4ATZD

Ad5 knob in complex with a designed ankyrin repeat protein
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
154
structure length
154
Chain Sequence
DLGKKLLEAARAGQDDEVRILMANGADANAYDHYGRTPLHMAAAVGHLEIVEVLLRNGADVNAVDTNGTTPLHLAASLGHLEIVEVLLKYGADVNAKDATGITPLYLAAYWGHLEIVEVLLKHGADVNAQDKFGKTAFDISIDIGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/de novo protein
molecule keywords Fiber protein
publication title Development of a generic adenovirus delivery system based on structure-guided design of bispecific trimeric DARPin adapters.
pubmed doi rcsb
source organism Human adenovirus c serotype 5
total genus 46
structure length 154
sequence length 154
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2012-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4atzD00
1YCSB 4HRMB 1D9SA 3LJNA 3W9FA 1WG0A 1MX2A 2ETAA 3AJIA 2QYJA 3EHRA 4CZ2D 1IXVA 5KWDA 2JABA 2RFMA 4Z68A 2ETBA 4ZHBA 3EU9A 2DWZA 1QYMA 4O60A 5CEDB 3NOCD 5EYLA 4K5CA 5KNHD 1K3ZD 1YMPA 3AAAC 1UOHA 4OAUC 3V2OA 5KNGA 2PNNA 5ENPD 2V5QC 4HBDA 2Y0BG 1IHBA 3TWTA 4DRXE 3T8KA 1BI7B 3W9GA 1G3NB 2F8XK 4J8YA 1BI8B 2VGEA 3JUEA 3NBNB 2L6BA 2XZTG 2F8YA 2DVWA 5CBOA 4HI8A 4BEPA 5KBAA 2RFAA 1NFIE 1MYOA 4G8KA 4HLLA 3TWRA 4QQIA 5HRYA 1BU9A 4BESA 3ZNGA 1TR4A 2MYOA 3HRAA 5AQAA 2XEHA 5FINA 5AAOA 5CECB 2A5EA 3EHQA 1SW6A 4CYMD 2ZGDA 3IXEA 2F37A 1S70B 5CERB 3B95A 2ZGGA 3UTMA 2ETCA 5ITZF 5BXOA 4F1PA 3J5QB 5ENSD 5CEAA 3UI2A 3ZUVB 2FO1E 5AN8A 5ENOD 4NIKA 3TWWA 4LSZE 3ZKJA 1K1BA 5CBNA 3DEPA 1N0RA 2Y1LE 4K5AB 3J5PA 3TWQA 5BXUA 4LNUD 3F6QA 2XENA 3B7BA 3JXIA 3DEOA 3TWSA 3ZU7B 1A5EA 1YYHA 1BLXB 5EIBE 1IKND 3Q9UC 2QC9A 4DUIA 4O1PA 3C5RA 3TWXA 1MX4A 5AQBA 5EILA 5D66A 5AQ9A 4G8LA 3TWVA 5HS0A 4DX2A 4F6RD 4OAVB 4YDYA 2XZDG 2DZNA 3SO8A 5EN5D 1OT8A 4DX5D 4N5QA 1MJ0A 4HNAD 3T9KA 5FIOA 2BKGA 2DZOA 4U95D 5JA4D 4J7WA 5ENQD 1N0QA 1DCQA 1SVXA 3TWUA 3JXJA 4BERA 4C48B 4RLYA 3HG0D 1BD8A 4ATZD 4DX7D 4DX6D 1K1AA 3V30A 2B0OE 4QFVA 4GMRA 3D9HA 4HRNA 5AARA 3UXGA 2HE0A 4BSZB 2KBXA 4HB5A 5JMND 4UUCA 4O1OA 5EYPF 1MX6A 4U8VD 5ENRD 4HQDA 3V79K 4GPMA 3NOGD 1AP7A 4TUMA 4YDWA 4A63B 5AQ7A 4K5BA 4DX1A 2V4HC 2NYJA 4HI9A 1DC2A 5HKPA 3KEAA 4HRLA 2P2CP 5EIDA 3V31A 4JB8P 4BETA 2BKKB 2XEEA 3V2XA 2AJAA 1OY3D 1WDYA 1N11A 4U8YD 4B93B 3Q9NC 4LG6A 1AWCB 2J8SD 4ZFHA 4U96D 5ENTD 2KXPC
chains in the Genus database with same CATH superfamily
3RO3A 3PZDA 4DK5A 3D9NA 5FQ6A 4PS7A 1BPOA 4UWHA 2PQRA 4UQXA 5EYLA 2WQ6A 1SZAA 5KNGA 4Q69A 1BI7B 4J8SA 5D0QD 2ZISA 2L6BA 1UG3A 3IEGA 4GU5A 4IYPA 3I5PA 1FT1A 1N54A 2XRYA 1Z6TA 3HRAA 4EZKA 4WNGA 2V0PA 2RKKA 4TXRA 3PEUB 4NRHB 5CMYA 3ZYMA 5BV0A 4XEIG 3F6QA 3CQCB 3TWSA 3D9IA 5HQ8A 1RW2A 3APFA 2FBNA 1MX4A 2DCPA 5C1DA 4XIFA 3CSTA 1H0AA 2UY1A 4KT6B 1N0QA 2IO3C 3CHQA 3AG3E 1FVFA 4I6JA 1K1AA 1NA3A 2WXOA 3MZLB 4U7EB 5ENRD 4GPMA 3RIBA 4A63B 5HKPA 2CFZA 2IONA 1EPUA 3SGHA 1E8YA 4AIFA 2BKKB 5BT1A 4EZLA 3KSQA 3LVQE 1OWNA 1XGWA 3KD7A 1Z3XA 5KWDA 3ESKA 4KBQA 3N71A 2FF4A 4AXHA 1O1RA 1K3ZD 4NACA 3C98A 3QWWA 4G11A 4UQZA 5ENNA 2XZTG 1INZA 4FLHA 3Q7FA 3ZXSA 3TG5A 1U3CA 2XEHA 3EHQA 1SW6A 2PM6A 3ABLE 4A1GA 3S2AA 5BW8C 2NXPA 4TXQA 1Z5SC 5BXUA 2WMOA 4I1OB 3ZU7B 5JJ7A 5FT9A 4LUNU 3RRNB 3ABKE 5EIBE 1Q2ZA 3ASOE 4N3BA 2FEZA 3TWVA 3G2TA 5JJTA 4Y6WA 1N9AA 2P9UG 3SHFA 3PEVB 3PUJA 3DSVA 5LX8A 3T8MA 2B6CA 3FU5A 2P58C 5A6CA 2L6JA 3Q79A 1EYHA 5FZRA 3Q49B 3FTZA 1OCCE 4K5BA 2H6FA 5T3RA 2WVIA 1HU3A 2WQ7A 3FFLA 4GYOA 5G2NA 2R59A 3L6AA 4FU3A 4PUCA 3SY2A 3CKBA 4FJYA 4HOQA 3EHRA 3QNKA 3FULA 2ETBA 5KJKA 4JHJA 3SNXA 3CV0A 1D8DA 1ZBPA 4RSYA 4Q94A 3ASGA 4J8YA 1K8KG 2VGEA 3FUMA 3QC1A 4HI8A 4C0EA 2BEDA 3SBSA 5FINA 4X8QA 5FQ8A 1H2VC 3AU5A 3Q15A 2NSZA 2Y69E 3ZVVA 5LFAA 4GTQA 3UKRG 2Y1LE 3ZHEB 4I1AA 2Q7FA 2WB2A 3DEOA 3JCKC 3SF4A 3RSEG 2FULA 5BV1A 4DX2A 3R7QA 3C72A 2IEJA 4P29A 4HNAD 2KCKA 4TV3A 2FI7A 4U95D 3UPVA 3CIAA 3HYMB 3EHNA 3V30A 3SFYA 2EQXA 4GMRA 5CCMA 4YDEA 3HDXA 4U8VD 1S63A 4UI9J 4GTSA 2P2CP 3MCXA 2JLBA 4AEZC 3EHMA 4FA6A 3LY9A 4L7TA 4B93B 4OVVA 4GTVA 2EIJE 4HS2A 2E0IA 4AM9A 3W9FA 1QNFA 3UT8A 3GZ2A 1OUVA 5AJDA 5ENPD 1IHBA 1V55E 4FLBA 2DYRE 2F8XK 3RRUA 2YNQA 3MX3A 3S7BA 1ELRA 5AENA 3U64A 4WNFA 4AY5A 2X3MA 2F37A 3UT7A 3RO2A 3AG4E 4AOFA 3HXBA 3Q7AA 5AN8A 4WWNA 4JA9A 3X2QE 4APOA 3I3NA 3D9LA 5CMWA 4MLPA 3CVYA 2KATA 5DBKA 3EDTB 3MKQB 3UT4A 3TAXA 4DUIA 4I9EA 5AQ9A 1PY1A 2IFUA 3BUAA 3E34A 4ATGA 5CRUA 4HXIA 4I6EA 5G04J 4JL0A 3FTVA 3NAWA 1FT2A 3E32A 3CR3A 3V79K 4TUMA 1D8EA 3RRMB 2XPZA 3FH7A 2XCBA 5AYWD 2XEEA 1NA0A 1OY3D 2P9KG 3UM1A 1HH8A 4HVBA 2GW1A 5ARGA 4MKTA 1IXVA 3ZW3A 4GYYA 2VSXE 1LF8A 4UWLA 3ULQA 4O60A 3PNLB 3ZRHA 4CRWA 4FHJA 1E8ZA 2XPIA 3W9GA 1G3NB 2KCVA 4LEUA 1S64A 4B0ZA 2R02A 4WNDA 2F8YA 2R5SA 5CBOA 2R2LA 4E6HA 1TR4A 2I6HA 2ZGDA 4KYOB 4GZ6A 2E2EA 4UI9K 4FJZA 3CLJA 4N3CA 3ZUVB 5EDSA 2LSUA 3S7JA 4XKCA 2PZIA 3TWQA 2XENA 1DNPA 1BLXB 3Q73A 3EIQC 3C5RA 3L13A 5C2YA 4G8LA 5AIJA 3DRAA 4CT4A 2DZOA 2IOSA 2X6HA 4C48B 3OTNA 2P9NG 5M72A 5B1BE 4HB5A 5JMND 4XI9A 3CK9A 1N94A 4U07A 5CCLA 4UWKA 4YDWA 3HHMA 4EZJA 1DC2A 4JC8A 5G05J 3FWVA 3ZXPA 1QZ2A 3HVEB 4MBGA 3TXNA 4RQIA 4M7CA 2OOEA 2QYJA 5A7DB 4DLOA 1LD7A 2F0YA 2WXMA 1PAQA 3Q75A 1E90A 1JWGA 1IYGA 3ASDA 4BEPA 3VLFA 5HRYA 3AS4A 1HG5A 5AJLA 4A3TA 2L0TB 4CT0A 4LSZE 1OWPA 1UW4B 3LS8A 4LNUD 1X5BA 3AS8A 1HX8A 3Q9UC 4IULA 5EILA 4GCOA 2CHZA 4BTAA 2H6IA 3QARA 3MGBA 1MJ0A 4Q96A 4KVOA 1MHQA 3CVPA 3D9PA 4GA1A 4BWRA 3FUKA 3TWUA 4RLYA 1BD8A 4DX7D 4QFVA 3APCA 4RG6A 1O1TA 4RG9A 2P9IG 1ELWA 5EYPF 4HOSA 3L16A 4OVUA 1SA4A 4DX1A 4HI9A 5FZQA 4BETA 2KM4A 4LG6A 2J8SD 4K03A 3LXUX 3URZA 4I17A 4WUYA 4L23A 5LCWJ 3ONLA 1H6PA 1E7VA 2PNNA 2YHCA 3ESLA 3TWTA 2X38A 3PZ2A 2CFUA 2GROB 2UY1B 5ANLA 3FHEA 1ELKA 2LNIA 2XQ0A 1NL4A 2IF4A 1QBQA 2RFAA 2YINA 4G8KA 4HLLA 4QQIA 3U3WA 1KT1A 4IRUA 5AAOA 5JHBA 3PS6A 2LSVA 2ETCA 3IBEA 3MEKA 1TEZA 3UI2A 3PH0C 5B3SE 4K5AB 4KZ0A 2YQ8A 1DVPA 3ASFA 4NQ0A 4G26A 2XEVA 2VJ8A 4N5CA 4PDXA 4HFGA 4HLEA 1OWLA 4J6IA 4APFA 2BKGA 4CDNA 1E7UA 3PREA 5CHEE 3FTUA 1SVXA 4ANVA 1OCRE 2L9BA 4BSZB 4B89A 4URKA 4JW1A 2WXKA 1HG2A 4G24A 2XGOA 3ISMC 1N4PA 4BX8A 3PVLA 2OEWA 4JVSA 3V2XA 2VGXA 3OXLA 3FU0A 3HXFA 3CVVA 3OAWA 3L17A 4U96D 3ZYKA 2M63A 2KXPC 3CGHA 3LJNA 4ME2A 3E4BA 5G04C 3MV2B 2AVPA 2MHKA 4N2SA 3MV3B 5FTPA 4I1MA 3DXMG 3AG1E 3CK8A 3SFXA 2Y0BG 2KC7A 4DLQA 4CCAA 2LAIA 2R03A 3VTXA 3G2WA 2QYUA 1BI8B 4YDOA 3NBNB 4ANXA 4R7LA 3FEYA 3FU6A 1NFIE 4ACKA 4U63A 4BESA 5AQAA 1MZCA 3B95A 3UTMA 3ZYLA 3B7RL 2XRZA 1HXIA 4UWFA 1EF1C 2AXZA 2V5FA 4GTRA 2VTBA 5BPPA 4PH4B 5EX3A 1IKND 2VSYA 3MA5A 2OCCE 5BUZA 4MS6A 1LTXA 3PNTB 2IU1A 1XNFA 5FIOA 1SZ9A 1DCQA 3PZ1A 1OWOA 5EKQD 5AARA 3UXGA 4XZ4A 2OVBA 4UUCA 2HR2A 3CVWA 3E33A 4JHRA 4GCNA 3UM0A 2RD0A 3UX4A 2NC9A 1QQEA 1IHGA 2MRIA 2WMNA 3Q78A 3Q5MA 2AJAA 4A3VA 4GA2A 3FP3A 5ANRA 4ZFHA 1IQUA 4M3OA 3NF1A 4G1TA 4BSXA 4BX9A 2J09A 4CZ2D 2WXGA 4I43A 2KZTA 3FTYA 3LJ3A 3E30A 3IHYA 4TRQA 3VLEA 1HO8A 3L9TA 2UWJG 4XKBA 5G05C 4B8CB 4ANWA 3QDNA 3DXKG 4FHKA 3U66A 3BQOA 5ITZF 1JCSA 1X81A 2P9PG 3MKRA 3NZSA 4WNEA 1U2VG 5CBNA 1N0RA 2WXQA 2OV8A 4L2LA 1H2TC 2I2OA 3CHMA 2QC9A 3UINC 3GW4A 3ZYQA 3EU5A 3QJZA 3ZGQA 3PZ4A 5T4YA 3EIJA 1E8WA 4O1OA 2X6JA 3CHRA 3RK6A 2WM9A 5AQ7A 4V3IA 4GZ3A 4JHKA 1UN9A 1TN6A 3D9KA 4C0MA 3FUIA 3Q9NC 2X6IA 2KBXA 4FC8A 3CHPA 4FP7A 4CDMA 3AU4A 4JD2G 1S0PA 4G2VA 2DWZA 4CGWA 2MOWA 2JEKA 5KJLA 3V2OA 2CG2A 1KZPA 1SA5A 2WXRA 3FH8A 4MRUA 1L5JA 3QK0A 1ZB1A 2BF0X 4YVOA 2GRLA 2BTDA 5CECB 3RU0A 4CYMD 3TJPA 3WG7E 2XGMA 2ZGGA 1NZNA 3J5QB 5ENSD 4HOUA 4J8DA 4WWOA 3EJNA 3DEPA 3CK7A 4U0UA 5FWQA 2AXUA 1A5EA 3P2BA 2XCCA 4O1PA 4CEMA 4BTBA 3IKOB 4KVMA 3R9AB 3KEZA 4YDYA 3T9KA 3TGOA 4J7WA 1TNBA 3JXJA 4BERA 3VTYA 2B0OE 4GA0A 5FJYA 4N3AA 2WXHA 5D2MC 4GTTA 1OWMA 2A4ZA 1TJCA 4HQDA 3NOGD 3QWVA 4GAAA 1HF8A 1OCOE 4L9PA 3FUJA 4G25A 1YA0A 1B89A 1Z3YA 3U4TA 1U3DA 1E96B 3B7TA 3G2UA 5EX0A 3DWLG 2PM7A 3E37A 2CHXA 2WQHA 3UMVA 1N4RA 3EU9A 1QYMA 4W9RA 4YNDA 3HVEA 2YHEA 3MYVA 2LO6A 4F1SA 2BUGA 2QFCA 3B7UX 3JUEA 3ABME 3UIOC 4FULA 1MQSA 2DVWA 3D9OA 1H19A 2KCLA 3CKCA 2X6KA 4JEHA 3AS5A 3UIPC 1FCHA 4RVBA 5HI7A 3LPZA 1JPLA 2QZAA 4LRZA 2P9LG 5T8IA 3FTWA 2VSOE 2IOLA 3KAEA 3UQ3A 1UN8A 4KMOA 3UKUG 1PC2A 4U8HA 1UJKA 3CQGB 1OT8A 2RG8A 5E76A 2VGYA 3SQVA 4B8AA 2ZIRA 1TNYA 4ATZD 2GRQB 3FTXA 3ML9A 4OYSA 3D9HA 3ZIMA 3GZSA 4DI3A 1MX6A 4LNBA 1NP7A 4N2QA 2NYJA 1JCRA 3KEAA 4U0SA 2H6HA 4TUUA 3HXDA 1LD8A 1FVHA 3DSSA 1EDUA 4GTMA 3SD5A 5CEDB 3RKVA 3UUXA 3ZFWA 2GRMA 3JYSA 5H7PA 4OAUC 2J07A 4E85A 1RZ4A 5IY5E 3KSLA 2VYIA 4JXTA 4ACLA 3LY8A 4LNGA 2CHWA 3PZ3A 2XPYA 3FY4A 3UM2A 3TWRA 3BG1B 4XX5A 2A5EA 3IXEA 4H7XA 2ZXWE 4AP2A 3PE3A 5CEAA 2LUHA 2XS8A 4UQYA 5ENOD 1N95A 3L54A 1KZOA 1K1BA 4GZ5A 1DCEA 4UI9C 1FPPA 4AV7A 4JEUA 2DIWA 4F53A 2J08A 3ENEA 4IN3B 2ZU6B 4CDRA 2XZDG 4FADA 1WY6A 4DX5D 4GMLA 1H2UA 2OEVA 2DYSE 4ILGA 5ENQD 3LEWA 4I2WA 1O5MA 2Y3AA 4TXPA 2LXMA 5LOZA 2I1JA 3GYZA 4B94A 2WXIA 1IQRA 2IO2C 1AP7A 4JA7A 3CVLA 4I9CA 5EIDA 3V31A 4JB8P 2DBAA 1A17A 5FQ4A 4U8YD 3C3RA 4D10C 4L2YA 3FH5A 1HE8A 1MX2A 2ETAA 3AJIA 3S7FA 2RFMA 1JWFA 2VSNA 3ASNE 3K9IA 2EILE 2GGFA 4DRXE 1N52A 3G2VA 3R7RA 1H6OA 3SI5A 3DSXA 2FO7A 2GRPB 4BT8A 1BU9A 2EINE 3QAQA 5CERB 2VQ2A 2J49A 3FUFA 3HXCA 4GZDA 2AWIA 5J08A 3SFZA 2V4LA 3ZKJA 5CRVA 4NURA 3FDHA 2VGXB 1YYHA 1HS6A 4EBAA 4EPZA 3O48A 4BY6A 2IJGX 4LERA 2C2LA 3AG2E 4EECA 1UJJA 1TJFA 2X6FA 3QB2A 5KJMA 4Y6CA 4DX6D 1VDYA 2R17C 2WXNA 3WXXA 3RAUA 4AVXA 4F3VA 4GYWA 3O4ZA 2LXLA 2H6GA 2HM8A 1WM5A 3DSWA 5FQ7A 4HRLA 4H7YA 3ULYA 3ZHEA 2Y4TA 4CGVA 2J9QA 3S7DA 1YCSB 4HRMB 2VTBB 3FUNA 2J4DA 4WWPA 3SBTB 3TXMA 2JABA 4BT9A 4ZHBA 3KS2A 4K5CA 1YMPA 3T5VA 2C0LA 3HIZA 3QWPA 3T8KA 3FEXA 2GRRB 5D0OD 3LCAA 4WAFA 2WXJA 3IV0A 3PUKA 3TG4A 2XHEA 1Y8MA 2QY7A 4PS8A 2FO1E 2PQNA 4PS3A 4L1BA 3DPDA 3B7BA 2ONDA 3FUEA 1ZU2A 1HFAA 1P5QA 1HZ4A 4GTOA 5E75A 3G2SA 3CVXA 3TWXA 5AQBA 3U9WA 1NI1A 4BFRA 2AW6A 1Y6IA 2V8SE 3HXEA 4HOTA 2KZTB 3ZPJA 3D9JA 4O6FA 2ILRA 4JPSA 4C9BB 5A23A 3APDA 4U0ZA 2IY0C 3T5XA 1OCZE 3ZN3A 4HRNA 3CHOA 2HYZA 3MJWA 3R9MA 2Y4UA 4DJAA 3CSFA 2XGSA 3BU8A 3LYAA 3OXGA 4HORA 3ASHA 5B1AE 1W3BA 5G55A 2WXLA 4J0UA 1WDYA 3B7SA 5BNWA 3MKQA 2PL2A 5ENTD 4KZCA 1D9SA 5DIZA 5KCMA 1SQMA 1WG0A 3LVRE 4KXKB 4EHMA 3C3OA 4Z68A 3NOCD 5KNHD 3AAAC 4DI4A 2V5QC 3Q47B 4HBDA 1GW6A 1H6KA 4N39A 1TNZA 2L0IA 3CVQA 3P1UA 4JZYA 5KBAA 1OXJA 3ZNGA 2MYOA 3LY7A 3JQ0A 1S70B 3FU3A 2A5UA 5BXOA 4F1PA 3NZUA 2WXFA 1O1SA 2J4BA 3ONKA 1E8XA 3J5PA 3TL5A 3JXIA 3L08A 4GMJA 2EIKE 2I9CA 4EQFA 5D66A 4F6RD 4OAVB 1JUQA 2DZNA 3SO8A 4J8FA 5JA4D 5LCWC 3HG0D 3FUDA 1WAO1 3I4GA 4ANUA 1TYQG 4I6GA 3DSUA 3DBSA 4ABNA 4K0RA 2R05A 3PDNA 3CEQA 4G23A 3I4RB 3BG0B 1TN8A 3PRZA 4DPRA 1TNOA 1KT0A 3ULEG 3LDZA 4YVQC 2IQCA 4AY6A 3JQ1A 2AXVA 3L22A 3IHVA 4GTPA 5KJNA 2WPVA 2P9SG 3B13A 3D3MA 3CVUA 1V54E 4XE0A 1UOHA 3DPYA 2CG3A 3LKUA 3VLDA 2GRNB 3OXFA 4GZCA 4ILHB 3Q4AB 5LP0A 2LAHA 1KLXA 1MYOA 3GZ1A 5ARFA 4EBAG 5J90A 3CVNA 1KPSB 4GPKA 3CHSA 3DSTA 3JUIA 4A55A 4NIKA 3BEEA 3TWWA 4F7AA 1JCQA 3L82A 3QKYA 3SZ7A 5JJ6A 3NQPA 1TN7A 3RJVA 4XI0A 2HO1A 5JHAA 4I2ZA 4UWGA 3D9MA 4LCTA 5HS0A 3C3QA 5EN5D 4N5QA 1TNUA 4U04A 3FTSA 3NB2A 2I1KA 5FZSA 3QOUA 2OVFA 3ML8A 3FUHA 2HE0A 4GB9A 3ZEFA 4AJWA 2EIME 3PE4A 1N4QA 2V4HC 4ILIA 4A1SA 2WXPA 3UM3A 4J8EA 2XS1A 3EUVA 1N4SA 1N11A 1AWCB 2C0MA
chains in the Genus database with same CATH topology
1YCSB 4HRMB 1D9SA 3LJNA 3W9FA 1WG0A 1MX2A 2ETAA 3AJIA 2QYJA 3EHRA 4CZ2D 1IXVA 5KWDA 2JABA 2RFMA 4Z68A 2ETBA 4ZHBA 3EU9A 2DWZA 1QYMA 4O60A 5CEDB 3NOCD 5EYLA 4K5CA 5KNHD 1K3ZD 1YMPA 3AAAC 1UOHA 4OAUC 3V2OA 5KNGA 2PNNA 5ENPD 2V5QC 4HBDA 2Y0BG 1IHBA 3TWTA 4DRXE 3T8KA 1BI7B 3W9GA 1G3NB 2F8XK 4J8YA 1BI8B 2VGEA 3JUEA 3NBNB 2L6BA 2XZTG 2F8YA 2DVWA 5CBOA 4HI8A 4BEPA 5KBAA 2RFAA 1NFIE 1MYOA 4G8KA 4HLLA 3TWRA 4QQIA 5HRYA 1BU9A 4BESA 3ZNGA 1TR4A 2MYOA 3HRAA 5AQAA 2XEHA 5FINA 5AAOA 5CECB 2A5EA 3EHQA 1SW6A 4CYMD 2ZGDA 3IXEA 2F37A 1S70B 5CERB 3B95A 2ZGGA 3UTMA 2ETCA 5ITZF 5BXOA 4F1PA 3J5QB 5ENSD 5CEAA 3UI2A 3ZUVB 2FO1E 5AN8A 5ENOD 4NIKA 3TWWA 4LSZE 3ZKJA 1K1BA 5CBNA 3DEPA 1N0RA 2Y1LE 4K5AB 3J5PA 3TWQA 5BXUA 4LNUD 3F6QA 2XENA 3B7BA 3JXIA 3DEOA 3TWSA 3ZU7B 1A5EA 1YYHA 1BLXB 5EIBE 1IKND 3Q9UC 2QC9A 4DUIA 4O1PA 3C5RA 3TWXA 1MX4A 5AQBA 5EILA 5D66A 5AQ9A 4G8LA 3TWVA 5HS0A 4DX2A 4F6RD 4OAVB 4YDYA 2XZDG 2DZNA 3SO8A 5EN5D 1OT8A 4DX5D 4N5QA 1MJ0A 4HNAD 3T9KA 5FIOA 2BKGA 2DZOA 4U95D 5JA4D 4J7WA 5ENQD 1N0QA 1DCQA 1SVXA 3TWUA 3JXJA 4BERA 4C48B 4RLYA 3HG0D 1BD8A 4ATZD 4DX7D 4DX6D 1K1AA 3V30A 2B0OE 4QFVA 4GMRA 3D9HA 4HRNA 5AARA 3UXGA 2HE0A 4BSZB 2KBXA 4HB5A 5JMND 4UUCA 4O1OA 5EYPF 1MX6A 4U8VD 5ENRD 4HQDA 3V79K 4GPMA 3NOGD 1AP7A 4TUMA 4YDWA 4A63B 5AQ7A 4K5BA 4DX1A 2V4HC 2NYJA 4HI9A 1DC2A 5HKPA 3KEAA 4HRLA 2P2CP 5EIDA 3V31A 4JB8P 4BETA 2BKKB 2XEEA 3V2XA 2AJAA 1OY3D 1WDYA 1N11A 4U8YD 4B93B 3Q9NC 4LG6A 1AWCB 2J8SD 4ZFHA 4U96D 5ENTD 2KXPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YCS B;  4HRM B;  1D9S A;  3LJN A;  3W9F A;  1WG0 A;  1MX2 A;  2ETA A;  3AJI A;  2QYJ A;  3EHR A;  4CZ2 D;  1IXV A;  5KWD A;  2JAB A;  2RFM A;  4Z68 A;  2ETB A;  4ZHB A;  3EU9 A;  2DWZ A;  1QYM A;  4O60 A;  5CED B;  3NOC D;  5EYL A;  4K5C A;  5KNH D;  1K3Z D;  1YMP A;  3AAA C;  1UOH A;  4OAU C;  3V2O A;  5KNG A;  2PNN A;  5ENP D;  2V5Q C;  4HBD A;  2Y0B G;  1IHB A;  3TWT A;  4DRX E;  3T8K A;  1BI7 B;  3W9G A;  1G3N B;  2F8X K;  4J8Y A;  1BI8 B;  2VGE A;  3JUE A;  3NBN B;  2L6B A;  2XZT G;  2F8Y A;  2DVW A;  5CBO A;  4HI8 A;  4BEP A;  5KBA A;  2RFA A;  1NFI E;  1MYO A;  4G8K A;  4HLL A;  3TWR A;  4QQI A;  5HRY A;  1BU9 A;  4BES A;  3ZNG A;  1TR4 A;  2MYO A;  3HRA A;  5AQA A;  2XEH A;  5FIN A;  5AAO A;  5CEC B;  2A5E A;  3EHQ A;  1SW6 A;  4CYM D;  2ZGD A;  3IXE A;  2F37 A;  1S70 B;  5CER B;  3B95 A;  2ZGG A;  3UTM A;  2ETC A;  5ITZ F;  5BXO A;  4F1P A;  3J5Q B;  5ENS D;  5CEA A;  3UI2 A;  3ZUV B;  2FO1 E;  5AN8 A;  5ENO D;  4NIK A;  3TWW A;  4LSZ E;  3ZKJ A;  1K1B A;  5CBN A;  3DEP A;  1N0R A;  2Y1L E;  4K5A B;  3J5P A;  3TWQ A;  5BXU A;  4LNU D;  3F6Q A;  2XEN A;  3B7B A;  3JXI A;  3DEO A;  3TWS A;  3ZU7 B;  1A5E A;  1YYH A;  1BLX B;  5EIB E;  1IKN D;  3Q9U C;  2QC9 A;  4DUI A;  4O1P A;  3C5R A;  3TWX A;  1MX4 A;  5AQB A;  5EIL A;  5D66 A;  5AQ9 A;  4G8L A;  3TWV A;  5HS0 A;  4DX2 A;  4F6R D;  4OAV B;  4YDY A;  2XZD G;  2DZN A;  3SO8 A;  5EN5 D;  1OT8 A;  4DX5 D;  4N5Q A;  1MJ0 A;  4HNA D;  3T9K A;  5FIO A;  2BKG A;  2DZO A;  4U95 D;  5JA4 D;  4J7W A;  5ENQ D;  1N0Q A;  1DCQ A;  1SVX A;  3TWU A;  3JXJ A;  4BER A;  4C48 B;  4RLY A;  3HG0 D;  1BD8 A;  4ATZ D;  4DX7 D;  4DX6 D;  1K1A A;  3V30 A;  2B0O E;  4QFV A;  4GMR A;  3D9H A;  4HRN A;  5AAR A;  3UXG A;  2HE0 A;  4BSZ B;  2KBX A;  4HB5 A;  5JMN D;  4UUC A;  4O1O A;  5EYP F;  1MX6 A;  4U8V D;  5ENR D;  4HQD A;  3V79 K;  4GPM A;  3NOG D;  1AP7 A;  4TUM A;  4YDW A;  4A63 B;  5AQ7 A;  4K5B A;  4DX1 A;  2V4H C;  2NYJ A;  4HI9 A;  1DC2 A;  5HKP A;  3KEA A;  4HRL A;  2P2C P;  5EID A;  3V31 A;  4JB8 P;  4BET A;  2BKK B;  2XEE A;  3V2X A;  2AJA A;  1OY3 D;  1WDY A;  1N11 A;  4U8Y D;  4B93 B;  3Q9N C;  4LG6 A;  1AWC B;  2J8S D;  4ZFH A;  4U96 D;  5ENT D;  2KXP C; 
#chains in the Genus database with same CATH topology
 3RO3 A;  3PZD A;  4DK5 A;  3D9N A;  5FQ6 A;  4PS7 A;  1BPO A;  4UWH A;  2PQR A;  4UQX A;  5EYL A;  2WQ6 A;  1SZA A;  5KNG A;  4Q69 A;  1BI7 B;  4J8S A;  5D0Q D;  2ZIS A;  2L6B A;  1UG3 A;  3IEG A;  4GU5 A;  4IYP A;  3I5P A;  1FT1 A;  1N54 A;  2XRY A;  1Z6T A;  3HRA A;  4EZK A;  4WNG A;  2V0P A;  2RKK A;  4TXR A;  3PEU B;  4NRH B;  5CMY A;  3ZYM A;  5BV0 A;  4XEI G;  3F6Q A;  3CQC B;  3TWS A;  3D9I A;  5HQ8 A;  1RW2 A;  3APF A;  2FBN A;  1MX4 A;  2DCP A;  5C1D A;  4XIF A;  3CST A;  1H0A A;  2UY1 A;  4KT6 B;  1N0Q A;  2IO3 C;  3CHQ A;  3AG3 E;  1FVF A;  4I6J A;  1K1A A;  1NA3 A;  2WXO A;  3MZL B;  4U7E B;  5ENR D;  4GPM A;  3RIB A;  4A63 B;  5HKP A;  2CFZ A;  2ION A;  1EPU A;  3SGH A;  1E8Y A;  4AIF A;  2BKK B;  5BT1 A;  4EZL A;  3KSQ A;  3LVQ E;  1OWN A;  1XGW A;  3KD7 A;  1Z3X A;  5KWD A;  3ESK A;  4KBQ A;  3N71 A;  2FF4 A;  4AXH A;  1O1R A;  1K3Z D;  4NAC A;  3C98 A;  3QWW A;  4G11 A;  4UQZ A;  5ENN A;  2XZT G;  1INZ A;  4FLH A;  3Q7F A;  3ZXS A;  3TG5 A;  1U3C A;  2XEH A;  3EHQ A;  1SW6 A;  2PM6 A;  3ABL E;  4A1G A;  3S2A A;  5BW8 C;  2NXP A;  4TXQ A;  1Z5S C;  5BXU A;  2WMO A;  4I1O B;  3ZU7 B;  5JJ7 A;  5FT9 A;  4LUN U;  3RRN B;  3ABK E;  5EIB E;  1Q2Z A;  3ASO E;  4N3B A;  2FEZ A;  3TWV A;  3G2T A;  5JJT A;  4Y6W A;  1N9A A;  2P9U G;  3SHF A;  3PEV B;  3PUJ A;  3DSV A;  5LX8 A;  3T8M A;  2B6C A;  3FU5 A;  2P58 C;  5A6C A;  2L6J A;  3Q79 A;  1EYH A;  5FZR A;  3Q49 B;  3FTZ A;  1OCC E;  4K5B A;  2H6F A;  5T3R A;  2WVI A;  1HU3 A;  2WQ7 A;  3FFL A;  4GYO A;  5G2N A;  2R59 A;  3L6A A;  4FU3 A;  4PUC A;  3SY2 A;  3CKB A;  4FJY A;  4HOQ A;  3EHR A;  3QNK A;  3FUL A;  2ETB A;  5KJK A;  4JHJ A;  3SNX A;  3CV0 A;  1D8D A;  1ZBP A;  4RSY A;  4Q94 A;  3ASG A;  4J8Y A;  1K8K G;  2VGE A;  3FUM A;  3QC1 A;  4HI8 A;  4C0E A;  2BED A;  3SBS A;  5FIN A;  4X8Q A;  5FQ8 A;  1H2V C;  3AU5 A;  3Q15 A;  2NSZ A;  2Y69 E;  3ZVV A;  5LFA A;  4GTQ A;  3UKR G;  2Y1L E;  3ZHE B;  4I1A A;  2Q7F A;  2WB2 A;  3DEO A;  3JCK C;  3SF4 A;  3RSE G;  2FUL A;  5BV1 A;  4DX2 A;  3R7Q A;  3C72 A;  2IEJ A;  4P29 A;  4HNA D;  2KCK A;  4TV3 A;  2FI7 A;  4U95 D;  3UPV A;  3CIA A;  3HYM B;  3EHN A;  3V30 A;  3SFY A;  2EQX A;  4GMR A;  5CCM A;  4YDE A;  3HDX A;  4U8V D;  1S63 A;  4UI9 J;  4GTS A;  2P2C P;  3MCX A;  2JLB A;  4AEZ C;  3EHM A;  4FA6 A;  3LY9 A;  4L7T A;  4B93 B;  4OVV A;  4GTV A;  2EIJ E;  4HS2 A;  2E0I A;  4AM9 A;  3W9F A;  1QNF A;  3UT8 A;  3GZ2 A;  1OUV A;  5AJD A;  5ENP D;  1IHB A;  1V55 E;  4FLB A;  2DYR E;  2F8X K;  3RRU A;  2YNQ A;  3MX3 A;  3S7B A;  1ELR A;  5AEN A;  3U64 A;  4WNF A;  4AY5 A;  2X3M A;  2F37 A;  3UT7 A;  3RO2 A;  3AG4 E;  4AOF A;  3HXB A;  3Q7A A;  5AN8 A;  4WWN A;  4JA9 A;  3X2Q E;  4APO A;  3I3N A;  3D9L A;  5CMW A;  4MLP A;  3CVY A;  2KAT A;  5DBK A;  3EDT B;  3MKQ B;  3UT4 A;  3TAX A;  4DUI A;  4I9E A;  5AQ9 A;  1PY1 A;  2IFU A;  3BUA A;  3E34 A;  4ATG A;  5CRU A;  4HXI A;  4I6E A;  5G04 J;  4JL0 A;  3FTV A;  3NAW A;  1FT2 A;  3E32 A;  3CR3 A;  3V79 K;  4TUM A;  1D8E A;  3RRM B;  2XPZ A;  3FH7 A;  2XCB A;  5AYW D;  2XEE A;  1NA0 A;  1OY3 D;  2P9K G;  3UM1 A;  1HH8 A;  4HVB A;  2GW1 A;  5ARG A;  4MKT A;  1IXV A;  3ZW3 A;  4GYY A;  2VSX E;  1LF8 A;  4UWL A;  3ULQ A;  4O60 A;  3PNL B;  3ZRH A;  4CRW A;  4FHJ A;  1E8Z A;  2XPI A;  3W9G A;  1G3N B;  2KCV A;  4LEU A;  1S64 A;  4B0Z A;  2R02 A;  4WND A;  2F8Y A;  2R5S A;  5CBO A;  2R2L A;  4E6H A;  1TR4 A;  2I6H A;  2ZGD A;  4KYO B;  4GZ6 A;  2E2E A;  4UI9 K;  4FJZ A;  3CLJ A;  4N3C A;  3ZUV B;  5EDS A;  2LSU A;  3S7J A;  4XKC A;  2PZI A;  3TWQ A;  2XEN A;  1DNP A;  1BLX B;  3Q73 A;  3EIQ C;  3C5R A;  3L13 A;  5C2Y A;  4G8L A;  5AIJ A;  3DRA A;  4CT4 A;  2DZO A;  2IOS A;  2X6H A;  4C48 B;  3OTN A;  2P9N G;  5M72 A;  5B1B E;  4HB5 A;  5JMN D;  4XI9 A;  3CK9 A;  1N94 A;  4U07 A;  5CCL A;  4UWK A;  4YDW A;  3HHM A;  4EZJ A;  1DC2 A;  4JC8 A;  5G05 J;  3FWV A;  3ZXP A;  1QZ2 A;  3HVE B;  4MBG A;  3TXN A;  4RQI A;  4M7C A;  2OOE A;  2QYJ A;  5A7D B;  4DLO A;  1LD7 A;  2F0Y A;  2WXM A;  1PAQ A;  3Q75 A;  1E90 A;  1JWG A;  1IYG A;  3ASD A;  4BEP A;  3VLF A;  5HRY A;  3AS4 A;  1HG5 A;  5AJL A;  4A3T A;  2L0T B;  4CT0 A;  4LSZ E;  1OWP A;  1UW4 B;  3LS8 A;  4LNU D;  1X5B A;  3AS8 A;  1HX8 A;  3Q9U C;  4IUL A;  5EIL A;  4GCO A;  2CHZ A;  4BTA A;  2H6I A;  3QAR A;  3MGB A;  1MJ0 A;  4Q96 A;  4KVO A;  1MHQ A;  3CVP A;  3D9P A;  4GA1 A;  4BWR A;  3FUK A;  3TWU A;  4RLY A;  1BD8 A;  4DX7 D;  4QFV A;  3APC A;  4RG6 A;  1O1T A;  4RG9 A;  2P9I G;  1ELW A;  5EYP F;  4HOS A;  3L16 A;  4OVU A;  1SA4 A;  4DX1 A;  4HI9 A;  5FZQ A;  4BET A;  2KM4 A;  4LG6 A;  2J8S D;  4K03 A;  3LXU X;  3URZ A;  4I17 A;  4WUY A;  4L23 A;  5LCW J;  3ONL A;  1H6P A;  1E7V A;  2PNN A;  2YHC A;  3ESL A;  3TWT A;  2X38 A;  3PZ2 A;  2CFU A;  2GRO B;  2UY1 B;  5ANL A;  3FHE A;  1ELK A;  2LNI A;  2XQ0 A;  1NL4 A;  2IF4 A;  1QBQ A;  2RFA A;  2YIN A;  4G8K A;  4HLL A;  4QQI A;  3U3W A;  1KT1 A;  4IRU A;  5AAO A;  5JHB A;  3PS6 A;  2LSV A;  2ETC A;  3IBE A;  3MEK A;  1TEZ A;  3UI2 A;  3PH0 C;  5B3S E;  4K5A B;  4KZ0 A;  2YQ8 A;  1DVP A;  3ASF A;  4NQ0 A;  4G26 A;  2XEV A;  2VJ8 A;  4N5C A;  4PDX A;  4HFG A;  4HLE A;  1OWL A;  4J6I A;  4APF A;  2BKG A;  4CDN A;  1E7U A;  3PRE A;  5CHE E;  3FTU A;  1SVX A;  4ANV A;  1OCR E;  2L9B A;  4BSZ B;  4B89 A;  4URK A;  4JW1 A;  2WXK A;  1HG2 A;  4G24 A;  2XGO A;  3ISM C;  1N4P A;  4BX8 A;  3PVL A;  2OEW A;  4JVS A;  3V2X A;  2VGX A;  3OXL A;  3FU0 A;  3HXF A;  3CVV A;  3OAW A;  3L17 A;  4U96 D;  3ZYK A;  2M63 A;  2KXP C;  3CGH A;  3LJN A;  4ME2 A;  3E4B A;  5G04 C;  3MV2 B;  2AVP A;  2MHK A;  4N2S A;  3MV3 B;  5FTP A;  4I1M A;  3DXM G;  3AG1 E;  3CK8 A;  3SFX A;  2Y0B G;  2KC7 A;  4DLQ A;  4CCA A;  2LAI A;  2R03 A;  3VTX A;  3G2W A;  2QYU A;  1BI8 B;  4YDO A;  3NBN B;  4ANX A;  4R7L A;  3FEY A;  3FU6 A;  1NFI E;  4ACK A;  4U63 A;  4BES A;  5AQA A;  1MZC A;  3B95 A;  3UTM A;  3ZYL A;  3B7R L;  2XRZ A;  1HXI A;  4UWF A;  1EF1 C;  2AXZ A;  2V5F A;  4GTR A;  2VTB A;  5BPP A;  4PH4 B;  5EX3 A;  1IKN D;  2VSY A;  3MA5 A;  2OCC E;  5BUZ A;  4MS6 A;  1LTX A;  3PNT B;  2IU1 A;  1XNF A;  5FIO A;  1SZ9 A;  1DCQ A;  3PZ1 A;  1OWO A;  5EKQ D;  5AAR A;  3UXG A;  4XZ4 A;  2OVB A;  4UUC A;  2HR2 A;  3CVW A;  3E33 A;  4JHR A;  4GCN A;  3UM0 A;  2RD0 A;  3UX4 A;  2NC9 A;  1QQE A;  1IHG A;  2MRI A;  2WMN A;  3Q78 A;  3Q5M A;  2AJA A;  4A3V A;  4GA2 A;  3FP3 A;  5ANR A;  4ZFH A;  1IQU A;  4M3O A;  3NF1 A;  4G1T A;  4BSX A;  4BX9 A;  2J09 A;  4CZ2 D;  2WXG A;  4I43 A;  2KZT A;  3FTY A;  3LJ3 A;  3E30 A;  3IHY A;  4TRQ A;  3VLE A;  1HO8 A;  3L9T A;  2UWJ G;  4XKB A;  5G05 C;  4B8C B;  4ANW A;  3QDN A;  3DXK G;  4FHK A;  3U66 A;  3BQO A;  5ITZ F;  1JCS A;  1X81 A;  2P9P G;  3MKR A;  3NZS A;  4WNE A;  1U2V G;  5CBN A;  1N0R A;  2WXQ A;  2OV8 A;  4L2L A;  1H2T C;  2I2O A;  3CHM A;  2QC9 A;  3UIN C;  3GW4 A;  3ZYQ A;  3EU5 A;  3QJZ A;  3ZGQ A;  3PZ4 A;  5T4Y A;  3EIJ A;  1E8W A;  4O1O A;  2X6J A;  3CHR A;  3RK6 A;  2WM9 A;  5AQ7 A;  4V3I A;  4GZ3 A;  4JHK A;  1UN9 A;  1TN6 A;  3D9K A;  4C0M A;  3FUI A;  3Q9N C;  2X6I A;  2KBX A;  4FC8 A;  3CHP A;  4FP7 A;  4CDM A;  3AU4 A;  4JD2 G;  1S0P A;  4G2V A;  2DWZ A;  4CGW A;  2MOW A;  2JEK A;  5KJL A;  3V2O A;  2CG2 A;  1KZP A;  1SA5 A;  2WXR A;  3FH8 A;  4MRU A;  1L5J A;  3QK0 A;  1ZB1 A;  2BF0 X;  4YVO A;  2GRL A;  2BTD A;  5CEC B;  3RU0 A;  4CYM D;  3TJP A;  3WG7 E;  2XGM A;  2ZGG A;  1NZN A;  3J5Q B;  5ENS D;  4HOU A;  4J8D A;  4WWO A;  3EJN A;  3DEP A;  3CK7 A;  4U0U A;  5FWQ A;  2AXU A;  1A5E A;  3P2B A;  2XCC A;  4O1P A;  4CEM A;  4BTB A;  3IKO B;  4KVM A;  3R9A B;  3KEZ A;  4YDY A;  3T9K A;  3TGO A;  4J7W A;  1TNB A;  3JXJ A;  4BER A;  3VTY A;  2B0O E;  4GA0 A;  5FJY A;  4N3A A;  2WXH A;  5D2M C;  4GTT A;  1OWM A;  2A4Z A;  1TJC A;  4HQD A;  3NOG D;  3QWV A;  4GAA A;  1HF8 A;  1OCO E;  4L9P A;  3FUJ A;  4G25 A;  1YA0 A;  1B89 A;  1Z3Y A;  3U4T A;  1U3D A;  1E96 B;  3B7T A;  3G2U A;  5EX0 A;  3DWL G;  2PM7 A;  3E37 A;  2CHX A;  2WQH A;  3UMV A;  1N4R A;  3EU9 A;  1QYM A;  4W9R A;  4YND A;  3HVE A;  2YHE A;  3MYV A;  2LO6 A;  4F1S A;  2BUG A;  2QFC A;  3B7U X;  3JUE A;  3ABM E;  3UIO C;  4FUL A;  1MQS A;  2DVW A;  3D9O A;  1H19 A;  2KCL A;  3CKC A;  2X6K A;  4JEH A;  3AS5 A;  3UIP C;  1FCH A;  4RVB A;  5HI7 A;  3LPZ A;  1JPL A;  2QZA A;  4LRZ A;  2P9L G;  5T8I A;  3FTW A;  2VSO E;  2IOL A;  3KAE A;  3UQ3 A;  1UN8 A;  4KMO A;  3UKU G;  1PC2 A;  4U8H A;  1UJK A;  3CQG B;  1OT8 A;  2RG8 A;  5E76 A;  2VGY A;  3SQV A;  4B8A A;  2ZIR A;  1TNY A;  4ATZ D;  2GRQ B;  3FTX A;  3ML9 A;  4OYS A;  3D9H A;  3ZIM A;  3GZS A;  4DI3 A;  1MX6 A;  4LNB A;  1NP7 A;  4N2Q A;  2NYJ A;  1JCR A;  3KEA A;  4U0S A;  2H6H A;  4TUU A;  3HXD A;  1LD8 A;  1FVH A;  3DSS A;  1EDU A;  4GTM A;  3SD5 A;  5CED B;  3RKV A;  3UUX A;  3ZFW A;  2GRM A;  3JYS A;  5H7P A;  4OAU C;  2J07 A;  4E85 A;  1RZ4 A;  5IY5 E;  3KSL A;  2VYI A;  4JXT A;  4ACL A;  3LY8 A;  4LNG A;  2CHW A;  3PZ3 A;  2XPY A;  3FY4 A;  3UM2 A;  3TWR A;  3BG1 B;  4XX5 A;  2A5E A;  3IXE A;  4H7X A;  2ZXW E;  4AP2 A;  3PE3 A;  5CEA A;  2LUH A;  2XS8 A;  4UQY A;  5ENO D;  1N95 A;  3L54 A;  1KZO A;  1K1B A;  4GZ5 A;  1DCE A;  4UI9 C;  1FPP A;  4AV7 A;  4JEU A;  2DIW A;  4F53 A;  2J08 A;  3ENE A;  4IN3 B;  2ZU6 B;  4CDR A;  2XZD G;  4FAD A;  1WY6 A;  4DX5 D;  4GML A;  1H2U A;  2OEV A;  2DYS E;  4ILG A;  5ENQ D;  3LEW A;  4I2W A;  1O5M A;  2Y3A A;  4TXP A;  2LXM A;  5LOZ A;  2I1J A;  3GYZ A;  4B94 A;  2WXI A;  1IQR A;  2IO2 C;  1AP7 A;  4JA7 A;  3CVL A;  4I9C A;  5EID A;  3V31 A;  4JB8 P;  2DBA A;  1A17 A;  5FQ4 A;  4U8Y D;  3C3R A;  4D10 C;  4L2Y A;  3FH5 A;  1HE8 A;  1MX2 A;  2ETA A;  3AJI A;  3S7F A;  2RFM A;  1JWF A;  2VSN A;  3ASN E;  3K9I A;  2EIL E;  2GGF A;  4DRX E;  1N52 A;  3G2V A;  3R7R A;  1H6O A;  3SI5 A;  3DSX A;  2FO7 A;  2GRP B;  4BT8 A;  1BU9 A;  2EIN E;  3QAQ A;  5CER B;  2VQ2 A;  2J49 A;  3FUF A;  3HXC A;  4GZD A;  2AWI A;  5J08 A;  3SFZ A;  2V4L A;  3ZKJ A;  5CRV A;  4NUR A;  3FDH A;  2VGX B;  1YYH A;  1HS6 A;  4EBA A;  4EPZ A;  3O48 A;  4BY6 A;  2IJG X;  4LER A;  2C2L A;  3AG2 E;  4EEC A;  1UJJ A;  1TJF A;  2X6F A;  3QB2 A;  5KJM A;  4Y6C A;  4DX6 D;  1VDY A;  2R17 C;  2WXN A;  3WXX A;  3RAU A;  4AVX A;  4F3V A;  4GYW A;  3O4Z A;  2LXL A;  2H6G A;  2HM8 A;  1WM5 A;  3DSW A;  5FQ7 A;  4HRL A;  4H7Y A;  3ULY A;  3ZHE A;  2Y4T A;  4CGV A;  2J9Q A;  3S7D A;  1YCS B;  4HRM B;  2VTB B;  3FUN A;  2J4D A;  4WWP A;  3SBT B;  3TXM A;  2JAB A;  4BT9 A;  4ZHB A;  3KS2 A;  4K5C A;  1YMP A;  3T5V A;  2C0L A;  3HIZ A;  3QWP A;  3T8K A;  3FEX A;  2GRR B;  5D0O D;  3LCA A;  4WAF A;  2WXJ A;  3IV0 A;  3PUK A;  3TG4 A;  2XHE A;  1Y8M A;  2QY7 A;  4PS8 A;  2FO1 E;  2PQN A;  4PS3 A;  4L1B A;  3DPD A;  3B7B A;  2OND A;  3FUE A;  1ZU2 A;  1HFA A;  1P5Q A;  1HZ4 A;  4GTO A;  5E75 A;  3G2S A;  3CVX A;  3TWX A;  5AQB A;  3U9W A;  1NI1 A;  4BFR A;  2AW6 A;  1Y6I A;  2V8S E;  3HXE A;  4HOT A;  2KZT B;  3ZPJ A;  3D9J A;  4O6F A;  2ILR A;  4JPS A;  4C9B B;  5A23 A;  3APD A;  4U0Z A;  2IY0 C;  3T5X A;  1OCZ E;  3ZN3 A;  4HRN A;  3CHO A;  2HYZ A;  3MJW A;  3R9M A;  2Y4U A;  4DJA A;  3CSF A;  2XGS A;  3BU8 A;  3LYA A;  3OXG A;  4HOR A;  3ASH A;  5B1A E;  1W3B A;  5G55 A;  2WXL A;  4J0U A;  1WDY A;  3B7S A;  5BNW A;  3MKQ A;  2PL2 A;  5ENT D;  4KZC A;  1D9S A;  5DIZ A;  5KCM A;  1SQM A;  1WG0 A;  3LVR E;  4KXK B;  4EHM A;  3C3O A;  4Z68 A;  3NOC D;  5KNH D;  3AAA C;  4DI4 A;  2V5Q C;  3Q47 B;  4HBD A;  1GW6 A;  1H6K A;  4N39 A;  1TNZ A;  2L0I A;  3CVQ A;  3P1U A;  4JZY A;  5KBA A;  1OXJ A;  3ZNG A;  2MYO A;  3LY7 A;  3JQ0 A;  1S70 B;  3FU3 A;  2A5U A;  5BXO A;  4F1P A;  3NZU A;  2WXF A;  1O1S A;  2J4B A;  3ONK A;  1E8X A;  3J5P A;  3TL5 A;  3JXI A;  3L08 A;  4GMJ A;  2EIK E;  2I9C A;  4EQF A;  5D66 A;  4F6R D;  4OAV B;  1JUQ A;  2DZN A;  3SO8 A;  4J8F A;  5JA4 D;  5LCW C;  3HG0 D;  3FUD A;  1WAO 1;  3I4G A;  4ANU A;  1TYQ G;  4I6G A;  3DSU A;  3DBS A;  4ABN A;  4K0R A;  2R05 A;  3PDN A;  3CEQ A;  4G23 A;  3I4R B;  3BG0 B;  1TN8 A;  3PRZ A;  4DPR A;  1TNO A;  1KT0 A;  3ULE G;  3LDZ A;  4YVQ C;  2IQC A;  4AY6 A;  3JQ1 A;  2AXV A;  3L22 A;  3IHV A;  4GTP A;  5KJN A;  2WPV A;  2P9S G;  3B13 A;  3D3M A;  3CVU A;  1V54 E;  4XE0 A;  1UOH A;  3DPY A;  2CG3 A;  3LKU A;  3VLD A;  2GRN B;  3OXF A;  4GZC A;  4ILH B;  3Q4A B;  5LP0 A;  2LAH A;  1KLX A;  1MYO A;  3GZ1 A;  5ARF A;  4EBA G;  5J90 A;  3CVN A;  1KPS B;  4GPK A;  3CHS A;  3DST A;  3JUI A;  4A55 A;  4NIK A;  3BEE A;  3TWW A;  4F7A A;  1JCQ A;  3L82 A;  3QKY A;  3SZ7 A;  5JJ6 A;  3NQP A;  1TN7 A;  3RJV A;  4XI0 A;  2HO1 A;  5JHA A;  4I2Z A;  4UWG A;  3D9M A;  4LCT A;  5HS0 A;  3C3Q A;  5EN5 D;  4N5Q A;  1TNU A;  4U04 A;  3FTS A;  3NB2 A;  2I1K A;  5FZS A;  3QOU A;  2OVF A;  3ML8 A;  3FUH A;  2HE0 A;  4GB9 A;  3ZEF A;  4AJW A;  2EIM E;  3PE4 A;  1N4Q A;  2V4H C;  4ILI A;  4A1S A;  2WXP A;  3UM3 A;  4J8E A;  2XS1 A;  3EUV A;  1N4S A;  1N11 A;  1AWC B;  2C0M A; 
#chains in the Genus database with same CATH homology
 1YCS B;  4HRM B;  1D9S A;  3LJN A;  3W9F A;  1WG0 A;  1MX2 A;  2ETA A;  3AJI A;  2QYJ A;  3EHR A;  4CZ2 D;  1IXV A;  5KWD A;  2JAB A;  2RFM A;  4Z68 A;  2ETB A;  4ZHB A;  3EU9 A;  2DWZ A;  1QYM A;  4O60 A;  5CED B;  3NOC D;  5EYL A;  4K5C A;  5KNH D;  1K3Z D;  1YMP A;  3AAA C;  1UOH A;  4OAU C;  3V2O A;  5KNG A;  2PNN A;  5ENP D;  2V5Q C;  4HBD A;  2Y0B G;  1IHB A;  3TWT A;  4DRX E;  3T8K A;  1BI7 B;  3W9G A;  1G3N B;  2F8X K;  4J8Y A;  1BI8 B;  2VGE A;  3JUE A;  3NBN B;  2L6B A;  2XZT G;  2F8Y A;  2DVW A;  5CBO A;  4HI8 A;  4BEP A;  5KBA A;  2RFA A;  1NFI E;  1MYO A;  4G8K A;  4HLL A;  3TWR A;  4QQI A;  5HRY A;  1BU9 A;  4BES A;  3ZNG A;  1TR4 A;  2MYO A;  3HRA A;  5AQA A;  2XEH A;  5FIN A;  5AAO A;  5CEC B;  2A5E A;  3EHQ A;  1SW6 A;  4CYM D;  2ZGD A;  3IXE A;  2F37 A;  1S70 B;  5CER B;  3B95 A;  2ZGG A;  3UTM A;  2ETC A;  5ITZ F;  5BXO A;  4F1P A;  3J5Q B;  5ENS D;  5CEA A;  3UI2 A;  3ZUV B;  2FO1 E;  5AN8 A;  5ENO D;  4NIK A;  3TWW A;  4LSZ E;  3ZKJ A;  1K1B A;  5CBN A;  3DEP A;  1N0R A;  2Y1L E;  4K5A B;  3J5P A;  3TWQ A;  5BXU A;  4LNU D;  3F6Q A;  2XEN A;  3B7B A;  3JXI A;  3DEO A;  3TWS A;  3ZU7 B;  1A5E A;  1YYH A;  1BLX B;  5EIB E;  1IKN D;  3Q9U C;  2QC9 A;  4DUI A;  4O1P A;  3C5R A;  3TWX A;  1MX4 A;  5AQB A;  5EIL A;  5D66 A;  5AQ9 A;  4G8L A;  3TWV A;  5HS0 A;  4DX2 A;  4F6R D;  4OAV B;  4YDY A;  2XZD G;  2DZN A;  3SO8 A;  5EN5 D;  1OT8 A;  4DX5 D;  4N5Q A;  1MJ0 A;  4HNA D;  3T9K A;  5FIO A;  2BKG A;  2DZO A;  4U95 D;  5JA4 D;  4J7W A;  5ENQ D;  1N0Q A;  1DCQ A;  1SVX A;  3TWU A;  3JXJ A;  4BER A;  4C48 B;  4RLY A;  3HG0 D;  1BD8 A;  4ATZ D;  4DX7 D;  4DX6 D;  1K1A A;  3V30 A;  2B0O E;  4QFV A;  4GMR A;  3D9H A;  4HRN A;  5AAR A;  3UXG A;  2HE0 A;  4BSZ B;  2KBX A;  4HB5 A;  5JMN D;  4UUC A;  4O1O A;  5EYP F;  1MX6 A;  4U8V D;  5ENR D;  4HQD A;  3V79 K;  4GPM A;  3NOG D;  1AP7 A;  4TUM A;  4YDW A;  4A63 B;  5AQ7 A;  4K5B A;  4DX1 A;  2V4H C;  2NYJ A;  4HI9 A;  1DC2 A;  5HKP A;  3KEA A;  4HRL A;  2P2C P;  5EID A;  3V31 A;  4JB8 P;  4BET A;  2BKK B;  2XEE A;  3V2X A;  2AJA A;  1OY3 D;  1WDY A;  1N11 A;  4U8Y D;  4B93 B;  3Q9N C;  4LG6 A;  1AWC B;  2J8S D;  4ZFH A;  4U96 D;  5ENT D;  2KXP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...