1YCSB

P53-53bp2 complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
193
structure length
193
Chain Sequence
PLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGITALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAVFAMTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYEPQNDDELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Complex (anti-oncogene/ankyrin repeats)
molecule keywords P53
publication title Structure of the p53 tumor suppressor bound to the ankyrin and SH3 domains of 53BP2.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 1996-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00018 SH3_1 SH3 domain
B PF00023 Ank Ankyrin repeat
B PF13606 Ank_3 Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1ycsB01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ycsB02
1OT8A 5ENOD 4DUIA 5EN5D 4BEPA 2I0NA 3VS3A 1G83A 4J7WA 1WLPB 1JEGA 1K1ZA 2J6FA 1ZUKA 2ETAA 4G8LA 3V79K 3W9GA 2MIOA 2XENA 2DL7A 2J8SD 4RTVA 1H3HA 2VKNA 2LQWA 3CQTA 2RFAA 2XZDG 2DVJA 1GBRA 1PKTA 5L23A 1AWCB 2YUNA 3M0RA 1YWOA 3UF4A 4CZ2D 2KBTA 4OMMA 1N0RA 4OMQA 2JT4A 2GTJA 1WXTA 1WG0A 5CBNA 1NG2A 3TSZA 1GBQA 1PHTA 4DX6D 2DZOA 1T3LA 5CECB 2CUDA 2FG0A 4K5AB 2QYJA 1QWFA 2X3XD 4BESA 1G3NB 1AOJA 2DWZA 2B0OE 2W10A 5GJVB 2P2CP 1UJ0A 1SW6A 5IHNA 2C0OA 2LQNA 1BLXB 2HCKA 2CH4W 2JXBA 3GBQA 4J9BA 1K1BA 3NOCD 2JM9A 5EYPF 3M0SA 5JA4D 2EKHA 2F2WA 2KGTA 2J6OA 4JB8P 2ETBA 4DX5D 1JXOA 2DZNA 2ZGDA 1VYTA 2G6FX 3DEOA 5IXFA 1AEYA 4KRTA 4LUEA 5CERB 2E5KA 5IH2A 3SO8A 5ENQD 4JJDA 4RTTA 4JJCA 3TWTA 2DL4A 4N5QA 4QFVA 3I5RA 3J5PA 4Z68A 5CEAA 4B93B 4AG1C 2F37A 4O1PA 2O31A 1JO8A 1NYGA 4F1PA 2JM8A 4J9GA 4LUDA 1ABOA 4LG6A 2HSPA 2EYWA 1WFWA 3JXJA 3REBB 1SPKA 2JW4A 4LE9A 3T9KA 2XEEA 1NYFA 1B3QA 2CT4A 3TWWA 1GL5A 1SRMA 2ROTA 4M4ZA 4BERA 1BK2A 4J9HA 4R0KA 1UDLA 4GMRA 4ESRA 3JV3A 2KYBA 1K0SA 4NIKA 2RMOA 3NMZC 3ZUVB 1T0HA 1OPLA 2YT6A 1BBZA 1WXUA 2D0NA 3H0FA 2FO0A 4RTWA 5ENSD 2VVKA 1UFFA 1PNJA 4A63B 1T3SA 1UG1A 4K5CA 4GBQA 1OOTA 3I5SA 3HRAA 5AQBA 2KBXA 1IXVA 2LX7A 4F17A 1I1JA 5CBOA 3VS0A 2DYBA 5AARA 1QLYA 5AQ7A 3NBNB 4QQIA 1MJ0A 2DA9A 3LH5A 1ABQA 2LCSA 1A0NB 2ROLA 1H92A 1XOVA 1AP7A 3ZL7C 1YP5A 1TR4A 4HNAD 5AAOA 2K6DA 5FWBA 1VYVA 2NWMA 3TWVA 2AKKA 1GCPA 2EGEA 5ITZF 2EW3A 2LZ6B 2O9SA 1UTIA 3H0IA 3SEMA 1MX4A 1YNZA 4JJBA 1YYHA 3HG0D 1SHGA 3REAB 2MYOA 2DMOA 2M0YA 4UUCA 2KXDA 2BZXA 4JZ3A 4ORZA 3V31A 2MOXA 3AJIA 4DX2A 4RTXA 1Y57A 3A98A 1B07A 1UJYA 4HRLA 2EQIA 1X2KA 3VS4A 2HEQA 2KR3A 4ATZD 2RN8A 3QWYA 5HS0A 3ZKJA 2HBWA 1WDXA 3NGPA 1UOHA 4J9EA 2VGEA 3D9HA 5FW9A 3V2OA 2ED0A 4C48B 1QKWA 2FO1E 2Y0BG 2FRYA 2LJ1A 1X69A 4J9CA 1WXBA 3TVTA 3U23A 5IHIA 4BETA 3KFVA 1WIEA 2DBMA 2VWFA 2V1QA 4G8KA 5FINA 1QKXA 1BD8A 1OEBA 1UECA 2KYMA 1ZUYA 2LNHB 4RTYA 3M0QA 4BSZB 2A36A 2KE9A 3QWXX 3UA6A 4LN2A 2DRKA 2YUQA 4Y92A 4AG2C 1BI8B 1IHBA 3EG0A 2CSIA 3VS7A 4HB5A 2L6BA 1T0JA 2AK5A 5HCKA 2LJ3A 3UA7A 1J3TA 1HSQA 1G2BA 2DM1A 2KXPC 4U8YD 1BI7B 3EG2A 5EILA 1U06A 3FJ5A 3VRYA 1SVXA 2JABA 3B7BA 1U5SA 5EYLA 1AWJA 1SRLA 2DX1A 1GFCA 1AWXA 2L3QA 2BTTA 4ZNXA 4D8DA 1V1CA 1MUZA 3JUEA 1UUEA 2RQRA 4AFQC 1I07A 5FWCA 4D8KA 4WCIA 3PVLA 1TUDA 1K0XA 1VA7A 3W9FA 1JQQA 2KXCA 2BKGA 1PRMC 2H8HA 3PE0A 1AD5A 2EYYA 4HQDA 1MYOA 1NLPC 3I9QA 1I0CA 2JTEA 4EIKA 2O9VA 2JS2A 2KRNA 1IKND 2AZSA 1K1AA 2F8YA 2KRSA 1UHCA 4AFZC 4TUMA 4ZFHA 4HI8A 2B86A 1ZUUA 1RUWA 2SRCA 1AWOA 1LCKA 5HRYA 1X2QA 1NFIE 2PZ1A 3T8KA 1CKAA 1WDYA 2D8JA 3LJNA 2J06A 2RQTA 4K11A 1OY3D 3EU9A 1RI9A 4F14A 3TSWA 1TUCA 1GCQC 1NEGA 4J9DA 4LNUD 2EYZA 4J9IA 2FPFA 2K2MA 3AAAC 1X6GA 2YUPA 2JMAA 3Q9UC 3C5RA 4OAVB 2BZYA 2EPDA 2EYXA 2HE0A 2GGRA 1W70A 1ZLMA 1H8KA 4F16A 5ENRD 1Y0MA 3THKA 1QYMA 5HKPA 1CKBA 3EG3A 2K7AA 1QWEA 4ZHBA 2FRWA 3R6NA 1EFNA 3TWXA 1N11A 4RTZA 2DF6A 2DVWA 4AFUC 3NPFA 1AVZC 1UE9A 1YMPA 1UGVA 1M8MA 5EIBE 4RUGA 1WI7A 4E6RA 2J7IA 4GLMA 2EVRA 5KNHD 1N5ZA 5AQ9A 3B95A 3TWQA 2LP5A 4AFSC 2NYJA 2CT3A 4JZ4A 5FIOA 4DRXE 3JXIA 4U8VD 2KT8A 2OAWA 4HBDA 5I11A 3Q9NC 2EBPA 1K9AA 1RLQC 2SEMA 4HI9A 2M51A 2FEIA 2V5QC 5KBAA 4HCKA 2LMJA 2RNAA 4LNPA 1BU1A 2DJQA 1PRLC 2V4HC 2FPEA 4O60A 5BXOA 3VS6A 2J6KA 2AZVA 2JS0A 2W0ZA 1CSKA 3VRZA 3UTMA 4U95D 2OJ2A 1SSHA 1YN8A 4OMNA 1N0QA 2D8HA 1U3OA 1ZX6A 5D66A 2YDLA 3RBBB 2ZGGA 4LSZE 4J9FA 4U96D 4IIOA 3NHNA 4OMPA 1K76A 2K3BA 2LJ0A 2RQUA 2ESWA 1SEMA 4DEXA 2GBQA 1QCFA 2KT1A 2ECZA 4RLYA 5BXUA 2AJAA 5IXBA 4DX7D 2RFMA 3IQLA 3VS5A 2PTKA 2CSQA 2OI3A 2A37A 3M0UA 4RTUA 2ETCA 1DCQA 1M3AA 2KNBB 2D1XA 1MV3A 3EHRA 1X6BA 2V1RA 3C0CA 5EC7A 2PNNA 1BB9A 2DILA 3O5ZA 1E7OA 2EGAA 3UXGA 1JU5C 3UATA 2KROA 1DC2A 5KNGA 2F8XK 4J8YA 2P4RA 1MX2A 1WA7A 5GJWB 1GFDA 1HD3A 2CDTA 1KSWA 1S70B 1UHFA 3M0TA 4CC4B 1PKSA 1SHFA 5IHKA 1OV3A 2L3PA 4YDYA 1D9SA 2GTOA 1Z9ZA 2KRMA 1GRIA 1M3BA 4Z8AA 1VYUA 4Z89A 1JXMA 5JMND 4HVUA 1PWTA 3H0HA 2XEHA 4X1VA 2J05A 4HVWA 4QT7A 2ABLA 2XMFA 3DEPA 1BU9A 4CC2A 2F2XA 1M30A 4HVVA 1IO6A 2L3SA 3V30A 4K5BA 1RLPC 1Z9QA 4OMLA 2A28A 3KEAA 3J5QB 4DEYA 2X3WD 2C0TA 5AQAA 3F6QA 2NUZA 3EG1A 2BKKB 5ENTD 4DX1A 1WYXA 1KFZA 1KJWA 2K79A 2DL5A 1HJDA 2A5EA 5EIDA 4GPMA 2ED1A 1ARKA 2IIMA 2RQVA 3PVQA 4HRMB 1E6GA 2BZ8A 2DL3A 2L2PA 3SHWA 2CREA 4CC7A 5I22A 4Z88A 3V2XA 1W1FA 1S1NA 1K4US 1NEBA 3VS1A 2F2VA 3RNJA 3VS2A 1NLOC 2KEAA 3ULRB 2MCNA 1KIKA 3EHQA 2A08A 1M3CA 4CC3A 2O2OA 3I35A 2XZTG 3TWSA 4HLLA 1FYNA 3TWUA 2DL8A 1E6HA 2YSQA 2JMCA 2FPDA 4CYMD 2K9GA 4O1OA 1FMKA 1MX6A 5AN8A 1TG0A 1NM7A 1W6XA 3H41A 1AWWA 1A5EA 1YWPA 2EGCA 1M27C 4OMOA 1AZEA 2C0IA 3M0PA 2CUBA 1GCQA 2QDLA 2ENMA 4FSSA 1X27A 2YUOA 2RPNA 2DNUA 1YCSB 2DBKA 3EGUA 1ZBJA 2CH4A 2RF0A 4IIMA 4HXJA 3IXEA 2AKLA 1MV0B 1K3ZD 5CEDB 3TWRA 2GQIA 4JPBW 5ENPD 2L0AA 2DE0X 5KWDA 2O88A 4OAUC 4YDWA 1ZSGA 1WX6A 3ZU7B 2DRMA 2PNIA 3UI2A 3ZNGA 5ECAA 2Y1LE 4HRNA 2DLPA 2QC9A 2GNCA 4F6RD 1X43A 2RQWA 1AZGB 2HDAA 3NOGD 1OPKA
chains in the Genus database with same CATH superfamily
5EN5D 1O5MA 4BI4A 1G83A 2VJ8A 2ZPGB 5IY5E 3V79K 2HL3A 5CRVA 2CKKA 1VQPT 1C0MA 1RADB 1BKBA 1TS9A 3QWWA 3SI5A 2PQRA 3BG1B 1H3HA 2L9BA 4GA1A 2QFCA 2CHXA 4UQXA 3CHPA 1GBRA 1PKTA 5L23A 4FT2A 3M0RA 3TG5A 2GTJA 2M1HA 1MGQA 3BDLA 3TSZA 1PHTA 2DZOA 1T3LA 5CECB 2C2LA 4Q96A 4BESA 3ZFJA 1Y07A 2LTOA 1O1SA 2R02A 4BDZA 1AOJA 1LVKA 5AJLA 2W10A 2CP6A 3OYGA 1UJ0A 1E90A 4XQ3A 4H7XA 5DLOA 1BLXB 2UY1B 3BEEA 3AT1B 3M0SA 3CMEA 2PQNA 1Y96B 4JB8P 3CCJT 3F70A 5KYXB 5BNWA 5GAMf 3HXDA 4N4GA 4JLIA 4KRTA 3S3MA 1VQ9T 5CERB 1KHCA 3EJNA 4C5EA 3FULA 3S3NA 5ENQD 3MYVA 3V8LA 4DLOA 5G04J 4A1SA 2OTLA 4QFVA 4JS5A 1A17A 3B7UX 2O31A 2ZGWA 1ABOA 4NS5A 4QQDA 3HVEA 3PMIA 2EYWA 3CCRQ 1WFWA 4IUPA 2WPVA 3JXJA 2IU1A 1TTHB 2KC7A 3FUIA 1SPKA 2JW4A 3QHSA 3CCQQ 3URGA 5LJ5d 4ATGA 2XDDA 4GZDA 3OYFA 1B3QA 4KVOA 3TAXA 5FJYA 3UM2A 4RMOA 3LW5E 3TWWA 4OF1A 2VGYA 3MGBA 3VV0A 2ROTA 3AU5A 2YLCA 1O1TA 3P2BA 2DTOA 4BERA 4MMLA 3GIBA 3M57A 3JV3A 3G2SA 5E76A 4UQYA 2YRCA 3BW1A 1IZ6A 1RAEB 3PFSA 3UPUA 5T4YA 2J07A 3JCMW 4RTWA 3OB9A 2E41A 5ENSD 1YHQA 3TGOA 1T3SA 2OTJT 4NRHB 4K5CA 4KH1B 3FFLA 1I1JA 4OGCA 2RHZA 2DYBA 2EINE 3CVPA 5AARA 2QTXA 1YJNQ 4HS2A 4PJOE 1S72A 4M77F 4WNDA 3DLLA 3LH5A 3LJ3A 4K03A 3DSSA 1HFAA 2OOEA 2HMAA 1TR4A 4HNAD 5DLQE 3CC4Q 3RRNB 1WHGA 1TXQA 4GTTA 4XX5A 3TWVA 2NWMA 2AKKA 5CVIA 4UWLA 4EBAA 2NSZA 2A3LA 2K3YA 4KULA 3G4SA 2VYTA 4NOYA 4GTMA 3CPWA 4LDWA 1M1FA 2DMOA 3G71T 2HSEB 4L2YA 3M5AA 3EAEA 2KXDA 2DTHA 2O4XB 4RTXA 3PZDA 3PE3A 1B07A 1UJYA 4HLEA 1INZA 1VQOA 3OA6A 1X2KA 3DPDA 2KK4A 3OBWA 3UPVA 1QZ2A 4B8AA 4ATZD 2RN8A 4M78G 4FYXB 5HS0A 3ASDA 2X4JA 4J9EA 2X6IA 3NGPA 4L59A 2KMTA 3X20B 2FO1E 2PUOB 2LJ1A 3TVTA 1X69A 3L1AA 1DNPA 4V3IA 5IHIA 1SQMA 3RJVA 2VSYA 2PZIA 3TG4A 4BETA 4D10C 1KK7A 4XKBA 3SFZA 2VWFA 2V26A 4PS3A 1QKXA 4EZJA 4BT9A 5CKDA 1E7UA 2KE9A 2GFUA 4AT1B 7AT1B 2YUQA 4Y92A 4AG2C 1XQHA 5CR2A 1DJ7B 5GAOm 2ZPHB 4DOVA 2XCCA 2QQSA 3PNTB 1P5QA 2KZTB 1VQKT 3ZBDA 1YITT 4LD6A 1J3TA 1ZBPA 3FUKA 1G2BA 2BIVA 4TRQA 4FJZA 1ELWA 4AY5A 4XU2A 5LJ5h 3I56T 2WXLA 3DSUA 5EYLA 1AWJA 2L89A 2XU8A 4C8QE 1BI1A 1V54E 4HA8A 2J9QA 4A4HA 3KS2A 1I07A 5FWCA 4WCIA 4J83A 2GQVA 3QJ6A 1VA7A 3CCUA 1M90R 1K0XA 4A4EA 2XGSA 3LGFA 1NLPC 2DXCA 4UI9K 3JQ1A 3GZSA 2KRNA 3OYJA 1W2BP 1K1AA 1UHCA 4GTOA 3HHMA 2DXTA 4RCBA 2ZU6B 8AT1B 1JJ2P 2I9CA 4ZGEB 3HHTB 2B86A 1FMWA 1AWOA 1VQ4Q 2ZPIB 3RKXA 3SFXA 1X2QA 4UQZA 5KCHA 4EZKA 3T8KA 1CKAA 3Q7FA 1WDYA 3CD6A 2D8JA 3LY8A 5CKBA 3JCMP 1YFNA 3JB9G 4K11A 1Y71A 5G05C 4I6GA 2K5FA 3TSWA 4IUUA 4X9DA 1GCQC 1VQ6A 1NEGA 1VQLA 5FQ7A 4J9IA 3RMSA 1HX8A 4HCZA 2E6NA 4AY6A 2JMAA 4I6JA 4MDWA 2IG0A 3RUXA 3SWNA 3DSTA 1VQNQ 4LD9K 4OAVB 2BZYA 2HE0A 4OYSA 1W70A 1H8KA 3OYLA 4HT8A 4WWPA 2Y4YA 2GRPB 3FU5A 4FLBA 1M1GA 2EQJA 3D9NA 3TWXA 3LYIA 1EIFA 3V7SA 3X25B 4JXTA 1VQ8T 5B1AE 2X6KA 5FU7B 1UGVA 1M8MA 3LS8A 5EIBE 1H641 2EKOA 2GRNB 3P8DA 4GLMA 3ABLE 2EVRA 1TEZA 2R17C 3B95A 2LP5A 5M72A 2M16A 2NYJA 3P1UA 1I5LA 4J0UA 3JXIA 1AHJB 5GAMd 3ZFWA 3CMAQ 3MKQB 1K9AA 1RLQC 5ARFA 1X81A 2M51A 3PGGA 4XIFA 4LNPA 2RNAA 4LDVA 2V4HC 5FZQA 2MI6A 3ESKA 3LCAA 1TWBA 1Q2ZA 1R0CB 3OYBA 4JDSA 3C3QA 3CKCA 2MRIA 3MJXA 2ZIRA 3D7SB 1N4QA 3CC2Q 2JS0A 2MPXC 1CSKA 2W0ZA 4WNEA 3T5XA 3UTMA 1SG5A 3JB9H 3M58A 2OJ2A 4Y91A 3JAME 4WWOA 2XDPA 4OMNA 2EQMA 1N0QA 4JC8A 4GA0A 1ZA1B 4WAFA 4PJLA 2CG3A 2EQKA 1M90C 5D66A 4MZMA 3Q78A 5CKFA 2P58C 4M78F 4J9FA 4U96D 4OP0A 1NI1A 4QVDA 1JJ2S 4M7AC 1PAQA 2LJ0A 3IV0A 2RQUA 2C06A 2ESWA 1HXIA 2GBQA 1QCFA 2ECZA 4E85A 3LLRA 3EGDA 1VQPA 1I4K1 3IQLA 1QVPA 2AT1B 5AYFA 3CV0A 2CP5A 2OI3A 3E1SA 3ASHA 2A37A 2MHKA 2R03A 1D8DA 2ETCA 3CXCP 2KNBB 1E8WA 3CMET 3L42A 1HU3A 3H8ZA 4QQ6A 2VV5A 3SDZA 3EFOB 2V1RA 3BQOA 2RHXA 2EIJE 1BB9A 3Q5MA 5EC7A 3MA5A 1VQ5T 3EG9A 3J7AF 2I2LA 3O5ZA 5EKQD 2OEVA 2EGAA 3QPHA 1G3WA 2QK0A 5KNGA 2F8XK 2X38A 2OTLT 2P4RA 1FVHA 1ZA2B 5GJWB 3VLEA 1GFDA 1SZAA 4JA9A 2CDTA 1KC8C 4JVSA 1UHFA 4PJOG 4CC4B 2DXBA 1BYMA 3CHMA 4FULA 4M75B 5FQ8A 3L2VA 3I3NA 2XICA 2R05A 3FTWA 1NPRA 3TL5A 2GTOA 3OYKA 4JS4A 5G05J 3FH7A 2XCBA 3RU0A 1WHLA 3CVQA 3G7ZA 3CCVQ 1VQ7Q 1M3BA 2JTMA 3UX4A 1VYUA 4G11A 3FDRA 3KBGA 4GYWA 2IJGX 4UWHA 4Z89A 2FI7A 1H6PA 4M78A 4C92B 4U04A 1PWTA 4PS7A 2J05A 3PZ1A 4I6EA 2WXMA 3VTXA 2NLUA 5AIJA 1V29B 2P9NG 3DEPA 2E3HA 1E8XA 5KYUB 4OMFB 1IO6A 1YJWA 2L3SA 4MMKA 5GAMh 5KJLA 1Z9QA 5J3BA 4J7FA 3S7DA 1EYHA 3J5QB 4RCCA 4FW2A 2E5QA 3CVWA 3F6QA 4ANJA 2RHUA 4MZTA 2WXGA 1HF8A 4ATOA 3V7RA 2ED1A 1ARKA 1KQSP 4F04B 3U9WA 2FL7A 2MWPA 3SGHA 4F53A 2MOWA 3CK9A 1JRIA 1OZ2A 2KI7A 2FULA 3L13A 2M02A 2YRDA 2BZ8A 3MP1A 2EWNA 1YHQQ 3SHWA 4CC7A 3QWVA 1NP7A 1K8AR 2HD0A 1NEBA 3IBEA 2F2VA 3QUIA 3T9NA 5B1BE 3VS2A 1BCOA 1NLOC 4E47A 1K73R 1M4ZA 4E7KA 5CQYA 4A3VA 2MCNA 1N4RA 3G4ST 3MV3B 3OS2A 1S72Q 4CGVA 2HNIA 3FLGA 2EFIA 5HK0A 1FYNA 3TWUA 2DD5A 2LCLA 3WVEB 4C0DB 3CCEA 1FMKA 1MX6A 2BUGA 2WXHA 4M77C 3CXCS 4HFGA 3OS1A 1AWWA 5GAOq 2K57A 2EIKE 2FZCB 2ILRA 1WJQA 4JRKA 1PM3A 4UI9C 4XZ4A 2C0IA 4C8QG 1VQOT 4BX8A 2ENMA 2YHTA 1RAHB 1X27A 1MZCA 1HO8A 1ZBJA 3OMCA 2IO2C 2BUDA 2RF0A 4IIMA 4N4HA 3IXEA 2LSVA 1IHGA 2AKLA 2GQIA 3Q49B 2JOYA 3RKVA 2L0AA 2DE0X 4XEIG 3G71A 4KVMA 4YDWA 4DK5A 1LPLA 1ZSGA 1MHNA 3NFCA 3UI2A 2LVMA 4BT8A 3A8HB 3T8MA 2QC9A 3K9IA 5GAOn 3CKBA 3NZUA 2YQ8A 3A8MB 5ENOD 2VTBA 3B7TA 4J7WA 1WLPB 2AIRB 3OBYA 3PIOA 3BFMA 2CZ6B 2J6FA 2ETAA 1N9SA 3KD7A 4B89A 3CC7Q 3QJYA 1M1KU 2R5AA 3W9GA 3FP3A 2K4YA 5DM7R 2DL7A 5GAMj 3TJPA 2Y3AA 3KSLA 4N5CA 3CQTA 2MK5A 2I1KA 3CCLT 2RFAA 3AG3E 1SF9A 4C0ZA 1RABB 4B8CB 1YWOA 5GAOl 4CZ2D 4OMMA 2IY0C 4PKCC 2KATA 5AENA 2JT4A 1W2BA 3GF5A 1NG2A 1O1RA 1HE8A 3V7CA 1Q82C 4DX6D 2EYQA 2CUDA 3L2UA 1H2TC 1QWFA 4E7JA 4GA2A 3HP9A 3EU5A 2BKDN 2E6ZA 3EDTB 2F5KA 1Q86U 1KQSS 1VQKA 2IEJA 1TJCA 1YITA 3ER0A 1BI0A 2C0OA 2HCKA 4I9CA 1U3DA 3I56A 2WXIA 4FC8A 2F2WA 2KGTA 3FUNA 2A5UA 4KMOA 2ETBA 1JXOA 1QVGP 4M75D 3CCUQ 3SHFA 3DB3A 3FEXA 2RI3A 1DVPA 3VUBA 2R5MA 3CD6T 4XU3A 1K8AC 3AG1E 4RKUE 5JJ6A 5BPPA 1IGUA 4CDNA 4RTTA 3SQVA 2DL4A 2F5TX 2BF0X 2RB6A 4N5QA 1IGQA 3J5PA 4B93B 1VQLT 2F37A 5FQ4A 3RO2A 1JO8A 1NYGA 4C92D 4ANWA 4C9BB 1NL4A 1B7TA 3EGXA 3HTRA 2XEVA 3SZ7A 5CO7A 5KJKA 3REBB 3APCA 3FTUA 1TN8A 3SFYA 3JCMe 4L7TA 3T9KA 4AP2A 1ZHIA 2YWWA 1HXDA 2X3MA 3VLDA 1NYFA 1VQ6Q 4L9PA 4M7DB 2AXZA 2JNGA 1KC8U 4EPCA 1M2VA 4OB1B 3SY2A 2LQ8A 1BK2A 4GPKA 4R0KA 1FPPA 2XG8D 3FEYA 1IXDA 4ESRA 3RRUA 3NTIA 3GOXA 4AIFA 3HXFA 3L2RA 1FWZA 1QMCA 1ACMB 4ANUA 1OPLA 2YT6A 3LPZA 3PRZA 3QK0A 2NUTA 2D0NA 1WXUA 4JJNK 4XTXA 2ZISA 4AOFA 1H2VC 2FO0A 4A63B 3P8HA 4PFOA 4GBQA 1OOTA 4GZCA 3I5SA 1QVFS 2LX7A 4U0SA 4F17A 5KE3A 3MHXA 4EQFA 3OYEA 3KAEA 4PK4A 1QCOA 1QLYA 4B6MA 1VQMQ 2DK3A 4QQIA 2LNIA 4UI9J 3G2TA 4MZPA 2H3EB 1YCYA 2HZYA 3E19A 3QYGB 3DBSA 3O8VA 4PJMA 3FTYA 3G6EA 3FUFA 5BUZA 3UINC 2K3XA 1QP2A 1N8RR 3FUDA 4RSYA 4GTVA 1G3YA 4ANVA 2VASA 5C0MA 1GCPA 2EGEA 2EW3A 2A0FB 4L1BA 1O75A 2O9SA 3H0IA 4KGXB 4C0FA 2HM8A 1YNZA 3ASNE 3JCMb 1M2OA 3GP8A 3HG0D 2P84A 5LCWC 1FCHA 3FTSA 3Q79A 1SHGA 4A4FA 1NA3A 2LXLA 2WXKA 1IHVA 2LX9A 4O6JA 2KCVA 4JZ3A 4ORZA 4M7AF 2MOXA 3HSBA 4PNOA 3D3MA 4DX2A 4HCBA 3JCMX 3OMGA 3VJPA 3ULEG 2QQBA 3I55A 1TN6A 2EQIA 3ZYLA 3VS4A 3RESA 1UN8A 3QWYA 2JLBA 2FVUA 2ZPEB 3ZKJA 2HBWA 2XPZA 3GYZA 5FW9A 1MMDA 1RZ4A 3V2OA 1Q81R 3AS8A 2ED0A 4J6WA 4C5GA 2E0IA 2DJZA 2P0QA 2FRYA 2CZ0B 4APFA 3UT8A 1XTDA 3I4GA 4M78C 1ZB1A 5GMKh 1WIEA 2DBMA 1Y6IA 3IHVA 4MKTA 1OEBA 3SWNB 6AT1B 3M0QA 1VUBA 4BSZB 2A36A 3GLXA 1VQPQ 5D6WA 3E4BA 3UA6A 4LN2A 3QKYA 3E33A 2RI2A 4XU1A 1IHBA 2AWIA 3CCMA 2CSIA 4FYVB 3PZ4A 3PUKA 4N2QA 2AK5A 4X34A 4BI3A 2LJ3A 3UA7A 3VUZA 1QQEA 3MEKA 2DM1A 2KXPC 4N0AA 4L2LA 2CGHA 3EG2A 1U06A 3VRYA 5C6SA 2F1LA 1BPOA 4GZ5A 4D8DA 2L3QA 2BTTA 9ATCB 5GAN3 1V1CA 1VQ5A 2RQRA 4AFQC 4FHKA 3RRMB 5ANLA 1NZNA 3SD5A 2YNQA 1MMAA 4EMGA 1Q7YU 3W9FA 3RR6A 5KCOA 3PIPA 3QJZA 2V5FA 1PRMC 4M7AA 3OY9A 1UJJA 2VGXA 1MYOA 4HQDA 3LH0A 2O9VA 3CCJQ 4IURA 2H6HA 5D2MC 4F7UF 4CDMA 2AZSA 2KRSA 4D6WA 5FZSA 1VQ9Q 4WTOB 5AT1B 3FHEA 2VSOE 4PLLA 1Q82U 4HI8A 3S3OA 4A55A 1RUWA 2SRCA 1LCKA 3TREA 1YJWT 5HRYA 1WY6A 4XU0A 1X75C 2QDYB 2Q7FA 5T3RA 3SNXA 3L82A 2NUPA 2J06A 1XNFA 2R59A 2RD0A 1OY3D 3S2AA 3FIFA 3RKWA 4M7DD 1EZZB 4J9DA 1TNZA 2CP2A 2EYZA 1DCEA 1TOVA 3AAAC 1YA0A 4MBGA 1X6GA 4OB0B 4R56A 3CQCB 3Q9UC 3VYHB 4I2ZA 2GGRA 4I9EA 1ZLMA 5GMKm 3FEOA 5ANRA 4UWKA 1BIBA 1CKBA 2PQWA 4E2FB 4JPSA 3DRAA 2K7AA 2Y90A 3FWVA 2QA4A 5A0DA 2H6FA 1EFNA 3ASFA 5GMKj 5LJ3e 1B34A 3RO3A 3DPYA 3EGDB 2DVWA 4KT0E 4AFUC 1AVZC 1UE9A 1OQKA 1Q81C 5GAMg 3CCET 5GANe 3QBYA 3OW2S 3M4GA 2OTJQ 4HOUA 2QEXA 1N5ZA 5AQ9A 2KDSA 2P9SG 5LCWJ 3QB2A 4AM9A 3C72A 1O9SA 2IOSA 5FIOA 4DRXE 4U8VD 2KT8A 1KD1R 4HBDA 3EG9B 3Q9NC 3ML9A 4F7UA 2Z0WA 4M75E 3ZXSA 2SEMA 2XPYA 2X4YA 2V5QC 2QXFA 1MMGA 2LMJA 3UT7A 3X24B 1PRLC 2PVDB 4C0EA 3ZEFA 2RI5A 5JHAA 4GMLA 3WXXA 5EG2A 2B6CA 3RDVA 3ASOE 4IUVA 4C92E 2AZVA 1S64A 3ZW3A 4OVVA 3VU3C 3G71Q 1YI2A 8ATCB 3URZA 3DB4A 2EIME 4M78B 3RIRA 1ZX6A 3WG7E 2ZGGA 2K5IA 5D7UA 3L16A 4LSZE 4IIOA 3JCMc 3NHNA 2CZ1B 4KYOB 5KYYA 4Q94A 2K3BA 1TSFA 3RMQA 4BUGA 5A6CA 2E10A 3PZ3A 3QO3A 3TXMA 1TJFA 1QCNA 1SEMA 5HKCA 5DIZA 4DEXA 4N2SA 4PJJA 4MDXA 1PY1A 1QVGA 1UW4B 4M77A 5IXBA 5T8IA 2RFMA 4P5NA 1YIJT 2PTKA 3CCLA 1P92A 3CSTA 4BY6C 2P9PG 4RTUA 4KGZB 2F0YA 3FTVA 2L5QA 3FC3A 5CHEE 3MP6A 1MV3A 3SD4A 1HG5A 3EHRA 3D9PA 2DVEA 2H3JA 3V8KA 5LJ5e 2BE9B 4ZTJA 2PNNA 1PCXA 1K9MR 2P9UG 3LYAA 2GCXA 3UXGA 1JU5C 1YITQ 1VQKQ 4CCAA 3HRSA 3NF1A 1OWOA 4J8YA 3CPFA 1BI3A 5CKEA 3HFOA 3I56Q 2WMOA 4Y28E 1S70B 3M0TA 1TU0B 2HYZA 5IHKA 1NJIR 1OV3A 2LSUA 2ZPBB 1U3CA 3MEAA 3JCMf 2HQXA 1UGRB 4C0GA 4CGWA 5D0OD 3MKRA 2GGFA 4U8HA 1IB8A 2DO3A 3FUMA 5LX8A 3Q1JA 1OCCE 4Z8AA 4EMKA 2YLBA 1WZOA 4PJOC 2R57A 4IULA 4ACKA 4X9CA 2X4WA 2C0MA 4C0MA 5KYWA 5LFAA 4GZ3A 1JXMA 4E7ZA 1YBYA 4QQGA 1PD0A 2DXUA 3JB9J 4X1VA 4JZYA 1KD1C 1KHIA 3UWNA 4N3BA 4DA4A 2DD4A 4QT7A 2ABLA 2X6FA 4G1TA 4U07A 5A7DB 3GW4A 4B94A 4BE1A 3RAUA 2VTBB 3KEAA 4DEYA 4DJAA 5AQAA 4M7CA 2NUZA 4XTWA 1RAGB 1N4SA 2BKKB 2VSXE 5ENTD 5FQ6A 3S7JA 1VDYA 4GPMA 4BACA 1WQWA 1N4PA 1SA4A 3ME9A 1U1SA 3UT1A 2M9UA 4IRUA 4C5IA 3ML8A 3QDFA 2RQVA 3C12A 3UMVA 4URKA 4HOTA 3FUHA 1IREB 2L2PA 1ZSZA 2CREA 3D9IA 3G6ET 3LVQE 5JHBA 1QQJA 2OVBA 4XTYA 5KCMA 2WQ7A 1VQ8Q 3CK8A 3ZPJA 3NTKA 4CC3A 1N94A 4HLLA 1KZPA 2DEUA 2JMCA 3QARA 2FPDA 2K9GA 4XKCA 4HORA 4I17A 3UUXA 3G6EQ 3JCMJ 3DXKG 4XK8E 4EZLA 2FYKA 4EECA 5CMWA 2EGCA 3I55T 2HBPA 3QKJA 1AZEA 2C0LA 5A0GA 4N0AC 3PREA 1QNFA 3NB2A 1SSFA 4LDYA 3D9MA 1G3SA 4ILHB 1QP3A 2E2EA 1LOJA 4HXJA 1MV0B 2QAZA 4JPBW 1FX7A 5ENPD 3ZRHA 4ZGJB 4C8QC 1WX6A 3ZU7B 1G5VA 4WNFA 3ZNGA 1IRXA 5ECAA 2DLPA 2WXNA 4M7DE 3QIIA 2RQWA 3FY4A 4EPZA 1AZGB 2HDAA 2X35A 3EGXB 3AHUA 1OT8A 1NJIC 3NAWA 2I0NA 1JEGA 4BI8B 4CDRA 3MV2B 1S63A 2P9LG 1NPPA 1ZUKA 1Z3XA 3CCMT 4IN3B 4Z02A 5DY9A 3HRTA 2LUHA 3N71A 2J8SD 1M2VB 1PG5B 4RTVA 5GAOp 2CZ7B 2LQWA 2KCKA 2XZDG 2DVJA 5G55A 2QASA 1AWCB 1X5BA 3UF4A 3B7RL 4YTLA 1WXTA 2IF4A 1D0XA 5CBNA 1GBQA 4BFRA 2NUTB 2FG0A 1IQRA 1TN7A 4K5AB 1WPYA 2VSNA 1N95A 4BX9A 4PFPA 1YJ9A 2X51A 3VKIA 2DWZA 4BTAA 3CMEQ 3QG1A 2Y69E 2B0OE 1JWGA 1N9RA 5GJVB 4B9XA 1SW6A 3P8BB 3GBQA 4J9BA 2CH4W 3OS5A 2E1HA 1K1BA 3NOCD 1VQ5Q 5EYPF 4E7IA 3ONLA 2EKHA 3CHSA 2J6OA 2G3RA 2DETA 2DZNA 4RVBA 2G6FX 5IXFA 4KH0B 2OTLQ 2MYSA 5DBKA 4LUEA 2E5KA 5IH2A 3LY9A 3SO8A 1HYOA 3B13A 1D1BA 4JJDA 4O5VA 4VUBA 3TWTA 4M75G 5FRMA 1FT1A 4BTBA 3H9NA 3I5RA 4GMJA 1W4SA 4Z68A 5CEAA 3BY7A 4UC4A 4AG1C 3GNGA 4J9GA 5LL6S 4WWNA 5J90A 4LUDA 1LJOA 5I2SA 4E7HA 4TXPA 1OCRE 3JB9F 3CHQA 3WVDB 3ZHEA 3EHMA 2PVGB 4LE9A 3VYGA 4C92G 3CCRA 2XEEA 4GYOA 2X6HA 2UWJG 3PMTA 2QA4T 5LJ3f 3C94A 1MHQA 2LNVA 3QAQA 4FA6A 1GL5A 5H7PA 1SRMA 3CCQA 1WHHA 4M4ZA 5GMKl 1M9SA 2CHZA 1UEBA 4I1AA 4AVXA 5BT1A 2KYBA 2P4TA 2HKNA 4AV7A 1K0SA 4NIKA 2IONA 3JYSA 4JRIA 5LOZA 4OB3B 2RMOA 4RG9A 2AXUA 3ZUVB 3QOUA 1T0HA 4FM4B 2RA2A 2QEXT 2GF7A 2PM7A 1LF8A 1FVFA 3KEZA 4IKFA 1PNJA 4XI0A 2YRVA 2EAYA 4HKEA 5AQBA 1IXVA 2YINA 2BEDA 3QXEB 1I5OB 5AQ7A 5CK9A 3NBNB 1MJ0A 2DA9A 2EQXA 1ABQA 3N5BB 4NL3A 5J26A 3BG0B 1WM5A 4U0UA 5AAOA 3G4SQ 4G2VA 1NZ9A 1WJRA 1LTXA 3QNKA 3C3RA 2QYZA 3JCMd 4JRPA 3VTYA 5ITZF 4OVAA 4B9WA 1YI2T 4Q69A 1UTIA 3SEMA 1MX4A 4JJBA 2AW6A 3Q73A 2E12A 1TNYA 2MYOA 2XDBA 4M7AB 4N3AA 4UUCA 4IUTA 2VGXB 1D1CA 1VQOQ 2WXFA 3OYNA 1FT2A 3DSWA 4YNDA 1H19A 2NXPA 1Y57A 4G25A 3HVEB 2DFUA 2AVPA 4ELYC 2XQ0A 3E37A 3JQ0A 3EIJA 3DKMA 2KR3A 3L2QA 3FUEA 3D9JA 4IYPA 1QVFP 1ZBXA 2J08A 3D9HA 2NUPB 4YVOA 4C48B 1QKWA 5JJ7A 1NBEB 4EMKC 4A3TA 4MRUA 3U23A 4J9CA 1WXBA 5CMYA 4PDXA 1OU9A 2RHYA 1PC2A 2J49A 1BD8A 1UECA 2LNHB 2KYMA 1ZUYA 2DERA 1H3ZA 3R7RA 3ZGQA 1V76A 2LCCA 4A4GA 1JJ2A 4BSXA 2DRKA 3M56A 4FYYB 5AJDA 2HL5C 3R9MA 3EG0A 3CCLQ 3VS7A 3V8JA 1M90U 4AXHA 4HB5A 1QBQA 2L6BA 5HCKA 4JW1A 3UKUG 1B34B 1YIJA 2O01E 2QQ9A 3J80E 4KXKB 3CVUA 4MS6A 2KSSA 2KVQG 2NYSA 4J6XA 4MLPA 4BE2A 3FJ5A 5EILA 1SVXA 5FT9A 2VB6A 1U5SA 3OSVA 2VXEA 2LXMA 2YXYA 2DX1A 4J5YA 1GFCA 1AWXA 2KY9A 2XPIA 3L2ZA 4RG6A 4PJOF 3JUEA 1UUEA 2MMPA 4OVUA 1ZSZC 2RG8A 1TUDA 2JVVA 3HFNA 1UJKA 3M9QA 5CRUA 1K73C 3NZSA 3PH0C 4WF2A 4DOWA 4F7UB 3CEQA 2EYYA 2LO6A 3G2VA 3I9QA 1I0CA 2JTEA 3CBPA 4EIKA 2JS2A 1WNLA 1IKND 2RJFA 2F8YA 2VYIA 1RL2A 2KM4A 3SF4A 4AFZC 4TUMA 3CD6Q 2FF4A 4NL2A 3INZA 4EBAG 2J4DA 1NFIE 2PZ1A 4RG2A 2XKOC 1KQ1A 3LJNA 1VQLQ 1VQ4A 3Q47B 3LWIA 2RQTA 3EH1A 1RI9A 3EU9A 4BY6A 4F14A 2WQHA 2X9HA 5M9OA 3PS6A 4C92F 4LNUD 1G3TA 2FPFA 3U3WA 4APOA 2QYUA 3A5ZB 1EPUA 3JCMh 2EYXA 3AG4E 1H6KA 3CHOA 4M7DG 4GTQA 4DBHA 1KT0A 4F16A 5ENRD 1M8VA 1ELKA 1QYMA 5HKPA 4I43A 2QQRA 1VQNA 1QWEA 4ZHBA 4LDXA 3OYMA 3E30A 4CI0C 1N11A 2GRMA 2DF6A 4JLGA 1OYXA 3L08A 4M77B 1TNUA 1TUGB 3NPFA 1RACB 2DIWA 5GAN2 3L6AA 4HOSA 2EJFA 4GB9A 4RUGA 1WI7A 4E6RA 1OXJA 3A1PA 4PJOA 2L0TB 5GMKi 5HQ8A 3MCXA 2RD1A 4I2WA 3TWQA 3CPWS 2E70A 2JEKA 4AFSC 1WAO1 2KAFA 2OAWA 2RHIA 5I11A 1E8ZA 2WMNA 3ZN3A 2EBPA 4E7SA 1KQ2A 2HKQB 3EFRA 5BW8C 3EH2A 1FXXA 3QDRB 4C8QF 2GRRB 3BUAA 1R0BG 1BU1A 1UB4A 2DJQA 3TU4K 1N9AA 2CFZA 4O60A 3ASGA 5BXOA 4M7AD 3VS6A 3META 1SZ9A 2DYSE 2LAIA 2J6KA 3VRZA 3CXCA 1VOMA 1HG2A 1TNBA 5LP0A 3LXUX 1YJNT 3SBTB 3CC2A 5LJ3d 2OCCE 3FJPA 1JWFA 5KYWB 2QTVA 2IO3C 4U63A 2XGOA 5KYNA 1ELRA 3B7SA 1D1AA 3FTZA 2GW1A 4CT4A 1UGQB 2YDLA 1D0YA 3RBBB 4OMPA 3E32A 5GANd 1NE8A 3OW2P 4H7YA 5CQXA 2JTFA 4JHKA 4XI9A 3PZ2A 4GAAA 2DZCA 3AS4A 3OTNA 2WXPA 5KE2A 1JB0E 1G8XA 3CVNA 2PL2A 3JCMV 4CRWA 2KT1A 3M4YA 3L22A 5CIUA 4F7AA 2XRYA 5A0LA 4BDYA 1JCRA 3ULQA 4DX7D 1D3BA 3FU3A 3BU8A 3E34A 1MNEA 1YJ9T 2QZAA 5BV1A 3VS5A 1IYGA 4ZN3A 5AYWD 2CSQA 2QQAA 1V55E 3M0UA 1KPSB 3AG2E 1RAAB 3TQ7P 4U7EB 3OYDA 3GZ1A 2D1XA 1H6OA 4LUNU 2A4ZA 1ZSZB 1X6BA 3C0CA 2WSFE 1YJ9Q 1MNDA 1N27A 1E7OA 4C8QA 3UATA 2FZKB 2HQHA 1S0PA 3Q7AA 1DC2A 3PEUB 3UM1A 3RK6A 5E75A 1WA7A 2WXOA 2R5SA 3SBSA 2V8IA 3IEGA 3APDA 3ESLA 2DZ9A 4LNBA 5A23A 2Y4XA 2WXQA 1KQSA 1D9SA 2VGNA 3GNFB 1Z9ZA 3EHNA 2KRMA 4JEUA 3OYAA 1GRIA 2DTIA 3AU4A 3CCRT 3ENEA 1N8RC 4L5GA 2VQ2A 3I4RB 3M54A 3CCVA 4HOQA 3CCQT 1VQ7A 3H0HA 3DLMA 2XEHA 2M0OA 4II1A 2VXFA 5C2YA 1YJWQ 4HVWA 2XMFA 3GZ2A 2DBAA 4CC2A 1M30A 3E2UA 4HVVA 2XHEA 3ABKE 4FT4A 3V30A 4AJWA 4DPRA 1OX8A 4K5BA 2COWA 1K8AU 2VC8A 1OCZE 4OMLA 1K73U 2A28A 2OX7A 3UKRG 2X3WD 2CP7A 1BI2A 1LD7A 3HXCA 4M7DF 1KJWA 2EQUA 2K79A 2QGFB 4GCOA 2DL5A 5EIDA 2P9IG 3Q15A 5GAN8 4FL6A 4M77D 3MEVA 5D6XA 2PVOB 5CCMA 1U1TA 3ZYKA 1BIAA 5L8RE 2D6FA 3DXMG 1W1FA 4QW2A 4FYWB 3L2WA 2KEAA 5LJ3h 3ULRB 1MQSA 1KIKA 3CC4T 3FH8A 1OWMA 1UGPB 1PC0A 2O2OA 2DEQA 4KBMB 4KUIA 5B3SE 2XZTG 3TWSA 3CCEQ 2I1JA 1TNOA 2DL8A 2RJCA 2YSQA 3PNWC 5GANh 4GTRA 4CYMD 3AS5A 1QVFA 3E9FA 5AN8A 1UN9A 2RK2A 3MO8A 4A1GA 3QSUA 1NM7A 4DI3A 3UIPC 1JPLA 4YDEA 5FU7C 1A5EA 1YWPA 3RERA 3QZ9B 2LC4A 4OMOA 4Y6WA 3M0PA 4PS8A 2CUBA 2YUOA 3RIBA 2RPNA 4JA7A 2DNUA 1UG3A 1YCSB 3EGUA 2CH4A 4M3OA 4TXRA 2IPOB 2Y4UA 3OXFA 5CEDB 3MEWA 2GRQB 3TWRA 5KWDA 3CVXA 2E65A 2PNIA 3FB9A 1D0ZA 3APFA 2Y1LE 1Y8MA 3CEYA 1EX4A 2GNCA 3QC1A 2DCPA 3NOGD 1OPKA 4DUIA 5CCLA 3ZHEB 3L9TA 4BEPA 3VS3A 3QWPA 4M7DA 4JHRA 3TCJA 3O4ZA 1K1ZA 1IHWA 3LX7A 4G8LA 1AT1B 4J7IA 2MIOA 3Q4AB 2XENA 2I2OA 3PTAA 3ONKA 5HI7A 5FTPA 5FLXE 3CC7A 5FZRA 1X6OA 3O48A 3UT4A 1XNIA 3JCKC 2VKNA 2JZ2A 4AMCA 2YUNA 2DIQA 2RH2A 3M53A 2NC9A 2KBTA 1PD1A 1N0RA 4OMQA 2K5LA 2LT4A 2P0KA 1WG0A 3X28B 2CHWA 5FWQA 3QZ5B 4PLIA 1YIJQ 3RKYA 2QYJA 1M1KR 2X3XD 4W9RA 5BV0A 3JCMQ 2F69A 3Q75A 1G3NB 5GAN5 5KJMA 3OYCA 4F3VA 3CIAA 2IQCA 3QDNA 4A54A 3L54A 4XE0A 4HT9A 3CR3A 3ISMC 4JEHA 1PSFA 2P2CP 2DAQA 5IHNA 5LJ3j 2BTDA 3C98A 1I8FA 2JXBA 2LQNA 5FRNA 3RSEG 2JM9A 3MP8A 5JA4D 1KLXA 4DX5D 1XJWB 2ZGDA 1VYTA 5GANj 3DEOA 2RJEA 3UM0A 2CS7A 1AEYA 2OVFA 4LNGA 3CGHA 1U8RA 1H0AA 2EJ9A 1RAFB 1VQ4T 4JHJA 4M7AE 2RO0A 4J8EA 4JJCA 4V2SA 2COZA 4OB2B 1Q86R 4ZN1A 4IUQA 4O1PA 2JM8A 5J08A 4F1PA 2XK0A 4LG6A 4R55A 3L17A 2HSPA 4G26A 4M75C 3CVVA 1JCSA 2DYRE 1VQNT 2QGGA 3JRZA 1Z3YA 2CT4A 2HAXA 2DKGA 3DSXA 4C5HA 3S7FA 4GTSA 2ZPFB 4J9HA 1UDLA 4PJNA 3PEVB 4GMRA 2E64A 4C92C 4FCYA 4WNGA 1C6VX 1WHMA 1ZQ1A 3NMZC 2R2LA 1LD8A 1OWPA 3LY7A 1EDUA 1BBZA 1N8RU 3H0FA 4L23A 2VVKA 2MF2A 1UFFA 3MCAB 4RQIA 3OSSC 3FTXA 4TV3A 1UG1A 3R9AB 3HRAA 2XD0A 2KBXA 2BE7D 1KC8R 2WSCE 5KJNA 1XGWA 4N3CA 5CBOA 1N52A 2PM6A 3VS0A 5GAOr 3JCMg 4NURA 5HY6A 2UY1A 3CMAT 2XHCA 1A0NB 2LCSA 4TUUA 4CRIA 2ROLA 1Y96A 1H92A 4CT0A 1HH8A 1XOVA 2IVWA 3JUIA 2ZCFB 1E7VA 5KYXA 1AP7A 3ZL7C 1YP5A 1VQMA 2AHJB 1TH7A 2K6DA 5FWBA 1VYVA 1VIFA 4F7UE 3OW2A 4DBRA 3MZLB 1EF1C 2LZ6B 1WJSA 2XIDA 5CAIA 5LJ5j 1R77A 4JD2G 3HL8A 4ACLA 2FB7A 3OQ5A 1Q81U 2IFUA 1YYHA 1K9MC 3CC2T 3REAB 1M1KC 4J8SA 4ILGA 2M0YA 4KBQA 3I55Q 3CQGB 2BZXA 3J81E 4PUCA 3V31A 3ASKA 1SKUB 4M78D 3AJIA 4J8DA 2R58A 3HPWA 4C0DC 1OZ3A 3A98A 2IOLA 5EDSA 3S6WA 2OEWA 3WXMB 1SA5A 4HRLA 3FU0A 3CBOA 4A4KA 3CCSA 1H2UA 3D9LA 4LRZA 3BDUA 3ZEHA 2HEQA 1R8OB 2QI2A 1UGSB 3IKOB 1JBMA 1WQ7A 3OYYA 1YJNA 4J6IA 1WDXA 1UOHA 5EX3A 2VGEA 4HCCA 1I81A 4CEMA 4Q5WA 2Y0BG 1OX9A 4BY6B 2XS1A 3KSQA 4FHJA 3HIZA 4FLHA 1D09B 1W2BS 3JSCA 3KFVA 1Q86C 4J8FA 2V1QA 4G8KA 4ANXA 5FINA 4LXCA 4RTYA 2PU9B 2J09A 3CCMQ 2VUBA 3A8GB 3QWXX 3C95A 4M77E 2KCLA 3U64A 4Y6CA 1BI8B 2K2VA 1BCMA 2JJ9A 1T0JA 1M5Q1 2EJGA 2V8SE 1HSQA 5ENNA 4U8YD 4F1SA 4K0RA 1BI7B 1K8KG 2WXRA 2XRZA 2JABA 1MMNA 3B7BA 2FO7A 2L3RA 4PJOB 4JRQA 1SRLA 2WM9A 1E96B 1RW2A 4ZNXA 1U2VG 1MUZA 3SB2A 4YDOA 3FRNA 4D8KA 2KQWA 3X26B 3PVLA 2E4HA 1JQQA 2KXCA 4XAXB 2BKGA 2H8HA 3CCVT 5JJTA 3IHYA 1VQ7T 2H6IA 3PE0A 4FU6A 1AD5A 5G2NA 2GRLA 2L8DA 1HZ4A 3OS0A 3HRUA 4LDUA 3U66A 2DIGA 2O4XA 3UDCA 1B89A 2B8AA 1C1AA 4EDUA 2L6JA 2VGMA 2P0PA 4ZFHA 1Y7XA 3CVYA 1ZUUA 3JB9D 3HXEA 3CCJA 4AEZC 2CG2A 3QYHB 4KUDK 1VQ9A 1HK9A 5GAMe 4KZCA 3CK7A 3NTHA 3ABME 1Q7YR 5CCAA 5GMKe 3X2QE 3C4SA 5FROA 3TXNA 1VIEA 1TUCA 1IQUA 4ELZC 2RK1A 3OXGA 2OAUA 4ZGDB 2K2MA 5GANf 2YUPA 4LERA 5EX0A 3TEEA 4DQ2A 3C5RA 4GY5A 4BE0A 2EPDA 2QA4Q 1Q82R 3U4TA 1Y0MA 3THKA 2X4XA 2H6GA 3EG3A 3FDHA 1OI1A 1YHQT 2FRWA 3R6NA 4N39A 1KD1U 3OXLA 4KGVB 4RTZA 2KZTA 4M7DC 3FH5A 4TVRA 3FU6A 1D3BB 2L0IA 3D9OA 3GPLA 2QEXQ 1YMPA 1S72T 1GW6A 1F1BB 2FBNA 4QVCA 3I5PA 4I1OB 2J7IA 3LGLA 5ARGA 5GAN4 4KZ0A 5KNHD 3PT9A 3A8OB 3PDNA 4WUYA 2HR2A 4QVZA 2OTJA 2CT3A 2DPPB 4JZ4A 2COYA 3CC4A 4C8QB 2GROB 4TXQA 1HS6A 3CBMA 3M55A 1LNXA 1WGSA 4G24A 4HI9A 4NQ0A 3VLFA 2FEIA 1OCOE 5KBAA 4HCKA 2EILE 3OAWA 1ZU2A 3PE4A 3EFSA 4L6V5 2FPEA 2YHCA 5LJ3g 1NA0A 4YVQC 1YI2Q 3UQ3A 4RG8A 5FU6C 5GAN6 1QW1A 2CYZB 4U95D 2E3IA 4PFZA 4A53A 5GANg 3C3OA 4FP7A 4M7AG 1SSHA 2HO1A 4ME2A 2WVIA 1YN8A 1Z6TA 3OYHA 4DI4A 5D6YA 1TYQG 2ONDA 5GAN7 2XGMA 1U3OA 2M63A 3PNLB 2RKKA 2D8HA 2LT1A 3MEUA 3CC7T 1N54A 2JUFA 4I1MA 4E7LA 4U0ZA 4O6FA 2QG9B 3HXBA 4DLQA 1K76A 5LJ5f 2LRQA 4P29A 4GCNA 4JL0A 5IN1A 2AXVA 4BWRA 2FHDA 4LCTA 3CPWP 4ABNA 1K9MU 4HVBA 4RLYA 5BXUA 4FIBA 4G23A 2AJAA 4FU3A 3ZXPA 5KH6A 3ULYA 3G2UA 1Q7YC 4X8QA 2V8KA 3MJWA 2D0QB 3LEWA 4GLKA 2V0PA 2ZXWE 3A8LB 4XTVA 1NJIU 4GYYA 1DCQA 1M3AA 4JUVA 2J4BA 4J8OA 2ZAEA 2WB2A 1WHJA 3ZVVA 3SWNC 2DILA 3HKSA 2LQKA 3JB9I 3D9KA 3MKQA 4PJOD 2KROA 3CCUT 5J39A 3EIQC 4FW1A 1WHKA 1MX2A 1HD3A 1PSEA 1KSWA 1OU8A 3MX3A 1PKSA 1SHFA 3H6ZA 4UWFA 2MAMA 3G1JA 4E6HA 3ZIMA 2L3PA 4M75F 4YDYA 2CP0A 1D8EA 1JUQA 3DWLG 1Z5SC 4XTZA 4OGEA 3S7BA 2QY7A 2EIFA 1W3BA 4F7UG 4M78E 4QKUA 3KUFA 3PUJA 5JMND 4HVUA 2XI9A 3LKUA 5LJ5g 1VQ6T 4DBFA 2FZGB 3MPUB 3CLJA 1N6AA 5G04C 4UWGA 3FUJA 2WXJA 3NQPA 3E9GA 1KZOA 3LVRE 4ILIA 3SFMA 1BU9A 2F2XA 2CP3A 3ZYMA 4BB7A 5KYYB 3CSFA 1RLPC 2D9TA 3LDZA 1OULA 5IAYA 5D0QD 2C0TA 4R7LA 1FMVA 2ATCB 2LAHA 1RAIB 3EG1A 1JCQA 5CKHA 4DX1A 5A2QE 1WYXA 3R6OA 1KFZA 3UM3A 5IT9E 1X01A 1HJDA 2A5EA 2X6JA 4N4IA 2IIMA 1E8YA 2LDMA 3DSVA 4XTUA 2XS8A 3HDXA 2JN0A 2ZZDA 3EUVA 3PVQA 4HRMB 1E6GA 2DL3A 1RI0A 3EFOA 5I22A 4Z88A 2RM4A 1VQMT 3V2XA 4PL6A 1S1NA 3MKDA 1K4US 3VS1A 4FSXA 2V4LA 3RNJA 2V8JA 4FJYA 3BE3A 2CFUA 2P9KG 4M77G 1OWLA 3EHQA 2A08A 2MWOA 1KG1A 4EHMA 1M3CA 3UIOC 3I35A 4DBQA 1GXIE 1E6HA 2A7YA 3HYMB 1VQ8A 1OWNA 4M75A 2WSEE 4C8QD 3CMAA 4O1OA 5I21A 4B0ZA 1TG0A 4KT6B 1W6XA 3H41A 4GTPA 5FU6B 2WACA 3T5VA 3R7QA 4GU5A 4GZ6A 1M27C 2HQEA 1L5JA 4PH4B 3KXTA 2Y4TA 2PUKB 2I6HA 4EMHA 3CCST 1GCQA 2QDLA 4FADA 1Q95G 3M59A 4FSSA 4J6YA 3LWHA 4LEUA 3G2WA 4C92A 1OUVA 2DBKA 4EMKB 2RJDA 5HK3A 2OV8A 5C1DA 3CHRA 1K3ZD 4HXIA 2O88A 4OAUC 2DYIA 2DRMA 3ZYQA 1KT1A 4HRNA 2GFAA 2FEZA 5KYUA 3CCSQ 2WQ6A 4F6RD 4ME7A 3CVLA 1X43A 4BD3A 4ZTFA 1QVGS 3OYIA 5I2MA 4NACA 2YHEA
chains in the Genus database with same CATH topology
1OT8A 5ENOD 4DUIA 5EN5D 4BEPA 2I0NA 3VS3A 1G83A 4J7WA 1WLPB 1JEGA 1K1ZA 2J6FA 1ZUKA 2ETAA 4G8LA 3V79K 3W9GA 2MIOA 2XENA 2DL7A 2J8SD 4RTVA 1H3HA 2VKNA 2LQWA 3CQTA 2RFAA 2XZDG 2DVJA 1GBRA 1PKTA 5L23A 1AWCB 2YUNA 3M0RA 1YWOA 3UF4A 4CZ2D 2KBTA 4OMMA 1N0RA 4OMQA 2JT4A 2GTJA 1WXTA 1WG0A 5CBNA 1NG2A 3TSZA 1GBQA 1PHTA 4DX6D 2DZOA 1T3LA 5CECB 2CUDA 2FG0A 4K5AB 2QYJA 1QWFA 2X3XD 4BESA 1G3NB 1AOJA 2DWZA 2B0OE 2W10A 5GJVB 2P2CP 1UJ0A 1SW6A 5IHNA 2C0OA 2LQNA 1BLXB 2HCKA 2CH4W 2JXBA 3GBQA 4J9BA 1K1BA 3NOCD 2JM9A 5EYPF 3M0SA 5JA4D 2EKHA 2F2WA 2KGTA 2J6OA 4JB8P 2ETBA 4DX5D 1JXOA 2DZNA 2ZGDA 1VYTA 2G6FX 3DEOA 5IXFA 1AEYA 4KRTA 4LUEA 5CERB 2E5KA 5IH2A 3SO8A 5ENQD 4JJDA 4RTTA 4JJCA 3TWTA 2DL4A 4N5QA 4QFVA 3I5RA 3J5PA 4Z68A 5CEAA 4B93B 4AG1C 2F37A 4O1PA 2O31A 1JO8A 1NYGA 4F1PA 2JM8A 4J9GA 4LUDA 1ABOA 4LG6A 2HSPA 2EYWA 1WFWA 3JXJA 3REBB 1SPKA 2JW4A 4LE9A 3T9KA 2XEEA 1NYFA 1B3QA 2CT4A 3TWWA 1GL5A 1SRMA 2ROTA 4M4ZA 4BERA 1BK2A 4J9HA 4R0KA 1UDLA 4GMRA 4ESRA 3JV3A 2KYBA 1K0SA 4NIKA 2RMOA 3NMZC 3ZUVB 1T0HA 1OPLA 2YT6A 1BBZA 1WXUA 2D0NA 3H0FA 2FO0A 4RTWA 5ENSD 2VVKA 1UFFA 1PNJA 4A63B 1T3SA 1UG1A 4K5CA 4GBQA 1OOTA 3I5SA 3HRAA 5AQBA 2KBXA 1IXVA 2LX7A 4F17A 1I1JA 5CBOA 3VS0A 2DYBA 5AARA 1QLYA 5AQ7A 3NBNB 4QQIA 1MJ0A 2DA9A 3LH5A 1ABQA 2LCSA 1A0NB 2ROLA 1H92A 1XOVA 1AP7A 3ZL7C 1YP5A 1TR4A 4HNAD 5AAOA 2K6DA 5FWBA 1VYVA 2NWMA 3TWVA 2AKKA 1GCPA 2EGEA 5ITZF 2EW3A 2LZ6B 2O9SA 1UTIA 3H0IA 3SEMA 1MX4A 1YNZA 4JJBA 1YYHA 3HG0D 1SHGA 3REAB 2MYOA 2DMOA 2M0YA 4UUCA 2KXDA 2BZXA 4JZ3A 4ORZA 3V31A 2MOXA 3AJIA 4DX2A 4RTXA 1Y57A 3A98A 1B07A 1UJYA 4HRLA 2EQIA 1X2KA 3VS4A 2HEQA 2KR3A 4ATZD 2RN8A 3QWYA 5HS0A 3ZKJA 2HBWA 1WDXA 3NGPA 1UOHA 4J9EA 2VGEA 3D9HA 5FW9A 3V2OA 2ED0A 4C48B 1QKWA 2FO1E 2Y0BG 2FRYA 2LJ1A 1X69A 4J9CA 1WXBA 3TVTA 3U23A 5IHIA 4BETA 3KFVA 1WIEA 2DBMA 2VWFA 2V1QA 4G8KA 5FINA 1QKXA 1BD8A 1OEBA 1UECA 2KYMA 1ZUYA 2LNHB 4RTYA 3M0QA 4BSZB 2A36A 2KE9A 3QWXX 3UA6A 4LN2A 2DRKA 2YUQA 4Y92A 4AG2C 1BI8B 1IHBA 3EG0A 2CSIA 3VS7A 4HB5A 2L6BA 1T0JA 2AK5A 5HCKA 2LJ3A 3UA7A 1J3TA 1HSQA 1G2BA 2DM1A 2KXPC 4U8YD 1BI7B 3EG2A 5EILA 1U06A 3FJ5A 3VRYA 1SVXA 2JABA 3B7BA 1U5SA 5EYLA 1AWJA 1SRLA 2DX1A 1GFCA 1AWXA 2L3QA 2BTTA 4ZNXA 4D8DA 1V1CA 1MUZA 3JUEA 1UUEA 2RQRA 4AFQC 1I07A 5FWCA 4D8KA 4WCIA 3PVLA 1TUDA 1K0XA 1VA7A 3W9FA 1JQQA 2KXCA 2BKGA 1PRMC 2H8HA 3PE0A 1AD5A 2EYYA 4HQDA 1MYOA 1NLPC 3I9QA 1I0CA 2JTEA 4EIKA 2O9VA 2JS2A 2KRNA 1IKND 2AZSA 1K1AA 2F8YA 2KRSA 1UHCA 4AFZC 4TUMA 4ZFHA 4HI8A 2B86A 1ZUUA 1RUWA 2SRCA 1AWOA 1LCKA 5HRYA 1X2QA 1NFIE 2PZ1A 3T8KA 1CKAA 1WDYA 2D8JA 3LJNA 2J06A 2RQTA 4K11A 1OY3D 3EU9A 1RI9A 4F14A 3TSWA 1TUCA 1GCQC 1NEGA 4J9DA 4LNUD 2EYZA 4J9IA 2FPFA 2K2MA 3AAAC 1X6GA 2YUPA 2JMAA 3Q9UC 3C5RA 4OAVB 2BZYA 2EPDA 2EYXA 2HE0A 2GGRA 1W70A 1ZLMA 1H8KA 4F16A 5ENRD 1Y0MA 3THKA 1QYMA 5HKPA 1CKBA 3EG3A 2K7AA 1QWEA 4ZHBA 2FRWA 3R6NA 1EFNA 3TWXA 1N11A 4RTZA 2DF6A 2DVWA 4AFUC 3NPFA 1AVZC 1UE9A 1YMPA 1UGVA 1M8MA 5EIBE 4RUGA 1WI7A 4E6RA 2J7IA 4GLMA 2EVRA 5KNHD 1N5ZA 5AQ9A 3B95A 3TWQA 2LP5A 4AFSC 2NYJA 2CT3A 4JZ4A 5FIOA 4DRXE 3JXIA 4U8VD 2KT8A 2OAWA 4HBDA 5I11A 3Q9NC 2EBPA 1K9AA 1RLQC 2SEMA 4HI9A 2M51A 2FEIA 2V5QC 5KBAA 4HCKA 2LMJA 2RNAA 4LNPA 1BU1A 2DJQA 1PRLC 2V4HC 2FPEA 4O60A 5BXOA 3VS6A 2J6KA 2AZVA 2JS0A 2W0ZA 1CSKA 3VRZA 3UTMA 4U95D 2OJ2A 1SSHA 1YN8A 4OMNA 1N0QA 2D8HA 1U3OA 1ZX6A 5D66A 2YDLA 3RBBB 2ZGGA 4LSZE 4J9FA 4U96D 4IIOA 3NHNA 4OMPA 1K76A 2K3BA 2LJ0A 2RQUA 2ESWA 1SEMA 4DEXA 2GBQA 1QCFA 2KT1A 2ECZA 4RLYA 5BXUA 2AJAA 5IXBA 4DX7D 2RFMA 3IQLA 3VS5A 2PTKA 2CSQA 2OI3A 2A37A 3M0UA 4RTUA 2ETCA 1DCQA 1M3AA 2KNBB 2D1XA 1MV3A 3EHRA 1X6BA 2V1RA 3C0CA 5EC7A 2PNNA 1BB9A 2DILA 3O5ZA 1E7OA 2EGAA 3UXGA 1JU5C 3UATA 2KROA 1DC2A 5KNGA 2F8XK 4J8YA 2P4RA 1MX2A 1WA7A 5GJWB 1GFDA 1HD3A 2CDTA 1KSWA 1S70B 1UHFA 3M0TA 4CC4B 1PKSA 1SHFA 5IHKA 1OV3A 2L3PA 4YDYA 1D9SA 2GTOA 1Z9ZA 2KRMA 1GRIA 1M3BA 4Z8AA 1VYUA 4Z89A 1JXMA 5JMND 4HVUA 1PWTA 3H0HA 2XEHA 4X1VA 2J05A 4HVWA 4QT7A 2ABLA 2XMFA 3DEPA 1BU9A 4CC2A 2F2XA 1M30A 4HVVA 1IO6A 2L3SA 3V30A 4K5BA 1RLPC 1Z9QA 4OMLA 2A28A 3KEAA 3J5QB 4DEYA 2X3WD 2C0TA 5AQAA 3F6QA 2NUZA 3EG1A 2BKKB 5ENTD 4DX1A 1WYXA 1KFZA 1KJWA 2K79A 2DL5A 1HJDA 2A5EA 5EIDA 4GPMA 2ED1A 1ARKA 2IIMA 2RQVA 3PVQA 4HRMB 1E6GA 2BZ8A 2DL3A 2L2PA 3SHWA 2CREA 4CC7A 5I22A 4Z88A 3V2XA 1W1FA 1S1NA 1K4US 1NEBA 3VS1A 2F2VA 3RNJA 3VS2A 1NLOC 2KEAA 3ULRB 2MCNA 1KIKA 3EHQA 2A08A 1M3CA 4CC3A 2O2OA 3I35A 2XZTG 3TWSA 4HLLA 1FYNA 3TWUA 2DL8A 1E6HA 2YSQA 2JMCA 2FPDA 4CYMD 2K9GA 4O1OA 1FMKA 1MX6A 5AN8A 1TG0A 1NM7A 1W6XA 3H41A 1AWWA 1A5EA 1YWPA 2EGCA 1M27C 4OMOA 1AZEA 2C0IA 3M0PA 2CUBA 1GCQA 2QDLA 2ENMA 4FSSA 1X27A 2YUOA 2RPNA 2DNUA 1YCSB 2DBKA 3EGUA 1ZBJA 2CH4A 2RF0A 4IIMA 4HXJA 3IXEA 2AKLA 1MV0B 1K3ZD 5CEDB 3TWRA 2GQIA 4JPBW 5ENPD 2L0AA 2DE0X 5KWDA 2O88A 4OAUC 4YDWA 1ZSGA 1WX6A 3ZU7B 2DRMA 2PNIA 3UI2A 3ZNGA 5ECAA 2Y1LE 4HRNA 2DLPA 2QC9A 2GNCA 4F6RD 1X43A 2RQWA 1AZGB 2HDAA 3NOGD 1OPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OT8 A;  5ENO D;  4DUI A;  5EN5 D;  4BEP A;  2I0N A;  3VS3 A;  1G83 A;  4J7W A;  1WLP B;  1JEG A;  1K1Z A;  2J6F A;  1ZUK A;  2ETA A;  4G8L A;  3V79 K;  3W9G A;  2MIO A;  2XEN A;  2DL7 A;  2J8S D;  4RTV A;  1H3H A;  2VKN A;  2LQW A;  3CQT A;  2RFA A;  2XZD G;  2DVJ A;  1GBR A;  1PKT A;  5L23 A;  1AWC B;  2YUN A;  3M0R A;  1YWO A;  3UF4 A;  4CZ2 D;  2KBT A;  4OMM A;  1N0R A;  4OMQ A;  2JT4 A;  2GTJ A;  1WXT A;  1WG0 A;  5CBN A;  1NG2 A;  3TSZ A;  1GBQ A;  1PHT A;  4DX6 D;  2DZO A;  1T3L A;  5CEC B;  2CUD A;  2FG0 A;  4K5A B;  2QYJ A;  1QWF A;  2X3X D;  4BES A;  1G3N B;  1AOJ A;  2DWZ A;  2B0O E;  2W10 A;  5GJV B;  2P2C P;  1UJ0 A;  1SW6 A;  5IHN A;  2C0O A;  2LQN A;  1BLX B;  2HCK A;  2CH4 W;  2JXB A;  3GBQ A;  4J9B A;  1K1B A;  3NOC D;  2JM9 A;  5EYP F;  3M0S A;  5JA4 D;  2EKH A;  2F2W A;  2KGT A;  2J6O A;  4JB8 P;  2ETB A;  4DX5 D;  1JXO A;  2DZN A;  2ZGD A;  1VYT A;  2G6F X;  3DEO A;  5IXF A;  1AEY A;  4KRT A;  4LUE A;  5CER B;  2E5K A;  5IH2 A;  3SO8 A;  5ENQ D;  4JJD A;  4RTT A;  4JJC A;  3TWT A;  2DL4 A;  4N5Q A;  4QFV A;  3I5R A;  3J5P A;  4Z68 A;  5CEA A;  4B93 B;  4AG1 C;  2F37 A;  4O1P A;  2O31 A;  1JO8 A;  1NYG A;  4F1P A;  2JM8 A;  4J9G A;  4LUD A;  1ABO A;  4LG6 A;  2HSP A;  2EYW A;  1WFW A;  3JXJ A;  3REB B;  1SPK A;  2JW4 A;  4LE9 A;  3T9K A;  2XEE A;  1NYF A;  1B3Q A;  2CT4 A;  3TWW A;  1GL5 A;  1SRM A;  2ROT A;  4M4Z A;  4BER A;  1BK2 A;  4J9H A;  4R0K A;  1UDL A;  4GMR A;  4ESR A;  3JV3 A;  2KYB A;  1K0S A;  4NIK A;  2RMO A;  3NMZ C;  3ZUV B;  1T0H A;  1OPL A;  2YT6 A;  1BBZ A;  1WXU A;  2D0N A;  3H0F A;  2FO0 A;  4RTW A;  5ENS D;  2VVK A;  1UFF A;  1PNJ A;  4A63 B;  1T3S A;  1UG1 A;  4K5C A;  4GBQ A;  1OOT A;  3I5S A;  3HRA A;  5AQB A;  2KBX A;  1IXV A;  2LX7 A;  4F17 A;  1I1J A;  5CBO A;  3VS0 A;  2DYB A;  5AAR A;  1QLY A;  5AQ7 A;  3NBN B;  4QQI A;  1MJ0 A;  2DA9 A;  3LH5 A;  1ABQ A;  2LCS A;  1A0N B;  2ROL A;  1H92 A;  1XOV A;  1AP7 A;  3ZL7 C;  1YP5 A;  1TR4 A;  4HNA D;  5AAO A;  2K6D A;  5FWB A;  1VYV A;  2NWM A;  3TWV A;  2AKK A;  1GCP A;  2EGE A;  5ITZ F;  2EW3 A;  2LZ6 B;  2O9S A;  1UTI A;  3H0I A;  3SEM A;  1MX4 A;  1YNZ A;  4JJB A;  1YYH A;  3HG0 D;  1SHG A;  3REA B;  2MYO A;  2DMO A;  2M0Y A;  4UUC A;  2KXD A;  2BZX A;  4JZ3 A;  4ORZ A;  3V31 A;  2MOX A;  3AJI A;  4DX2 A;  4RTX A;  1Y57 A;  3A98 A;  1B07 A;  1UJY A;  4HRL A;  2EQI A;  1X2K A;  3VS4 A;  2HEQ A;  2KR3 A;  4ATZ D;  2RN8 A;  3QWY A;  5HS0 A;  3ZKJ A;  2HBW A;  1WDX A;  3NGP A;  1UOH A;  4J9E A;  2VGE A;  3D9H A;  5FW9 A;  3V2O A;  2ED0 A;  4C48 B;  1QKW A;  2FO1 E;  2Y0B G;  2FRY A;  2LJ1 A;  1X69 A;  4J9C A;  1WXB A;  3TVT A;  3U23 A;  5IHI A;  4BET A;  3KFV A;  1WIE A;  2DBM A;  2VWF A;  2V1Q A;  4G8K A;  5FIN A;  1QKX A;  1BD8 A;  1OEB A;  1UEC A;  2KYM A;  1ZUY A;  2LNH B;  4RTY A;  3M0Q A;  4BSZ B;  2A36 A;  2KE9 A;  3QWX X;  3UA6 A;  4LN2 A;  2DRK A;  2YUQ A;  4Y92 A;  4AG2 C;  1BI8 B;  1IHB A;  3EG0 A;  2CSI A;  3VS7 A;  4HB5 A;  2L6B A;  1T0J A;  2AK5 A;  5HCK A;  2LJ3 A;  3UA7 A;  1J3T A;  1HSQ A;  1G2B A;  2DM1 A;  2KXP C;  4U8Y D;  1BI7 B;  3EG2 A;  5EIL A;  1U06 A;  3FJ5 A;  3VRY A;  1SVX A;  2JAB A;  3B7B A;  1U5S A;  5EYL A;  1AWJ A;  1SRL A;  2DX1 A;  1GFC A;  1AWX A;  2L3Q A;  2BTT A;  4ZNX A;  4D8D A;  1V1C A;  1MUZ A;  3JUE A;  1UUE A;  2RQR A;  4AFQ C;  1I07 A;  5FWC A;  4D8K A;  4WCI A;  3PVL A;  1TUD A;  1K0X A;  1VA7 A;  3W9F A;  1JQQ A;  2KXC A;  2BKG A;  1PRM C;  2H8H A;  3PE0 A;  1AD5 A;  2EYY A;  4HQD A;  1MYO A;  1NLP C;  3I9Q A;  1I0C A;  2JTE A;  4EIK A;  2O9V A;  2JS2 A;  2KRN A;  1IKN D;  2AZS A;  1K1A A;  2F8Y A;  2KRS A;  1UHC A;  4AFZ C;  4TUM A;  4ZFH A;  4HI8 A;  2B86 A;  1ZUU A;  1RUW A;  2SRC A;  1AWO A;  1LCK A;  5HRY A;  1X2Q A;  1NFI E;  2PZ1 A;  3T8K A;  1CKA A;  1WDY A;  2D8J A;  3LJN A;  2J06 A;  2RQT A;  4K11 A;  1OY3 D;  3EU9 A;  1RI9 A;  4F14 A;  3TSW A;  1TUC A;  1GCQ C;  1NEG A;  4J9D A;  4LNU D;  2EYZ A;  4J9I A;  2FPF A;  2K2M A;  3AAA C;  1X6G A;  2YUP A;  2JMA A;  3Q9U C;  3C5R A;  4OAV B;  2BZY A;  2EPD A;  2EYX A;  2HE0 A;  2GGR A;  1W70 A;  1ZLM A;  1H8K A;  4F16 A;  5ENR D;  1Y0M A;  3THK A;  1QYM A;  5HKP A;  1CKB A;  3EG3 A;  2K7A A;  1QWE A;  4ZHB A;  2FRW A;  3R6N A;  1EFN A;  3TWX A;  1N11 A;  4RTZ A;  2DF6 A;  2DVW A;  4AFU C;  3NPF A;  1AVZ C;  1UE9 A;  1YMP A;  1UGV A;  1M8M A;  5EIB E;  4RUG A;  1WI7 A;  4E6R A;  2J7I A;  4GLM A;  2EVR A;  5KNH D;  1N5Z A;  5AQ9 A;  3B95 A;  3TWQ A;  2LP5 A;  4AFS C;  2NYJ A;  2CT3 A;  4JZ4 A;  5FIO A;  4DRX E;  3JXI A;  4U8V D;  2KT8 A;  2OAW A;  4HBD A;  5I11 A;  3Q9N C;  2EBP A;  1K9A A;  1RLQ C;  2SEM A;  4HI9 A;  2M51 A;  2FEI A;  2V5Q C;  5KBA A;  4HCK A;  2LMJ A;  2RNA A;  4LNP A;  1BU1 A;  2DJQ A;  1PRL C;  2V4H C;  2FPE A;  4O60 A;  5BXO A;  3VS6 A;  2J6K A;  2AZV A;  2JS0 A;  2W0Z A;  1CSK A;  3VRZ A;  3UTM A;  4U95 D;  2OJ2 A;  1SSH A;  1YN8 A;  4OMN A;  1N0Q A;  2D8H A;  1U3O A;  1ZX6 A;  5D66 A;  2YDL A;  3RBB B;  2ZGG A;  4LSZ E;  4J9F A;  4U96 D;  4IIO A;  3NHN A;  4OMP A;  1K76 A;  2K3B A;  2LJ0 A;  2RQU A;  2ESW A;  1SEM A;  4DEX A;  2GBQ A;  1QCF A;  2KT1 A;  2ECZ A;  4RLY A;  5BXU A;  2AJA A;  5IXB A;  4DX7 D;  2RFM A;  3IQL A;  3VS5 A;  2PTK A;  2CSQ A;  2OI3 A;  2A37 A;  3M0U A;  4RTU A;  2ETC A;  1DCQ A;  1M3A A;  2KNB B;  2D1X A;  1MV3 A;  3EHR A;  1X6B A;  2V1R A;  3C0C A;  5EC7 A;  2PNN A;  1BB9 A;  2DIL A;  3O5Z A;  1E7O A;  2EGA A;  3UXG A;  1JU5 C;  3UAT A;  2KRO A;  1DC2 A;  5KNG A;  2F8X K;  4J8Y A;  2P4R A;  1MX2 A;  1WA7 A;  5GJW B;  1GFD A;  1HD3 A;  2CDT A;  1KSW A;  1S70 B;  1UHF A;  3M0T A;  4CC4 B;  1PKS A;  1SHF A;  5IHK A;  1OV3 A;  2L3P A;  4YDY A;  1D9S A;  2GTO A;  1Z9Z A;  2KRM A;  1GRI A;  1M3B A;  4Z8A A;  1VYU A;  4Z89 A;  1JXM A;  5JMN D;  4HVU A;  1PWT A;  3H0H A;  2XEH A;  4X1V A;  2J05 A;  4HVW A;  4QT7 A;  2ABL A;  2XMF A;  3DEP A;  1BU9 A;  4CC2 A;  2F2X A;  1M30 A;  4HVV A;  1IO6 A;  2L3S A;  3V30 A;  4K5B A;  1RLP C;  1Z9Q A;  4OML A;  2A28 A;  3KEA A;  3J5Q B;  4DEY A;  2X3W D;  2C0T A;  5AQA A;  3F6Q A;  2NUZ A;  3EG1 A;  2BKK B;  5ENT D;  4DX1 A;  1WYX A;  1KFZ A;  1KJW A;  2K79 A;  2DL5 A;  1HJD A;  2A5E A;  5EID A;  4GPM A;  2ED1 A;  1ARK A;  2IIM A;  2RQV A;  3PVQ A;  4HRM B;  1E6G A;  2BZ8 A;  2DL3 A;  2L2P A;  3SHW A;  2CRE A;  4CC7 A;  5I22 A;  4Z88 A;  3V2X A;  1W1F A;  1S1N A;  1K4U S;  1NEB A;  3VS1 A;  2F2V A;  3RNJ A;  3VS2 A;  1NLO C;  2KEA A;  3ULR B;  2MCN A;  1KIK A;  3EHQ A;  2A08 A;  1M3C A;  4CC3 A;  2O2O A;  3I35 A;  2XZT G;  3TWS A;  4HLL A;  1FYN A;  3TWU A;  2DL8 A;  1E6H A;  2YSQ A;  2JMC A;  2FPD A;  4CYM D;  2K9G A;  4O1O A;  1FMK A;  1MX6 A;  5AN8 A;  1TG0 A;  1NM7 A;  1W6X A;  3H41 A;  1AWW A;  1A5E A;  1YWP A;  2EGC A;  1M27 C;  4OMO A;  1AZE A;  2C0I A;  3M0P A;  2CUB A;  1GCQ A;  2QDL A;  2ENM A;  4FSS A;  1X27 A;  2YUO A;  2RPN A;  2DNU A;  1YCS B;  2DBK A;  3EGU A;  1ZBJ A;  2CH4 A;  2RF0 A;  4IIM A;  4HXJ A;  3IXE A;  2AKL A;  1MV0 B;  1K3Z D;  5CED B;  3TWR A;  2GQI A;  4JPB W;  5ENP D;  2L0A A;  2DE0 X;  5KWD A;  2O88 A;  4OAU C;  4YDW A;  1ZSG A;  1WX6 A;  3ZU7 B;  2DRM A;  2PNI A;  3UI2 A;  3ZNG A;  5ECA A;  2Y1L E;  4HRN A;  2DLP A;  2QC9 A;  2GNC A;  4F6R D;  1X43 A;  2RQW A;  1AZG B;  2HDA A;  3NOG D;  1OPK A; 
#chains in the Genus database with same CATH topology
 5EN5 D;  1O5M A;  4BI4 A;  1G83 A;  2VJ8 A;  2ZPG B;  5IY5 E;  3V79 K;  2HL3 A;  5CRV A;  2CKK A;  1VQP T;  1C0M A;  1RAD B;  1BKB A;  1TS9 A;  3QWW A;  3SI5 A;  2PQR A;  3BG1 B;  1H3H A;  2L9B A;  4GA1 A;  2QFC A;  2CHX A;  4UQX A;  3CHP A;  1GBR A;  1PKT A;  5L23 A;  4FT2 A;  3M0R A;  3TG5 A;  2GTJ A;  2M1H A;  1MGQ A;  3BDL A;  3TSZ A;  1PHT A;  2DZO A;  1T3L A;  5CEC B;  2C2L A;  4Q96 A;  4BES A;  3ZFJ A;  1Y07 A;  2LTO A;  1O1S A;  2R02 A;  4BDZ A;  1AOJ A;  1LVK A;  5AJL A;  2W10 A;  2CP6 A;  3OYG A;  1UJ0 A;  1E90 A;  4XQ3 A;  4H7X A;  5DLO A;  1BLX B;  2UY1 B;  3BEE A;  3AT1 B;  3M0S A;  3CME A;  2PQN A;  1Y96 B;  4JB8 P;  3CCJ T;  3F70 A;  5KYX B;  5BNW A;  5GAM f;  3HXD A;  4N4G A;  4JLI A;  4KRT A;  3S3M A;  1VQ9 T;  5CER B;  1KHC A;  3EJN A;  4C5E A;  3FUL A;  3S3N A;  5ENQ D;  3MYV A;  3V8L A;  4DLO A;  5G04 J;  4A1S A;  2OTL A;  4QFV A;  4JS5 A;  1A17 A;  3B7U X;  2O31 A;  2ZGW A;  1ABO A;  4NS5 A;  4QQD A;  3HVE A;  3PMI A;  2EYW A;  3CCR Q;  1WFW A;  4IUP A;  2WPV A;  3JXJ A;  2IU1 A;  1TTH B;  2KC7 A;  3FUI A;  1SPK A;  2JW4 A;  3QHS A;  3CCQ Q;  3URG A;  5LJ5 d;  4ATG A;  2XDD A;  4GZD A;  3OYF A;  1B3Q A;  4KVO A;  3TAX A;  5FJY A;  3UM2 A;  4RMO A;  3LW5 E;  3TWW A;  4OF1 A;  2VGY A;  3MGB A;  3VV0 A;  2ROT A;  3AU5 A;  2YLC A;  1O1T A;  3P2B A;  2DTO A;  4BER A;  4MML A;  3GIB A;  3M57 A;  3JV3 A;  3G2S A;  5E76 A;  4UQY A;  2YRC A;  3BW1 A;  1IZ6 A;  1RAE B;  3PFS A;  3UPU A;  5T4Y A;  2J07 A;  3JCM W;  4RTW A;  3OB9 A;  2E41 A;  5ENS D;  1YHQ A;  3TGO A;  1T3S A;  2OTJ T;  4NRH B;  4K5C A;  4KH1 B;  3FFL A;  1I1J A;  4OGC A;  2RHZ A;  2DYB A;  2EIN E;  3CVP A;  5AAR A;  2QTX A;  1YJN Q;  4HS2 A;  4PJO E;  1S72 A;  4M77 F;  4WND A;  3DLL A;  3LH5 A;  3LJ3 A;  4K03 A;  3DSS A;  1HFA A;  2OOE A;  2HMA A;  1TR4 A;  4HNA D;  5DLQ E;  3CC4 Q;  3RRN B;  1WHG A;  1TXQ A;  4GTT A;  4XX5 A;  3TWV A;  2NWM A;  2AKK A;  5CVI A;  4UWL A;  4EBA A;  2NSZ A;  2A3L A;  2K3Y A;  4KUL A;  3G4S A;  2VYT A;  4NOY A;  4GTM A;  3CPW A;  4LDW A;  1M1F A;  2DMO A;  3G71 T;  2HSE B;  4L2Y A;  3M5A A;  3EAE A;  2KXD A;  2DTH A;  2O4X B;  4RTX A;  3PZD A;  3PE3 A;  1B07 A;  1UJY A;  4HLE A;  1INZ A;  1VQO A;  3OA6 A;  1X2K A;  3DPD A;  2KK4 A;  3OBW A;  3UPV A;  1QZ2 A;  4B8A A;  4ATZ D;  2RN8 A;  4M78 G;  4FYX B;  5HS0 A;  3ASD A;  2X4J A;  4J9E A;  2X6I A;  3NGP A;  4L59 A;  2KMT A;  3X20 B;  2FO1 E;  2PUO B;  2LJ1 A;  3TVT A;  1X69 A;  3L1A A;  1DNP A;  4V3I A;  5IHI A;  1SQM A;  3RJV A;  2VSY A;  2PZI A;  3TG4 A;  4BET A;  4D10 C;  1KK7 A;  4XKB A;  3SFZ A;  2VWF A;  2V26 A;  4PS3 A;  1QKX A;  4EZJ A;  4BT9 A;  5CKD A;  1E7U A;  2KE9 A;  2GFU A;  4AT1 B;  7AT1 B;  2YUQ A;  4Y92 A;  4AG2 C;  1XQH A;  5CR2 A;  1DJ7 B;  5GAO m;  2ZPH B;  4DOV A;  2XCC A;  2QQS A;  3PNT B;  1P5Q A;  2KZT B;  1VQK T;  3ZBD A;  1YIT T;  4LD6 A;  1J3T A;  1ZBP A;  3FUK A;  1G2B A;  2BIV A;  4TRQ A;  4FJZ A;  1ELW A;  4AY5 A;  4XU2 A;  5LJ5 h;  3I56 T;  2WXL A;  3DSU A;  5EYL A;  1AWJ A;  2L89 A;  2XU8 A;  4C8Q E;  1BI1 A;  1V54 E;  4HA8 A;  2J9Q A;  4A4H A;  3KS2 A;  1I07 A;  5FWC A;  4WCI A;  4J83 A;  2GQV A;  3QJ6 A;  1VA7 A;  3CCU A;  1M90 R;  1K0X A;  4A4E A;  2XGS A;  3LGF A;  1NLP C;  2DXC A;  4UI9 K;  3JQ1 A;  3GZS A;  2KRN A;  3OYJ A;  1W2B P;  1K1A A;  1UHC A;  4GTO A;  3HHM A;  2DXT A;  4RCB A;  2ZU6 B;  8AT1 B;  1JJ2 P;  2I9C A;  4ZGE B;  3HHT B;  2B86 A;  1FMW A;  1AWO A;  1VQ4 Q;  2ZPI B;  3RKX A;  3SFX A;  1X2Q A;  4UQZ A;  5KCH A;  4EZK A;  3T8K A;  1CKA A;  3Q7F A;  1WDY A;  3CD6 A;  2D8J A;  3LY8 A;  5CKB A;  3JCM P;  1YFN A;  3JB9 G;  4K11 A;  1Y71 A;  5G05 C;  4I6G A;  2K5F A;  3TSW A;  4IUU A;  4X9D A;  1GCQ C;  1VQ6 A;  1NEG A;  1VQL A;  5FQ7 A;  4J9I A;  3RMS A;  1HX8 A;  4HCZ A;  2E6N A;  4AY6 A;  2JMA A;  4I6J A;  4MDW A;  2IG0 A;  3RUX A;  3SWN A;  3DST A;  1VQN Q;  4LD9 K;  4OAV B;  2BZY A;  2HE0 A;  4OYS A;  1W70 A;  1H8K A;  3OYL A;  4HT8 A;  4WWP A;  2Y4Y A;  2GRP B;  3FU5 A;  4FLB A;  1M1G A;  2EQJ A;  3D9N A;  3TWX A;  3LYI A;  1EIF A;  3V7S A;  3X25 B;  4JXT A;  1VQ8 T;  5B1A E;  2X6K A;  5FU7 B;  1UGV A;  1M8M A;  3LS8 A;  5EIB E;  1H64 1;  2EKO A;  2GRN B;  3P8D A;  4GLM A;  3ABL E;  2EVR A;  1TEZ A;  2R17 C;  3B95 A;  2LP5 A;  5M72 A;  2M16 A;  2NYJ A;  3P1U A;  1I5L A;  4J0U A;  3JXI A;  1AHJ B;  5GAM d;  3ZFW A;  3CMA Q;  3MKQ B;  1K9A A;  1RLQ C;  5ARF A;  1X81 A;  2M51 A;  3PGG A;  4XIF A;  4LNP A;  2RNA A;  4LDV A;  2V4H C;  5FZQ A;  2MI6 A;  3ESK A;  3LCA A;  1TWB A;  1Q2Z A;  1R0C B;  3OYB A;  4JDS A;  3C3Q A;  3CKC A;  2MRI A;  3MJX A;  2ZIR A;  3D7S B;  1N4Q A;  3CC2 Q;  2JS0 A;  2MPX C;  1CSK A;  2W0Z A;  4WNE A;  3T5X A;  3UTM A;  1SG5 A;  3JB9 H;  3M58 A;  2OJ2 A;  4Y91 A;  3JAM E;  4WWO A;  2XDP A;  4OMN A;  2EQM A;  1N0Q A;  4JC8 A;  4GA0 A;  1ZA1 B;  4WAF A;  4PJL A;  2CG3 A;  2EQK A;  1M90 C;  5D66 A;  4MZM A;  3Q78 A;  5CKF A;  2P58 C;  4M78 F;  4J9F A;  4U96 D;  4OP0 A;  1NI1 A;  4QVD A;  1JJ2 S;  4M7A C;  1PAQ A;  2LJ0 A;  3IV0 A;  2RQU A;  2C06 A;  2ESW A;  1HXI A;  2GBQ A;  1QCF A;  2ECZ A;  4E85 A;  3LLR A;  3EGD A;  1VQP A;  1I4K 1;  3IQL A;  1QVP A;  2AT1 B;  5AYF A;  3CV0 A;  2CP5 A;  2OI3 A;  3E1S A;  3ASH A;  2A37 A;  2MHK A;  2R03 A;  1D8D A;  2ETC A;  3CXC P;  2KNB B;  1E8W A;  3CME T;  3L42 A;  1HU3 A;  3H8Z A;  4QQ6 A;  2VV5 A;  3SDZ A;  3EFO B;  2V1R A;  3BQO A;  2RHX A;  2EIJ E;  1BB9 A;  3Q5M A;  5EC7 A;  3MA5 A;  1VQ5 T;  3EG9 A;  3J7A F;  2I2L A;  3O5Z A;  5EKQ D;  2OEV A;  2EGA A;  3QPH A;  1G3W A;  2QK0 A;  5KNG A;  2F8X K;  2X38 A;  2OTL T;  2P4R A;  1FVH A;  1ZA2 B;  5GJW B;  3VLE A;  1GFD A;  1SZA A;  4JA9 A;  2CDT A;  1KC8 C;  4JVS A;  1UHF A;  4PJO G;  4CC4 B;  2DXB A;  1BYM A;  3CHM A;  4FUL A;  4M75 B;  5FQ8 A;  3L2V A;  3I3N A;  2XIC A;  2R05 A;  3FTW A;  1NPR A;  3TL5 A;  2GTO A;  3OYK A;  4JS4 A;  5G05 J;  3FH7 A;  2XCB A;  3RU0 A;  1WHL A;  3CVQ A;  3G7Z A;  3CCV Q;  1VQ7 Q;  1M3B A;  2JTM A;  3UX4 A;  1VYU A;  4G11 A;  3FDR A;  3KBG A;  4GYW A;  2IJG X;  4UWH A;  4Z89 A;  2FI7 A;  1H6P A;  4M78 A;  4C92 B;  4U04 A;  1PWT A;  4PS7 A;  2J05 A;  3PZ1 A;  4I6E A;  2WXM A;  3VTX A;  2NLU A;  5AIJ A;  1V29 B;  2P9N G;  3DEP A;  2E3H A;  1E8X A;  5KYU B;  4OMF B;  1IO6 A;  1YJW A;  2L3S A;  4MMK A;  5GAM h;  5KJL A;  1Z9Q A;  5J3B A;  4J7F A;  3S7D A;  1EYH A;  3J5Q B;  4RCC A;  4FW2 A;  2E5Q A;  3CVW A;  3F6Q A;  4ANJ A;  2RHU A;  4MZT A;  2WXG A;  1HF8 A;  4ATO A;  3V7R A;  2ED1 A;  1ARK A;  1KQS P;  4F04 B;  3U9W A;  2FL7 A;  2MWP A;  3SGH A;  4F53 A;  2MOW A;  3CK9 A;  1JRI A;  1OZ2 A;  2KI7 A;  2FUL A;  3L13 A;  2M02 A;  2YRD A;  2BZ8 A;  3MP1 A;  2EWN A;  1YHQ Q;  3SHW A;  4CC7 A;  3QWV A;  1NP7 A;  1K8A R;  2HD0 A;  1NEB A;  3IBE A;  2F2V A;  3QUI A;  3T9N A;  5B1B E;  3VS2 A;  1BCO A;  1NLO C;  4E47 A;  1K73 R;  1M4Z A;  4E7K A;  5CQY A;  4A3V A;  2MCN A;  1N4R A;  3G4S T;  3MV3 B;  3OS2 A;  1S72 Q;  4CGV A;  2HNI A;  3FLG A;  2EFI A;  5HK0 A;  1FYN A;  3TWU A;  2DD5 A;  2LCL A;  3WVE B;  4C0D B;  3CCE A;  1FMK A;  1MX6 A;  2BUG A;  2WXH A;  4M77 C;  3CXC S;  4HFG A;  3OS1 A;  1AWW A;  5GAO q;  2K57 A;  2EIK E;  2FZC B;  2ILR A;  1WJQ A;  4JRK A;  1PM3 A;  4UI9 C;  4XZ4 A;  2C0I A;  4C8Q G;  1VQO T;  4BX8 A;  2ENM A;  2YHT A;  1RAH B;  1X27 A;  1MZC A;  1HO8 A;  1ZBJ A;  3OMC A;  2IO2 C;  2BUD A;  2RF0 A;  4IIM A;  4N4H A;  3IXE A;  2LSV A;  1IHG A;  2AKL A;  2GQI A;  3Q49 B;  2JOY A;  3RKV A;  2L0A A;  2DE0 X;  4XEI G;  3G71 A;  4KVM A;  4YDW A;  4DK5 A;  1LPL A;  1ZSG A;  1MHN A;  3NFC A;  3UI2 A;  2LVM A;  4BT8 A;  3A8H B;  3T8M A;  2QC9 A;  3K9I A;  5GAO n;  3CKB A;  3NZU A;  2YQ8 A;  3A8M B;  5ENO D;  2VTB A;  3B7T A;  4J7W A;  1WLP B;  2AIR B;  3OBY A;  3PIO A;  3BFM A;  2CZ6 B;  2J6F A;  2ETA A;  1N9S A;  3KD7 A;  4B89 A;  3CC7 Q;  3QJY A;  1M1K U;  2R5A A;  3W9G A;  3FP3 A;  2K4Y A;  5DM7 R;  2DL7 A;  5GAM j;  3TJP A;  2Y3A A;  3KSL A;  4N5C A;  3CQT A;  2MK5 A;  2I1K A;  3CCL T;  2RFA A;  3AG3 E;  1SF9 A;  4C0Z A;  1RAB B;  4B8C B;  1YWO A;  5GAO l;  4CZ2 D;  4OMM A;  2IY0 C;  4PKC C;  2KAT A;  5AEN A;  2JT4 A;  1W2B A;  3GF5 A;  1NG2 A;  1O1R A;  1HE8 A;  3V7C A;  1Q82 C;  4DX6 D;  2EYQ A;  2CUD A;  3L2U A;  1H2T C;  1QWF A;  4E7J A;  4GA2 A;  3HP9 A;  3EU5 A;  2BKD N;  2E6Z A;  3EDT B;  2F5K A;  1Q86 U;  1KQS S;  1VQK A;  2IEJ A;  1TJC A;  1YIT A;  3ER0 A;  1BI0 A;  2C0O A;  2HCK A;  4I9C A;  1U3D A;  3I56 A;  2WXI A;  4FC8 A;  2F2W A;  2KGT A;  3FUN A;  2A5U A;  4KMO A;  2ETB A;  1JXO A;  1QVG P;  4M75 D;  3CCU Q;  3SHF A;  3DB3 A;  3FEX A;  2RI3 A;  1DVP A;  3VUB A;  2R5M A;  3CD6 T;  4XU3 A;  1K8A C;  3AG1 E;  4RKU E;  5JJ6 A;  5BPP A;  1IGU A;  4CDN A;  4RTT A;  3SQV A;  2DL4 A;  2F5T X;  2BF0 X;  2RB6 A;  4N5Q A;  1IGQ A;  3J5P A;  4B93 B;  1VQL T;  2F37 A;  5FQ4 A;  3RO2 A;  1JO8 A;  1NYG A;  4C92 D;  4ANW A;  4C9B B;  1NL4 A;  1B7T A;  3EGX A;  3HTR A;  2XEV A;  3SZ7 A;  5CO7 A;  5KJK A;  3REB B;  3APC A;  3FTU A;  1TN8 A;  3SFY A;  3JCM e;  4L7T A;  3T9K A;  4AP2 A;  1ZHI A;  2YWW A;  1HXD A;  2X3M A;  3VLD A;  1NYF A;  1VQ6 Q;  4L9P A;  4M7D B;  2AXZ A;  2JNG A;  1KC8 U;  4EPC A;  1M2V A;  4OB1 B;  3SY2 A;  2LQ8 A;  1BK2 A;  4GPK A;  4R0K A;  1FPP A;  2XG8 D;  3FEY A;  1IXD A;  4ESR A;  3RRU A;  3NTI A;  3GOX A;  4AIF A;  3HXF A;  3L2R A;  1FWZ A;  1QMC A;  1ACM B;  4ANU A;  1OPL A;  2YT6 A;  3LPZ A;  3PRZ A;  3QK0 A;  2NUT A;  2D0N A;  1WXU A;  4JJN K;  4XTX A;  2ZIS A;  4AOF A;  1H2V C;  2FO0 A;  4A63 B;  3P8H A;  4PFO A;  4GBQ A;  1OOT A;  4GZC A;  3I5S A;  1QVF S;  2LX7 A;  4U0S A;  4F17 A;  5KE3 A;  3MHX A;  4EQF A;  3OYE A;  3KAE A;  4PK4 A;  1QCO A;  1QLY A;  4B6M A;  1VQM Q;  2DK3 A;  4QQI A;  2LNI A;  4UI9 J;  3G2T A;  4MZP A;  2H3E B;  1YCY A;  2HZY A;  3E19 A;  3QYG B;  3DBS A;  3O8V A;  4PJM A;  3FTY A;  3G6E A;  3FUF A;  5BUZ A;  3UIN C;  2K3X A;  1QP2 A;  1N8R R;  3FUD A;  4RSY A;  4GTV A;  1G3Y A;  4ANV A;  2VAS A;  5C0M A;  1GCP A;  2EGE A;  2EW3 A;  2A0F B;  4L1B A;  1O75 A;  2O9S A;  3H0I A;  4KGX B;  4C0F A;  2HM8 A;  1YNZ A;  3ASN E;  3JCM b;  1M2O A;  3GP8 A;  3HG0 D;  2P84 A;  5LCW C;  1FCH A;  3FTS A;  3Q79 A;  1SHG A;  4A4F A;  1NA3 A;  2LXL A;  2WXK A;  1IHV A;  2LX9 A;  4O6J A;  2KCV A;  4JZ3 A;  4ORZ A;  4M7A F;  2MOX A;  3HSB A;  4PNO A;  3D3M A;  4DX2 A;  4HCB A;  3JCM X;  3OMG A;  3VJP A;  3ULE G;  2QQB A;  3I55 A;  1TN6 A;  2EQI A;  3ZYL A;  3VS4 A;  3RES A;  1UN8 A;  3QWY A;  2JLB A;  2FVU A;  2ZPE B;  3ZKJ A;  2HBW A;  2XPZ A;  3GYZ A;  5FW9 A;  1MMD A;  1RZ4 A;  3V2O A;  1Q81 R;  3AS8 A;  2ED0 A;  4J6W A;  4C5G A;  2E0I A;  2DJZ A;  2P0Q A;  2FRY A;  2CZ0 B;  4APF A;  3UT8 A;  1XTD A;  3I4G A;  4M78 C;  1ZB1 A;  5GMK h;  1WIE A;  2DBM A;  1Y6I A;  3IHV A;  4MKT A;  1OEB A;  3SWN B;  6AT1 B;  3M0Q A;  1VUB A;  4BSZ B;  2A36 A;  3GLX A;  1VQP Q;  5D6W A;  3E4B A;  3UA6 A;  4LN2 A;  3QKY A;  3E33 A;  2RI2 A;  4XU1 A;  1IHB A;  2AWI A;  3CCM A;  2CSI A;  4FYV B;  3PZ4 A;  3PUK A;  4N2Q A;  2AK5 A;  4X34 A;  4BI3 A;  2LJ3 A;  3UA7 A;  3VUZ A;  1QQE A;  3MEK A;  2DM1 A;  2KXP C;  4N0A A;  4L2L A;  2CGH A;  3EG2 A;  1U06 A;  3VRY A;  5C6S A;  2F1L A;  1BPO A;  4GZ5 A;  4D8D A;  2L3Q A;  2BTT A;  9ATC B;  5GAN 3;  1V1C A;  1VQ5 A;  2RQR A;  4AFQ C;  4FHK A;  3RRM B;  5ANL A;  1NZN A;  3SD5 A;  2YNQ A;  1MMA A;  4EMG A;  1Q7Y U;  3W9F A;  3RR6 A;  5KCO A;  3PIP A;  3QJZ A;  2V5F A;  1PRM C;  4M7A A;  3OY9 A;  1UJJ A;  2VGX A;  1MYO A;  4HQD A;  3LH0 A;  2O9V A;  3CCJ Q;  4IUR A;  2H6H A;  5D2M C;  4F7U F;  4CDM A;  2AZS A;  2KRS A;  4D6W A;  5FZS A;  1VQ9 Q;  4WTO B;  5AT1 B;  3FHE A;  2VSO E;  4PLL A;  1Q82 U;  4HI8 A;  3S3O A;  4A55 A;  1RUW A;  2SRC A;  1LCK A;  3TRE A;  1YJW T;  5HRY A;  1WY6 A;  4XU0 A;  1X75 C;  2QDY B;  2Q7F A;  5T3R A;  3SNX A;  3L82 A;  2NUP A;  2J06 A;  1XNF A;  2R59 A;  2RD0 A;  1OY3 D;  3S2A A;  3FIF A;  3RKW A;  4M7D D;  1EZZ B;  4J9D A;  1TNZ A;  2CP2 A;  2EYZ A;  1DCE A;  1TOV A;  3AAA C;  1YA0 A;  4MBG A;  1X6G A;  4OB0 B;  4R56 A;  3CQC B;  3Q9U C;  3VYH B;  4I2Z A;  2GGR A;  4I9E A;  1ZLM A;  5GMK m;  3FEO A;  5ANR A;  4UWK A;  1BIB A;  1CKB A;  2PQW A;  4E2F B;  4JPS A;  3DRA A;  2K7A A;  2Y90 A;  3FWV A;  2QA4 A;  5A0D A;  2H6F A;  1EFN A;  3ASF A;  5GMK j;  5LJ3 e;  1B34 A;  3RO3 A;  3DPY A;  3EGD B;  2DVW A;  4KT0 E;  4AFU C;  1AVZ C;  1UE9 A;  1OQK A;  1Q81 C;  5GAM g;  3CCE T;  5GAN e;  3QBY A;  3OW2 S;  3M4G A;  2OTJ Q;  4HOU A;  2QEX A;  1N5Z A;  5AQ9 A;  2KDS A;  2P9S G;  5LCW J;  3QB2 A;  4AM9 A;  3C72 A;  1O9S A;  2IOS A;  5FIO A;  4DRX E;  4U8V D;  2KT8 A;  1KD1 R;  4HBD A;  3EG9 B;  3Q9N C;  3ML9 A;  4F7U A;  2Z0W A;  4M75 E;  3ZXS A;  2SEM A;  2XPY A;  2X4Y A;  2V5Q C;  2QXF A;  1MMG A;  2LMJ A;  3UT7 A;  3X24 B;  1PRL C;  2PVD B;  4C0E A;  3ZEF A;  2RI5 A;  5JHA A;  4GML A;  3WXX A;  5EG2 A;  2B6C A;  3RDV A;  3ASO E;  4IUV A;  4C92 E;  2AZV A;  1S64 A;  3ZW3 A;  4OVV A;  3VU3 C;  3G71 Q;  1YI2 A;  8ATC B;  3URZ A;  3DB4 A;  2EIM E;  4M78 B;  3RIR A;  1ZX6 A;  3WG7 E;  2ZGG A;  2K5I A;  5D7U A;  3L16 A;  4LSZ E;  4IIO A;  3JCM c;  3NHN A;  2CZ1 B;  4KYO B;  5KYY A;  4Q94 A;  2K3B A;  1TSF A;  3RMQ A;  4BUG A;  5A6C A;  2E10 A;  3PZ3 A;  3QO3 A;  3TXM A;  1TJF A;  1QCN A;  1SEM A;  5HKC A;  5DIZ A;  4DEX A;  4N2S A;  4PJJ A;  4MDX A;  1PY1 A;  1QVG A;  1UW4 B;  4M77 A;  5IXB A;  5T8I A;  2RFM A;  4P5N A;  1YIJ T;  2PTK A;  3CCL A;  1P92 A;  3CST A;  4BY6 C;  2P9P G;  4RTU A;  4KGZ B;  2F0Y A;  3FTV A;  2L5Q A;  3FC3 A;  5CHE E;  3MP6 A;  1MV3 A;  3SD4 A;  1HG5 A;  3EHR A;  3D9P A;  2DVE A;  2H3J A;  3V8K A;  5LJ5 e;  2BE9 B;  4ZTJ A;  2PNN A;  1PCX A;  1K9M R;  2P9U G;  3LYA A;  2GCX A;  3UXG A;  1JU5 C;  1YIT Q;  1VQK Q;  4CCA A;  3HRS A;  3NF1 A;  1OWO A;  4J8Y A;  3CPF A;  1BI3 A;  5CKE A;  3HFO A;  3I56 Q;  2WMO A;  4Y28 E;  1S70 B;  3M0T A;  1TU0 B;  2HYZ A;  5IHK A;  1NJI R;  1OV3 A;  2LSU A;  2ZPB B;  1U3C A;  3MEA A;  3JCM f;  2HQX A;  1UGR B;  4C0G A;  4CGW A;  5D0O D;  3MKR A;  2GGF A;  4U8H A;  1IB8 A;  2DO3 A;  3FUM A;  5LX8 A;  3Q1J A;  1OCC E;  4Z8A A;  4EMK A;  2YLB A;  1WZO A;  4PJO C;  2R57 A;  4IUL A;  4ACK A;  4X9C A;  2X4W A;  2C0M A;  4C0M A;  5KYW A;  5LFA A;  4GZ3 A;  1JXM A;  4E7Z A;  1YBY A;  4QQG A;  1PD0 A;  2DXU A;  3JB9 J;  4X1V A;  4JZY A;  1KD1 C;  1KHI A;  3UWN A;  4N3B A;  4DA4 A;  2DD4 A;  4QT7 A;  2ABL A;  2X6F A;  4G1T A;  4U07 A;  5A7D B;  3GW4 A;  4B94 A;  4BE1 A;  3RAU A;  2VTB B;  3KEA A;  4DEY A;  4DJA A;  5AQA A;  4M7C A;  2NUZ A;  4XTW A;  1RAG B;  1N4S A;  2BKK B;  2VSX E;  5ENT D;  5FQ6 A;  3S7J A;  1VDY A;  4GPM A;  4BAC A;  1WQW A;  1N4P A;  1SA4 A;  3ME9 A;  1U1S A;  3UT1 A;  2M9U A;  4IRU A;  4C5I A;  3ML8 A;  3QDF A;  2RQV A;  3C12 A;  3UMV A;  4URK A;  4HOT A;  3FUH A;  1IRE B;  2L2P A;  1ZSZ A;  2CRE A;  3D9I A;  3G6E T;  3LVQ E;  5JHB A;  1QQJ A;  2OVB A;  4XTY A;  5KCM A;  2WQ7 A;  1VQ8 Q;  3CK8 A;  3ZPJ A;  3NTK A;  4CC3 A;  1N94 A;  4HLL A;  1KZP A;  2DEU A;  2JMC A;  3QAR A;  2FPD A;  2K9G A;  4XKC A;  4HOR A;  4I17 A;  3UUX A;  3G6E Q;  3JCM J;  3DXK G;  4XK8 E;  4EZL A;  2FYK A;  4EEC A;  5CMW A;  2EGC A;  3I55 T;  2HBP A;  3QKJ A;  1AZE A;  2C0L A;  5A0G A;  4N0A C;  3PRE A;  1QNF A;  3NB2 A;  1SSF A;  4LDY A;  3D9M A;  1G3S A;  4ILH B;  1QP3 A;  2E2E A;  1LOJ A;  4HXJ A;  1MV0 B;  2QAZ A;  4JPB W;  1FX7 A;  5ENP D;  3ZRH A;  4ZGJ B;  4C8Q C;  1WX6 A;  3ZU7 B;  1G5V A;  4WNF A;  3ZNG A;  1IRX A;  5ECA A;  2DLP A;  2WXN A;  4M7D E;  3QII A;  2RQW A;  3FY4 A;  4EPZ A;  1AZG B;  2HDA A;  2X35 A;  3EGX B;  3AHU A;  1OT8 A;  1NJI C;  3NAW A;  2I0N A;  1JEG A;  4BI8 B;  4CDR A;  3MV2 B;  1S63 A;  2P9L G;  1NPP A;  1ZUK A;  1Z3X A;  3CCM T;  4IN3 B;  4Z02 A;  5DY9 A;  3HRT A;  2LUH A;  3N71 A;  2J8S D;  1M2V B;  1PG5 B;  4RTV A;  5GAO p;  2CZ7 B;  2LQW A;  2KCK A;  2XZD G;  2DVJ A;  5G55 A;  2QAS A;  1AWC B;  1X5B A;  3UF4 A;  3B7R L;  4YTL A;  1WXT A;  2IF4 A;  1D0X A;  5CBN A;  1GBQ A;  4BFR A;  2NUT B;  2FG0 A;  1IQR A;  1TN7 A;  4K5A B;  1WPY A;  2VSN A;  1N95 A;  4BX9 A;  4PFP A;  1YJ9 A;  2X51 A;  3VKI A;  2DWZ A;  4BTA A;  3CME Q;  3QG1 A;  2Y69 E;  2B0O E;  1JWG A;  1N9R A;  5GJV B;  4B9X A;  1SW6 A;  3P8B B;  3GBQ A;  4J9B A;  2CH4 W;  3OS5 A;  2E1H A;  1K1B A;  3NOC D;  1VQ5 Q;  5EYP F;  4E7I A;  3ONL A;  2EKH A;  3CHS A;  2J6O A;  2G3R A;  2DET A;  2DZN A;  4RVB A;  2G6F X;  5IXF A;  4KH0 B;  2OTL Q;  2MYS A;  5DBK A;  4LUE A;  2E5K A;  5IH2 A;  3LY9 A;  3SO8 A;  1HYO A;  3B13 A;  1D1B A;  4JJD A;  4O5V A;  4VUB A;  3TWT A;  4M75 G;  5FRM A;  1FT1 A;  4BTB A;  3H9N A;  3I5R A;  4GMJ A;  1W4S A;  4Z68 A;  5CEA A;  3BY7 A;  4UC4 A;  4AG1 C;  3GNG A;  4J9G A;  5LL6 S;  4WWN A;  5J90 A;  4LUD A;  1LJO A;  5I2S A;  4E7H A;  4TXP A;  1OCR E;  3JB9 F;  3CHQ A;  3WVD B;  3ZHE A;  3EHM A;  2PVG B;  4LE9 A;  3VYG A;  4C92 G;  3CCR A;  2XEE A;  4GYO A;  2X6H A;  2UWJ G;  3PMT A;  2QA4 T;  5LJ3 f;  3C94 A;  1MHQ A;  2LNV A;  3QAQ A;  4FA6 A;  1GL5 A;  5H7P A;  1SRM A;  3CCQ A;  1WHH A;  4M4Z A;  5GMK l;  1M9S A;  2CHZ A;  1UEB A;  4I1A A;  4AVX A;  5BT1 A;  2KYB A;  2P4T A;  2HKN A;  4AV7 A;  1K0S A;  4NIK A;  2ION A;  3JYS A;  4JRI A;  5LOZ A;  4OB3 B;  2RMO A;  4RG9 A;  2AXU A;  3ZUV B;  3QOU A;  1T0H A;  4FM4 B;  2RA2 A;  2QEX T;  2GF7 A;  2PM7 A;  1LF8 A;  1FVF A;  3KEZ A;  4IKF A;  1PNJ A;  4XI0 A;  2YRV A;  2EAY A;  4HKE A;  5AQB A;  1IXV A;  2YIN A;  2BED A;  3QXE B;  1I5O B;  5AQ7 A;  5CK9 A;  3NBN B;  1MJ0 A;  2DA9 A;  2EQX A;  1ABQ A;  3N5B B;  4NL3 A;  5J26 A;  3BG0 B;  1WM5 A;  4U0U A;  5AAO A;  3G4S Q;  4G2V A;  1NZ9 A;  1WJR A;  1LTX A;  3QNK A;  3C3R A;  2QYZ A;  3JCM d;  4JRP A;  3VTY A;  5ITZ F;  4OVA A;  4B9W A;  1YI2 T;  4Q69 A;  1UTI A;  3SEM A;  1MX4 A;  4JJB A;  2AW6 A;  3Q73 A;  2E12 A;  1TNY A;  2MYO A;  2XDB A;  4M7A B;  4N3A A;  4UUC A;  4IUT A;  2VGX B;  1D1C A;  1VQO Q;  2WXF A;  3OYN A;  1FT2 A;  3DSW A;  4YND A;  1H19 A;  2NXP A;  1Y57 A;  4G25 A;  3HVE B;  2DFU A;  2AVP A;  4ELY C;  2XQ0 A;  3E37 A;  3JQ0 A;  3EIJ A;  3DKM A;  2KR3 A;  3L2Q A;  3FUE A;  3D9J A;  4IYP A;  1QVF P;  1ZBX A;  2J08 A;  3D9H A;  2NUP B;  4YVO A;  4C48 B;  1QKW A;  5JJ7 A;  1NBE B;  4EMK C;  4A3T A;  4MRU A;  3U23 A;  4J9C A;  1WXB A;  5CMY A;  4PDX A;  1OU9 A;  2RHY A;  1PC2 A;  2J49 A;  1BD8 A;  1UEC A;  2LNH B;  2KYM A;  1ZUY A;  2DER A;  1H3Z A;  3R7R A;  3ZGQ A;  1V76 A;  2LCC A;  4A4G A;  1JJ2 A;  4BSX A;  2DRK A;  3M56 A;  4FYY B;  5AJD A;  2HL5 C;  3R9M A;  3EG0 A;  3CCL Q;  3VS7 A;  3V8J A;  1M90 U;  4AXH A;  4HB5 A;  1QBQ A;  2L6B A;  5HCK A;  4JW1 A;  3UKU G;  1B34 B;  1YIJ A;  2O01 E;  2QQ9 A;  3J80 E;  4KXK B;  3CVU A;  4MS6 A;  2KSS A;  2KVQ G;  2NYS A;  4J6X A;  4MLP A;  4BE2 A;  3FJ5 A;  5EIL A;  1SVX A;  5FT9 A;  2VB6 A;  1U5S A;  3OSV A;  2VXE A;  2LXM A;  2YXY A;  2DX1 A;  4J5Y A;  1GFC A;  1AWX A;  2KY9 A;  2XPI A;  3L2Z A;  4RG6 A;  4PJO F;  3JUE A;  1UUE A;  2MMP A;  4OVU A;  1ZSZ C;  2RG8 A;  1TUD A;  2JVV A;  3HFN A;  1UJK A;  3M9Q A;  5CRU A;  1K73 C;  3NZS A;  3PH0 C;  4WF2 A;  4DOW A;  4F7U B;  3CEQ A;  2EYY A;  2LO6 A;  3G2V A;  3I9Q A;  1I0C A;  2JTE A;  3CBP A;  4EIK A;  2JS2 A;  1WNL A;  1IKN D;  2RJF A;  2F8Y A;  2VYI A;  1RL2 A;  2KM4 A;  3SF4 A;  4AFZ C;  4TUM A;  3CD6 Q;  2FF4 A;  4NL2 A;  3INZ A;  4EBA G;  2J4D A;  1NFI E;  2PZ1 A;  4RG2 A;  2XKO C;  1KQ1 A;  3LJN A;  1VQL Q;  1VQ4 A;  3Q47 B;  3LWI A;  2RQT A;  3EH1 A;  1RI9 A;  3EU9 A;  4BY6 A;  4F14 A;  2WQH A;  2X9H A;  5M9O A;  3PS6 A;  4C92 F;  4LNU D;  1G3T A;  2FPF A;  3U3W A;  4APO A;  2QYU A;  3A5Z B;  1EPU A;  3JCM h;  2EYX A;  3AG4 E;  1H6K A;  3CHO A;  4M7D G;  4GTQ A;  4DBH A;  1KT0 A;  4F16 A;  5ENR D;  1M8V A;  1ELK A;  1QYM A;  5HKP A;  4I43 A;  2QQR A;  1VQN A;  1QWE A;  4ZHB A;  4LDX A;  3OYM A;  3E30 A;  4CI0 C;  1N11 A;  2GRM A;  2DF6 A;  4JLG A;  1OYX A;  3L08 A;  4M77 B;  1TNU A;  1TUG B;  3NPF A;  1RAC B;  2DIW A;  5GAN 2;  3L6A A;  4HOS A;  2EJF A;  4GB9 A;  4RUG A;  1WI7 A;  4E6R A;  1OXJ A;  3A1P A;  4PJO A;  2L0T B;  5GMK i;  5HQ8 A;  3MCX A;  2RD1 A;  4I2W A;  3TWQ A;  3CPW S;  2E70 A;  2JEK A;  4AFS C;  1WAO 1;  2KAF A;  2OAW A;  2RHI A;  5I11 A;  1E8Z A;  2WMN A;  3ZN3 A;  2EBP A;  4E7S A;  1KQ2 A;  2HKQ B;  3EFR A;  5BW8 C;  3EH2 A;  1FXX A;  3QDR B;  4C8Q F;  2GRR B;  3BUA A;  1R0B G;  1BU1 A;  1UB4 A;  2DJQ A;  3TU4 K;  1N9A A;  2CFZ A;  4O60 A;  3ASG A;  5BXO A;  4M7A D;  3VS6 A;  3MET A;  1SZ9 A;  2DYS E;  2LAI A;  2J6K A;  3VRZ A;  3CXC A;  1VOM A;  1HG2 A;  1TNB A;  5LP0 A;  3LXU X;  1YJN T;  3SBT B;  3CC2 A;  5LJ3 d;  2OCC E;  3FJP A;  1JWF A;  5KYW B;  2QTV A;  2IO3 C;  4U63 A;  2XGO A;  5KYN A;  1ELR A;  3B7S A;  1D1A A;  3FTZ A;  2GW1 A;  4CT4 A;  1UGQ B;  2YDL A;  1D0Y A;  3RBB B;  4OMP A;  3E32 A;  5GAN d;  1NE8 A;  3OW2 P;  4H7Y A;  5CQX A;  2JTF A;  4JHK A;  4XI9 A;  3PZ2 A;  4GAA A;  2DZC A;  3AS4 A;  3OTN A;  2WXP A;  5KE2 A;  1JB0 E;  1G8X A;  3CVN A;  2PL2 A;  3JCM V;  4CRW A;  2KT1 A;  3M4Y A;  3L22 A;  5CIU A;  4F7A A;  2XRY A;  5A0L A;  4BDY A;  1JCR A;  3ULQ A;  4DX7 D;  1D3B A;  3FU3 A;  3BU8 A;  3E34 A;  1MNE A;  1YJ9 T;  2QZA A;  5BV1 A;  3VS5 A;  1IYG A;  4ZN3 A;  5AYW D;  2CSQ A;  2QQA A;  1V55 E;  3M0U A;  1KPS B;  3AG2 E;  1RAA B;  3TQ7 P;  4U7E B;  3OYD A;  3GZ1 A;  2D1X A;  1H6O A;  4LUN U;  2A4Z A;  1ZSZ B;  1X6B A;  3C0C A;  2WSF E;  1YJ9 Q;  1MND A;  1N27 A;  1E7O A;  4C8Q A;  3UAT A;  2FZK B;  2HQH A;  1S0P A;  3Q7A A;  1DC2 A;  3PEU B;  3UM1 A;  3RK6 A;  5E75 A;  1WA7 A;  2WXO A;  2R5S A;  3SBS A;  2V8I A;  3IEG A;  3APD A;  3ESL A;  2DZ9 A;  4LNB A;  5A23 A;  2Y4X A;  2WXQ A;  1KQS A;  1D9S A;  2VGN A;  3GNF B;  1Z9Z A;  3EHN A;  2KRM A;  4JEU A;  3OYA A;  1GRI A;  2DTI A;  3AU4 A;  3CCR T;  3ENE A;  1N8R C;  4L5G A;  2VQ2 A;  3I4R B;  3M54 A;  3CCV A;  4HOQ A;  3CCQ T;  1VQ7 A;  3H0H A;  3DLM A;  2XEH A;  2M0O A;  4II1 A;  2VXF A;  5C2Y A;  1YJW Q;  4HVW A;  2XMF A;  3GZ2 A;  2DBA A;  4CC2 A;  1M30 A;  3E2U A;  4HVV A;  2XHE A;  3ABK E;  4FT4 A;  3V30 A;  4AJW A;  4DPR A;  1OX8 A;  4K5B A;  2COW A;  1K8A U;  2VC8 A;  1OCZ E;  4OML A;  1K73 U;  2A28 A;  2OX7 A;  3UKR G;  2X3W D;  2CP7 A;  1BI2 A;  1LD7 A;  3HXC A;  4M7D F;  1KJW A;  2EQU A;  2K79 A;  2QGF B;  4GCO A;  2DL5 A;  5EID A;  2P9I G;  3Q15 A;  5GAN 8;  4FL6 A;  4M77 D;  3MEV A;  5D6X A;  2PVO B;  5CCM A;  1U1T A;  3ZYK A;  1BIA A;  5L8R E;  2D6F A;  3DXM G;  1W1F A;  4QW2 A;  4FYW B;  3L2W A;  2KEA A;  5LJ3 h;  3ULR B;  1MQS A;  1KIK A;  3CC4 T;  3FH8 A;  1OWM A;  1UGP B;  1PC0 A;  2O2O A;  2DEQ A;  4KBM B;  4KUI A;  5B3S E;  2XZT G;  3TWS A;  3CCE Q;  2I1J A;  1TNO A;  2DL8 A;  2RJC A;  2YSQ A;  3PNW C;  5GAN h;  4GTR A;  4CYM D;  3AS5 A;  1QVF A;  3E9F A;  5AN8 A;  1UN9 A;  2RK2 A;  3MO8 A;  4A1G A;  3QSU A;  1NM7 A;  4DI3 A;  3UIP C;  1JPL A;  4YDE A;  5FU7 C;  1A5E A;  1YWP A;  3RER A;  3QZ9 B;  2LC4 A;  4OMO A;  4Y6W A;  3M0P A;  4PS8 A;  2CUB A;  2YUO A;  3RIB A;  2RPN A;  4JA7 A;  2DNU A;  1UG3 A;  1YCS B;  3EGU A;  2CH4 A;  4M3O A;  4TXR A;  2IPO B;  2Y4U A;  3OXF A;  5CED B;  3MEW A;  2GRQ B;  3TWR A;  5KWD A;  3CVX A;  2E65 A;  2PNI A;  3FB9 A;  1D0Z A;  3APF A;  2Y1L E;  1Y8M A;  3CEY A;  1EX4 A;  2GNC A;  3QC1 A;  2DCP A;  3NOG D;  1OPK A;  4DUI A;  5CCL A;  3ZHE B;  3L9T A;  4BEP A;  3VS3 A;  3QWP A;  4M7D A;  4JHR A;  3TCJ A;  3O4Z A;  1K1Z A;  1IHW A;  3LX7 A;  4G8L A;  1AT1 B;  4J7I A;  2MIO A;  3Q4A B;  2XEN A;  2I2O A;  3PTA A;  3ONK A;  5HI7 A;  5FTP A;  5FLX E;  3CC7 A;  5FZR A;  1X6O A;  3O48 A;  3UT4 A;  1XNI A;  3JCK C;  2VKN A;  2JZ2 A;  4AMC A;  2YUN A;  2DIQ A;  2RH2 A;  3M53 A;  2NC9 A;  2KBT A;  1PD1 A;  1N0R A;  4OMQ A;  2K5L A;  2LT4 A;  2P0K A;  1WG0 A;  3X28 B;  2CHW A;  5FWQ A;  3QZ5 B;  4PLI A;  1YIJ Q;  3RKY A;  2QYJ A;  1M1K R;  2X3X D;  4W9R A;  5BV0 A;  3JCM Q;  2F69 A;  3Q75 A;  1G3N B;  5GAN 5;  5KJM A;  3OYC A;  4F3V A;  3CIA A;  2IQC A;  3QDN A;  4A54 A;  3L54 A;  4XE0 A;  4HT9 A;  3CR3 A;  3ISM C;  4JEH A;  1PSF A;  2P2C P;  2DAQ A;  5IHN A;  5LJ3 j;  2BTD A;  3C98 A;  1I8F A;  2JXB A;  2LQN A;  5FRN A;  3RSE G;  2JM9 A;  3MP8 A;  5JA4 D;  1KLX A;  4DX5 D;  1XJW B;  2ZGD A;  1VYT A;  5GAN j;  3DEO A;  2RJE A;  3UM0 A;  2CS7 A;  1AEY A;  2OVF A;  4LNG A;  3CGH A;  1U8R A;  1H0A A;  2EJ9 A;  1RAF B;  1VQ4 T;  4JHJ A;  4M7A E;  2RO0 A;  4J8E A;  4JJC A;  4V2S A;  2COZ A;  4OB2 B;  1Q86 R;  4ZN1 A;  4IUQ A;  4O1P A;  2JM8 A;  5J08 A;  4F1P A;  2XK0 A;  4LG6 A;  4R55 A;  3L17 A;  2HSP A;  4G26 A;  4M75 C;  3CVV A;  1JCS A;  2DYR E;  1VQN T;  2QGG A;  3JRZ A;  1Z3Y A;  2CT4 A;  2HAX A;  2DKG A;  3DSX A;  4C5H A;  3S7F A;  4GTS A;  2ZPF B;  4J9H A;  1UDL A;  4PJN A;  3PEV B;  4GMR A;  2E64 A;  4C92 C;  4FCY A;  4WNG A;  1C6V X;  1WHM A;  1ZQ1 A;  3NMZ C;  2R2L A;  1LD8 A;  1OWP A;  3LY7 A;  1EDU A;  1BBZ A;  1N8R U;  3H0F A;  4L23 A;  2VVK A;  2MF2 A;  1UFF A;  3MCA B;  4RQI A;  3OSS C;  3FTX A;  4TV3 A;  1UG1 A;  3R9A B;  3HRA A;  2XD0 A;  2KBX A;  2BE7 D;  1KC8 R;  2WSC E;  5KJN A;  1XGW A;  4N3C A;  5CBO A;  1N52 A;  2PM6 A;  3VS0 A;  5GAO r;  3JCM g;  4NUR A;  5HY6 A;  2UY1 A;  3CMA T;  2XHC A;  1A0N B;  2LCS A;  4TUU A;  4CRI A;  2ROL A;  1Y96 A;  1H92 A;  4CT0 A;  1HH8 A;  1XOV A;  2IVW A;  3JUI A;  2ZCF B;  1E7V A;  5KYX A;  1AP7 A;  3ZL7 C;  1YP5 A;  1VQM A;  2AHJ B;  1TH7 A;  2K6D A;  5FWB A;  1VYV A;  1VIF A;  4F7U E;  3OW2 A;  4DBR A;  3MZL B;  1EF1 C;  2LZ6 B;  1WJS A;  2XID A;  5CAI A;  5LJ5 j;  1R77 A;  4JD2 G;  3HL8 A;  4ACL A;  2FB7 A;  3OQ5 A;  1Q81 U;  2IFU A;  1YYH A;  1K9M C;  3CC2 T;  3REA B;  1M1K C;  4J8S A;  4ILG A;  2M0Y A;  4KBQ A;  3I55 Q;  3CQG B;  2BZX A;  3J81 E;  4PUC A;  3V31 A;  3ASK A;  1SKU B;  4M78 D;  3AJI A;  4J8D A;  2R58 A;  3HPW A;  4C0D C;  1OZ3 A;  3A98 A;  2IOL A;  5EDS A;  3S6W A;  2OEW A;  3WXM B;  1SA5 A;  4HRL A;  3FU0 A;  3CBO A;  4A4K A;  3CCS A;  1H2U A;  3D9L A;  4LRZ A;  3BDU A;  3ZEH A;  2HEQ A;  1R8O B;  2QI2 A;  1UGS B;  3IKO B;  1JBM A;  1WQ7 A;  3OYY A;  1YJN A;  4J6I A;  1WDX A;  1UOH A;  5EX3 A;  2VGE A;  4HCC A;  1I81 A;  4CEM A;  4Q5W A;  2Y0B G;  1OX9 A;  4BY6 B;  2XS1 A;  3KSQ A;  4FHJ A;  3HIZ A;  4FLH A;  1D09 B;  1W2B S;  3JSC A;  3KFV A;  1Q86 C;  4J8F A;  2V1Q A;  4G8K A;  4ANX A;  5FIN A;  4LXC A;  4RTY A;  2PU9 B;  2J09 A;  3CCM Q;  2VUB A;  3A8G B;  3QWX X;  3C95 A;  4M77 E;  2KCL A;  3U64 A;  4Y6C A;  1BI8 B;  2K2V A;  1BCM A;  2JJ9 A;  1T0J A;  1M5Q 1;  2EJG A;  2V8S E;  1HSQ A;  5ENN A;  4U8Y D;  4F1S A;  4K0R A;  1BI7 B;  1K8K G;  2WXR A;  2XRZ A;  2JAB A;  1MMN A;  3B7B A;  2FO7 A;  2L3R A;  4PJO B;  4JRQ A;  1SRL A;  2WM9 A;  1E96 B;  1RW2 A;  4ZNX A;  1U2V G;  1MUZ A;  3SB2 A;  4YDO A;  3FRN A;  4D8K A;  2KQW A;  3X26 B;  3PVL A;  2E4H A;  1JQQ A;  2KXC A;  4XAX B;  2BKG A;  2H8H A;  3CCV T;  5JJT A;  3IHY A;  1VQ7 T;  2H6I A;  3PE0 A;  4FU6 A;  1AD5 A;  5G2N A;  2GRL A;  2L8D A;  1HZ4 A;  3OS0 A;  3HRU A;  4LDU A;  3U66 A;  2DIG A;  2O4X A;  3UDC A;  1B89 A;  2B8A A;  1C1A A;  4EDU A;  2L6J A;  2VGM A;  2P0P A;  4ZFH A;  1Y7X A;  3CVY A;  1ZUU A;  3JB9 D;  3HXE A;  3CCJ A;  4AEZ C;  2CG2 A;  3QYH B;  4KUD K;  1VQ9 A;  1HK9 A;  5GAM e;  4KZC A;  3CK7 A;  3NTH A;  3ABM E;  1Q7Y R;  5CCA A;  5GMK e;  3X2Q E;  3C4S A;  5FRO A;  3TXN A;  1VIE A;  1TUC A;  1IQU A;  4ELZ C;  2RK1 A;  3OXG A;  2OAU A;  4ZGD B;  2K2M A;  5GAN f;  2YUP A;  4LER A;  5EX0 A;  3TEE A;  4DQ2 A;  3C5R A;  4GY5 A;  4BE0 A;  2EPD A;  2QA4 Q;  1Q82 R;  3U4T A;  1Y0M A;  3THK A;  2X4X A;  2H6G A;  3EG3 A;  3FDH A;  1OI1 A;  1YHQ T;  2FRW A;  3R6N A;  4N39 A;  1KD1 U;  3OXL A;  4KGV B;  4RTZ A;  2KZT A;  4M7D C;  3FH5 A;  4TVR A;  3FU6 A;  1D3B B;  2L0I A;  3D9O A;  3GPL A;  2QEX Q;  1YMP A;  1S72 T;  1GW6 A;  1F1B B;  2FBN A;  4QVC A;  3I5P A;  4I1O B;  2J7I A;  3LGL A;  5ARG A;  5GAN 4;  4KZ0 A;  5KNH D;  3PT9 A;  3A8O B;  3PDN A;  4WUY A;  2HR2 A;  4QVZ A;  2OTJ A;  2CT3 A;  2DPP B;  4JZ4 A;  2COY A;  3CC4 A;  4C8Q B;  2GRO B;  4TXQ A;  1HS6 A;  3CBM A;  3M55 A;  1LNX A;  1WGS A;  4G24 A;  4HI9 A;  4NQ0 A;  3VLF A;  2FEI A;  1OCO E;  5KBA A;  4HCK A;  2EIL E;  3OAW A;  1ZU2 A;  3PE4 A;  3EFS A;  4L6V 5;  2FPE A;  2YHC A;  5LJ3 g;  1NA0 A;  4YVQ C;  1YI2 Q;  3UQ3 A;  4RG8 A;  5FU6 C;  5GAN 6;  1QW1 A;  2CYZ B;  4U95 D;  2E3I A;  4PFZ A;  4A53 A;  5GAN g;  3C3O A;  4FP7 A;  4M7A G;  1SSH A;  2HO1 A;  4ME2 A;  2WVI A;  1YN8 A;  1Z6T A;  3OYH A;  4DI4 A;  5D6Y A;  1TYQ G;  2OND A;  5GAN 7;  2XGM A;  1U3O A;  2M63 A;  3PNL B;  2RKK A;  2D8H A;  2LT1 A;  3MEU A;  3CC7 T;  1N54 A;  2JUF A;  4I1M A;  4E7L A;  4U0Z A;  4O6F A;  2QG9 B;  3HXB A;  4DLQ A;  1K76 A;  5LJ5 f;  2LRQ A;  4P29 A;  4GCN A;  4JL0 A;  5IN1 A;  2AXV A;  4BWR A;  2FHD A;  4LCT A;  3CPW P;  4ABN A;  1K9M U;  4HVB A;  4RLY A;  5BXU A;  4FIB A;  4G23 A;  2AJA A;  4FU3 A;  3ZXP A;  5KH6 A;  3ULY A;  3G2U A;  1Q7Y C;  4X8Q A;  2V8K A;  3MJW A;  2D0Q B;  3LEW A;  4GLK A;  2V0P A;  2ZXW E;  3A8L B;  4XTV A;  1NJI U;  4GYY A;  1DCQ A;  1M3A A;  4JUV A;  2J4B A;  4J8O A;  2ZAE A;  2WB2 A;  1WHJ A;  3ZVV A;  3SWN C;  2DIL A;  3HKS A;  2LQK A;  3JB9 I;  3D9K A;  3MKQ A;  4PJO D;  2KRO A;  3CCU T;  5J39 A;  3EIQ C;  4FW1 A;  1WHK A;  1MX2 A;  1HD3 A;  1PSE A;  1KSW A;  1OU8 A;  3MX3 A;  1PKS A;  1SHF A;  3H6Z A;  4UWF A;  2MAM A;  3G1J A;  4E6H A;  3ZIM A;  2L3P A;  4M75 F;  4YDY A;  2CP0 A;  1D8E A;  1JUQ A;  3DWL G;  1Z5S C;  4XTZ A;  4OGE A;  3S7B A;  2QY7 A;  2EIF A;  1W3B A;  4F7U G;  4M78 E;  4QKU A;  3KUF A;  3PUJ A;  5JMN D;  4HVU A;  2XI9 A;  3LKU A;  5LJ5 g;  1VQ6 T;  4DBF A;  2FZG B;  3MPU B;  3CLJ A;  1N6A A;  5G04 C;  4UWG A;  3FUJ A;  2WXJ A;  3NQP A;  3E9G A;  1KZO A;  3LVR E;  4ILI A;  3SFM A;  1BU9 A;  2F2X A;  2CP3 A;  3ZYM A;  4BB7 A;  5KYY B;  3CSF A;  1RLP C;  2D9T A;  3LDZ A;  1OUL A;  5IAY A;  5D0Q D;  2C0T A;  4R7L A;  1FMV A;  2ATC B;  2LAH A;  1RAI B;  3EG1 A;  1JCQ A;  5CKH A;  4DX1 A;  5A2Q E;  1WYX A;  3R6O A;  1KFZ A;  3UM3 A;  5IT9 E;  1X01 A;  1HJD A;  2A5E A;  2X6J A;  4N4I A;  2IIM A;  1E8Y A;  2LDM A;  3DSV A;  4XTU A;  2XS8 A;  3HDX A;  2JN0 A;  2ZZD A;  3EUV A;  3PVQ A;  4HRM B;  1E6G A;  2DL3 A;  1RI0 A;  3EFO A;  5I22 A;  4Z88 A;  2RM4 A;  1VQM T;  3V2X A;  4PL6 A;  1S1N A;  3MKD A;  1K4U S;  3VS1 A;  4FSX A;  2V4L A;  3RNJ A;  2V8J A;  4FJY A;  3BE3 A;  2CFU A;  2P9K G;  4M77 G;  1OWL A;  3EHQ A;  2A08 A;  2MWO A;  1KG1 A;  4EHM A;  1M3C A;  3UIO C;  3I35 A;  4DBQ A;  1GXI E;  1E6H A;  2A7Y A;  3HYM B;  1VQ8 A;  1OWN A;  4M75 A;  2WSE E;  4C8Q D;  3CMA A;  4O1O A;  5I21 A;  4B0Z A;  1TG0 A;  4KT6 B;  1W6X A;  3H41 A;  4GTP A;  5FU6 B;  2WAC A;  3T5V A;  3R7Q A;  4GU5 A;  4GZ6 A;  1M27 C;  2HQE A;  1L5J A;  4PH4 B;  3KXT A;  2Y4T A;  2PUK B;  2I6H A;  4EMH A;  3CCS T;  1GCQ A;  2QDL A;  4FAD A;  1Q95 G;  3M59 A;  4FSS A;  4J6Y A;  3LWH A;  4LEU A;  3G2W A;  4C92 A;  1OUV A;  2DBK A;  4EMK B;  2RJD A;  5HK3 A;  2OV8 A;  5C1D A;  3CHR A;  1K3Z D;  4HXI A;  2O88 A;  4OAU C;  2DYI A;  2DRM A;  3ZYQ A;  1KT1 A;  4HRN A;  2GFA A;  2FEZ A;  5KYU A;  3CCS Q;  2WQ6 A;  4F6R D;  4ME7 A;  3CVL A;  1X43 A;  4BD3 A;  4ZTF A;  1QVG S;  3OYI A;  5I2M A;  4NAC A;  2YHE A; 
#chains in the Genus database with same CATH homology
 1OT8 A;  5ENO D;  4DUI A;  5EN5 D;  4BEP A;  2I0N A;  3VS3 A;  1G83 A;  4J7W A;  1WLP B;  1JEG A;  1K1Z A;  2J6F A;  1ZUK A;  2ETA A;  4G8L A;  3V79 K;  3W9G A;  2MIO A;  2XEN A;  2DL7 A;  2J8S D;  4RTV A;  1H3H A;  2VKN A;  2LQW A;  3CQT A;  2RFA A;  2XZD G;  2DVJ A;  1GBR A;  1PKT A;  5L23 A;  1AWC B;  2YUN A;  3M0R A;  1YWO A;  3UF4 A;  4CZ2 D;  2KBT A;  4OMM A;  1N0R A;  4OMQ A;  2JT4 A;  2GTJ A;  1WXT A;  1WG0 A;  5CBN A;  1NG2 A;  3TSZ A;  1GBQ A;  1PHT A;  4DX6 D;  2DZO A;  1T3L A;  5CEC B;  2CUD A;  2FG0 A;  4K5A B;  2QYJ A;  1QWF A;  2X3X D;  4BES A;  1G3N B;  1AOJ A;  2DWZ A;  2B0O E;  2W10 A;  5GJV B;  2P2C P;  1UJ0 A;  1SW6 A;  5IHN A;  2C0O A;  2LQN A;  1BLX B;  2HCK A;  2CH4 W;  2JXB A;  3GBQ A;  4J9B A;  1K1B A;  3NOC D;  2JM9 A;  5EYP F;  3M0S A;  5JA4 D;  2EKH A;  2F2W A;  2KGT A;  2J6O A;  4JB8 P;  2ETB A;  4DX5 D;  1JXO A;  2DZN A;  2ZGD A;  1VYT A;  2G6F X;  3DEO A;  5IXF A;  1AEY A;  4KRT A;  4LUE A;  5CER B;  2E5K A;  5IH2 A;  3SO8 A;  5ENQ D;  4JJD A;  4RTT A;  4JJC A;  3TWT A;  2DL4 A;  4N5Q A;  4QFV A;  3I5R A;  3J5P A;  4Z68 A;  5CEA A;  4B93 B;  4AG1 C;  2F37 A;  4O1P A;  2O31 A;  1JO8 A;  1NYG A;  4F1P A;  2JM8 A;  4J9G A;  4LUD A;  1ABO A;  4LG6 A;  2HSP A;  2EYW A;  1WFW A;  3JXJ A;  3REB B;  1SPK A;  2JW4 A;  4LE9 A;  3T9K A;  2XEE A;  1NYF A;  1B3Q A;  2CT4 A;  3TWW A;  1GL5 A;  1SRM A;  2ROT A;  4M4Z A;  4BER A;  1BK2 A;  4J9H A;  4R0K A;  1UDL A;  4GMR A;  4ESR A;  3JV3 A;  2KYB A;  1K0S A;  4NIK A;  2RMO A;  3NMZ C;  3ZUV B;  1T0H A;  1OPL A;  2YT6 A;  1BBZ A;  1WXU A;  2D0N A;  3H0F A;  2FO0 A;  4RTW A;  5ENS D;  2VVK A;  1UFF A;  1PNJ A;  4A63 B;  1T3S A;  1UG1 A;  4K5C A;  4GBQ A;  1OOT A;  3I5S A;  3HRA A;  5AQB A;  2KBX A;  1IXV A;  2LX7 A;  4F17 A;  1I1J A;  5CBO A;  3VS0 A;  2DYB A;  5AAR A;  1QLY A;  5AQ7 A;  3NBN B;  4QQI A;  1MJ0 A;  2DA9 A;  3LH5 A;  1ABQ A;  2LCS A;  1A0N B;  2ROL A;  1H92 A;  1XOV A;  1AP7 A;  3ZL7 C;  1YP5 A;  1TR4 A;  4HNA D;  5AAO A;  2K6D A;  5FWB A;  1VYV A;  2NWM A;  3TWV A;  2AKK A;  1GCP A;  2EGE A;  5ITZ F;  2EW3 A;  2LZ6 B;  2O9S A;  1UTI A;  3H0I A;  3SEM A;  1MX4 A;  1YNZ A;  4JJB A;  1YYH A;  3HG0 D;  1SHG A;  3REA B;  2MYO A;  2DMO A;  2M0Y A;  4UUC A;  2KXD A;  2BZX A;  4JZ3 A;  4ORZ A;  3V31 A;  2MOX A;  3AJI A;  4DX2 A;  4RTX A;  1Y57 A;  3A98 A;  1B07 A;  1UJY A;  4HRL A;  2EQI A;  1X2K A;  3VS4 A;  2HEQ A;  2KR3 A;  4ATZ D;  2RN8 A;  3QWY A;  5HS0 A;  3ZKJ A;  2HBW A;  1WDX A;  3NGP A;  1UOH A;  4J9E A;  2VGE A;  3D9H A;  5FW9 A;  3V2O A;  2ED0 A;  4C48 B;  1QKW A;  2FO1 E;  2Y0B G;  2FRY A;  2LJ1 A;  1X69 A;  4J9C A;  1WXB A;  3TVT A;  3U23 A;  5IHI A;  4BET A;  3KFV A;  1WIE A;  2DBM A;  2VWF A;  2V1Q A;  4G8K A;  5FIN A;  1QKX A;  1BD8 A;  1OEB A;  1UEC A;  2KYM A;  1ZUY A;  2LNH B;  4RTY A;  3M0Q A;  4BSZ B;  2A36 A;  2KE9 A;  3QWX X;  3UA6 A;  4LN2 A;  2DRK A;  2YUQ A;  4Y92 A;  4AG2 C;  1BI8 B;  1IHB A;  3EG0 A;  2CSI A;  3VS7 A;  4HB5 A;  2L6B A;  1T0J A;  2AK5 A;  5HCK A;  2LJ3 A;  3UA7 A;  1J3T A;  1HSQ A;  1G2B A;  2DM1 A;  2KXP C;  4U8Y D;  1BI7 B;  3EG2 A;  5EIL A;  1U06 A;  3FJ5 A;  3VRY A;  1SVX A;  2JAB A;  3B7B A;  1U5S A;  5EYL A;  1AWJ A;  1SRL A;  2DX1 A;  1GFC A;  1AWX A;  2L3Q A;  2BTT A;  4ZNX A;  4D8D A;  1V1C A;  1MUZ A;  3JUE A;  1UUE A;  2RQR A;  4AFQ C;  1I07 A;  5FWC A;  4D8K A;  4WCI A;  3PVL A;  1TUD A;  1K0X A;  1VA7 A;  3W9F A;  1JQQ A;  2KXC A;  2BKG A;  1PRM C;  2H8H A;  3PE0 A;  1AD5 A;  2EYY A;  4HQD A;  1MYO A;  1NLP C;  3I9Q A;  1I0C A;  2JTE A;  4EIK A;  2O9V A;  2JS2 A;  2KRN A;  1IKN D;  2AZS A;  1K1A A;  2F8Y A;  2KRS A;  1UHC A;  4AFZ C;  4TUM A;  4ZFH A;  4HI8 A;  2B86 A;  1ZUU A;  1RUW A;  2SRC A;  1AWO A;  1LCK A;  5HRY A;  1X2Q A;  1NFI E;  2PZ1 A;  3T8K A;  1CKA A;  1WDY A;  2D8J A;  3LJN A;  2J06 A;  2RQT A;  4K11 A;  1OY3 D;  3EU9 A;  1RI9 A;  4F14 A;  3TSW A;  1TUC A;  1GCQ C;  1NEG A;  4J9D A;  4LNU D;  2EYZ A;  4J9I A;  2FPF A;  2K2M A;  3AAA C;  1X6G A;  2YUP A;  2JMA A;  3Q9U C;  3C5R A;  4OAV B;  2BZY A;  2EPD A;  2EYX A;  2HE0 A;  2GGR A;  1W70 A;  1ZLM A;  1H8K A;  4F16 A;  5ENR D;  1Y0M A;  3THK A;  1QYM A;  5HKP A;  1CKB A;  3EG3 A;  2K7A A;  1QWE A;  4ZHB A;  2FRW A;  3R6N A;  1EFN A;  3TWX A;  1N11 A;  4RTZ A;  2DF6 A;  2DVW A;  4AFU C;  3NPF A;  1AVZ C;  1UE9 A;  1YMP A;  1UGV A;  1M8M A;  5EIB E;  4RUG A;  1WI7 A;  4E6R A;  2J7I A;  4GLM A;  2EVR A;  5KNH D;  1N5Z A;  5AQ9 A;  3B95 A;  3TWQ A;  2LP5 A;  4AFS C;  2NYJ A;  2CT3 A;  4JZ4 A;  5FIO A;  4DRX E;  3JXI A;  4U8V D;  2KT8 A;  2OAW A;  4HBD A;  5I11 A;  3Q9N C;  2EBP A;  1K9A A;  1RLQ C;  2SEM A;  4HI9 A;  2M51 A;  2FEI A;  2V5Q C;  5KBA A;  4HCK A;  2LMJ A;  2RNA A;  4LNP A;  1BU1 A;  2DJQ A;  1PRL C;  2V4H C;  2FPE A;  4O60 A;  5BXO A;  3VS6 A;  2J6K A;  2AZV A;  2JS0 A;  2W0Z A;  1CSK A;  3VRZ A;  3UTM A;  4U95 D;  2OJ2 A;  1SSH A;  1YN8 A;  4OMN A;  1N0Q A;  2D8H A;  1U3O A;  1ZX6 A;  5D66 A;  2YDL A;  3RBB B;  2ZGG A;  4LSZ E;  4J9F A;  4U96 D;  4IIO A;  3NHN A;  4OMP A;  1K76 A;  2K3B A;  2LJ0 A;  2RQU A;  2ESW A;  1SEM A;  4DEX A;  2GBQ A;  1QCF A;  2KT1 A;  2ECZ A;  4RLY A;  5BXU A;  2AJA A;  5IXB A;  4DX7 D;  2RFM A;  3IQL A;  3VS5 A;  2PTK A;  2CSQ A;  2OI3 A;  2A37 A;  3M0U A;  4RTU A;  2ETC A;  1DCQ A;  1M3A A;  2KNB B;  2D1X A;  1MV3 A;  3EHR A;  1X6B A;  2V1R A;  3C0C A;  5EC7 A;  2PNN A;  1BB9 A;  2DIL A;  3O5Z A;  1E7O A;  2EGA A;  3UXG A;  1JU5 C;  3UAT A;  2KRO A;  1DC2 A;  5KNG A;  2F8X K;  4J8Y A;  2P4R A;  1MX2 A;  1WA7 A;  5GJW B;  1GFD A;  1HD3 A;  2CDT A;  1KSW A;  1S70 B;  1UHF A;  3M0T A;  4CC4 B;  1PKS A;  1SHF A;  5IHK A;  1OV3 A;  2L3P A;  4YDY A;  1D9S A;  2GTO A;  1Z9Z A;  2KRM A;  1GRI A;  1M3B A;  4Z8A A;  1VYU A;  4Z89 A;  1JXM A;  5JMN D;  4HVU A;  1PWT A;  3H0H A;  2XEH A;  4X1V A;  2J05 A;  4HVW A;  4QT7 A;  2ABL A;  2XMF A;  3DEP A;  1BU9 A;  4CC2 A;  2F2X A;  1M30 A;  4HVV A;  1IO6 A;  2L3S A;  3V30 A;  4K5B A;  1RLP C;  1Z9Q A;  4OML A;  2A28 A;  3KEA A;  3J5Q B;  4DEY A;  2X3W D;  2C0T A;  5AQA A;  3F6Q A;  2NUZ A;  3EG1 A;  2BKK B;  5ENT D;  4DX1 A;  1WYX A;  1KFZ A;  1KJW A;  2K79 A;  2DL5 A;  1HJD A;  2A5E A;  5EID A;  4GPM A;  2ED1 A;  1ARK A;  2IIM A;  2RQV A;  3PVQ A;  4HRM B;  1E6G A;  2BZ8 A;  2DL3 A;  2L2P A;  3SHW A;  2CRE A;  4CC7 A;  5I22 A;  4Z88 A;  3V2X A;  1W1F A;  1S1N A;  1K4U S;  1NEB A;  3VS1 A;  2F2V A;  3RNJ A;  3VS2 A;  1NLO C;  2KEA A;  3ULR B;  2MCN A;  1KIK A;  3EHQ A;  2A08 A;  1M3C A;  4CC3 A;  2O2O A;  3I35 A;  2XZT G;  3TWS A;  4HLL A;  1FYN A;  3TWU A;  2DL8 A;  1E6H A;  2YSQ A;  2JMC A;  2FPD A;  4CYM D;  2K9G A;  4O1O A;  1FMK A;  1MX6 A;  5AN8 A;  1TG0 A;  1NM7 A;  1W6X A;  3H41 A;  1AWW A;  1A5E A;  1YWP A;  2EGC A;  1M27 C;  4OMO A;  1AZE A;  2C0I A;  3M0P A;  2CUB A;  1GCQ A;  2QDL A;  2ENM A;  4FSS A;  1X27 A;  2YUO A;  2RPN A;  2DNU A;  1YCS B;  2DBK A;  3EGU A;  1ZBJ A;  2CH4 A;  2RF0 A;  4IIM A;  4HXJ A;  3IXE A;  2AKL A;  1MV0 B;  1K3Z D;  5CED B;  3TWR A;  2GQI A;  4JPB W;  5ENP D;  2L0A A;  2DE0 X;  5KWD A;  2O88 A;  4OAU C;  4YDW A;  1ZSG A;  1WX6 A;  3ZU7 B;  2DRM A;  2PNI A;  3UI2 A;  3ZNG A;  5ECA A;  2Y1L E;  4HRN A;  2DLP A;  2QC9 A;  2GNC A;  4F6R D;  1X43 A;  2RQW A;  1AZG B;  2HDA A;  3NOG D;  1OPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...