5G55A 3UT7A 4XIFA 2A5EA 5ARGA 4RQIA 4CGVA 4U07A 5KJKA 2XENA 3DSSA 1MHQA 4K0RA 4BEPA 1E7VA 2CHWA 2WXQA 2FO1E 3UQ3A 3CVYA 3J5PA 3B7BA 3AU4A 3UM3A 4DX2A 5FINA 3AG4E 2KBXA 5AJDA 5J90A 5ITZF 2J9QA 4I2ZA 3QNKA 5KJMA 3PNLB 1K8KG 5EDSA 2CFUA 4OYSA 2BUGA 3S7DA 3MA5A 2VSYA 1YYHA 4O1PA 4ANXA 2EINE 5CMYA 4HRLA 5KNHD 2L9BA 4CZ2D 2ZU6B 1BPOA 4AXHA 4HI8A 3FUHA 4N5CA 3LVQE 4RSYA 3B95A 2FULA 2QZAA 2V4LA 1SZAA 4HOTA 3RK6A 3LKUA 3DEPA 3UM2A 4NIKA 5FZRA 3ZGQA 4UQZA 4BT8A 2X3MA 4IYPA 2XPYA 4N5QA 2DCPA 1N0QA 3L17A 1HF8A 1Y6IA 3C72A 3ZXPA 3ABLE 3FTSA 3CVVA 4BT9A 3CK9A 5HS0A 3QDNA 4UQYA 2DZNA 2AXZA 3FH5A 4JB8P 1H2TC 3KD7A 5G04C 4J7WA 4HB5A 5LFAA 2XRZA 2J09A 3ASGA 1O1RA 2GROB 2Y4UA 2FBNA 3ML9A 1OCRE 4DUIA 5AQAA 3TWQA 5B1AE 2FO7A 1E96B 3VLEA 1LF8A 4J8YA 1HS6A 1TJFA 1Z3XA 1ZBPA 1XGWA 4ACKA 5LP0A 5DIZA 3X2QE 4H7XA 3ZYMA 5EX0A 3CQCB 2HYZA 3DRAA 4NQ0A 4WNDA 5LCWC 4DRXE 1MX4A 1QQEA 3TWTA 4BX8A 4XI9A 4LRZA 2GRLA 3U66A 5FZQA 4I1OB 1OWLA 2Y1LE 2EQXA 3FY4A 1JCRA 1K3ZD 2VSXE 4KXKB 4FJYA 3FWVA 1PY1A 3ASNE 1KLXA 4GTOA 1O1TA 2F37A 3PE3A 5HKPA 3JQ1A 3E30A 3B7SA 3DSUA 1JWFA 5AYWD 3DXMG 2B6CA 4FC8A 2LO6A 4GTPA 2XEHA 5LOZA 2R02A 5ENNA 3B7TA 2BEDA 4UWHA 5EKQD 3OXFA 3LPZA 3CQGB 4A1GA 1N4QA 3TWWA 3DPDA 2XPZA 2L0IA 2P9NG 3CVWA 4K03A 1OWMA 2VGEA 2P9SG 2BTDA 1KT0A 2ZXWE 4N3CA 1LTXA 4AY5A 3JXIA 3OXLA 2C0MA 3HVEB 2PNNA 1TNUA 2WXGA 3V31A 3C98A 3AG2E 4U8VD 2ILRA 5ENRD 1BLXB 4DLOA 2GRQB 4U0SA 4UWGA 4XX5A 3ZPJA 3L82A 2ETCA 5IY5E 2IFUA 3SFYA 3FULA 3KSQA 1WDYA 2DWZA 4NURA 3QB2A 3Q78A 4BSZB 1OWPA 1UG3A 3GZSA 5CRUA 4JVSA 3ML8A 2IO3C 3Q79A 3FUJA 1TNZA 4ILHB 4KT6B 2KCKA 5FZSA 1TNYA 4KBQA 3SBSA 3TG5A 4DX7D 4ZFHA 1N11A 5T8IA 1ELKA 4CDMA 5FIOA 4YNDA 5C1DA 4ILIA 5ENTD 3PZDA 3HG0D 4TRQA 3LY9A 5G05C 2ZGGA 2F8YA 2KM4A 4HI9A 3CKBA 2X6KA 4QFVA 3CLJA 1SW6A 2KATA 2VSNA 3D3MA 4BETA 3EJNA 4DK5A 2HM8A 3LS8A 5CERB 1SVXA 4GMLA 4LEUA 4ANWA 3ZU7B 3I4RB 2WPVA 4G2VA 1S63A 4KZCA 2VTBB 2IF4A 2P9UG 5ANRA 2P2CP 5CECB 3CIAA 1XNFA 1H6OA 4IULA 1UOHA 3IHVA 3PEUB 2BF0X 3U64A 1OWOA 4I43A 4J8DA 1N52A 5EILA 3ZYKA 1NZNA 2LSVA 4V3IA 5J08A 2WQ7A 4U0UA 4GZCA 2MYOA 3QAQA 3FH8A 4WNEA 1LD8A 4LG6A 1K1BA 4G1TA 4BY6A 4G11A 3R9AB 2Y3AA 2B0OE 3PUKA 2WMNA 4E6HA 2RKKA 3S7BA 4BSXA 4K5CA 5B1BE 3L6AA 5BXOA 1TNBA 4DX6D 1WM5A 3ONKA 1UN9A 2Q7FA 3ASFA 3UMVA 5ENSD 3RO3A 3TWRA 2AXUA 4ATZD 3CVQA 3RSEG 3ZYLA 2UWJG 4Z68A 1TNOA 2KZTB 3E32A 3ZUVB 3U9WA 4N3BA 3VTYA 4M3OA 2XGSA 4UWLA 3EU5A 2DYRE 3RRNB 2OV8A 3VLFA 3G2VA 2AW6A 4W9RA 1B89A 4WAFA 2VYIA 5BV1A 2V4HC 3UIPC 2PQNA 4AY6A 2GW1A 3LY8A 4XZ4A 5T4YA 1HH8A 4A1SA 1V55E 5ANLA 4LNBA 4FADA 1N9AA 3SFZA 4OVVA 3CR3A 5AQ7A 3PRZA 2NC9A 3GZ2A 3TAXA 2QC9A 4L7TA 5B3SE 3MV2B 1MQSA 4GA1A 1MX2A 4YDWA 1HX8A 2EIME 4K5AB 1IHBA 2VGXA 3T5XA 5FT9A 3D9KA 2L6BA 4JW1A 3FUDA 3ASDA 2Y4TA 4JHKA 4I1MA 2F8XK 3EHNA 3MZLB 1U2VG 4FU3A 4GTTA 3D9LA 4CEMA 3Q7FA 3UUXA 3UIOC 2I2OA 2BKGA 2ETBA 3I4GA 4MBGA 3RKVA 3FU0A 1UN8A 4FLBA 3VTXA 5A23A 2J4DA 3URZA 1Z5SC 2X38A 3CVNA 3ASOE 4HLLA 4KVMA 4CDNA 4HORA 3CHPA 4WWNA 4I9CA 4UWFA 2A5UA 2GGFA 3PH0C 3WG7E 1DCQA 1HE8A 5HRYA 4J6IA 3OTNA 1E8YA 3MKQA 4HOUA 3L13A 2J07A 1LD7A 3BUAA 3HXBA 3ESLA 5BUZA 4BFRA 3Q7AA 3HIZA 4L2LA 2LXLA 3SQVA 5A7DB 2QFCA 2IOLA 2XCCA 3BEEA 1UJJA 4TUUA 4RG9A 1BI8B 1BU9A 1QBQA 1HG2A 3B7RL 4AOFA 1VDYA 3PE4A 2UY1A 2AVPA 3ZN3A 1N54A 3SZ7A 3DPYA 2GRNB 3ZYQA 4G26A 3ASHA 3FUEA 4M7CA 1S64A 3IEGA 5BW8C 4CYMD 5FQ7A 3G2TA 3AG3E 1UJKA 2IO2C 4LNGA 2XGMA 4G24A 3TWXA 2R5SA 5BNWA 4UUCA 4GTSA 4F3VA 4JEUA 3ISMC 3PREA 1U3CA 2UY1B 3LY7A 5BT1A 3CHSA 1MX6A 3G2SA 4JZYA 4ZHBA 3CK8A 3HDXA 1N4PA 1SZ9A 2CHZA 1BD8A 4L23A 5FQ6A 1KZOA 1H0AA 4ATGA 5CRVA 2ZGDA 3E37A 3DEOA 3JQ0A 3CEQA 2YQ8A 4N2SA 2PM6A 4ABNA 3AS5A 3AAAC 3DSXA 2DZOA 3FH7A 3PEVB 4IN3B 4U7EB 3ZXSA 1TN7A 4ME2A 3SNXA 2C0LA 3EHMA 3DBSA 3FP3A 1IYGA 4HNAD 5FJYA 1EF1C 3HRAA 3FTYA 1QZ2A 3FEXA 3UPVA 3IKOB 4APFA 1E8XA 3NF1A 3APDA 3AJIA 3GW4A 3E33A 4I6JA 1PC2A
chains in the Genus database with same CATH topology
4DUIA 5BXOA 5EN5D 2KBXA 5AQAA 2ZGGA 1IKND 2F8YA 3TWQA 4CYMD 4HI9A 4DX6D 5ITZF 5CBOA 2RFMA 4QFVA 5EYPF 3TWWA 5ENSD 3ZKJA 5JA4D 1SW6A 2BKGA 2ETBA 2BKKB 3LJNA 3TWRA 4BETA 4B93B 5AQ9A 4U95D 4DX1A 4ATZD 5EYLA 2VGEA 3TWXA 1MJ0A 4J8YA 2J8SD 3F6QA 4UUCA 4Z68A 3UXGA 5CERB 3TWUA 3D9HA 3Q9UC 1SVXA 3JXJA 1OY3D 3EHRA 1YYHA 3ZUVB 4O1PA 2DVWA 4OAVB 4HLLA 2HE0A 3Q9NC 4HRMB 4K5BA 1AP7A 3ZU7B 3JXIA 4HBDA 1QYMA 4HRLA 5KNHD 1AWCB 2ETAA 2PNNA 5ENOD 4CZ2D 5ENQD 1IXVA 4U96D 3TWSA 1WG0A 3V31A 1MYOA 5AN8A 1MX6A 2KXPC 2XEEA 4HI8A 1DCQA 3JUEA 3T8KA 4U8VD 5HRYA 3KEAA 2P2CP 4F1PA 5ENRD 4ZHBA 5CECB 1BLXB 3B95A 4A63B 1OT8A 3NBNB 4DRXE 1MX4A 2V4HC 3V30A 4O60A 5BXUA 1BD8A 3T9KA 1UOHA 1YCSB 3V2XA 3DEPA 4G8LA 4NIKA 1D9SA 3TWTA 5KWDA 3IXEA 1NFIE 3SO8A 2ETCA 5EILA 3J5QB 2Y1LE 4HRNA 4LSZE 4QQIA 4GPMA 1TR4A 2JABA 5EIDA 5KNGA 2RFAA 1WDYA 1K3ZD 2ZGDA 1S70B 2DWZA 3DEOA 4YDYA 5CBNA 4N5QA 3V2OA 1K1AA 5AQ7A 5AQBA 3UTMA 2AJAA 3NOCD 1N0QA 2MYOA 3AAAC 5AAOA 4BERA 5EIBE 2QC9A 4BSZB 1BI8B 2DZOA 1BU9A 2A5EA 1MX2A 2F37A 4LG6A 4YDWA 3UI2A 4RLYA 1K1BA 5JMND 2XENA 1N0RA 5AARA 5HKPA 1G3NB 2V5QC 2XZTG 3NOGD 3TWVA 4F6RD 5CEAA 4LNUD 5HS0A 4BEPA 4DX7D 4ZFHA 4K5AB 1BI7B 1IHBA 3EU9A 3W9GA 4HQDA 2FO1E 1A5EA 2NYJA 2DZNA 1N11A 2L6BA 3EHQA 4JB8P 5ENPD 4DX5D 4HNAD 3C5RA 4OAUC 2B0OE 5FIOA 4J7WA 2XEHA 2QYJA 2XZDG 4G8KA 4GMRA 4HB5A 3HRAA 5ENTD 1DC2A 4BESA 2F8XK 3ZNGA 1YMPA 4TUMA 3HG0D 3J5PA 4O1OA 3B7BA 3AJIA 4K5CA 2Y0BG 5KBAA 4U8YD 5D66A 3W9FA 5CEDB 4C48B 3V79K 4DX2A 5FINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUI A;  5BXO A;  5EN5 D;  2KBX A;  5AQA A;  2ZGG A;  1IKN D;  2F8Y A;  3TWQ A;  4CYM D;  4HI9 A;  4DX6 D;  5ITZ F;  5CBO A;  2RFM A;  4QFV A;  5EYP F;  3TWW A;  5ENS D;  3ZKJ A;  5JA4 D;  1SW6 A;  2BKG A;  2ETB A;  2BKK B;  3LJN A;  3TWR A;  4BET A;  4B93 B;  5AQ9 A;  4U95 D;  4DX1 A;  4ATZ D;  5EYL A;  2VGE A;  3TWX A;  1MJ0 A;  4J8Y A;  2J8S D;  3F6Q A;  4UUC A;  4Z68 A;  3UXG A;  5CER B;  3TWU A;  3D9H A;  3Q9U C;  1SVX A;  3JXJ A;  1OY3 D;  3EHR A;  1YYH A;  3ZUV B;  4O1P A;  2DVW A;  4OAV B;  4HLL A;  2HE0 A;  3Q9N C;  4HRM B;  4K5B A;  1AP7 A;  3ZU7 B;  3JXI A;  4HBD A;  1QYM A;  4HRL A;  5KNH D;  1AWC B;  2ETA A;  2PNN A;  5ENO D;  4CZ2 D;  5ENQ D;  1IXV A;  4U96 D;  3TWS A;  1WG0 A;  3V31 A;  1MYO A;  5AN8 A;  1MX6 A;  2KXP C;  2XEE A;  4HI8 A;  1DCQ A;  3JUE A;  3T8K A;  4U8V D;  5HRY A;  3KEA A;  2P2C P;  4F1P A;  5ENR D;  4ZHB A;  5CEC B;  1BLX B;  3B95 A;  4A63 B;  1OT8 A;  3NBN B;  4DRX E;  1MX4 A;  2V4H C;  3V30 A;  4O60 A;  5BXU A;  1BD8 A;  3T9K A;  1UOH A;  1YCS B;  3V2X A;  3DEP A;  4G8L A;  4NIK A;  1D9S A;  3TWT A;  5KWD A;  3IXE A;  1NFI E;  3SO8 A;  2ETC A;  5EIL A;  3J5Q B;  2Y1L E;  4HRN A;  4LSZ E;  4QQI A;  4GPM A;  1TR4 A;  2JAB A;  5EID A;  5KNG A;  2RFA A;  1WDY A;  1K3Z D;  2ZGD A;  1S70 B;  2DWZ A;  3DEO A;  4YDY A;  5CBN A;  4N5Q A;  3V2O A;  1K1A A;  5AQ7 A;  5AQB A;  3UTM A;  2AJA A;  3NOC D;  1N0Q A;  2MYO A;  3AAA C;  5AAO A;  4BER A;  5EIB E;  2QC9 A;  4BSZ B;  1BI8 B;  2DZO A;  1BU9 A;  2A5E A;  1MX2 A;  2F37 A;  4LG6 A;  4YDW A;  3UI2 A;  4RLY A;  1K1B A;  5JMN D;  2XEN A;  1N0R A;  5AAR A;  5HKP A;  1G3N B;  2V5Q C;  2XZT G;  3NOG D;  3TWV A;  4F6R D;  5CEA A;  4LNU D;  5HS0 A;  4BEP A;  4DX7 D;  4ZFH A;  4K5A B;  1BI7 B;  1IHB A;  3EU9 A;  3W9G A;  4HQD A;  2FO1 E;  1A5E A;  2NYJ A;  2DZN A;  1N11 A;  2L6B A;  3EHQ A;  4JB8 P;  5ENP D;  4DX5 D;  4HNA D;  3C5R A;  4OAU C;  2B0O E;  5FIO A;  4J7W A;  2XEH A;  2QYJ A;  2XZD G;  4G8K A;  4GMR A;  4HB5 A;  3HRA A;  5ENT D;  1DC2 A;  4BES A;  2F8X K;  3ZNG A;  1YMP A;  4TUM A;  3HG0 D;  3J5P A;  4O1O A;  3B7B A;  3AJI A;  4K5C A;  2Y0B G;  5KBA A;  4U8Y D;  5D66 A;  3W9F A;  5CED B;  4C48 B;  3V79 K;  4DX2 A;  5FIN A; 
#chains in the Genus database with same CATH topology
 5EN5 D;  3QC1 A;  3QWW A;  4UWK A;  3Q73 A;  1H6K A;  5EYP F;  2LNI A;  1ZB1 A;  4B93 B;  4DX1 A;  1E7U A;  4GZD A;  3MGB A;  5LX8 A;  2OEV A;  4RVB A;  3JXJ A;  1OY3 D;  2EIJ E;  3C3O A;  3FU6 A;  4B0Z A;  2OCC E;  2J49 A;  1AWC B;  4GTV A;  1MYO A;  4E85 A;  3JUE A;  3ZRH A;  2WB2 A;  3MV3 B;  3T9K A;  1O1S A;  4J0U A;  3ESK A;  3PNT B;  4C9B B;  3L08 A;  3SGH A;  3MEK A;  3NZU A;  2DIW A;  3PVL A;  5KJL A;  1OCC E;  2XCB A;  4I6E A;  2P9P G;  3Q47 B;  4GYY A;  3OXG A;  5D2M C;  3LJ3 A;  3WXX A;  1HXI A;  3P2B A;  2V0P A;  4HOS A;  5A6C A;  1TN6 A;  2WXI A;  3D9I A;  3S2A A;  2R05 A;  4X8Q A;  5JMN D;  2R03 A;  1E8Z A;  1Y8M A;  2WMO A;  5JJT A;  4F6R D;  2VSO E;  4GCN A;  2RD0 A;  2X6I A;  3EUV A;  3L22 A;  1JCS A;  4G8K A;  3EIQ C;  3KAE A;  2MHK A;  4ANU A;  5T3R A;  2Y0B G;  3RAU A;  3RIB A;  2A4Z A;  3PS6 A;  2LXM A;  3FHE A;  3LJN A;  3SY2 A;  2V8S E;  1FT1 A;  3CK7 A;  4C0E A;  1MJ0 A;  1A17 A;  2H6F A;  2H6I A;  4GU5 A;  3DSV A;  4K5B A;  2PZI A;  1H19 A;  3HXE A;  4GAA A;  4URK A;  2PM7 A;  5AN8 A;  2L0T B;  3T8K A;  3C3R A;  3D9O A;  2XQ0 A;  3N71 A;  4C0M A;  2NSZ A;  2X6F A;  2WXH A;  4FUL A;  4O60 A;  4MKT A;  3CVX A;  2KC7 A;  3NAW A;  2WXR A;  2LAH A;  4PH4 B;  3ULE G;  4A55 A;  4LCT A;  3HXD A;  5JJ6 A;  4I2W A;  4AIF A;  2IOS A;  4GYW A;  3CHM A;  4JA9 A;  3UTM A;  1SA5 A;  2QYU A;  2WXK A;  2P58 C;  4GTM A;  4MS6 A;  4A3V A;  1E8W A;  1DCE A;  1Z6T A;  2P9I G;  4RLY A;  4YDE A;  4HFG A;  4R7L A;  4FLH A;  4ILG A;  4EZJ A;  4JXT A;  2XZT G;  3CHQ A;  1ELW A;  4EZL A;  3W9G A;  4EBA G;  3QK0 A;  3EHQ A;  4BTB A;  2XZD G;  3GZ1 A;  4FA6 A;  3LDZ A;  4XE0 A;  3KEZ A;  1YMP A;  3D9J A;  4WNF A;  4C48 B;  1WY6 A;  5D0O D;  2LUH A;  2L6J A;  1OXJ A;  1OUV A;  2BKK B;  4CDR A;  3PZ3 A;  4F1S A;  5EYL A;  4U8H A;  3NB2 A;  4P29 A;  1P5Q A;  3EDT B;  3ZIM A;  2J08 A;  3AU5 A;  1SA4 A;  2VQ2 A;  2WQH A;  3TGO A;  3TWU A;  3HXF A;  4OVU A;  3Q9U C;  1ELR A;  3ZEF A;  3Q9N C;  3Q5M A;  3PZ4 A;  4GZ6 A;  1HZ4 A;  1S0P A;  2R59 A;  5KCM A;  2KCL A;  3LEW A;  4GYO A;  2IEJ A;  2WXL A;  4AJW A;  4Q94 A;  3BG0 B;  3V30 A;  5BXU A;  3L9T A;  4KVO A;  3PZ1 A;  3ZHE A;  3IXE A;  3QOU A;  3B13 A;  1DVP A;  3P1U A;  1N94 A;  3UX4 A;  2EIK E;  4JEH A;  1D8D A;  3G2W A;  3FU5 A;  5AAO A;  5EIB E;  2HO1 A;  4MLP A;  4U63 A;  3Q49 B;  4D10 C;  4TV3 A;  2XGO A;  2XRY A;  3PDN A;  1A5E A;  4WNG A;  4GA0 A;  5DBK A;  2WXJ A;  3FUF A;  4GMR A;  2OEW A;  3QJZ A;  3ZNG A;  1JWG A;  4L1B A;  3FTU A;  4HS2 A;  1DNP A;  2I9C A;  4EEC A;  1IKN D;  3ZKJ A;  4I1A A;  4L2Y A;  3T8M A;  1INZ A;  3SFX A;  1UW4 B;  4I6G A;  3FUN A;  5AEN A;  2PL2 A;  2AWI A;  3BG1 B;  2H6H A;  4HRM B;  1NA3 A;  4KMO A;  3ABK E;  2C2L A;  2P9L G;  4EZK A;  3FDH A;  2CG2 A;  3FTV A;  3TL5 A;  4A63 B;  1OT8 A;  3NBN B;  1TN8 A;  4DI4 A;  3V2X A;  3HXC A;  1NL4 A;  4GPK A;  2PQR A;  4GPM A;  1TR4 A;  3KS2 A;  3CGH A;  4WWP A;  4H7Y A;  4GB9 A;  1FT2 A;  4YDY A;  1O5M A;  3V2O A;  2VGX B;  3NOC D;  3ZFW A;  1OCZ E;  4CCA A;  4GCO A;  1EYH A;  1FPP A;  3UT4 A;  3TXM A;  3LXU X;  2IY0 C;  3PZ2 A;  1X81 A;  1JUQ A;  4N3A A;  4EBA A;  1Q2Z A;  4A3T A;  5E75 A;  4JD2 G;  1DC2 A;  4FHK A;  3SD5 A;  2WXP A;  4J8F A;  4JC8 A;  4U8Y D;  3W9F A;  5CED B;  4TXQ A;  4NAC A;  3AS4 A;  3U3W A;  3FTW A;  5JJ7 A;  2RFM A;  1N4S A;  4U95 D;  4TXR A;  2WXO A;  3EIJ A;  4YVQ C;  3MKQ B;  3F6Q A;  3R9M A;  4UI9 J;  2HE0 A;  3UM0 A;  1NP7 A;  5HQ8 A;  4IRU A;  5ENO D;  5D0Q D;  1TJC A;  3LVR E;  3FU3 A;  3HHM A;  5EX3 A;  2XEV A;  3UKU G;  1EPU A;  1ZU2 A;  4G8L A;  3FUI A;  3HYM B;  2I6H A;  3G2U A;  1H6P A;  3KSL A;  3RRU A;  5AIJ A;  2WVI A;  4APO A;  3S7J A;  1K1A A;  4DLQ A;  4BWR A;  1FVH A;  4BER A;  1GW6 A;  3RU0 A;  3FTX A;  3ULY A;  4N39 A;  4JHJ A;  5C2Y A;  4JHR A;  4CRW A;  2HR2 A;  4AV7 A;  5CEA A;  2IJG X;  2EIL E;  3AG1 E;  1WAO 1;  4XKB A;  3TJP A;  3FFL A;  2QYJ A;  4GA2 A;  4BES A;  2WQ6 A;  3CVL A;  2R2L A;  1FVF A;  5FQ4 A;  3DXK G;  4O1O A;  5KBA A;  3TXN A;  2XHE A;  4PS7 A;  4RG6 A;  4KZ0 A;  2YIN A;  3DSW A;  1JPL A;  4UI9 K;  4F53 A;  2OOE A;  4G23 A;  3S7F A;  2J8S D;  3D9P A;  3MJW A;  4BTA A;  4WWO A;  4BX9 A;  3IV0 A;  4OAV B;  3APF A;  3FUK A;  2MOW A;  2ETA A;  3BQO A;  3JYS A;  1E90 A;  5CMW A;  1WG0 A;  4CT0 A;  2YHE A;  4AEZ C;  3VLD A;  3KEA A;  1IHG A;  5CCM A;  1PAQ A;  4JA7 A;  3CHO A;  1H2V C;  1OWN A;  3MCX A;  3QWP A;  2X6J A;  1W3B A;  2WXF A;  1D9S A;  1NFI E;  3HVE A;  4L9P A;  3SO8 A;  4LSZ E;  4B8A A;  2E0I A;  5KNG A;  2RFA A;  4PS3 A;  4TXP A;  4XEI G;  2OVB A;  5CCL A;  2ZIS A;  2I1J A;  5CBN A;  3SHF A;  3RRM B;  1NI1 A;  2WM9 A;  2FF4 A;  5KJN A;  3RO2 A;  4DI3 A;  1TYQ G;  2E2E A;  5FWQ A;  3QKY A;  2XPI A;  5ARF A;  1G3N B;  2V5Q C;  3NOG D;  3TWV A;  4Q69 A;  4U04 A;  3ABM E;  3EU9 A;  4B94 A;  2KCV A;  4OAU C;  2WXN A;  4TUM A;  1HFA A;  3AS8 A;  2OVF A;  5JHB A;  3ULQ A;  2XS1 A;  3NQP A;  2ION A;  4HXI A;  5G04 J;  5CBO A;  3E4B A;  5JA4 D;  5KWD A;  3ZW3 A;  4FP7 A;  2JEK A;  4KYO B;  4CT4 A;  3NZS A;  5JHA A;  3D9H A;  3JCK C;  2CG3 A;  2XS8 A;  4B8C B;  1KZP A;  1QYM A;  1IQU A;  1TEZ A;  3MYV A;  1IXV A;  1HG5 A;  4B89 A;  2I1K A;  1SQM A;  3IHY A;  2KXP C;  3SF4 A;  1H2U A;  2P9K G;  3JUI A;  3R7Q A;  4YVO A;  1D8E A;  1YCS B;  1RW2 A;  3UT8 A;  3CSF A;  3GYZ A;  3Q4A B;  4QQI A;  4XKC A;  2JAB A;  3CST A;  2VTB A;  5LCW J;  3DST A;  3UIN C;  2VGY A;  5AQB A;  1YA0 A;  3ONL A;  3LCA A;  4U0Z A;  3UM1 A;  2LAI A;  2YNQ A;  5AJL A;  4DPR A;  5FQ8 A;  2IQC A;  3UI2 A;  4Y6C A;  4EQF A;  4PUC A;  2J4B A;  2GRM A;  5AAR A;  2VJ8 A;  2CHX A;  4HOQ A;  3FEY A;  4GMJ A;  1BI7 B;  2FEZ A;  4GTR A;  4O6F A;  4N2Q A;  2JLB A;  3SI5 A;  2OND A;  3K9I A;  4YDO A;  1HO8 A;  4MRU A;  2Y69 E;  5D66 A;  2GRR B;  3RJV A;  1MZC A;  3QWV A;  3O48 A;  3L16 A;  3IBE A;  3BU8 A;  1KPS B;  4Y6W A;  3L54 A;  3ZVV A;  3E34 A;  3EHR A;  3FUM A;  3MKR A;  2LSU A;  4LER A;  4XI0 A;  4LUN U;  1KT1 A;  4Q96 A;  4J8E A;  4PS8 A;  4EHM A;  3LYA A;  3C3Q A;  4UQX A;  5ENQ D;  3OAW A;  4U96 D;  3TWS A;  2XEE A;  3D9N A;  4FJZ A;  1EDU A;  2R17 C;  3TG4 A;  4EPZ A;  2WXM A;  3R7R A;  5FTP A;  2KZT A;  2IU1 A;  5CHE E;  3D9M A;  2MRI A;  4NRH B;  1Z3Y A;  4I17 A;  3Q15 A;  1N95 A;  3J5Q B;  4HRN A;  4HLE A;  2V5F A;  3CHR A;  2F0Y A;  4FHJ A;  5G2N A;  4PDX A;  1U3D A;  1L5J A;  4JPS A;  2AJA A;  3U4T A;  3Q75 A;  4GZ3 A;  4WUY A;  1RZ4 A;  1N4R A;  1N0R A;  4HVB A;  4GZ5 A;  2CFZ A;  4F7A A;  1QNF A;  4CGW A;  4LNU D;  4ANV A;  4DJA A;  4G25 A;  4HQD A;  4AP2 A;  2NYJ A;  5ENP D;  4DX5 D;  3C5R A;  4I9E A;  3ENE A;  5M72 A;  5BV0 A;  1HU3 A;  1OCO E;  5E76 A;  3V79 K;  3QAR A;  2RG8 A;  1NA0 A;  4GTQ A;  1V54 E;  4J8S A;  4UI9 C;  4AVX A;  5AQ9 A;  1IQR A;  3O4Z A;  3B7U X;  4ACL A;  5HI7 A;  5G05 J;  3I3N A;  1X5B A;  3UXG A;  2YHC A;  2DVW A;  3SBT B;  3ZHE B;  2ZIR A;  1AP7 A;  3CVP A;  2X6H A;  4HBD A;  2M63 A;  3UKR G;  3DWL G;  5H7P A;  5BPP A;  2GRP B;  3MX3 A;  4F1P A;  1FCH A;  3CKC A;  2DBA A;  3CV0 A;  2NXP A;  2AXV A;  3T5V A;  2DYS E;  3I5P A;  3APC A;  2QY7 A;  5EID A;  2H6G A;  3FTZ A;  1S70 B;  3CVU A;  3PUJ A;  2FI7 A;  4AM9 A;  4JL0 A;  1JCQ A;  5G55 A;  3UT7 A;  4XIF A;  2A5E A;  5ARG A;  4RQI A;  4CGV A;  4U07 A;  5KJK A;  2XEN A;  3DSS A;  1MHQ A;  4K0R A;  4BEP A;  1E7V A;  2CHW A;  2WXQ A;  2FO1 E;  3UQ3 A;  3CVY A;  3J5P A;  3B7B A;  3AU4 A;  3UM3 A;  4DX2 A;  5FIN A;  3AG4 E;  2KBX A;  5AJD A;  5J90 A;  5ITZ F;  2J9Q A;  4I2Z A;  3QNK A;  5KJM A;  3PNL B;  1K8K G;  5EDS A;  2CFU A;  4OYS A;  2BUG A;  3S7D A;  3MA5 A;  2VSY A;  1YYH A;  4O1P A;  4ANX A;  2EIN E;  5CMY A;  4HRL A;  5KNH D;  2L9B A;  4CZ2 D;  2ZU6 B;  1BPO A;  4AXH A;  4HI8 A;  3FUH A;  4N5C A;  3LVQ E;  4RSY A;  3B95 A;  2FUL A;  2QZA A;  2V4L A;  1SZA A;  4HOT A;  3RK6 A;  3LKU A;  3DEP A;  3UM2 A;  4NIK A;  5FZR A;  3ZGQ A;  4UQZ A;  4BT8 A;  2X3M A;  4IYP A;  2XPY A;  4N5Q A;  2DCP A;  1N0Q A;  3L17 A;  1HF8 A;  1Y6I A;  3C72 A;  3ZXP A;  3ABL E;  3FTS A;  3CVV A;  4BT9 A;  3CK9 A;  5HS0 A;  3QDN A;  4UQY A;  2DZN A;  2AXZ A;  3FH5 A;  4JB8 P;  1H2T C;  3KD7 A;  5G04 C;  4J7W A;  4HB5 A;  5LFA A;  2XRZ A;  2J09 A;  3ASG A;  1O1R A;  2GRO B;  2Y4U A;  2FBN A;  3ML9 A;  1OCR E;  4DUI A;  5AQA A;  3TWQ A;  5B1A E;  2FO7 A;  1E96 B;  3VLE A;  1LF8 A;  4J8Y A;  1HS6 A;  1TJF A;  1Z3X A;  1ZBP A;  1XGW A;  4ACK A;  5LP0 A;  5DIZ A;  3X2Q E;  4H7X A;  3ZYM A;  5EX0 A;  3CQC B;  2HYZ A;  3DRA A;  4NQ0 A;  4WND A;  5LCW C;  4DRX E;  1MX4 A;  1QQE A;  3TWT A;  4BX8 A;  4XI9 A;  4LRZ A;  2GRL A;  3U66 A;  5FZQ A;  4I1O B;  1OWL A;  2Y1L E;  2EQX A;  3FY4 A;  1JCR A;  1K3Z D;  2VSX E;  4KXK B;  4FJY A;  3FWV A;  1PY1 A;  3ASN E;  1KLX A;  4GTO A;  1O1T A;  2F37 A;  3PE3 A;  5HKP A;  3JQ1 A;  3E30 A;  3B7S A;  3DSU A;  1JWF A;  5AYW D;  3DXM G;  2B6C A;  4FC8 A;  2LO6 A;  4GTP A;  2XEH A;  5LOZ A;  2R02 A;  5ENN A;  3B7T A;  2BED A;  4UWH A;  5EKQ D;  3OXF A;  3LPZ A;  3CQG B;  4A1G A;  1N4Q A;  3TWW A;  3DPD A;  2XPZ A;  2L0I A;  2P9N G;  3CVW A;  4K03 A;  1OWM A;  2VGE A;  2P9S G;  2BTD A;  1KT0 A;  2ZXW E;  4N3C A;  1LTX A;  4AY5 A;  3JXI A;  3OXL A;  2C0M A;  3HVE B;  2PNN A;  1TNU A;  2WXG A;  3V31 A;  3C98 A;  3AG2 E;  4U8V D;  2ILR A;  5ENR D;  1BLX B;  4DLO A;  2GRQ B;  4U0S A;  4UWG A;  4XX5 A;  3ZPJ A;  3L82 A;  2ETC A;  5IY5 E;  2IFU A;  3SFY A;  3FUL A;  3KSQ A;  1WDY A;  2DWZ A;  4NUR A;  3QB2 A;  3Q78 A;  4BSZ B;  1OWP A;  1UG3 A;  3GZS A;  5CRU A;  4JVS A;  3ML8 A;  2IO3 C;  3Q79 A;  3FUJ A;  1TNZ A;  4ILH B;  4KT6 B;  2KCK A;  5FZS A;  1TNY A;  4KBQ A;  3SBS A;  3TG5 A;  4DX7 D;  4ZFH A;  1N11 A;  5T8I A;  1ELK A;  4CDM A;  5FIO A;  4YND A;  5C1D A;  4ILI A;  5ENT D;  3PZD A;  3HG0 D;  4TRQ A;  3LY9 A;  5G05 C;  2ZGG A;  2F8Y A;  2KM4 A;  4HI9 A;  3CKB A;  2X6K A;  4QFV A;  3CLJ A;  1SW6 A;  2KAT A;  2VSN A;  3D3M A;  4BET A;  3EJN A;  4DK5 A;  2HM8 A;  3LS8 A;  5CER B;  1SVX A;  4GML A;  4LEU A;  4ANW A;  3ZU7 B;  3I4R B;  2WPV A;  4G2V A;  1S63 A;  4KZC A;  2VTB B;  2IF4 A;  2P9U G;  5ANR A;  2P2C P;  5CEC B;  3CIA A;  1XNF A;  1H6O A;  4IUL A;  1UOH A;  3IHV A;  3PEU B;  2BF0 X;  3U64 A;  1OWO A;  4I43 A;  4J8D A;  1N52 A;  5EIL A;  3ZYK A;  1NZN A;  2LSV A;  4V3I A;  5J08 A;  2WQ7 A;  4U0U A;  4GZC A;  2MYO A;  3QAQ A;  3FH8 A;  4WNE A;  1LD8 A;  4LG6 A;  1K1B A;  4G1T A;  4BY6 A;  4G11 A;  3R9A B;  2Y3A A;  2B0O E;  3PUK A;  2WMN A;  4E6H A;  2RKK A;  3S7B A;  4BSX A;  4K5C A;  5B1B E;  3L6A A;  5BXO A;  1TNB A;  4DX6 D;  1WM5 A;  3ONK A;  1UN9 A;  2Q7F A;  3ASF A;  3UMV A;  5ENS D;  3RO3 A;  3TWR A;  2AXU A;  4ATZ D;  3CVQ A;  3RSE G;  3ZYL A;  2UWJ G;  4Z68 A;  1TNO A;  2KZT B;  3E32 A;  3ZUV B;  3U9W A;  4N3B A;  3VTY A;  4M3O A;  2XGS A;  4UWL A;  3EU5 A;  2DYR E;  3RRN B;  2OV8 A;  3VLF A;  3G2V A;  2AW6 A;  4W9R A;  1B89 A;  4WAF A;  2VYI A;  5BV1 A;  2V4H C;  3UIP C;  2PQN A;  4AY6 A;  2GW1 A;  3LY8 A;  4XZ4 A;  5T4Y A;  1HH8 A;  4A1S A;  1V55 E;  5ANL A;  4LNB A;  4FAD A;  1N9A A;  3SFZ A;  4OVV A;  3CR3 A;  5AQ7 A;  3PRZ A;  2NC9 A;  3GZ2 A;  3TAX A;  2QC9 A;  4L7T A;  5B3S E;  3MV2 B;  1MQS A;  4GA1 A;  1MX2 A;  4YDW A;  1HX8 A;  2EIM E;  4K5A B;  1IHB A;  2VGX A;  3T5X A;  5FT9 A;  3D9K A;  2L6B A;  4JW1 A;  3FUD A;  3ASD A;  2Y4T A;  4JHK A;  4I1M A;  2F8X K;  3EHN A;  3MZL B;  1U2V G;  4FU3 A;  4GTT A;  3D9L A;  4CEM A;  3Q7F A;  3UUX A;  3UIO C;  2I2O A;  2BKG A;  2ETB A;  3I4G A;  4MBG A;  3RKV A;  3FU0 A;  1UN8 A;  4FLB A;  3VTX A;  5A23 A;  2J4D A;  3URZ A;  1Z5S C;  2X38 A;  3CVN A;  3ASO E;  4HLL A;  4KVM A;  4CDN A;  4HOR A;  3CHP A;  4WWN A;  4I9C A;  4UWF A;  2A5U A;  2GGF A;  3PH0 C;  3WG7 E;  1DCQ A;  1HE8 A;  5HRY A;  4J6I A;  3OTN A;  1E8Y A;  3MKQ A;  4HOU A;  3L13 A;  2J07 A;  1LD7 A;  3BUA A;  3HXB A;  3ESL A;  5BUZ A;  4BFR A;  3Q7A A;  3HIZ A;  4L2L A;  2LXL A;  3SQV A;  5A7D B;  2QFC A;  2IOL A;  2XCC A;  3BEE A;  1UJJ A;  4TUU A;  4RG9 A;  1BI8 B;  1BU9 A;  1QBQ A;  1HG2 A;  3B7R L;  4AOF A;  1VDY A;  3PE4 A;  2UY1 A;  2AVP A;  3ZN3 A;  1N54 A;  3SZ7 A;  3DPY A;  2GRN B;  3ZYQ A;  4G26 A;  3ASH A;  3FUE A;  4M7C A;  1S64 A;  3IEG A;  5BW8 C;  4CYM D;  5FQ7 A;  3G2T A;  3AG3 E;  1UJK A;  2IO2 C;  4LNG A;  2XGM A;  4G24 A;  3TWX A;  2R5S A;  5BNW A;  4UUC A;  4GTS A;  4F3V A;  4JEU A;  3ISM C;  3PRE A;  1U3C A;  2UY1 B;  3LY7 A;  5BT1 A;  3CHS A;  1MX6 A;  3G2S A;  4JZY A;  4ZHB A;  3CK8 A;  3HDX A;  1N4P A;  1SZ9 A;  2CHZ A;  1BD8 A;  4L23 A;  5FQ6 A;  1KZO A;  1H0A A;  4ATG A;  5CRV A;  2ZGD A;  3E37 A;  3DEO A;  3JQ0 A;  3CEQ A;  2YQ8 A;  4N2S A;  2PM6 A;  4ABN A;  3AS5 A;  3AAA C;  3DSX A;  2DZO A;  3FH7 A;  3PEV B;  4IN3 B;  4U7E B;  3ZXS A;  1TN7 A;  4ME2 A;  3SNX A;  2C0L A;  3EHM A;  3DBS A;  3FP3 A;  1IYG A;  4HNA D;  5FJY A;  1EF1 C;  3HRA A;  3FTY A;  1QZ2 A;  3FEX A;  3UPV A;  3IKO B;  4APF A;  1E8X A;  3NF1 A;  3APD A;  3AJI A;  3GW4 A;  3E33 A;  4I6J A;  1PC2 A; 
#chains in the Genus database with same CATH homology
 4DUI A;  5BXO A;  5EN5 D;  2KBX A;  5AQA A;  2ZGG A;  1IKN D;  2F8Y A;  3TWQ A;  4CYM D;  4HI9 A;  4DX6 D;  5ITZ F;  5CBO A;  2RFM A;  4QFV A;  5EYP F;  3TWW A;  5ENS D;  3ZKJ A;  5JA4 D;  1SW6 A;  2BKG A;  2ETB A;  2BKK B;  3LJN A;  3TWR A;  4BET A;  4B93 B;  5AQ9 A;  4U95 D;  4DX1 A;  4ATZ D;  5EYL A;  2VGE A;  3TWX A;  1MJ0 A;  4J8Y A;  2J8S D;  3F6Q A;  4UUC A;  4Z68 A;  3UXG A;  5CER B;  3TWU A;  3D9H A;  3Q9U C;  1SVX A;  3JXJ A;  1OY3 D;  3EHR A;  1YYH A;  3ZUV B;  4O1P A;  2DVW A;  4OAV B;  4HLL A;  2HE0 A;  3Q9N C;  4HRM B;  4K5B A;  1AP7 A;  3ZU7 B;  3JXI A;  4HBD A;  1QYM A;  4HRL A;  5KNH D;  1AWC B;  2ETA A;  2PNN A;  5ENO D;  4CZ2 D;  5ENQ D;  1IXV A;  4U96 D;  3TWS A;  1WG0 A;  3V31 A;  1MYO A;  5AN8 A;  1MX6 A;  2KXP C;  2XEE A;  4HI8 A;  1DCQ A;  3JUE A;  3T8K A;  4U8V D;  5HRY A;  3KEA A;  2P2C P;  4F1P A;  5ENR D;  4ZHB A;  5CEC B;  1BLX B;  3B95 A;  4A63 B;  1OT8 A;  3NBN B;  4DRX E;  1MX4 A;  2V4H C;  3V30 A;  4O60 A;  5BXU A;  1BD8 A;  3T9K A;  1UOH A;  1YCS B;  3V2X A;  3DEP A;  4G8L A;  4NIK A;  1D9S A;  3TWT A;  5KWD A;  3IXE A;  1NFI E;  3SO8 A;  2ETC A;  5EIL A;  3J5Q B;  2Y1L E;  4HRN A;  4LSZ E;  4QQI A;  4GPM A;  1TR4 A;  2JAB A;  5EID A;  5KNG A;  2RFA A;  1WDY A;  1K3Z D;  2ZGD A;  1S70 B;  2DWZ A;  3DEO A;  4YDY A;  5CBN A;  4N5Q A;  3V2O A;  1K1A A;  5AQ7 A;  5AQB A;  3UTM A;  2AJA A;  3NOC D;  1N0Q A;  2MYO A;  3AAA C;  5AAO A;  4BER A;  5EIB E;  2QC9 A;  4BSZ B;  1BI8 B;  2DZO A;  1BU9 A;  2A5E A;  1MX2 A;  2F37 A;  4LG6 A;  4YDW A;  3UI2 A;  4RLY A;  1K1B A;  5JMN D;  2XEN A;  1N0R A;  5AAR A;  5HKP A;  1G3N B;  2V5Q C;  2XZT G;  3NOG D;  3TWV A;  4F6R D;  5CEA A;  4LNU D;  5HS0 A;  4BEP A;  4DX7 D;  4ZFH A;  4K5A B;  1BI7 B;  1IHB A;  3EU9 A;  3W9G A;  4HQD A;  2FO1 E;  1A5E A;  2NYJ A;  2DZN A;  1N11 A;  2L6B A;  3EHQ A;  4JB8 P;  5ENP D;  4DX5 D;  4HNA D;  3C5R A;  4OAU C;  2B0O E;  5FIO A;  4J7W A;  2XEH A;  2QYJ A;  2XZD G;  4G8K A;  4GMR A;  4HB5 A;  3HRA A;  5ENT D;  1DC2 A;  4BES A;  2F8X K;  3ZNG A;  1YMP A;  4TUM A;  3HG0 D;  3J5P A;  4O1O A;  3B7B A;  3AJI A;  4K5C A;  2Y0B G;  5KBA A;  4U8Y D;  5D66 A;  3W9F A;  5CED B;  4C48 B;  3V79 K;  4DX2 A;  5FIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...