5EIDA

Akr2a ankyrin repeat domain
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
123
structure length
123
Chain Sequence
SIVHQTASLGDVEGLKAALASGGNKDEEDSEGRTALHFACGYGELKCAQVLIDAGASVNAVDKNKNTPLHYAAGYGRKECVSLLLENGAAVTLQNLDEKTPIDVAKLNSQLEVVKLLEKDAFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords Ankyrin repeat domain-containing protein 2
publication title structure of AKR2A ankyrin repeat domain at 2.0 angstroms resolution
rcsb
source organism Arabidopsis thaliana
total genus 43
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2015-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13637 Ank_4 Ankyrin repeats (many copies)
A PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5eidA00
5FINA 4QQIA 4UUCA 5ENPD 1YCSB 2DZOA 3NOCD 1WDYA 5CBOA 2V4HC 2F8YA 3TWRA 3AJIA 2A5EA 2XEHA 5ENOD 4G8KA 1MJ0A 3V2OA 5ENQD 4OAVB 4U8VD 4O1PA 5KNHD 3TWXA 2VGEA 1SVXA 1S70B 1YMPA 3NOGD 2L6BA 4RLYA 5EYPF 4BSZB 2XZDG 4BESA 5AQ7A 2Y1LE 4OAUC 2DVWA 3KEAA 5EIBE 3TWQA 5AAOA 4N5QA 3TWWA 3TWSA 1BU9A 3JUEA 2XZTG 2F8XK 5CEDB 1OY3D 3Q9UC 3V79K 2FO1E 5CERB 2RFAA 5CEAA 4DX2A 1N11A 2HE0A 5FIOA 4O60A 1BI8B 4HLLA 3UXGA 3HRAA 1DC2A 1MX2A 5HKPA 3ZNGA 4C48B 4DX7D 4HRLA 4LSZE 5EYLA 1MX6A 4HI9A 2DZNA 3V31A 1BI7B 5CBNA 3DEPA 4K5BA 3NBNB 4O1OA 2KXPC 5AQBA 3V30A 1NFIE 4Z68A 4JB8P 4HI8A 5ENTD 3J5PA 2BKKB 5AQAA 5AARA 2DWZA 5JMND 3F6QA 5ITZF 5KBAA 5KNGA 1BD8A 4HQDA 3W9FA 3Q9NC 4TUMA 4YDWA 5EN5D 3IXEA 3ZKJA 4U8YD 1IHBA 1K1BA 2JABA 4K5CA 5EILA 2ETCA 2XEEA 3C5RA 2F37A 1K3ZD 5CECB 2RFMA 4CYMD 3EHRA 3JXIA 4ZFHA 4J8YA 1N0RA 2ZGGA 3HG0D 5EIDA 4F6RD 2ZGDA 2ETBA 2BKGA 1QYMA 2XENA 5BXOA 5D66A 3V2XA 3ZU7B 5BXUA 1MYOA 4LNUD 1IXVA 1SW6A 2Y0BG 2J8SD 4YDYA 1MX4A 2B0OE 1UOHA 3UI2A 3ZUVB 3T9KA 3AAAC 3EHQA 1G3NB 3EU9A 5ENRD 1IKND 1K1AA 4HRMB 4GPMA 3W9GA 5JA4D 5KWDA 3TWVA 3UTMA 4CZ2D 4NIKA 4F1PA 4HBDA 1YYHA 3J5QB 4GMRA 1A5EA 1N0QA 2MYOA 1AWCB 4DX1A 2PNNA 4HNAD 5ENSD 4J7WA 4ZHBA 3TWUA 4U95D 4B93B 3D9HA 4DX5D 4BERA 1OT8A 1TR4A 4U96D 3T8KA 1DCQA 4LG6A 2NYJA 4BEPA 2AJAA 5AN8A 5HS0A 2QYJA 2P2CP 3B95A 3JXJA 3SO8A 3TWTA 4HB5A 5AQ9A 1WG0A 5HRYA 4A63B 4G8LA 4QFVA 4HRNA 2QC9A 2V5QC 2ETAA 4BETA 4DRXE 4DUIA 4DX6D 3DEOA 4ATZD 3B7BA 1D9SA 3LJNA 1AP7A 4K5AB 2KBXA 1BLXB
chains in the Genus database with same CATH superfamily
1TNOA 1OWLA 3TWRA 4ACKA 4WNFA 3SY2A 5FJYA 1NZNA 3VTXA 1N4SA 1JWGA 1N94A 3SI5A 2JEKA 4HVBA 3TWQA 3DSXA 4L9PA 3Q9UC 2VSNA 2L0IA 4XIFA 3MV2B 5CERB 4GZDA 1TNYA 3T5XA 2I6HA 3ISMC 5CRVA 2LSVA 3CHPA 5ARFA 1U3DA 4GTVA 4LCTA 4CDNA 2RG8A 3B7UX 3CKBA 3SQVA 3CGHA 1Z3YA 4WUYA 1D8EA 3Q4AB 4U8YD 4GTPA 4GPKA 4I6JA 4EZKA 1ZB1A 5T3RA 2QFCA 3X2QE 2B0OE 1UOHA 3T9KA 5DBKA 4H7YA 4DLOA 4JXTA 4GPMA 2KM4A 3C72A 4N2SA 1H6PA 1OCOE 4DJAA 4HOTA 4GTTA 4CDRA 1HH8A 2UY1B 2WM9A 1SQMA 2XRYA 5D0QD 2AXZA 4BTBA 4A63B 1U3CA 4DX6D 1D9SA 4J8DA 5T4YA 1QNFA 3FTUA 3AG1E 1RZ4A 4TXRA 2GW1A 4ANXA 3SNXA 3QOUA 4U7EB 2Y69E 3JCKC 3VTYA 1O1RA 2VGEA 2GRRB 2KCKA 4TV3A 4A3VA 3L54A 1FCHA 5FIOA 3ZIMA 1DC2A 4ACLA 4A55A 2X3MA 4JHKA 3D9MA 4HORA 5EKQD 4JA9A 3FU3A 1E7VA 1N54A 2I1JA 4UWFA 4TXPA 2DYSE 2H6HA 4UWKA 4ABNA 1EF1C 3KD7A 4TUMA 1EDUA 3EIQC 3BU8A 3IV0A 4J8YA 1TN7A 2BKGA 5D66A 2VSOE 1LD7A 2R17C 4YDYA 3TL5A 2L6JA 2P9KG 3UTMA 1YYHA 2FO7A 4GMRA 1A5EA 4JC8A 4I9CA 3U4TA 3PZ4A 5CCMA 4WNEA 4ZHBA 4XE0A 4CRWA 1TR4A 3Q47B 2JLBA 3UM1A 3FTZA 2OVBA 4JW1A 3B7BA 5ANLA 4AM9A 3NOCD 5M72A 5AENA 4CT0A 3ASHA 3FUDA 3GYZA 3UKRG 3TWXA 1S70B 3KEAA 4L7TA 4N5QA 3QWWA 1QBQA 1IQUA 2DBAA 5JJTA 4CGWA 2RFAA 2XGSA 3MV3B 4GZ3A 4HFGA 1O1SA 2CG2A 1E7UA 3CV0A 3BUAA 2P9LG 3CK7A 3OXFA 1NFIE 3FTWA 4FU3A 4KZCA 4G2VA 4EECA 3PH0C 3ZKJA 4X8QA 2WXPA 4K0RA 5EIDA 4BFRA 4I17A 4EZLA 2CFUA 3I3NA 4I1OB 2B6CA 4AEZC 3RIBA 4JL0A 4V3IA 3KAEA 1K1AA 3ZFWA 3CLJA 3KSLA 1V54E 5J90A 1FT1A 3ML9A 4FHKA 1E90A 3WXXA 3R9AB 4ILIA 3TWUA 3MZLB 1WM5A 3UT8A 4DX5D 3RO2A 1DCQA 3FU6A 2J07A 3NB2A 3AS5A 2DCPA 3CVUA 2WXLA 4MBGA 5C1DA 3D9JA 3ML8A 4DK5A 4FP7A 1YA0A 2DZOA 3GZ1A 4AIFA 2F8YA 2A5UA 2WMOA 3CHOA 1TYQG 4U8VD 5LOZA 1TNBA 2IQCA 3EDTB 1PAQA 2Y4TA 2OEVA 3DPDA 1TNUA 3IHYA 2CHXA 4DX2A 4O60A 4ANUA 3D9KA 3OTNA 3G2TA 2QZAA 1BI7B 5H7PA 3CVPA 3Q75A 2KXPC 3HXCA 1LF8A 2ONDA 2NSZA 4HQDA 2KCVA 3HYMB 3UUXA 4Y6CA 1HX8A 3TXMA 2RKKA 4EQFA 4GU5A 1K3ZD 2ZGGA 3MJWA 5BPPA 4P29A 3AAAC 4EPZA 2GRNB 3ZXSA 3PZ2A 4WAFA 2R02A 4HNAD 3FU5A 4J7WA 1OCZE 2XPYA 3LVRE 3MKRA 3URZA 2XQ0A 3JXJA 3TWTA 5JHBA 1JWFA 4HB5A 3PE4A 4G11A 3KSQA 4U0ZA 1HZ4A 3IEGA 2I9CA 4J8SA 1NA0A 2HO1A 2V4LA 3DBSA 1QQEA 2H6IA 2GRPB 4UQXA 4CGVA 4G8KA 4YVQC 5ENQD 1OWOA 5KNHD 1N4QA 2P9UG 5KJLA 2PM6A 5EYPF 5G05J 4OVVA 3OAWA 3PZ1A 3FP3A 3CQGB 2XCCA 3IHVA 5LFAA 3C3RA 3RAUA 4JHRA 4ME2A 4ATGA 3ABKE 5BV0A 3QB2A 2DWZA 3PZDA 4MRUA 2V5FA 1UG3A 3R7QA 3JYSA 3T8MA 1KZOA 4Y6WA 4URKA 2XEEA 4JA7A 3EHRA 3ULEG 5FQ6A 5AIJA 1H19A 3ULQA 3ZU7B 3LDZA 3TGOA 1P5QA 1IKND 5E75A 5CMWA 3TAXA 3CVWA 3HIZA 1SZAA 4XZ4A 3UM3A 3RO3A 3G2UA 4BERA 1Z3XA 4U96D 2WQ7A 2X6HA 4FULA 2CHZA 3O48A 3D9NA 5AQ9A 4CT4A 3DXKG 2GGFA 1H2TC 3HHMA 3L17A 4BX9A 2VGYA 1LTXA 2KATA 5FINA 3FTXA 1E8ZA 2WXMA 3FTVA 4O1PA 3S7DA 5E76A 3LY8A 5J08A 2L6BA 2R59A 2VQ2A 3DSTA 4XX5A 3AG4E 1D8DA 4GCNA 3G2SA 1DVPA 3S2AA 4WWNA 3SD5A 1S64A 4E6HA 3ZHEA 3FU0A 3BG0B 2E2EA 4G23A 3V30A 3U9WA 4JB8P 3CHQA 3QWVA 3J5PA 5ITZF 1N95A 1UJJA 3G2VA 3KEZA 3QARA 3U3WA 3VLEA 4CYMD 3MCXA 3JXIA 3CHMA 4GZ6A 1KLXA 4M3OA 1HXIA 2ZU6B 5G55A 3ZUVB 1UN8A 1TN6A 4F1PA 1UN9A 1OWNA 1EPUA 4ILGA 1O1TA 2I1KA 3FUFA 3L16A 5B1BE 3C3QA 3D9HA 5ANRA 3BEEA 4XI9A 5CRUA 2R03A 1OCRE 3UQ3A 5HRYA 2MHKA 4TXQA 3HVEA 2DYRE 3MEKA 2XS8A 2CG3A 2WXKA 4J8EA 1WDYA 1JUQA 1SA5A 2A5EA 1OXJA 5FQ8A 2BEDA 3NZUA 2LO6A 2FF4A 5EIBE 3FUMA 2L0TB 3GZ2A 5LP0A 4CDMA 3DWLG 2R2LA 5FZQA 4DX7D 3UM2A 2WVIA 3PRZA 3ABLE 4J6IA 4K5BA 2VSYA 2X6KA 3DSVA 3ENEA 2P9SG 4YDWA 4FJYA 5EILA 4WWPA 1OWMA 2ETBA 1S0PA 5BXUA 1X5BA 2WB2A 1H6KA 3UI2A 4C0MA 3EHQA 2X6IA 5A23A 4TRQA 4ILHB 1WY6A 4JEUA 3LCAA 3T5VA 3CKCA 3CHRA 3SFYA 2EQXA 1OT8A 4LG6A 3CHSA 5AJLA 3FULA 4QFVA 3PEUB 2QC9A 1HS6A 2ZXWE 1ELKA 4RG9A 5ENPD 1YCSB 2EIKE 3ZYQA 3AJIA 3L6AA 3CQCB 4HS2A 1MJ0A 4KT6B 3NOGD 4F1SA 5JJ7A 3UINC 1E8XA 2WXIA 3CSFA 3DSUA 3RU0A 3V79K 3QJZA 3LEWA 4UI9K 2HYZA 4UWHA 2QYUA 4HOSA 3FUIA 3I4RB 4KVOA 4YVOA 3CVYA 3D9OA 3E37A 4HI9A 3AG2E 3PEVB 2AXVA 1E8YA 1KPSB 3FEXA 4PS7A 1IHGA 5AYWD 1K1BA 3CVQA 3FUJA 3RRUA 5CECB 4M7CA 3UM0A 1MHQA 5HI7A 3PNLB 4EHMA 2Y0BG 4MKTA 1MX4A 1MZCA 3R9MA 4J8FA 3QAQA 3P1UA 3TWVA 4CZ2D 2IO2C 4R7LA 1AWCB 4DX1A 3HXBA 4U8HA 1NA3A 1O5MA 4NACA 2XGOA 2OCCE 3KS2A 5CMYA 2R5SA 1N52A 4UQYA 4UQZA 3T8KA 1WAO1 4EBAG 1V55E 2IU1A 4PUCA 3FH7A 3MA5A 2XCBA 4IN3B 4KBQA 1Q2ZA 2V4HC 1ELRA 4GCOA 1E96B 1JPLA 2FULA 3LYAA 3SFZA 4L2YA 1TN8A 2WXGA 3RK6A 2C0LA 2J4BA 4APOA 4DPRA 4RLYA 2EIME 2J49A 2DVWA 3E30A 4WNGA 3PDNA 2FO1E 3AS8A 1VDYA 4GAAA 2KCLA 5KJMA 4I43A 2FEZA 1OCCE 2P9IG 4UWGA 4HRLA 1IQRA 3B13A 1ELWA 4MS6A 5CBNA 2E0IA 1X81A 3LVQE 3ZXPA 1FPPA 4B8AA 4B94A 1NI1A 3OXGA 3DPYA 4Q94A 3VLFA 4K5CA 3ASFA 5BT1A 2IFUA 3L82A 3D9LA 4HLEA 1DNPA 4GYWA 3W9GA 2EIJE 1NL4A 4NIKA 1ZU2A 3ZYMA 5BV1A 4IRUA 2IONA 3NQPA 2FI7A 2WXOA 2PQNA 3L9TA 3SO8A 2OEWA 1W3BA 2KZTB 4DI4A 5D0OD 3UT4A 4HRNA 5EDSA 2WQHA 3UIOC 4BETA 1K8KG 3Q73A 2KZTA 3S7FA 2XEHA 3U64A 4B0ZA 2Y1LE 3FTSA 2BUGA 3P2BA 2J4DA 4F7AA 1BU9A 3JUEA 2F8XK 4XI0A 3EUVA 4GA0A 5FT9A 4HLLA 3MX3A 4AV7A 4GTOA 3HDXA 4LSZE 3RKVA 2FBNA 3FY4A 3ZGQA 3Q79A 2XHEA 2MOWA 3ULYA 3ASNE 4HI8A 2L9BA 1B89A 3W9FA 4FJZA 4AVXA 4EBAA 3TJPA 5IY5E 3ASDA 1NP7A 2YHEA 2OVFA 3GW4A 2Y3AA 1JCRA 4FHJA 3D9IA 4JD2G 4C9BB 4L23A 2XS1A 3N71A 3FEYA 4HBDA 3Q5MA 3PZ3A 2VTBA 3IKOB 4U95D 4K03A 1KT1A 5LCWC 4BEPA 2OV8A 2IY0C 1WG0A 1BPOA 1HO8A 1L5JA 4AJWA 5HQ8A 4HOQA 4A1SA 4BSXA 3Q7FA 4ATZD 4K5AB 4I2WA 4NQ0A 4OVUA 4F53A 3L13A 2GROB 5AQ7A 1UW4B 4GTMA 3Q15A 4FLBA 1FVFA 4BT9A 4U0SA 5G04C 3C98A 3WG7E 2HM8A 3UKUG 4I9EA 4BWRA 1TNZA 5HKPA 2IOSA 2HR2A 4Q69A 1MX6A 2EINE 5G2NA 2LUHA 3SBSA 4RG6A 5CCLA 4A1GA 1HG2A 4N3BA 5ENTD 5JMND 3F6QA 1BD8A 3LY9A 2LXLA 3ZHEB 4B89A 3AU5A 1IHBA 1H2UA 1SZ9A 3FUHA 1PC2A 4F6RD 4RSYA 2ZISA 2ZGDA 3VLDA 1QYMA 2BF0X 3LPZA 2GRQB 3PS6A 2J8SD 4I6EA 1UJKA 3L22A 1FT2A 4I1MA 3J5QB 2IF4A 2ILRA 3LXUX 5KCMA 5FQ4A 4CCAA 3FUNA 4B93B 5AN8A 3MKQB 3SHFA 4YNDA 4U0UA 4UI9C 3HXDA 4I2ZA 3DSSA 2V5QC 4DRXE 4LNGA 1BLXB 2P9PG 3HVEB 3MKQA 4YDOA 3S7JA 4G26A 1FVHA 4G24A 4OAVB 3G2WA 3UPVA 2WQ6A 1SVXA 3EHMA 1YMPA 3PNTB 1Y6IA 2XZDG 5B3SE 4BX8A 4FLHA 5ARGA 5CEDB 3AG3E 3I5PA 3QDNA 2NXPA 4MLPA 2IEJA 4UI9J 2C0MA 3CEQA 4GTRA 3CIAA 2MRIA 3D9PA 4PS3A 3V31A 3ZW3A 1TEZA 4O1OA 4GMLA 5AQAA 4DI3A 1INZA 3Q49B 3FUEA 1N4PA 2LAIA 5ENNA 2XEVA 2JABA 3QNKA 4LEUA 1JCQA 1MQSA 4ZFHA 3HG0D 2PL2A 2X38A 1MYOA 5BUZA 4XKCA 5FWQA 3UMVA 2LXMA 2UWJG 1GW6A 3LJ3A 4PS8A 1H6OA 4WWOA 2UY1A 2MYOA 4RVBA 4BTAA 3SF4A 3FFLA 1H0AA 4PH4B 1Z5SC 2V8SE 4I1AA 1S63A 4LERA 2WXQA 4DUIA 2VGXB 2M63A 4UUCA 4GTQA 2Q7FA 4J0UA 4FA6A 2I2OA 3JQ1A 3V2OA 1OUVA 3FH8A 3RRNB 3CVNA 2VGXA 3EIJA 3EU5A 4UWLA 5B1AE 3HXEA 3ESLA 5AAOA 4W9RA 3TWWA 2XZTG 1A17A 2H6FA 1PY1A 1BI8B 3HRAA 2F0YA 4G25A 3SZ7A 3CK8A 3TXNA 5JHAA 3DSWA 3FH5A 3CSTA 5AARA 3S7BA 5KNGA 4L2LA 4N39A 2XGMA 3SGHA 3IXEA 2LSUA 3DXMG 4JPSA 2X6FA 4B8CB 4KYOB 5BXOA 3V2XA 5FZRA 2R05A 3FHEA 1Y8MA 4U63A 2OOEA 4EZJA 4N3AA 3UT7A 4WNDA 1G3NB 3EU9A 5KWDA 4AOFA 2J08A 4KVMA 4A3TA 3JQ0A 3ONKA 2WXRA 2GRMA 1HU3A 3OXLA 3I4GA 3FTYA 3PUKA 2H6GA 3BQOA 3B95A 5AJDA 3HXFA 5T8IA 4JHJA 4G8LA 3BG1B 4JZYA 1AP7A 4QQIA 5C2YA 3ZYKA 5ENOD 4BY6A 4NRHB 2J9QA 4BSZB 2ZIRA 2VSXE 4OAUC 3ONLA 2AW6A 2X6JA 4OYSA 4LRZA 5FZSA 4GZ5A 2KC7A 2XPZA 2XPIA 4AY6A 3B7SA 2C2LA 4C0EA 4AXHA 1KZPA 3FUKA 3CVLA 3ZPJA 3DEPA 3NBNB 1XNFA 4KMOA 4Z68A 5BW8C 3Q78A 4YDEA 4G1TA 5KJNA 1HF8A 4GYOA 4D10C 3CK9A 1LD8A 4KXKB 2WMNA 2RD0A 4FC8A 4TUUA 3TG5A 1EYHA 2YNQA 1IXVA 3U66A 3QKYA 3O4ZA 2VYIA 1U2VG 3UIPC 2QY7A 4ANWA 3CVVA 2PNNA 4IYPA 2CHWA 4GYYA 1HFAA 3ZYLA 4F3VA 2VJ8A 3RRMB 3AS4A 2NYJA 2AJAA 2IO3C 2QYJA 2P2CP 3MYVA 2EILE 4GB9A 3NAWA 3NF1A 4GMJA 1QZ2A 1ZBPA 2WXJA 2BTDA 4GTSA 1H2VC 3E4BA 2V0PA 3FWVA 3AU4A 3LJNA 3ZN3A 4RQIA 5CBOA 1HE8A 2A4ZA 2GRLA 4E85A 2PZIA 3APFA 2Y4UA 4BESA 5EX0A 3PREA 4JVSA 3ASGA 1SA4A 2P9NG 1HG5A 5A7DB 5EX3A 2LNIA 2PM7A 1N11A 3UXGA 4ANVA 2WPVA 5LX8A 3PVLA 5EYLA 3E32A 2YQ8A 4GZCA 2LAHA 4LNBA 3EJNA 5AQBA 2WXFA 1N9AA 3B7TA 3PE3A 2CFZA 2WXNA 3Q9NC 5EN5D 1OWPA 4GA1A 4APFA 3E34A 2F37A 2RFMA 5G05C 3Q7AA 1N0RA 5CHEE 2XENA 1SW6A 4AP2A 5KJKA 4NURA 5JA4D 5ENRD 2YHCA 4N2QA 3D3MA 3ABME 1N0QA 3QK0A 4BT8A 3CVXA 1DCEA 2VTBB 2IOLA 3RSEG 3LS8A 4XKBA 4XEIG 2ETAA 4HXIA 3FDHA 5KBAA 5BNWA 4AY5A 3R7RA 5FTPA 3DRAA 4GA2A 4KZ0A 4IULA 5D2MC 3JUIA 3CR3A 3TG4A 2P58C 4I6GA 3NZSA 3TWSA 1IYGA 1OY3D 5DIZA 4LUNU 2AVPA 4U04A 5CEAA 2DIWA 2HE0A 2AWIA 2AXUA 2J09A 3LKUA 4JEHA 1MX2A 3UX4A 4CEMA 3ZNGA 4C48B 2DZNA 4Q96A 1TJFA 3APCA 4DLQA 4L1BA 2NC9A 3C3OA 2BKKB 3L08A 5LCWJ 4N5CA 4HOUA 3ESKA 5FQ7A 1JCSA 3E33A 1RW2A 4O6FA 3QC1A 4H7XA 3RJVA 3ZEFA 2ETCA 3C5RA 5JJ6A 2WXHA 4LNUD 2YINA 3EHNA 4FADA 1XGWA 3MGBA 5A6CA 1N4RA 4U07A 3GZSA 2PQRA 4HRMB 3ASOE 2XRZA 3QWPA 3SFXA 3ZVVA 4PDXA 1TJCA 5ENSD 2IJGX 1KT0A 5G04J 1E8WA 3LY7A 3B7RL 5HS0A 3IBEA 4N3CA 3K9IA 3SBTB 3ZRHA 1Z6TA 3PUJA 3APDA 3DEOA 2KBXA
chains in the Genus database with same CATH topology
5FINA 4QQIA 4UUCA 5ENPD 1YCSB 2DZOA 3NOCD 1WDYA 5CBOA 2V4HC 2F8YA 3TWRA 3AJIA 2A5EA 2XEHA 5ENOD 4G8KA 1MJ0A 3V2OA 5ENQD 4OAVB 4U8VD 4O1PA 5KNHD 3TWXA 2VGEA 1SVXA 1S70B 1YMPA 3NOGD 2L6BA 4RLYA 5EYPF 4BSZB 2XZDG 4BESA 5AQ7A 2Y1LE 4OAUC 2DVWA 3KEAA 5EIBE 3TWQA 5AAOA 4N5QA 3TWWA 3TWSA 1BU9A 3JUEA 2XZTG 2F8XK 5CEDB 1OY3D 3Q9UC 3V79K 2FO1E 5CERB 2RFAA 5CEAA 4DX2A 1N11A 2HE0A 5FIOA 4O60A 1BI8B 4HLLA 3UXGA 3HRAA 1DC2A 1MX2A 5HKPA 3ZNGA 4C48B 4DX7D 4HRLA 4LSZE 5EYLA 1MX6A 4HI9A 2DZNA 3V31A 1BI7B 5CBNA 3DEPA 4K5BA 3NBNB 4O1OA 2KXPC 5AQBA 3V30A 1NFIE 4Z68A 4JB8P 4HI8A 5ENTD 3J5PA 2BKKB 5AQAA 5AARA 2DWZA 5JMND 3F6QA 5ITZF 5KBAA 5KNGA 1BD8A 4HQDA 3W9FA 3Q9NC 4TUMA 4YDWA 5EN5D 3IXEA 3ZKJA 4U8YD 1IHBA 1K1BA 2JABA 4K5CA 5EILA 2ETCA 2XEEA 3C5RA 2F37A 1K3ZD 5CECB 2RFMA 4CYMD 3EHRA 3JXIA 4ZFHA 4J8YA 1N0RA 2ZGGA 3HG0D 5EIDA 4F6RD 2ZGDA 2ETBA 2BKGA 1QYMA 2XENA 5BXOA 5D66A 3V2XA 3ZU7B 5BXUA 1MYOA 4LNUD 1IXVA 1SW6A 2Y0BG 2J8SD 4YDYA 1MX4A 2B0OE 1UOHA 3UI2A 3ZUVB 3T9KA 3AAAC 3EHQA 1G3NB 3EU9A 5ENRD 1IKND 1K1AA 4HRMB 4GPMA 3W9GA 5JA4D 5KWDA 3TWVA 3UTMA 4CZ2D 4NIKA 4F1PA 4HBDA 1YYHA 3J5QB 4GMRA 1A5EA 1N0QA 2MYOA 1AWCB 4DX1A 2PNNA 4HNAD 5ENSD 4J7WA 4ZHBA 3TWUA 4U95D 4B93B 3D9HA 4DX5D 4BERA 1OT8A 1TR4A 4U96D 3T8KA 1DCQA 4LG6A 2NYJA 4BEPA 2AJAA 5AN8A 5HS0A 2QYJA 2P2CP 3B95A 3JXJA 3SO8A 3TWTA 4HB5A 5AQ9A 1WG0A 5HRYA 4A63B 4G8LA 4QFVA 4HRNA 2QC9A 2V5QC 2ETAA 4BETA 4DRXE 4DUIA 4DX6D 3DEOA 4ATZD 3B7BA 1D9SA 3LJNA 1AP7A 4K5AB 2KBXA 1BLXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FIN A;  4QQI A;  4UUC A;  5ENP D;  1YCS B;  2DZO A;  3NOC D;  1WDY A;  5CBO A;  2V4H C;  2F8Y A;  3TWR A;  3AJI A;  2A5E A;  2XEH A;  5ENO D;  4G8K A;  1MJ0 A;  3V2O A;  5ENQ D;  4OAV B;  4U8V D;  4O1P A;  5KNH D;  3TWX A;  2VGE A;  1SVX A;  1S70 B;  1YMP A;  3NOG D;  2L6B A;  4RLY A;  5EYP F;  4BSZ B;  2XZD G;  4BES A;  5AQ7 A;  2Y1L E;  4OAU C;  2DVW A;  3KEA A;  5EIB E;  3TWQ A;  5AAO A;  4N5Q A;  3TWW A;  3TWS A;  1BU9 A;  3JUE A;  2XZT G;  2F8X K;  5CED B;  1OY3 D;  3Q9U C;  3V79 K;  2FO1 E;  5CER B;  2RFA A;  5CEA A;  4DX2 A;  1N11 A;  2HE0 A;  5FIO A;  4O60 A;  1BI8 B;  4HLL A;  3UXG A;  3HRA A;  1DC2 A;  1MX2 A;  5HKP A;  3ZNG A;  4C48 B;  4DX7 D;  4HRL A;  4LSZ E;  5EYL A;  1MX6 A;  4HI9 A;  2DZN A;  3V31 A;  1BI7 B;  5CBN A;  3DEP A;  4K5B A;  3NBN B;  4O1O A;  2KXP C;  5AQB A;  3V30 A;  1NFI E;  4Z68 A;  4JB8 P;  4HI8 A;  5ENT D;  3J5P A;  2BKK B;  5AQA A;  5AAR A;  2DWZ A;  5JMN D;  3F6Q A;  5ITZ F;  5KBA A;  5KNG A;  1BD8 A;  4HQD A;  3W9F A;  3Q9N C;  4TUM A;  4YDW A;  5EN5 D;  3IXE A;  3ZKJ A;  4U8Y D;  1IHB A;  1K1B A;  2JAB A;  4K5C A;  5EIL A;  2ETC A;  2XEE A;  3C5R A;  2F37 A;  1K3Z D;  5CEC B;  2RFM A;  4CYM D;  3EHR A;  3JXI A;  4ZFH A;  4J8Y A;  1N0R A;  2ZGG A;  3HG0 D;  5EID A;  4F6R D;  2ZGD A;  2ETB A;  2BKG A;  1QYM A;  2XEN A;  5BXO A;  5D66 A;  3V2X A;  3ZU7 B;  5BXU A;  1MYO A;  4LNU D;  1IXV A;  1SW6 A;  2Y0B G;  2J8S D;  4YDY A;  1MX4 A;  2B0O E;  1UOH A;  3UI2 A;  3ZUV B;  3T9K A;  3AAA C;  3EHQ A;  1G3N B;  3EU9 A;  5ENR D;  1IKN D;  1K1A A;  4HRM B;  4GPM A;  3W9G A;  5JA4 D;  5KWD A;  3TWV A;  3UTM A;  4CZ2 D;  4NIK A;  4F1P A;  4HBD A;  1YYH A;  3J5Q B;  4GMR A;  1A5E A;  1N0Q A;  2MYO A;  1AWC B;  4DX1 A;  2PNN A;  4HNA D;  5ENS D;  4J7W A;  4ZHB A;  3TWU A;  4U95 D;  4B93 B;  3D9H A;  4DX5 D;  4BER A;  1OT8 A;  1TR4 A;  4U96 D;  3T8K A;  1DCQ A;  4LG6 A;  2NYJ A;  4BEP A;  2AJA A;  5AN8 A;  5HS0 A;  2QYJ A;  2P2C P;  3B95 A;  3JXJ A;  3SO8 A;  3TWT A;  4HB5 A;  5AQ9 A;  1WG0 A;  5HRY A;  4A63 B;  4G8L A;  4QFV A;  4HRN A;  2QC9 A;  2V5Q C;  2ETA A;  4BET A;  4DRX E;  4DUI A;  4DX6 D;  3DEO A;  4ATZ D;  3B7B A;  1D9S A;  3LJN A;  1AP7 A;  4K5A B;  2KBX A;  1BLX B; 
#chains in the Genus database with same CATH topology
 1TNO A;  1OWL A;  3TWR A;  4ACK A;  4WNF A;  3SY2 A;  5FJY A;  1NZN A;  3VTX A;  1N4S A;  1JWG A;  1N94 A;  3SI5 A;  2JEK A;  4HVB A;  3TWQ A;  3DSX A;  4L9P A;  3Q9U C;  2VSN A;  2L0I A;  4XIF A;  3MV2 B;  5CER B;  4GZD A;  1TNY A;  3T5X A;  2I6H A;  3ISM C;  5CRV A;  2LSV A;  3CHP A;  5ARF A;  1U3D A;  4GTV A;  4LCT A;  4CDN A;  2RG8 A;  3B7U X;  3CKB A;  3SQV A;  3CGH A;  1Z3Y A;  4WUY A;  1D8E A;  3Q4A B;  4U8Y D;  4GTP A;  4GPK A;  4I6J A;  4EZK A;  1ZB1 A;  5T3R A;  2QFC A;  3X2Q E;  2B0O E;  1UOH A;  3T9K A;  5DBK A;  4H7Y A;  4DLO A;  4JXT A;  4GPM A;  2KM4 A;  3C72 A;  4N2S A;  1H6P A;  1OCO E;  4DJA A;  4HOT A;  4GTT A;  4CDR A;  1HH8 A;  2UY1 B;  2WM9 A;  1SQM A;  2XRY A;  5D0Q D;  2AXZ A;  4BTB A;  4A63 B;  1U3C A;  4DX6 D;  1D9S A;  4J8D A;  5T4Y A;  1QNF A;  3FTU A;  3AG1 E;  1RZ4 A;  4TXR A;  2GW1 A;  4ANX A;  3SNX A;  3QOU A;  4U7E B;  2Y69 E;  3JCK C;  3VTY A;  1O1R A;  2VGE A;  2GRR B;  2KCK A;  4TV3 A;  4A3V A;  3L54 A;  1FCH A;  5FIO A;  3ZIM A;  1DC2 A;  4ACL A;  4A55 A;  2X3M A;  4JHK A;  3D9M A;  4HOR A;  5EKQ D;  4JA9 A;  3FU3 A;  1E7V A;  1N54 A;  2I1J A;  4UWF A;  4TXP A;  2DYS E;  2H6H A;  4UWK A;  4ABN A;  1EF1 C;  3KD7 A;  4TUM A;  1EDU A;  3EIQ C;  3BU8 A;  3IV0 A;  4J8Y A;  1TN7 A;  2BKG A;  5D66 A;  2VSO E;  1LD7 A;  2R17 C;  4YDY A;  3TL5 A;  2L6J A;  2P9K G;  3UTM A;  1YYH A;  2FO7 A;  4GMR A;  1A5E A;  4JC8 A;  4I9C A;  3U4T A;  3PZ4 A;  5CCM A;  4WNE A;  4ZHB A;  4XE0 A;  4CRW A;  1TR4 A;  3Q47 B;  2JLB A;  3UM1 A;  3FTZ A;  2OVB A;  4JW1 A;  3B7B A;  5ANL A;  4AM9 A;  3NOC D;  5M72 A;  5AEN A;  4CT0 A;  3ASH A;  3FUD A;  3GYZ A;  3UKR G;  3TWX A;  1S70 B;  3KEA A;  4L7T A;  4N5Q A;  3QWW A;  1QBQ A;  1IQU A;  2DBA A;  5JJT A;  4CGW A;  2RFA A;  2XGS A;  3MV3 B;  4GZ3 A;  4HFG A;  1O1S A;  2CG2 A;  1E7U A;  3CV0 A;  3BUA A;  2P9L G;  3CK7 A;  3OXF A;  1NFI E;  3FTW A;  4FU3 A;  4KZC A;  4G2V A;  4EEC A;  3PH0 C;  3ZKJ A;  4X8Q A;  2WXP A;  4K0R A;  5EID A;  4BFR A;  4I17 A;  4EZL A;  2CFU A;  3I3N A;  4I1O B;  2B6C A;  4AEZ C;  3RIB A;  4JL0 A;  4V3I A;  3KAE A;  1K1A A;  3ZFW A;  3CLJ A;  3KSL A;  1V54 E;  5J90 A;  1FT1 A;  3ML9 A;  4FHK A;  1E90 A;  3WXX A;  3R9A B;  4ILI A;  3TWU A;  3MZL B;  1WM5 A;  3UT8 A;  4DX5 D;  3RO2 A;  1DCQ A;  3FU6 A;  2J07 A;  3NB2 A;  3AS5 A;  2DCP A;  3CVU A;  2WXL A;  4MBG A;  5C1D A;  3D9J A;  3ML8 A;  4DK5 A;  4FP7 A;  1YA0 A;  2DZO A;  3GZ1 A;  4AIF A;  2F8Y A;  2A5U A;  2WMO A;  3CHO A;  1TYQ G;  4U8V D;  5LOZ A;  1TNB A;  2IQC A;  3EDT B;  1PAQ A;  2Y4T A;  2OEV A;  3DPD A;  1TNU A;  3IHY A;  2CHX A;  4DX2 A;  4O60 A;  4ANU A;  3D9K A;  3OTN A;  3G2T A;  2QZA A;  1BI7 B;  5H7P A;  3CVP A;  3Q75 A;  2KXP C;  3HXC A;  1LF8 A;  2OND A;  2NSZ A;  4HQD A;  2KCV A;  3HYM B;  3UUX A;  4Y6C A;  1HX8 A;  3TXM A;  2RKK A;  4EQF A;  4GU5 A;  1K3Z D;  2ZGG A;  3MJW A;  5BPP A;  4P29 A;  3AAA C;  4EPZ A;  2GRN B;  3ZXS A;  3PZ2 A;  4WAF A;  2R02 A;  4HNA D;  3FU5 A;  4J7W A;  1OCZ E;  2XPY A;  3LVR E;  3MKR A;  3URZ A;  2XQ0 A;  3JXJ A;  3TWT A;  5JHB A;  1JWF A;  4HB5 A;  3PE4 A;  4G11 A;  3KSQ A;  4U0Z A;  1HZ4 A;  3IEG A;  2I9C A;  4J8S A;  1NA0 A;  2HO1 A;  2V4L A;  3DBS A;  1QQE A;  2H6I A;  2GRP B;  4UQX A;  4CGV A;  4G8K A;  4YVQ C;  5ENQ D;  1OWO A;  5KNH D;  1N4Q A;  2P9U G;  5KJL A;  2PM6 A;  5EYP F;  5G05 J;  4OVV A;  3OAW A;  3PZ1 A;  3FP3 A;  3CQG B;  2XCC A;  3IHV A;  5LFA A;  3C3R A;  3RAU A;  4JHR A;  4ME2 A;  4ATG A;  3ABK E;  5BV0 A;  3QB2 A;  2DWZ A;  3PZD A;  4MRU A;  2V5F A;  1UG3 A;  3R7Q A;  3JYS A;  3T8M A;  1KZO A;  4Y6W A;  4URK A;  2XEE A;  4JA7 A;  3EHR A;  3ULE G;  5FQ6 A;  5AIJ A;  1H19 A;  3ULQ A;  3ZU7 B;  3LDZ A;  3TGO A;  1P5Q A;  1IKN D;  5E75 A;  5CMW A;  3TAX A;  3CVW A;  3HIZ A;  1SZA A;  4XZ4 A;  3UM3 A;  3RO3 A;  3G2U A;  4BER A;  1Z3X A;  4U96 D;  2WQ7 A;  2X6H A;  4FUL A;  2CHZ A;  3O48 A;  3D9N A;  5AQ9 A;  4CT4 A;  3DXK G;  2GGF A;  1H2T C;  3HHM A;  3L17 A;  4BX9 A;  2VGY A;  1LTX A;  2KAT A;  5FIN A;  3FTX A;  1E8Z A;  2WXM A;  3FTV A;  4O1P A;  3S7D A;  5E76 A;  3LY8 A;  5J08 A;  2L6B A;  2R59 A;  2VQ2 A;  3DST A;  4XX5 A;  3AG4 E;  1D8D A;  4GCN A;  3G2S A;  1DVP A;  3S2A A;  4WWN A;  3SD5 A;  1S64 A;  4E6H A;  3ZHE A;  3FU0 A;  3BG0 B;  2E2E A;  4G23 A;  3V30 A;  3U9W A;  4JB8 P;  3CHQ A;  3QWV A;  3J5P A;  5ITZ F;  1N95 A;  1UJJ A;  3G2V A;  3KEZ A;  3QAR A;  3U3W A;  3VLE A;  4CYM D;  3MCX A;  3JXI A;  3CHM A;  4GZ6 A;  1KLX A;  4M3O A;  1HXI A;  2ZU6 B;  5G55 A;  3ZUV B;  1UN8 A;  1TN6 A;  4F1P A;  1UN9 A;  1OWN A;  1EPU A;  4ILG A;  1O1T A;  2I1K A;  3FUF A;  3L16 A;  5B1B E;  3C3Q A;  3D9H A;  5ANR A;  3BEE A;  4XI9 A;  5CRU A;  2R03 A;  1OCR E;  3UQ3 A;  5HRY A;  2MHK A;  4TXQ A;  3HVE A;  2DYR E;  3MEK A;  2XS8 A;  2CG3 A;  2WXK A;  4J8E A;  1WDY A;  1JUQ A;  1SA5 A;  2A5E A;  1OXJ A;  5FQ8 A;  2BED A;  3NZU A;  2LO6 A;  2FF4 A;  5EIB E;  3FUM A;  2L0T B;  3GZ2 A;  5LP0 A;  4CDM A;  3DWL G;  2R2L A;  5FZQ A;  4DX7 D;  3UM2 A;  2WVI A;  3PRZ A;  3ABL E;  4J6I A;  4K5B A;  2VSY A;  2X6K A;  3DSV A;  3ENE A;  2P9S G;  4YDW A;  4FJY A;  5EIL A;  4WWP A;  1OWM A;  2ETB A;  1S0P A;  5BXU A;  1X5B A;  2WB2 A;  1H6K A;  3UI2 A;  4C0M A;  3EHQ A;  2X6I A;  5A23 A;  4TRQ A;  4ILH B;  1WY6 A;  4JEU A;  3LCA A;  3T5V A;  3CKC A;  3CHR A;  3SFY A;  2EQX A;  1OT8 A;  4LG6 A;  3CHS A;  5AJL A;  3FUL A;  4QFV A;  3PEU B;  2QC9 A;  1HS6 A;  2ZXW E;  1ELK A;  4RG9 A;  5ENP D;  1YCS B;  2EIK E;  3ZYQ A;  3AJI A;  3L6A A;  3CQC B;  4HS2 A;  1MJ0 A;  4KT6 B;  3NOG D;  4F1S A;  5JJ7 A;  3UIN C;  1E8X A;  2WXI A;  3CSF A;  3DSU A;  3RU0 A;  3V79 K;  3QJZ A;  3LEW A;  4UI9 K;  2HYZ A;  4UWH A;  2QYU A;  4HOS A;  3FUI A;  3I4R B;  4KVO A;  4YVO A;  3CVY A;  3D9O A;  3E37 A;  4HI9 A;  3AG2 E;  3PEV B;  2AXV A;  1E8Y A;  1KPS B;  3FEX A;  4PS7 A;  1IHG A;  5AYW D;  1K1B A;  3CVQ A;  3FUJ A;  3RRU A;  5CEC B;  4M7C A;  3UM0 A;  1MHQ A;  5HI7 A;  3PNL B;  4EHM A;  2Y0B G;  4MKT A;  1MX4 A;  1MZC A;  3R9M A;  4J8F A;  3QAQ A;  3P1U A;  3TWV A;  4CZ2 D;  2IO2 C;  4R7L A;  1AWC B;  4DX1 A;  3HXB A;  4U8H A;  1NA3 A;  1O5M A;  4NAC A;  2XGO A;  2OCC E;  3KS2 A;  5CMY A;  2R5S A;  1N52 A;  4UQY A;  4UQZ A;  3T8K A;  1WAO 1;  4EBA G;  1V55 E;  2IU1 A;  4PUC A;  3FH7 A;  3MA5 A;  2XCB A;  4IN3 B;  4KBQ A;  1Q2Z A;  2V4H C;  1ELR A;  4GCO A;  1E96 B;  1JPL A;  2FUL A;  3LYA A;  3SFZ A;  4L2Y A;  1TN8 A;  2WXG A;  3RK6 A;  2C0L A;  2J4B A;  4APO A;  4DPR A;  4RLY A;  2EIM E;  2J49 A;  2DVW A;  3E30 A;  4WNG A;  3PDN A;  2FO1 E;  3AS8 A;  1VDY A;  4GAA A;  2KCL A;  5KJM A;  4I43 A;  2FEZ A;  1OCC E;  2P9I G;  4UWG A;  4HRL A;  1IQR A;  3B13 A;  1ELW A;  4MS6 A;  5CBN A;  2E0I A;  1X81 A;  3LVQ E;  3ZXP A;  1FPP A;  4B8A A;  4B94 A;  1NI1 A;  3OXG A;  3DPY A;  4Q94 A;  3VLF A;  4K5C A;  3ASF A;  5BT1 A;  2IFU A;  3L82 A;  3D9L A;  4HLE A;  1DNP A;  4GYW A;  3W9G A;  2EIJ E;  1NL4 A;  4NIK A;  1ZU2 A;  3ZYM A;  5BV1 A;  4IRU A;  2ION A;  3NQP A;  2FI7 A;  2WXO A;  2PQN A;  3L9T A;  3SO8 A;  2OEW A;  1W3B A;  2KZT B;  4DI4 A;  5D0O D;  3UT4 A;  4HRN A;  5EDS A;  2WQH A;  3UIO C;  4BET A;  1K8K G;  3Q73 A;  2KZT A;  3S7F A;  2XEH A;  3U64 A;  4B0Z A;  2Y1L E;  3FTS A;  2BUG A;  3P2B A;  2J4D A;  4F7A A;  1BU9 A;  3JUE A;  2F8X K;  4XI0 A;  3EUV A;  4GA0 A;  5FT9 A;  4HLL A;  3MX3 A;  4AV7 A;  4GTO A;  3HDX A;  4LSZ E;  3RKV A;  2FBN A;  3FY4 A;  3ZGQ A;  3Q79 A;  2XHE A;  2MOW A;  3ULY A;  3ASN E;  4HI8 A;  2L9B A;  1B89 A;  3W9F A;  4FJZ A;  4AVX A;  4EBA A;  3TJP A;  5IY5 E;  3ASD A;  1NP7 A;  2YHE A;  2OVF A;  3GW4 A;  2Y3A A;  1JCR A;  4FHJ A;  3D9I A;  4JD2 G;  4C9B B;  4L23 A;  2XS1 A;  3N71 A;  3FEY A;  4HBD A;  3Q5M A;  3PZ3 A;  2VTB A;  3IKO B;  4U95 D;  4K03 A;  1KT1 A;  5LCW C;  4BEP A;  2OV8 A;  2IY0 C;  1WG0 A;  1BPO A;  1HO8 A;  1L5J A;  4AJW A;  5HQ8 A;  4HOQ A;  4A1S A;  4BSX A;  3Q7F A;  4ATZ D;  4K5A B;  4I2W A;  4NQ0 A;  4OVU A;  4F53 A;  3L13 A;  2GRO B;  5AQ7 A;  1UW4 B;  4GTM A;  3Q15 A;  4FLB A;  1FVF A;  4BT9 A;  4U0S A;  5G04 C;  3C98 A;  3WG7 E;  2HM8 A;  3UKU G;  4I9E A;  4BWR A;  1TNZ A;  5HKP A;  2IOS A;  2HR2 A;  4Q69 A;  1MX6 A;  2EIN E;  5G2N A;  2LUH A;  3SBS A;  4RG6 A;  5CCL A;  4A1G A;  1HG2 A;  4N3B A;  5ENT D;  5JMN D;  3F6Q A;  1BD8 A;  3LY9 A;  2LXL A;  3ZHE B;  4B89 A;  3AU5 A;  1IHB A;  1H2U A;  1SZ9 A;  3FUH A;  1PC2 A;  4F6R D;  4RSY A;  2ZIS A;  2ZGD A;  3VLD A;  1QYM A;  2BF0 X;  3LPZ A;  2GRQ B;  3PS6 A;  2J8S D;  4I6E A;  1UJK A;  3L22 A;  1FT2 A;  4I1M A;  3J5Q B;  2IF4 A;  2ILR A;  3LXU X;  5KCM A;  5FQ4 A;  4CCA A;  3FUN A;  4B93 B;  5AN8 A;  3MKQ B;  3SHF A;  4YND A;  4U0U A;  4UI9 C;  3HXD A;  4I2Z A;  3DSS A;  2V5Q C;  4DRX E;  4LNG A;  1BLX B;  2P9P G;  3HVE B;  3MKQ A;  4YDO A;  3S7J A;  4G26 A;  1FVH A;  4G24 A;  4OAV B;  3G2W A;  3UPV A;  2WQ6 A;  1SVX A;  3EHM A;  1YMP A;  3PNT B;  1Y6I A;  2XZD G;  5B3S E;  4BX8 A;  4FLH A;  5ARG A;  5CED B;  3AG3 E;  3I5P A;  3QDN A;  2NXP A;  4MLP A;  2IEJ A;  4UI9 J;  2C0M A;  3CEQ A;  4GTR A;  3CIA A;  2MRI A;  3D9P A;  4PS3 A;  3V31 A;  3ZW3 A;  1TEZ A;  4O1O A;  4GML A;  5AQA A;  4DI3 A;  1INZ A;  3Q49 B;  3FUE A;  1N4P A;  2LAI A;  5ENN A;  2XEV A;  2JAB A;  3QNK A;  4LEU A;  1JCQ A;  1MQS A;  4ZFH A;  3HG0 D;  2PL2 A;  2X38 A;  1MYO A;  5BUZ A;  4XKC A;  5FWQ A;  3UMV A;  2LXM A;  2UWJ G;  1GW6 A;  3LJ3 A;  4PS8 A;  1H6O A;  4WWO A;  2UY1 A;  2MYO A;  4RVB A;  4BTA A;  3SF4 A;  3FFL A;  1H0A A;  4PH4 B;  1Z5S C;  2V8S E;  4I1A A;  1S63 A;  4LER A;  2WXQ A;  4DUI A;  2VGX B;  2M63 A;  4UUC A;  4GTQ A;  2Q7F A;  4J0U A;  4FA6 A;  2I2O A;  3JQ1 A;  3V2O A;  1OUV A;  3FH8 A;  3RRN B;  3CVN A;  2VGX A;  3EIJ A;  3EU5 A;  4UWL A;  5B1A E;  3HXE A;  3ESL A;  5AAO A;  4W9R A;  3TWW A;  2XZT G;  1A17 A;  2H6F A;  1PY1 A;  1BI8 B;  3HRA A;  2F0Y A;  4G25 A;  3SZ7 A;  3CK8 A;  3TXN A;  5JHA A;  3DSW A;  3FH5 A;  3CST A;  5AAR A;  3S7B A;  5KNG A;  4L2L A;  4N39 A;  2XGM A;  3SGH A;  3IXE A;  2LSU A;  3DXM G;  4JPS A;  2X6F A;  4B8C B;  4KYO B;  5BXO A;  3V2X A;  5FZR A;  2R05 A;  3FHE A;  1Y8M A;  4U63 A;  2OOE A;  4EZJ A;  4N3A A;  3UT7 A;  4WND A;  1G3N B;  3EU9 A;  5KWD A;  4AOF A;  2J08 A;  4KVM A;  4A3T A;  3JQ0 A;  3ONK A;  2WXR A;  2GRM A;  1HU3 A;  3OXL A;  3I4G A;  3FTY A;  3PUK A;  2H6G A;  3BQO A;  3B95 A;  5AJD A;  3HXF A;  5T8I A;  4JHJ A;  4G8L A;  3BG1 B;  4JZY A;  1AP7 A;  4QQI A;  5C2Y A;  3ZYK A;  5ENO D;  4BY6 A;  4NRH B;  2J9Q A;  4BSZ B;  2ZIR A;  2VSX E;  4OAU C;  3ONL A;  2AW6 A;  2X6J A;  4OYS A;  4LRZ A;  5FZS A;  4GZ5 A;  2KC7 A;  2XPZ A;  2XPI A;  4AY6 A;  3B7S A;  2C2L A;  4C0E A;  4AXH A;  1KZP A;  3FUK A;  3CVL A;  3ZPJ A;  3DEP A;  3NBN B;  1XNF A;  4KMO A;  4Z68 A;  5BW8 C;  3Q78 A;  4YDE A;  4G1T A;  5KJN A;  1HF8 A;  4GYO A;  4D10 C;  3CK9 A;  1LD8 A;  4KXK B;  2WMN A;  2RD0 A;  4FC8 A;  4TUU A;  3TG5 A;  1EYH A;  2YNQ A;  1IXV A;  3U66 A;  3QKY A;  3O4Z A;  2VYI A;  1U2V G;  3UIP C;  2QY7 A;  4ANW A;  3CVV A;  2PNN A;  4IYP A;  2CHW A;  4GYY A;  1HFA A;  3ZYL A;  4F3V A;  2VJ8 A;  3RRM B;  3AS4 A;  2NYJ A;  2AJA A;  2IO3 C;  2QYJ A;  2P2C P;  3MYV A;  2EIL E;  4GB9 A;  3NAW A;  3NF1 A;  4GMJ A;  1QZ2 A;  1ZBP A;  2WXJ A;  2BTD A;  4GTS A;  1H2V C;  3E4B A;  2V0P A;  3FWV A;  3AU4 A;  3LJN A;  3ZN3 A;  4RQI A;  5CBO A;  1HE8 A;  2A4Z A;  2GRL A;  4E85 A;  2PZI A;  3APF A;  2Y4U A;  4BES A;  5EX0 A;  3PRE A;  4JVS A;  3ASG A;  1SA4 A;  2P9N G;  1HG5 A;  5A7D B;  5EX3 A;  2LNI A;  2PM7 A;  1N11 A;  3UXG A;  4ANV A;  2WPV A;  5LX8 A;  3PVL A;  5EYL A;  3E32 A;  2YQ8 A;  4GZC A;  2LAH A;  4LNB A;  3EJN A;  5AQB A;  2WXF A;  1N9A A;  3B7T A;  3PE3 A;  2CFZ A;  2WXN A;  3Q9N C;  5EN5 D;  1OWP A;  4GA1 A;  4APF A;  3E34 A;  2F37 A;  2RFM A;  5G05 C;  3Q7A A;  1N0R A;  5CHE E;  2XEN A;  1SW6 A;  4AP2 A;  5KJK A;  4NUR A;  5JA4 D;  5ENR D;  2YHC A;  4N2Q A;  3D3M A;  3ABM E;  1N0Q A;  3QK0 A;  4BT8 A;  3CVX A;  1DCE A;  2VTB B;  2IOL A;  3RSE G;  3LS8 A;  4XKB A;  4XEI G;  2ETA A;  4HXI A;  3FDH A;  5KBA A;  5BNW A;  4AY5 A;  3R7R A;  5FTP A;  3DRA A;  4GA2 A;  4KZ0 A;  4IUL A;  5D2M C;  3JUI A;  3CR3 A;  3TG4 A;  2P58 C;  4I6G A;  3NZS A;  3TWS A;  1IYG A;  1OY3 D;  5DIZ A;  4LUN U;  2AVP A;  4U04 A;  5CEA A;  2DIW A;  2HE0 A;  2AWI A;  2AXU A;  2J09 A;  3LKU A;  4JEH A;  1MX2 A;  3UX4 A;  4CEM A;  3ZNG A;  4C48 B;  2DZN A;  4Q96 A;  1TJF A;  3APC A;  4DLQ A;  4L1B A;  2NC9 A;  3C3O A;  2BKK B;  3L08 A;  5LCW J;  4N5C A;  4HOU A;  3ESK A;  5FQ7 A;  1JCS A;  3E33 A;  1RW2 A;  4O6F A;  3QC1 A;  4H7X A;  3RJV A;  3ZEF A;  2ETC A;  3C5R A;  5JJ6 A;  2WXH A;  4LNU D;  2YIN A;  3EHN A;  4FAD A;  1XGW A;  3MGB A;  5A6C A;  1N4R A;  4U07 A;  3GZS A;  2PQR A;  4HRM B;  3ASO E;  2XRZ A;  3QWP A;  3SFX A;  3ZVV A;  4PDX A;  1TJC A;  5ENS D;  2IJG X;  1KT0 A;  5G04 J;  1E8W A;  3LY7 A;  3B7R L;  5HS0 A;  3IBE A;  4N3C A;  3K9I A;  3SBT B;  3ZRH A;  1Z6T A;  3PUJ A;  3APD A;  3DEO A;  2KBX A; 
#chains in the Genus database with same CATH homology
 5FIN A;  4QQI A;  4UUC A;  5ENP D;  1YCS B;  2DZO A;  3NOC D;  1WDY A;  5CBO A;  2V4H C;  2F8Y A;  3TWR A;  3AJI A;  2A5E A;  2XEH A;  5ENO D;  4G8K A;  1MJ0 A;  3V2O A;  5ENQ D;  4OAV B;  4U8V D;  4O1P A;  5KNH D;  3TWX A;  2VGE A;  1SVX A;  1S70 B;  1YMP A;  3NOG D;  2L6B A;  4RLY A;  5EYP F;  4BSZ B;  2XZD G;  4BES A;  5AQ7 A;  2Y1L E;  4OAU C;  2DVW A;  3KEA A;  5EIB E;  3TWQ A;  5AAO A;  4N5Q A;  3TWW A;  3TWS A;  1BU9 A;  3JUE A;  2XZT G;  2F8X K;  5CED B;  1OY3 D;  3Q9U C;  3V79 K;  2FO1 E;  5CER B;  2RFA A;  5CEA A;  4DX2 A;  1N11 A;  2HE0 A;  5FIO A;  4O60 A;  1BI8 B;  4HLL A;  3UXG A;  3HRA A;  1DC2 A;  1MX2 A;  5HKP A;  3ZNG A;  4C48 B;  4DX7 D;  4HRL A;  4LSZ E;  5EYL A;  1MX6 A;  4HI9 A;  2DZN A;  3V31 A;  1BI7 B;  5CBN A;  3DEP A;  4K5B A;  3NBN B;  4O1O A;  2KXP C;  5AQB A;  3V30 A;  1NFI E;  4Z68 A;  4JB8 P;  4HI8 A;  5ENT D;  3J5P A;  2BKK B;  5AQA A;  5AAR A;  2DWZ A;  5JMN D;  3F6Q A;  5ITZ F;  5KBA A;  5KNG A;  1BD8 A;  4HQD A;  3W9F A;  3Q9N C;  4TUM A;  4YDW A;  5EN5 D;  3IXE A;  3ZKJ A;  4U8Y D;  1IHB A;  1K1B A;  2JAB A;  4K5C A;  5EIL A;  2ETC A;  2XEE A;  3C5R A;  2F37 A;  1K3Z D;  5CEC B;  2RFM A;  4CYM D;  3EHR A;  3JXI A;  4ZFH A;  4J8Y A;  1N0R A;  2ZGG A;  3HG0 D;  5EID A;  4F6R D;  2ZGD A;  2ETB A;  2BKG A;  1QYM A;  2XEN A;  5BXO A;  5D66 A;  3V2X A;  3ZU7 B;  5BXU A;  1MYO A;  4LNU D;  1IXV A;  1SW6 A;  2Y0B G;  2J8S D;  4YDY A;  1MX4 A;  2B0O E;  1UOH A;  3UI2 A;  3ZUV B;  3T9K A;  3AAA C;  3EHQ A;  1G3N B;  3EU9 A;  5ENR D;  1IKN D;  1K1A A;  4HRM B;  4GPM A;  3W9G A;  5JA4 D;  5KWD A;  3TWV A;  3UTM A;  4CZ2 D;  4NIK A;  4F1P A;  4HBD A;  1YYH A;  3J5Q B;  4GMR A;  1A5E A;  1N0Q A;  2MYO A;  1AWC B;  4DX1 A;  2PNN A;  4HNA D;  5ENS D;  4J7W A;  4ZHB A;  3TWU A;  4U95 D;  4B93 B;  3D9H A;  4DX5 D;  4BER A;  1OT8 A;  1TR4 A;  4U96 D;  3T8K A;  1DCQ A;  4LG6 A;  2NYJ A;  4BEP A;  2AJA A;  5AN8 A;  5HS0 A;  2QYJ A;  2P2C P;  3B95 A;  3JXJ A;  3SO8 A;  3TWT A;  4HB5 A;  5AQ9 A;  1WG0 A;  5HRY A;  4A63 B;  4G8L A;  4QFV A;  4HRN A;  2QC9 A;  2V5Q C;  2ETA A;  4BET A;  4DRX E;  4DUI A;  4DX6 D;  3DEO A;  4ATZ D;  3B7B A;  1D9S A;  3LJN A;  1AP7 A;  4K5A B;  2KBX A;  1BLX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...