4ATZD

Ad5 knob in complex with a designed ankyrin repeat protein
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
154
structure length
154
Chain Sequence
DLGKKLLEAARAGQDDEVRILMANGADANAYDHYGRTPLHMAAAVGHLEIVEVLLRNGADVNAVDTNGTTPLHLAASLGHLEIVEVLLKYGADVNAKDATGITPLYLAAYWGHLEIVEVLLKHGADVNAQDKFGKTAFDISIDIGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fiber protein
publication title Development of a generic adenovirus delivery system based on structure-guided design of bispecific trimeric DARPin adapters.
pubmed doi rcsb
source organism Human adenovirus c serotype 5
molecule tags Viral protein/de novo protein
total genus 46
structure length 154
sequence length 154
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2012-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4atzD00
3KEAA 3TWXA 5KWDA 4NIKA 3HG0D 2FO1E 3V2OA 2V5QC 3AAAC 4HQDA 3TWSA 2ETCA 3NBNB 1BU9A 4HI8A 1DCQA 2NYJA 3Q9UC 4LSZE 5CERB 3V30A 2F8YA 4HNAD 5EYPF 5AARA 2XEHA 3TWQA 3UI2A 3ZUVB 2ETAA 3TWTA 4HBDA 3TWWA 3HRAA 3JXJA 4YDYA 1YMPA 4U96D 3W9FA 2BKGA 4A63B 2QYJA 3C5RA 4DX1A 3IXEA 3Q9NC 4J8YA 5EYLA 5AN8A 2B0OE 1SVXA 4DX6D 3TWUA 4QQIA 2DVWA 1MX2A 1OY3D 2DZOA 1WDYA 5AAOA 4HRNA 2KXPC 3SO8A 4QFVA 1QYMA 4GMRA 3ZU7B 4CYMD 4DRXE 1A5EA 1UOHA 1G3NB 2DWZA 2XEEA 4LNUD 4OAVB 3B95A 1TR4A 5EN5D 4U8VD 3EU9A 4YDWA 2F8XK 4LG6A 3ZKJA 2J8SD 5AQ9A 5AQAA 1MX6A 4B93B 3V79K 5KBAA 2BKKB 4DX5D 3J5PA 3AJIA 5AQBA 5CEDB 4K5CA 3V31A 1IHBA 4Z68A 5ENQD 1AWCB 4BEPA 1AP7A 1D9SA 4HRMB 5HKPA 1DC2A 5ENOD 4OAUC 3EHRA 4G8KA 2KBXA 4G8LA 4CZ2D 1MYOA 1YCSB 1K3ZD 3T9KA 4K5AB 4HB5A 2XZDG 2JABA 2AJAA 3W9GA 1N11A 1K1BA 1MX4A 3JUEA 1NFIE 4U8YD 5EILA 5KNGA 5CBNA 2A5EA 5BXOA 3NOCD 5KNHD 3T8KA 1K1AA 4GPMA 4HLLA 4BESA 4O1PA 2ETBA 1BI8B 3LJNA 4BERA 2ZGGA 4UUCA 2MYOA 4TUMA 5ENPD 3DEPA 4K5BA 4HRLA 1N0QA 2Y0BG 5AQ7A 5JMND 3D9HA 1SW6A 5HS0A 5JA4D 1MJ0A 5CEAA 2XENA 4DX2A 4HI9A 3DEOA 2ZGDA 4ZFHA 5EIDA 4O1OA 3B7BA 2PNNA 2RFMA 5FIOA 5ITZF 1S70B 2XZTG 3J5QB 3JXIA 3NOGD 1IKND 5HRYA 3ZNGA 5FINA 2QC9A 1OT8A 2HE0A 2Y1LE 4RLYA 5ENSD 4ATZD 1YYHA 4DX7D 4F1PA 3TWVA 2RFAA 4J7WA 4C48B 1BD8A 5CBOA 5CECB 1BLXB 3TWRA 2L6BA 5ENTD 3UXGA 5EIBE 1BI7B 3UTMA 3EHQA 4ZHBA 2VGEA 2DZNA 2F37A 2P2CP 4BETA 4F6RD 4N5QA 3V2XA 5BXUA 4DUIA 2V4HC 4JB8P 5ENRD 1WG0A 4U95D 4BSZB 5D66A 4O60A 1N0RA 1IXVA 3F6QA
chains in the Genus database with same CATH superfamily
5KJKA 2I1JA 4RQIA 2WXMA 5EYPF 5JHBA 3LJ3A 4XKBA 5J08A 3DWLG 1PC2A 3B7UX 3ULQA 2H6FA 1H6KA 1OY3D 4GMRA 3ZU7B 4XI9A 3CSFA 3PZ1A 4OVUA 4XKCA 2MHKA 3ML9A 1MX6A 2I6HA 4WUYA 2P9IG 2GRRB 3CVLA 1L5JA 4JA9A 4CCAA 2LNIA 1TNBA 2Y3AA 2AXVA 2JABA 5LCWC 4I6JA 2FBNA 2GRNB 4GZ3A 4I2WA 4PS8A 1BI8B 1NP7A 4EZLA 2WXGA 1HH8A 3RRUA 3LY8A 2KC7A 3ESLA 3AG2E 3ONLA 3FTYA 3SI5A 3PNLB 4F1PA 3TWVA 2RFAA 5CECB 4N3BA 2VGYA 4F1SA 4ILIA 4URKA 3V2XA 1WG0A 3PDNA 3ASOE 4O60A 1WM5A 2VSYA 3LCAA 4PS7A 3L13A 1FPPA 1TN8A 3TGOA 5LFAA 5AYWD 5CERB 2IJGX 2A4ZA 3ZUVB 3TWTA 4B8AA 3S7JA 3HYMB 2PL2A 1H2UA 4V3IA 2R05A 3FUKA 3Q15A 2EIKE 4CYMD 4DRXE 2ILRA 3R7RA 3ISMC 1TR4A 1HS6A 1E90A 4XX5A 2CHZA 2PQRA 3C3OA 5EX0A 2VJ8A 3EHRA 1Y6IA 4CZ2D 3LY7A 4HB5A 3NB2A 4CDRA 2PM7A 5EILA 3IHYA 3FULA 4BX8A 5ENPD 4UUCA 3PZ3A 4DLQA 1HU3A 4EBAA 5JMND 2FI7A 3AG4E 5CEAA 4G25A 5DIZA 5BV0A 4XIFA 3BEEA 3S2AA 3SQVA 3C72A 2HE0A 4I6GA 5ANRA 3U3WA 5ENSD 5FZQA 4F53A 3UM3A 2EQXA 4GA0A 3X2QE 2WQ7A 2A5UA 3OTNA 5BPPA 2XS8A 2P9UG 2V5QC 2WMNA 2NYJA 3APFA 3FEXA 1N4RA 3QDNA 2E2EA 1YMPA 4H7YA 4E85A 3CK7A 3C5RA 3HVEA 3D9NA 5CCMA 4LEUA 3U64A 3RRMB 2P9SG 3MZLB 2VSXE 1OCRE 2KM4A 4GTOA 3FTXA 3PZ4A 3UKRG 4CT0A 3DRAA 3E30A 4TRQA 2I1KA 4FADA 3DPDA 5FZSA 4PH4B 3MYVA 2YQ8A 1KT1A 2LSUA 4WWNA 4GTTA 3CHPA 1E7VA 4ANVA 4AIFA 3LJNA 1FCHA 5G05J 3TXMA 2HO1A 1E8ZA 3HXCA 1MJ0A 3CEQA 3PEVB 3TJPA 4EBAG 3D9KA 2WVIA 3OXLA 5EIDA 3HVEB 3U9WA 3U66A 2PNNA 2XHEA 4I1OB 4B8CB 2XPYA 1MHQA 3QB2A 4Q96A 4DX7D 1YYHA 2XRZA 5BNWA 4IULA 4L9PA 2VGEA 4WNDA 1HE8A 2P2CP 3FY4A 3VTXA 4AJWA 3I4GA 4U95D 1OCCE 4A1SA 3UM1A 4HOQA 2V8SE 3LYAA 2X6KA 3B7RL 2AVPA 2WB2A 3Q78A 4A3TA 1FVHA 3CKCA 3SBTB 4U96D 3I4RB 3W9FA 2L0TB 4D10C 2R03A 4WNEA 4J8YA 1HO8A 4GU5A 4HLEA 1TNUA 4QFVA 4RG6A 3B95A 4F3VA 3CVWA 1D8DA 3ABLE 4ME2A 1ZB1A 3ASDA 3N71A 3J5PA 3HHMA 4J8DA 3QKYA 3T5XA 2DYRE 1D9SA 2WXLA 4MBGA 1DC2A 4CRWA 4U63A 4EECA 1Q2ZA 3CKBA 1EYHA 2C2LA 3G2SA 2H6IA 5B1BE 3MX3A 4JHKA 3MGBA 4J6IA 4BESA 2P9KG 4IYPA 3LY9A 2CHWA 2AW6A 4BFRA 4LRZA 3D9PA 4FLBA 1TYQG 3DEOA 1E8YA 2YINA 4BT9A 4AOFA 5HRYA 1TJCA 4JA7A 4GA1A 2CG2A 2EINE 2VQ2A 3ZXSA 3LDZA 5FQ4A 1IQUA 2V4HC 3FTUA 4NQ0A 1INZA 2WXPA 3AAAC 2J07A 2ETCA 1BU9A 3I5PA 4CDMA 4MKTA 3CLJA 3BG1B 2XEHA 3PE4A 3CHMA 1K8KG 3OXGA 2RG8A 3TXNA 1JCSA 4PUCA 5LP0A 2QYJA 3FFLA 1UJKA 3LEWA 3D9OA 3L82A 4HRNA 5KJNA 3UM0A 1XGWA 5EN5D 2WXOA 2RKKA 3QJZA 2J8SD 5H7PA 3TAXA 4B93B 4K5CA 4NRHB 4PDXA 4Z68A 4CGVA 2Y4UA 2X6HA 4GTVA 1O5MA 2EILE 3MKQA 3T8KA 4HLLA 4UQZA 3SNXA 3DSUA 4CGWA 4M3OA 4K5BA 2Y0BG 4ILHB 4JEUA 2OCCE 3JCKC 4BX9A 1RW2A 4ZFHA 5DBKA 2OOEA 2GROB 2J08A 2Y1LE 1H2TC 4XZ4A 1NL4A 3CVVA 4EZKA 5FQ6A 5CRUA 3PS6A 4KZCA 3FH5A 2AXUA 4R7LA 4L23A 3EHQA 4BETA 5E76A 1ELKA 5T4YA 1JCQA 1FT2A 3FH7A 1OWPA 4C9BB 3CVYA 3SF4A 1IYGA 5B1AE 3RKVA 3IHVA 1HFAA 1O1TA 3D9LA 4KMOA 5BT1A 3V30A 5LOZA 4KBQA 2ZIRA 3NZUA 4HBDA 3TWWA 5KCMA 3MKQB 3FUIA 5CHEE 2OEVA 2J4BA 4A63B 4KXKB 5EYLA 3LVQE 3E32A 4Q94A 3ZN3A 4YVQC 5G55A 2R2LA 1UOHA 2XEEA 3ASFA 3MJWA 1HZ4A 2F8XK 1UJJA 1H19A 3HXFA 2WXRA 3UQ3A 5E75A 3ZW3A 2XGMA 4GA2A 2CG3A 4HS2A 4N3CA 3MV3B 4MLPA 2KBXA 4G8LA 1EPUA 2P58C 1OCZE 4EQFA 4G26A 1K1AA 5A6CA 2HM8A 4OVVA 2BUGA 1W3BA 3MV2B 4G24A 4UQXA 4TXQA 1OWLA 4I1MA 5FQ8A 3EIQC 2WXIA 4GZ6A 4ACLA 5FIOA 3E4BA 3J5QB 3IKOB 1PAQA 2XPIA 1OWMA 1BLXB 3FUFA 3CQGB 1YA0A 1TNYA 3KAEA 4GYYA 3UX4A 1JWFA 3SFZA 3UMVA 4L2YA 4Y6WA 3TWXA 4AVXA 4KZ0A 3PUKA 4A55A 4HOUA 2H6HA 3DSWA 2IEJA 2X38A 4CDNA 3BG0B 2GRLA 2WM9A 2KXPC 3O4ZA 4U7EB 3Q47B 3VLDA 4J0UA 3V79K 1N54A 1HG5A 3AS8A 3TG5A 4I1AA 4AEZC 1AP7A 1O1SA 4HOSA 4JC8A 1EF1C 2M63A 2V4LA 4FJZA 1N9AA 1N94A 3S7FA 2WXKA 3S7DA 3W9GA 4K03A 3UT4A 3B7SA 4GZDA 2KATA 1Y8MA 5B3SE 1UG3A 3ZYMA 4GPMA 2ETBA 1U3CA 1LF8A 2LXMA 1U2VG 1N0QA 2J09A 3CVXA 5HS0A 5C2YA 3L6AA 4AV7A 3EDTB 4U0UA 1UW4B 3B7BA 4TXRA 1XNFA 2H6GA 4RVBA 3D9JA 4U0ZA 3CGHA 3FUHA 5ENTD 3RK6A 5EIBE 3CVPA 3ZXPA 1E8WA 2LAIA 2J9QA 1X81A 3KEAA 5HQ8A 5G04J 2AWIA 2FO1E 3Q9UC 3HXDA 1WY6A 4Q69A 3UPVA 2FEZA 1SA4A 4GZ5A 2BF0X 3P2BA 1E8XA 2WMOA 3MKRA 5AAOA 5FJYA 1JPLA 2DWZA 3NZSA 4DJAA 5JJ7A 5BUZA 3ABME 2WPVA 4I43A 2C0LA 3SHFA 5AQ9A 4HOTA 3FWVA 1IHBA 4BEPA 3RSEG 1MQSA 5LX8A 1LD7A 2KZTA 3D3MA 3LPZA 3C3QA 1DVPA 4K5AB 2WXHA 2BEDA 1NA0A 4JEHA 4A3VA 1KZPA 4I17A 4UWGA 2ZGGA 3PVLA 2X6JA 1Z6TA 1ELWA 2NXPA 5ARGA 4JD2G 3NAWA 4AY6A 1N4PA 4O1OA 3UIOC 3MEKA 3EUVA 5T3RA 4FLHA 2VSNA 2EIME 1IQRA 2IO3C 2L6BA 4I6EA 3SZ7A 4JB8P 3DXMG 4GTQA 2IY0C 3AU4A 3D9IA 3QOUA 3ULYA 4GCNA 4UWKA 4RG9A 1FVFA 3AG1E 4WWOA 4HQDA 2KZTB 2OEWA 4TV3A 5ENNA 1NI1A 1B89A 4FULA 3JXJA 3Q49B 2WXFA 2DIWA 4FJYA 5G2NA 1D8EA 3HDXA 1QNFA 3K9IA 3ONKA 3G2WA 2UWJG 3QWWA 4L2LA 5C1DA 3LKUA 5KBAA 5AQBA 2HR2A 3FUEA 2AXZA 1OWNA 5D0QD 4B89A 1QBQA 3G2VA 2QFCA 2YHCA 3Q7AA 3PEUB 3ZHEA 4XEIG 3KSLA 3WXXA 4FHKA 1QQEA 5FZRA 2A5EA 3SY2A 2KCKA 3B7TA 4KVMA 3WG7E 5LCWJ 3VTYA 4E6HA 1JUQA 3ZPJA 1Z5SC 4UWLA 2XENA 3CVNA 4GMJA 4DX2A 4LNGA 4APOA 2NC9A 3D9MA 3IV0A 5FINA 3JYSA 4JZYA 4UI9C 2X3MA 4C48B 4FHJA 2R59A 3IBEA 5BXUA 4TXPA 3L16A 2IOLA 2Q7FA 3FU5A 4C0MA 5KWDA 2E0IA 3TWSA 3AU5A 3ZHEB 3L9TA 3Q73A 5FT9A 2ETAA 4AP2A 2MRIA 1KLXA 4DX1A 4WNFA 3G2TA 3T8MA 1G3NB 1RZ4A 4OAVB 3ZRHA 5BW8C 4J8EA 1FT1A 3ZKJA 5D2MC 3E34A 2L0IA 3DXKG 3AG3E 5HKPA 4L7TA 3P1UA 4HFGA 4IN3B 3MCXA 1KT0A 3PH0C 1LTXA 1OXJA 3CV0A 2VGXA 2MYOA 1BPOA 3DEPA 2PZIA 3U4TA 2P9NG 3FU6A 3LS8A 3ZYQA 1SW6A 2LSVA 5EDSA 3Q5MA 4GZCA 3UM2A 3GYZA 1N52A 3Q7FA 5ITZF 5KJLA 3GZ2A 4KYOB 1A17A 3ZYKA 2VSOE 3CVQA 3JQ1A 3ZFWA 5EX3A 1NZNA 4N5QA 4DUIA 3BU8A 3G2UA 4J8SA 1DCQA 2LUHA 3UT8A 3CHRA 4NURA 2IF4A 2VGXB 1UN9A 2B0OE 2J4DA 2DVWA 3HIZA 1N95A 2R02A 2YHEA 4I9CA 1SA5A 2XCBA 4KVOA 2GRPB 1O1RA 3AJIA 2OVBA 4JHJA 4YDEA 4OAUC 3QARA 1YCSB 3T9KA 4N2QA 4EZJA 5G05C 4HVBA 4ILGA 2V0PA 4O1PA 3KD7A 2HYZA 3FUMA 4OYSA 1N4QA 2WQ6A 3D9HA 3FTVA 5FQ7A 4HI9A 3CHOA 2WQHA 2RFMA 4GB9A 2XZTG 3APCA 3JXIA 2F0YA 1IKND 3ZNGA 1PY1A 3QK0A 1VDYA 4J7WA 1LD8A 1ZBPA 1SQMA 2V5FA 2MOWA 2ONDA 4FA6A 4RSYA 2XPZA 5A23A 4JPSA 1BI7B 3DSTA 3SD5A 4J8FA 2OVFA 1N0RA 1IXVA 4GTPA 1Z3XA 3ZIMA 3DSVA 3HG0D 4EPZA 3BQOA 3R9AB 1H2VC 3EJNA 2XRYA 2BKGA 2GRQB 5JJTA 2X6FA 4X8QA 5AN8A 1SVXA 1HF8A 4XE0A 3TWUA 3QNKA 1WDYA 3TG4A 4HORA 2WXQA 4AM9A 1S0PA 3OXFA 4YDWA 2P9LG 3I3NA 3Q79A 3BUAA 3KEZA 4ANXA 4WWPA 4U07A 4BTAA 4G8KA 3FUJA 4UI9K 3LXUX 2AJAA 3E37A 1NA3A 4YVOA 5CBNA 1TN6A 3NOCD 1H6PA 3SFYA 3FU0A 4TUMA 3FTZA 4UI9J 4G2VA 4I9EA 4G11A 2KCLA 4GYWA 4G23A 3ULEG 2ZGDA 2FULA 2QC9A 3L08A 4RLYA 3PZ2A 5AIJA 1BD8A 4BSXA 2IQCA 4YNDA 4GTRA 3Q4AB 1S64A 2EIJE 2CFZA 2PQNA 3ABKE 2DCPA 1TNZA 1KZOA 5ENRD 3DSXA 5D66A 3EHMA 3E33A 3CSTA 2OV8A 5ARFA 3FEYA 1HX8A 2GW1A 3NBNB 4FU3A 3FDHA 1H0AA 2C0MA 4HNAD 5AARA 3NQPA 2WXJA 3ASHA 3TWQA 3ASNE 1E7UA 2IOSA 2GRMA 4M7CA 1WAO1 2XGOA 3UUXA 4G1TA 1V55E 3IXEA 4PS3A 1V54E 3B13A 4U04A 5CMWA 4GMLA 4MS6A 1A5EA 1P5QA 4ANUA 4JVSA 2ZISA 1OUVA 1MZCA 4BY6A 3HXEA 4AY5A 3RRNB 3APDA 4TUUA 3CVUA 1EDUA 1ZU2A 4NACA 5ENOD 2FF4A 4ACKA 3VLEA 3EHNA 1MYOA 4DPRA 1K3ZD 2P9PG 4LUNU 2XS1A 1K1BA 1N4SA 1NFIE 5EKQD 3QWPA 5KNHD 4P29A 4UQYA 4UWHA 3PNTB 4MRUA 4BERA 2KCVA 2DBAA 4B94A 3R7QA 1HG2A 3ESKA 3GW4A 5M72A 2ZXWE 3FH8A 4O6FA 3T5VA 1DNPA 3CK8A 2UY1A 3CQCB 3CK9A 4ATZD 4IRUA 2RD0A 4CT4A 2XEVA 3GZ1A 2YNQA 3TWRA 3RO3A 2Y4TA 4JL0A 1Z3YA 2DZNA 4F6RD 1E96B 2I2OA 2L9BA 3CHQA 3FTWA 3V2OA 3KSQA 4LNBA 4JXTA 4HI8A 3RIBA 3FU3A 4L1BA 4LSZE 1QZ2A 2VTBA 3UINC 3UI2A 4GCOA 1S63A 1OCOE 4YDYA 1SZAA 5BV1A 2NSZA 3ZYLA 5AJLA 4DX6D 4I2ZA 4QQIA 1TJFA 3AS5A 2R17C 4U0SA 4U8VD 4APFA 4Y6CA 5T8IA 4LG6A 2UY1B 4LCTA 2BKKB 1X5BA 3V31A 4HRMB 2CHXA 3UT7A 3JQ0A 3FUDA 4GTMA 3TL5A 3UIPC 2XQ0A 3EIJA 5D0OD 5KNGA 2IO2C 2FO7A 2I9CA 3FUNA 3HXBA 2IU1A 2VTBB 4GTSA 1KPSB 4ABNA 5JA4D 5CMYA 3KS2A 3L54A 4DI4A 4DK5A 2JLBA 3JUIA 4UWFA 1S70B 4YDOA 2J49A 3VLFA 2QYUA 3UXGA 1GW6A 4ZHBA 2IFUA 5CCLA 3ZGQA 2B6CA 3NF1A 3EU5A 1U3DA 4NIKA 4A1GA 3ML8A 2F8YA 3MA5A 1SZ9A 3DBSA 5ANLA 2L6JA 2LXLA 3HRAA 1TN7A 3IEGA 4EHMA 5AENA 3DSSA 4F7AA 4DLOA 3Q9NC 3QWVA 2R5SA 4U8HA 3R9MA 3ZEFA 3FTSA 4LNUD 2LAHA 4DI3A 4B0ZA 5CEDB 4XI0A 5ENQD 3QAQA 3C3RA 3CHSA 2WXNA 1TEZA 4N5CA 2IONA 2DYSE 2BTDA 2XZDG 3CR3A 1N11A 2GGFA 1MX4A 3JUEA 2PM6A 3ZVVA 2LO6A 4U8YD 1OWOA 4AXHA 3FHEA 4BTBA 4HRLA 5AQ7A 3URZA 3PUJA 5J90A 3ENEA 4N39A 4GYOA 5KJMA 3LVRE 4WNGA 3ASGA 1UN8A 3RAUA 3RJVA 4JW1A 5FTPA 2XGSA 3SFXA 3GZSA 5JJ6A 2F37A 5G04C 5IY5E 3SBSA 4BWRA 3AS4A 4BSZB 4CEMA 5CRVA 4BT8A 3CIAA 4H7XA 3PE3A 3UKUG 1H6OA 3Q75A 1JWGA 3DPYA 3PRZA 1MX2A 4KT6B 2DZOA 2VYIA 3SO8A 1TNOA 1QYMA 3C98A 5JHAA 5HI7A 3EU9A 5AQAA 1IHGA 1DCEA 4DX5D 2X6IA 4ATGA 4WAFA 1AWCB 2JEKA 4LERA 2XCCA 3SGHA 2QY7A 4FP7A 1ELRA 2ZU6B 4N3AA 3PZDA 4FC8A 5BXOA 1JCRA 4ANWA 2Y69E 3RU0A 4N2SA 2CFUA 4GPKA 4C0EA 1HXIA 3NOGD 4W9RA 1OT8A 2QZAA 3QC1A 5CBOA 3PREA 3S7BA 5FWQA 3RO2A 3FP3A 4HXIA 4JHRA 3UTMA 3OAWA 5AJDA 5A7DB 3L17A 3O48A 3L22A 4GAAA 3F6QA 4K0RA
chains in the Genus database with same CATH topology
3KEAA 3TWXA 5KWDA 4NIKA 3HG0D 2FO1E 3V2OA 2V5QC 3AAAC 4HQDA 3TWSA 2ETCA 3NBNB 1BU9A 4HI8A 1DCQA 2NYJA 3Q9UC 4LSZE 5CERB 3V30A 2F8YA 4HNAD 5EYPF 5AARA 2XEHA 3TWQA 3UI2A 3ZUVB 2ETAA 3TWTA 4HBDA 3TWWA 3HRAA 3JXJA 4YDYA 1YMPA 4U96D 3W9FA 2BKGA 4A63B 2QYJA 3C5RA 4DX1A 3IXEA 3Q9NC 4J8YA 5EYLA 5AN8A 2B0OE 1SVXA 4DX6D 3TWUA 4QQIA 2DVWA 1MX2A 1OY3D 2DZOA 1WDYA 5AAOA 4HRNA 2KXPC 3SO8A 4QFVA 1QYMA 4GMRA 3ZU7B 4CYMD 4DRXE 1A5EA 1UOHA 1G3NB 2DWZA 2XEEA 4LNUD 4OAVB 3B95A 1TR4A 5EN5D 4U8VD 3EU9A 4YDWA 2F8XK 4LG6A 3ZKJA 2J8SD 5AQ9A 5AQAA 1MX6A 4B93B 3V79K 5KBAA 2BKKB 4DX5D 3J5PA 3AJIA 5AQBA 5CEDB 4K5CA 3V31A 1IHBA 4Z68A 5ENQD 1AWCB 4BEPA 1AP7A 1D9SA 4HRMB 5HKPA 1DC2A 5ENOD 4OAUC 3EHRA 4G8KA 2KBXA 4G8LA 4CZ2D 1MYOA 1YCSB 1K3ZD 3T9KA 4K5AB 4HB5A 2XZDG 2JABA 2AJAA 3W9GA 1N11A 1K1BA 1MX4A 3JUEA 1NFIE 4U8YD 5EILA 5KNGA 5CBNA 2A5EA 5BXOA 3NOCD 5KNHD 3T8KA 1K1AA 4GPMA 4HLLA 4BESA 4O1PA 2ETBA 1BI8B 3LJNA 4BERA 2ZGGA 4UUCA 2MYOA 4TUMA 5ENPD 3DEPA 4K5BA 4HRLA 1N0QA 2Y0BG 5AQ7A 5JMND 3D9HA 1SW6A 5HS0A 5JA4D 1MJ0A 5CEAA 2XENA 4DX2A 4HI9A 3DEOA 2ZGDA 4ZFHA 5EIDA 4O1OA 3B7BA 2PNNA 2RFMA 5FIOA 5ITZF 1S70B 2XZTG 3J5QB 3JXIA 3NOGD 1IKND 5HRYA 3ZNGA 5FINA 2QC9A 1OT8A 2HE0A 2Y1LE 4RLYA 5ENSD 4ATZD 1YYHA 4DX7D 4F1PA 3TWVA 2RFAA 4J7WA 4C48B 1BD8A 5CBOA 5CECB 1BLXB 3TWRA 2L6BA 5ENTD 3UXGA 5EIBE 1BI7B 3UTMA 3EHQA 4ZHBA 2VGEA 2DZNA 2F37A 2P2CP 4BETA 4F6RD 4N5QA 3V2XA 5BXUA 4DUIA 2V4HC 4JB8P 5ENRD 1WG0A 4U95D 4BSZB 5D66A 4O60A 1N0RA 1IXVA 3F6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KEA A;  3TWX A;  5KWD A;  4NIK A;  3HG0 D;  2FO1 E;  3V2O A;  2V5Q C;  3AAA C;  4HQD A;  3TWS A;  2ETC A;  3NBN B;  1BU9 A;  4HI8 A;  1DCQ A;  2NYJ A;  3Q9U C;  4LSZ E;  5CER B;  3V30 A;  2F8Y A;  4HNA D;  5EYP F;  5AAR A;  2XEH A;  3TWQ A;  3UI2 A;  3ZUV B;  2ETA A;  3TWT A;  4HBD A;  3TWW A;  3HRA A;  3JXJ A;  4YDY A;  1YMP A;  4U96 D;  3W9F A;  2BKG A;  4A63 B;  2QYJ A;  3C5R A;  4DX1 A;  3IXE A;  3Q9N C;  4J8Y A;  5EYL A;  5AN8 A;  2B0O E;  1SVX A;  4DX6 D;  3TWU A;  4QQI A;  2DVW A;  1MX2 A;  1OY3 D;  2DZO A;  1WDY A;  5AAO A;  4HRN A;  2KXP C;  3SO8 A;  4QFV A;  1QYM A;  4GMR A;  3ZU7 B;  4CYM D;  4DRX E;  1A5E A;  1UOH A;  1G3N B;  2DWZ A;  2XEE A;  4LNU D;  4OAV B;  3B95 A;  1TR4 A;  5EN5 D;  4U8V D;  3EU9 A;  4YDW A;  2F8X K;  4LG6 A;  3ZKJ A;  2J8S D;  5AQ9 A;  5AQA A;  1MX6 A;  4B93 B;  3V79 K;  5KBA A;  2BKK B;  4DX5 D;  3J5P A;  3AJI A;  5AQB A;  5CED B;  4K5C A;  3V31 A;  1IHB A;  4Z68 A;  5ENQ D;  1AWC B;  4BEP A;  1AP7 A;  1D9S A;  4HRM B;  5HKP A;  1DC2 A;  5ENO D;  4OAU C;  3EHR A;  4G8K A;  2KBX A;  4G8L A;  4CZ2 D;  1MYO A;  1YCS B;  1K3Z D;  3T9K A;  4K5A B;  4HB5 A;  2XZD G;  2JAB A;  2AJA A;  3W9G A;  1N11 A;  1K1B A;  1MX4 A;  3JUE A;  1NFI E;  4U8Y D;  5EIL A;  5KNG A;  5CBN A;  2A5E A;  5BXO A;  3NOC D;  5KNH D;  3T8K A;  1K1A A;  4GPM A;  4HLL A;  4BES A;  4O1P A;  2ETB A;  1BI8 B;  3LJN A;  4BER A;  2ZGG A;  4UUC A;  2MYO A;  4TUM A;  5ENP D;  3DEP A;  4K5B A;  4HRL A;  1N0Q A;  2Y0B G;  5AQ7 A;  5JMN D;  3D9H A;  1SW6 A;  5HS0 A;  5JA4 D;  1MJ0 A;  5CEA A;  2XEN A;  4DX2 A;  4HI9 A;  3DEO A;  2ZGD A;  4ZFH A;  5EID A;  4O1O A;  3B7B A;  2PNN A;  2RFM A;  5FIO A;  5ITZ F;  1S70 B;  2XZT G;  3J5Q B;  3JXI A;  3NOG D;  1IKN D;  5HRY A;  3ZNG A;  5FIN A;  2QC9 A;  1OT8 A;  2HE0 A;  2Y1L E;  4RLY A;  5ENS D;  4ATZ D;  1YYH A;  4DX7 D;  4F1P A;  3TWV A;  2RFA A;  4J7W A;  4C48 B;  1BD8 A;  5CBO A;  5CEC B;  1BLX B;  3TWR A;  2L6B A;  5ENT D;  3UXG A;  5EIB E;  1BI7 B;  3UTM A;  3EHQ A;  4ZHB A;  2VGE A;  2DZN A;  2F37 A;  2P2C P;  4BET A;  4F6R D;  4N5Q A;  3V2X A;  5BXU A;  4DUI A;  2V4H C;  4JB8 P;  5ENR D;  1WG0 A;  4U95 D;  4BSZ B;  5D66 A;  4O60 A;  1N0R A;  1IXV A;  3F6Q A; 
#chains in the Genus database with same CATH topology
 5KJK A;  2I1J A;  4RQI A;  2WXM A;  5EYP F;  5JHB A;  3LJ3 A;  4XKB A;  5J08 A;  3DWL G;  1PC2 A;  3B7U X;  3ULQ A;  2H6F A;  1H6K A;  1OY3 D;  4GMR A;  3ZU7 B;  4XI9 A;  3CSF A;  3PZ1 A;  4OVU A;  4XKC A;  2MHK A;  3ML9 A;  1MX6 A;  2I6H A;  4WUY A;  2P9I G;  2GRR B;  3CVL A;  1L5J A;  4JA9 A;  4CCA A;  2LNI A;  1TNB A;  2Y3A A;  2AXV A;  2JAB A;  5LCW C;  4I6J A;  2FBN A;  2GRN B;  4GZ3 A;  4I2W A;  4PS8 A;  1BI8 B;  1NP7 A;  4EZL A;  2WXG A;  1HH8 A;  3RRU A;  3LY8 A;  2KC7 A;  3ESL A;  3AG2 E;  3ONL A;  3FTY A;  3SI5 A;  3PNL B;  4F1P A;  3TWV A;  2RFA A;  5CEC B;  4N3B A;  2VGY A;  4F1S A;  4ILI A;  4URK A;  3V2X A;  1WG0 A;  3PDN A;  3ASO E;  4O60 A;  1WM5 A;  2VSY A;  3LCA A;  4PS7 A;  3L13 A;  1FPP A;  1TN8 A;  3TGO A;  5LFA A;  5AYW D;  5CER B;  2IJG X;  2A4Z A;  3ZUV B;  3TWT A;  4B8A A;  3S7J A;  3HYM B;  2PL2 A;  1H2U A;  4V3I A;  2R05 A;  3FUK A;  3Q15 A;  2EIK E;  4CYM D;  4DRX E;  2ILR A;  3R7R A;  3ISM C;  1TR4 A;  1HS6 A;  1E90 A;  4XX5 A;  2CHZ A;  2PQR A;  3C3O A;  5EX0 A;  2VJ8 A;  3EHR A;  1Y6I A;  4CZ2 D;  3LY7 A;  4HB5 A;  3NB2 A;  4CDR A;  2PM7 A;  5EIL A;  3IHY A;  3FUL A;  4BX8 A;  5ENP D;  4UUC A;  3PZ3 A;  4DLQ A;  1HU3 A;  4EBA A;  5JMN D;  2FI7 A;  3AG4 E;  5CEA A;  4G25 A;  5DIZ A;  5BV0 A;  4XIF A;  3BEE A;  3S2A A;  3SQV A;  3C72 A;  2HE0 A;  4I6G A;  5ANR A;  3U3W A;  5ENS D;  5FZQ A;  4F53 A;  3UM3 A;  2EQX A;  4GA0 A;  3X2Q E;  2WQ7 A;  2A5U A;  3OTN A;  5BPP A;  2XS8 A;  2P9U G;  2V5Q C;  2WMN A;  2NYJ A;  3APF A;  3FEX A;  1N4R A;  3QDN A;  2E2E A;  1YMP A;  4H7Y A;  4E85 A;  3CK7 A;  3C5R A;  3HVE A;  3D9N A;  5CCM A;  4LEU A;  3U64 A;  3RRM B;  2P9S G;  3MZL B;  2VSX E;  1OCR E;  2KM4 A;  4GTO A;  3FTX A;  3PZ4 A;  3UKR G;  4CT0 A;  3DRA A;  3E30 A;  4TRQ A;  2I1K A;  4FAD A;  3DPD A;  5FZS A;  4PH4 B;  3MYV A;  2YQ8 A;  1KT1 A;  2LSU A;  4WWN A;  4GTT A;  3CHP A;  1E7V A;  4ANV A;  4AIF A;  3LJN A;  1FCH A;  5G05 J;  3TXM A;  2HO1 A;  1E8Z A;  3HXC A;  1MJ0 A;  3CEQ A;  3PEV B;  3TJP A;  4EBA G;  3D9K A;  2WVI A;  3OXL A;  5EID A;  3HVE B;  3U9W A;  3U66 A;  2PNN A;  2XHE A;  4I1O B;  4B8C B;  2XPY A;  1MHQ A;  3QB2 A;  4Q96 A;  4DX7 D;  1YYH A;  2XRZ A;  5BNW A;  4IUL A;  4L9P A;  2VGE A;  4WND A;  1HE8 A;  2P2C P;  3FY4 A;  3VTX A;  4AJW A;  3I4G A;  4U95 D;  1OCC E;  4A1S A;  3UM1 A;  4HOQ A;  2V8S E;  3LYA A;  2X6K A;  3B7R L;  2AVP A;  2WB2 A;  3Q78 A;  4A3T A;  1FVH A;  3CKC A;  3SBT B;  4U96 D;  3I4R B;  3W9F A;  2L0T B;  4D10 C;  2R03 A;  4WNE A;  4J8Y A;  1HO8 A;  4GU5 A;  4HLE A;  1TNU A;  4QFV A;  4RG6 A;  3B95 A;  4F3V A;  3CVW A;  1D8D A;  3ABL E;  4ME2 A;  1ZB1 A;  3ASD A;  3N71 A;  3J5P A;  3HHM A;  4J8D A;  3QKY A;  3T5X A;  2DYR E;  1D9S A;  2WXL A;  4MBG A;  1DC2 A;  4CRW A;  4U63 A;  4EEC A;  1Q2Z A;  3CKB A;  1EYH A;  2C2L A;  3G2S A;  2H6I A;  5B1B E;  3MX3 A;  4JHK A;  3MGB A;  4J6I A;  4BES A;  2P9K G;  4IYP A;  3LY9 A;  2CHW A;  2AW6 A;  4BFR A;  4LRZ A;  3D9P A;  4FLB A;  1TYQ G;  3DEO A;  1E8Y A;  2YIN A;  4BT9 A;  4AOF A;  5HRY A;  1TJC A;  4JA7 A;  4GA1 A;  2CG2 A;  2EIN E;  2VQ2 A;  3ZXS A;  3LDZ A;  5FQ4 A;  1IQU A;  2V4H C;  3FTU A;  4NQ0 A;  1INZ A;  2WXP A;  3AAA C;  2J07 A;  2ETC A;  1BU9 A;  3I5P A;  4CDM A;  4MKT A;  3CLJ A;  3BG1 B;  2XEH A;  3PE4 A;  3CHM A;  1K8K G;  3OXG A;  2RG8 A;  3TXN A;  1JCS A;  4PUC A;  5LP0 A;  2QYJ A;  3FFL A;  1UJK A;  3LEW A;  3D9O A;  3L82 A;  4HRN A;  5KJN A;  3UM0 A;  1XGW A;  5EN5 D;  2WXO A;  2RKK A;  3QJZ A;  2J8S D;  5H7P A;  3TAX A;  4B93 B;  4K5C A;  4NRH B;  4PDX A;  4Z68 A;  4CGV A;  2Y4U A;  2X6H A;  4GTV A;  1O5M A;  2EIL E;  3MKQ A;  3T8K A;  4HLL A;  4UQZ A;  3SNX A;  3DSU A;  4CGW A;  4M3O A;  4K5B A;  2Y0B G;  4ILH B;  4JEU A;  2OCC E;  3JCK C;  4BX9 A;  1RW2 A;  4ZFH A;  5DBK A;  2OOE A;  2GRO B;  2J08 A;  2Y1L E;  1H2T C;  4XZ4 A;  1NL4 A;  3CVV A;  4EZK A;  5FQ6 A;  5CRU A;  3PS6 A;  4KZC A;  3FH5 A;  2AXU A;  4R7L A;  4L23 A;  3EHQ A;  4BET A;  5E76 A;  1ELK A;  5T4Y A;  1JCQ A;  1FT2 A;  3FH7 A;  1OWP A;  4C9B B;  3CVY A;  3SF4 A;  1IYG A;  5B1A E;  3RKV A;  3IHV A;  1HFA A;  1O1T A;  3D9L A;  4KMO A;  5BT1 A;  3V30 A;  5LOZ A;  4KBQ A;  2ZIR A;  3NZU A;  4HBD A;  3TWW A;  5KCM A;  3MKQ B;  3FUI A;  5CHE E;  2OEV A;  2J4B A;  4A63 B;  4KXK B;  5EYL A;  3LVQ E;  3E32 A;  4Q94 A;  3ZN3 A;  4YVQ C;  5G55 A;  2R2L A;  1UOH A;  2XEE A;  3ASF A;  3MJW A;  1HZ4 A;  2F8X K;  1UJJ A;  1H19 A;  3HXF A;  2WXR A;  3UQ3 A;  5E75 A;  3ZW3 A;  2XGM A;  4GA2 A;  2CG3 A;  4HS2 A;  4N3C A;  3MV3 B;  4MLP A;  2KBX A;  4G8L A;  1EPU A;  2P58 C;  1OCZ E;  4EQF A;  4G26 A;  1K1A A;  5A6C A;  2HM8 A;  4OVV A;  2BUG A;  1W3B A;  3MV2 B;  4G24 A;  4UQX A;  4TXQ A;  1OWL A;  4I1M A;  5FQ8 A;  3EIQ C;  2WXI A;  4GZ6 A;  4ACL A;  5FIO A;  3E4B A;  3J5Q B;  3IKO B;  1PAQ A;  2XPI A;  1OWM A;  1BLX B;  3FUF A;  3CQG B;  1YA0 A;  1TNY A;  3KAE A;  4GYY A;  3UX4 A;  1JWF A;  3SFZ A;  3UMV A;  4L2Y A;  4Y6W A;  3TWX A;  4AVX A;  4KZ0 A;  3PUK A;  4A55 A;  4HOU A;  2H6H A;  3DSW A;  2IEJ A;  2X38 A;  4CDN A;  3BG0 B;  2GRL A;  2WM9 A;  2KXP C;  3O4Z A;  4U7E B;  3Q47 B;  3VLD A;  4J0U A;  3V79 K;  1N54 A;  1HG5 A;  3AS8 A;  3TG5 A;  4I1A A;  4AEZ C;  1AP7 A;  1O1S A;  4HOS A;  4JC8 A;  1EF1 C;  2M63 A;  2V4L A;  4FJZ A;  1N9A A;  1N94 A;  3S7F A;  2WXK A;  3S7D A;  3W9G A;  4K03 A;  3UT4 A;  3B7S A;  4GZD A;  2KAT A;  1Y8M A;  5B3S E;  1UG3 A;  3ZYM A;  4GPM A;  2ETB A;  1U3C A;  1LF8 A;  2LXM A;  1U2V G;  1N0Q A;  2J09 A;  3CVX A;  5HS0 A;  5C2Y A;  3L6A A;  4AV7 A;  3EDT B;  4U0U A;  1UW4 B;  3B7B A;  4TXR A;  1XNF A;  2H6G A;  4RVB A;  3D9J A;  4U0Z A;  3CGH A;  3FUH A;  5ENT D;  3RK6 A;  5EIB E;  3CVP A;  3ZXP A;  1E8W A;  2LAI A;  2J9Q A;  1X81 A;  3KEA A;  5HQ8 A;  5G04 J;  2AWI A;  2FO1 E;  3Q9U C;  3HXD A;  1WY6 A;  4Q69 A;  3UPV A;  2FEZ A;  1SA4 A;  4GZ5 A;  2BF0 X;  3P2B A;  1E8X A;  2WMO A;  3MKR A;  5AAO A;  5FJY A;  1JPL A;  2DWZ A;  3NZS A;  4DJA A;  5JJ7 A;  5BUZ A;  3ABM E;  2WPV A;  4I43 A;  2C0L A;  3SHF A;  5AQ9 A;  4HOT A;  3FWV A;  1IHB A;  4BEP A;  3RSE G;  1MQS A;  5LX8 A;  1LD7 A;  2KZT A;  3D3M A;  3LPZ A;  3C3Q A;  1DVP A;  4K5A B;  2WXH A;  2BED A;  1NA0 A;  4JEH A;  4A3V A;  1KZP A;  4I17 A;  4UWG A;  2ZGG A;  3PVL A;  2X6J A;  1Z6T A;  1ELW A;  2NXP A;  5ARG A;  4JD2 G;  3NAW A;  4AY6 A;  1N4P A;  4O1O A;  3UIO C;  3MEK A;  3EUV A;  5T3R A;  4FLH A;  2VSN A;  2EIM E;  1IQR A;  2IO3 C;  2L6B A;  4I6E A;  3SZ7 A;  4JB8 P;  3DXM G;  4GTQ A;  2IY0 C;  3AU4 A;  3D9I A;  3QOU A;  3ULY A;  4GCN A;  4UWK A;  4RG9 A;  1FVF A;  3AG1 E;  4WWO A;  4HQD A;  2KZT B;  2OEW A;  4TV3 A;  5ENN A;  1NI1 A;  1B89 A;  4FUL A;  3JXJ A;  3Q49 B;  2WXF A;  2DIW A;  4FJY A;  5G2N A;  1D8E A;  3HDX A;  1QNF A;  3K9I A;  3ONK A;  3G2W A;  2UWJ G;  3QWW A;  4L2L A;  5C1D A;  3LKU A;  5KBA A;  5AQB A;  2HR2 A;  3FUE A;  2AXZ A;  1OWN A;  5D0Q D;  4B89 A;  1QBQ A;  3G2V A;  2QFC A;  2YHC A;  3Q7A A;  3PEU B;  3ZHE A;  4XEI G;  3KSL A;  3WXX A;  4FHK A;  1QQE A;  5FZR A;  2A5E A;  3SY2 A;  2KCK A;  3B7T A;  4KVM A;  3WG7 E;  5LCW J;  3VTY A;  4E6H A;  1JUQ A;  3ZPJ A;  1Z5S C;  4UWL A;  2XEN A;  3CVN A;  4GMJ A;  4DX2 A;  4LNG A;  4APO A;  2NC9 A;  3D9M A;  3IV0 A;  5FIN A;  3JYS A;  4JZY A;  4UI9 C;  2X3M A;  4C48 B;  4FHJ A;  2R59 A;  3IBE A;  5BXU A;  4TXP A;  3L16 A;  2IOL A;  2Q7F A;  3FU5 A;  4C0M A;  5KWD A;  2E0I A;  3TWS A;  3AU5 A;  3ZHE B;  3L9T A;  3Q73 A;  5FT9 A;  2ETA A;  4AP2 A;  2MRI A;  1KLX A;  4DX1 A;  4WNF A;  3G2T A;  3T8M A;  1G3N B;  1RZ4 A;  4OAV B;  3ZRH A;  5BW8 C;  4J8E A;  1FT1 A;  3ZKJ A;  5D2M C;  3E34 A;  2L0I A;  3DXK G;  3AG3 E;  5HKP A;  4L7T A;  3P1U A;  4HFG A;  4IN3 B;  3MCX A;  1KT0 A;  3PH0 C;  1LTX A;  1OXJ A;  3CV0 A;  2VGX A;  2MYO A;  1BPO A;  3DEP A;  2PZI A;  3U4T A;  2P9N G;  3FU6 A;  3LS8 A;  3ZYQ A;  1SW6 A;  2LSV A;  5EDS A;  3Q5M A;  4GZC A;  3UM2 A;  3GYZ A;  1N52 A;  3Q7F A;  5ITZ F;  5KJL A;  3GZ2 A;  4KYO B;  1A17 A;  3ZYK A;  2VSO E;  3CVQ A;  3JQ1 A;  3ZFW A;  5EX3 A;  1NZN A;  4N5Q A;  4DUI A;  3BU8 A;  3G2U A;  4J8S A;  1DCQ A;  2LUH A;  3UT8 A;  3CHR A;  4NUR A;  2IF4 A;  2VGX B;  1UN9 A;  2B0O E;  2J4D A;  2DVW A;  3HIZ A;  1N95 A;  2R02 A;  2YHE A;  4I9C A;  1SA5 A;  2XCB A;  4KVO A;  2GRP B;  1O1R A;  3AJI A;  2OVB A;  4JHJ A;  4YDE A;  4OAU C;  3QAR A;  1YCS B;  3T9K A;  4N2Q A;  4EZJ A;  5G05 C;  4HVB A;  4ILG A;  2V0P A;  4O1P A;  3KD7 A;  2HYZ A;  3FUM A;  4OYS A;  1N4Q A;  2WQ6 A;  3D9H A;  3FTV A;  5FQ7 A;  4HI9 A;  3CHO A;  2WQH A;  2RFM A;  4GB9 A;  2XZT G;  3APC A;  3JXI A;  2F0Y A;  1IKN D;  3ZNG A;  1PY1 A;  3QK0 A;  1VDY A;  4J7W A;  1LD8 A;  1ZBP A;  1SQM A;  2V5F A;  2MOW A;  2OND A;  4FA6 A;  4RSY A;  2XPZ A;  5A23 A;  4JPS A;  1BI7 B;  3DST A;  3SD5 A;  4J8F A;  2OVF A;  1N0R A;  1IXV A;  4GTP A;  1Z3X A;  3ZIM A;  3DSV A;  3HG0 D;  4EPZ A;  3BQO A;  3R9A B;  1H2V C;  3EJN A;  2XRY A;  2BKG A;  2GRQ B;  5JJT A;  2X6F A;  4X8Q A;  5AN8 A;  1SVX A;  1HF8 A;  4XE0 A;  3TWU A;  3QNK A;  1WDY A;  3TG4 A;  4HOR A;  2WXQ A;  4AM9 A;  1S0P A;  3OXF A;  4YDW A;  2P9L G;  3I3N A;  3Q79 A;  3BUA A;  3KEZ A;  4ANX A;  4WWP A;  4U07 A;  4BTA A;  4G8K A;  3FUJ A;  4UI9 K;  3LXU X;  2AJA A;  3E37 A;  1NA3 A;  4YVO A;  5CBN A;  1TN6 A;  3NOC D;  1H6P A;  3SFY A;  3FU0 A;  4TUM A;  3FTZ A;  4UI9 J;  4G2V A;  4I9E A;  4G11 A;  2KCL A;  4GYW A;  4G23 A;  3ULE G;  2ZGD A;  2FUL A;  2QC9 A;  3L08 A;  4RLY A;  3PZ2 A;  5AIJ A;  1BD8 A;  4BSX A;  2IQC A;  4YND A;  4GTR A;  3Q4A B;  1S64 A;  2EIJ E;  2CFZ A;  2PQN A;  3ABK E;  2DCP A;  1TNZ A;  1KZO A;  5ENR D;  3DSX A;  5D66 A;  3EHM A;  3E33 A;  3CST A;  2OV8 A;  5ARF A;  3FEY A;  1HX8 A;  2GW1 A;  3NBN B;  4FU3 A;  3FDH A;  1H0A A;  2C0M A;  4HNA D;  5AAR A;  3NQP A;  2WXJ A;  3ASH A;  3TWQ A;  3ASN E;  1E7U A;  2IOS A;  2GRM A;  4M7C A;  1WAO 1;  2XGO A;  3UUX A;  4G1T A;  1V55 E;  3IXE A;  4PS3 A;  1V54 E;  3B13 A;  4U04 A;  5CMW A;  4GML A;  4MS6 A;  1A5E A;  1P5Q A;  4ANU A;  4JVS A;  2ZIS A;  1OUV A;  1MZC A;  4BY6 A;  3HXE A;  4AY5 A;  3RRN B;  3APD A;  4TUU A;  3CVU A;  1EDU A;  1ZU2 A;  4NAC A;  5ENO D;  2FF4 A;  4ACK A;  3VLE A;  3EHN A;  1MYO A;  4DPR A;  1K3Z D;  2P9P G;  4LUN U;  2XS1 A;  1K1B A;  1N4S A;  1NFI E;  5EKQ D;  3QWP A;  5KNH D;  4P29 A;  4UQY A;  4UWH A;  3PNT B;  4MRU A;  4BER A;  2KCV A;  2DBA A;  4B94 A;  3R7Q A;  1HG2 A;  3ESK A;  3GW4 A;  5M72 A;  2ZXW E;  3FH8 A;  4O6F A;  3T5V A;  1DNP A;  3CK8 A;  2UY1 A;  3CQC B;  3CK9 A;  4ATZ D;  4IRU A;  2RD0 A;  4CT4 A;  2XEV A;  3GZ1 A;  2YNQ A;  3TWR A;  3RO3 A;  2Y4T A;  4JL0 A;  1Z3Y A;  2DZN A;  4F6R D;  1E96 B;  2I2O A;  2L9B A;  3CHQ A;  3FTW A;  3V2O A;  3KSQ A;  4LNB A;  4JXT A;  4HI8 A;  3RIB A;  3FU3 A;  4L1B A;  4LSZ E;  1QZ2 A;  2VTB A;  3UIN C;  3UI2 A;  4GCO A;  1S63 A;  1OCO E;  4YDY A;  1SZA A;  5BV1 A;  2NSZ A;  3ZYL A;  5AJL A;  4DX6 D;  4I2Z A;  4QQI A;  1TJF A;  3AS5 A;  2R17 C;  4U0S A;  4U8V D;  4APF A;  4Y6C A;  5T8I A;  4LG6 A;  2UY1 B;  4LCT A;  2BKK B;  1X5B A;  3V31 A;  4HRM B;  2CHX A;  3UT7 A;  3JQ0 A;  3FUD A;  4GTM A;  3TL5 A;  3UIP C;  2XQ0 A;  3EIJ A;  5D0O D;  5KNG A;  2IO2 C;  2FO7 A;  2I9C A;  3FUN A;  3HXB A;  2IU1 A;  2VTB B;  4GTS A;  1KPS B;  4ABN A;  5JA4 D;  5CMY A;  3KS2 A;  3L54 A;  4DI4 A;  4DK5 A;  2JLB A;  3JUI A;  4UWF A;  1S70 B;  4YDO A;  2J49 A;  3VLF A;  2QYU A;  3UXG A;  1GW6 A;  4ZHB A;  2IFU A;  5CCL A;  3ZGQ A;  2B6C A;  3NF1 A;  3EU5 A;  1U3D A;  4NIK A;  4A1G A;  3ML8 A;  2F8Y A;  3MA5 A;  1SZ9 A;  3DBS A;  5ANL A;  2L6J A;  2LXL A;  3HRA A;  1TN7 A;  3IEG A;  4EHM A;  5AEN A;  3DSS A;  4F7A A;  4DLO A;  3Q9N C;  3QWV A;  2R5S A;  4U8H A;  3R9M A;  3ZEF A;  3FTS A;  4LNU D;  2LAH A;  4DI3 A;  4B0Z A;  5CED B;  4XI0 A;  5ENQ D;  3QAQ A;  3C3R A;  3CHS A;  2WXN A;  1TEZ A;  4N5C A;  2ION A;  2DYS E;  2BTD A;  2XZD G;  3CR3 A;  1N11 A;  2GGF A;  1MX4 A;  3JUE A;  2PM6 A;  3ZVV A;  2LO6 A;  4U8Y D;  1OWO A;  4AXH A;  3FHE A;  4BTB A;  4HRL A;  5AQ7 A;  3URZ A;  3PUJ A;  5J90 A;  3ENE A;  4N39 A;  4GYO A;  5KJM A;  3LVR E;  4WNG A;  3ASG A;  1UN8 A;  3RAU A;  3RJV A;  4JW1 A;  5FTP A;  2XGS A;  3SFX A;  3GZS A;  5JJ6 A;  2F37 A;  5G04 C;  5IY5 E;  3SBS A;  4BWR A;  3AS4 A;  4BSZ B;  4CEM A;  5CRV A;  4BT8 A;  3CIA A;  4H7X A;  3PE3 A;  3UKU G;  1H6O A;  3Q75 A;  1JWG A;  3DPY A;  3PRZ A;  1MX2 A;  4KT6 B;  2DZO A;  2VYI A;  3SO8 A;  1TNO A;  1QYM A;  3C98 A;  5JHA A;  5HI7 A;  3EU9 A;  5AQA A;  1IHG A;  1DCE A;  4DX5 D;  2X6I A;  4ATG A;  4WAF A;  1AWC B;  2JEK A;  4LER A;  2XCC A;  3SGH A;  2QY7 A;  4FP7 A;  1ELR A;  2ZU6 B;  4N3A A;  3PZD A;  4FC8 A;  5BXO A;  1JCR A;  4ANW A;  2Y69 E;  3RU0 A;  4N2S A;  2CFU A;  4GPK A;  4C0E A;  1HXI A;  3NOG D;  4W9R A;  1OT8 A;  2QZA A;  3QC1 A;  5CBO A;  3PRE A;  3S7B A;  5FWQ A;  3RO2 A;  3FP3 A;  4HXI A;  4JHR A;  3UTM A;  3OAW A;  5AJD A;  5A7D B;  3L17 A;  3O48 A;  3L22 A;  4GAA A;  3F6Q A;  4K0R A; 
#chains in the Genus database with same CATH homology
 3KEA A;  3TWX A;  5KWD A;  4NIK A;  3HG0 D;  2FO1 E;  3V2O A;  2V5Q C;  3AAA C;  4HQD A;  3TWS A;  2ETC A;  3NBN B;  1BU9 A;  4HI8 A;  1DCQ A;  2NYJ A;  3Q9U C;  4LSZ E;  5CER B;  3V30 A;  2F8Y A;  4HNA D;  5EYP F;  5AAR A;  2XEH A;  3TWQ A;  3UI2 A;  3ZUV B;  2ETA A;  3TWT A;  4HBD A;  3TWW A;  3HRA A;  3JXJ A;  4YDY A;  1YMP A;  4U96 D;  3W9F A;  2BKG A;  4A63 B;  2QYJ A;  3C5R A;  4DX1 A;  3IXE A;  3Q9N C;  4J8Y A;  5EYL A;  5AN8 A;  2B0O E;  1SVX A;  4DX6 D;  3TWU A;  4QQI A;  2DVW A;  1MX2 A;  1OY3 D;  2DZO A;  1WDY A;  5AAO A;  4HRN A;  2KXP C;  3SO8 A;  4QFV A;  1QYM A;  4GMR A;  3ZU7 B;  4CYM D;  4DRX E;  1A5E A;  1UOH A;  1G3N B;  2DWZ A;  2XEE A;  4LNU D;  4OAV B;  3B95 A;  1TR4 A;  5EN5 D;  4U8V D;  3EU9 A;  4YDW A;  2F8X K;  4LG6 A;  3ZKJ A;  2J8S D;  5AQ9 A;  5AQA A;  1MX6 A;  4B93 B;  3V79 K;  5KBA A;  2BKK B;  4DX5 D;  3J5P A;  3AJI A;  5AQB A;  5CED B;  4K5C A;  3V31 A;  1IHB A;  4Z68 A;  5ENQ D;  1AWC B;  4BEP A;  1AP7 A;  1D9S A;  4HRM B;  5HKP A;  1DC2 A;  5ENO D;  4OAU C;  3EHR A;  4G8K A;  2KBX A;  4G8L A;  4CZ2 D;  1MYO A;  1YCS B;  1K3Z D;  3T9K A;  4K5A B;  4HB5 A;  2XZD G;  2JAB A;  2AJA A;  3W9G A;  1N11 A;  1K1B A;  1MX4 A;  3JUE A;  1NFI E;  4U8Y D;  5EIL A;  5KNG A;  5CBN A;  2A5E A;  5BXO A;  3NOC D;  5KNH D;  3T8K A;  1K1A A;  4GPM A;  4HLL A;  4BES A;  4O1P A;  2ETB A;  1BI8 B;  3LJN A;  4BER A;  2ZGG A;  4UUC A;  2MYO A;  4TUM A;  5ENP D;  3DEP A;  4K5B A;  4HRL A;  1N0Q A;  2Y0B G;  5AQ7 A;  5JMN D;  3D9H A;  1SW6 A;  5HS0 A;  5JA4 D;  1MJ0 A;  5CEA A;  2XEN A;  4DX2 A;  4HI9 A;  3DEO A;  2ZGD A;  4ZFH A;  5EID A;  4O1O A;  3B7B A;  2PNN A;  2RFM A;  5FIO A;  5ITZ F;  1S70 B;  2XZT G;  3J5Q B;  3JXI A;  3NOG D;  1IKN D;  5HRY A;  3ZNG A;  5FIN A;  2QC9 A;  1OT8 A;  2HE0 A;  2Y1L E;  4RLY A;  5ENS D;  4ATZ D;  1YYH A;  4DX7 D;  4F1P A;  3TWV A;  2RFA A;  4J7W A;  4C48 B;  1BD8 A;  5CBO A;  5CEC B;  1BLX B;  3TWR A;  2L6B A;  5ENT D;  3UXG A;  5EIB E;  1BI7 B;  3UTM A;  3EHQ A;  4ZHB A;  2VGE A;  2DZN A;  2F37 A;  2P2C P;  4BET A;  4F6R D;  4N5Q A;  3V2X A;  5BXU A;  4DUI A;  2V4H C;  4JB8 P;  5ENR D;  1WG0 A;  4U95 D;  4BSZ B;  5D66 A;  4O60 A;  1N0R A;  1IXV A;  3F6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...