1YCSB

P53-53bp2 complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
193
structure length
193
Chain Sequence
b'PLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGITALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAVFAMTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYEPQNDDELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords P53
publication title Structure of the p53 tumor suppressor bound to the ankyrin and SH3 domains of 53BP2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (anti-oncogene/ankyrin repeats)
total genus 46
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 1996-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00018 SH3_1 SH3 domain
B PF00023 Ank Ankyrin repeat
B PF13606 Ank_3 Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1ycsB01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ycsB02
5HRYA 1K1BA 4J7WA 1PRMC 2BZYA 2YUOA 1X2QA 2GGRA 2LX7A 2C0TA 2DBMA 1PKSA 2L3QA 2P4RA 5HKPA 2A5EA 5JA4D 1OEBA 2LCSA 2MOXA 1OY3D 2BZ8A 1JQQA 4J9EA 5AQ7A 4HRLA 2HEQA 2HBWA 5CEAA 1QCFA 1AWJA 3HG0D 1OPKA 5IXBA 1B3QA 1YN8A 2K9GA 2KE9A 3D9HA 3JV3A 4NIKA 3M0PA 1NYFA 1QYMA 3UF4A 4Z89A 2OAWA 2B0OE 1N0RA 5AQ9A 1PWTA 4E6RA 3F6QA 1W6XA 5ENTD 4CC2A 1QKXA 4DX5D 2CH4A 1K0XA 1MX2A 1UE9A 1VYUA 4KRTA 1T3LA 4JB8P 1N5ZA 1XOVA 2FG0A 2FO0A 2XMFA 3Q9NC 2KYMA 2KYBA 3IQLA 4QT7A 3V2XA 2RFMA 5EIDA 2CH4W 1ZBJA 2CSQA 4Z8AA 1GCQA 2DMOA 2QC9A 4U96D 3TSWA 2P2CP 5HCKA 4HI9A 4TUMA 1NLOC 2RMOA 1KSWA 3AAAC 1QLYA 2F2WA 2J06A 1BU1A 4HXJA 2AK5A 4RTXA 5FIOA 4RUGA 1WXUA 1G2BA 5ECAA 1H92A 5AQAA 1IHBA 2KXCA 3I35A 1ZUKA 2X3XD 2EPDA 4J9GA 1UHFA 3M0UA 1GCQC 3UA7A 4HVVA 1U5SA 3VS1A 5FWCA 1SVXA 1WYXA 1M3BA 2M51A 2LJ3A 3H0FA 1UJYA 1A5EA 3TWWA 1SHGA 4OMNA 4CC4B 1H8KA 2GTJA 2DNUA 4HVUA 1TR4A 3DEOA 3NHNA 4JJBA 2NWMA 1K0SA 2V4HC 4BEPA 3SHWA 1SHFA 3TWVA 3M0SA 4K5AB 5EN5D 2HDAA 5CBOA 4LE9A 3THKA 1NEBA 2LZ6B 4CYMD 5ENOD 5HS0A 2RNAA 3EHQA 4RTYA 1GBQA 1VYVA 4BSZB 1VYTA 3REAB 3NMZC 1WX6A 3KEAA 5KBAA 4DUIA 1TG0A 1WDXA 1IXVA 3QWYA 4UUCA 3TSZA 2BKGA 3NOCD 1PKTA 4F1PA 1NLPC 2YUQA 4X1VA 1RI9A 3TVTA 2SEMA 2ROLA 1GRIA 2DA9A 4HLLA 3VRZA 1TUCA 1ZUYA 2DM1A 4DX7D 4ESRA 1YWOA 5ITZF 3EU9A 1WI7A 3AJIA 5AN8A 2ETAA 5EC7A 3UI2A 4IIMA 2L6BA 3ZKJA 2JXBA 2RQTA 2DRMA 4J9HA 2PNIA 4HCKA 1WDYA 1BBZA 4ATZD 2FO1E 1X2KA 4LUDA 2D8JA 1K4US 2DYBA 1ZX6A 2KT1A 2DLPA 3T8KA 4DX1A 2EGAA 4F16A 2D1XA 2NUZA 4F14A 2DVJA 3B7BA 5EYPF 2AJAA 1HD3A 1Y57A 4BERA 3TWTA 1NM7A 3I9QA 1AP7A 2KROA 1NFIE 3TWXA 2J6KA 3TWSA 3NGPA 4M4ZA 3EGUA 3VS3A 2MIOA 2OJ2A 2DRKA 1OV3A 2ABLA 4IIOA 4QQIA 2EGCA 4D8DA 2JS0A 2Y0BG 2K6DA 3HRAA 2YUNA 1ZLMA 1JXMA 1UFFA 2FRWA 3NBNB 4O1PA 3LJNA 2CT4A 1I07A 1AEYA 2DE0X 2CT3A 1ZUUA 1QWEA 1MV3A 2GQIA 1V1CA 2FPDA 2F37A 1WFWA 2CSIA 1TUDA 4G8LA 2GNCA 5FWBA 3NPFA 5ENRD 4AG2C 3C5RA 3T9KA 2GBQA 3CQTA 2Y1LE 4CC7A 1HSQA 1YNZA 2J8SD 2J05A 1IO6A 2V5QC 4ORZA 1CKAA 4Z88A 4OAVB 2DL4A 1UJ0A 2DL7A 1NEGA 1M27C 1PHTA 2XEEA 1E7OA 2FRYA 2V1RA 5AQBA 2J6FA 4WCIA 5L23A 3ZNGA 3UXGA 1X6GA 2BKKB 3JUEA 2V1QA 3V79K 1GCPA 1GFDA 2DL3A 4DX2A 2CREA 2ESWA 3DEPA 3ZUVB 1E6GA 1K76A 1ARKA 2BZXA 2EYYA 2L2PA 3M0QA 1MYOA 4O60A 4YDYA 1FYNA 4ZNXA 3PVLA 1UUEA 2K7AA 4K5CA 1U06A 2LP5A 2A28A 1KIKA 4B93B 2SRCA 4R0KA 1JEGA 1A0NB 1AZEA 4RLYA 1S70B 2C0IA 1U3OA 1CSKA 5JMND 1KFZA 4AFQC 2O2OA 2JM8A 5IHIA 2ETCA 2XZDG 2O31A 2YDLA 1JO8A 4LG6A 2EVRA 2HSPA 1MV0B 4OMMA 2LJ0A 2W0ZA 4QFVA 1PNJA 4RTUA 3VS4A 4HB5A 4DRXE 5CEDB 4RTTA 1M30A 1I0CA 2KXDA 2JABA 4HNAD 3C0CA 3H0HA 2EYWA 1UG1A 3TWUA 4ZHBA 2F2XA 2A37A 4J9FA 3EG3A 1T0HA 3EHRA 2RQWA 1H3HA 2XEHA 2D0NA 4N5QA 3GBQA 4F6RD 1CKBA 4D8KA 1AOJA 2ROTA 2D8HA 1MJ0A 4FSSA 4BESA 5IXFA 3FJ5A 1AWWA 3ULRB 1AD5A 3H0IA 2DVWA 2AZVA 3EG1A 2FPFA 2RQRA 5KWDA 4LNPA 1X69A 2KT8A 4Y92A 4AFUC 2XZTG 1MX4A 5CBNA 3V31A 4GPMA 4J9DA 1K1ZA 2B86A 4J9BA 4K11A 1GBRA 2J6OA 1Z9ZA 5I11A 4OMQA 4CC3A 2RPNA 4ZFHA 2KRMA 1RLQC 2RQUA 4RTWA 2JMCA 1AWXA 1JXOA 2JS2A 2DL8A 1K1AA 2ETBA 3W9FA 3R6NA 1GFCA 1UTIA 4JJCA 2KXPC 3UATA 1QKWA 1X6BA 3IXEA 2CUDA 5IH2A 5AAOA 2HCKA 2X3WD 2F8XK 3JXIA 4HVWA 1X27A 2KR3A 4RTZA 2KGTA 3PE0A 1GL5A 2O9SA 1SW6A 2E5KA 3H41A 2RF0A 2O9VA 1AVZC 2FPEA 1SRMA 3KFVA 2ENMA 4HRNA 1LCKA 3I5RA 3VS5A 1ABQA 2EGEA 1ABOA 3RBBB 2IIMA 2K3BA 2KRNA 1BI8B 5EILA 2DF6A 1N0QA 1M3CA 2QYJA 2ZGDA 2J7IA 2YT6A 2JT4A 1K3ZD 2ED0A 2JTEA 2YSQA 2YUPA 4AG1C 1BK2A 2EBPA 3ZU7B 2CUBA 1UOHA 1N11A 5BXUA 5CECB 3EG0A 1VA7A 4DEYA 3VS7A 1PRLC 4OAUC 3PVQA 2KEAA 1I1JA 4BETA 4JJDA 2W10A 3UTMA 1JU5C 2ECZA 1DCQA 1M8MA 1YYHA 1G83A 4LUEA 1YMPA 2L3PA 4J9CA 4DEXA 1X43A 4JPBW 4LN2A 1OOTA 2BTTA 4U95D 1DC2A 2MYOA 4U8VD 3TWRA 1E6HA 3REBB 2PZ1A 1BD8A 2PNNA 2JW4A 1WLPB 4K5BA 1AWCB 2C0OA 1BI7B 2AZSA 1BU9A 1MUZA 4EIKA 5ENPD 2G6FX 2LQWA 3VS2A 2MCNA 1YP5A 4HBDA 1FMKA 4OMLA 1RUWA 3ZL7C 2EYXA 5CERB 2VKNA 1B07A 2VWFA 2EKHA 1HJDA 4C48B 2AKLA 1YWPA 4YDWA 1WG0A 3U23A 4JZ4A 3V2OA 5AARA 1J3TA 5BXOA 2DL5A 4GBQA 4J8YA 2AKKA 5FINA 5IHKA 2DZNA 2DILA 2KNBB 1SRLA 4AFSC 1UGVA 3VS6A 2CDTA 2VVKA 3QWXX 4HQDA 3V30A 2RFAA 1QWFA 2LMJA 4Z68A 1UDLA 3B95A 3UA6A 2KBXA 1W70A 2I0NA 2KBTA 5D66A 3VS0A 2O88A 1SSHA 2LNHB 5GJVB 4O1OA 1OT8A 2F8YA 4HRMB 1SPKA 4OMPA 3A98A 4GLMA 2A08A 4A63B 2DZOA 2RQVA 1Y0MA 3RNJA 3SEMA 2HE0A 2NYJA 2QDLA 1IKND 1YCSB 2ED1A 1NG2A 2EQIA 1EFNA 4G8KA 1WIEA 2EYZA 2FEIA 3M0TA 1SEMA 4LSZE 1D9SA 5ENQD 2A36A 2DBKA 5KNGA 4HI8A 1WA7A 2LJ1A 1WXBA 1ZSGA 2DX1A 3I5SA 1WXTA 4LNUD 4U8YD 1G3NB 1KJWA 3J5PA 3NOGD 1S1NA 2GTOA 2K79A 1UECA 3M0RA 1RLPC 3LH5A 4AFZC 1T0JA 3VRYA 1T3SA 2H8HA 2PTKA 1M3AA 5IHNA 5GJWB 2RN8A 2JMAA 3TWQA 2L0AA 2L3SA 1K9AA 2ZGGA 4CZ2D 1AZGB 4RTVA 1Z9QA 3JXJA 2F2VA 5EIBE 5I22A 1BB9A 2VGEA 1UHCA 2LQNA 4J9IA 1AWOA 5ENSD 4DX6D 5KNHD 4JZ3A 3Q9UC 3J5QB 4OMOA 3W9GA 2EW3A 4F17A 1NYGA 3SO8A 2DWZA 2M0YA 4GMRA 1BLXB 2OI3A 1MX6A 2DJQA 2JM9A 1OPLA 5FW9A 2KRSA 5EYLA 3O5ZA 1W1FA 3EG2A 2K2MA 2XENA
chains in the Genus database with same CATH superfamily
5D0OD 2EFIA 3LWIA 1QVFP 1R77A 3UT4A 4OF1A 2V0PA 2YUOA 1N8RU 5G04C 3LJ3A 1RAEB 4EMHA 2V8SE 2Y4UA 1KHCA 2DBMA 2D0QB 5BW8C 4WUYA 2L3QA 3LYIA 1TH7A 3X25B 4EQFA 5HKPA 3ZHEB 4GB9A 4IUVA 2RHYA 1N4PA 2WM9A 2LCSA 3DSTA 2OOEA 3I56Q 4JA9A 5DIZA 3TAXA 1KD1C 2BZ8A 1C1AA 5AQ7A 1QVPA 2HEQA 3OYIA 1AWJA 1G3TA 2OEWA 1WQ7A 2GRPB 2XCCA 3J81E 4DOVA 1YN8A 3NZSA 4IKFA 2RK2A 5BNWA 1QYMA 3CVXA 5C6SA 5LJ5h 1P92A 2RI5A 4M7DA 4NL3A 3ONKA 2RJEA 5AQ9A 4JHKA 1VQOQ 3TL5A 1W6XA 3UPUA 3HTRA 4N2SA 2CH4A 1UE9A 3NB2A 1I8FA 1T3LA 4JB8P 4WWNA 1N5ZA 1XOVA 3AU4A 2XMFA 3Q9NC 5GAMf 3IQLA 3V2XA 4QVCA 2RFMA 3E4BA 3CCQA 5D2MC 5L8RE 4A4GA 2KCVA 1GCQA 5FROA 1VQ9A 2RO0A 1RI0A 3WVDB 1PD0A 2RMOA 3E2UA 4IULA 4HXJA 4QQGA 1D09B 5FIOA 2CG3A 1SG5A 2V26A 4F04B 1WXUA 1G2BA 3E1SA 2XPZA 1H92A 3HXFA 4ELZC 2EIKE 3C3RA 1B34A 2AXVA 2F5KA 4BE1A 4J83A 1X81A 3NZUA 3RU0A 2MMPA 2ATCB 1GCQC 4Q69A 2ZCFB 1U5SA 3M0UA 4I6GA 5ARFA 2FZKB 5AJLA 5FWCA 2LCCA 1YFNA 2EIJE 1SHGA 3AG4E 1Z5SC 3L2WA 3SDZA 2RK1A 1VQ4A 3FH7A 1Q82C 3BUAA 2ZZDA 3UIPC 3JB9G 1JJ2P 1JWGA 1VQKQ 2HDAA 1MHNA 5GAOq 3P8BB 3ZXSA 3X2QE 2LT4A 4WF2A 5LJ3d 2FI7A 4EMGA 1VYTA 1B34B 5AJDA 3REAB 3NMZC 4JVSA 1W2BA 1KT1A 2HMAA 3CC4T 4OP0A 5T8IA 3MP8A 5KBAA 1IXVA 3EU5A 3ULQA 3RDVA 2QASA 2YUQA 4X1VA 1U8RA 3FULA 4FT2A 1GRIA 4APOA 1ZUYA 2DM1A 4EHMA 4DX7D 4ESRA 2VSYA 1UW4B 2WXFA 5JHAA 4G1TA 3TREA 3ZXPA 3VUZA 5EC7A 3KEZA 4IIMA 3PZ1A 3H8ZA 2FVUA 2L6BA 1G8XA 2JXBA 3Q1JA 2DRMA 1VQ7Q 1KZPA 3BDUA 4IN3B 3CCUA 5A23A 4HCKA 5KJLA 4ATZD 1K4US 2D8JA 2RG8A 4TXPA 2QEXQ 5AIJA 4ZTJA 2WVIA 3LVQE 1NZNA 2PQNA 4URKA 4DX1A 1GW6A 2NUZA 1NA3A 2LAIA 1D1AA 2CKKA 1WNLA 2DVJA 2QTXA 1WHLA 4BERA 3TWTA 3VU3C 2V5FA 3JCMJ 2KROA 4ABNA 3JYSA 4A4EA 1SSFA 2JTFA 4KVMA 1N6AA 5H7PA 3X24B 4KVOA 3NGPA 3RR6A 1Q86C 3KSLA 2MIOA 1I81A 1S72T 4XTYA 5FT9A 4QQIA 2EGCA 1OCZE 1YI2Q 3JCKC 1FWZA 2VASA 1VDYA 2E41A 2YUNA 1VQ4Q 4JUVA 3KD7A 5J08A 2VB6A 4M7DG 1JXMA 1Q7YU 4WNFA 1BCMA 1PC2A 3U66A 4ANUA 1K8KG 3FWVA 2XGMA 2VUBA 4RG8A 2GQIA 2FPDA 1M90U 3L16A 4CT0A 1YJ9A 3QK0A 1D1CA 4XAXB 3G7ZA 1VQOT 1B89A 2GNCA 2E6NA 3U9WA 1IB8A 2L3RA 3CMAA 1UGPB 4RG6A 2J05A 1XQHA 5GANf 3QDRB 1VQ5Q 4AEZC 3OW2P 1VQLQ 4LUNU 1DVPA 4DLOA 2QA4T 5GAMd 2Y4XA 5EX3A 5FWQA 4M77E 3HXEA 4J0UA 4LNGA 3HXCA 5L23A 5LFAA 3L42A 4BUGA 2BKKB 2V1QA 2V4LA 1GCPA 1HH8A 4PH4B 2YRCA 1K76A 2EYYA 2LCLA 3QJYA 3D9NA 2RD1A 4YDYA 3CSFA 2R03A 2E0IA 3FEXA 3Q7AA 1FYNA 2GCXA 4ZNXA 1UUEA 2LDMA 4QQ6A 1S64A 2QTVA 2GRQB 1KZOA 3P8HA 5T4YA 1JEGA 2DTIA 2Z0WA 3AG2E 1S70B 4RLYA 4PLLA 2KAFA 2C2LA 4J8OA 2J4DA 3ZIMA 3FIFA 4CGWA 1KFZA 1NZ9A 1Q2ZA 1XTDA 1F1BB 4I9EA 1MV0B 5CMWA 1JCQA 4ATGA 2W0ZA 1OU8A 2EKOA 3FH5A 1BI1A 3VS4A 4DRXE 5CEDB 1ELRA 5GANg 1EPUA 4HNAD 1MMNA 2DK3A 3VTYA 2EYWA 1MNEA 3H0HA 3M55A 4ZHBA 4M78E 1K9MU 2A37A 3EG3A 3L54A 2EYQA 3ZFJA 4KT0E 3HKSA 4F6RD 4DQ2A 2ROTA 4KBMB 2NUPA 2QI2A 1MJ0A 3E32A 2O01E 4FSSA 5IXFA 1YJ9Q 3ULRB 2WXJA 1H6PA 2AZVA 3L1AA 3FTYA 2JVVA 5LCWJ 3CVWA 1YJNQ 4AXHA 1X69A 4KGZB 3MEAA 4RCBA 3S3MA 5A7DB 3KAEA 2KT8A 4HKEA 3RKWA 1LNXA 3FDRA 2NLUA 1MX4A 1VQ7T 3MHXA 3EFOA 1Q81C 2YNQA 4CDMA 3CCQT 1KQSS 2X9HA 4MDWA 4J9BA 2VSOE 1GBRA 2PQRA 2VC8A 1VQ9T 2ZGWA 5JJ6A 4GYOA 3U64A 2RPNA 3PFSA 2X51A 3EFSA 2RQUA 3EAEA 3QKJA 3GPLA 1VQPA 2NUPB 3KS2A 4DI4A 4Z02A 3QJZA 1GFCA 3CEYA 2LO6A 3C4SA 4JRPA 3PREA 2X6FA 4ILIA 2VQ2A 1V54E 5FZSA 3CC2Q 3CKBA 2IONA 4C0EA 4G24A 3EFOB 2BTDA 3CCSQ 1VQ4T 3JXIA 2KR3A 4RTZA 3GP8A 3PE0A 3UM0A 3SWNC 2WXNA 2E5KA 2DCPA 2RF0A 4U0ZA 1AVZC 2VGYA 2PL2A 3P2BA 5KYWB 3KFVA 3JSCA 3VS5A 5GAN3 1FT2A 4FM4B 4ZGJB 1YJWA 3S3OA 1N0QA 5CK9A 3EFRA 3VTXA 2QGGA 2QYJA 3LS8A 2R59A 1IGUA 1JJ2A 5BV0A 5AT1B 4JD2G 2J7IA 2VGXB 4LDXA 3SFYA 2JT4A 1WJSA 2YUPA 2KI7A 5FTPA 5FRNA 1W3BA 3SBSA 2P9IG 1UOHA 1N11A 3PH0C 4RSYA 5DBKA 5BXUA 5CECB 3SQVA 3CVYA 1VA7A 3VLFA 3EG9A 3ZBDA 4P29A 1H0AA 1TNZA 4OAUC 3CCMA 2DERA 1KG1A 4BD3A 4JJDA 4L7TA 4BDYA 2WACA 3S7FA 2ECZA 1DCQA 1TEZA 4IUQA 4A53A 4EPZA 4NL2A 1XGWA 4X34A 3V8KA 1OWMA 3GZSA 1RAHB 4JPBW 3CCUT 4BE0A 4LN2A 3ZYMA 1MMDA 3D9OA 4M77F 4CRWA 1PG5B 1YA0A 4OYSA 1KHIA 2RA2A 1G5VA 3REBB 1BD8A 4GTTA 1FT1A 2XRYA 1NPPA 1E8YA 1AWCB 4XTZA 1K73C 5E75A 3C12A 1MUZA 3GZ2A 3NQPA 4JW1A 3UKRG 1MZCA 2CP2A 4AT1B 2RI3A 3HFOA 2ONDA 2K57A 2IOSA 2COZA 2E4HA 4C48B 3SZ7A 3LKUA 1X6OA 1YWPA 3U23A 4JZ4A 3V2OA 5LCWC 4GBQA 4J8YA 5ANLA 1WHGA 1OULA 2D6FA 1KD1R 1JWFA 3ISMC 3QB2A 3Q75A 2MF2A 2X4WA 3L9TA 5G55A 5HK3A 8ATCB 4HQDA 3BEEA 4PJOD 4JHJA 4KYOB 4RQIA 2LMJA 4Z68A 1M5Q1 4FA6A 4ANJA 1YJ9T 3S6WA 1JBMA 3JB9H 4M78F 4GTOA 3FU3A 4GAAA 4F53A 1TU0B 3BW1A 4NOYA 4OMPA 3A98A 1VQ6A 1HF8A 4A63B 3LGLA 5A0GA 4G25A 2QDLA 2ZPFB 2ED1A 2RJFA 4Y28E 3CMAT 3ME9A 5CCLA 3FUJA 1X75C 3PEVB 4C0ZA 4I1MA 4B8CB 2HL5C 1SEMA 2QDYB 2I6HA 4AV7A 3FU0A 2A36A 3CCMQ 3CBMA 4E2FB 3ENEA 3FTWA 2ZPEB 4KH1B 2CZ1B 5KNGA 5GAN7 3RKVA 5ANRA 1WA7A 3EGDB 5CMYA 4LD6A 4C5EA 3PNWC 1K8AC 3FUDA 4HA8A 4G23A 4FW1A 1ZSGA 1IQUA 4GTPA 4RVBA 4LNUD 1RADB 1KJWA 4NRHB 3J5PA 3OMCA 2VXEA 1JCRA 2K79A 1UECA 4RMOA 3OYLA 3OW2A 2VJ8A 3ZYKA 1T0JA 1UGSB 5KH6A 5LX8A 4HOQA 4Y6CA 1M3AA 2PM7A 5FU7C 2DIWA 3A5ZB 2CHWA 3M4GA 4E7ZA 1TNOA 1AZGB 4CZ2D 3HRTA 4RTVA 2L9BA 3JXJA 2EQKA 3T5VA 1TNUA 5KE2A 5FU7B 4EBAA 3AHUA 1Q95G 4HT9A 5LOZA 5ENSD 4ZGEB 3J5QB 4E7SA 3OAWA 4F17A 1NYGA 4IURA 3FTZA 3SO8A 1H641 1BCOA 2JOYA 1BLXB 2OI3A 3FB9A 1BIBA 3QDNA 1TJFA 4M77A 3LDZA 3FUHA 5CCMA 5FW9A 2KRSA 2EWNA 4KZ0A 5GMKl 3DSUA 4M7CA 3EG2A 2GRMA 4EDUA 8AT1B 1UEBA 2DD5A 4ILGA 4J7WA 2BZYA 1LD8A 1KQSP 4XU0A 4A3TA 2C0TA 5B1AE 2GQVA 4YVQC 3RKXA 3C3QA 1VQ6Q 2P9LG 2J07A 3FU6A 4L2LA 1D3BA 2WSEE 2B8AA 3B7UX 4N0AC 4HRLA 3OY9A 2DXCA 2HBWA 3MKQB 2CYZB 1OPKA 4M77B 3CHOA 5IXBA 3PIPA 3FH8A 3RMQA 2K9GA 2KE9A 2OTJA 3NTIA 3JV3A 4NIKA 4OVUA 4II1A 2JJ9A 1VQPT 2J4BA 3UF4A 3S3NA 4E85A 2HO1A 3CPWS 3B7RL 5G04J 4HCCA 1RZ4A 3R9AB 4M78A 5A2QE 3F6QA 4A55A 1L5JA 3GF5A 4CC2A 3MO8A 1VYUA 4JS5A 3G2VA 2FG0A 2H6HA 4YDOA 4ME7A 2CSQA 1ZBJA 2FL7A 4L6V5 3L08A 2DMOA 2IO2C 2QC9A 3TSWA 2P2CP 4C9BB 4HI9A 4TUMA 2PVDB 2FEZA 1KSWA 2F2WA 1BU1A 3QPHA 2JTMA 2AW6A 3D9KA 3MPUB 1P5QA 5KCHA 1YJWT 4XTVA 5J39A 3I55A 2RI2A 3JCMh 1IHBA 4M78B 2GW1A 4PFZA 1WM5A 3M58A 3EJNA 1SVXA 2M51A 2LJ3A 3H0FA 4OMNA 4CC4B 4K0RA 3TWWA 4ILHB 1TSFA 4C8QD 4C0FA 3G2TA 3RO3A 2BE7D 3DEOA 2YLBA 4KGVB 5GMKe 3CEQA 4FADA 3M57A 3CCMT 1K0SA 2V4HC 4BEPA 4L23A 3L13A 4GZ5A 4I6JA 3DWLG 2IU1A 3TWVA 4BT8A 1SHFA 3QUIA 3SHWA 3L2RA 4K5AB 5EN5D 2MYSA 1KC8C 5CBOA 3THKA 4E7IA 4FYYB 2GRRB 3J7AF 5ENOD 2MWPA 3TU4K 3EHQA 4RTYA 5IN1A 5LJ3f 4BSZB 3VLEA 1ZHIA 5CKEA 3UM1A 3DBSA 3G4SA 4EBAG 4DUIA 4U7EB 3TXMA 1O1SA 4LERA 4UUCA 1M9SA 1JRIA 4FJYA 2WSCE 1PKTA 3VKIA 1NLPC 1RI9A 3QWPA 4KT6B 2ROLA 3VRZA 2LNIA 1TUCA 2YRDA 1S0PA 3B13A 5EDSA 3HDXA 3ML9A 1X01A 1WI7A 3AJIA 2A5UA 2RHIA 4M77G 4MMKA 1KLXA 4PS8A 2DTHA 1N8RC 2RQTA 2PNIA 1VIFA 4X8QA 3RRMB 1X2KA 4LUDA 5GMKm 2XHEA 4JDSA 4XK8E 3T5XA 3HFNA 2DLPA 2LTOA 3UM2A 3DPYA 5I21A 1MQSA 3SI5A 2D1XA 5JHBA 3TQ7P 2A3LA 3OS1A 4BT9A 2HNIA 3G71A 1NM7A 1OQKA 4FYVB 3JCMf 5GAN2 2RM4A 1AP7A 4FCYA 1NFIE 3TWXA 3I55Q 3Q49B 2VXFA 5LJ3g 3JAME 1IYGA 1SF9A 3HRUA 2J6KA 3TWSA 1O5MA 1OX8A 4J7IA 1VQ6T 4B94A 3CVLA 3VS3A 3JCMP 2DRKA 1OV3A 3AU5A 3QSUA 2WXIA 3I4RB 4FJZA 4C92D 2GRNB 4MZTA 4KBQA 2JNGA 2JS0A 2Y0BG 2DJZA 4I43A 4WWPA 2GF7A 3MYVA 2WPVA 1S72Q 1BI2A 1UFFA 5CKHA 4M78G 1N4SA 2FRWA 4C5IA 5FLXE 4ACLA 1D1BA 2CT4A 4XTWA 2CT3A 2WQ7A 1ZUUA 2X6HA 2KCKA 2PVOB 3EHMA 2KZTA 3H9NA 5CRUA 3QHSA 3CVVA 3NTKA 3LYAA 4MDXA 2RD0A 4G2VA 4J8EA 1U1TA 3KSQA 4FU6A 1IHGA 3FDHA 1UGQB 3LH0A 5GAN4 1HZ4A 2C0MA 5HY6A 5FWBA 5ENRD 3MCAB 3T9KA 4HLEA 3ESLA 2E5QA 3UMVA 2I2LA 3G4SQ 3CHSA 5CR2A 4PJOC 1OX9A 5GAOl 2J09A 4WTOB 4TVRA 2K5LA 1IO6A 2KCLA 1O1RA 2V5QC 1U3CA 4GU5A 1CKAA 1TTHB 1TS9A 1D8EA 3ASNE 1NBEB 3RSEG 3FJPA 2DL4A 4PJOB 1PHTA 1XJWB 2O4XA 4UQXA 2V1RA 2E3IA 3CV0A 5DLOA 2J6FA 3OYHA 2QGFB 1UB4A 2KZTB 3UXGA 2EQMA 1G3SA 3QARA 4KMOA 1TYQG 2QA4Q 2YWWA 2ESWA 2ZXWE 3QDFA 2P84A 2WMNA 4AJWA 2YHTA 4PFPA 3RESA 4QVDA 1M1GA 3U4TA 3GNGA 1MYOA 3VYGA 4UWFA 2K7AA 2QG9B 4K5CA 4HOUA 2G3RA 1U06A 1KQ2A 1DCEA 1NJIR 4A54A 4U8HA 4B93B 1RAAB 3TG4A 2SRCA 4R0KA 1YITA 4HOSA 3BE3A 4ANVA 4N4HA 1A0NB 1IREB 2L5QA 4EMKC 2AXZA 1U3OA 5JMND 4GMJA 2JM8A 2O4XB 1OUVA 2XZDG 5BPPA 2YDLA 5KYXA 4HS2A 4LG6A 2R17C 2EVRA 2HSPA 1X5BA 4GZ6A 4EMKB 2LJ0A 4QFVA 2UY1A 2M02A 4RTUA 3H6ZA 2LRQA 2ZISA 4M7AD 4VUBA 2V8IA 1HU3A 1I0CA 3CPWP 1LOJA 1KQSA 5EKQD 4FHKA 3TWUA 3UT1A 2OTJT 4IUTA 5GAMg 1ZA1B 2P4TA 4J9FA 3JCMb 3FC3A 4BI3A 4D8KA 5CHEE 4A4HA 1VQ8A 3CCEA 4NQ0A 4BESA 3FJ5A 3WVEB 1AWWA 5LJ5f 3EG1A 2LVMA 2FPFA 3QOUA 2DXBA 3G6EA 5KWDA 3URZA 2BUDA 4B89A 4TXQA 4N39A 1SA4A 5KYXB 1QCOA 3B7SA 4FLBA 5CBNA 4GPMA 4WNDA 4Y6WA 1K1ZA 2UY1B 1ZSZC 4DA4A 4K11A 2Y69E 2A4ZA 1Z9ZA 2I2OA 4OMQA 4EPCA 4J8FA 1WAO1 3PIOA 3SD4A 1RLQC 3CCQQ 2WXHA 3FTVA 1QZ2A 2JS2A 3BY7A 1VQ9Q 3I55T 4MBGA 3RRNB 4C5HA 1O75A 4JJCA 1Q7YC 3C3OA 1RAFB 3CVUA 1QKWA 1HK9A 3JCMd 2CUDA 2CP3A 5AAOA 3CQCB 1M90C 2L6JA 3DLLA 2MPXC 3MX3A 2KMTA 3UT8A 2VYTA 1YITQ 3DXKG 1LJOA 2FZGB 2KGTA 4J8DA 5LJ5g 1OWOA 1PAQA 2O9SA 2XGSA 3JCMX 4GPKA 2DXTA 2IPOB 2ZPBB 4HRNA 1LCKA 1R0BG 4KZCA 1YBYA 5D6WA 5HQ8A 1ABOA 3RBBB 2IIMA 2K3BA 2DF6A 4XZ4A 3MV3B 1M3CA 1RAIB 1ZQ1A 1JCSA 3G4ST 3SFMA 2K5IA 1FX7A 2WXQA 1TUGB 5GAOm 2QK0A 3LLRA 3M9QA 1E8WA 4N3AA 2ED0A 2JTEA 3QYHB 4PLIA 4AG1C 1BK2A 5GMKi 3TCJA 3ABLE 3IV0A 4DEYA 3S7DA 3PZ3A 3E30A 4PJMA 2ZPIB 4HT8A 1M8MA 3CXCS 2WXPA 3ASKA 4LUEA 3LW5E 1YMPA 5CIUA 1X43A 5GMKj 4XKCA 1Y7XA 4C8QC 3UX4A 3CCRA 2P0KA 4QVZA 3UPVA 5DY9A 1OWPA 4U95D 4M75D 4M3OA 1HG5A 2FBNA 3LVRE 3TWRA 1E6HA 2R58A 1TJCA 2QAZA 3CCUQ 2PNNA 3FTUA 3ABME 2C0OA 4JLGA 1EYHA 2RH2A 2H6FA 2E10A 2G6FX 4KH0B 1K9MC 4HBDA 3JUIA 3FUEA 2X6KA 4AP2A 3UKUG 4HORA 3CVQA 1FMKA 3AT1B 2OTLA 1H6OA 3MP6A 1YHQA 4JRIA 1B07A 2EKHA 1HJDA 4B9WA 4YDWA 2DEUA 5BXOA 2FHDA 3FEOA 2AXUA 1XNIA 1IHVA 2DILA 1SRLA 4ANWA 2VGNA 2NSZA 5GAN5 2M63A 1BKBA 2CDTA 1EF1C 1QVFA 1SA5A 2R57A 4PFOA 4B0ZA 4DBRA 1UJKA 1HG2A 2RFAA 4PUCA 5GAMe 3L2QA 4J6YA 4BI4A 4TRQA 1UDLA 3B95A 2MI6A 3V8LA 2QQAA 3NTHA 2DIQA 5CQYA 1W70A 5D6YA 5KYUB 3NF1A 1SSHA 2LNHB 5GJVB 3CCJA 1OT8A 5CCAA 4PKCC 2F8YA 4HRMB 4OVAA 4GLMA 3CHRA 3CD6A 2XU8A 1Y0MA 2HE0A 2FB7A 5LJ5d 4YDEA 5D6XA 2P58C 2K4YA 5KCOA 2R5AA 1EFNA 3UWNA 4R55A 4G8KA 1WIEA 4RG9A 1M1KU 2FEIA 3M0TA 4LSZE 2XS1A 3QC1A 1D9SA 4K03A 3CMAQ 2DBKA 5KJNA 3VUBA 3NFCA 3ABKE 1BI3A 3CCLA 1WXBA 4AY6A 4C92C 2J49A 1WXTA 4L2YA 4U8YD 5G2NA 5KYWA 2XI9A 4CDRA 3CCRQ 2LQKA 4LD9K 1M8VA 5M9OA 2QQSA 3ZVVA 2L0IA 3SWNA 4I9CA 4O6FA 3RO2A 4GY5A 3PNTB 3CHQA 1DJ7B 4C92B 2CHXA 1ZBPA 3D9PA 3DSSA 1PM3A 1YITT 2XK0A 1UN9A 3WXXA 3GW4A 2L0AA 2VGMA 1K9AA 1Y6IA 3LGFA 1ZB1A 5FQ6A 5J90A 2VGXA 2DEQA 1N27A 1HXIA 2VGEA 2COYA 3CKCA 2OTLQ 2F69A 4H7XA 1YHQQ 1AWOA 4KXKB 4DX6D 1KT0A 2VYIA 4JZ3A 2IEJA 3JB9I 1FXXA 3P1UA 3CLJA 1NE8A 2M0YA 4UQZA 2CFZA 4O5VA 2DJQA 3L6AA 2CFUA 1HS6A 1OPLA 3MEVA 3SWNB 1I5LA 4Q96A 4PJLA 2BIVA 4D10C 2K2MA 2XENA 2OV8A 2YINA 4C0DC 1LF8A 2BF0X 4GTVA 3PGGA 3CCET 1SQMA 1K1BA 5HRYA 3DSVA 4BACA 1PRMC 3OBYA 3G6ET 1X2QA 4TUUA 2GGRA 2HQHA 2XDBA 3F70A 1PY1A 2HKQB 4L9PA 1PKSA 2P4RA 3CPWA 4L59A 4C0DB 4XI0A 2A5EA 4E47A 1OEBA 1WHHA 1O9SA 3RAUA 1OY3D 4HFGA 3SD5A 1E8ZA 2HYZA 4G11A 3ZYLA 1JQQA 2X6IA 1QCFA 3HG0D 1M1FA 3I3NA 1VQMA 3Q78A 1NYFA 2JUFA 2L89A 4Z89A 3JB9D 1R0CB 1RW2A 4M7AC 2B0OE 1N0RA 3RJVA 4E6RA 4GTMA 3FUKA 4G26A 2Y4YA 2E2EA 1VQPQ 5JJ7A 2DFUA 4I1AA 4DX5D 1IRXA 2FZCB 4KRTA 2FO0A 4JLIA 2KYMA 4QT7A 2KYBA 3GZ1A 3Q5MA 2CH4W 4PJOE 2WXOA 4JXTA 2DXUA 3JQ0A 1NJIU 5BV1A 5HK0A 4U96D 1M2OA 2R5SA 3IKOB 3QIIA 3TGOA 3OSSC 2AK5A 2Y3AA 2LX9A 4A4KA 3D3MA 3BQOA 4BB7A 5ECAA 1YCYA 5GANe 5B1BE 3EGDA 2XEVA 5KJMA 2P9UG 3DXMG 3UUXA 2IVWA 2EPDA 4XEIG 1C0MA 3FU5A 1UHFA 3UA7A 1YJWQ 1WYXA 4GCOA 1UJYA 1A5EA 1QBQA 3CXCP 2GTJA 3BG1B 4HVUA 1TR4A 5CVIA 2NWMA 3RKYA 1HO8A 5LJ3j 3VLDA 5LL6S 3M0SA 4RCCA 2NC9A 2LT1A 4F7AA 3E33A 4H7YA 2HQEA 4NURA 4LDUA 2LZ6B 4CYMD 3CCRT 2RNAA 4R56A 1GBQA 1VYVA 2J9QA 4A1GA 1FPPA 3D9JA 3MEWA 1A17A 3KEAA 4NACA 1UGRB 1VQMQ 1YIJA 2RHXA 1EIFA 1FMVA 1TG0A 3O8VA 1GXIE 3QWYA 2COWA 3CVPA 4BTBA 4BX8A 4M7DD 4ME2A 2R02A 2Q7FA 2MRIA 2RJCA 1TN7A 3PEUB 2DIGA 3E19A 3ZEHA 2LQ8A 2OTLT 3MGBA 1YHQT 5ITZF 2C06A 5AN8A 1TNYA 1NPRA 2NUTA 1N4RA 2ETAA 1W4SA 3FLGA 5IAYA 2RKKA 3KUFA 1Q82R 3ZKJA 2E12A 4J9HA 4QW2A 1Y8MA 2EJGA 2XS8A 1WDYA 1G3WA 2FO1E 1LD7A 3HP9A 2XPYA 2EIFA 5CAIA 2WSFE 2K3YA 4UI9C 2KT1A 4LDYA 3T8KA 4F16A 1QP3A 3HVEA 3MKQA 4FL6A 4BY6A 2EQXA 4N0AA 3ONLA 2ZPHB 4OGEA 3WXMB 3B7TA 4W9RA 5CO7A 3ZPJA 3OYNA 4M4ZA 2K5FA 4GCNA 4M75C 2NUTB 2ABLA 4IIOA 2YLCA 1N54A 3IHYA 2NYSA 3HRAA 4M75B 5KE3A 1C6VX 3QWWA 5GAOn 3OYAA 4BY6C 1ZLMA 3OYEA 1OWLA 4JRQA 5I2MA 2AIRB 3KBGA 4O1PA 3CCLT 2CP5A 1OWNA 1AEYA 3HVEB 4PS7A 2DE0X 3AS8A 3ML8A 1MV3A 4BY6B 4ZGDB 2F37A 4BDZA 4U0SA 2CSIA 1WJRA 2IOLA 3MV2B 4G8LA 3FFLA 4J6IA 2WXKA 2EAYA 3JB9J 3NPFA 5GAMj 3DPDA 4PK4A 1YIJQ 4GA1A 5LP0A 3CQTA 4MZPA 2FYKA 2Y1LE 1QMCA 3PUJA 1LPLA 4CC7A 1HSQA 4YVOA 1YNZA 4F7UB 2KM4A 1Q86R 4Z88A 3M59A 3JCMV 1UJ0A 1NEGA 5DM7R 1FVFA 3FP3A 3BG0B 1HX8A 3WG7E 2L8DA 1BI0A 1JJ2S 4PJOF 3KXTA 2EINE 3DB3A 3JUEA 3QG1A 4XE0A 3PDNA 1QP2A 3E9GA 3DSXA 3DEPA 3EG0A 2BZXA 2L2PA 4C8QE 5FU6C 3DRAA 3QJ6A 2V8KA 2I1KA 4Q94A 2AHJB 3PZDA 4BFRA 3QBYA 4I17A 2LP5A 1KIKA 4AY5A 1VQNA 1HE8A 2ILRA 5C0MA 1N94A 1HFAA 2CP0A 2R5MA 1VUBA 5A0DA 2PZIA 2DYIA 2DYSE 3FHEA 4AFQC 5IHIA 1TNBA 1TN8A 2ETCA 2CS7A 2KQWA 4ZN1A 4OMMA 2QQBA 3CMEA 1PNJA 2IG0A 2YHCA 4JZYA 3A8LB 4FT4A 1QVGS 1E96B 1M30A 4GZ3A 2XD0A 2KXDA 2JABA 5FQ8A 3C0CA 5B3SE 1UG1A 3META 2F2XA 1VQMT 5C1DA 3EHRA 4JEHA 2XEHA 2VTBA 2D0NA 2HL3A 4N5QA 2M9UA 3JCMW 3OYJA 5FQ4A 1CKBA 3GIBA 1AOJA 1JUQA 1PSFA 2EJ9A 2OTJQ 3I56A 3H0IA 2DVWA 2R2LA 1E90A 2IFUA 4F1SA 2EQUA 2HM8A 2RB6A 5HI7A 3FEYA 3S7BA 4AFUC 4J8SA 1KK7A 4AMCA 2XZTG 2XKOC 1OZ2A 4PL6A 4KULA 2DYRE 4AOFA 1N9SA 4KUDK 2IY0C 5KJKA 2FF4A 2DZCA 3OYGA 4CDNA 3U3WA 5I11A 4J5YA 3MKDA 3OXFA 4BTAA 4ZFHA 2VTBB 4GLKA 4RTWA 1V55E 5C2YA 3ZGQA 1AWXA 1JXOA 2GFUA 2KK4A 3D9LA 2ETBA 3R6NA 1RL2A 2WXMA 5I2SA 5EX0A 2QFCA 4C92E 2LXLA 4JJNK 3LXUX 5J3BA 3UATA 3AG3E 3L22A 3G2WA 2MK5A 3J80E 5IH2A 4U07A 2DETA 2HCKA 3X20B 1VIEA 3E37A 4RKUE 3RIRA 3V7RA 2KDSA 2KC7A 4XU1A 3H41A 4P5NA 2E65A 4KUIA 3OS0A 1Q81R 1FMWA 3K9IA 1D0ZA 2QYUA 3RERA 2BKDN 4N2QA 2M0OA 4PJOA 2EILE 3OBWA 4OB3B 3CXCA 2IJGX 2OCCE 2KRNA 1BI8B 3BFMA 3G1JA 5GAOp 4ACKA 4CEMA 3DLMA 3FUIA 3OQ5A 2I9CA 2WQHA 2P9PG 3RUXA 1YIJT 4FHJA 2Y90A 2OAUA 4QKUA 2RHUA 2YT6A 5GANj 3ASOE 1Y71A 1K3ZD 3ZEFA 4N3CA 1OZ3A 2YSQA 1OCOE 1VQKA 1TXQA 4JPSA 3ZU7B 3ULYA 3HIZA 3VS7A 1PRLC 2X4YA 1SKUB 3PVQA 1I1JA 2W10A 3ZN3A 3N5BB 3UTMA 3LPZA 3JCMg 3ZYQA 2XIDA 1YYHA 4GYWA 2VV5A 5DLQE 1G83A 1Z3XA 3SHFA 1E8XA 4MLPA 4DEXA 1SZAA 2L0TB 2I1JA 1OOTA 3P8DA 4EMKA 1DC2A 4N4IA 4OB0B 3SNXA 2PZ1A 1H3ZA 1OXJA 2JW4A 1WLPB 2CG2A 4J6WA 1BI7B 5G05C 2AZSA 3OMGA 3LY8A 3OYYA 4C8QF 5ENPD 5T3RA 1KD1U 4XI9A 3L17A 4E7HA 3VS2A 1WHMA 2CZ6B 2MCNA 3QO3A 4M7AE 3C95A 1VQ7A 2FULA 1RUWA 4GZCA 3ZL7C 5CERB 2VKNA 3G71Q 1ZA2B 5AENA 2EJFA 2AKLA 2M1HA 2QEXA 5AARA 4LDWA 2DL5A 3I4GA 4M7DC 3A8HB 4J7FA 5FINA 5IHKA 1BPOA 1OU9A 4DBHA 2BEDA 2XICA 4UWLA 4XTXA 4AFSC 4A4FA 3VS6A 4M7DB 4HCZA 4XQ3A 3V30A 3OB9A 2F1LA 1QWFA 4GTRA 2P9SG 1QQJA 4U04A 3OXGA 1ZSZA 2GROB 3FUFA 1FVHA 2KBXA 3VS0A 3M5AA 4LXCA 5D66A 2M16A 4E7LA 3V8JA 1UJJA 4O1OA 3RK6A 2DPPB 1SPKA 4E7JA 1YI2A 1JPLA 3RNJA 1K73R 3SEMA 7AT1B 4PJJA 3Q4AB 1YCSB 3L2VA 4MKTA 4ANXA 2A7YA 3QYGB 3PMIA 4BE2A 3CPFA 1MNDA 2MHKA 2JEKA 1RAGB 4ATOA 1AT1B 2QXFA 2OX7A 4CCAA 2ZAEA 1PD1A 4HI8A 2QQRA 4IUPA 3FRNA 1DNPA 3LY9A 4L1BA 2DX1A 1ZSZB 4MMLA 4XKBA 2MWOA 1BYMA 2E70A 3ASGA 1NL4A 3NOGD 3PS6A 2GTOA 3M0RA 4FSXA 3LH5A 1Q82U 1VQ5A 1T3SA 5J26A 2H8HA 3CCVA 1Z3YA 3OYDA 1VQLA 3JRZA 5GANh 3SY2A 2RN8A 1QNFA 1VQNT 4C92F 4JRKA 3TWQA 4HCBA 2ZGGA 5LJ3e 2QY7A 4C0GA 2F2VA 4PJOG 4DPRA 1QVGP 5I22A 4CT4A 3A8GB 4YTLA 1WGSA 1BB9A 2LQNA 4UI9K 4J9IA 4PNOA 1MHQA 1HYOA 4PS3A 3CMET 3L2ZA 2EW3A 4XU2A 3ASFA 3CHPA 5E76A 2PVGB 2KY9A 3IEGA 2XDPA 2JM9A 1U3DA 5IY5E 1K8AR 2X4JA 1IQRA 3LWHA 2GFAA 3CBOA 4N5CA 4UWHA 4BX9A 3VV0A 1H2VC 3VJPA 4U0UA 3SBTB 3JQ1A 4JEUA 3I56T 3FUMA 5KCMA 2LX7A 3OS5A 4C8QA 2VSXE 4GTSA 3UQ3A 3D9MA 3HXBA 1VQ8Q 5JA4D 4FC8A 2WXRA 3CCEQ 2K3XA 2EQJA 3DB4A 1RACB 4BWRA 2MOXA 3VYHB 3R9MA 1EDUA 4M75E 3G6EQ 3Q73A 4DJAA 5D7UA 3JCMe 1WJQA 4J9EA 5CEAA 1NA0A 2RJDA 5A0LA 3O4ZA 4F3VA 1B3QA 3L82A 4GZDA 3D9HA 5FZRA 3LEWA 2CZ0B 3M0PA 1Q86U 1O1TA 2LC4A 1YJNA 9ATCB 2YQ8A 2OAWA 3CGHA 4C8QB 4MS6A 4V3IA 1Y96A 2E6ZA 1S63A 1PWTA 3G71T 3ASDA 2H6IA 4DLQA 1U1SA 1TN6A 5ENTD 1QKXA 3MCXA 3MKRA 2MAMA 1MX2A 5KYUA 2Y4TA 1PSEA 1K0XA 3CCVQ 3PRZA 3G2SA 4F7UE 3PMTA 5AYWD 4XIFA 3A1PA 3ZFWA 5EIDA 4M7AF 4Z8AA 4CRIA 3EGXA 3FUNA 3Q79A 3CQGB 5HCKA 2JZ2A 2HAXA 1NLOC 1WPYA 3UDCA 4RTXA 3AAAC 1QLYA 4OB1B 2J06A 3M4YA 3FY4A 4HOTA 3G2UA 3X26B 4HXIA 3HSBA 4RUGA 3CC2A 1M1KC 2P0PA 5AQAA 4M77D 1Y96B 2KXCA 3TG5A 1ZUKA 3I35A 4XX5A 2X3XD 2JLBA 3CCSA 4J9GA 5A6CA 3SGHA 2X4XA 3VS1A 2CZ7B 3CK7A 4I2ZA 1WHKA 4HVVA 1M3BA 3C98A 3INZA 4AIFA 4DBQA 3QNKA 1VQKT 1H8KA 2X35A 2IF4A 2DNUA 4C92A 6AT1B 3ZRHA 3NHNA 4JJBA 3EGXB 4B9XA 3RRUA 3GLXA 4OVVA 4LE9A 4XU3A 1NEBA 5HS0A 2CHZA 4FLHA 2UWJG 1SZ9A 1WX6A 3R7RA 3PE4A 2X3MA 1WDXA 1ZBXA 3TSZA 3AG1E 2BKGA 3NOCD 3QZ9B 4F1PA 4M78D 3QAQA 1QCNA 4XTUA 1ELWA 3TVTA 2SEMA 3MP1A 5KYNA 2DA9A 4HLLA 3DSWA 2CP7A 3CIAA 1PCXA 3MEUA 1OYXA 1UG3A 1YWOA 2BE9B 3A8OB 3EU9A 2QEXT 2PUKB 3ZW3A 3QZ5B 4X9CA 1WHJA 3UI2A 4N3BA 1UN8A 4DBFA 2BUGA 3D9IA 5LJ5e 1W2BS 1BBZA 3CC7A 2DYBA 1KC8R 5GMKh 1WZOA 4C8QG 1ZX6A 3UM3A 3BU8A 2EGAA 4JL0A 4MZMA 4F14A 3B7BA 3GYZA 3IBEA 5EYPF 2AJAA 1HD3A 1Y57A 5IT9E 2ZPGB 3I9QA 2E64A 1Q81U 4KGXB 4FU3A 2XRZA 4AM9A 1KQ1A 3PTAA 3JCMQ 1VQ8T 1YI2T 2X38A 2GGFA 4B6MA 3EGUA 1NP7A 1NI1A 2OJ2A 1IHWA 1D0YA 4UWGA 4LNBA 3CCJQ 2K2VA 2XCBA 4D8DA 3PZ4A 3LX7A 3CD6Q 2K6DA 4LEUA 2ZU6B 2HZYA 4NS5A 3OYBA 4M7AA 2LSVA 2PQWA 3EDTB 4UI9J 1XNFA 3NBNB 4M75F 3LJNA 1N8RR 1I07A 1Y07A 3LY7A 1QWEA 5FJYA 1IGQA 1V1CA 4UC4A 3EHNA 1NJIC 1WFWA 1H2UA 1LVKA 2DO3A 1TUDA 4O6JA 2WMOA 3CCLQ 1VQ5T 3CCVT 2EIME 4AG2C 3C5RA 2JN0A 1VQLT 2GBQA 3SFXA 4WAFA 3FTSA 4D6WA 1N4QA 3C72A 4A3VA 2J8SD 5GANd 2F0YA 4M7AB 3TEEA 4ORZA 5FQ7A 1Z6TA 4OAVB 3SB2A 4OGCA 5ARGA 4F7UF 2DL7A 2FRYA 1M27C 3Q7FA 2XEEA 3MZLB 3HHMA 1E7OA 3URGA 5AQBA 2YXYA 4WCIA 3ZNGA 2CP6A 2B6CA 4DK5A 1EZZB 1X6GA 2XHCA 3V79K 4IUUA 2DL3A 4DX2A 1GFDA 2CREA 1H19A 3ZUVB 3UT7A 1E6GA 3CC7Q 1TOVA 2PUOB 3T9NA 4C92G 2WB2A 1ARKA 5AYFA 1QVGA 3M0QA 3I5PA 1ACMB 1WQWA 4O60A 4IRUA 4YNDA 3PVLA 4LCTA 3A8MB 4LRZA 1R8OB 3EG9B 4B8AA 1IXDA 3M54A 2DBAA 2A28A 4U63A 4C0MA 2OVFA 4RG2A 2AT1B 1AZEA 4EZJA 2C0IA 3CR3A 3EH2A 4CI0C 1CSKA 2O2OA 4EZLA 4X9DA 2DAQA 2O31A 1JO8A 2OVBA 1QQEA 3PZ2A 3APFA 4HB5A 3APDA 1K73U 4RTTA 3S7JA 3SFZA 2E3HA 4M7DE 2P0QA 3HRSA 1T0HA 4E6HA 2RQWA 4WNGA 1H3HA 4A1SA 3AS4A 3GBQA 1YJNT 3S2AA 2HSEB 2D8HA 3CHMA 1AD5A 4J6XA 3NAWA 2RQRA 3Q15A 2HKNA 1I5OB 2H6GA 1MMGA 2XQ0A 1E7VA 4LNPA 3SF4A 3N71A 2IQCA 4Y92A 4GA2A 3V31A 4J9DA 1QVFS 2IO3C 2GRLA 5CRVA 2B86A 3OS2A 1EX4A 2J6OA 2J08A 4MRUA 5M72A 3HYMB 5CQXA 1B7TA 4N4GA 4CC3A 3ULEG 2KRMA 2DZ9A 2XG8D 2DD4A 3CK8A 1V76A 4M75A 1JB0E 4GYYA 5ENNA 1N52A 3PUKA 2JMCA 1U2VG 2YRVA 3CC2T 3OYFA 2DL8A 1K1AA 3D7SB 3OA6A 3W9FA 3HHTB 2HQXA 1UTIA 5HKCA 1OI1A 3E9FA 3TXNA 3CCST 1PC0A 4UWKA 4OB2B 2KXPC 4CGVA 1VOMA 4PJNA 4M7AG 1X6BA 1V29B 5CKFA 3O48A 4EZKA 3IXEA 3CCJT 3OXLA 4AVXA 1RABB 4HVBA 3CD6T 1K8AU 2X3WD 2F8XK 2HR2A 4FP7A 3APCA 3TJPA 1BIAA 4HVWA 1X27A 4I1OB 1GL5A 2DKGA 1SW6A 4I6EA 4BSXA 2KSSA 5FRMA 2O9VA 5BUZA 1H2TC 1I4K1 2FPEA 2HD0A 4F7UA 2LUHA 1SRMA 2ENMA 3UINC 3CVNA 2KATA 3I5RA 1ABQA 2EGEA 4WWOA 2LNVA 3X28B 3OYMA 3JB9F 4FULA 5EILA 2A0FB 2R05A 4QQDA 1WY6A 2ZIRA 2ZGDA 4DI3A 2P9NG 1M4ZA 1N9AA 1G3YA 2XPIA 1M2VA 3QWVA 1Q7YR 4JS4A 2EBPA 2MOWA 2CUBA 3M56A 4M77C 1W2BP 4L5GA 5JJTA 4JA7A 2KEAA 1M90R 4BETA 3MJXA 4FIBA 3PT9A 2PM6A 1JU5C 4I2WA 1QW1A 1MMAA 5LJ3h 3E34A 2L3PA 4J9CA 2WXGA 3V7SA 3CC7T 5GAN6 5GAOr 4JC8A 2BTTA 2V8JA 4V2SA 4TXRA 2FO7A 2MYOA 3ESKA 4UQYA 4U8VD 4E7KA 4APFA 4IYPA 3CC4A 3R7QA 4K5BA 1M2VB 2VSNA 4BI8B 1BU9A 3V7CA 4EIKA 1ELKA 2LQWA 3GNFB 2C0LA 1D3BB 1YP5A 5KYYA 4OMLA 2QYZA 2RHZA 2EYXA 5FU6B 1KPSB 3ER0A 2VWFA 2WXLA 3T8MA 1WG0A 4OMFB 1J3TA 1INZA 2AKKA 2QQ9A 4WNEA 1D0XA 2E1HA 4M78C 5CKBA 3OYCA 2DZNA 5D0QD 3CSTA 1LTXA 3EUVA 3ASHA 3IHVA 2KNBB 1UGVA 2VVKA 1OCCE 3M53A 3C94A 3MJWA 3QWXX 4ZN3A 2AWIA 4PDXA 4TV3A 5G05J 1D8DA 5BT1A 2CGHA 2D9TA 4Y91A 2DTOA 5LJ5j 3QKYA 3UA6A 4M7DF 3QXEB 2O88A 2I0NA 2KBTA 1E7UA 4EECA 2H3EB 4ELYC 3BDLA 5KYYB 2LSUA 3R6OA 3JCMc 2YHEA 4JHRA 2A08A 2DZOA 2RQVA 2H3JA 2NYJA 5EG2A 1IKND 1S72A 3EIJA 1NG2A 2EQIA 1HXDA 5GAN8 2PU9B 4M75G 1K9MR 2XDDA 2EYZA 1AHJB 4ZTFA 3EH1A 5ENQD 4DOWA 3GOXA 1N9RA 1OCRE 2LJ1A 2NXPA 2X6JA 1IZ6A 3Q47B 3I5SA 1ZU2A 1G3NB 1H6KA 1S1NA 3HPWA 1M1KR 4FYXB 3LCAA 2DVEA 1VQOA 3RIBA 3PE3A 4GMLA 2WQ6A 1RLPC 2LXMA 4AFZC 3VRYA 2PTKA 3MA5A 4GTQA 3CC4Q 1FCHA 5IHNA 4F7UG 5GJWB 1N95A 2F5TX 4FYWB 3L2UA 2QZAA 1KC8U 5FZQA 2JMAA 2L3SA 5GAMh 4C5GA 1Z9QA 1MGQA 5CKDA 5EIBE 3OSVA 2LAHA 3PNLB 4GA0A 3CK9A 3OTNA 2KVQG 3ZHEA 1UHCA 4LDVA 2QA4A 3RMSA 3OYKA 1VQNQ 3HXDA 2OEVA 5KNHD 4Q5WA 3Q9UC 3FTXA 4OMOA 3W9GA 3UIOC 1TWBA 3OW2S 2DWZA 4GMRA 4R7LA 3MEKA 2P9KG 1MX6A 3HL8A 4FW2A 2XGOA 3AS5A 2HBPA 3CMEQ 5EYLA 3O5ZA 1W1FA 3DKMA 3EIQC 2AVPA 3CBPA
chains in the Genus database with same CATH topology
5HRYA 1K1BA 4J7WA 1PRMC 2BZYA 2YUOA 1X2QA 2GGRA 2LX7A 2C0TA 2DBMA 1PKSA 2L3QA 2P4RA 5HKPA 2A5EA 5JA4D 1OEBA 2LCSA 2MOXA 1OY3D 2BZ8A 1JQQA 4J9EA 5AQ7A 4HRLA 2HEQA 2HBWA 5CEAA 1QCFA 1AWJA 3HG0D 1OPKA 5IXBA 1B3QA 1YN8A 2K9GA 2KE9A 3D9HA 3JV3A 4NIKA 3M0PA 1NYFA 1QYMA 3UF4A 4Z89A 2OAWA 2B0OE 1N0RA 5AQ9A 1PWTA 4E6RA 3F6QA 1W6XA 5ENTD 4CC2A 1QKXA 4DX5D 2CH4A 1K0XA 1MX2A 1UE9A 1VYUA 4KRTA 1T3LA 4JB8P 1N5ZA 1XOVA 2FG0A 2FO0A 2XMFA 3Q9NC 2KYMA 2KYBA 3IQLA 4QT7A 3V2XA 2RFMA 5EIDA 2CH4W 1ZBJA 2CSQA 4Z8AA 1GCQA 2DMOA 2QC9A 4U96D 3TSWA 2P2CP 5HCKA 4HI9A 4TUMA 1NLOC 2RMOA 1KSWA 3AAAC 1QLYA 2F2WA 2J06A 1BU1A 4HXJA 2AK5A 4RTXA 5FIOA 4RUGA 1WXUA 1G2BA 5ECAA 1H92A 5AQAA 1IHBA 2KXCA 3I35A 1ZUKA 2X3XD 2EPDA 4J9GA 1UHFA 3M0UA 1GCQC 3UA7A 4HVVA 1U5SA 3VS1A 5FWCA 1SVXA 1WYXA 1M3BA 2M51A 2LJ3A 3H0FA 1UJYA 1A5EA 3TWWA 1SHGA 4OMNA 4CC4B 1H8KA 2GTJA 2DNUA 4HVUA 1TR4A 3DEOA 3NHNA 4JJBA 2NWMA 1K0SA 2V4HC 4BEPA 3SHWA 1SHFA 3TWVA 3M0SA 4K5AB 5EN5D 2HDAA 5CBOA 4LE9A 3THKA 1NEBA 2LZ6B 4CYMD 5ENOD 5HS0A 2RNAA 3EHQA 4RTYA 1GBQA 1VYVA 4BSZB 1VYTA 3REAB 3NMZC 1WX6A 3KEAA 5KBAA 4DUIA 1TG0A 1WDXA 1IXVA 3QWYA 4UUCA 3TSZA 2BKGA 3NOCD 1PKTA 4F1PA 1NLPC 2YUQA 4X1VA 1RI9A 3TVTA 2SEMA 2ROLA 1GRIA 2DA9A 4HLLA 3VRZA 1TUCA 1ZUYA 2DM1A 4DX7D 4ESRA 1YWOA 5ITZF 3EU9A 1WI7A 3AJIA 5AN8A 2ETAA 5EC7A 3UI2A 4IIMA 2L6BA 3ZKJA 2JXBA 2RQTA 2DRMA 4J9HA 2PNIA 4HCKA 1WDYA 1BBZA 4ATZD 2FO1E 1X2KA 4LUDA 2D8JA 1K4US 2DYBA 1ZX6A 2KT1A 2DLPA 3T8KA 4DX1A 2EGAA 4F16A 2D1XA 2NUZA 4F14A 2DVJA 3B7BA 5EYPF 2AJAA 1HD3A 1Y57A 4BERA 3TWTA 1NM7A 3I9QA 1AP7A 2KROA 1NFIE 3TWXA 2J6KA 3TWSA 3NGPA 4M4ZA 3EGUA 3VS3A 2MIOA 2OJ2A 2DRKA 1OV3A 2ABLA 4IIOA 4QQIA 2EGCA 4D8DA 2JS0A 2Y0BG 2K6DA 3HRAA 2YUNA 1ZLMA 1JXMA 1UFFA 2FRWA 3NBNB 4O1PA 3LJNA 2CT4A 1I07A 1AEYA 2DE0X 2CT3A 1ZUUA 1QWEA 1MV3A 2GQIA 1V1CA 2FPDA 2F37A 1WFWA 2CSIA 1TUDA 4G8LA 2GNCA 5FWBA 3NPFA 5ENRD 4AG2C 3C5RA 3T9KA 2GBQA 3CQTA 2Y1LE 4CC7A 1HSQA 1YNZA 2J8SD 2J05A 1IO6A 2V5QC 4ORZA 1CKAA 4Z88A 4OAVB 2DL4A 1UJ0A 2DL7A 1NEGA 1M27C 1PHTA 2XEEA 1E7OA 2FRYA 2V1RA 5AQBA 2J6FA 4WCIA 5L23A 3ZNGA 3UXGA 1X6GA 2BKKB 3JUEA 2V1QA 3V79K 1GCPA 1GFDA 2DL3A 4DX2A 2CREA 2ESWA 3DEPA 3ZUVB 1E6GA 1K76A 1ARKA 2BZXA 2EYYA 2L2PA 3M0QA 1MYOA 4O60A 4YDYA 1FYNA 4ZNXA 3PVLA 1UUEA 2K7AA 4K5CA 1U06A 2LP5A 2A28A 1KIKA 4B93B 2SRCA 4R0KA 1JEGA 1A0NB 1AZEA 4RLYA 1S70B 2C0IA 1U3OA 1CSKA 5JMND 1KFZA 4AFQC 2O2OA 2JM8A 5IHIA 2ETCA 2XZDG 2O31A 2YDLA 1JO8A 4LG6A 2EVRA 2HSPA 1MV0B 4OMMA 2LJ0A 2W0ZA 4QFVA 1PNJA 4RTUA 3VS4A 4HB5A 4DRXE 5CEDB 4RTTA 1M30A 1I0CA 2KXDA 2JABA 4HNAD 3C0CA 3H0HA 2EYWA 1UG1A 3TWUA 4ZHBA 2F2XA 2A37A 4J9FA 3EG3A 1T0HA 3EHRA 2RQWA 1H3HA 2XEHA 2D0NA 4N5QA 3GBQA 4F6RD 1CKBA 4D8KA 1AOJA 2ROTA 2D8HA 1MJ0A 4FSSA 4BESA 5IXFA 3FJ5A 1AWWA 3ULRB 1AD5A 3H0IA 2DVWA 2AZVA 3EG1A 2FPFA 2RQRA 5KWDA 4LNPA 1X69A 2KT8A 4Y92A 4AFUC 2XZTG 1MX4A 5CBNA 3V31A 4GPMA 4J9DA 1K1ZA 2B86A 4J9BA 4K11A 1GBRA 2J6OA 1Z9ZA 5I11A 4OMQA 4CC3A 2RPNA 4ZFHA 2KRMA 1RLQC 2RQUA 4RTWA 2JMCA 1AWXA 1JXOA 2JS2A 2DL8A 1K1AA 2ETBA 3W9FA 3R6NA 1GFCA 1UTIA 4JJCA 2KXPC 3UATA 1QKWA 1X6BA 3IXEA 2CUDA 5IH2A 5AAOA 2HCKA 2X3WD 2F8XK 3JXIA 4HVWA 1X27A 2KR3A 4RTZA 2KGTA 3PE0A 1GL5A 2O9SA 1SW6A 2E5KA 3H41A 2RF0A 2O9VA 1AVZC 2FPEA 1SRMA 3KFVA 2ENMA 4HRNA 1LCKA 3I5RA 3VS5A 1ABQA 2EGEA 1ABOA 3RBBB 2IIMA 2K3BA 2KRNA 1BI8B 5EILA 2DF6A 1N0QA 1M3CA 2QYJA 2ZGDA 2J7IA 2YT6A 2JT4A 1K3ZD 2ED0A 2JTEA 2YSQA 2YUPA 4AG1C 1BK2A 2EBPA 3ZU7B 2CUBA 1UOHA 1N11A 5BXUA 5CECB 3EG0A 1VA7A 4DEYA 3VS7A 1PRLC 4OAUC 3PVQA 2KEAA 1I1JA 4BETA 4JJDA 2W10A 3UTMA 1JU5C 2ECZA 1DCQA 1M8MA 1YYHA 1G83A 4LUEA 1YMPA 2L3PA 4J9CA 4DEXA 1X43A 4JPBW 4LN2A 1OOTA 2BTTA 4U95D 1DC2A 2MYOA 4U8VD 3TWRA 1E6HA 3REBB 2PZ1A 1BD8A 2PNNA 2JW4A 1WLPB 4K5BA 1AWCB 2C0OA 1BI7B 2AZSA 1BU9A 1MUZA 4EIKA 5ENPD 2G6FX 2LQWA 3VS2A 2MCNA 1YP5A 4HBDA 1FMKA 4OMLA 1RUWA 3ZL7C 2EYXA 5CERB 2VKNA 1B07A 2VWFA 2EKHA 1HJDA 4C48B 2AKLA 1YWPA 4YDWA 1WG0A 3U23A 4JZ4A 3V2OA 5AARA 1J3TA 5BXOA 2DL5A 4GBQA 4J8YA 2AKKA 5FINA 5IHKA 2DZNA 2DILA 2KNBB 1SRLA 4AFSC 1UGVA 3VS6A 2CDTA 2VVKA 3QWXX 4HQDA 3V30A 2RFAA 1QWFA 2LMJA 4Z68A 1UDLA 3B95A 3UA6A 2KBXA 1W70A 2I0NA 2KBTA 5D66A 3VS0A 2O88A 1SSHA 2LNHB 5GJVB 4O1OA 1OT8A 2F8YA 4HRMB 1SPKA 4OMPA 3A98A 4GLMA 2A08A 4A63B 2DZOA 2RQVA 1Y0MA 3RNJA 3SEMA 2HE0A 2NYJA 2QDLA 1IKND 1YCSB 2ED1A 1NG2A 2EQIA 1EFNA 4G8KA 1WIEA 2EYZA 2FEIA 3M0TA 1SEMA 4LSZE 1D9SA 5ENQD 2A36A 2DBKA 5KNGA 4HI8A 1WA7A 2LJ1A 1WXBA 1ZSGA 2DX1A 3I5SA 1WXTA 4LNUD 4U8YD 1G3NB 1KJWA 3J5PA 3NOGD 1S1NA 2GTOA 2K79A 1UECA 3M0RA 1RLPC 3LH5A 4AFZC 1T0JA 3VRYA 1T3SA 2H8HA 2PTKA 1M3AA 5IHNA 5GJWB 2RN8A 2JMAA 3TWQA 2L0AA 2L3SA 1K9AA 2ZGGA 4CZ2D 1AZGB 4RTVA 1Z9QA 3JXJA 2F2VA 5EIBE 5I22A 1BB9A 2VGEA 1UHCA 2LQNA 4J9IA 1AWOA 5ENSD 4DX6D 5KNHD 4JZ3A 3Q9UC 3J5QB 4OMOA 3W9GA 2EW3A 4F17A 1NYGA 3SO8A 2DWZA 2M0YA 4GMRA 1BLXB 2OI3A 1MX6A 2DJQA 2JM9A 1OPLA 5FW9A 2KRSA 5EYLA 3O5ZA 1W1FA 3EG2A 2K2MA 2XENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HRY A;  1K1B A;  4J7W A;  1PRM C;  2BZY A;  2YUO A;  1X2Q A;  2GGR A;  2LX7 A;  2C0T A;  2DBM A;  1PKS A;  2L3Q A;  2P4R A;  5HKP A;  2A5E A;  5JA4 D;  1OEB A;  2LCS A;  2MOX A;  1OY3 D;  2BZ8 A;  1JQQ A;  4J9E A;  5AQ7 A;  4HRL A;  2HEQ A;  2HBW A;  5CEA A;  1QCF A;  1AWJ A;  3HG0 D;  1OPK A;  5IXB A;  1B3Q A;  1YN8 A;  2K9G A;  2KE9 A;  3D9H A;  3JV3 A;  4NIK A;  3M0P A;  1NYF A;  1QYM A;  3UF4 A;  4Z89 A;  2OAW A;  2B0O E;  1N0R A;  5AQ9 A;  1PWT A;  4E6R A;  3F6Q A;  1W6X A;  5ENT D;  4CC2 A;  1QKX A;  4DX5 D;  2CH4 A;  1K0X A;  1MX2 A;  1UE9 A;  1VYU A;  4KRT A;  1T3L A;  4JB8 P;  1N5Z A;  1XOV A;  2FG0 A;  2FO0 A;  2XMF A;  3Q9N C;  2KYM A;  2KYB A;  3IQL A;  4QT7 A;  3V2X A;  2RFM A;  5EID A;  2CH4 W;  1ZBJ A;  2CSQ A;  4Z8A A;  1GCQ A;  2DMO A;  2QC9 A;  4U96 D;  3TSW A;  2P2C P;  5HCK A;  4HI9 A;  4TUM A;  1NLO C;  2RMO A;  1KSW A;  3AAA C;  1QLY A;  2F2W A;  2J06 A;  1BU1 A;  4HXJ A;  2AK5 A;  4RTX A;  5FIO A;  4RUG A;  1WXU A;  1G2B A;  5ECA A;  1H92 A;  5AQA A;  1IHB A;  2KXC A;  3I35 A;  1ZUK A;  2X3X D;  2EPD A;  4J9G A;  1UHF A;  3M0U A;  1GCQ C;  3UA7 A;  4HVV A;  1U5S A;  3VS1 A;  5FWC A;  1SVX A;  1WYX A;  1M3B A;  2M51 A;  2LJ3 A;  3H0F A;  1UJY A;  1A5E A;  3TWW A;  1SHG A;  4OMN A;  4CC4 B;  1H8K A;  2GTJ A;  2DNU A;  4HVU A;  1TR4 A;  3DEO A;  3NHN A;  4JJB A;  2NWM A;  1K0S A;  2V4H C;  4BEP A;  3SHW A;  1SHF A;  3TWV A;  3M0S A;  4K5A B;  5EN5 D;  2HDA A;  5CBO A;  4LE9 A;  3THK A;  1NEB A;  2LZ6 B;  4CYM D;  5ENO D;  5HS0 A;  2RNA A;  3EHQ A;  4RTY A;  1GBQ A;  1VYV A;  4BSZ B;  1VYT A;  3REA B;  3NMZ C;  1WX6 A;  3KEA A;  5KBA A;  4DUI A;  1TG0 A;  1WDX A;  1IXV A;  3QWY A;  4UUC A;  3TSZ A;  2BKG A;  3NOC D;  1PKT A;  4F1P A;  1NLP C;  2YUQ A;  4X1V A;  1RI9 A;  3TVT A;  2SEM A;  2ROL A;  1GRI A;  2DA9 A;  4HLL A;  3VRZ A;  1TUC A;  1ZUY A;  2DM1 A;  4DX7 D;  4ESR A;  1YWO A;  5ITZ F;  3EU9 A;  1WI7 A;  3AJI A;  5AN8 A;  2ETA A;  5EC7 A;  3UI2 A;  4IIM A;  2L6B A;  3ZKJ A;  2JXB A;  2RQT A;  2DRM A;  4J9H A;  2PNI A;  4HCK A;  1WDY A;  1BBZ A;  4ATZ D;  2FO1 E;  1X2K A;  4LUD A;  2D8J A;  1K4U S;  2DYB A;  1ZX6 A;  2KT1 A;  2DLP A;  3T8K A;  4DX1 A;  2EGA A;  4F16 A;  2D1X A;  2NUZ A;  4F14 A;  2DVJ A;  3B7B A;  5EYP F;  2AJA A;  1HD3 A;  1Y57 A;  4BER A;  3TWT A;  1NM7 A;  3I9Q A;  1AP7 A;  2KRO A;  1NFI E;  3TWX A;  2J6K A;  3TWS A;  3NGP A;  4M4Z A;  3EGU A;  3VS3 A;  2MIO A;  2OJ2 A;  2DRK A;  1OV3 A;  2ABL A;  4IIO A;  4QQI A;  2EGC A;  4D8D A;  2JS0 A;  2Y0B G;  2K6D A;  3HRA A;  2YUN A;  1ZLM A;  1JXM A;  1UFF A;  2FRW A;  3NBN B;  4O1P A;  3LJN A;  2CT4 A;  1I07 A;  1AEY A;  2DE0 X;  2CT3 A;  1ZUU A;  1QWE A;  1MV3 A;  2GQI A;  1V1C A;  2FPD A;  2F37 A;  1WFW A;  2CSI A;  1TUD A;  4G8L A;  2GNC A;  5FWB A;  3NPF A;  5ENR D;  4AG2 C;  3C5R A;  3T9K A;  2GBQ A;  3CQT A;  2Y1L E;  4CC7 A;  1HSQ A;  1YNZ A;  2J8S D;  2J05 A;  1IO6 A;  2V5Q C;  4ORZ A;  1CKA A;  4Z88 A;  4OAV B;  2DL4 A;  1UJ0 A;  2DL7 A;  1NEG A;  1M27 C;  1PHT A;  2XEE A;  1E7O A;  2FRY A;  2V1R A;  5AQB A;  2J6F A;  4WCI A;  5L23 A;  3ZNG A;  3UXG A;  1X6G A;  2BKK B;  3JUE A;  2V1Q A;  3V79 K;  1GCP A;  1GFD A;  2DL3 A;  4DX2 A;  2CRE A;  2ESW A;  3DEP A;  3ZUV B;  1E6G A;  1K76 A;  1ARK A;  2BZX A;  2EYY A;  2L2P A;  3M0Q A;  1MYO A;  4O60 A;  4YDY A;  1FYN A;  4ZNX A;  3PVL A;  1UUE A;  2K7A A;  4K5C A;  1U06 A;  2LP5 A;  2A28 A;  1KIK A;  4B93 B;  2SRC A;  4R0K A;  1JEG A;  1A0N B;  1AZE A;  4RLY A;  1S70 B;  2C0I A;  1U3O A;  1CSK A;  5JMN D;  1KFZ A;  4AFQ C;  2O2O A;  2JM8 A;  5IHI A;  2ETC A;  2XZD G;  2O31 A;  2YDL A;  1JO8 A;  4LG6 A;  2EVR A;  2HSP A;  1MV0 B;  4OMM A;  2LJ0 A;  2W0Z A;  4QFV A;  1PNJ A;  4RTU A;  3VS4 A;  4HB5 A;  4DRX E;  5CED B;  4RTT A;  1M30 A;  1I0C A;  2KXD A;  2JAB A;  4HNA D;  3C0C A;  3H0H A;  2EYW A;  1UG1 A;  3TWU A;  4ZHB A;  2F2X A;  2A37 A;  4J9F A;  3EG3 A;  1T0H A;  3EHR A;  2RQW A;  1H3H A;  2XEH A;  2D0N A;  4N5Q A;  3GBQ A;  4F6R D;  1CKB A;  4D8K A;  1AOJ A;  2ROT A;  2D8H A;  1MJ0 A;  4FSS A;  4BES A;  5IXF A;  3FJ5 A;  1AWW A;  3ULR B;  1AD5 A;  3H0I A;  2DVW A;  2AZV A;  3EG1 A;  2FPF A;  2RQR A;  5KWD A;  4LNP A;  1X69 A;  2KT8 A;  4Y92 A;  4AFU C;  2XZT G;  1MX4 A;  5CBN A;  3V31 A;  4GPM A;  4J9D A;  1K1Z A;  2B86 A;  4J9B A;  4K11 A;  1GBR A;  2J6O A;  1Z9Z A;  5I11 A;  4OMQ A;  4CC3 A;  2RPN A;  4ZFH A;  2KRM A;  1RLQ C;  2RQU A;  4RTW A;  2JMC A;  1AWX A;  1JXO A;  2JS2 A;  2DL8 A;  1K1A A;  2ETB A;  3W9F A;  3R6N A;  1GFC A;  1UTI A;  4JJC A;  2KXP C;  3UAT A;  1QKW A;  1X6B A;  3IXE A;  2CUD A;  5IH2 A;  5AAO A;  2HCK A;  2X3W D;  2F8X K;  3JXI A;  4HVW A;  1X27 A;  2KR3 A;  4RTZ A;  2KGT A;  3PE0 A;  1GL5 A;  2O9S A;  1SW6 A;  2E5K A;  3H41 A;  2RF0 A;  2O9V A;  1AVZ C;  2FPE A;  1SRM A;  3KFV A;  2ENM A;  4HRN A;  1LCK A;  3I5R A;  3VS5 A;  1ABQ A;  2EGE A;  1ABO A;  3RBB B;  2IIM A;  2K3B A;  2KRN A;  1BI8 B;  5EIL A;  2DF6 A;  1N0Q A;  1M3C A;  2QYJ A;  2ZGD A;  2J7I A;  2YT6 A;  2JT4 A;  1K3Z D;  2ED0 A;  2JTE A;  2YSQ A;  2YUP A;  4AG1 C;  1BK2 A;  2EBP A;  3ZU7 B;  2CUB A;  1UOH A;  1N11 A;  5BXU A;  5CEC B;  3EG0 A;  1VA7 A;  4DEY A;  3VS7 A;  1PRL C;  4OAU C;  3PVQ A;  2KEA A;  1I1J A;  4BET A;  4JJD A;  2W10 A;  3UTM A;  1JU5 C;  2ECZ A;  1DCQ A;  1M8M A;  1YYH A;  1G83 A;  4LUE A;  1YMP A;  2L3P A;  4J9C A;  4DEX A;  1X43 A;  4JPB W;  4LN2 A;  1OOT A;  2BTT A;  4U95 D;  1DC2 A;  2MYO A;  4U8V D;  3TWR A;  1E6H A;  3REB B;  2PZ1 A;  1BD8 A;  2PNN A;  2JW4 A;  1WLP B;  4K5B A;  1AWC B;  2C0O A;  1BI7 B;  2AZS A;  1BU9 A;  1MUZ A;  4EIK A;  5ENP D;  2G6F X;  2LQW A;  3VS2 A;  2MCN A;  1YP5 A;  4HBD A;  1FMK A;  4OML A;  1RUW A;  3ZL7 C;  2EYX A;  5CER B;  2VKN A;  1B07 A;  2VWF A;  2EKH A;  1HJD A;  4C48 B;  2AKL A;  1YWP A;  4YDW A;  1WG0 A;  3U23 A;  4JZ4 A;  3V2O A;  5AAR A;  1J3T A;  5BXO A;  2DL5 A;  4GBQ A;  4J8Y A;  2AKK A;  5FIN A;  5IHK A;  2DZN A;  2DIL A;  2KNB B;  1SRL A;  4AFS C;  1UGV A;  3VS6 A;  2CDT A;  2VVK A;  3QWX X;  4HQD A;  3V30 A;  2RFA A;  1QWF A;  2LMJ A;  4Z68 A;  1UDL A;  3B95 A;  3UA6 A;  2KBX A;  1W70 A;  2I0N A;  2KBT A;  5D66 A;  3VS0 A;  2O88 A;  1SSH A;  2LNH B;  5GJV B;  4O1O A;  1OT8 A;  2F8Y A;  4HRM B;  1SPK A;  4OMP A;  3A98 A;  4GLM A;  2A08 A;  4A63 B;  2DZO A;  2RQV A;  1Y0M A;  3RNJ A;  3SEM A;  2HE0 A;  2NYJ A;  2QDL A;  1IKN D;  1YCS B;  2ED1 A;  1NG2 A;  2EQI A;  1EFN A;  4G8K A;  1WIE A;  2EYZ A;  2FEI A;  3M0T A;  1SEM A;  4LSZ E;  1D9S A;  5ENQ D;  2A36 A;  2DBK A;  5KNG A;  4HI8 A;  1WA7 A;  2LJ1 A;  1WXB A;  1ZSG A;  2DX1 A;  3I5S A;  1WXT A;  4LNU D;  4U8Y D;  1G3N B;  1KJW A;  3J5P A;  3NOG D;  1S1N A;  2GTO A;  2K79 A;  1UEC A;  3M0R A;  1RLP C;  3LH5 A;  4AFZ C;  1T0J A;  3VRY A;  1T3S A;  2H8H A;  2PTK A;  1M3A A;  5IHN A;  5GJW B;  2RN8 A;  2JMA A;  3TWQ A;  2L0A A;  2L3S A;  1K9A A;  2ZGG A;  4CZ2 D;  1AZG B;  4RTV A;  1Z9Q A;  3JXJ A;  2F2V A;  5EIB E;  5I22 A;  1BB9 A;  2VGE A;  1UHC A;  2LQN A;  4J9I A;  1AWO A;  5ENS D;  4DX6 D;  5KNH D;  4JZ3 A;  3Q9U C;  3J5Q B;  4OMO A;  3W9G A;  2EW3 A;  4F17 A;  1NYG A;  3SO8 A;  2DWZ A;  2M0Y A;  4GMR A;  1BLX B;  2OI3 A;  1MX6 A;  2DJQ A;  2JM9 A;  1OPL A;  5FW9 A;  2KRS A;  5EYL A;  3O5Z A;  1W1F A;  3EG2 A;  2K2M A;  2XEN A; 
#chains in the Genus database with same CATH topology
 5D0O D;  2EFI A;  3LWI A;  1QVF P;  1R77 A;  3UT4 A;  4OF1 A;  2V0P A;  2YUO A;  1N8R U;  5G04 C;  3LJ3 A;  1RAE B;  4EMH A;  2V8S E;  2Y4U A;  1KHC A;  2DBM A;  2D0Q B;  5BW8 C;  4WUY A;  2L3Q A;  3LYI A;  1TH7 A;  3X25 B;  4EQF A;  5HKP A;  3ZHE B;  4GB9 A;  4IUV A;  2RHY A;  1N4P A;  2WM9 A;  2LCS A;  3DST A;  2OOE A;  3I56 Q;  4JA9 A;  5DIZ A;  3TAX A;  1KD1 C;  2BZ8 A;  1C1A A;  5AQ7 A;  1QVP A;  2HEQ A;  3OYI A;  1AWJ A;  1G3T A;  2OEW A;  1WQ7 A;  2GRP B;  2XCC A;  3J81 E;  4DOV A;  1YN8 A;  3NZS A;  4IKF A;  2RK2 A;  5BNW A;  1QYM A;  3CVX A;  5C6S A;  5LJ5 h;  1P92 A;  2RI5 A;  4M7D A;  4NL3 A;  3ONK A;  2RJE A;  5AQ9 A;  4JHK A;  1VQO Q;  3TL5 A;  1W6X A;  3UPU A;  3HTR A;  4N2S A;  2CH4 A;  1UE9 A;  3NB2 A;  1I8F A;  1T3L A;  4JB8 P;  4WWN A;  1N5Z A;  1XOV A;  3AU4 A;  2XMF A;  3Q9N C;  5GAM f;  3IQL A;  3V2X A;  4QVC A;  2RFM A;  3E4B A;  3CCQ A;  5D2M C;  5L8R E;  4A4G A;  2KCV A;  1GCQ A;  5FRO A;  1VQ9 A;  2RO0 A;  1RI0 A;  3WVD B;  1PD0 A;  2RMO A;  3E2U A;  4IUL A;  4HXJ A;  4QQG A;  1D09 B;  5FIO A;  2CG3 A;  1SG5 A;  2V26 A;  4F04 B;  1WXU A;  1G2B A;  3E1S A;  2XPZ A;  1H92 A;  3HXF A;  4ELZ C;  2EIK E;  3C3R A;  1B34 A;  2AXV A;  2F5K A;  4BE1 A;  4J83 A;  1X81 A;  3NZU A;  3RU0 A;  2MMP A;  2ATC B;  1GCQ C;  4Q69 A;  2ZCF B;  1U5S A;  3M0U A;  4I6G A;  5ARF A;  2FZK B;  5AJL A;  5FWC A;  2LCC A;  1YFN A;  2EIJ E;  1SHG A;  3AG4 E;  1Z5S C;  3L2W A;  3SDZ A;  2RK1 A;  1VQ4 A;  3FH7 A;  1Q82 C;  3BUA A;  2ZZD A;  3UIP C;  3JB9 G;  1JJ2 P;  1JWG A;  1VQK Q;  2HDA A;  1MHN A;  5GAO q;  3P8B B;  3ZXS A;  3X2Q E;  2LT4 A;  4WF2 A;  5LJ3 d;  2FI7 A;  4EMG A;  1VYT A;  1B34 B;  5AJD A;  3REA B;  3NMZ C;  4JVS A;  1W2B A;  1KT1 A;  2HMA A;  3CC4 T;  4OP0 A;  5T8I A;  3MP8 A;  5KBA A;  1IXV A;  3EU5 A;  3ULQ A;  3RDV A;  2QAS A;  2YUQ A;  4X1V A;  1U8R A;  3FUL A;  4FT2 A;  1GRI A;  4APO A;  1ZUY A;  2DM1 A;  4EHM A;  4DX7 D;  4ESR A;  2VSY A;  1UW4 B;  2WXF A;  5JHA A;  4G1T A;  3TRE A;  3ZXP A;  3VUZ A;  5EC7 A;  3KEZ A;  4IIM A;  3PZ1 A;  3H8Z A;  2FVU A;  2L6B A;  1G8X A;  2JXB A;  3Q1J A;  2DRM A;  1VQ7 Q;  1KZP A;  3BDU A;  4IN3 B;  3CCU A;  5A23 A;  4HCK A;  5KJL A;  4ATZ D;  1K4U S;  2D8J A;  2RG8 A;  4TXP A;  2QEX Q;  5AIJ A;  4ZTJ A;  2WVI A;  3LVQ E;  1NZN A;  2PQN A;  4URK A;  4DX1 A;  1GW6 A;  2NUZ A;  1NA3 A;  2LAI A;  1D1A A;  2CKK A;  1WNL A;  2DVJ A;  2QTX A;  1WHL A;  4BER A;  3TWT A;  3VU3 C;  2V5F A;  3JCM J;  2KRO A;  4ABN A;  3JYS A;  4A4E A;  1SSF A;  2JTF A;  4KVM A;  1N6A A;  5H7P A;  3X24 B;  4KVO A;  3NGP A;  3RR6 A;  1Q86 C;  3KSL A;  2MIO A;  1I81 A;  1S72 T;  4XTY A;  5FT9 A;  4QQI A;  2EGC A;  1OCZ E;  1YI2 Q;  3JCK C;  1FWZ A;  2VAS A;  1VDY A;  2E41 A;  2YUN A;  1VQ4 Q;  4JUV A;  3KD7 A;  5J08 A;  2VB6 A;  4M7D G;  1JXM A;  1Q7Y U;  4WNF A;  1BCM A;  1PC2 A;  3U66 A;  4ANU A;  1K8K G;  3FWV A;  2XGM A;  2VUB A;  4RG8 A;  2GQI A;  2FPD A;  1M90 U;  3L16 A;  4CT0 A;  1YJ9 A;  3QK0 A;  1D1C A;  4XAX B;  3G7Z A;  1VQO T;  1B89 A;  2GNC A;  2E6N A;  3U9W A;  1IB8 A;  2L3R A;  3CMA A;  1UGP B;  4RG6 A;  2J05 A;  1XQH A;  5GAN f;  3QDR B;  1VQ5 Q;  4AEZ C;  3OW2 P;  1VQL Q;  4LUN U;  1DVP A;  4DLO A;  2QA4 T;  5GAM d;  2Y4X A;  5EX3 A;  5FWQ A;  4M77 E;  3HXE A;  4J0U A;  4LNG A;  3HXC A;  5L23 A;  5LFA A;  3L42 A;  4BUG A;  2BKK B;  2V1Q A;  2V4L A;  1GCP A;  1HH8 A;  4PH4 B;  2YRC A;  1K76 A;  2EYY A;  2LCL A;  3QJY A;  3D9N A;  2RD1 A;  4YDY A;  3CSF A;  2R03 A;  2E0I A;  3FEX A;  3Q7A A;  1FYN A;  2GCX A;  4ZNX A;  1UUE A;  2LDM A;  4QQ6 A;  1S64 A;  2QTV A;  2GRQ B;  1KZO A;  3P8H A;  5T4Y A;  1JEG A;  2DTI A;  2Z0W A;  3AG2 E;  1S70 B;  4RLY A;  4PLL A;  2KAF A;  2C2L A;  4J8O A;  2J4D A;  3ZIM A;  3FIF A;  4CGW A;  1KFZ A;  1NZ9 A;  1Q2Z A;  1XTD A;  1F1B B;  4I9E A;  1MV0 B;  5CMW A;  1JCQ A;  4ATG A;  2W0Z A;  1OU8 A;  2EKO A;  3FH5 A;  1BI1 A;  3VS4 A;  4DRX E;  5CED B;  1ELR A;  5GAN g;  1EPU A;  4HNA D;  1MMN A;  2DK3 A;  3VTY A;  2EYW A;  1MNE A;  3H0H A;  3M55 A;  4ZHB A;  4M78 E;  1K9M U;  2A37 A;  3EG3 A;  3L54 A;  2EYQ A;  3ZFJ A;  4KT0 E;  3HKS A;  4F6R D;  4DQ2 A;  2ROT A;  4KBM B;  2NUP A;  2QI2 A;  1MJ0 A;  3E32 A;  2O01 E;  4FSS A;  5IXF A;  1YJ9 Q;  3ULR B;  2WXJ A;  1H6P A;  2AZV A;  3L1A A;  3FTY A;  2JVV A;  5LCW J;  3CVW A;  1YJN Q;  4AXH A;  1X69 A;  4KGZ B;  3MEA A;  4RCB A;  3S3M A;  5A7D B;  3KAE A;  2KT8 A;  4HKE A;  3RKW A;  1LNX A;  3FDR A;  2NLU A;  1MX4 A;  1VQ7 T;  3MHX A;  3EFO A;  1Q81 C;  2YNQ A;  4CDM A;  3CCQ T;  1KQS S;  2X9H A;  4MDW A;  4J9B A;  2VSO E;  1GBR A;  2PQR A;  2VC8 A;  1VQ9 T;  2ZGW A;  5JJ6 A;  4GYO A;  3U64 A;  2RPN A;  3PFS A;  2X51 A;  3EFS A;  2RQU A;  3EAE A;  3QKJ A;  3GPL A;  1VQP A;  2NUP B;  3KS2 A;  4DI4 A;  4Z02 A;  3QJZ A;  1GFC A;  3CEY A;  2LO6 A;  3C4S A;  4JRP A;  3PRE A;  2X6F A;  4ILI A;  2VQ2 A;  1V54 E;  5FZS A;  3CC2 Q;  3CKB A;  2ION A;  4C0E A;  4G24 A;  3EFO B;  2BTD A;  3CCS Q;  1VQ4 T;  3JXI A;  2KR3 A;  4RTZ A;  3GP8 A;  3PE0 A;  3UM0 A;  3SWN C;  2WXN A;  2E5K A;  2DCP A;  2RF0 A;  4U0Z A;  1AVZ C;  2VGY A;  2PL2 A;  3P2B A;  5KYW B;  3KFV A;  3JSC A;  3VS5 A;  5GAN 3;  1FT2 A;  4FM4 B;  4ZGJ B;  1YJW A;  3S3O A;  1N0Q A;  5CK9 A;  3EFR A;  3VTX A;  2QGG A;  2QYJ A;  3LS8 A;  2R59 A;  1IGU A;  1JJ2 A;  5BV0 A;  5AT1 B;  4JD2 G;  2J7I A;  2VGX B;  4LDX A;  3SFY A;  2JT4 A;  1WJS A;  2YUP A;  2KI7 A;  5FTP A;  5FRN A;  1W3B A;  3SBS A;  2P9I G;  1UOH A;  1N11 A;  3PH0 C;  4RSY A;  5DBK A;  5BXU A;  5CEC B;  3SQV A;  3CVY A;  1VA7 A;  3VLF A;  3EG9 A;  3ZBD A;  4P29 A;  1H0A A;  1TNZ A;  4OAU C;  3CCM A;  2DER A;  1KG1 A;  4BD3 A;  4JJD A;  4L7T A;  4BDY A;  2WAC A;  3S7F A;  2ECZ A;  1DCQ A;  1TEZ A;  4IUQ A;  4A53 A;  4EPZ A;  4NL2 A;  1XGW A;  4X34 A;  3V8K A;  1OWM A;  3GZS A;  1RAH B;  4JPB W;  3CCU T;  4BE0 A;  4LN2 A;  3ZYM A;  1MMD A;  3D9O A;  4M77 F;  4CRW A;  1PG5 B;  1YA0 A;  4OYS A;  1KHI A;  2RA2 A;  1G5V A;  3REB B;  1BD8 A;  4GTT A;  1FT1 A;  2XRY A;  1NPP A;  1E8Y A;  1AWC B;  4XTZ A;  1K73 C;  5E75 A;  3C12 A;  1MUZ A;  3GZ2 A;  3NQP A;  4JW1 A;  3UKR G;  1MZC A;  2CP2 A;  4AT1 B;  2RI3 A;  3HFO A;  2OND A;  2K57 A;  2IOS A;  2COZ A;  2E4H A;  4C48 B;  3SZ7 A;  3LKU A;  1X6O A;  1YWP A;  3U23 A;  4JZ4 A;  3V2O A;  5LCW C;  4GBQ A;  4J8Y A;  5ANL A;  1WHG A;  1OUL A;  2D6F A;  1KD1 R;  1JWF A;  3ISM C;  3QB2 A;  3Q75 A;  2MF2 A;  2X4W A;  3L9T A;  5G55 A;  5HK3 A;  8ATC B;  4HQD A;  3BEE A;  4PJO D;  4JHJ A;  4KYO B;  4RQI A;  2LMJ A;  4Z68 A;  1M5Q 1;  4FA6 A;  4ANJ A;  1YJ9 T;  3S6W A;  1JBM A;  3JB9 H;  4M78 F;  4GTO A;  3FU3 A;  4GAA A;  4F53 A;  1TU0 B;  3BW1 A;  4NOY A;  4OMP A;  3A98 A;  1VQ6 A;  1HF8 A;  4A63 B;  3LGL A;  5A0G A;  4G25 A;  2QDL A;  2ZPF B;  2ED1 A;  2RJF A;  4Y28 E;  3CMA T;  3ME9 A;  5CCL A;  3FUJ A;  1X75 C;  3PEV B;  4C0Z A;  4I1M A;  4B8C B;  2HL5 C;  1SEM A;  2QDY B;  2I6H A;  4AV7 A;  3FU0 A;  2A36 A;  3CCM Q;  3CBM A;  4E2F B;  3ENE A;  3FTW A;  2ZPE B;  4KH1 B;  2CZ1 B;  5KNG A;  5GAN 7;  3RKV A;  5ANR A;  1WA7 A;  3EGD B;  5CMY A;  4LD6 A;  4C5E A;  3PNW C;  1K8A C;  3FUD A;  4HA8 A;  4G23 A;  4FW1 A;  1ZSG A;  1IQU A;  4GTP A;  4RVB A;  4LNU D;  1RAD B;  1KJW A;  4NRH B;  3J5P A;  3OMC A;  2VXE A;  1JCR A;  2K79 A;  1UEC A;  4RMO A;  3OYL A;  3OW2 A;  2VJ8 A;  3ZYK A;  1T0J A;  1UGS B;  5KH6 A;  5LX8 A;  4HOQ A;  4Y6C A;  1M3A A;  2PM7 A;  5FU7 C;  2DIW A;  3A5Z B;  2CHW A;  3M4G A;  4E7Z A;  1TNO A;  1AZG B;  4CZ2 D;  3HRT A;  4RTV A;  2L9B A;  3JXJ A;  2EQK A;  3T5V A;  1TNU A;  5KE2 A;  5FU7 B;  4EBA A;  3AHU A;  1Q95 G;  4HT9 A;  5LOZ A;  5ENS D;  4ZGE B;  3J5Q B;  4E7S A;  3OAW A;  4F17 A;  1NYG A;  4IUR A;  3FTZ A;  3SO8 A;  1H64 1;  1BCO A;  2JOY A;  1BLX B;  2OI3 A;  3FB9 A;  1BIB A;  3QDN A;  1TJF A;  4M77 A;  3LDZ A;  3FUH A;  5CCM A;  5FW9 A;  2KRS A;  2EWN A;  4KZ0 A;  5GMK l;  3DSU A;  4M7C A;  3EG2 A;  2GRM A;  4EDU A;  8AT1 B;  1UEB A;  2DD5 A;  4ILG A;  4J7W A;  2BZY A;  1LD8 A;  1KQS P;  4XU0 A;  4A3T A;  2C0T A;  5B1A E;  2GQV A;  4YVQ C;  3RKX A;  3C3Q A;  1VQ6 Q;  2P9L G;  2J07 A;  3FU6 A;  4L2L A;  1D3B A;  2WSE E;  2B8A A;  3B7U X;  4N0A C;  4HRL A;  3OY9 A;  2DXC A;  2HBW A;  3MKQ B;  2CYZ B;  1OPK A;  4M77 B;  3CHO A;  5IXB A;  3PIP A;  3FH8 A;  3RMQ A;  2K9G A;  2KE9 A;  2OTJ A;  3NTI A;  3JV3 A;  4NIK A;  4OVU A;  4II1 A;  2JJ9 A;  1VQP T;  2J4B A;  3UF4 A;  3S3N A;  4E85 A;  2HO1 A;  3CPW S;  3B7R L;  5G04 J;  4HCC A;  1RZ4 A;  3R9A B;  4M78 A;  5A2Q E;  3F6Q A;  4A55 A;  1L5J A;  3GF5 A;  4CC2 A;  3MO8 A;  1VYU A;  4JS5 A;  3G2V A;  2FG0 A;  2H6H A;  4YDO A;  4ME7 A;  2CSQ A;  1ZBJ A;  2FL7 A;  4L6V 5;  3L08 A;  2DMO A;  2IO2 C;  2QC9 A;  3TSW A;  2P2C P;  4C9B B;  4HI9 A;  4TUM A;  2PVD B;  2FEZ A;  1KSW A;  2F2W A;  1BU1 A;  3QPH A;  2JTM A;  2AW6 A;  3D9K A;  3MPU B;  1P5Q A;  5KCH A;  1YJW T;  4XTV A;  5J39 A;  3I55 A;  2RI2 A;  3JCM h;  1IHB A;  4M78 B;  2GW1 A;  4PFZ A;  1WM5 A;  3M58 A;  3EJN A;  1SVX A;  2M51 A;  2LJ3 A;  3H0F A;  4OMN A;  4CC4 B;  4K0R A;  3TWW A;  4ILH B;  1TSF A;  4C8Q D;  4C0F A;  3G2T A;  3RO3 A;  2BE7 D;  3DEO A;  2YLB A;  4KGV B;  5GMK e;  3CEQ A;  4FAD A;  3M57 A;  3CCM T;  1K0S A;  2V4H C;  4BEP A;  4L23 A;  3L13 A;  4GZ5 A;  4I6J A;  3DWL G;  2IU1 A;  3TWV A;  4BT8 A;  1SHF A;  3QUI A;  3SHW A;  3L2R A;  4K5A B;  5EN5 D;  2MYS A;  1KC8 C;  5CBO A;  3THK A;  4E7I A;  4FYY B;  2GRR B;  3J7A F;  5ENO D;  2MWP A;  3TU4 K;  3EHQ A;  4RTY A;  5IN1 A;  5LJ3 f;  4BSZ B;  3VLE A;  1ZHI A;  5CKE A;  3UM1 A;  3DBS A;  3G4S A;  4EBA G;  4DUI A;  4U7E B;  3TXM A;  1O1S A;  4LER A;  4UUC A;  1M9S A;  1JRI A;  4FJY A;  2WSC E;  1PKT A;  3VKI A;  1NLP C;  1RI9 A;  3QWP A;  4KT6 B;  2ROL A;  3VRZ A;  2LNI A;  1TUC A;  2YRD A;  1S0P A;  3B13 A;  5EDS A;  3HDX A;  3ML9 A;  1X01 A;  1WI7 A;  3AJI A;  2A5U A;  2RHI A;  4M77 G;  4MMK A;  1KLX A;  4PS8 A;  2DTH A;  1N8R C;  2RQT A;  2PNI A;  1VIF A;  4X8Q A;  3RRM B;  1X2K A;  4LUD A;  5GMK m;  2XHE A;  4JDS A;  4XK8 E;  3T5X A;  3HFN A;  2DLP A;  2LTO A;  3UM2 A;  3DPY A;  5I21 A;  1MQS A;  3SI5 A;  2D1X A;  5JHB A;  3TQ7 P;  2A3L A;  3OS1 A;  4BT9 A;  2HNI A;  3G71 A;  1NM7 A;  1OQK A;  4FYV B;  3JCM f;  5GAN 2;  2RM4 A;  1AP7 A;  4FCY A;  1NFI E;  3TWX A;  3I55 Q;  3Q49 B;  2VXF A;  5LJ3 g;  3JAM E;  1IYG A;  1SF9 A;  3HRU A;  2J6K A;  3TWS A;  1O5M A;  1OX8 A;  4J7I A;  1VQ6 T;  4B94 A;  3CVL A;  3VS3 A;  3JCM P;  2DRK A;  1OV3 A;  3AU5 A;  3QSU A;  2WXI A;  3I4R B;  4FJZ A;  4C92 D;  2GRN B;  4MZT A;  4KBQ A;  2JNG A;  2JS0 A;  2Y0B G;  2DJZ A;  4I43 A;  4WWP A;  2GF7 A;  3MYV A;  2WPV A;  1S72 Q;  1BI2 A;  1UFF A;  5CKH A;  4M78 G;  1N4S A;  2FRW A;  4C5I A;  5FLX E;  4ACL A;  1D1B A;  2CT4 A;  4XTW A;  2CT3 A;  2WQ7 A;  1ZUU A;  2X6H A;  2KCK A;  2PVO B;  3EHM A;  2KZT A;  3H9N A;  5CRU A;  3QHS A;  3CVV A;  3NTK A;  3LYA A;  4MDX A;  2RD0 A;  4G2V A;  4J8E A;  1U1T A;  3KSQ A;  4FU6 A;  1IHG A;  3FDH A;  1UGQ B;  3LH0 A;  5GAN 4;  1HZ4 A;  2C0M A;  5HY6 A;  5FWB A;  5ENR D;  3MCA B;  3T9K A;  4HLE A;  3ESL A;  2E5Q A;  3UMV A;  2I2L A;  3G4S Q;  3CHS A;  5CR2 A;  4PJO C;  1OX9 A;  5GAO l;  2J09 A;  4WTO B;  4TVR A;  2K5L A;  1IO6 A;  2KCL A;  1O1R A;  2V5Q C;  1U3C A;  4GU5 A;  1CKA A;  1TTH B;  1TS9 A;  1D8E A;  3ASN E;  1NBE B;  3RSE G;  3FJP A;  2DL4 A;  4PJO B;  1PHT A;  1XJW B;  2O4X A;  4UQX A;  2V1R A;  2E3I A;  3CV0 A;  5DLO A;  2J6F A;  3OYH A;  2QGF B;  1UB4 A;  2KZT B;  3UXG A;  2EQM A;  1G3S A;  3QAR A;  4KMO A;  1TYQ G;  2QA4 Q;  2YWW A;  2ESW A;  2ZXW E;  3QDF A;  2P84 A;  2WMN A;  4AJW A;  2YHT A;  4PFP A;  3RES A;  4QVD A;  1M1G A;  3U4T A;  3GNG A;  1MYO A;  3VYG A;  4UWF A;  2K7A A;  2QG9 B;  4K5C A;  4HOU A;  2G3R A;  1U06 A;  1KQ2 A;  1DCE A;  1NJI R;  4A54 A;  4U8H A;  4B93 B;  1RAA B;  3TG4 A;  2SRC A;  4R0K A;  1YIT A;  4HOS A;  3BE3 A;  4ANV A;  4N4H A;  1A0N B;  1IRE B;  2L5Q A;  4EMK C;  2AXZ A;  1U3O A;  5JMN D;  4GMJ A;  2JM8 A;  2O4X B;  1OUV A;  2XZD G;  5BPP A;  2YDL A;  5KYX A;  4HS2 A;  4LG6 A;  2R17 C;  2EVR A;  2HSP A;  1X5B A;  4GZ6 A;  4EMK B;  2LJ0 A;  4QFV A;  2UY1 A;  2M02 A;  4RTU A;  3H6Z A;  2LRQ A;  2ZIS A;  4M7A D;  4VUB A;  2V8I A;  1HU3 A;  1I0C A;  3CPW P;  1LOJ A;  1KQS A;  5EKQ D;  4FHK A;  3TWU A;  3UT1 A;  2OTJ T;  4IUT A;  5GAM g;  1ZA1 B;  2P4T A;  4J9F A;  3JCM b;  3FC3 A;  4BI3 A;  4D8K A;  5CHE E;  4A4H A;  1VQ8 A;  3CCE A;  4NQ0 A;  4BES A;  3FJ5 A;  3WVE B;  1AWW A;  5LJ5 f;  3EG1 A;  2LVM A;  2FPF A;  3QOU A;  2DXB A;  3G6E A;  5KWD A;  3URZ A;  2BUD A;  4B89 A;  4TXQ A;  4N39 A;  1SA4 A;  5KYX B;  1QCO A;  3B7S A;  4FLB A;  5CBN A;  4GPM A;  4WND A;  4Y6W A;  1K1Z A;  2UY1 B;  1ZSZ C;  4DA4 A;  4K11 A;  2Y69 E;  2A4Z A;  1Z9Z A;  2I2O A;  4OMQ A;  4EPC A;  4J8F A;  1WAO 1;  3PIO A;  3SD4 A;  1RLQ C;  3CCQ Q;  2WXH A;  3FTV A;  1QZ2 A;  2JS2 A;  3BY7 A;  1VQ9 Q;  3I55 T;  4MBG A;  3RRN B;  4C5H A;  1O75 A;  4JJC A;  1Q7Y C;  3C3O A;  1RAF B;  3CVU A;  1QKW A;  1HK9 A;  3JCM d;  2CUD A;  2CP3 A;  5AAO A;  3CQC B;  1M90 C;  2L6J A;  3DLL A;  2MPX C;  3MX3 A;  2KMT A;  3UT8 A;  2VYT A;  1YIT Q;  3DXK G;  1LJO A;  2FZG B;  2KGT A;  4J8D A;  5LJ5 g;  1OWO A;  1PAQ A;  2O9S A;  2XGS A;  3JCM X;  4GPK A;  2DXT A;  2IPO B;  2ZPB B;  4HRN A;  1LCK A;  1R0B G;  4KZC A;  1YBY A;  5D6W A;  5HQ8 A;  1ABO A;  3RBB B;  2IIM A;  2K3B A;  2DF6 A;  4XZ4 A;  3MV3 B;  1M3C A;  1RAI B;  1ZQ1 A;  1JCS A;  3G4S T;  3SFM A;  2K5I A;  1FX7 A;  2WXQ A;  1TUG B;  5GAO m;  2QK0 A;  3LLR A;  3M9Q A;  1E8W A;  4N3A A;  2ED0 A;  2JTE A;  3QYH B;  4PLI A;  4AG1 C;  1BK2 A;  5GMK i;  3TCJ A;  3ABL E;  3IV0 A;  4DEY A;  3S7D A;  3PZ3 A;  3E30 A;  4PJM A;  2ZPI B;  4HT8 A;  1M8M A;  3CXC S;  2WXP A;  3ASK A;  4LUE A;  3LW5 E;  1YMP A;  5CIU A;  1X43 A;  5GMK j;  4XKC A;  1Y7X A;  4C8Q C;  3UX4 A;  3CCR A;  2P0K A;  4QVZ A;  3UPV A;  5DY9 A;  1OWP A;  4U95 D;  4M75 D;  4M3O A;  1HG5 A;  2FBN A;  3LVR E;  3TWR A;  1E6H A;  2R58 A;  1TJC A;  2QAZ A;  3CCU Q;  2PNN A;  3FTU A;  3ABM E;  2C0O A;  4JLG A;  1EYH A;  2RH2 A;  2H6F A;  2E10 A;  2G6F X;  4KH0 B;  1K9M C;  4HBD A;  3JUI A;  3FUE A;  2X6K A;  4AP2 A;  3UKU G;  4HOR A;  3CVQ A;  1FMK A;  3AT1 B;  2OTL A;  1H6O A;  3MP6 A;  1YHQ A;  4JRI A;  1B07 A;  2EKH A;  1HJD A;  4B9W A;  4YDW A;  2DEU A;  5BXO A;  2FHD A;  3FEO A;  2AXU A;  1XNI A;  1IHV A;  2DIL A;  1SRL A;  4ANW A;  2VGN A;  2NSZ A;  5GAN 5;  2M63 A;  1BKB A;  2CDT A;  1EF1 C;  1QVF A;  1SA5 A;  2R57 A;  4PFO A;  4B0Z A;  4DBR A;  1UJK A;  1HG2 A;  2RFA A;  4PUC A;  5GAM e;  3L2Q A;  4J6Y A;  4BI4 A;  4TRQ A;  1UDL A;  3B95 A;  2MI6 A;  3V8L A;  2QQA A;  3NTH A;  2DIQ A;  5CQY A;  1W70 A;  5D6Y A;  5KYU B;  3NF1 A;  1SSH A;  2LNH B;  5GJV B;  3CCJ A;  1OT8 A;  5CCA A;  4PKC C;  2F8Y A;  4HRM B;  4OVA A;  4GLM A;  3CHR A;  3CD6 A;  2XU8 A;  1Y0M A;  2HE0 A;  2FB7 A;  5LJ5 d;  4YDE A;  5D6X A;  2P58 C;  2K4Y A;  5KCO A;  2R5A A;  1EFN A;  3UWN A;  4R55 A;  4G8K A;  1WIE A;  4RG9 A;  1M1K U;  2FEI A;  3M0T A;  4LSZ E;  2XS1 A;  3QC1 A;  1D9S A;  4K03 A;  3CMA Q;  2DBK A;  5KJN A;  3VUB A;  3NFC A;  3ABK E;  1BI3 A;  3CCL A;  1WXB A;  4AY6 A;  4C92 C;  2J49 A;  1WXT A;  4L2Y A;  4U8Y D;  5G2N A;  5KYW A;  2XI9 A;  4CDR A;  3CCR Q;  2LQK A;  4LD9 K;  1M8V A;  5M9O A;  2QQS A;  3ZVV A;  2L0I A;  3SWN A;  4I9C A;  4O6F A;  3RO2 A;  4GY5 A;  3PNT B;  3CHQ A;  1DJ7 B;  4C92 B;  2CHX A;  1ZBP A;  3D9P A;  3DSS A;  1PM3 A;  1YIT T;  2XK0 A;  1UN9 A;  3WXX A;  3GW4 A;  2L0A A;  2VGM A;  1K9A A;  1Y6I A;  3LGF A;  1ZB1 A;  5FQ6 A;  5J90 A;  2VGX A;  2DEQ A;  1N27 A;  1HXI A;  2VGE A;  2COY A;  3CKC A;  2OTL Q;  2F69 A;  4H7X A;  1YHQ Q;  1AWO A;  4KXK B;  4DX6 D;  1KT0 A;  2VYI A;  4JZ3 A;  2IEJ A;  3JB9 I;  1FXX A;  3P1U A;  3CLJ A;  1NE8 A;  2M0Y A;  4UQZ A;  2CFZ A;  4O5V A;  2DJQ A;  3L6A A;  2CFU A;  1HS6 A;  1OPL A;  3MEV A;  3SWN B;  1I5L A;  4Q96 A;  4PJL A;  2BIV A;  4D10 C;  2K2M A;  2XEN A;  2OV8 A;  2YIN A;  4C0D C;  1LF8 A;  2BF0 X;  4GTV A;  3PGG A;  3CCE T;  1SQM A;  1K1B A;  5HRY A;  3DSV A;  4BAC A;  1PRM C;  3OBY A;  3G6E T;  1X2Q A;  4TUU A;  2GGR A;  2HQH A;  2XDB A;  3F70 A;  1PY1 A;  2HKQ B;  4L9P A;  1PKS A;  2P4R A;  3CPW A;  4L59 A;  4C0D B;  4XI0 A;  2A5E A;  4E47 A;  1OEB A;  1WHH A;  1O9S A;  3RAU A;  1OY3 D;  4HFG A;  3SD5 A;  1E8Z A;  2HYZ A;  4G11 A;  3ZYL A;  1JQQ A;  2X6I A;  1QCF A;  3HG0 D;  1M1F A;  3I3N A;  1VQM A;  3Q78 A;  1NYF A;  2JUF A;  2L89 A;  4Z89 A;  3JB9 D;  1R0C B;  1RW2 A;  4M7A C;  2B0O E;  1N0R A;  3RJV A;  4E6R A;  4GTM A;  3FUK A;  4G26 A;  2Y4Y A;  2E2E A;  1VQP Q;  5JJ7 A;  2DFU A;  4I1A A;  4DX5 D;  1IRX A;  2FZC B;  4KRT A;  2FO0 A;  4JLI A;  2KYM A;  4QT7 A;  2KYB A;  3GZ1 A;  3Q5M A;  2CH4 W;  4PJO E;  2WXO A;  4JXT A;  2DXU A;  3JQ0 A;  1NJI U;  5BV1 A;  5HK0 A;  4U96 D;  1M2O A;  2R5S A;  3IKO B;  3QII A;  3TGO A;  3OSS C;  2AK5 A;  2Y3A A;  2LX9 A;  4A4K A;  3D3M A;  3BQO A;  4BB7 A;  5ECA A;  1YCY A;  5GAN e;  5B1B E;  3EGD A;  2XEV A;  5KJM A;  2P9U G;  3DXM G;  3UUX A;  2IVW A;  2EPD A;  4XEI G;  1C0M A;  3FU5 A;  1UHF A;  3UA7 A;  1YJW Q;  1WYX A;  4GCO A;  1UJY A;  1A5E A;  1QBQ A;  3CXC P;  2GTJ A;  3BG1 B;  4HVU A;  1TR4 A;  5CVI A;  2NWM A;  3RKY A;  1HO8 A;  5LJ3 j;  3VLD A;  5LL6 S;  3M0S A;  4RCC A;  2NC9 A;  2LT1 A;  4F7A A;  3E33 A;  4H7Y A;  2HQE A;  4NUR A;  4LDU A;  2LZ6 B;  4CYM D;  3CCR T;  2RNA A;  4R56 A;  1GBQ A;  1VYV A;  2J9Q A;  4A1G A;  1FPP A;  3D9J A;  3MEW A;  1A17 A;  3KEA A;  4NAC A;  1UGR B;  1VQM Q;  1YIJ A;  2RHX A;  1EIF A;  1FMV A;  1TG0 A;  3O8V A;  1GXI E;  3QWY A;  2COW A;  3CVP A;  4BTB A;  4BX8 A;  4M7D D;  4ME2 A;  2R02 A;  2Q7F A;  2MRI A;  2RJC A;  1TN7 A;  3PEU B;  2DIG A;  3E19 A;  3ZEH A;  2LQ8 A;  2OTL T;  3MGB A;  1YHQ T;  5ITZ F;  2C06 A;  5AN8 A;  1TNY A;  1NPR A;  2NUT A;  1N4R A;  2ETA A;  1W4S A;  3FLG A;  5IAY A;  2RKK A;  3KUF A;  1Q82 R;  3ZKJ A;  2E12 A;  4J9H A;  4QW2 A;  1Y8M A;  2EJG A;  2XS8 A;  1WDY A;  1G3W A;  2FO1 E;  1LD7 A;  3HP9 A;  2XPY A;  2EIF A;  5CAI A;  2WSF E;  2K3Y A;  4UI9 C;  2KT1 A;  4LDY A;  3T8K A;  4F16 A;  1QP3 A;  3HVE A;  3MKQ A;  4FL6 A;  4BY6 A;  2EQX A;  4N0A A;  3ONL A;  2ZPH B;  4OGE A;  3WXM B;  3B7T A;  4W9R A;  5CO7 A;  3ZPJ A;  3OYN A;  4M4Z A;  2K5F A;  4GCN A;  4M75 C;  2NUT B;  2ABL A;  4IIO A;  2YLC A;  1N54 A;  3IHY A;  2NYS A;  3HRA A;  4M75 B;  5KE3 A;  1C6V X;  3QWW A;  5GAO n;  3OYA A;  4BY6 C;  1ZLM A;  3OYE A;  1OWL A;  4JRQ A;  5I2M A;  2AIR B;  3KBG A;  4O1P A;  3CCL T;  2CP5 A;  1OWN A;  1AEY A;  3HVE B;  4PS7 A;  2DE0 X;  3AS8 A;  3ML8 A;  1MV3 A;  4BY6 B;  4ZGD B;  2F37 A;  4BDZ A;  4U0S A;  2CSI A;  1WJR A;  2IOL A;  3MV2 B;  4G8L A;  3FFL A;  4J6I A;  2WXK A;  2EAY A;  3JB9 J;  3NPF A;  5GAM j;  3DPD A;  4PK4 A;  1YIJ Q;  4GA1 A;  5LP0 A;  3CQT A;  4MZP A;  2FYK A;  2Y1L E;  1QMC A;  3PUJ A;  1LPL A;  4CC7 A;  1HSQ A;  4YVO A;  1YNZ A;  4F7U B;  2KM4 A;  1Q86 R;  4Z88 A;  3M59 A;  3JCM V;  1UJ0 A;  1NEG A;  5DM7 R;  1FVF A;  3FP3 A;  3BG0 B;  1HX8 A;  3WG7 E;  2L8D A;  1BI0 A;  1JJ2 S;  4PJO F;  3KXT A;  2EIN E;  3DB3 A;  3JUE A;  3QG1 A;  4XE0 A;  3PDN A;  1QP2 A;  3E9G A;  3DSX A;  3DEP A;  3EG0 A;  2BZX A;  2L2P A;  4C8Q E;  5FU6 C;  3DRA A;  3QJ6 A;  2V8K A;  2I1K A;  4Q94 A;  2AHJ B;  3PZD A;  4BFR A;  3QBY A;  4I17 A;  2LP5 A;  1KIK A;  4AY5 A;  1VQN A;  1HE8 A;  2ILR A;  5C0M A;  1N94 A;  1HFA A;  2CP0 A;  2R5M A;  1VUB A;  5A0D A;  2PZI A;  2DYI A;  2DYS E;  3FHE A;  4AFQ C;  5IHI A;  1TNB A;  1TN8 A;  2ETC A;  2CS7 A;  2KQW A;  4ZN1 A;  4OMM A;  2QQB A;  3CME A;  1PNJ A;  2IG0 A;  2YHC A;  4JZY A;  3A8L B;  4FT4 A;  1QVG S;  1E96 B;  1M30 A;  4GZ3 A;  2XD0 A;  2KXD A;  2JAB A;  5FQ8 A;  3C0C A;  5B3S E;  1UG1 A;  3MET A;  2F2X A;  1VQM T;  5C1D A;  3EHR A;  4JEH A;  2XEH A;  2VTB A;  2D0N A;  2HL3 A;  4N5Q A;  2M9U A;  3JCM W;  3OYJ A;  5FQ4 A;  1CKB A;  3GIB A;  1AOJ A;  1JUQ A;  1PSF A;  2EJ9 A;  2OTJ Q;  3I56 A;  3H0I A;  2DVW A;  2R2L A;  1E90 A;  2IFU A;  4F1S A;  2EQU A;  2HM8 A;  2RB6 A;  5HI7 A;  3FEY A;  3S7B A;  4AFU C;  4J8S A;  1KK7 A;  4AMC A;  2XZT G;  2XKO C;  1OZ2 A;  4PL6 A;  4KUL A;  2DYR E;  4AOF A;  1N9S A;  4KUD K;  2IY0 C;  5KJK A;  2FF4 A;  2DZC A;  3OYG A;  4CDN A;  3U3W A;  5I11 A;  4J5Y A;  3MKD A;  3OXF A;  4BTA A;  4ZFH A;  2VTB B;  4GLK A;  4RTW A;  1V55 E;  5C2Y A;  3ZGQ A;  1AWX A;  1JXO A;  2GFU A;  2KK4 A;  3D9L A;  2ETB A;  3R6N A;  1RL2 A;  2WXM A;  5I2S A;  5EX0 A;  2QFC A;  4C92 E;  2LXL A;  4JJN K;  3LXU X;  5J3B A;  3UAT A;  3AG3 E;  3L22 A;  3G2W A;  2MK5 A;  3J80 E;  5IH2 A;  4U07 A;  2DET A;  2HCK A;  3X20 B;  1VIE A;  3E37 A;  4RKU E;  3RIR A;  3V7R A;  2KDS A;  2KC7 A;  4XU1 A;  3H41 A;  4P5N A;  2E65 A;  4KUI A;  3OS0 A;  1Q81 R;  1FMW A;  3K9I A;  1D0Z A;  2QYU A;  3RER A;  2BKD N;  4N2Q A;  2M0O A;  4PJO A;  2EIL E;  3OBW A;  4OB3 B;  3CXC A;  2IJG X;  2OCC E;  2KRN A;  1BI8 B;  3BFM A;  3G1J A;  5GAO p;  4ACK A;  4CEM A;  3DLM A;  3FUI A;  3OQ5 A;  2I9C A;  2WQH A;  2P9P G;  3RUX A;  1YIJ T;  4FHJ A;  2Y90 A;  2OAU A;  4QKU A;  2RHU A;  2YT6 A;  5GAN j;  3ASO E;  1Y71 A;  1K3Z D;  3ZEF A;  4N3C A;  1OZ3 A;  2YSQ A;  1OCO E;  1VQK A;  1TXQ A;  4JPS A;  3ZU7 B;  3ULY A;  3HIZ A;  3VS7 A;  1PRL C;  2X4Y A;  1SKU B;  3PVQ A;  1I1J A;  2W10 A;  3ZN3 A;  3N5B B;  3UTM A;  3LPZ A;  3JCM g;  3ZYQ A;  2XID A;  1YYH A;  4GYW A;  2VV5 A;  5DLQ E;  1G83 A;  1Z3X A;  3SHF A;  1E8X A;  4MLP A;  4DEX A;  1SZA A;  2L0T B;  2I1J A;  1OOT A;  3P8D A;  4EMK A;  1DC2 A;  4N4I A;  4OB0 B;  3SNX A;  2PZ1 A;  1H3Z A;  1OXJ A;  2JW4 A;  1WLP B;  2CG2 A;  4J6W A;  1BI7 B;  5G05 C;  2AZS A;  3OMG A;  3LY8 A;  3OYY A;  4C8Q F;  5ENP D;  5T3R A;  1KD1 U;  4XI9 A;  3L17 A;  4E7H A;  3VS2 A;  1WHM A;  2CZ6 B;  2MCN A;  3QO3 A;  4M7A E;  3C95 A;  1VQ7 A;  2FUL A;  1RUW A;  4GZC A;  3ZL7 C;  5CER B;  2VKN A;  3G71 Q;  1ZA2 B;  5AEN A;  2EJF A;  2AKL A;  2M1H A;  2QEX A;  5AAR A;  4LDW A;  2DL5 A;  3I4G A;  4M7D C;  3A8H B;  4J7F A;  5FIN A;  5IHK A;  1BPO A;  1OU9 A;  4DBH A;  2BED A;  2XIC A;  4UWL A;  4XTX A;  4AFS C;  4A4F A;  3VS6 A;  4M7D B;  4HCZ A;  4XQ3 A;  3V30 A;  3OB9 A;  2F1L A;  1QWF A;  4GTR A;  2P9S G;  1QQJ A;  4U04 A;  3OXG A;  1ZSZ A;  2GRO B;  3FUF A;  1FVH A;  2KBX A;  3VS0 A;  3M5A A;  4LXC A;  5D66 A;  2M16 A;  4E7L A;  3V8J A;  1UJJ A;  4O1O A;  3RK6 A;  2DPP B;  1SPK A;  4E7J A;  1YI2 A;  1JPL A;  3RNJ A;  1K73 R;  3SEM A;  7AT1 B;  4PJJ A;  3Q4A B;  1YCS B;  3L2V A;  4MKT A;  4ANX A;  2A7Y A;  3QYG B;  3PMI A;  4BE2 A;  3CPF A;  1MND A;  2MHK A;  2JEK A;  1RAG B;  4ATO A;  1AT1 B;  2QXF A;  2OX7 A;  4CCA A;  2ZAE A;  1PD1 A;  4HI8 A;  2QQR A;  4IUP A;  3FRN A;  1DNP A;  3LY9 A;  4L1B A;  2DX1 A;  1ZSZ B;  4MML A;  4XKB A;  2MWO A;  1BYM A;  2E70 A;  3ASG A;  1NL4 A;  3NOG D;  3PS6 A;  2GTO A;  3M0R A;  4FSX A;  3LH5 A;  1Q82 U;  1VQ5 A;  1T3S A;  5J26 A;  2H8H A;  3CCV A;  1Z3Y A;  3OYD A;  1VQL A;  3JRZ A;  5GAN h;  3SY2 A;  2RN8 A;  1QNF A;  1VQN T;  4C92 F;  4JRK A;  3TWQ A;  4HCB A;  2ZGG A;  5LJ3 e;  2QY7 A;  4C0G A;  2F2V A;  4PJO G;  4DPR A;  1QVG P;  5I22 A;  4CT4 A;  3A8G B;  4YTL A;  1WGS A;  1BB9 A;  2LQN A;  4UI9 K;  4J9I A;  4PNO A;  1MHQ A;  1HYO A;  4PS3 A;  3CME T;  3L2Z A;  2EW3 A;  4XU2 A;  3ASF A;  3CHP A;  5E76 A;  2PVG B;  2KY9 A;  3IEG A;  2XDP A;  2JM9 A;  1U3D A;  5IY5 E;  1K8A R;  2X4J A;  1IQR A;  3LWH A;  2GFA A;  3CBO A;  4N5C A;  4UWH A;  4BX9 A;  3VV0 A;  1H2V C;  3VJP A;  4U0U A;  3SBT B;  3JQ1 A;  4JEU A;  3I56 T;  3FUM A;  5KCM A;  2LX7 A;  3OS5 A;  4C8Q A;  2VSX E;  4GTS A;  3UQ3 A;  3D9M A;  3HXB A;  1VQ8 Q;  5JA4 D;  4FC8 A;  2WXR A;  3CCE Q;  2K3X A;  2EQJ A;  3DB4 A;  1RAC B;  4BWR A;  2MOX A;  3VYH B;  3R9M A;  1EDU A;  4M75 E;  3G6E Q;  3Q73 A;  4DJA A;  5D7U A;  3JCM e;  1WJQ A;  4J9E A;  5CEA A;  1NA0 A;  2RJD A;  5A0L A;  3O4Z A;  4F3V A;  1B3Q A;  3L82 A;  4GZD A;  3D9H A;  5FZR A;  3LEW A;  2CZ0 B;  3M0P A;  1Q86 U;  1O1T A;  2LC4 A;  1YJN A;  9ATC B;  2YQ8 A;  2OAW A;  3CGH A;  4C8Q B;  4MS6 A;  4V3I A;  1Y96 A;  2E6Z A;  1S63 A;  1PWT A;  3G71 T;  3ASD A;  2H6I A;  4DLQ A;  1U1S A;  1TN6 A;  5ENT D;  1QKX A;  3MCX A;  3MKR A;  2MAM A;  1MX2 A;  5KYU A;  2Y4T A;  1PSE A;  1K0X A;  3CCV Q;  3PRZ A;  3G2S A;  4F7U E;  3PMT A;  5AYW D;  4XIF A;  3A1P A;  3ZFW A;  5EID A;  4M7A F;  4Z8A A;  4CRI A;  3EGX A;  3FUN A;  3Q79 A;  3CQG B;  5HCK A;  2JZ2 A;  2HAX A;  1NLO C;  1WPY A;  3UDC A;  4RTX A;  3AAA C;  1QLY A;  4OB1 B;  2J06 A;  3M4Y A;  3FY4 A;  4HOT A;  3G2U A;  3X26 B;  4HXI A;  3HSB A;  4RUG A;  3CC2 A;  1M1K C;  2P0P A;  5AQA A;  4M77 D;  1Y96 B;  2KXC A;  3TG5 A;  1ZUK A;  3I35 A;  4XX5 A;  2X3X D;  2JLB A;  3CCS A;  4J9G A;  5A6C A;  3SGH A;  2X4X A;  3VS1 A;  2CZ7 B;  3CK7 A;  4I2Z A;  1WHK A;  4HVV A;  1M3B A;  3C98 A;  3INZ A;  4AIF A;  4DBQ A;  3QNK A;  1VQK T;  1H8K A;  2X35 A;  2IF4 A;  2DNU A;  4C92 A;  6AT1 B;  3ZRH A;  3NHN A;  4JJB A;  3EGX B;  4B9X A;  3RRU A;  3GLX A;  4OVV A;  4LE9 A;  4XU3 A;  1NEB A;  5HS0 A;  2CHZ A;  4FLH A;  2UWJ G;  1SZ9 A;  1WX6 A;  3R7R A;  3PE4 A;  2X3M A;  1WDX A;  1ZBX A;  3TSZ A;  3AG1 E;  2BKG A;  3NOC D;  3QZ9 B;  4F1P A;  4M78 D;  3QAQ A;  1QCN A;  4XTU A;  1ELW A;  3TVT A;  2SEM A;  3MP1 A;  5KYN A;  2DA9 A;  4HLL A;  3DSW A;  2CP7 A;  3CIA A;  1PCX A;  3MEU A;  1OYX A;  1UG3 A;  1YWO A;  2BE9 B;  3A8O B;  3EU9 A;  2QEX T;  2PUK B;  3ZW3 A;  3QZ5 B;  4X9C A;  1WHJ A;  3UI2 A;  4N3B A;  1UN8 A;  4DBF A;  2BUG A;  3D9I A;  5LJ5 e;  1W2B S;  1BBZ A;  3CC7 A;  2DYB A;  1KC8 R;  5GMK h;  1WZO A;  4C8Q G;  1ZX6 A;  3UM3 A;  3BU8 A;  2EGA A;  4JL0 A;  4MZM A;  4F14 A;  3B7B A;  3GYZ A;  3IBE A;  5EYP F;  2AJA A;  1HD3 A;  1Y57 A;  5IT9 E;  2ZPG B;  3I9Q A;  2E64 A;  1Q81 U;  4KGX B;  4FU3 A;  2XRZ A;  4AM9 A;  1KQ1 A;  3PTA A;  3JCM Q;  1VQ8 T;  1YI2 T;  2X38 A;  2GGF A;  4B6M A;  3EGU A;  1NP7 A;  1NI1 A;  2OJ2 A;  1IHW A;  1D0Y A;  4UWG A;  4LNB A;  3CCJ Q;  2K2V A;  2XCB A;  4D8D A;  3PZ4 A;  3LX7 A;  3CD6 Q;  2K6D A;  4LEU A;  2ZU6 B;  2HZY A;  4NS5 A;  3OYB A;  4M7A A;  2LSV A;  2PQW A;  3EDT B;  4UI9 J;  1XNF A;  3NBN B;  4M75 F;  3LJN A;  1N8R R;  1I07 A;  1Y07 A;  3LY7 A;  1QWE A;  5FJY A;  1IGQ A;  1V1C A;  4UC4 A;  3EHN A;  1NJI C;  1WFW A;  1H2U A;  1LVK A;  2DO3 A;  1TUD A;  4O6J A;  2WMO A;  3CCL Q;  1VQ5 T;  3CCV T;  2EIM E;  4AG2 C;  3C5R A;  2JN0 A;  1VQL T;  2GBQ A;  3SFX A;  4WAF A;  3FTS A;  4D6W A;  1N4Q A;  3C72 A;  4A3V A;  2J8S D;  5GAN d;  2F0Y A;  4M7A B;  3TEE A;  4ORZ A;  5FQ7 A;  1Z6T A;  4OAV B;  3SB2 A;  4OGC A;  5ARG A;  4F7U F;  2DL7 A;  2FRY A;  1M27 C;  3Q7F A;  2XEE A;  3MZL B;  3HHM A;  1E7O A;  3URG A;  5AQB A;  2YXY A;  4WCI A;  3ZNG A;  2CP6 A;  2B6C A;  4DK5 A;  1EZZ B;  1X6G A;  2XHC A;  3V79 K;  4IUU A;  2DL3 A;  4DX2 A;  1GFD A;  2CRE A;  1H19 A;  3ZUV B;  3UT7 A;  1E6G A;  3CC7 Q;  1TOV A;  2PUO B;  3T9N A;  4C92 G;  2WB2 A;  1ARK A;  5AYF A;  1QVG A;  3M0Q A;  3I5P A;  1ACM B;  1WQW A;  4O60 A;  4IRU A;  4YND A;  3PVL A;  4LCT A;  3A8M B;  4LRZ A;  1R8O B;  3EG9 B;  4B8A A;  1IXD A;  3M54 A;  2DBA A;  2A28 A;  4U63 A;  4C0M A;  2OVF A;  4RG2 A;  2AT1 B;  1AZE A;  4EZJ A;  2C0I A;  3CR3 A;  3EH2 A;  4CI0 C;  1CSK A;  2O2O A;  4EZL A;  4X9D A;  2DAQ A;  2O31 A;  1JO8 A;  2OVB A;  1QQE A;  3PZ2 A;  3APF A;  4HB5 A;  3APD A;  1K73 U;  4RTT A;  3S7J A;  3SFZ A;  2E3H A;  4M7D E;  2P0Q A;  3HRS A;  1T0H A;  4E6H A;  2RQW A;  4WNG A;  1H3H A;  4A1S A;  3AS4 A;  3GBQ A;  1YJN T;  3S2A A;  2HSE B;  2D8H A;  3CHM A;  1AD5 A;  4J6X A;  3NAW A;  2RQR A;  3Q15 A;  2HKN A;  1I5O B;  2H6G A;  1MMG A;  2XQ0 A;  1E7V A;  4LNP A;  3SF4 A;  3N71 A;  2IQC A;  4Y92 A;  4GA2 A;  3V31 A;  4J9D A;  1QVF S;  2IO3 C;  2GRL A;  5CRV A;  2B86 A;  3OS2 A;  1EX4 A;  2J6O A;  2J08 A;  4MRU A;  5M72 A;  3HYM B;  5CQX A;  1B7T A;  4N4G A;  4CC3 A;  3ULE G;  2KRM A;  2DZ9 A;  2XG8 D;  2DD4 A;  3CK8 A;  1V76 A;  4M75 A;  1JB0 E;  4GYY A;  5ENN A;  1N52 A;  3PUK A;  2JMC A;  1U2V G;  2YRV A;  3CC2 T;  3OYF A;  2DL8 A;  1K1A A;  3D7S B;  3OA6 A;  3W9F A;  3HHT B;  2HQX A;  1UTI A;  5HKC A;  1OI1 A;  3E9F A;  3TXN A;  3CCS T;  1PC0 A;  4UWK A;  4OB2 B;  2KXP C;  4CGV A;  1VOM A;  4PJN A;  4M7A G;  1X6B A;  1V29 B;  5CKF A;  3O48 A;  4EZK A;  3IXE A;  3CCJ T;  3OXL A;  4AVX A;  1RAB B;  4HVB A;  3CD6 T;  1K8A U;  2X3W D;  2F8X K;  2HR2 A;  4FP7 A;  3APC A;  3TJP A;  1BIA A;  4HVW A;  1X27 A;  4I1O B;  1GL5 A;  2DKG A;  1SW6 A;  4I6E A;  4BSX A;  2KSS A;  5FRM A;  2O9V A;  5BUZ A;  1H2T C;  1I4K 1;  2FPE A;  2HD0 A;  4F7U A;  2LUH A;  1SRM A;  2ENM A;  3UIN C;  3CVN A;  2KAT A;  3I5R A;  1ABQ A;  2EGE A;  4WWO A;  2LNV A;  3X28 B;  3OYM A;  3JB9 F;  4FUL A;  5EIL A;  2A0F B;  2R05 A;  4QQD A;  1WY6 A;  2ZIR A;  2ZGD A;  4DI3 A;  2P9N G;  1M4Z A;  1N9A A;  1G3Y A;  2XPI A;  1M2V A;  3QWV A;  1Q7Y R;  4JS4 A;  2EBP A;  2MOW A;  2CUB A;  3M56 A;  4M77 C;  1W2B P;  4L5G A;  5JJT A;  4JA7 A;  2KEA A;  1M90 R;  4BET A;  3MJX A;  4FIB A;  3PT9 A;  2PM6 A;  1JU5 C;  4I2W A;  1QW1 A;  1MMA A;  5LJ3 h;  3E34 A;  2L3P A;  4J9C A;  2WXG A;  3V7S A;  3CC7 T;  5GAN 6;  5GAO r;  4JC8 A;  2BTT A;  2V8J A;  4V2S A;  4TXR A;  2FO7 A;  2MYO A;  3ESK A;  4UQY A;  4U8V D;  4E7K A;  4APF A;  4IYP A;  3CC4 A;  3R7Q A;  4K5B A;  1M2V B;  2VSN A;  4BI8 B;  1BU9 A;  3V7C A;  4EIK A;  1ELK A;  2LQW A;  3GNF B;  2C0L A;  1D3B B;  1YP5 A;  5KYY A;  4OML A;  2QYZ A;  2RHZ A;  2EYX A;  5FU6 B;  1KPS B;  3ER0 A;  2VWF A;  2WXL A;  3T8M A;  1WG0 A;  4OMF B;  1J3T A;  1INZ A;  2AKK A;  2QQ9 A;  4WNE A;  1D0X A;  2E1H A;  4M78 C;  5CKB A;  3OYC A;  2DZN A;  5D0Q D;  3CST A;  1LTX A;  3EUV A;  3ASH A;  3IHV A;  2KNB B;  1UGV A;  2VVK A;  1OCC E;  3M53 A;  3C94 A;  3MJW A;  3QWX X;  4ZN3 A;  2AWI A;  4PDX A;  4TV3 A;  5G05 J;  1D8D A;  5BT1 A;  2CGH A;  2D9T A;  4Y91 A;  2DTO A;  5LJ5 j;  3QKY A;  3UA6 A;  4M7D F;  3QXE B;  2O88 A;  2I0N A;  2KBT A;  1E7U A;  4EEC A;  2H3E B;  4ELY C;  3BDL A;  5KYY B;  2LSU A;  3R6O A;  3JCM c;  2YHE A;  4JHR A;  2A08 A;  2DZO A;  2RQV A;  2H3J A;  2NYJ A;  5EG2 A;  1IKN D;  1S72 A;  3EIJ A;  1NG2 A;  2EQI A;  1HXD A;  5GAN 8;  2PU9 B;  4M75 G;  1K9M R;  2XDD A;  2EYZ A;  1AHJ B;  4ZTF A;  3EH1 A;  5ENQ D;  4DOW A;  3GOX A;  1N9R A;  1OCR E;  2LJ1 A;  2NXP A;  2X6J A;  1IZ6 A;  3Q47 B;  3I5S A;  1ZU2 A;  1G3N B;  1H6K A;  1S1N A;  3HPW A;  1M1K R;  4FYX B;  3LCA A;  2DVE A;  1VQO A;  3RIB A;  3PE3 A;  4GML A;  2WQ6 A;  1RLP C;  2LXM A;  4AFZ C;  3VRY A;  2PTK A;  3MA5 A;  4GTQ A;  3CC4 Q;  1FCH A;  5IHN A;  4F7U G;  5GJW B;  1N95 A;  2F5T X;  4FYW B;  3L2U A;  2QZA A;  1KC8 U;  5FZQ A;  2JMA A;  2L3S A;  5GAM h;  4C5G A;  1Z9Q A;  1MGQ A;  5CKD A;  5EIB E;  3OSV A;  2LAH A;  3PNL B;  4GA0 A;  3CK9 A;  3OTN A;  2KVQ G;  3ZHE A;  1UHC A;  4LDV A;  2QA4 A;  3RMS A;  3OYK A;  1VQN Q;  3HXD A;  2OEV A;  5KNH D;  4Q5W A;  3Q9U C;  3FTX A;  4OMO A;  3W9G A;  3UIO C;  1TWB A;  3OW2 S;  2DWZ A;  4GMR A;  4R7L A;  3MEK A;  2P9K G;  1MX6 A;  3HL8 A;  4FW2 A;  2XGO A;  3AS5 A;  2HBP A;  3CME Q;  5EYL A;  3O5Z A;  1W1F A;  3DKM A;  3EIQ C;  2AVP A;  3CBP A; 
#chains in the Genus database with same CATH homology
 5HRY A;  1K1B A;  4J7W A;  1PRM C;  2BZY A;  2YUO A;  1X2Q A;  2GGR A;  2LX7 A;  2C0T A;  2DBM A;  1PKS A;  2L3Q A;  2P4R A;  5HKP A;  2A5E A;  5JA4 D;  1OEB A;  2LCS A;  2MOX A;  1OY3 D;  2BZ8 A;  1JQQ A;  4J9E A;  5AQ7 A;  4HRL A;  2HEQ A;  2HBW A;  5CEA A;  1QCF A;  1AWJ A;  3HG0 D;  1OPK A;  5IXB A;  1B3Q A;  1YN8 A;  2K9G A;  2KE9 A;  3D9H A;  3JV3 A;  4NIK A;  3M0P A;  1NYF A;  1QYM A;  3UF4 A;  4Z89 A;  2OAW A;  2B0O E;  1N0R A;  5AQ9 A;  1PWT A;  4E6R A;  3F6Q A;  1W6X A;  5ENT D;  4CC2 A;  1QKX A;  4DX5 D;  2CH4 A;  1K0X A;  1MX2 A;  1UE9 A;  1VYU A;  4KRT A;  1T3L A;  4JB8 P;  1N5Z A;  1XOV A;  2FG0 A;  2FO0 A;  2XMF A;  3Q9N C;  2KYM A;  2KYB A;  3IQL A;  4QT7 A;  3V2X A;  2RFM A;  5EID A;  2CH4 W;  1ZBJ A;  2CSQ A;  4Z8A A;  1GCQ A;  2DMO A;  2QC9 A;  4U96 D;  3TSW A;  2P2C P;  5HCK A;  4HI9 A;  4TUM A;  1NLO C;  2RMO A;  1KSW A;  3AAA C;  1QLY A;  2F2W A;  2J06 A;  1BU1 A;  4HXJ A;  2AK5 A;  4RTX A;  5FIO A;  4RUG A;  1WXU A;  1G2B A;  5ECA A;  1H92 A;  5AQA A;  1IHB A;  2KXC A;  3I35 A;  1ZUK A;  2X3X D;  2EPD A;  4J9G A;  1UHF A;  3M0U A;  1GCQ C;  3UA7 A;  4HVV A;  1U5S A;  3VS1 A;  5FWC A;  1SVX A;  1WYX A;  1M3B A;  2M51 A;  2LJ3 A;  3H0F A;  1UJY A;  1A5E A;  3TWW A;  1SHG A;  4OMN A;  4CC4 B;  1H8K A;  2GTJ A;  2DNU A;  4HVU A;  1TR4 A;  3DEO A;  3NHN A;  4JJB A;  2NWM A;  1K0S A;  2V4H C;  4BEP A;  3SHW A;  1SHF A;  3TWV A;  3M0S A;  4K5A B;  5EN5 D;  2HDA A;  5CBO A;  4LE9 A;  3THK A;  1NEB A;  2LZ6 B;  4CYM D;  5ENO D;  5HS0 A;  2RNA A;  3EHQ A;  4RTY A;  1GBQ A;  1VYV A;  4BSZ B;  1VYT A;  3REA B;  3NMZ C;  1WX6 A;  3KEA A;  5KBA A;  4DUI A;  1TG0 A;  1WDX A;  1IXV A;  3QWY A;  4UUC A;  3TSZ A;  2BKG A;  3NOC D;  1PKT A;  4F1P A;  1NLP C;  2YUQ A;  4X1V A;  1RI9 A;  3TVT A;  2SEM A;  2ROL A;  1GRI A;  2DA9 A;  4HLL A;  3VRZ A;  1TUC A;  1ZUY A;  2DM1 A;  4DX7 D;  4ESR A;  1YWO A;  5ITZ F;  3EU9 A;  1WI7 A;  3AJI A;  5AN8 A;  2ETA A;  5EC7 A;  3UI2 A;  4IIM A;  2L6B A;  3ZKJ A;  2JXB A;  2RQT A;  2DRM A;  4J9H A;  2PNI A;  4HCK A;  1WDY A;  1BBZ A;  4ATZ D;  2FO1 E;  1X2K A;  4LUD A;  2D8J A;  1K4U S;  2DYB A;  1ZX6 A;  2KT1 A;  2DLP A;  3T8K A;  4DX1 A;  2EGA A;  4F16 A;  2D1X A;  2NUZ A;  4F14 A;  2DVJ A;  3B7B A;  5EYP F;  2AJA A;  1HD3 A;  1Y57 A;  4BER A;  3TWT A;  1NM7 A;  3I9Q A;  1AP7 A;  2KRO A;  1NFI E;  3TWX A;  2J6K A;  3TWS A;  3NGP A;  4M4Z A;  3EGU A;  3VS3 A;  2MIO A;  2OJ2 A;  2DRK A;  1OV3 A;  2ABL A;  4IIO A;  4QQI A;  2EGC A;  4D8D A;  2JS0 A;  2Y0B G;  2K6D A;  3HRA A;  2YUN A;  1ZLM A;  1JXM A;  1UFF A;  2FRW A;  3NBN B;  4O1P A;  3LJN A;  2CT4 A;  1I07 A;  1AEY A;  2DE0 X;  2CT3 A;  1ZUU A;  1QWE A;  1MV3 A;  2GQI A;  1V1C A;  2FPD A;  2F37 A;  1WFW A;  2CSI A;  1TUD A;  4G8L A;  2GNC A;  5FWB A;  3NPF A;  5ENR D;  4AG2 C;  3C5R A;  3T9K A;  2GBQ A;  3CQT A;  2Y1L E;  4CC7 A;  1HSQ A;  1YNZ A;  2J8S D;  2J05 A;  1IO6 A;  2V5Q C;  4ORZ A;  1CKA A;  4Z88 A;  4OAV B;  2DL4 A;  1UJ0 A;  2DL7 A;  1NEG A;  1M27 C;  1PHT A;  2XEE A;  1E7O A;  2FRY A;  2V1R A;  5AQB A;  2J6F A;  4WCI A;  5L23 A;  3ZNG A;  3UXG A;  1X6G A;  2BKK B;  3JUE A;  2V1Q A;  3V79 K;  1GCP A;  1GFD A;  2DL3 A;  4DX2 A;  2CRE A;  2ESW A;  3DEP A;  3ZUV B;  1E6G A;  1K76 A;  1ARK A;  2BZX A;  2EYY A;  2L2P A;  3M0Q A;  1MYO A;  4O60 A;  4YDY A;  1FYN A;  4ZNX A;  3PVL A;  1UUE A;  2K7A A;  4K5C A;  1U06 A;  2LP5 A;  2A28 A;  1KIK A;  4B93 B;  2SRC A;  4R0K A;  1JEG A;  1A0N B;  1AZE A;  4RLY A;  1S70 B;  2C0I A;  1U3O A;  1CSK A;  5JMN D;  1KFZ A;  4AFQ C;  2O2O A;  2JM8 A;  5IHI A;  2ETC A;  2XZD G;  2O31 A;  2YDL A;  1JO8 A;  4LG6 A;  2EVR A;  2HSP A;  1MV0 B;  4OMM A;  2LJ0 A;  2W0Z A;  4QFV A;  1PNJ A;  4RTU A;  3VS4 A;  4HB5 A;  4DRX E;  5CED B;  4RTT A;  1M30 A;  1I0C A;  2KXD A;  2JAB A;  4HNA D;  3C0C A;  3H0H A;  2EYW A;  1UG1 A;  3TWU A;  4ZHB A;  2F2X A;  2A37 A;  4J9F A;  3EG3 A;  1T0H A;  3EHR A;  2RQW A;  1H3H A;  2XEH A;  2D0N A;  4N5Q A;  3GBQ A;  4F6R D;  1CKB A;  4D8K A;  1AOJ A;  2ROT A;  2D8H A;  1MJ0 A;  4FSS A;  4BES A;  5IXF A;  3FJ5 A;  1AWW A;  3ULR B;  1AD5 A;  3H0I A;  2DVW A;  2AZV A;  3EG1 A;  2FPF A;  2RQR A;  5KWD A;  4LNP A;  1X69 A;  2KT8 A;  4Y92 A;  4AFU C;  2XZT G;  1MX4 A;  5CBN A;  3V31 A;  4GPM A;  4J9D A;  1K1Z A;  2B86 A;  4J9B A;  4K11 A;  1GBR A;  2J6O A;  1Z9Z A;  5I11 A;  4OMQ A;  4CC3 A;  2RPN A;  4ZFH A;  2KRM A;  1RLQ C;  2RQU A;  4RTW A;  2JMC A;  1AWX A;  1JXO A;  2JS2 A;  2DL8 A;  1K1A A;  2ETB A;  3W9F A;  3R6N A;  1GFC A;  1UTI A;  4JJC A;  2KXP C;  3UAT A;  1QKW A;  1X6B A;  3IXE A;  2CUD A;  5IH2 A;  5AAO A;  2HCK A;  2X3W D;  2F8X K;  3JXI A;  4HVW A;  1X27 A;  2KR3 A;  4RTZ A;  2KGT A;  3PE0 A;  1GL5 A;  2O9S A;  1SW6 A;  2E5K A;  3H41 A;  2RF0 A;  2O9V A;  1AVZ C;  2FPE A;  1SRM A;  3KFV A;  2ENM A;  4HRN A;  1LCK A;  3I5R A;  3VS5 A;  1ABQ A;  2EGE A;  1ABO A;  3RBB B;  2IIM A;  2K3B A;  2KRN A;  1BI8 B;  5EIL A;  2DF6 A;  1N0Q A;  1M3C A;  2QYJ A;  2ZGD A;  2J7I A;  2YT6 A;  2JT4 A;  1K3Z D;  2ED0 A;  2JTE A;  2YSQ A;  2YUP A;  4AG1 C;  1BK2 A;  2EBP A;  3ZU7 B;  2CUB A;  1UOH A;  1N11 A;  5BXU A;  5CEC B;  3EG0 A;  1VA7 A;  4DEY A;  3VS7 A;  1PRL C;  4OAU C;  3PVQ A;  2KEA A;  1I1J A;  4BET A;  4JJD A;  2W10 A;  3UTM A;  1JU5 C;  2ECZ A;  1DCQ A;  1M8M A;  1YYH A;  1G83 A;  4LUE A;  1YMP A;  2L3P A;  4J9C A;  4DEX A;  1X43 A;  4JPB W;  4LN2 A;  1OOT A;  2BTT A;  4U95 D;  1DC2 A;  2MYO A;  4U8V D;  3TWR A;  1E6H A;  3REB B;  2PZ1 A;  1BD8 A;  2PNN A;  2JW4 A;  1WLP B;  4K5B A;  1AWC B;  2C0O A;  1BI7 B;  2AZS A;  1BU9 A;  1MUZ A;  4EIK A;  5ENP D;  2G6F X;  2LQW A;  3VS2 A;  2MCN A;  1YP5 A;  4HBD A;  1FMK A;  4OML A;  1RUW A;  3ZL7 C;  2EYX A;  5CER B;  2VKN A;  1B07 A;  2VWF A;  2EKH A;  1HJD A;  4C48 B;  2AKL A;  1YWP A;  4YDW A;  1WG0 A;  3U23 A;  4JZ4 A;  3V2O A;  5AAR A;  1J3T A;  5BXO A;  2DL5 A;  4GBQ A;  4J8Y A;  2AKK A;  5FIN A;  5IHK A;  2DZN A;  2DIL A;  2KNB B;  1SRL A;  4AFS C;  1UGV A;  3VS6 A;  2CDT A;  2VVK A;  3QWX X;  4HQD A;  3V30 A;  2RFA A;  1QWF A;  2LMJ A;  4Z68 A;  1UDL A;  3B95 A;  3UA6 A;  2KBX A;  1W70 A;  2I0N A;  2KBT A;  5D66 A;  3VS0 A;  2O88 A;  1SSH A;  2LNH B;  5GJV B;  4O1O A;  1OT8 A;  2F8Y A;  4HRM B;  1SPK A;  4OMP A;  3A98 A;  4GLM A;  2A08 A;  4A63 B;  2DZO A;  2RQV A;  1Y0M A;  3RNJ A;  3SEM A;  2HE0 A;  2NYJ A;  2QDL A;  1IKN D;  1YCS B;  2ED1 A;  1NG2 A;  2EQI A;  1EFN A;  4G8K A;  1WIE A;  2EYZ A;  2FEI A;  3M0T A;  1SEM A;  4LSZ E;  1D9S A;  5ENQ D;  2A36 A;  2DBK A;  5KNG A;  4HI8 A;  1WA7 A;  2LJ1 A;  1WXB A;  1ZSG A;  2DX1 A;  3I5S A;  1WXT A;  4LNU D;  4U8Y D;  1G3N B;  1KJW A;  3J5P A;  3NOG D;  1S1N A;  2GTO A;  2K79 A;  1UEC A;  3M0R A;  1RLP C;  3LH5 A;  4AFZ C;  1T0J A;  3VRY A;  1T3S A;  2H8H A;  2PTK A;  1M3A A;  5IHN A;  5GJW B;  2RN8 A;  2JMA A;  3TWQ A;  2L0A A;  2L3S A;  1K9A A;  2ZGG A;  4CZ2 D;  1AZG B;  4RTV A;  1Z9Q A;  3JXJ A;  2F2V A;  5EIB E;  5I22 A;  1BB9 A;  2VGE A;  1UHC A;  2LQN A;  4J9I A;  1AWO A;  5ENS D;  4DX6 D;  5KNH D;  4JZ3 A;  3Q9U C;  3J5Q B;  4OMO A;  3W9G A;  2EW3 A;  4F17 A;  1NYG A;  3SO8 A;  2DWZ A;  2M0Y A;  4GMR A;  1BLX B;  2OI3 A;  1MX6 A;  2DJQ A;  2JM9 A;  1OPL A;  5FW9 A;  2KRS A;  5EYL A;  3O5Z A;  1W1F A;  3EG2 A;  2K2M A;  2XEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...