1YCSB

P53-53bp2 complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
193
structure length
193
Chain Sequence
PLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGITALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAVFAMTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYEPQNDDELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords P53
publication title Structure of the p53 tumor suppressor bound to the ankyrin and SH3 domains of 53BP2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (anti-oncogene/ankyrin repeats)
total genus 46
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 1996-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00018 SH3_1 SH3 domain
B PF00023 Ank Ankyrin repeat
B PF13606 Ank_3 Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1ycsB01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ycsB02
2RQTA 2KXPC 1BBZA 1JQQA 4AFQC 3O5ZA 3RNJA 1T0JA 2J6OA 4Z68A 4J9EA 2E5KA 3I9QA 4CC7A 4OAVB 1A5EA 3ZU7B 3NOGD 5BXOA 1CSKA 2K3BA 1ZUKA 2DRKA 2JMCA 2RQWA 3M0RA 5CBOA 4DX5D 3UATA 1PRLC 2OJ2A 3VS3A 4J9IA 1ZBJA 1BI7B 1K1BA 4KRTA 1AZEA 4U8VD 2LQNA 4F16A 4BSZB 1KFZA 1BI8B 5JA4D 5D66A 4HVWA 1GRIA 2EKHA 2KYMA 2W0ZA 4OMOA 2DZNA 1SHFA 2I0NA 2M0YA 2YUQA 4RTXA 5KBAA 4HB5A 2JM8A 2D8HA 4HCKA 1KIKA 4LN2A 2C0TA 3REBB 4E6RA 1HJDA 3EU9A 2O9VA 1JEGA 4JJBA 3SEMA 2X3XD 3ZL7C 1M3CA 2LJ3A 2F8YA 4K5AB 4DUIA 1N0QA 4LSZE 1Z9ZA 5ENSD 1BU9A 2F2XA 1T3SA 1VYUA 3VS7A 1IKND 5CERB 4G8LA 1FMKA 1NEGA 3UI2A 2DZOA 1ZUUA 4HRLA 2L3PA 4F6RD 4AG1C 1AEYA 3QWXX 1ABQA 2F8XK 2H8HA 2KXDA 2L6BA 3UXGA 4HNAD 2DL4A 2J6KA 3EHRA 5AAOA 2K2MA 1S1NA 1UTIA 2L0AA 3C5RA 1UHFA 3TVTA 2YDLA 1YWOA 4QFVA 1NLOC 3EG3A 5FW9A 3A98A 2BKKB 1MV3A 3UA6A 4ZHBA 2P2CP 4F1PA 5AQBA 1N0RA 2DWZA 1M30A 4QQIA 2MOXA 3PE0A 4RTVA 1Y57A 3B7BA 3I35A 1BK2A 4GLMA 1HD3A 1AWJA 3C0CA 1M8MA 2JMAA 1X27A 2GNCA 2JTEA 2DL8A 2MIOA 3DEPA 1MYOA 5CBNA 2K7AA 2CSIA 4HVVA 3LJNA 5EIBE 2GBQA 3PVQA 3VS4A 4HI9A 5AQ7A 1SPKA 2FO1E 2ED1A 1B07A 1WFWA 1QKWA 1I1JA 1SEMA 1YYHA 2DL3A 4GPMA 4DEXA 2EGAA 4CC2A 4TUMA 4F14A 4ZFHA 1UHCA 2RMOA 2DMOA 1IO6A 2ED0A 4HRNA 1SHGA 2KRMA 1MUZA 3NGPA 3V2OA 1XOVA 1Z9QA 2FPEA 1AWWA 2AKLA 2CDTA 1DC2A 2EYXA 2K79A 3EG0A 3JV3A 2DJQA 2XEEA 2MCNA 2EW3A 3ZNGA 4ATZD 1AOJA 2Y1LE 4HRMB 3JXIA 2RQUA 1N11A 5AN8A 2JT4A 2KE9A 2NUZA 2L2PA 2P4RA 2JS2A 2DM1A 1JXMA 2D0NA 5ENTD 2MYOA 4HI8A 1N5ZA 3VS6A 1QKXA 1WLPB 3IQLA 4JZ3A 5AQAA 4HBDA 1UGVA 4A63B 1W6XA 1IHBA 1WXTA 1W70A 4U95D 2YUNA 1NM7A 4OMPA 2O88A 3FJ5A 2KBXA 1TR4A 1X69A 3SHWA 1GCPA 4JJDA 5FWBA 4NIKA 2L3QA 3TWQA 1MX4A 3W9FA 5HRYA 2XZDG 3J5PA 3W9GA 1NYFA 2ETBA 2A5EA 1FYNA 1Y0MA 4IIOA 3F6QA 2FO0A 2ENMA 4X1VA 2J7IA 2DVWA 4RTYA 4J8YA 1YNZA 5GJVB 2DL7A 1E7OA 3NBNB 1JXOA 1BD8A 1M3BA 1ZUYA 3V79K 2RPNA 2NWMA 5KNHD 2VWFA 3U23A 2J6FA 5HS0A 1I07A 3JUEA 4AFSC 2JM9A 2W10A 1M27C 1NEBA 5ITZF 4LUDA 1K1AA 2VVKA 1RUWA 2C0IA 2YUOA 4BEPA 1K4US 1WXUA 3M0TA 4J9DA 1YWPA 3M0SA 3D9HA 3ZKJA 4N5QA 2DL5A 2J8SD 1T3LA 2DILA 5ENRD 4G8KA 1ZLMA 4OAUC 1VYVA 1MJ0A 3NHNA 1AVZC 2DE0X 5EILA 3VS1A 2CUBA 2ROTA 2RF0A 1OOTA 4Z8AA 4Z89A 2LQWA 3TWWA 1ZX6A 4M4ZA 4K5CA 2EYWA 3EHQA 3PVLA 3B95A 4LNUD 5GJWB 4B93B 4OMMA 1X2QA 4HQDA 3R6NA 4GMRA 3ULRB 4BESA 4DRXE 3KFVA 1K76A 2HEQA 2HDAA 1TG0A 3HRAA 3IXEA 5FIOA 3J5QB 2DNUA 4JZ4A 1JU5C 5ENOD 2JS0A 1BU1A 3TSZA 1I0CA 1PKTA 5ENPD 5EC7A 3V2XA 1UOHA 2XZTG 1VA7A 4J9FA 5AQ9A 4CC4B 4DX2A 1X6BA 5FWCA 3JXJA 4JPBW 1NLPC 2ECZA 2CSQA 2DYBA 2CREA 2ZGDA 3CQTA 4RLYA 4ORZA 4HLLA 2FRWA 2EQIA 5EIDA 2HCKA 2K6DA 2IIMA 2KRSA 4CZ2D 1PRMC 3GBQA 4ESRA 4J9HA 4Z88A 3T8KA 2M51A 3Q9UC 1LCKA 1ZSGA 2RFAA 1WG0A 2EYYA 3V30A 5BXUA 1OPLA 1BLXB 1DCQA 4J9BA 3UA7A 2OAWA 1JO8A 3NPFA 4LNPA 5ECAA 1M3AA 2DF6A 2PZ1A 2DA9A 2EGEA 3ZUVB 1RLPC 2LMJA 2X3WD 4AFZC 5IXFA 1H92A 1QYMA 3H41A 5AARA 1QLYA 1S70B 1G83A 2ETAA 4JB8P 5KWDA 2GGRA 2O31A 5CEAA 4O1PA 1WIEA 2HBWA 2CT3A 3V31A 1YN8A 3AJIA 1CKAA 1WDXA 2J05A 1EFNA 3M0PA 1MX6A 1TUCA 2AKKA 2V5QC 2V1QA 1MX2A 1PWTA 1SSHA 1KJWA 2LJ1A 2ESWA 1PKSA 4ZNXA 4DEYA 1OEBA 3TWUA 1OPKA 2BZXA 3VS2A 1KSWA 2XMFA 1X6GA 2F2WA 3H0HA 2DX1A 2O9SA 3TWSA 1UE9A 2HSPA 2A36A 2ABLA 3NMZC 1OV3A 4OMLA 1NYGA 1U06A 1YMPA 1WYXA 1K9AA 2V4HC 3QWYA 4AG2C 1X2KA 2YSQA 1IXVA 1HSQA 2PTKA 4RTWA 2F2VA 4O60A 1X43A 2CUDA 5HCKA 2SRCA 4DX6D 3VS5A 1T0HA 2LP5A 1GL5A 2VGEA 3NOCD 1CKBA 1GBQA 2CH4W 4IIMA 2FG0A 2FPFA 1E6HA 4O1OA 2DBMA 1AWOA 2Y0BG 4K11A 1A0NB 1WI7A 3DEOA 1V1CA 1RI9A 2RQRA 2F37A 1PNJA 1TUDA 5HKPA 4JJCA 1K1ZA 2ETCA 2PNNA 2GTOA 1YCSB 2V1RA 2LNHB 4U96D 5CECB 1AZGB 1UJ0A 2D1XA 1QWFA 2KNBB 1QCFA 1H8KA 2AZSA 2EVRA 3EG2A 2DLPA 5I22A 2KXCA 1UECA 2D8JA 2QDLA 4U8YD 4HVUA 2VKNA 4CC3A 5L23A 2J06A 2RFMA 2LCSA 4FSSA 1UDLA 1K3ZD 4DX7D 2EGCA 4CYMD 3HG0D 4F17A 2KBTA 2RN8A 2QC9A 4HXJA 2K9GA 5EN5D 1U3OA 2A37A 2BZ8A 3TWVA 1NG2A 4J7WA 1SRMA 2GTJA 5IHIA 3THKA 2G6FX 1UG1A 4DX1A 3VRYA 2CH4A 2CT4A 2BKGA 2C0OA 1AP7A 1AWCB 2XEHA 1GCQA 1W1FA 2DRMA 4OMNA 1SW6A 4YDYA 4LE9A 2KROA 5JMND 1UUEA 2BTTA 3H0FA 5IHKA 1GBRA 1U5SA 3UTMA 1OY3D 5EYLA 1SVXA 3TWXA 2QYJA 1OT8A 4WCIA 3SO8A 2KT1A 1NFIE 2A08A 2LZ6B 4RTTA 3TSWA 4YDWA 2BZYA 4LUEA 5KNGA 2AJAA 1SRLA 3Q9NC 1K0SA 2HE0A 2YT6A 2NYJA 1VYTA 3VRZA 1QWEA 1J3TA 1GFDA 2A28A 2ROLA 1ABOA 4RUGA 2OI3A 2JABA 4GBQA 2AZVA 2KT8A 5ENQD 1G3NB 4Y92A 2EYZA 1GCQC 5EYPF 5I11A 4QT7A 2KRNA 5IHNA 1AWXA 4D8DA 5CEDB 1GFCA 1ARKA 1AD5A 2GQIA 4RTUA 1UFFA 1D9SA 1G2BA 2AK5A 3EG1A 2KYBA 2L3SA 2FRYA 3T9KA 3EGUA 2EPDA 1H3HA 3H0IA 4UUCA 4D8KA 3VS0A 1WXBA 2DVJA 2O2OA 4RTZA 4J9CA 4K5BA 4C48B 2LX7A 4BETA 3M0UA 2KR3A 1B3QA 2KGTA 3AAAC 3TWTA 2RQVA 3I5RA 3TWRA 2PNIA 1BB9A 1WX6A 2FPDA 3M0QA 2SEMA 1E6GA 3LH5A 1WDYA 1YP5A 1UJYA 4LG6A 5IH2A 2LJ0A 4J9GA 2ZGGA 3REAB 2JXBA 2FEIA 2XENA 2EBPA 4R0KA 2JW4A 3KEAA 3UF4A 2KEAA 2B0OE 4OMQA 1PHTA 1WA7A 4AFUC 1K0XA 1MV0B 2DBKA 3RBBB 2RNAA 4EIKA 5IXBA 2YUPA 1RLQC 2B86A 3I5SA 5FINA 4BERA
chains in the Genus database with same CATH superfamily
5FU7C 2HKQB 2WM9A 3QDRB 4AFQC 1T0JA 1QVFP 4Z68A 2WXPA 1QW1A 3RU0A 3K9IA 1UW4B 3DSSA 5FQ4A 2OEVA 2HO1A 4M75B 2VXEA 4EMGA 3CCSQ 1NJIU 2BUDA 3FTZA 2DRKA 3UATA 2VGYA 1P92A 1IHWA 5KJKA 1TS9A 3FTUA 1K73U 5M9OA 3LWIA 4J8DA 2R17C 2Y69E 1K1BA 2LVMA 3RSEG 4KRTA 5KYXB 4U8VD 4BSZB 1BI8B 3QO3A 5JA4D 5D66A 4HVWA 5BW8C 2W0ZA 2EKOA 5KYUB 2R5SA 4CEMA 2DTHA 4B6MA 1QVFA 4HB5A 3EG9B 5T8IA 5CKEA 1HJDA 3REBB 1PC2A 2FZCB 2HR2A 4M78C 2KATA 3FU0A 2QZAA 2R05A 4A4EA 1H6OA 4FU6A 1GW6A 5GAMe 4LD9K 3PH0C 4J8EA 4JEUA 1BCMA 1T3SA 2GQVA 2JN0A 1EZZB 1IKND 1FMKA 5GMKl 4GTQA 1VOMA 1OWLA 4QVDA 1D1AA 2L3PA 4FT4A 3FUKA 3CCVA 3ULQA 1YHQT 2KXDA 3D9NA 3UXGA 2V26A 4XU2A 3CCVT 4ABNA 3Q15A 5JHAA 3CCJQ 2HSEB 2KI7A 3ZPJA 5LJ3f 3KEZA 4NACA 3CVLA 3SHFA 2I2LA 2ZPIB 2QGGA 2H3EB 1VIFA 1SZ9A 2IFUA 3X25B 4GU5A 5GAMj 1UHFA 4ANVA 4FIBA 1VQPQ 1N4SA 1NLOC 3EG3A 5FW9A 3FUNA 2MHKA 2BKKB 3UA6A 2XCCA 1TN6A 3QWVA 4KMOA 2GGFA 1Y96A 3HHMA 5LCWC 3CCST 3B7BA 2JZ2A 2CHXA 2K5IA 1BK2A 4GLMA 4BE0A 1HD3A 4MDWA 2F1LA 1M8MA 2K7AA 2E0IA 4TUUA 1QZ2A 4DPRA 4EZKA 2FO1E 1NA3A 3MO8A 1VQNA 1H6KA 5CKBA 1QKWA 3ASGA 1QP3A 1YYHA 2DL3A 4DEXA 2EGAA 3O4ZA 2R5MA 4F53A 1VQ6Q 3OBYA 2ZIRA 3B7UX 4TXRA 1UHCA 3SY2A 2VGMA 2LSUA 1VQNT 2KRMA 4PJOC 2FVUA 2AIRB 3V2OA 2PM6A 1XOVA 2PUOB 4C92A 2K2VA 2CDTA 1IHGA 2K79A 4CDRA 3RDVA 3ZNGA 1AOJA 2Y1LE 4HRMB 3JXIA 2RQUA 3HFOA 3UPUA 5KH6A 1KD1C 2C0LA 3SD4A 4GYYA 1N54A 2NUZA 2OV8A 3HL8A 4BDYA 4LCTA 5ENTD 1N5ZA 1M2VA 3EFRA 4IURA 1WLPB 3OS2A 5D6XA 2XS1A 1W6XA 5J90A 3D9IA 3S3OA 4J6IA 4LDVA 4AP2A 3EFOB 1VQPT 4A55A 3OYEA 2IO3C 5DM7R 2M63A 4B0ZA 1VQMQ 9ATCB 4KBQA 2HL5C 2IQCA 1OU8A 2M16A 1O1RA 5FWBA 1R0BG 4NIKA 1JCSA 1LD8A 4N3BA 3SNXA 4G2VA 4C0MA 4X9DA 1OXJA 3TWQA 1Q7YR 3W9FA 1NYFA 4BWRA 4OB2B 5KJMA 2DXUA 2VASA 2IEJA 3QAQA 3VU3C 3LY9A 2DVWA 1ZU2A 4P29A 2DAQA 4MZTA 3CCQQ 3MP6A 4HT8A 3NBNB 2JUFA 1JXOA 2RI2A 3S2AA 2YXYA 1JCQA 5FQ6A 4M77A 1NE8A 5IN1A 5CRUA 3FUEA 3U23A 5A0DA 3DLMA 5KJLA 3UT1A 1VQ6T 2QA4A 4AFSC 4D6WA 2X6FA 5EKQD 4MDXA 2FL7A 3ZXSA 1C6VX 1TUGB 4E7ZA 1WXUA 3M0TA 3OYAA 3CCMQ 4A4HA 3LY7A 3Q7FA 5GAN8 3I56Q 3D9HA 4N5QA 3S3MA 2GROB 1C1AA 4G8KA 1OCZE 3O8VA 2DYRE 3ZFWA 1U1SA 1MJ0A 3NHNA 3LGFA 4EBAG 1X75C 3A8GB 2DYIA 2RJFA 3EFSA 4C8QC 1OULA 3V7SA 4JL0A 2GRQB 2IONA 4M4ZA 4XU0A 4N4GA 2EYWA 3PVLA 1WQ7A 3RKVA 4LNUD 1JRIA 3JCMe 1X2QA 2QAZA 1WHMA 4DRXE 5AYWD 3KFVA 1KPSB 4Q5WA 1BI1A 1WHJA 1IGQA 2DNUA 1E8WA 3HFNA 1BU1A 1I0CA 1LD7A 1PKTA 3LKUA 5EC7A 4KYOB 3JCMX 3BDUA 3SFYA 1X5BA 4QQ6A 4ZGDB 3G2WA 2GFUA 3CCQT 1Y7XA 1NZ9A 3JXJA 5HI7A 1JBMA 4JPBW 2LCLA 4ZTJA 4EQFA 1N95A 3DKMA 1NJIR 4AT1B 1OZ3A 2I1KA 2CREA 2ZAEA 1JPLA 3E33A 3EGXA 4RVBA 3CQTA 4HLLA 4FYVB 2E3IA 3ASDA 2NC9A 5EIDA 4PL6A 3GBQA 2J4DA 3ULEG 3Q9UC 2KSSA 1PAQA 5T3RA 1LCKA 1ZSGA 1OCOE 4M7AC 3OYYA 3S3NA 4M78G 1WHKA 3ONKA 3VYHB 2CP2A 3J7AF 3UA7A 2RHUA 2P9UG 4J9BA 2H6HA 3NPFA 4LNPA 5ECAA 4GZCA 4FW2A 3ZUVB 2X3WD 2HQXA 2WQ7A 2FHDA 2RHYA 2ZPFB 2GGRA 4C5IA 3RRUA 2RI3A 5CEAA 3GZ2A 5D7UA 4J7FA 2CT3A 2DXBA 5JJ7A 3TEEA 1PG5B 1N4RA 3JSCA 1MX6A 4YVQC 1YJ9Q 2AKKA 3OXGA 4CI0C 3CC7Q 2HQHA 4B94A 2V1QA 4JXTA 3EAEA 1SSHA 4JLIA 2I6HA 1PKSA 3CD6Q 5GAMh 2DKGA 3OYJA 3TWUA 4G1TA 1OPKA 5L8RE 3VS2A 1KSWA 2XMFA 2XHCA 3JCMW 5KE3A 1X6GA 3CXCS 4R55A 1ZBPA 3B7TA 2DX1A 4KVMA 1VQOA 3DSTA 3PNTB 1WYXA 3M5AA 1U2VG 4MRUA 1Q7YC 5A23A 4WNGA 1IXVA 3HVEA 4N3CA 1WAO1 4BT9A 5CQXA 4KT6B 4DX6D 2SRCA 1VQKA 4LDXA 4AXHA 2PVGB 4O1OA 3PNLB 3UIPC 1AWOA 2WSEE 5A2QE 3BQOA 5D2MC 4ATGA 4E6HA 2F37A 1TUDA 1OWOA 3APDA 4XE0A 2M0OA 4PJOG 3EJNA 1YCSB 4PK4A 4LDYA 3UM2A 3CCEA 2LNHB 3PUKA 2E64A 4M7DB 4U96D 5CECB 4IUUA 3M59A 4PFZA 1S72Q 3EG2A 3RKWA 4ELZC 2J4BA 4F7UB 3SWNA 3UT4A 2PQWA 4GY5A 4M78F 1YI2A 2QDLA 4U8YD 2XDBA 3D9PA 3EIQC 4GLKA 4EMKB 2RFMA 1YITA 5DBKA 3L6AA 5IT9E 3MEWA 4DX7D 4QKUA 4HOUA 4CYMD 3HG0D 4AY5A 2XRZA 3CCRT 2QC9A 4HXJA 3ML9A 5CCMA 2WACA 5CKFA 4XEIG 2AHJB 2ZXWE 3HXEA 2KAFA 2BZ8A 2R2LA 3NTHA 5GAN5 3NAWA 3EGDB 3TU4K 2CP6A 2QQSA 3DRAA 5HKCA 1KLXA 1GCQA 1XQHA 4BY6B 3QZ5B 1EIFA 1UUEA 4BI8B 5A0GA 3H0FA 5IHKA 1GBRA 1N8RU 3UTMA 3UKUG 3TWXA 1OY3D 1Q95G 1Y07A 4WCIA 1U1TA 2KT1A 4L9PA 2A08A 4DI3A 5CKHA 4XTYA 3TSWA 2DTIA 5KYWA 5CR2A 3FUIA 3CVNA 3LVRE 4GMLA 2E10A 3FU3A 3WG7E 3S7FA 2XU8A 1WQWA 3X28B 1KD1U 1K0SA 2HE0A 3AS4A 1S0PA 3HIZA 4I6EA 1NJIC 3ASKA 2OEWA 1VYTA 3VRZA 2XGOA 1Y6IA 4PH4B 3FC3A 1QVGS 4UWKA 3CHMA 3ZN3A 4CRWA 1ABOA 1WHLA 5GAMd 2O4XA 2UWJG 4GBQA 3R7RA 2AZVA 4KBMB 2KT8A 1KHCA 5AT1B 4Y92A 7AT1B 3V8LA 5EYPF 5A7DB 5I11A 1V55E 1ZA1B 4DJAA 4U63A 4C0DC 5IHNA 2OVBA 5G2NA 1AWXA 4U7EB 4D8DA 3EDTB 3CKBA 1GFCA 1ARKA 3TJPA 3E9FA 2GQIA 4RTUA 4H7XA 5H7PA 5LJ5f 3Q47B 3CMAA 1EF1C 1UFFA 3NZSA 4BFRA 3G71Q 1G2BA 4GYWA 3ENEA 3CC4Q 2XPYA 2EQUA 3QDNA 4G24A 4C8QG 4TXPA 2HMAA 1NA0A 2B6CA 3H0IA 2H6FA 1BPOA 4LDWA 4D8KA 2KC7A 1I4K1 1WXBA 4J9CA 2PVDB 4K5BA 2XGSA 4M3OA 2RD1A 4WAFA 5GANe 2GRLA 2BF0X 2ZPBB 3HP9A 3E30A 3KS2A 3RERA 3I5RA 2ILRA 3OYLA 4CGVA 4JRIA 2PQRA 2GRPB 2PNIA 1WX6A 2FPDA 1KQSS 1Y8MA 2X6IA 1O1SA 4HS2A 3ASOE 1WDYA 1YFNA 1YP5A 2D0QB 5GAOq 5HY6A 2RB6A 3JCMh 4FP7A 2ZGGA 1IYGA 4ANXA 3NQPA 2COWA 3HTRA 2FEIA 2EBPA 4QQDA 4UI9J 3I55Q 3RO3A 5GANj 4AOFA 4HOQA 4M75F 3CCLA 3BG1B 4M7AG 3MEVA 3A8HB 2DFUA 4OMQA 4ANUA 3CCLT 4EDUA 4EIKA 3CC2Q 5FU7B 4RG9A 3N5BB 2RK2A 1U5SA 3PZDA 1VQ5A 2RQTA 4Q96A 1JQQA 2DZ9A 4KH0B 4KUIA 3G71T 4CC7A 3BUAA 3PNWC 3U9WA 4M7DC 1VQ5T 2QXFA 4ILGA 4N3AA 3ZU7B 2K3BA 3M57A 1M2VB 1RAFB 1PRLC 4HKEA 1VQ4A 4EMKC 4J8OA 1KHIA 3GPLA 1ZSZB 1AZEA 3UIOC 3U66A 2LQNA 2XEVA 4DOVA 1Q86R 4ME2A 1HS6A 4EPZA 5LJ3e 3CCUQ 2ZU6B 1GRIA 2KYMA 3T9NA 2DZNA 3I4GA 1I8FA 2I0NA 3E19A 3E2UA 2VTBA 4JJNK 2YUQA 4RTXA 1YJNQ 5KBAA 1NL4A 4HCKA 2D8HA 2MWOA 3RKYA 4LN2A 1XNIA 3QXEB 4E6RA 4DBQA 2O9VA 1TNZA 4JJBA 3SEMA 2LXMA 3ZL7C 1M3CA 2F8YA 2BKDN 4DUIA 2DVEA 4RKUE 4A4KA 2IU1A 1OU9A 4M77B 4NRHB 2NYSA 3LXUX 4G8LA 1NEGA 3UI2A 5FU6C 4HRLA 3ESLA 5LJ3j 3UMVA 1JB0E 4F04B 1ABQA 1QMCA 2H8HA 2LAHA 3FUDA 2KK4A 3FLGA 2E6NA 3EHRA 4X9CA 3HRSA 4GA1A 3NFCA 2L0AA 1VQ8Q 1YWOA 2IOLA 3BFMA 3A98A 1Q7YU 5C2YA 4ZHBA 2P2CP 2VGXB 4LDUA 5AQBA 3UQ3A 2LUHA 3FH7A 4QQIA 2MOXA 1D1BA 4RTVA 2NUTA 2K3YA 3ZW3A 3JCMd 2Y4YA 3BE3A 2F0YA 2CP5A 5AJDA 4XKBA 3SZ7A 3C0CA 3JAME 3U64A 4Q69A 1V29B 1X27A 2MIOA 3DEPA 3H9NA 1G3TA 3MYVA 5EIBE 2Z0WA 3OYKA 1H6PA 3JB9G 3M53A 2RO0A 3L17A 4YTLA 3A8LB 5BNWA 3FEXA 2ED1A 1B07A 3RUXA 1I1JA 1SEMA 4HXIA 4GPMA 5ENNA 1LJOA 3G2TA 2OTJQ 2AVPA 4A4FA 1N4QA 3L2UA 4ZFHA 2P4TA 4PJOB 2DMOA 2LT4A 2VYTA 5E75A 3TQ7P 4Y6WA 3JYSA 4HRNA 2VXFA 1MUZA 3TXNA 3ABKE 3D9MA 2GRMA 1Z9QA 4BB7A 2Y4UA 4FLBA 2EYXA 1VQLQ 1N8RR 3EGXB 2JEKA 2DD5A 2OX7A 3JCMQ 1MQSA 2FF4A 4J6WA 4XU1A 2MF2A 3HHTB 2HM8A 2KE9A 2P4RA 3VKIA 4NL3A 4U0ZA 4XU3A 4JZ3A 5AQAA 3E37A 4NL2A 3DB3A 1IHBA 3LDZA 3CVPA 5G55A 4A1GA 4U95D 4U8HA 4RG6A 4I2ZA 4OMPA 4PJMA 4BE1A 2RA2A 4ZGJB 1BKBA 1OX8A 1GCPA 2L0IA 2QY7A 2QASA 4C92C 4XZ4A 5J3BA 2J07A 5LCWJ 1FCHA 3A1PA 2OTLQ 4GTPA 2LAIA 4OVUA 4MBGA 2XZDG 2D6FA 5LX8A 3VLDA 3FRNA 3G6EA 2YHCA 4MLPA 3UT8A 3L08A 5CKDA 4X1VA 3F6QA 1SKUB 3FTWA 1IGUA 1UGRB 3QYGB 1WZOA 2KCKA 3CMEA 4RTYA 4Y91A 3G6ET 2EQJA 2DL7A 3QB2A 4U04A 1E7OA 5GAN6 3L2WA 4AY6A 4RG8A 1JCRA 3ZBDA 2H3JA 3FU5A 1E8ZA 4FADA 1Q86C 3CMET 5KNHD 5C1DA 2EIFA 3Q7AA 1FT2A 4APFA 1TOVA 2KZTB 5HS0A 1ZSZC 3VJPA 4E7KA 4E7LA 4ME7A 3FUHA 5GAN3 1M27C 1Q81R 4LUDA 5FROA 1E7VA 4BEPA 4JHRA 1YWPA 2QTVA 4J9DA 1I5LA 2WSFE 2LC4A 1VQLT 4YDEA 3ZKJA 5GANh 2J8SD 4GPKA 3L82A 2DILA 2HNIA 2BTDA 1ZLMA 1VYVA 2LQ8A 5FTPA 1AVZC 1TNUA 1YHQA 2WQHA 5EILA 3T8MA 4BTAA 3EH1A 4DK5A 4C8QB 5IAYA 4M77C 4Y28E 2R03A 2RF0A 2AT1B 4M75E 2QI2A 1ZX6A 2V8IA 3QG1A 3SFZA 4GTRA 1TTHB 2C2LA 4FYWB 5EDSA 2C06A 2GCXA 3EHQA 4U0SA 3QC1A 4B93B 3G4SQ 4B8CB 3S7DA 4BESA 1Z3YA 2P9NG 4M7DG 1XNFA 2HEQA 2KCVA 1RAGB 2OTLT 5FIOA 2VB6A 2XPZA 2FEZA 4L5GA 3CCSA 3Q75A 4F7UG 5ENOD 3OA6A 3UINC 1TSFA 1M5Q1 3V2XA 2XZTG 1VA7A 3S6WA 3JQ1A 2XQ0A 4GTTA 3UPVA 5FWCA 2EJ9A 5KYYA 1ZBXA 4L7TA 1NLPC 4IUPA 4XQ3A 4OB3B 1PD0A 1FT1A 3FWVA 3META 1MGQA 4ORZA 2GF7A 5EX0A 1OX9A 2FRWA 4M7AB 4G26A 3AT1B 3CV0A 4Z88A 1Q82U 3DBSA 2M51A 3EIJA 3CK8A 5CK9A 1WG0A 2EYYA 3ZHEB 3V30A 5BXUA 3JCKC 2XS8A 3OMCA 1BLXB 2OAWA 4DBHA 4M75D 3CXCP 2X51A 4PS7A 5IXFA 3P8HA 1H92A 5HK3A 4J8SA 3H41A 1QLYA 1G83A 3RIRA 5LJ3h 1N8RC 4O1PA 2EJGA 4YDOA 4IN3B 3V31A 1CKAA 4FL6A 2J05A 3JB9I 4C0ZA 5CCLA 4A53A 1S63A 2V5QC 4XX5A 2VSOE 3CCJA 3CGHA 1H641 4UWLA 4B9XA 1EPUA 3JQ0A 2LJ1A 3GYZA 2ESWA 4TV3A 4J5YA 4DEYA 1PY1A 3CCJT 1VQPA 4M7CA 3G4ST 3GNGA 3CXCA 4Z02A 1RABB 2F2WA 3P2BA 2E65A 4I6JA 1UE9A 3L54A 2A36A 1LF8A 3HXDA 2O01E 4OMLA 3C4SA 4QVZA 2UY1B 3LJ3A 1K9AA 2V4HC 3HXFA 2RM4A 2VYIA 5GANd 2RK1A 4M7DF 1HSQA 4RTWA 2XHEA 2F2VA 1VDYA 5HCKA 4XTVA 4KGVB 3NB2A 2JJ9A 2I2OA 4FU3A 3QIIA 1ZA2B 4E85A 4F7UF 4GCNA 2VGEA 1WJSA 2CH4W 1C0MA 2FPFA 4DI4A 3B13A 3B7SA 3U3WA 2XK0A 2XRYA 4X8QA 1IZ6A 2DBMA 2RHIA 4K11A 2XPIA 1VQ6A 1V1CA 2RQRA 4JJCA 5HKPA 5LL6S 3WVDB 5ANLA 1K1ZA 2VGNA 2K5LA 4MKTA 4MZMA 5KE2A 4ZTFA 1Q81C 2V1RA 5D0OD 3FTVA 4C0EA 3PUJA 4KZCA 4AVXA 2D1XA 3Q78A 1YJWQ 2GRNB 1H8KA 2AZSA 4M78A 3DXMG 5FJYA 4BX9A 5I22A 3SF4A 3VUZA 1D0XA 2CZ0B 4FW1A 3PZ3A 4PKCC 4CC3A 2VKNA 5L23A 2CZ6B 4FJYA 3FEOA 5J08A 1JJ2S 1ACMB 4I9EA 3CHPA 3FIFA 2E3HA 1Z3XA 2KBTA 4F17A 4J8FA 4GTSA 4N4HA 4XIFA 2K9GA 3G2UA 1WY6A 2MI6A 3Q73A 1NZNA 1DNPA 4J7WA 4JS5A 1QVGP 5IHIA 3EUVA 1VQMA 4C5GA 4DX1A 2VSXE 1X6OA 3BDLA 1MNEA 2C0OA 4C92G 4G25A 1AP7A 1W1FA 4OMNA 1U8RA 1VQMT 3AG2E 2EIJE 5G04C 2BTTA 3SWNC 1QP2A 3X2QE 1SVXA 3SO8A 5LJ5e 2LZ6B 4UWFA 5LJ3d 4RTTA 5KCMA 3CCQA 5LFAA 3EU5A 4LUEA 2AJAA 1IQRA 3RMSA 2BUGA 3FP3A 1BCOA 3E32A 4IRUA 3FFLA 2YT6A 4C0GA 1BI2A 1QVGA 3V8KA 3TAXA 4N39A 2MMPA 4UC4A 4LERA 4GB9A 1J3TA 4B9WA 1W3BA 3BW1A 1Q2ZA 3C98A 5GAN4 3RO2A 1BYMA 2JABA 4TVRA 3OYBA 5ENQD 1GCQC 2LTOA 1MZCA 4C0DB 2LXLA 3CCMA 5LJ5j 2KRNA 3RKXA 3I56A 1VQ9Q 5CQYA 2MOWA 1YJWT 3GF5A 3FUFA 5CEDB 3CCMT 1VQOQ 2P0KA 1M90U 1KQSP 3I56T 4ZN1A 3QWPA 1VQ7Q 3H8ZA 4QW2A 1VIEA 5GAMg 2RH2A 2FULA 3OSVA 3P8BB 3EG1A 5AIJA 2L3SA 4M77G 2GW1A 5HK0A 3EGUA 3MCXA 1H2VC 5FZQA 3UKRG 3FH5A 4UUCA 2IOSA 3D9LA 3Q5MA 1Q86U 4RTZA 4WUYA 3JB9J 1G3WA 4C48B 3FUMA 2KR3A 3OB9A 4JHJA 3TWTA 2RQVA 3M58A 3FEYA 2X4WA 3IHYA 2NUTB 1KQSA 1HO8A 3M0QA 4BI4A 3UUXA 5GAOp 3CCEQ 2SEMA 2CG2A 1D3BB 2C0MA 3QKYA 2E4HA 2MRIA 3MV3B 3PIOA 1X81A 2WXQA 4R7LA 3R7QA 4CT0A 1FXXA 1YI2Q 3REAB 2JXBA 4HOTA 1HX8A 1KT0A 3Q1JA 4IUQA 1YITQ 1G3SA 4M75A 1JUQA 4UQXA 3C3RA 2V0PA 1SZAA 2RJCA 3TGOA 2KEAA 3KUFA 5CO7A 3SBTB 3WXXA 2B0OE 4ILIA 1M4ZA 3VTYA 5KYXA 2DIQA 2NUPA 3KSLA 5FQ8A 1RLQC 2YUPA 3I5SA 2COYA 5IXBA 4RMOA 2EINE 1BIBA 2JNGA 5GAOn 3OXLA 3ESKA 1Q82R 1AHJB 2KXPC 4I6GA 1KQ2A 3ZYMA 1VQ7T 4J9EA 2J6OA 3OYMA 1XTDA 5KYUA 3UT7A 4UI9K 1AT1B 4OAVB 3LS8A 1PSFA 2V4LA 3EG9A 3DLLA 3U4TA 2R58A 1YJ9A 2WXIA 3CC7A 2CP7A 3NOGD 5BXOA 1CSKA 4HT9A 2HKNA 1ZUKA 2JMCA 3M0RA 2WSCE 3CCRA 5CBOA 4DX5D 2E41A 3CD6A 2OJ2A 1JWGA 3FUJA 1YJ9T 4HVBA 3CC7T 3PEUB 1MMDA 2KY9A 3Q4AB 1IQUA 3ABLE 1IHVA 1ZBJA 3D3MA 4J9IA 3PTAA 4M77F 2PZIA 2CFUA 3CD6T 1B34A 4FYXB 3EHNA 2YRDA 3A8OB 1ZQ1A 3CHOA 2EKHA 4OMOA 3Q79A 1SHFA 2M0YA 1ELWA 2XIDA 3ZIMA 5HQ8A 3ZVVA 3CBOA 3EU9A 3NTKA 4LUNU 2P9PG 2V5FA 2LJ3A 3MA5A 1N0QA 4BDZA 3FTYA 5FU6B 3WXMB 5ENSD 1BU9A 1ZHIA 2F2XA 1UJJA 5CERB 5GMKe 4K0RA 2WXOA 5CCAA 3PZ4A 2DZOA 2LSVA 3ONLA 3WVEB 1E96B 1BIAA 4AG1C 1AEYA 3CEQA 3QWXX 2L0TB 4JS4A 4E47A 1EYHA 3OTNA 2F8XK 5A0LA 4JPSA 2L6BA 1KQ1A 2IO2C 3OXFA 3CHSA 3NZUA 4II1A 2EIME 1OQKA 3JRZA 2DL4A 2J6KA 1N27A 1YA0A 1UTIA 3OY9A 3LWHA 1U3DA 3C5RA 3HPWA 1LTXA 3TG4A 3CKCA 2X4JA 2QEXQ 3ME9A 4ZGEB 4PFPA 4A54A 2LCCA 2YQ8A 4RQIA 5GMKj 1S72T 4W9RA 5KCOA 1K8AU 4F1PA 4EZLA 3L2QA 5BV0A 3CEYA 1G3YA 3PE0A 1HU3A 4PJOF 3L22A 3I35A 2F5KA 4H7YA 4CCAA 3OS0A 2YLBA 1HK9A 4GTMA 2CSIA 4O5VA 4HCZA 2GBQA 1X01A 1SPKA 1YIJQ 4JW1A 2WXNA 2D9TA 4GTVA 3T5XA 1H2UA 2WPVA 1Q81U 3JCMg 4F14A 3D9JA 3DPYA 2MYSA 2A4ZA 1RZ4A 1Y96B 3JCMJ 2ED0A 3EFOA 1SHGA 1N9AA 3QNKA 2QFCA 2DXCA 3GZSA 4I43A 1AWWA 1IRXA 2IG0A 3IBEA 4NS5A 4FC8A 2DJQA 2XEEA 4RSYA 2EW3A 3QKJA 2MCNA 3PEVB 3CPFA 5FRMA 2HL3A 1Z6TA 3INZA 4HFGA 2I9CA 5AN8A 5GMKm 2ZPGB 2EFIA 2DXTA 2L2PA 3PMTA 1VQ4Q 2DM1A 1D09B 5LJ5h 2D0NA 4MS6A 3VS6A 4PJNA 3IQLA 4HBDA 3S7JA 4A63B 1UGVA 2AXZA 1G8XA 1W2BS 1WXTA 3CQCB 3QUIA 4CGWA 1W70A 2O88A 2YUNA 1NM7A 3FJ5A 1DCEA 1M1GA 4IUTA 2QEXT 2KBXA 4I2WA 4WWNA 2ZZDA 4C92B 3LH0A 3SHWA 3G71A 1Q82C 1H19A 3CVUA 2DIWA 3CC4A 5BUZA 2LNVA 2J49A 5CRVA 1XJWB 3A5ZB 2RD0A 3CSTA 5HRYA 4EZJA 4IYPA 5EG2A 2CHWA 2QG9B 5KYNA 5I21A 3CC4T 2DZCA 1M90R 2A5EA 3MGBA 1FYNA 3A8MB 1Y0MA 2DO3A 2ENMA 5FRNA 3DSXA 2HAXA 3VYGA 2J7IA 3QSUA 4OF1A 4J8YA 5GJVB 3P1UA 3R9MA 2XKOC 1BD8A 1M3BA 1ZUYA 3LPZA 3V79K 1YIJT 2Y4TA 3UM0A 3OQ5A 3OYFA 1H3ZA 2VWFA 4C8QF 2J6FA 2DIGA 2HD0A 2M02A 3JUEA 5J26A 2FYKA 5G05C 2JM9A 4AV7A 4DLQA 3VLEA 4FHJA 4HA8A 4KGXB 3LY8A 2C0IA 3OAWA 3E1SA 1NPRA 3M55A 4EMHA 2J9QA 3KAEA 2ZPEB 3MJXA 1MNDA 4A1SA 1SG5A 3I55A 5GAN7 4URKA 3V7RA 3LVQE 4Q94A 3I55T 3HSBA 2CUBA 3P8DA 2ROTA 4Z8AA 4Z89A 3KXTA 2LQWA 3HXBA 3L2RA 3CPWS 3X20B 2Y3AA 2K4YA 3CC2A 2RJDA 4V3IA 2KCLA 4K5CA 3X24B 5BT1A 1U3CA 3B95A 4P5NA 3M4YA 2AWIA 5GJWB 3R6NA 3CHRA 4HQDA 4Y6CA 3PGGA 3CC2T 2CKKA 1K76A 2KDSA 4APOA 4M7AF 4FT2A 3EHMA 3IXEA 3J5QB 4OB0B 3CHQA 1HF8A 3TSZA 4MZPA 5ENPD 1OWPA 2PM7A 4J9FA 4E7JA 3OBWA 4DX2A 4L59A 4M78E 1MMAA 2E12A 3FU6A 5DLQE 4C5HA 2CFZA 3AG4E 2EQKA 3IHVA 2CSQA 2ECZA 2QGFB 2RG8A 3D9KA 3CCUA 3MKQA 3S7BA 1N94A 5LJ5d 4RLYA 1DVPA 1WJRA 2EQIA 2HCKA 2K6DA 2KRSA 2IIMA 4J83A 4XK8E 4CZ2D 4ESRA 3SB2A 5DLOA 3AG3E 4J9HA 3T8KA 3CCUT 2RFAA 2WXGA 5D0QD 1EDUA 1OPLA 5CVIA 5I2MA 1DCQA 2A3LA 1YJNT 2P9SG 1NI1A 1M3AA 2DF6A 2EGEA 1RLPC 3MEAA 4FSXA 1QYMA 5AARA 4C9BB 1S70B 2ZISA 4JB8P 5KWDA 1OYXA 2O31A 3AHUA 2L8DA 3BU8A 1WIEA 2A7YA 5GAN2 2VSNA 3VLFA 1YN8A 4I9CA 1WHGA 2XG8D 2YLCA 3MEUA 2P0QA 3M0PA 4XI0A 1TJFA 2K5FA 4OVVA 3QPHA 3PZ2A 1WM5A 3RAUA 4ZNXA 1HG5A 3MZLB 1VQ8A 4M78D 3ZEFA 3QYHB 4DQ2A 2DEUA 3RJVA 5GMKh 5IY5E 3SQVA 1TWBA 3VV0A 1HXDA 1ELRA 2KMTA 3H0HA 2O9SA 3ABME 3TWSA 1VQ8T 4XI9A 2ABLA 4OYSA 1WNLA 4BTBA 2FZKB 1PC0A 2VJ8A 3OYCA 3E9GA 2DEQA 2AXVA 3QWYA 2AW6A 4AG2C 4JRPA 3MX3A 2YSQA 1M90C 4PJOE 4O60A 3ULYA 1X43A 1K8AR 3NTIA 2H6GA 4YVOA 1GL5A 2F5TX 1GBQA 3NOCD 4L23A 2P84A 4IIMA 3CVWA 2JTMA 4EMKA 1YHQQ 1JJ2P 1I81A 2FG0A 2QQ9A 1PM3A 3OW2S 3M4GA 1UEBA 3OSSC 3CCVQ 2EILE 2Y0BG 1A0NB 3BG0B 1WI7A 2OTJA 3DEOA 2VUBA 5GANg 3PMIA 1Z5SC 2ETCA 5AENA 3RMQA 2PNNA 1V54E 3CIAA 2OTJT 3EGDA 2WB2A 2B8AA 3JB9F 2KNBB 1QWFA 1VQLA 3HVEB 3SBSA 5FWQA 4AM9A 3PE3A 2DLPA 3ISMC 4BE2A 4KVOA 1UECA 4BY6A 2PU9B 1MHQA 3QARA 2QQRA 1KZOA 2ZCFB 3GP8A 2R57A 2X6JA 4HVUA 2CHZA 1TJCA 1HFAA 1A17A 3GZ1A 4FSSA 1IB8A 1UDLA 1JJ2A 2LO6A 1QBQA 2RN8A 4OGCA 2MAMA 2QQAA 3E34A 2CYZB 3QWWA 2NUPB 2XD0A 1U3OA 2QDYB 3CK9A 1NG2A 4PJOD 3MEKA 4D10C 1UG1A 2CT4A 1SSFA 2BKGA 1UGQB 1AWCB 2EYQA 2Q7FA 2OTLA 1SW6A 2E2EA 4YDYA 5B3SE 3SWNB 1VQNQ 2KROA 5JMND 3APFA 5EYLA 3TG5A 1N9RA 1NPPA 2QYJA 3KD7A 5GAOr 1NFIE 1RACB 2YHEA 3ZEHA 4YDWA 1IREB 2BZYA 3Q49B 3CVVA 1SRLA 3Q9NC 1QCOA 2WXRA 4GZ6A 1B34B 1RL2A 4NURA 3C12A 2X4YA 2HBPA 3IKOB 4KGZB 2A5UA 2NYJA 3FJPA 3GNFB 3C3OA 3MP8A 4PJJA 8ATCB 1RW2A 5C0MA 4GAAA 1GFDA 1D8EA 5FZSA 4BX8A 2ROLA 1HXIA 1FPPA 1O9SA 2PUKB 2X3MA 4ACKA 2DTOA 2Y4XA 5LJ3g 2EYZA 4C8QE 1M2OA 4B89A 4QT7A 4WWPA 5C6SA 2FZGB 3R6OA 4N0AA 5KYWB 3L16A 2EJFA 2YINA 2OVFA 5E76A 2L9BA 4AIFA 1EX4A 1W4SA 4GA2A 1LPLA 3CSFA 2WMOA 3SI5A 2X38A 2EPDA 3FHEA 3CBPA 4I1OB 3VTXA 2O4XB 1KZPA 1D0YA 2IVWA 4FYYB 3TREA 3VS0A 2QYZA 1M9SA 2O2OA 2DBAA 4OB1B 4N2QA 3G4SA 2LX7A 1K9MU 2WXJA 2NSZA 4BETA 3M0UA 2OAUA 4EBAA 1B3QA 2KGTA 3AAAC 1QNFA 5G04J 4J0UA 3TWRA 2KM4A 3ASFA 1BB9A 4GZDA 3G2SA 3RIBA 1WHHA 3ZXPA 2IJGX 4GYOA 2EWNA 2YRCA 2QA4Q 2E5QA 4M7AE 2JTFA 1UJYA 2MWPA 4PUCA 2VV5A 4C8QD 3SFMA 1K8AC 3L13A 2CZ1B 4J9GA 4X34A 2IF4A 4JUVA 3N71A 1RAAB 2M1HA 2XENA 1TXQA 2DK3A 4CDMA 4R0KA 2JW4A 2CGHA 3APCA 4CDNA 3HRTA 3J80E 3MKDA 3JUIA 3MP1A 1UB4A 4N2SA 4AFUC 1PHTA 1WA7A 1MMNA 4KT0E 1ZSZA 2X6HA 2WXMA 1M8VA 4JA7A 2B86A 2P9IG 3DSVA 4UWHA 4BERA 4HCCA 1FMVA 4XTXA 3C94A 3SDZA 1BBZA 3UWNA 3O5ZA 3RNJA 2E5KA 3I9QA 4LNBA 4WNFA 3PIPA 4FA6A 1A5EA 2KVQG 4E7IA 3OS1A 3LYIA 1TU0B 4M75C 2RQWA 3LYAA 2LQKA 3GOXA 1KC8R 4M7AD 3FULA 4BSXA 2XI9A 3FDHA 4FULA 3RRNB 3VS3A 2QYUA 1BI7B 3DB4A 3FY4A 4F16A 1O1TA 4RCBA 1KFZA 1Y71A 4HOSA 2FI7A 1UG3A 3RESA 1FVFA 4LXCA 3H6ZA 4ILHB 4I1MA 4U07A 3ZYQA 2JM8A 3LGLA 4DOWA 2QA4T 3TCJA 1QVFS 1KIKA 1E8XA 2C0TA 4OMFB 4C5EA 5JHBA 3D9OA 1N9SA 1JEGA 2X3XD 4XTWA 4JZYA 4K5AB 4N5CA 3FH8A 2PL2A 4LSZE 2ONDA 1Z9ZA 5A6CA 2VGXA 1VYUA 3VS7A 4FLHA 3R9AB 3ZRHA 1NBEB 3AS5A 1ZUUA 2WXKA 4A3TA 3ZFJA 2HYZA 4F6RD 1UN8A 2P0PA 4BACA 3L1AA 4OVAA 2PQNA 2MPXC 3E4BA 4HNAD 2XDPA 4WTOB 2VTBB 6AT1B 3QDFA 1ZB1A 5AAOA 5CMWA 2K2MA 1YJWA 1UN9A 5EX3A 1S1NA 4UQYA 4PDXA 1M1KR 1TYQG 4LD6A 4ANWA 4LRZA 3I3NA 3TVTA 3ZYLA 4LNGA 3EH2A 2YDLA 4QFVA 3FTXA 4PLIA 5B1AE 1MV3A 4A4GA 3OYDA 1M30A 1N0RA 2DWZA 4PJOA 5GAMf 1Y57A 1SA4A 2R59A 1R0CB 1HYOA 2COZA 2IPOB 2L3RA 3AG1E 4ZN3A 1AWJA 1N6AA 2JMAA 4TRQA 4XKCA 2GNCA 2JTEA 1F1BB 2DL8A 1S64A 1MYOA 5CBNA 4UWGA 3LJNA 2KQWA 3F70A 4HVVA 1E8YA 4K03A 1VQKQ 4GZ3A 1K73R 5CAIA 3C72A 3PVQA 3VS4A 3BY7A 4HI9A 3CQGB 5AQ7A 3PT9A 1BI0A 3GW4A 1WFWA 1WGSA 1TEZA 2WMNA 3O48A 3OYNA 4WNEA 2HQEA 4TUMA 4CC2A 5I2SA 1W2BP 4ANJA 1O75A 2RMOA 4FM4B 5CIUA 1IO6A 1HH8A 1KG1A 1D1CA 1OWMA 5FT9A 2LX9A 3LEWA 3NGPA 1TNBA 2CS7A 2FPEA 4HCBA 3ASHA 2AKLA 3EG0A 4F1SA 1DC2A 4OGEA 4C92F 3JV3A 4FJZA 3MKQB 3RK6A 4DLOA 4ATZD 4IKFA 2HZYA 3FB9A 3FTSA 3JB9D 1MMGA 3CCRQ 1N11A 2P9LG 2JT4A 5DY9A 3OS5A 2JS2A 1H0AA 1UJKA 4GCOA 4WWOA 1JXMA 2MYOA 3DWLG 4HI8A 4KXKB 4L2YA 4HORA 1QKXA 4N4IA 1VQ9A 1W2BA 4JA9A 3FDRA 3PFSA 3URZA 5JJTA 3MCAB 4RG2A 5JJ6A 5KCHA 3GIBA 4I1AA 1VQ7A 1VQ9T 1TR4A 1X69A 2KZTA 4JJDA 4F7AA 3OMGA 2WVIA 2L3QA 4CRIA 1VQOT 3IV0A 1MX4A 1L5JA 3J5PA 3PRZA 3W9GA 1FX7A 1H2TC 2CZ7B 1K8KG 2ETBA 5CHEE 3SFXA 1R77A 5CMYA 2X35A 1KC8C 4IIOA 3UM3A 2FO0A 4XAXB 3CK7A 1E90A 2BEDA 3LW5E 4JRKA 3V7CA 1VQKT 4AMCA 2DERA 1YNZA 4J6XA 1K4US 4ACLA 4EHMA 2YRVA 2RPNA 2NWMA 2L89A 4C8QA 2CG3A 2V8SE 3MV2B 1LNXA 2RHXA 3CPWP 1GXIE 2E1HA 3QZ9B 1I07A 2VSYA 3QBYA 5GAOm 2I1JA 2W10A 1K9MR 3VUBA 2GRRB 1NEBA 5ITZF 4XTZA 1K1AA 2VVKA 1RUWA 2YUOA 3CCET 4XTUA 1INZA 4DBRA 1SQMA 3M0SA 3V8JA 4WNDA 2DL5A 1T3LA 2GFAA 2ATCB 5ENRD 1QCNA 3KSQA 1YI2T 1JWFA 4OAUC 3CMAQ 4M7DE 1KT1A 4G11A 2DE0X 1YITT 1V76A 3VS1A 4GTOA 4IULA 2FB7A 3ZGQA 4F7UE 2V8JA 1OOTA 1QQJA 3CPWA 4JD2G 1O5MA 3TWWA 5T4YA 5D6WA 2ZPHB 3UDCA 2RI5A 5FQ7A 1M1KC 4OMMA 3JB9H 4GMRA 3ULRB 4EECA 2VC8A 4M7AA 1S72A 1IXDA 4BD3A 1N52A 2HDAA 4NQ0A 1TG0A 3HRAA 2DD4A 3ZHEA 4JZ4A 1JU5C 2BE9B 2JS0A 2M9UA 4PS8A 4M75G 1OZ2A 1UOHA 5LOZA 3HXCA 2R5AA 5AQ9A 4CC4B 4LEUA 1X6BA 1RADB 4TXQA 1WPYA 4PFOA 3DXKG 2DYSE 5ANRA 2BE7D 1TN8A 1K73C 2DYBA 1FMWA 2ZGDA 3ASNE 1M1FA 3I4RB 2JOYA 3X26B 1PRMC 4B8AA 2WXHA 5G05J 3ZYKA 3CCLQ 2PVOB 2CP0A 4M7DD 3AS8A 3JCMf 1TNYA 2OOEA 1PD1A 4JC8A 2YNQA 4PLLA 1JO8A 2JVVA 2NLUA 2JLBA 4BT8A 2FO7A 2DA9A 2PZ1A 2LMJA 1G5VA 4JDSA 4AFZC 2XCBA 1XGWA 1LVKA 1VQ5Q 1DJ7B 2ETAA 5LJ5g 3DPDA 2J09A 1OWNA 5ARGA 2BIVA 5KYYB 2LDMA 3CVXA 3CMAT 2L6JA 2HBWA 1MHNA 2WXFA 2K3XA 3AJIA 1WDXA 2UY1A 2YWWA 2LNIA 1EFNA 1ELKA 3QK0A 3G1JA 4DBFA 1HG2A 2H6IA 3IEGA 1TUCA 2EAYA 2X4XA 1MX2A 4GMJA 1PWTA 5KJNA 1KJWA 1FVHA 1KK7A 3OW2P 5ARFA 1OEBA 1RAIB 2BZXA 3BEEA 3ML8A 2QEXA 3OYHA 2LRQA 3HRUA 2HSPA 3SD5A 2FBNA 3NMZC 1OV3A 3UX4A 4F3VA 1NYGA 1YMPA 1U06A 5D6YA 1X2KA 3CVYA 2G3RA 2PTKA 2CUDA 3QJYA 4C0FA 3C3QA 2EIKE 3SGHA 2WQ6A 1T0HA 1YCYA 2LP5A 3LX7A 5AYFA 3VS5A 1CKBA 3RR6A 1RI0A 1YIJA 2EQMA 3OW2A 1E6HA 5DIZA 3G7ZA 3OYIA 3D7SB 2A0FB 1RI9A 2Y90A 1PNJA 3CBMA 1TN7A 5BPPA 2L5QA 3L2ZA 4JVSA 4AJWA 1K9MC 2GTOA 4GA0A 5FZRA 1QVPA 4L1BA 2QQBA 5M72A 1AZGB 1UJ0A 3M54A 2R02A 1QCFA 3GLXA 1RAEB 4PS3A 2EVRA 5FLXE 2MK5A 2P9KG 4QQGA 2KXCA 4OP0A 1SF9A 2D8JA 4MMLA 2DCPA 4C92E 2J06A 3PZ1A 2NXPA 4U0UA 2EQXA 2LCSA 2F69A 1K3ZD 3JCMb 2EGCA 1D0ZA 1I5OB 4I17A 3UM1A 2V8KA 3KBGA 5EN5D 1VQ4T 2A37A 4FHKA 3TWVA 4RCCA 4O6FA 4UQZA 1SRMA 2GTJA 2OCCE 2G6FX 2X9HA 3QJ6A 3THKA 1QQEA 4WF2A 3VRYA 2DJZA 2CH4A 4PNOA 4E2FB 2DRMA 4M78B 2XEHA 5J39A 5GMKi 4LE9A 3DSWA 1TH7A 3HYMB 2J08A 4BY6C 2DPPB 1UGPB 2AXUA 1P5QA 1SA5A 3CLJA 1B89A 1OT8A 2X6KA 5LP0A 4ELYC 4V2SA 4PJLA 2YHTA 2WXLA 5KNGA 4L2LA 1YBYA 3AU5A 3MPUB 3PREA 4YNDA 1LOJA 1QWEA 2LT1A 5B1BE 4UI9C 1OI1A 2A28A 3QJZA 4RUGA 2OI3A 4BUGA 4C92D 4QVCA 8AT1B 1PCXA 4M77E 4EPCA 2E6ZA 3C95A 1G3NB 1YJNA 3LLRA 3DSUA 2RHZA 4VUBA 4CT4A 2RJEA 4A3VA 2DETA 3RRMB 2CP3A 4J6YA 4O6JA 1AD5A 2IY0C 4J7IA 3I5PA 1HZ4A 1D9SA 3LCAA 3QOUA 4AEZC 4KH1B 2AK5A 2XICA 4L6V5 4JRQA 1KC8U 3MKRA 4JHKA 2KYBA 1D3BA 1VUBA 2FRYA 3HKSA 3M9QA 3T9KA 4E7SA 3TXMA 1H3HA 2E70A 1B7TA 3ER0A 4R56A 3AU4A 3G6EQ 1TNOA 1BI3A 1UGSB 2DVJA 4JEHA 4BI3A 3JCMV 5GAOl 3CMEQ 2P58C 4E7HA 3PE4A 1WJQA 2ZGWA 3PDNA 3JCMc 4N0AC 3J81E 3M56A 3T5VA 4HLEA 1PSEA 3OYGA 1NP7A 2VQ2A 2RKKA 1E7UA 2QK0A 1E6GA 4KZ0A 3TL5A 1OCCE 2XGMA 3MHXA 3LH5A 4M77D 4ATOA 3NF1A 1FWZA 4DA4A 4LG6A 1RAHB 2QTXA 1D8DA 4IUVA 5IH2A 4G23A 2LJ0A 3L9TA 4JLGA 5AJLA 3QHSA 4KULA 4M7DA 4MMKA 3G2VA 1OCRE 3HDXA 2K57A 3L42A 4F7UA 3JCMP 3PS6A 1OUVA 1R8OB 2XDDA 3CR3A 3L2VA 3B7RL 1KD1R 4NOYA 3KEAA 4GZ5A 4KUDK 1N4PA 3UF4A 1HE8A 5GANf 5BV1A 4FCYA 1M1KU 1K0XA 3CVQA 1MV0B 2DBKA 3RBBB 2RNAA 3URGA 5FINA 3MJWA
chains in the Genus database with same CATH topology
2RQTA 2KXPC 1BBZA 1JQQA 4AFQC 3O5ZA 3RNJA 1T0JA 2J6OA 4Z68A 4J9EA 2E5KA 3I9QA 4CC7A 4OAVB 1A5EA 3ZU7B 3NOGD 5BXOA 1CSKA 2K3BA 1ZUKA 2DRKA 2JMCA 2RQWA 3M0RA 5CBOA 4DX5D 3UATA 1PRLC 2OJ2A 3VS3A 4J9IA 1ZBJA 1BI7B 1K1BA 4KRTA 1AZEA 4U8VD 2LQNA 4F16A 4BSZB 1KFZA 1BI8B 5JA4D 5D66A 4HVWA 1GRIA 2EKHA 2KYMA 2W0ZA 4OMOA 2DZNA 1SHFA 2I0NA 2M0YA 2YUQA 4RTXA 5KBAA 4HB5A 2JM8A 2D8HA 4HCKA 1KIKA 4LN2A 2C0TA 3REBB 4E6RA 1HJDA 3EU9A 2O9VA 1JEGA 4JJBA 3SEMA 2X3XD 3ZL7C 1M3CA 2LJ3A 2F8YA 4K5AB 4DUIA 1N0QA 4LSZE 1Z9ZA 5ENSD 1BU9A 2F2XA 1T3SA 1VYUA 3VS7A 1IKND 5CERB 4G8LA 1FMKA 1NEGA 3UI2A 2DZOA 1ZUUA 4HRLA 2L3PA 4F6RD 4AG1C 1AEYA 3QWXX 1ABQA 2F8XK 2H8HA 2KXDA 2L6BA 3UXGA 4HNAD 2DL4A 2J6KA 3EHRA 5AAOA 2K2MA 1S1NA 1UTIA 2L0AA 3C5RA 1UHFA 3TVTA 2YDLA 1YWOA 4QFVA 1NLOC 3EG3A 5FW9A 3A98A 2BKKB 1MV3A 3UA6A 4ZHBA 2P2CP 4F1PA 5AQBA 1N0RA 2DWZA 1M30A 4QQIA 2MOXA 3PE0A 4RTVA 1Y57A 3B7BA 3I35A 1BK2A 4GLMA 1HD3A 1AWJA 3C0CA 1M8MA 2JMAA 1X27A 2GNCA 2JTEA 2DL8A 2MIOA 3DEPA 1MYOA 5CBNA 2K7AA 2CSIA 4HVVA 3LJNA 5EIBE 2GBQA 3PVQA 3VS4A 4HI9A 5AQ7A 1SPKA 2FO1E 2ED1A 1B07A 1WFWA 1QKWA 1I1JA 1SEMA 1YYHA 2DL3A 4GPMA 4DEXA 2EGAA 4CC2A 4TUMA 4F14A 4ZFHA 1UHCA 2RMOA 2DMOA 1IO6A 2ED0A 4HRNA 1SHGA 2KRMA 1MUZA 3NGPA 3V2OA 1XOVA 1Z9QA 2FPEA 1AWWA 2AKLA 2CDTA 1DC2A 2EYXA 2K79A 3EG0A 3JV3A 2DJQA 2XEEA 2MCNA 2EW3A 3ZNGA 4ATZD 1AOJA 2Y1LE 4HRMB 3JXIA 2RQUA 1N11A 5AN8A 2JT4A 2KE9A 2NUZA 2L2PA 2P4RA 2JS2A 2DM1A 1JXMA 2D0NA 5ENTD 2MYOA 4HI8A 1N5ZA 3VS6A 1QKXA 1WLPB 3IQLA 4JZ3A 5AQAA 4HBDA 1UGVA 4A63B 1W6XA 1IHBA 1WXTA 1W70A 4U95D 2YUNA 1NM7A 4OMPA 2O88A 3FJ5A 2KBXA 1TR4A 1X69A 3SHWA 1GCPA 4JJDA 5FWBA 4NIKA 2L3QA 3TWQA 1MX4A 3W9FA 5HRYA 2XZDG 3J5PA 3W9GA 1NYFA 2ETBA 2A5EA 1FYNA 1Y0MA 4IIOA 3F6QA 2FO0A 2ENMA 4X1VA 2J7IA 2DVWA 4RTYA 4J8YA 1YNZA 5GJVB 2DL7A 1E7OA 3NBNB 1JXOA 1BD8A 1M3BA 1ZUYA 3V79K 2RPNA 2NWMA 5KNHD 2VWFA 3U23A 2J6FA 5HS0A 1I07A 3JUEA 4AFSC 2JM9A 2W10A 1M27C 1NEBA 5ITZF 4LUDA 1K1AA 2VVKA 1RUWA 2C0IA 2YUOA 4BEPA 1K4US 1WXUA 3M0TA 4J9DA 1YWPA 3M0SA 3D9HA 3ZKJA 4N5QA 2DL5A 2J8SD 1T3LA 2DILA 5ENRD 4G8KA 1ZLMA 4OAUC 1VYVA 1MJ0A 3NHNA 1AVZC 2DE0X 5EILA 3VS1A 2CUBA 2ROTA 2RF0A 1OOTA 4Z8AA 4Z89A 2LQWA 3TWWA 1ZX6A 4M4ZA 4K5CA 2EYWA 3EHQA 3PVLA 3B95A 4LNUD 5GJWB 4B93B 4OMMA 1X2QA 4HQDA 3R6NA 4GMRA 3ULRB 4BESA 4DRXE 3KFVA 1K76A 2HEQA 2HDAA 1TG0A 3HRAA 3IXEA 5FIOA 3J5QB 2DNUA 4JZ4A 1JU5C 5ENOD 2JS0A 1BU1A 3TSZA 1I0CA 1PKTA 5ENPD 5EC7A 3V2XA 1UOHA 2XZTG 1VA7A 4J9FA 5AQ9A 4CC4B 4DX2A 1X6BA 5FWCA 3JXJA 4JPBW 1NLPC 2ECZA 2CSQA 2DYBA 2CREA 2ZGDA 3CQTA 4RLYA 4ORZA 4HLLA 2FRWA 2EQIA 5EIDA 2HCKA 2K6DA 2IIMA 2KRSA 4CZ2D 1PRMC 3GBQA 4ESRA 4J9HA 4Z88A 3T8KA 2M51A 3Q9UC 1LCKA 1ZSGA 2RFAA 1WG0A 2EYYA 3V30A 5BXUA 1OPLA 1BLXB 1DCQA 4J9BA 3UA7A 2OAWA 1JO8A 3NPFA 4LNPA 5ECAA 1M3AA 2DF6A 2PZ1A 2DA9A 2EGEA 3ZUVB 1RLPC 2LMJA 2X3WD 4AFZC 5IXFA 1H92A 1QYMA 3H41A 5AARA 1QLYA 1S70B 1G83A 2ETAA 4JB8P 5KWDA 2GGRA 2O31A 5CEAA 4O1PA 1WIEA 2HBWA 2CT3A 3V31A 1YN8A 3AJIA 1CKAA 1WDXA 2J05A 1EFNA 3M0PA 1MX6A 1TUCA 2AKKA 2V5QC 2V1QA 1MX2A 1PWTA 1SSHA 1KJWA 2LJ1A 2ESWA 1PKSA 4ZNXA 4DEYA 1OEBA 3TWUA 1OPKA 2BZXA 3VS2A 1KSWA 2XMFA 1X6GA 2F2WA 3H0HA 2DX1A 2O9SA 3TWSA 1UE9A 2HSPA 2A36A 2ABLA 3NMZC 1OV3A 4OMLA 1NYGA 1U06A 1YMPA 1WYXA 1K9AA 2V4HC 3QWYA 4AG2C 1X2KA 2YSQA 1IXVA 1HSQA 2PTKA 4RTWA 2F2VA 4O60A 1X43A 2CUDA 5HCKA 2SRCA 4DX6D 3VS5A 1T0HA 2LP5A 1GL5A 2VGEA 3NOCD 1CKBA 1GBQA 2CH4W 4IIMA 2FG0A 2FPFA 1E6HA 4O1OA 2DBMA 1AWOA 2Y0BG 4K11A 1A0NB 1WI7A 3DEOA 1V1CA 1RI9A 2RQRA 2F37A 1PNJA 1TUDA 5HKPA 4JJCA 1K1ZA 2ETCA 2PNNA 2GTOA 1YCSB 2V1RA 2LNHB 4U96D 5CECB 1AZGB 1UJ0A 2D1XA 1QWFA 2KNBB 1QCFA 1H8KA 2AZSA 2EVRA 3EG2A 2DLPA 5I22A 2KXCA 1UECA 2D8JA 2QDLA 4U8YD 4HVUA 2VKNA 4CC3A 5L23A 2J06A 2RFMA 2LCSA 4FSSA 1UDLA 1K3ZD 4DX7D 2EGCA 4CYMD 3HG0D 4F17A 2KBTA 2RN8A 2QC9A 4HXJA 2K9GA 5EN5D 1U3OA 2A37A 2BZ8A 3TWVA 1NG2A 4J7WA 1SRMA 2GTJA 5IHIA 3THKA 2G6FX 1UG1A 4DX1A 3VRYA 2CH4A 2CT4A 2BKGA 2C0OA 1AP7A 1AWCB 2XEHA 1GCQA 1W1FA 2DRMA 4OMNA 1SW6A 4YDYA 4LE9A 2KROA 5JMND 1UUEA 2BTTA 3H0FA 5IHKA 1GBRA 1U5SA 3UTMA 1OY3D 5EYLA 1SVXA 3TWXA 2QYJA 1OT8A 4WCIA 3SO8A 2KT1A 1NFIE 2A08A 2LZ6B 4RTTA 3TSWA 4YDWA 2BZYA 4LUEA 5KNGA 2AJAA 1SRLA 3Q9NC 1K0SA 2HE0A 2YT6A 2NYJA 1VYTA 3VRZA 1QWEA 1J3TA 1GFDA 2A28A 2ROLA 1ABOA 4RUGA 2OI3A 2JABA 4GBQA 2AZVA 2KT8A 5ENQD 1G3NB 4Y92A 2EYZA 1GCQC 5EYPF 5I11A 4QT7A 2KRNA 5IHNA 1AWXA 4D8DA 5CEDB 1GFCA 1ARKA 1AD5A 2GQIA 4RTUA 1UFFA 1D9SA 1G2BA 2AK5A 3EG1A 2KYBA 2L3SA 2FRYA 3T9KA 3EGUA 2EPDA 1H3HA 3H0IA 4UUCA 4D8KA 3VS0A 1WXBA 2DVJA 2O2OA 4RTZA 4J9CA 4K5BA 4C48B 2LX7A 4BETA 3M0UA 2KR3A 1B3QA 2KGTA 3AAAC 3TWTA 2RQVA 3I5RA 3TWRA 2PNIA 1BB9A 1WX6A 2FPDA 3M0QA 2SEMA 1E6GA 3LH5A 1WDYA 1YP5A 1UJYA 4LG6A 5IH2A 2LJ0A 4J9GA 2ZGGA 3REAB 2JXBA 2FEIA 2XENA 2EBPA 4R0KA 2JW4A 3KEAA 3UF4A 2KEAA 2B0OE 4OMQA 1PHTA 1WA7A 4AFUC 1K0XA 1MV0B 2DBKA 3RBBB 2RNAA 4EIKA 5IXBA 2YUPA 1RLQC 2B86A 3I5SA 5FINA 4BERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RQT A;  2KXP C;  1BBZ A;  1JQQ A;  4AFQ C;  3O5Z A;  3RNJ A;  1T0J A;  2J6O A;  4Z68 A;  4J9E A;  2E5K A;  3I9Q A;  4CC7 A;  4OAV B;  1A5E A;  3ZU7 B;  3NOG D;  5BXO A;  1CSK A;  2K3B A;  1ZUK A;  2DRK A;  2JMC A;  2RQW A;  3M0R A;  5CBO A;  4DX5 D;  3UAT A;  1PRL C;  2OJ2 A;  3VS3 A;  4J9I A;  1ZBJ A;  1BI7 B;  1K1B A;  4KRT A;  1AZE A;  4U8V D;  2LQN A;  4F16 A;  4BSZ B;  1KFZ A;  1BI8 B;  5JA4 D;  5D66 A;  4HVW A;  1GRI A;  2EKH A;  2KYM A;  2W0Z A;  4OMO A;  2DZN A;  1SHF A;  2I0N A;  2M0Y A;  2YUQ A;  4RTX A;  5KBA A;  4HB5 A;  2JM8 A;  2D8H A;  4HCK A;  1KIK A;  4LN2 A;  2C0T A;  3REB B;  4E6R A;  1HJD A;  3EU9 A;  2O9V A;  1JEG A;  4JJB A;  3SEM A;  2X3X D;  3ZL7 C;  1M3C A;  2LJ3 A;  2F8Y A;  4K5A B;  4DUI A;  1N0Q A;  4LSZ E;  1Z9Z A;  5ENS D;  1BU9 A;  2F2X A;  1T3S A;  1VYU A;  3VS7 A;  1IKN D;  5CER B;  4G8L A;  1FMK A;  1NEG A;  3UI2 A;  2DZO A;  1ZUU A;  4HRL A;  2L3P A;  4F6R D;  4AG1 C;  1AEY A;  3QWX X;  1ABQ A;  2F8X K;  2H8H A;  2KXD A;  2L6B A;  3UXG A;  4HNA D;  2DL4 A;  2J6K A;  3EHR A;  5AAO A;  2K2M A;  1S1N A;  1UTI A;  2L0A A;  3C5R A;  1UHF A;  3TVT A;  2YDL A;  1YWO A;  4QFV A;  1NLO C;  3EG3 A;  5FW9 A;  3A98 A;  2BKK B;  1MV3 A;  3UA6 A;  4ZHB A;  2P2C P;  4F1P A;  5AQB A;  1N0R A;  2DWZ A;  1M30 A;  4QQI A;  2MOX A;  3PE0 A;  4RTV A;  1Y57 A;  3B7B A;  3I35 A;  1BK2 A;  4GLM A;  1HD3 A;  1AWJ A;  3C0C A;  1M8M A;  2JMA A;  1X27 A;  2GNC A;  2JTE A;  2DL8 A;  2MIO A;  3DEP A;  1MYO A;  5CBN A;  2K7A A;  2CSI A;  4HVV A;  3LJN A;  5EIB E;  2GBQ A;  3PVQ A;  3VS4 A;  4HI9 A;  5AQ7 A;  1SPK A;  2FO1 E;  2ED1 A;  1B07 A;  1WFW A;  1QKW A;  1I1J A;  1SEM A;  1YYH A;  2DL3 A;  4GPM A;  4DEX A;  2EGA A;  4CC2 A;  4TUM A;  4F14 A;  4ZFH A;  1UHC A;  2RMO A;  2DMO A;  1IO6 A;  2ED0 A;  4HRN A;  1SHG A;  2KRM A;  1MUZ A;  3NGP A;  3V2O A;  1XOV A;  1Z9Q A;  2FPE A;  1AWW A;  2AKL A;  2CDT A;  1DC2 A;  2EYX A;  2K79 A;  3EG0 A;  3JV3 A;  2DJQ A;  2XEE A;  2MCN A;  2EW3 A;  3ZNG A;  4ATZ D;  1AOJ A;  2Y1L E;  4HRM B;  3JXI A;  2RQU A;  1N11 A;  5AN8 A;  2JT4 A;  2KE9 A;  2NUZ A;  2L2P A;  2P4R A;  2JS2 A;  2DM1 A;  1JXM A;  2D0N A;  5ENT D;  2MYO A;  4HI8 A;  1N5Z A;  3VS6 A;  1QKX A;  1WLP B;  3IQL A;  4JZ3 A;  5AQA A;  4HBD A;  1UGV A;  4A63 B;  1W6X A;  1IHB A;  1WXT A;  1W70 A;  4U95 D;  2YUN A;  1NM7 A;  4OMP A;  2O88 A;  3FJ5 A;  2KBX A;  1TR4 A;  1X69 A;  3SHW A;  1GCP A;  4JJD A;  5FWB A;  4NIK A;  2L3Q A;  3TWQ A;  1MX4 A;  3W9F A;  5HRY A;  2XZD G;  3J5P A;  3W9G A;  1NYF A;  2ETB A;  2A5E A;  1FYN A;  1Y0M A;  4IIO A;  3F6Q A;  2FO0 A;  2ENM A;  4X1V A;  2J7I A;  2DVW A;  4RTY A;  4J8Y A;  1YNZ A;  5GJV B;  2DL7 A;  1E7O A;  3NBN B;  1JXO A;  1BD8 A;  1M3B A;  1ZUY A;  3V79 K;  2RPN A;  2NWM A;  5KNH D;  2VWF A;  3U23 A;  2J6F A;  5HS0 A;  1I07 A;  3JUE A;  4AFS C;  2JM9 A;  2W10 A;  1M27 C;  1NEB A;  5ITZ F;  4LUD A;  1K1A A;  2VVK A;  1RUW A;  2C0I A;  2YUO A;  4BEP A;  1K4U S;  1WXU A;  3M0T A;  4J9D A;  1YWP A;  3M0S A;  3D9H A;  3ZKJ A;  4N5Q A;  2DL5 A;  2J8S D;  1T3L A;  2DIL A;  5ENR D;  4G8K A;  1ZLM A;  4OAU C;  1VYV A;  1MJ0 A;  3NHN A;  1AVZ C;  2DE0 X;  5EIL A;  3VS1 A;  2CUB A;  2ROT A;  2RF0 A;  1OOT A;  4Z8A A;  4Z89 A;  2LQW A;  3TWW A;  1ZX6 A;  4M4Z A;  4K5C A;  2EYW A;  3EHQ A;  3PVL A;  3B95 A;  4LNU D;  5GJW B;  4B93 B;  4OMM A;  1X2Q A;  4HQD A;  3R6N A;  4GMR A;  3ULR B;  4BES A;  4DRX E;  3KFV A;  1K76 A;  2HEQ A;  2HDA A;  1TG0 A;  3HRA A;  3IXE A;  5FIO A;  3J5Q B;  2DNU A;  4JZ4 A;  1JU5 C;  5ENO D;  2JS0 A;  1BU1 A;  3TSZ A;  1I0C A;  1PKT A;  5ENP D;  5EC7 A;  3V2X A;  1UOH A;  2XZT G;  1VA7 A;  4J9F A;  5AQ9 A;  4CC4 B;  4DX2 A;  1X6B A;  5FWC A;  3JXJ A;  4JPB W;  1NLP C;  2ECZ A;  2CSQ A;  2DYB A;  2CRE A;  2ZGD A;  3CQT A;  4RLY A;  4ORZ A;  4HLL A;  2FRW A;  2EQI A;  5EID A;  2HCK A;  2K6D A;  2IIM A;  2KRS A;  4CZ2 D;  1PRM C;  3GBQ A;  4ESR A;  4J9H A;  4Z88 A;  3T8K A;  2M51 A;  3Q9U C;  1LCK A;  1ZSG A;  2RFA A;  1WG0 A;  2EYY A;  3V30 A;  5BXU A;  1OPL A;  1BLX B;  1DCQ A;  4J9B A;  3UA7 A;  2OAW A;  1JO8 A;  3NPF A;  4LNP A;  5ECA A;  1M3A A;  2DF6 A;  2PZ1 A;  2DA9 A;  2EGE A;  3ZUV B;  1RLP C;  2LMJ A;  2X3W D;  4AFZ C;  5IXF A;  1H92 A;  1QYM A;  3H41 A;  5AAR A;  1QLY A;  1S70 B;  1G83 A;  2ETA A;  4JB8 P;  5KWD A;  2GGR A;  2O31 A;  5CEA A;  4O1P A;  1WIE A;  2HBW A;  2CT3 A;  3V31 A;  1YN8 A;  3AJI A;  1CKA A;  1WDX A;  2J05 A;  1EFN A;  3M0P A;  1MX6 A;  1TUC A;  2AKK A;  2V5Q C;  2V1Q A;  1MX2 A;  1PWT A;  1SSH A;  1KJW A;  2LJ1 A;  2ESW A;  1PKS A;  4ZNX A;  4DEY A;  1OEB A;  3TWU A;  1OPK A;  2BZX A;  3VS2 A;  1KSW A;  2XMF A;  1X6G A;  2F2W A;  3H0H A;  2DX1 A;  2O9S A;  3TWS A;  1UE9 A;  2HSP A;  2A36 A;  2ABL A;  3NMZ C;  1OV3 A;  4OML A;  1NYG A;  1U06 A;  1YMP A;  1WYX A;  1K9A A;  2V4H C;  3QWY A;  4AG2 C;  1X2K A;  2YSQ A;  1IXV A;  1HSQ A;  2PTK A;  4RTW A;  2F2V A;  4O60 A;  1X43 A;  2CUD A;  5HCK A;  2SRC A;  4DX6 D;  3VS5 A;  1T0H A;  2LP5 A;  1GL5 A;  2VGE A;  3NOC D;  1CKB A;  1GBQ A;  2CH4 W;  4IIM A;  2FG0 A;  2FPF A;  1E6H A;  4O1O A;  2DBM A;  1AWO A;  2Y0B G;  4K11 A;  1A0N B;  1WI7 A;  3DEO A;  1V1C A;  1RI9 A;  2RQR A;  2F37 A;  1PNJ A;  1TUD A;  5HKP A;  4JJC A;  1K1Z A;  2ETC A;  2PNN A;  2GTO A;  1YCS B;  2V1R A;  2LNH B;  4U96 D;  5CEC B;  1AZG B;  1UJ0 A;  2D1X A;  1QWF A;  2KNB B;  1QCF A;  1H8K A;  2AZS A;  2EVR A;  3EG2 A;  2DLP A;  5I22 A;  2KXC A;  1UEC A;  2D8J A;  2QDL A;  4U8Y D;  4HVU A;  2VKN A;  4CC3 A;  5L23 A;  2J06 A;  2RFM A;  2LCS A;  4FSS A;  1UDL A;  1K3Z D;  4DX7 D;  2EGC A;  4CYM D;  3HG0 D;  4F17 A;  2KBT A;  2RN8 A;  2QC9 A;  4HXJ A;  2K9G A;  5EN5 D;  1U3O A;  2A37 A;  2BZ8 A;  3TWV A;  1NG2 A;  4J7W A;  1SRM A;  2GTJ A;  5IHI A;  3THK A;  2G6F X;  1UG1 A;  4DX1 A;  3VRY A;  2CH4 A;  2CT4 A;  2BKG A;  2C0O A;  1AP7 A;  1AWC B;  2XEH A;  1GCQ A;  1W1F A;  2DRM A;  4OMN A;  1SW6 A;  4YDY A;  4LE9 A;  2KRO A;  5JMN D;  1UUE A;  2BTT A;  3H0F A;  5IHK A;  1GBR A;  1U5S A;  3UTM A;  1OY3 D;  5EYL A;  1SVX A;  3TWX A;  2QYJ A;  1OT8 A;  4WCI A;  3SO8 A;  2KT1 A;  1NFI E;  2A08 A;  2LZ6 B;  4RTT A;  3TSW A;  4YDW A;  2BZY A;  4LUE A;  5KNG A;  2AJA A;  1SRL A;  3Q9N C;  1K0S A;  2HE0 A;  2YT6 A;  2NYJ A;  1VYT A;  3VRZ A;  1QWE A;  1J3T A;  1GFD A;  2A28 A;  2ROL A;  1ABO A;  4RUG A;  2OI3 A;  2JAB A;  4GBQ A;  2AZV A;  2KT8 A;  5ENQ D;  1G3N B;  4Y92 A;  2EYZ A;  1GCQ C;  5EYP F;  5I11 A;  4QT7 A;  2KRN A;  5IHN A;  1AWX A;  4D8D A;  5CED B;  1GFC A;  1ARK A;  1AD5 A;  2GQI A;  4RTU A;  1UFF A;  1D9S A;  1G2B A;  2AK5 A;  3EG1 A;  2KYB A;  2L3S A;  2FRY A;  3T9K A;  3EGU A;  2EPD A;  1H3H A;  3H0I A;  4UUC A;  4D8K A;  3VS0 A;  1WXB A;  2DVJ A;  2O2O A;  4RTZ A;  4J9C A;  4K5B A;  4C48 B;  2LX7 A;  4BET A;  3M0U A;  2KR3 A;  1B3Q A;  2KGT A;  3AAA C;  3TWT A;  2RQV A;  3I5R A;  3TWR A;  2PNI A;  1BB9 A;  1WX6 A;  2FPD A;  3M0Q A;  2SEM A;  1E6G A;  3LH5 A;  1WDY A;  1YP5 A;  1UJY A;  4LG6 A;  5IH2 A;  2LJ0 A;  4J9G A;  2ZGG A;  3REA B;  2JXB A;  2FEI A;  2XEN A;  2EBP A;  4R0K A;  2JW4 A;  3KEA A;  3UF4 A;  2KEA A;  2B0O E;  4OMQ A;  1PHT A;  1WA7 A;  4AFU C;  1K0X A;  1MV0 B;  2DBK A;  3RBB B;  2RNA A;  4EIK A;  5IXB A;  2YUP A;  1RLQ C;  2B86 A;  3I5S A;  5FIN A;  4BER A; 
#chains in the Genus database with same CATH topology
 5FU7 C;  2HKQ B;  2WM9 A;  3QDR B;  4AFQ C;  1T0J A;  1QVF P;  4Z68 A;  2WXP A;  1QW1 A;  3RU0 A;  3K9I A;  1UW4 B;  3DSS A;  5FQ4 A;  2OEV A;  2HO1 A;  4M75 B;  2VXE A;  4EMG A;  3CCS Q;  1NJI U;  2BUD A;  3FTZ A;  2DRK A;  3UAT A;  2VGY A;  1P92 A;  1IHW A;  5KJK A;  1TS9 A;  3FTU A;  1K73 U;  5M9O A;  3LWI A;  4J8D A;  2R17 C;  2Y69 E;  1K1B A;  2LVM A;  3RSE G;  4KRT A;  5KYX B;  4U8V D;  4BSZ B;  1BI8 B;  3QO3 A;  5JA4 D;  5D66 A;  4HVW A;  5BW8 C;  2W0Z A;  2EKO A;  5KYU B;  2R5S A;  4CEM A;  2DTH A;  4B6M A;  1QVF A;  4HB5 A;  3EG9 B;  5T8I A;  5CKE A;  1HJD A;  3REB B;  1PC2 A;  2FZC B;  2HR2 A;  4M78 C;  2KAT A;  3FU0 A;  2QZA A;  2R05 A;  4A4E A;  1H6O A;  4FU6 A;  1GW6 A;  5GAM e;  4LD9 K;  3PH0 C;  4J8E A;  4JEU A;  1BCM A;  1T3S A;  2GQV A;  2JN0 A;  1EZZ B;  1IKN D;  1FMK A;  5GMK l;  4GTQ A;  1VOM A;  1OWL A;  4QVD A;  1D1A A;  2L3P A;  4FT4 A;  3FUK A;  3CCV A;  3ULQ A;  1YHQ T;  2KXD A;  3D9N A;  3UXG A;  2V26 A;  4XU2 A;  3CCV T;  4ABN A;  3Q15 A;  5JHA A;  3CCJ Q;  2HSE B;  2KI7 A;  3ZPJ A;  5LJ3 f;  3KEZ A;  4NAC A;  3CVL A;  3SHF A;  2I2L A;  2ZPI B;  2QGG A;  2H3E B;  1VIF A;  1SZ9 A;  2IFU A;  3X25 B;  4GU5 A;  5GAM j;  1UHF A;  4ANV A;  4FIB A;  1VQP Q;  1N4S A;  1NLO C;  3EG3 A;  5FW9 A;  3FUN A;  2MHK A;  2BKK B;  3UA6 A;  2XCC A;  1TN6 A;  3QWV A;  4KMO A;  2GGF A;  1Y96 A;  3HHM A;  5LCW C;  3CCS T;  3B7B A;  2JZ2 A;  2CHX A;  2K5I A;  1BK2 A;  4GLM A;  4BE0 A;  1HD3 A;  4MDW A;  2F1L A;  1M8M A;  2K7A A;  2E0I A;  4TUU A;  1QZ2 A;  4DPR A;  4EZK A;  2FO1 E;  1NA3 A;  3MO8 A;  1VQN A;  1H6K A;  5CKB A;  1QKW A;  3ASG A;  1QP3 A;  1YYH A;  2DL3 A;  4DEX A;  2EGA A;  3O4Z A;  2R5M A;  4F53 A;  1VQ6 Q;  3OBY A;  2ZIR A;  3B7U X;  4TXR A;  1UHC A;  3SY2 A;  2VGM A;  2LSU A;  1VQN T;  2KRM A;  4PJO C;  2FVU A;  2AIR B;  3V2O A;  2PM6 A;  1XOV A;  2PUO B;  4C92 A;  2K2V A;  2CDT A;  1IHG A;  2K79 A;  4CDR A;  3RDV A;  3ZNG A;  1AOJ A;  2Y1L E;  4HRM B;  3JXI A;  2RQU A;  3HFO A;  3UPU A;  5KH6 A;  1KD1 C;  2C0L A;  3SD4 A;  4GYY A;  1N54 A;  2NUZ A;  2OV8 A;  3HL8 A;  4BDY A;  4LCT A;  5ENT D;  1N5Z A;  1M2V A;  3EFR A;  4IUR A;  1WLP B;  3OS2 A;  5D6X A;  2XS1 A;  1W6X A;  5J90 A;  3D9I A;  3S3O A;  4J6I A;  4LDV A;  4AP2 A;  3EFO B;  1VQP T;  4A55 A;  3OYE A;  2IO3 C;  5DM7 R;  2M63 A;  4B0Z A;  1VQM Q;  9ATC B;  4KBQ A;  2HL5 C;  2IQC A;  1OU8 A;  2M16 A;  1O1R A;  5FWB A;  1R0B G;  4NIK A;  1JCS A;  1LD8 A;  4N3B A;  3SNX A;  4G2V A;  4C0M A;  4X9D A;  1OXJ A;  3TWQ A;  1Q7Y R;  3W9F A;  1NYF A;  4BWR A;  4OB2 B;  5KJM A;  2DXU A;  2VAS A;  2IEJ A;  3QAQ A;  3VU3 C;  3LY9 A;  2DVW A;  1ZU2 A;  4P29 A;  2DAQ A;  4MZT A;  3CCQ Q;  3MP6 A;  4HT8 A;  3NBN B;  2JUF A;  1JXO A;  2RI2 A;  3S2A A;  2YXY A;  1JCQ A;  5FQ6 A;  4M77 A;  1NE8 A;  5IN1 A;  5CRU A;  3FUE A;  3U23 A;  5A0D A;  3DLM A;  5KJL A;  3UT1 A;  1VQ6 T;  2QA4 A;  4AFS C;  4D6W A;  2X6F A;  5EKQ D;  4MDX A;  2FL7 A;  3ZXS A;  1C6V X;  1TUG B;  4E7Z A;  1WXU A;  3M0T A;  3OYA A;  3CCM Q;  4A4H A;  3LY7 A;  3Q7F A;  5GAN 8;  3I56 Q;  3D9H A;  4N5Q A;  3S3M A;  2GRO B;  1C1A A;  4G8K A;  1OCZ E;  3O8V A;  2DYR E;  3ZFW A;  1U1S A;  1MJ0 A;  3NHN A;  3LGF A;  4EBA G;  1X75 C;  3A8G B;  2DYI A;  2RJF A;  3EFS A;  4C8Q C;  1OUL A;  3V7S A;  4JL0 A;  2GRQ B;  2ION A;  4M4Z A;  4XU0 A;  4N4G A;  2EYW A;  3PVL A;  1WQ7 A;  3RKV A;  4LNU D;  1JRI A;  3JCM e;  1X2Q A;  2QAZ A;  1WHM A;  4DRX E;  5AYW D;  3KFV A;  1KPS B;  4Q5W A;  1BI1 A;  1WHJ A;  1IGQ A;  2DNU A;  1E8W A;  3HFN A;  1BU1 A;  1I0C A;  1LD7 A;  1PKT A;  3LKU A;  5EC7 A;  4KYO B;  3JCM X;  3BDU A;  3SFY A;  1X5B A;  4QQ6 A;  4ZGD B;  3G2W A;  2GFU A;  3CCQ T;  1Y7X A;  1NZ9 A;  3JXJ A;  5HI7 A;  1JBM A;  4JPB W;  2LCL A;  4ZTJ A;  4EQF A;  1N95 A;  3DKM A;  1NJI R;  4AT1 B;  1OZ3 A;  2I1K A;  2CRE A;  2ZAE A;  1JPL A;  3E33 A;  3EGX A;  4RVB A;  3CQT A;  4HLL A;  4FYV B;  2E3I A;  3ASD A;  2NC9 A;  5EID A;  4PL6 A;  3GBQ A;  2J4D A;  3ULE G;  3Q9U C;  2KSS A;  1PAQ A;  5T3R A;  1LCK A;  1ZSG A;  1OCO E;  4M7A C;  3OYY A;  3S3N A;  4M78 G;  1WHK A;  3ONK A;  3VYH B;  2CP2 A;  3J7A F;  3UA7 A;  2RHU A;  2P9U G;  4J9B A;  2H6H A;  3NPF A;  4LNP A;  5ECA A;  4GZC A;  4FW2 A;  3ZUV B;  2X3W D;  2HQX A;  2WQ7 A;  2FHD A;  2RHY A;  2ZPF B;  2GGR A;  4C5I A;  3RRU A;  2RI3 A;  5CEA A;  3GZ2 A;  5D7U A;  4J7F A;  2CT3 A;  2DXB A;  5JJ7 A;  3TEE A;  1PG5 B;  1N4R A;  3JSC A;  1MX6 A;  4YVQ C;  1YJ9 Q;  2AKK A;  3OXG A;  4CI0 C;  3CC7 Q;  2HQH A;  4B94 A;  2V1Q A;  4JXT A;  3EAE A;  1SSH A;  4JLI A;  2I6H A;  1PKS A;  3CD6 Q;  5GAM h;  2DKG A;  3OYJ A;  3TWU A;  4G1T A;  1OPK A;  5L8R E;  3VS2 A;  1KSW A;  2XMF A;  2XHC A;  3JCM W;  5KE3 A;  1X6G A;  3CXC S;  4R55 A;  1ZBP A;  3B7T A;  2DX1 A;  4KVM A;  1VQO A;  3DST A;  3PNT B;  1WYX A;  3M5A A;  1U2V G;  4MRU A;  1Q7Y C;  5A23 A;  4WNG A;  1IXV A;  3HVE A;  4N3C A;  1WAO 1;  4BT9 A;  5CQX A;  4KT6 B;  4DX6 D;  2SRC A;  1VQK A;  4LDX A;  4AXH A;  2PVG B;  4O1O A;  3PNL B;  3UIP C;  1AWO A;  2WSE E;  5A2Q E;  3BQO A;  5D2M C;  4ATG A;  4E6H A;  2F37 A;  1TUD A;  1OWO A;  3APD A;  4XE0 A;  2M0O A;  4PJO G;  3EJN A;  1YCS B;  4PK4 A;  4LDY A;  3UM2 A;  3CCE A;  2LNH B;  3PUK A;  2E64 A;  4M7D B;  4U96 D;  5CEC B;  4IUU A;  3M59 A;  4PFZ A;  1S72 Q;  3EG2 A;  3RKW A;  4ELZ C;  2J4B A;  4F7U B;  3SWN A;  3UT4 A;  2PQW A;  4GY5 A;  4M78 F;  1YI2 A;  2QDL A;  4U8Y D;  2XDB A;  3D9P A;  3EIQ C;  4GLK A;  4EMK B;  2RFM A;  1YIT A;  5DBK A;  3L6A A;  5IT9 E;  3MEW A;  4DX7 D;  4QKU A;  4HOU A;  4CYM D;  3HG0 D;  4AY5 A;  2XRZ A;  3CCR T;  2QC9 A;  4HXJ A;  3ML9 A;  5CCM A;  2WAC A;  5CKF A;  4XEI G;  2AHJ B;  2ZXW E;  3HXE A;  2KAF A;  2BZ8 A;  2R2L A;  3NTH A;  5GAN 5;  3NAW A;  3EGD B;  3TU4 K;  2CP6 A;  2QQS A;  3DRA A;  5HKC A;  1KLX A;  1GCQ A;  1XQH A;  4BY6 B;  3QZ5 B;  1EIF A;  1UUE A;  4BI8 B;  5A0G A;  3H0F A;  5IHK A;  1GBR A;  1N8R U;  3UTM A;  3UKU G;  3TWX A;  1OY3 D;  1Q95 G;  1Y07 A;  4WCI A;  1U1T A;  2KT1 A;  4L9P A;  2A08 A;  4DI3 A;  5CKH A;  4XTY A;  3TSW A;  2DTI A;  5KYW A;  5CR2 A;  3FUI A;  3CVN A;  3LVR E;  4GML A;  2E10 A;  3FU3 A;  3WG7 E;  3S7F A;  2XU8 A;  1WQW A;  3X28 B;  1KD1 U;  1K0S A;  2HE0 A;  3AS4 A;  1S0P A;  3HIZ A;  4I6E A;  1NJI C;  3ASK A;  2OEW A;  1VYT A;  3VRZ A;  2XGO A;  1Y6I A;  4PH4 B;  3FC3 A;  1QVG S;  4UWK A;  3CHM A;  3ZN3 A;  4CRW A;  1ABO A;  1WHL A;  5GAM d;  2O4X A;  2UWJ G;  4GBQ A;  3R7R A;  2AZV A;  4KBM B;  2KT8 A;  1KHC A;  5AT1 B;  4Y92 A;  7AT1 B;  3V8L A;  5EYP F;  5A7D B;  5I11 A;  1V55 E;  1ZA1 B;  4DJA A;  4U63 A;  4C0D C;  5IHN A;  2OVB A;  5G2N A;  1AWX A;  4U7E B;  4D8D A;  3EDT B;  3CKB A;  1GFC A;  1ARK A;  3TJP A;  3E9F A;  2GQI A;  4RTU A;  4H7X A;  5H7P A;  5LJ5 f;  3Q47 B;  3CMA A;  1EF1 C;  1UFF A;  3NZS A;  4BFR A;  3G71 Q;  1G2B A;  4GYW A;  3ENE A;  3CC4 Q;  2XPY A;  2EQU A;  3QDN A;  4G24 A;  4C8Q G;  4TXP A;  2HMA A;  1NA0 A;  2B6C A;  3H0I A;  2H6F A;  1BPO A;  4LDW A;  4D8K A;  2KC7 A;  1I4K 1;  1WXB A;  4J9C A;  2PVD B;  4K5B A;  2XGS A;  4M3O A;  2RD1 A;  4WAF A;  5GAN e;  2GRL A;  2BF0 X;  2ZPB B;  3HP9 A;  3E30 A;  3KS2 A;  3RER A;  3I5R A;  2ILR A;  3OYL A;  4CGV A;  4JRI A;  2PQR A;  2GRP B;  2PNI A;  1WX6 A;  2FPD A;  1KQS S;  1Y8M A;  2X6I A;  1O1S A;  4HS2 A;  3ASO E;  1WDY A;  1YFN A;  1YP5 A;  2D0Q B;  5GAO q;  5HY6 A;  2RB6 A;  3JCM h;  4FP7 A;  2ZGG A;  1IYG A;  4ANX A;  3NQP A;  2COW A;  3HTR A;  2FEI A;  2EBP A;  4QQD A;  4UI9 J;  3I55 Q;  3RO3 A;  5GAN j;  4AOF A;  4HOQ A;  4M75 F;  3CCL A;  3BG1 B;  4M7A G;  3MEV A;  3A8H B;  2DFU A;  4OMQ A;  4ANU A;  3CCL T;  4EDU A;  4EIK A;  3CC2 Q;  5FU7 B;  4RG9 A;  3N5B B;  2RK2 A;  1U5S A;  3PZD A;  1VQ5 A;  2RQT A;  4Q96 A;  1JQQ A;  2DZ9 A;  4KH0 B;  4KUI A;  3G71 T;  4CC7 A;  3BUA A;  3PNW C;  3U9W A;  4M7D C;  1VQ5 T;  2QXF A;  4ILG A;  4N3A A;  3ZU7 B;  2K3B A;  3M57 A;  1M2V B;  1RAF B;  1PRL C;  4HKE A;  1VQ4 A;  4EMK C;  4J8O A;  1KHI A;  3GPL A;  1ZSZ B;  1AZE A;  3UIO C;  3U66 A;  2LQN A;  2XEV A;  4DOV A;  1Q86 R;  4ME2 A;  1HS6 A;  4EPZ A;  5LJ3 e;  3CCU Q;  2ZU6 B;  1GRI A;  2KYM A;  3T9N A;  2DZN A;  3I4G A;  1I8F A;  2I0N A;  3E19 A;  3E2U A;  2VTB A;  4JJN K;  2YUQ A;  4RTX A;  1YJN Q;  5KBA A;  1NL4 A;  4HCK A;  2D8H A;  2MWO A;  3RKY A;  4LN2 A;  1XNI A;  3QXE B;  4E6R A;  4DBQ A;  2O9V A;  1TNZ A;  4JJB A;  3SEM A;  2LXM A;  3ZL7 C;  1M3C A;  2F8Y A;  2BKD N;  4DUI A;  2DVE A;  4RKU E;  4A4K A;  2IU1 A;  1OU9 A;  4M77 B;  4NRH B;  2NYS A;  3LXU X;  4G8L A;  1NEG A;  3UI2 A;  5FU6 C;  4HRL A;  3ESL A;  5LJ3 j;  3UMV A;  1JB0 E;  4F04 B;  1ABQ A;  1QMC A;  2H8H A;  2LAH A;  3FUD A;  2KK4 A;  3FLG A;  2E6N A;  3EHR A;  4X9C A;  3HRS A;  4GA1 A;  3NFC A;  2L0A A;  1VQ8 Q;  1YWO A;  2IOL A;  3BFM A;  3A98 A;  1Q7Y U;  5C2Y A;  4ZHB A;  2P2C P;  2VGX B;  4LDU A;  5AQB A;  3UQ3 A;  2LUH A;  3FH7 A;  4QQI A;  2MOX A;  1D1B A;  4RTV A;  2NUT A;  2K3Y A;  3ZW3 A;  3JCM d;  2Y4Y A;  3BE3 A;  2F0Y A;  2CP5 A;  5AJD A;  4XKB A;  3SZ7 A;  3C0C A;  3JAM E;  3U64 A;  4Q69 A;  1V29 B;  1X27 A;  2MIO A;  3DEP A;  3H9N A;  1G3T A;  3MYV A;  5EIB E;  2Z0W A;  3OYK A;  1H6P A;  3JB9 G;  3M53 A;  2RO0 A;  3L17 A;  4YTL A;  3A8L B;  5BNW A;  3FEX A;  2ED1 A;  1B07 A;  3RUX A;  1I1J A;  1SEM A;  4HXI A;  4GPM A;  5ENN A;  1LJO A;  3G2T A;  2OTJ Q;  2AVP A;  4A4F A;  1N4Q A;  3L2U A;  4ZFH A;  2P4T A;  4PJO B;  2DMO A;  2LT4 A;  2VYT A;  5E75 A;  3TQ7 P;  4Y6W A;  3JYS A;  4HRN A;  2VXF A;  1MUZ A;  3TXN A;  3ABK E;  3D9M A;  2GRM A;  1Z9Q A;  4BB7 A;  2Y4U A;  4FLB A;  2EYX A;  1VQL Q;  1N8R R;  3EGX B;  2JEK A;  2DD5 A;  2OX7 A;  3JCM Q;  1MQS A;  2FF4 A;  4J6W A;  4XU1 A;  2MF2 A;  3HHT B;  2HM8 A;  2KE9 A;  2P4R A;  3VKI A;  4NL3 A;  4U0Z A;  4XU3 A;  4JZ3 A;  5AQA A;  3E37 A;  4NL2 A;  3DB3 A;  1IHB A;  3LDZ A;  3CVP A;  5G55 A;  4A1G A;  4U95 D;  4U8H A;  4RG6 A;  4I2Z A;  4OMP A;  4PJM A;  4BE1 A;  2RA2 A;  4ZGJ B;  1BKB A;  1OX8 A;  1GCP A;  2L0I A;  2QY7 A;  2QAS A;  4C92 C;  4XZ4 A;  5J3B A;  2J07 A;  5LCW J;  1FCH A;  3A1P A;  2OTL Q;  4GTP A;  2LAI A;  4OVU A;  4MBG A;  2XZD G;  2D6F A;  5LX8 A;  3VLD A;  3FRN A;  3G6E A;  2YHC A;  4MLP A;  3UT8 A;  3L08 A;  5CKD A;  4X1V A;  3F6Q A;  1SKU B;  3FTW A;  1IGU A;  1UGR B;  3QYG B;  1WZO A;  2KCK A;  3CME A;  4RTY A;  4Y91 A;  3G6E T;  2EQJ A;  2DL7 A;  3QB2 A;  4U04 A;  1E7O A;  5GAN 6;  3L2W A;  4AY6 A;  4RG8 A;  1JCR A;  3ZBD A;  2H3J A;  3FU5 A;  1E8Z A;  4FAD A;  1Q86 C;  3CME T;  5KNH D;  5C1D A;  2EIF A;  3Q7A A;  1FT2 A;  4APF A;  1TOV A;  2KZT B;  5HS0 A;  1ZSZ C;  3VJP A;  4E7K A;  4E7L A;  4ME7 A;  3FUH A;  5GAN 3;  1M27 C;  1Q81 R;  4LUD A;  5FRO A;  1E7V A;  4BEP A;  4JHR A;  1YWP A;  2QTV A;  4J9D A;  1I5L A;  2WSF E;  2LC4 A;  1VQL T;  4YDE A;  3ZKJ A;  5GAN h;  2J8S D;  4GPK A;  3L82 A;  2DIL A;  2HNI A;  2BTD A;  1ZLM A;  1VYV A;  2LQ8 A;  5FTP A;  1AVZ C;  1TNU A;  1YHQ A;  2WQH A;  5EIL A;  3T8M A;  4BTA A;  3EH1 A;  4DK5 A;  4C8Q B;  5IAY A;  4M77 C;  4Y28 E;  2R03 A;  2RF0 A;  2AT1 B;  4M75 E;  2QI2 A;  1ZX6 A;  2V8I A;  3QG1 A;  3SFZ A;  4GTR A;  1TTH B;  2C2L A;  4FYW B;  5EDS A;  2C06 A;  2GCX A;  3EHQ A;  4U0S A;  3QC1 A;  4B93 B;  3G4S Q;  4B8C B;  3S7D A;  4BES A;  1Z3Y A;  2P9N G;  4M7D G;  1XNF A;  2HEQ A;  2KCV A;  1RAG B;  2OTL T;  5FIO A;  2VB6 A;  2XPZ A;  2FEZ A;  4L5G A;  3CCS A;  3Q75 A;  4F7U G;  5ENO D;  3OA6 A;  3UIN C;  1TSF A;  1M5Q 1;  3V2X A;  2XZT G;  1VA7 A;  3S6W A;  3JQ1 A;  2XQ0 A;  4GTT A;  3UPV A;  5FWC A;  2EJ9 A;  5KYY A;  1ZBX A;  4L7T A;  1NLP C;  4IUP A;  4XQ3 A;  4OB3 B;  1PD0 A;  1FT1 A;  3FWV A;  3MET A;  1MGQ A;  4ORZ A;  2GF7 A;  5EX0 A;  1OX9 A;  2FRW A;  4M7A B;  4G26 A;  3AT1 B;  3CV0 A;  4Z88 A;  1Q82 U;  3DBS A;  2M51 A;  3EIJ A;  3CK8 A;  5CK9 A;  1WG0 A;  2EYY A;  3ZHE B;  3V30 A;  5BXU A;  3JCK C;  2XS8 A;  3OMC A;  1BLX B;  2OAW A;  4DBH A;  4M75 D;  3CXC P;  2X51 A;  4PS7 A;  5IXF A;  3P8H A;  1H92 A;  5HK3 A;  4J8S A;  3H41 A;  1QLY A;  1G83 A;  3RIR A;  5LJ3 h;  1N8R C;  4O1P A;  2EJG A;  4YDO A;  4IN3 B;  3V31 A;  1CKA A;  4FL6 A;  2J05 A;  3JB9 I;  4C0Z A;  5CCL A;  4A53 A;  1S63 A;  2V5Q C;  4XX5 A;  2VSO E;  3CCJ A;  3CGH A;  1H64 1;  4UWL A;  4B9X A;  1EPU A;  3JQ0 A;  2LJ1 A;  3GYZ A;  2ESW A;  4TV3 A;  4J5Y A;  4DEY A;  1PY1 A;  3CCJ T;  1VQP A;  4M7C A;  3G4S T;  3GNG A;  3CXC A;  4Z02 A;  1RAB B;  2F2W A;  3P2B A;  2E65 A;  4I6J A;  1UE9 A;  3L54 A;  2A36 A;  1LF8 A;  3HXD A;  2O01 E;  4OML A;  3C4S A;  4QVZ A;  2UY1 B;  3LJ3 A;  1K9A A;  2V4H C;  3HXF A;  2RM4 A;  2VYI A;  5GAN d;  2RK1 A;  4M7D F;  1HSQ A;  4RTW A;  2XHE A;  2F2V A;  1VDY A;  5HCK A;  4XTV A;  4KGV B;  3NB2 A;  2JJ9 A;  2I2O A;  4FU3 A;  3QII A;  1ZA2 B;  4E85 A;  4F7U F;  4GCN A;  2VGE A;  1WJS A;  2CH4 W;  1C0M A;  2FPF A;  4DI4 A;  3B13 A;  3B7S A;  3U3W A;  2XK0 A;  2XRY A;  4X8Q A;  1IZ6 A;  2DBM A;  2RHI A;  4K11 A;  2XPI A;  1VQ6 A;  1V1C A;  2RQR A;  4JJC A;  5HKP A;  5LL6 S;  3WVD B;  5ANL A;  1K1Z A;  2VGN A;  2K5L A;  4MKT A;  4MZM A;  5KE2 A;  4ZTF A;  1Q81 C;  2V1R A;  5D0O D;  3FTV A;  4C0E A;  3PUJ A;  4KZC A;  4AVX A;  2D1X A;  3Q78 A;  1YJW Q;  2GRN B;  1H8K A;  2AZS A;  4M78 A;  3DXM G;  5FJY A;  4BX9 A;  5I22 A;  3SF4 A;  3VUZ A;  1D0X A;  2CZ0 B;  4FW1 A;  3PZ3 A;  4PKC C;  4CC3 A;  2VKN A;  5L23 A;  2CZ6 B;  4FJY A;  3FEO A;  5J08 A;  1JJ2 S;  1ACM B;  4I9E A;  3CHP A;  3FIF A;  2E3H A;  1Z3X A;  2KBT A;  4F17 A;  4J8F A;  4GTS A;  4N4H A;  4XIF A;  2K9G A;  3G2U A;  1WY6 A;  2MI6 A;  3Q73 A;  1NZN A;  1DNP A;  4J7W A;  4JS5 A;  1QVG P;  5IHI A;  3EUV A;  1VQM A;  4C5G A;  4DX1 A;  2VSX E;  1X6O A;  3BDL A;  1MNE A;  2C0O A;  4C92 G;  4G25 A;  1AP7 A;  1W1F A;  4OMN A;  1U8R A;  1VQM T;  3AG2 E;  2EIJ E;  5G04 C;  2BTT A;  3SWN C;  1QP2 A;  3X2Q E;  1SVX A;  3SO8 A;  5LJ5 e;  2LZ6 B;  4UWF A;  5LJ3 d;  4RTT A;  5KCM A;  3CCQ A;  5LFA A;  3EU5 A;  4LUE A;  2AJA A;  1IQR A;  3RMS A;  2BUG A;  3FP3 A;  1BCO A;  3E32 A;  4IRU A;  3FFL A;  2YT6 A;  4C0G A;  1BI2 A;  1QVG A;  3V8K A;  3TAX A;  4N39 A;  2MMP A;  4UC4 A;  4LER A;  4GB9 A;  1J3T A;  4B9W A;  1W3B A;  3BW1 A;  1Q2Z A;  3C98 A;  5GAN 4;  3RO2 A;  1BYM A;  2JAB A;  4TVR A;  3OYB A;  5ENQ D;  1GCQ C;  2LTO A;  1MZC A;  4C0D B;  2LXL A;  3CCM A;  5LJ5 j;  2KRN A;  3RKX A;  3I56 A;  1VQ9 Q;  5CQY A;  2MOW A;  1YJW T;  3GF5 A;  3FUF A;  5CED B;  3CCM T;  1VQO Q;  2P0K A;  1M90 U;  1KQS P;  3I56 T;  4ZN1 A;  3QWP A;  1VQ7 Q;  3H8Z A;  4QW2 A;  1VIE A;  5GAM g;  2RH2 A;  2FUL A;  3OSV A;  3P8B B;  3EG1 A;  5AIJ A;  2L3S A;  4M77 G;  2GW1 A;  5HK0 A;  3EGU A;  3MCX A;  1H2V C;  5FZQ A;  3UKR G;  3FH5 A;  4UUC A;  2IOS A;  3D9L A;  3Q5M A;  1Q86 U;  4RTZ A;  4WUY A;  3JB9 J;  1G3W A;  4C48 B;  3FUM A;  2KR3 A;  3OB9 A;  4JHJ A;  3TWT A;  2RQV A;  3M58 A;  3FEY A;  2X4W A;  3IHY A;  2NUT B;  1KQS A;  1HO8 A;  3M0Q A;  4BI4 A;  3UUX A;  5GAO p;  3CCE Q;  2SEM A;  2CG2 A;  1D3B B;  2C0M A;  3QKY A;  2E4H A;  2MRI A;  3MV3 B;  3PIO A;  1X81 A;  2WXQ A;  4R7L A;  3R7Q A;  4CT0 A;  1FXX A;  1YI2 Q;  3REA B;  2JXB A;  4HOT A;  1HX8 A;  1KT0 A;  3Q1J A;  4IUQ A;  1YIT Q;  1G3S A;  4M75 A;  1JUQ A;  4UQX A;  3C3R A;  2V0P A;  1SZA A;  2RJC A;  3TGO A;  2KEA A;  3KUF A;  5CO7 A;  3SBT B;  3WXX A;  2B0O E;  4ILI A;  1M4Z A;  3VTY A;  5KYX A;  2DIQ A;  2NUP A;  3KSL A;  5FQ8 A;  1RLQ C;  2YUP A;  3I5S A;  2COY A;  5IXB A;  4RMO A;  2EIN E;  1BIB A;  2JNG A;  5GAO n;  3OXL A;  3ESK A;  1Q82 R;  1AHJ B;  2KXP C;  4I6G A;  1KQ2 A;  3ZYM A;  1VQ7 T;  4J9E A;  2J6O A;  3OYM A;  1XTD A;  5KYU A;  3UT7 A;  4UI9 K;  1AT1 B;  4OAV B;  3LS8 A;  1PSF A;  2V4L A;  3EG9 A;  3DLL A;  3U4T A;  2R58 A;  1YJ9 A;  2WXI A;  3CC7 A;  2CP7 A;  3NOG D;  5BXO A;  1CSK A;  4HT9 A;  2HKN A;  1ZUK A;  2JMC A;  3M0R A;  2WSC E;  3CCR A;  5CBO A;  4DX5 D;  2E41 A;  3CD6 A;  2OJ2 A;  1JWG A;  3FUJ A;  1YJ9 T;  4HVB A;  3CC7 T;  3PEU B;  1MMD A;  2KY9 A;  3Q4A B;  1IQU A;  3ABL E;  1IHV A;  1ZBJ A;  3D3M A;  4J9I A;  3PTA A;  4M77 F;  2PZI A;  2CFU A;  3CD6 T;  1B34 A;  4FYX B;  3EHN A;  2YRD A;  3A8O B;  1ZQ1 A;  3CHO A;  2EKH A;  4OMO A;  3Q79 A;  1SHF A;  2M0Y A;  1ELW A;  2XID A;  3ZIM A;  5HQ8 A;  3ZVV A;  3CBO A;  3EU9 A;  3NTK A;  4LUN U;  2P9P G;  2V5F A;  2LJ3 A;  3MA5 A;  1N0Q A;  4BDZ A;  3FTY A;  5FU6 B;  3WXM B;  5ENS D;  1BU9 A;  1ZHI A;  2F2X A;  1UJJ A;  5CER B;  5GMK e;  4K0R A;  2WXO A;  5CCA A;  3PZ4 A;  2DZO A;  2LSV A;  3ONL A;  3WVE B;  1E96 B;  1BIA A;  4AG1 C;  1AEY A;  3CEQ A;  3QWX X;  2L0T B;  4JS4 A;  4E47 A;  1EYH A;  3OTN A;  2F8X K;  5A0L A;  4JPS A;  2L6B A;  1KQ1 A;  2IO2 C;  3OXF A;  3CHS A;  3NZU A;  4II1 A;  2EIM E;  1OQK A;  3JRZ A;  2DL4 A;  2J6K A;  1N27 A;  1YA0 A;  1UTI A;  3OY9 A;  3LWH A;  1U3D A;  3C5R A;  3HPW A;  1LTX A;  3TG4 A;  3CKC A;  2X4J A;  2QEX Q;  3ME9 A;  4ZGE B;  4PFP A;  4A54 A;  2LCC A;  2YQ8 A;  4RQI A;  5GMK j;  1S72 T;  4W9R A;  5KCO A;  1K8A U;  4F1P A;  4EZL A;  3L2Q A;  5BV0 A;  3CEY A;  1G3Y A;  3PE0 A;  1HU3 A;  4PJO F;  3L22 A;  3I35 A;  2F5K A;  4H7Y A;  4CCA A;  3OS0 A;  2YLB A;  1HK9 A;  4GTM A;  2CSI A;  4O5V A;  4HCZ A;  2GBQ A;  1X01 A;  1SPK A;  1YIJ Q;  4JW1 A;  2WXN A;  2D9T A;  4GTV A;  3T5X A;  1H2U A;  2WPV A;  1Q81 U;  3JCM g;  4F14 A;  3D9J A;  3DPY A;  2MYS A;  2A4Z A;  1RZ4 A;  1Y96 B;  3JCM J;  2ED0 A;  3EFO A;  1SHG A;  1N9A A;  3QNK A;  2QFC A;  2DXC A;  3GZS A;  4I43 A;  1AWW A;  1IRX A;  2IG0 A;  3IBE A;  4NS5 A;  4FC8 A;  2DJQ A;  2XEE A;  4RSY A;  2EW3 A;  3QKJ A;  2MCN A;  3PEV B;  3CPF A;  5FRM A;  2HL3 A;  1Z6T A;  3INZ A;  4HFG A;  2I9C A;  5AN8 A;  5GMK m;  2ZPG B;  2EFI A;  2DXT A;  2L2P A;  3PMT A;  1VQ4 Q;  2DM1 A;  1D09 B;  5LJ5 h;  2D0N A;  4MS6 A;  3VS6 A;  4PJN A;  3IQL A;  4HBD A;  3S7J A;  4A63 B;  1UGV A;  2AXZ A;  1G8X A;  1W2B S;  1WXT A;  3CQC B;  3QUI A;  4CGW A;  1W70 A;  2O88 A;  2YUN A;  1NM7 A;  3FJ5 A;  1DCE A;  1M1G A;  4IUT A;  2QEX T;  2KBX A;  4I2W A;  4WWN A;  2ZZD A;  4C92 B;  3LH0 A;  3SHW A;  3G71 A;  1Q82 C;  1H19 A;  3CVU A;  2DIW A;  3CC4 A;  5BUZ A;  2LNV A;  2J49 A;  5CRV A;  1XJW B;  3A5Z B;  2RD0 A;  3CST A;  5HRY A;  4EZJ A;  4IYP A;  5EG2 A;  2CHW A;  2QG9 B;  5KYN A;  5I21 A;  3CC4 T;  2DZC A;  1M90 R;  2A5E A;  3MGB A;  1FYN A;  3A8M B;  1Y0M A;  2DO3 A;  2ENM A;  5FRN A;  3DSX A;  2HAX A;  3VYG A;  2J7I A;  3QSU A;  4OF1 A;  4J8Y A;  5GJV B;  3P1U A;  3R9M A;  2XKO C;  1BD8 A;  1M3B A;  1ZUY A;  3LPZ A;  3V79 K;  1YIJ T;  2Y4T A;  3UM0 A;  3OQ5 A;  3OYF A;  1H3Z A;  2VWF A;  4C8Q F;  2J6F A;  2DIG A;  2HD0 A;  2M02 A;  3JUE A;  5J26 A;  2FYK A;  5G05 C;  2JM9 A;  4AV7 A;  4DLQ A;  3VLE A;  4FHJ A;  4HA8 A;  4KGX B;  3LY8 A;  2C0I A;  3OAW A;  3E1S A;  1NPR A;  3M55 A;  4EMH A;  2J9Q A;  3KAE A;  2ZPE B;  3MJX A;  1MND A;  4A1S A;  1SG5 A;  3I55 A;  5GAN 7;  4URK A;  3V7R A;  3LVQ E;  4Q94 A;  3I55 T;  3HSB A;  2CUB A;  3P8D A;  2ROT A;  4Z8A A;  4Z89 A;  3KXT A;  2LQW A;  3HXB A;  3L2R A;  3CPW S;  3X20 B;  2Y3A A;  2K4Y A;  3CC2 A;  2RJD A;  4V3I A;  2KCL A;  4K5C A;  3X24 B;  5BT1 A;  1U3C A;  3B95 A;  4P5N A;  3M4Y A;  2AWI A;  5GJW B;  3R6N A;  3CHR A;  4HQD A;  4Y6C A;  3PGG A;  3CC2 T;  2CKK A;  1K76 A;  2KDS A;  4APO A;  4M7A F;  4FT2 A;  3EHM A;  3IXE A;  3J5Q B;  4OB0 B;  3CHQ A;  1HF8 A;  3TSZ A;  4MZP A;  5ENP D;  1OWP A;  2PM7 A;  4J9F A;  4E7J A;  3OBW A;  4DX2 A;  4L59 A;  4M78 E;  1MMA A;  2E12 A;  3FU6 A;  5DLQ E;  4C5H A;  2CFZ A;  3AG4 E;  2EQK A;  3IHV A;  2CSQ A;  2ECZ A;  2QGF B;  2RG8 A;  3D9K A;  3CCU A;  3MKQ A;  3S7B A;  1N94 A;  5LJ5 d;  4RLY A;  1DVP A;  1WJR A;  2EQI A;  2HCK A;  2K6D A;  2KRS A;  2IIM A;  4J83 A;  4XK8 E;  4CZ2 D;  4ESR A;  3SB2 A;  5DLO A;  3AG3 E;  4J9H A;  3T8K A;  3CCU T;  2RFA A;  2WXG A;  5D0Q D;  1EDU A;  1OPL A;  5CVI A;  5I2M A;  1DCQ A;  2A3L A;  1YJN T;  2P9S G;  1NI1 A;  1M3A A;  2DF6 A;  2EGE A;  1RLP C;  3MEA A;  4FSX A;  1QYM A;  5AAR A;  4C9B B;  1S70 B;  2ZIS A;  4JB8 P;  5KWD A;  1OYX A;  2O31 A;  3AHU A;  2L8D A;  3BU8 A;  1WIE A;  2A7Y A;  5GAN 2;  2VSN A;  3VLF A;  1YN8 A;  4I9C A;  1WHG A;  2XG8 D;  2YLC A;  3MEU A;  2P0Q A;  3M0P A;  4XI0 A;  1TJF A;  2K5F A;  4OVV A;  3QPH A;  3PZ2 A;  1WM5 A;  3RAU A;  4ZNX A;  1HG5 A;  3MZL B;  1VQ8 A;  4M78 D;  3ZEF A;  3QYH B;  4DQ2 A;  2DEU A;  3RJV A;  5GMK h;  5IY5 E;  3SQV A;  1TWB A;  3VV0 A;  1HXD A;  1ELR A;  2KMT A;  3H0H A;  2O9S A;  3ABM E;  3TWS A;  1VQ8 T;  4XI9 A;  2ABL A;  4OYS A;  1WNL A;  4BTB A;  2FZK B;  1PC0 A;  2VJ8 A;  3OYC A;  3E9G A;  2DEQ A;  2AXV A;  3QWY A;  2AW6 A;  4AG2 C;  4JRP A;  3MX3 A;  2YSQ A;  1M90 C;  4PJO E;  4O60 A;  3ULY A;  1X43 A;  1K8A R;  3NTI A;  2H6G A;  4YVO A;  1GL5 A;  2F5T X;  1GBQ A;  3NOC D;  4L23 A;  2P84 A;  4IIM A;  3CVW A;  2JTM A;  4EMK A;  1YHQ Q;  1JJ2 P;  1I81 A;  2FG0 A;  2QQ9 A;  1PM3 A;  3OW2 S;  3M4G A;  1UEB A;  3OSS C;  3CCV Q;  2EIL E;  2Y0B G;  1A0N B;  3BG0 B;  1WI7 A;  2OTJ A;  3DEO A;  2VUB A;  5GAN g;  3PMI A;  1Z5S C;  2ETC A;  5AEN A;  3RMQ A;  2PNN A;  1V54 E;  3CIA A;  2OTJ T;  3EGD A;  2WB2 A;  2B8A A;  3JB9 F;  2KNB B;  1QWF A;  1VQL A;  3HVE B;  3SBS A;  5FWQ A;  4AM9 A;  3PE3 A;  2DLP A;  3ISM C;  4BE2 A;  4KVO A;  1UEC A;  4BY6 A;  2PU9 B;  1MHQ A;  3QAR A;  2QQR A;  1KZO A;  2ZCF B;  3GP8 A;  2R57 A;  2X6J A;  4HVU A;  2CHZ A;  1TJC A;  1HFA A;  1A17 A;  3GZ1 A;  4FSS A;  1IB8 A;  1UDL A;  1JJ2 A;  2LO6 A;  1QBQ A;  2RN8 A;  4OGC A;  2MAM A;  2QQA A;  3E34 A;  2CYZ B;  3QWW A;  2NUP B;  2XD0 A;  1U3O A;  2QDY B;  3CK9 A;  1NG2 A;  4PJO D;  3MEK A;  4D10 C;  1UG1 A;  2CT4 A;  1SSF A;  2BKG A;  1UGQ B;  1AWC B;  2EYQ A;  2Q7F A;  2OTL A;  1SW6 A;  2E2E A;  4YDY A;  5B3S E;  3SWN B;  1VQN Q;  2KRO A;  5JMN D;  3APF A;  5EYL A;  3TG5 A;  1N9R A;  1NPP A;  2QYJ A;  3KD7 A;  5GAO r;  1NFI E;  1RAC B;  2YHE A;  3ZEH A;  4YDW A;  1IRE B;  2BZY A;  3Q49 B;  3CVV A;  1SRL A;  3Q9N C;  1QCO A;  2WXR A;  4GZ6 A;  1B34 B;  1RL2 A;  4NUR A;  3C12 A;  2X4Y A;  2HBP A;  3IKO B;  4KGZ B;  2A5U A;  2NYJ A;  3FJP A;  3GNF B;  3C3O A;  3MP8 A;  4PJJ A;  8ATC B;  1RW2 A;  5C0M A;  4GAA A;  1GFD A;  1D8E A;  5FZS A;  4BX8 A;  2ROL A;  1HXI A;  1FPP A;  1O9S A;  2PUK B;  2X3M A;  4ACK A;  2DTO A;  2Y4X A;  5LJ3 g;  2EYZ A;  4C8Q E;  1M2O A;  4B89 A;  4QT7 A;  4WWP A;  5C6S A;  2FZG B;  3R6O A;  4N0A A;  5KYW B;  3L16 A;  2EJF A;  2YIN A;  2OVF A;  5E76 A;  2L9B A;  4AIF A;  1EX4 A;  1W4S A;  4GA2 A;  1LPL A;  3CSF A;  2WMO A;  3SI5 A;  2X38 A;  2EPD A;  3FHE A;  3CBP A;  4I1O B;  3VTX A;  2O4X B;  1KZP A;  1D0Y A;  2IVW A;  4FYY B;  3TRE A;  3VS0 A;  2QYZ A;  1M9S A;  2O2O A;  2DBA A;  4OB1 B;  4N2Q A;  3G4S A;  2LX7 A;  1K9M U;  2WXJ A;  2NSZ A;  4BET A;  3M0U A;  2OAU A;  4EBA A;  1B3Q A;  2KGT A;  3AAA C;  1QNF A;  5G04 J;  4J0U A;  3TWR A;  2KM4 A;  3ASF A;  1BB9 A;  4GZD A;  3G2S A;  3RIB A;  1WHH A;  3ZXP A;  2IJG X;  4GYO A;  2EWN A;  2YRC A;  2QA4 Q;  2E5Q A;  4M7A E;  2JTF A;  1UJY A;  2MWP A;  4PUC A;  2VV5 A;  4C8Q D;  3SFM A;  1K8A C;  3L13 A;  2CZ1 B;  4J9G A;  4X34 A;  2IF4 A;  4JUV A;  3N71 A;  1RAA B;  2M1H A;  2XEN A;  1TXQ A;  2DK3 A;  4CDM A;  4R0K A;  2JW4 A;  2CGH A;  3APC A;  4CDN A;  3HRT A;  3J80 E;  3MKD A;  3JUI A;  3MP1 A;  1UB4 A;  4N2S A;  4AFU C;  1PHT A;  1WA7 A;  1MMN A;  4KT0 E;  1ZSZ A;  2X6H A;  2WXM A;  1M8V A;  4JA7 A;  2B86 A;  2P9I G;  3DSV A;  4UWH A;  4BER A;  4HCC A;  1FMV A;  4XTX A;  3C94 A;  3SDZ A;  1BBZ A;  3UWN A;  3O5Z A;  3RNJ A;  2E5K A;  3I9Q A;  4LNB A;  4WNF A;  3PIP A;  4FA6 A;  1A5E A;  2KVQ G;  4E7I A;  3OS1 A;  3LYI A;  1TU0 B;  4M75 C;  2RQW A;  3LYA A;  2LQK A;  3GOX A;  1KC8 R;  4M7A D;  3FUL A;  4BSX A;  2XI9 A;  3FDH A;  4FUL A;  3RRN B;  3VS3 A;  2QYU A;  1BI7 B;  3DB4 A;  3FY4 A;  4F16 A;  1O1T A;  4RCB A;  1KFZ A;  1Y71 A;  4HOS A;  2FI7 A;  1UG3 A;  3RES A;  1FVF A;  4LXC A;  3H6Z A;  4ILH B;  4I1M A;  4U07 A;  3ZYQ A;  2JM8 A;  3LGL A;  4DOW A;  2QA4 T;  3TCJ A;  1QVF S;  1KIK A;  1E8X A;  2C0T A;  4OMF B;  4C5E A;  5JHB A;  3D9O A;  1N9S A;  1JEG A;  2X3X D;  4XTW A;  4JZY A;  4K5A B;  4N5C A;  3FH8 A;  2PL2 A;  4LSZ E;  2OND A;  1Z9Z A;  5A6C A;  2VGX A;  1VYU A;  3VS7 A;  4FLH A;  3R9A B;  3ZRH A;  1NBE B;  3AS5 A;  1ZUU A;  2WXK A;  4A3T A;  3ZFJ A;  2HYZ A;  4F6R D;  1UN8 A;  2P0P A;  4BAC A;  3L1A A;  4OVA A;  2PQN A;  2MPX C;  3E4B A;  4HNA D;  2XDP A;  4WTO B;  2VTB B;  6AT1 B;  3QDF A;  1ZB1 A;  5AAO A;  5CMW A;  2K2M A;  1YJW A;  1UN9 A;  5EX3 A;  1S1N A;  4UQY A;  4PDX A;  1M1K R;  1TYQ G;  4LD6 A;  4ANW A;  4LRZ A;  3I3N A;  3TVT A;  3ZYL A;  4LNG A;  3EH2 A;  2YDL A;  4QFV A;  3FTX A;  4PLI A;  5B1A E;  1MV3 A;  4A4G A;  3OYD A;  1M30 A;  1N0R A;  2DWZ A;  4PJO A;  5GAM f;  1Y57 A;  1SA4 A;  2R59 A;  1R0C B;  1HYO A;  2COZ A;  2IPO B;  2L3R A;  3AG1 E;  4ZN3 A;  1AWJ A;  1N6A A;  2JMA A;  4TRQ A;  4XKC A;  2GNC A;  2JTE A;  1F1B B;  2DL8 A;  1S64 A;  1MYO A;  5CBN A;  4UWG A;  3LJN A;  2KQW A;  3F70 A;  4HVV A;  1E8Y A;  4K03 A;  1VQK Q;  4GZ3 A;  1K73 R;  5CAI A;  3C72 A;  3PVQ A;  3VS4 A;  3BY7 A;  4HI9 A;  3CQG B;  5AQ7 A;  3PT9 A;  1BI0 A;  3GW4 A;  1WFW A;  1WGS A;  1TEZ A;  2WMN A;  3O48 A;  3OYN A;  4WNE A;  2HQE A;  4TUM A;  4CC2 A;  5I2S A;  1W2B P;  4ANJ A;  1O75 A;  2RMO A;  4FM4 B;  5CIU A;  1IO6 A;  1HH8 A;  1KG1 A;  1D1C A;  1OWM A;  5FT9 A;  2LX9 A;  3LEW A;  3NGP A;  1TNB A;  2CS7 A;  2FPE A;  4HCB A;  3ASH A;  2AKL A;  3EG0 A;  4F1S A;  1DC2 A;  4OGE A;  4C92 F;  3JV3 A;  4FJZ A;  3MKQ B;  3RK6 A;  4DLO A;  4ATZ D;  4IKF A;  2HZY A;  3FB9 A;  3FTS A;  3JB9 D;  1MMG A;  3CCR Q;  1N11 A;  2P9L G;  2JT4 A;  5DY9 A;  3OS5 A;  2JS2 A;  1H0A A;  1UJK A;  4GCO A;  4WWO A;  1JXM A;  2MYO A;  3DWL G;  4HI8 A;  4KXK B;  4L2Y A;  4HOR A;  1QKX A;  4N4I A;  1VQ9 A;  1W2B A;  4JA9 A;  3FDR A;  3PFS A;  3URZ A;  5JJT A;  3MCA B;  4RG2 A;  5JJ6 A;  5KCH A;  3GIB A;  4I1A A;  1VQ7 A;  1VQ9 T;  1TR4 A;  1X69 A;  2KZT A;  4JJD A;  4F7A A;  3OMG A;  2WVI A;  2L3Q A;  4CRI A;  1VQO T;  3IV0 A;  1MX4 A;  1L5J A;  3J5P A;  3PRZ A;  3W9G A;  1FX7 A;  1H2T C;  2CZ7 B;  1K8K G;  2ETB A;  5CHE E;  3SFX A;  1R77 A;  5CMY A;  2X35 A;  1KC8 C;  4IIO A;  3UM3 A;  2FO0 A;  4XAX B;  3CK7 A;  1E90 A;  2BED A;  3LW5 E;  4JRK A;  3V7C A;  1VQK T;  4AMC A;  2DER A;  1YNZ A;  4J6X A;  1K4U S;  4ACL A;  4EHM A;  2YRV A;  2RPN A;  2NWM A;  2L89 A;  4C8Q A;  2CG3 A;  2V8S E;  3MV2 B;  1LNX A;  2RHX A;  3CPW P;  1GXI E;  2E1H A;  3QZ9 B;  1I07 A;  2VSY A;  3QBY A;  5GAO m;  2I1J A;  2W10 A;  1K9M R;  3VUB A;  2GRR B;  1NEB A;  5ITZ F;  4XTZ A;  1K1A A;  2VVK A;  1RUW A;  2YUO A;  3CCE T;  4XTU A;  1INZ A;  4DBR A;  1SQM A;  3M0S A;  3V8J A;  4WND A;  2DL5 A;  1T3L A;  2GFA A;  2ATC B;  5ENR D;  1QCN A;  3KSQ A;  1YI2 T;  1JWF A;  4OAU C;  3CMA Q;  4M7D E;  1KT1 A;  4G11 A;  2DE0 X;  1YIT T;  1V76 A;  3VS1 A;  4GTO A;  4IUL A;  2FB7 A;  3ZGQ A;  4F7U E;  2V8J A;  1OOT A;  1QQJ A;  3CPW A;  4JD2 G;  1O5M A;  3TWW A;  5T4Y A;  5D6W A;  2ZPH B;  3UDC A;  2RI5 A;  5FQ7 A;  1M1K C;  4OMM A;  3JB9 H;  4GMR A;  3ULR B;  4EEC A;  2VC8 A;  4M7A A;  1S72 A;  1IXD A;  4BD3 A;  1N52 A;  2HDA A;  4NQ0 A;  1TG0 A;  3HRA A;  2DD4 A;  3ZHE A;  4JZ4 A;  1JU5 C;  2BE9 B;  2JS0 A;  2M9U A;  4PS8 A;  4M75 G;  1OZ2 A;  1UOH A;  5LOZ A;  3HXC A;  2R5A A;  5AQ9 A;  4CC4 B;  4LEU A;  1X6B A;  1RAD B;  4TXQ A;  1WPY A;  4PFO A;  3DXK G;  2DYS E;  5ANR A;  2BE7 D;  1TN8 A;  1K73 C;  2DYB A;  1FMW A;  2ZGD A;  3ASN E;  1M1F A;  3I4R B;  2JOY A;  3X26 B;  1PRM C;  4B8A A;  2WXH A;  5G05 J;  3ZYK A;  3CCL Q;  2PVO B;  2CP0 A;  4M7D D;  3AS8 A;  3JCM f;  1TNY A;  2OOE A;  1PD1 A;  4JC8 A;  2YNQ A;  4PLL A;  1JO8 A;  2JVV A;  2NLU A;  2JLB A;  4BT8 A;  2FO7 A;  2DA9 A;  2PZ1 A;  2LMJ A;  1G5V A;  4JDS A;  4AFZ C;  2XCB A;  1XGW A;  1LVK A;  1VQ5 Q;  1DJ7 B;  2ETA A;  5LJ5 g;  3DPD A;  2J09 A;  1OWN A;  5ARG A;  2BIV A;  5KYY B;  2LDM A;  3CVX A;  3CMA T;  2L6J A;  2HBW A;  1MHN A;  2WXF A;  2K3X A;  3AJI A;  1WDX A;  2UY1 A;  2YWW A;  2LNI A;  1EFN A;  1ELK A;  3QK0 A;  3G1J A;  4DBF A;  1HG2 A;  2H6I A;  3IEG A;  1TUC A;  2EAY A;  2X4X A;  1MX2 A;  4GMJ A;  1PWT A;  5KJN A;  1KJW A;  1FVH A;  1KK7 A;  3OW2 P;  5ARF A;  1OEB A;  1RAI B;  2BZX A;  3BEE A;  3ML8 A;  2QEX A;  3OYH A;  2LRQ A;  3HRU A;  2HSP A;  3SD5 A;  2FBN A;  3NMZ C;  1OV3 A;  3UX4 A;  4F3V A;  1NYG A;  1YMP A;  1U06 A;  5D6Y A;  1X2K A;  3CVY A;  2G3R A;  2PTK A;  2CUD A;  3QJY A;  4C0F A;  3C3Q A;  2EIK E;  3SGH A;  2WQ6 A;  1T0H A;  1YCY A;  2LP5 A;  3LX7 A;  5AYF A;  3VS5 A;  1CKB A;  3RR6 A;  1RI0 A;  1YIJ A;  2EQM A;  3OW2 A;  1E6H A;  5DIZ A;  3G7Z A;  3OYI A;  3D7S B;  2A0F B;  1RI9 A;  2Y90 A;  1PNJ A;  3CBM A;  1TN7 A;  5BPP A;  2L5Q A;  3L2Z A;  4JVS A;  4AJW A;  1K9M C;  2GTO A;  4GA0 A;  5FZR A;  1QVP A;  4L1B A;  2QQB A;  5M72 A;  1AZG B;  1UJ0 A;  3M54 A;  2R02 A;  1QCF A;  3GLX A;  1RAE B;  4PS3 A;  2EVR A;  5FLX E;  2MK5 A;  2P9K G;  4QQG A;  2KXC A;  4OP0 A;  1SF9 A;  2D8J A;  4MML A;  2DCP A;  4C92 E;  2J06 A;  3PZ1 A;  2NXP A;  4U0U A;  2EQX A;  2LCS A;  2F69 A;  1K3Z D;  3JCM b;  2EGC A;  1D0Z A;  1I5O B;  4I17 A;  3UM1 A;  2V8K A;  3KBG A;  5EN5 D;  1VQ4 T;  2A37 A;  4FHK A;  3TWV A;  4RCC A;  4O6F A;  4UQZ A;  1SRM A;  2GTJ A;  2OCC E;  2G6F X;  2X9H A;  3QJ6 A;  3THK A;  1QQE A;  4WF2 A;  3VRY A;  2DJZ A;  2CH4 A;  4PNO A;  4E2F B;  2DRM A;  4M78 B;  2XEH A;  5J39 A;  5GMK i;  4LE9 A;  3DSW A;  1TH7 A;  3HYM B;  2J08 A;  4BY6 C;  2DPP B;  1UGP B;  2AXU A;  1P5Q A;  1SA5 A;  3CLJ A;  1B89 A;  1OT8 A;  2X6K A;  5LP0 A;  4ELY C;  4V2S A;  4PJL A;  2YHT A;  2WXL A;  5KNG A;  4L2L A;  1YBY A;  3AU5 A;  3MPU B;  3PRE A;  4YND A;  1LOJ A;  1QWE A;  2LT1 A;  5B1B E;  4UI9 C;  1OI1 A;  2A28 A;  3QJZ A;  4RUG A;  2OI3 A;  4BUG A;  4C92 D;  4QVC A;  8AT1 B;  1PCX A;  4M77 E;  4EPC A;  2E6Z A;  3C95 A;  1G3N B;  1YJN A;  3LLR A;  3DSU A;  2RHZ A;  4VUB A;  4CT4 A;  2RJE A;  4A3V A;  2DET A;  3RRM B;  2CP3 A;  4J6Y A;  4O6J A;  1AD5 A;  2IY0 C;  4J7I A;  3I5P A;  1HZ4 A;  1D9S A;  3LCA A;  3QOU A;  4AEZ C;  4KH1 B;  2AK5 A;  2XIC A;  4L6V 5;  4JRQ A;  1KC8 U;  3MKR A;  4JHK A;  2KYB A;  1D3B A;  1VUB A;  2FRY A;  3HKS A;  3M9Q A;  3T9K A;  4E7S A;  3TXM A;  1H3H A;  2E70 A;  1B7T A;  3ER0 A;  4R56 A;  3AU4 A;  3G6E Q;  1TNO A;  1BI3 A;  1UGS B;  2DVJ A;  4JEH A;  4BI3 A;  3JCM V;  5GAO l;  3CME Q;  2P58 C;  4E7H A;  3PE4 A;  1WJQ A;  2ZGW A;  3PDN A;  3JCM c;  4N0A C;  3J81 E;  3M56 A;  3T5V A;  4HLE A;  1PSE A;  3OYG A;  1NP7 A;  2VQ2 A;  2RKK A;  1E7U A;  2QK0 A;  1E6G A;  4KZ0 A;  3TL5 A;  1OCC E;  2XGM A;  3MHX A;  3LH5 A;  4M77 D;  4ATO A;  3NF1 A;  1FWZ A;  4DA4 A;  4LG6 A;  1RAH B;  2QTX A;  1D8D A;  4IUV A;  5IH2 A;  4G23 A;  2LJ0 A;  3L9T A;  4JLG A;  5AJL A;  3QHS A;  4KUL A;  4M7D A;  4MMK A;  3G2V A;  1OCR E;  3HDX A;  2K57 A;  3L42 A;  4F7U A;  3JCM P;  3PS6 A;  1OUV A;  1R8O B;  2XDD A;  3CR3 A;  3L2V A;  3B7R L;  1KD1 R;  4NOY A;  3KEA A;  4GZ5 A;  4KUD K;  1N4P A;  3UF4 A;  1HE8 A;  5GAN f;  5BV1 A;  4FCY A;  1M1K U;  1K0X A;  3CVQ A;  1MV0 B;  2DBK A;  3RBB B;  2RNA A;  3URG A;  5FIN A;  3MJW A; 
#chains in the Genus database with same CATH homology
 2RQT A;  2KXP C;  1BBZ A;  1JQQ A;  4AFQ C;  3O5Z A;  3RNJ A;  1T0J A;  2J6O A;  4Z68 A;  4J9E A;  2E5K A;  3I9Q A;  4CC7 A;  4OAV B;  1A5E A;  3ZU7 B;  3NOG D;  5BXO A;  1CSK A;  2K3B A;  1ZUK A;  2DRK A;  2JMC A;  2RQW A;  3M0R A;  5CBO A;  4DX5 D;  3UAT A;  1PRL C;  2OJ2 A;  3VS3 A;  4J9I A;  1ZBJ A;  1BI7 B;  1K1B A;  4KRT A;  1AZE A;  4U8V D;  2LQN A;  4F16 A;  4BSZ B;  1KFZ A;  1BI8 B;  5JA4 D;  5D66 A;  4HVW A;  1GRI A;  2EKH A;  2KYM A;  2W0Z A;  4OMO A;  2DZN A;  1SHF A;  2I0N A;  2M0Y A;  2YUQ A;  4RTX A;  5KBA A;  4HB5 A;  2JM8 A;  2D8H A;  4HCK A;  1KIK A;  4LN2 A;  2C0T A;  3REB B;  4E6R A;  1HJD A;  3EU9 A;  2O9V A;  1JEG A;  4JJB A;  3SEM A;  2X3X D;  3ZL7 C;  1M3C A;  2LJ3 A;  2F8Y A;  4K5A B;  4DUI A;  1N0Q A;  4LSZ E;  1Z9Z A;  5ENS D;  1BU9 A;  2F2X A;  1T3S A;  1VYU A;  3VS7 A;  1IKN D;  5CER B;  4G8L A;  1FMK A;  1NEG A;  3UI2 A;  2DZO A;  1ZUU A;  4HRL A;  2L3P A;  4F6R D;  4AG1 C;  1AEY A;  3QWX X;  1ABQ A;  2F8X K;  2H8H A;  2KXD A;  2L6B A;  3UXG A;  4HNA D;  2DL4 A;  2J6K A;  3EHR A;  5AAO A;  2K2M A;  1S1N A;  1UTI A;  2L0A A;  3C5R A;  1UHF A;  3TVT A;  2YDL A;  1YWO A;  4QFV A;  1NLO C;  3EG3 A;  5FW9 A;  3A98 A;  2BKK B;  1MV3 A;  3UA6 A;  4ZHB A;  2P2C P;  4F1P A;  5AQB A;  1N0R A;  2DWZ A;  1M30 A;  4QQI A;  2MOX A;  3PE0 A;  4RTV A;  1Y57 A;  3B7B A;  3I35 A;  1BK2 A;  4GLM A;  1HD3 A;  1AWJ A;  3C0C A;  1M8M A;  2JMA A;  1X27 A;  2GNC A;  2JTE A;  2DL8 A;  2MIO A;  3DEP A;  1MYO A;  5CBN A;  2K7A A;  2CSI A;  4HVV A;  3LJN A;  5EIB E;  2GBQ A;  3PVQ A;  3VS4 A;  4HI9 A;  5AQ7 A;  1SPK A;  2FO1 E;  2ED1 A;  1B07 A;  1WFW A;  1QKW A;  1I1J A;  1SEM A;  1YYH A;  2DL3 A;  4GPM A;  4DEX A;  2EGA A;  4CC2 A;  4TUM A;  4F14 A;  4ZFH A;  1UHC A;  2RMO A;  2DMO A;  1IO6 A;  2ED0 A;  4HRN A;  1SHG A;  2KRM A;  1MUZ A;  3NGP A;  3V2O A;  1XOV A;  1Z9Q A;  2FPE A;  1AWW A;  2AKL A;  2CDT A;  1DC2 A;  2EYX A;  2K79 A;  3EG0 A;  3JV3 A;  2DJQ A;  2XEE A;  2MCN A;  2EW3 A;  3ZNG A;  4ATZ D;  1AOJ A;  2Y1L E;  4HRM B;  3JXI A;  2RQU A;  1N11 A;  5AN8 A;  2JT4 A;  2KE9 A;  2NUZ A;  2L2P A;  2P4R A;  2JS2 A;  2DM1 A;  1JXM A;  2D0N A;  5ENT D;  2MYO A;  4HI8 A;  1N5Z A;  3VS6 A;  1QKX A;  1WLP B;  3IQL A;  4JZ3 A;  5AQA A;  4HBD A;  1UGV A;  4A63 B;  1W6X A;  1IHB A;  1WXT A;  1W70 A;  4U95 D;  2YUN A;  1NM7 A;  4OMP A;  2O88 A;  3FJ5 A;  2KBX A;  1TR4 A;  1X69 A;  3SHW A;  1GCP A;  4JJD A;  5FWB A;  4NIK A;  2L3Q A;  3TWQ A;  1MX4 A;  3W9F A;  5HRY A;  2XZD G;  3J5P A;  3W9G A;  1NYF A;  2ETB A;  2A5E A;  1FYN A;  1Y0M A;  4IIO A;  3F6Q A;  2FO0 A;  2ENM A;  4X1V A;  2J7I A;  2DVW A;  4RTY A;  4J8Y A;  1YNZ A;  5GJV B;  2DL7 A;  1E7O A;  3NBN B;  1JXO A;  1BD8 A;  1M3B A;  1ZUY A;  3V79 K;  2RPN A;  2NWM A;  5KNH D;  2VWF A;  3U23 A;  2J6F A;  5HS0 A;  1I07 A;  3JUE A;  4AFS C;  2JM9 A;  2W10 A;  1M27 C;  1NEB A;  5ITZ F;  4LUD A;  1K1A A;  2VVK A;  1RUW A;  2C0I A;  2YUO A;  4BEP A;  1K4U S;  1WXU A;  3M0T A;  4J9D A;  1YWP A;  3M0S A;  3D9H A;  3ZKJ A;  4N5Q A;  2DL5 A;  2J8S D;  1T3L A;  2DIL A;  5ENR D;  4G8K A;  1ZLM A;  4OAU C;  1VYV A;  1MJ0 A;  3NHN A;  1AVZ C;  2DE0 X;  5EIL A;  3VS1 A;  2CUB A;  2ROT A;  2RF0 A;  1OOT A;  4Z8A A;  4Z89 A;  2LQW A;  3TWW A;  1ZX6 A;  4M4Z A;  4K5C A;  2EYW A;  3EHQ A;  3PVL A;  3B95 A;  4LNU D;  5GJW B;  4B93 B;  4OMM A;  1X2Q A;  4HQD A;  3R6N A;  4GMR A;  3ULR B;  4BES A;  4DRX E;  3KFV A;  1K76 A;  2HEQ A;  2HDA A;  1TG0 A;  3HRA A;  3IXE A;  5FIO A;  3J5Q B;  2DNU A;  4JZ4 A;  1JU5 C;  5ENO D;  2JS0 A;  1BU1 A;  3TSZ A;  1I0C A;  1PKT A;  5ENP D;  5EC7 A;  3V2X A;  1UOH A;  2XZT G;  1VA7 A;  4J9F A;  5AQ9 A;  4CC4 B;  4DX2 A;  1X6B A;  5FWC A;  3JXJ A;  4JPB W;  1NLP C;  2ECZ A;  2CSQ A;  2DYB A;  2CRE A;  2ZGD A;  3CQT A;  4RLY A;  4ORZ A;  4HLL A;  2FRW A;  2EQI A;  5EID A;  2HCK A;  2K6D A;  2IIM A;  2KRS A;  4CZ2 D;  1PRM C;  3GBQ A;  4ESR A;  4J9H A;  4Z88 A;  3T8K A;  2M51 A;  3Q9U C;  1LCK A;  1ZSG A;  2RFA A;  1WG0 A;  2EYY A;  3V30 A;  5BXU A;  1OPL A;  1BLX B;  1DCQ A;  4J9B A;  3UA7 A;  2OAW A;  1JO8 A;  3NPF A;  4LNP A;  5ECA A;  1M3A A;  2DF6 A;  2PZ1 A;  2DA9 A;  2EGE A;  3ZUV B;  1RLP C;  2LMJ A;  2X3W D;  4AFZ C;  5IXF A;  1H92 A;  1QYM A;  3H41 A;  5AAR A;  1QLY A;  1S70 B;  1G83 A;  2ETA A;  4JB8 P;  5KWD A;  2GGR A;  2O31 A;  5CEA A;  4O1P A;  1WIE A;  2HBW A;  2CT3 A;  3V31 A;  1YN8 A;  3AJI A;  1CKA A;  1WDX A;  2J05 A;  1EFN A;  3M0P A;  1MX6 A;  1TUC A;  2AKK A;  2V5Q C;  2V1Q A;  1MX2 A;  1PWT A;  1SSH A;  1KJW A;  2LJ1 A;  2ESW A;  1PKS A;  4ZNX A;  4DEY A;  1OEB A;  3TWU A;  1OPK A;  2BZX A;  3VS2 A;  1KSW A;  2XMF A;  1X6G A;  2F2W A;  3H0H A;  2DX1 A;  2O9S A;  3TWS A;  1UE9 A;  2HSP A;  2A36 A;  2ABL A;  3NMZ C;  1OV3 A;  4OML A;  1NYG A;  1U06 A;  1YMP A;  1WYX A;  1K9A A;  2V4H C;  3QWY A;  4AG2 C;  1X2K A;  2YSQ A;  1IXV A;  1HSQ A;  2PTK A;  4RTW A;  2F2V A;  4O60 A;  1X43 A;  2CUD A;  5HCK A;  2SRC A;  4DX6 D;  3VS5 A;  1T0H A;  2LP5 A;  1GL5 A;  2VGE A;  3NOC D;  1CKB A;  1GBQ A;  2CH4 W;  4IIM A;  2FG0 A;  2FPF A;  1E6H A;  4O1O A;  2DBM A;  1AWO A;  2Y0B G;  4K11 A;  1A0N B;  1WI7 A;  3DEO A;  1V1C A;  1RI9 A;  2RQR A;  2F37 A;  1PNJ A;  1TUD A;  5HKP A;  4JJC A;  1K1Z A;  2ETC A;  2PNN A;  2GTO A;  1YCS B;  2V1R A;  2LNH B;  4U96 D;  5CEC B;  1AZG B;  1UJ0 A;  2D1X A;  1QWF A;  2KNB B;  1QCF A;  1H8K A;  2AZS A;  2EVR A;  3EG2 A;  2DLP A;  5I22 A;  2KXC A;  1UEC A;  2D8J A;  2QDL A;  4U8Y D;  4HVU A;  2VKN A;  4CC3 A;  5L23 A;  2J06 A;  2RFM A;  2LCS A;  4FSS A;  1UDL A;  1K3Z D;  4DX7 D;  2EGC A;  4CYM D;  3HG0 D;  4F17 A;  2KBT A;  2RN8 A;  2QC9 A;  4HXJ A;  2K9G A;  5EN5 D;  1U3O A;  2A37 A;  2BZ8 A;  3TWV A;  1NG2 A;  4J7W A;  1SRM A;  2GTJ A;  5IHI A;  3THK A;  2G6F X;  1UG1 A;  4DX1 A;  3VRY A;  2CH4 A;  2CT4 A;  2BKG A;  2C0O A;  1AP7 A;  1AWC B;  2XEH A;  1GCQ A;  1W1F A;  2DRM A;  4OMN A;  1SW6 A;  4YDY A;  4LE9 A;  2KRO A;  5JMN D;  1UUE A;  2BTT A;  3H0F A;  5IHK A;  1GBR A;  1U5S A;  3UTM A;  1OY3 D;  5EYL A;  1SVX A;  3TWX A;  2QYJ A;  1OT8 A;  4WCI A;  3SO8 A;  2KT1 A;  1NFI E;  2A08 A;  2LZ6 B;  4RTT A;  3TSW A;  4YDW A;  2BZY A;  4LUE A;  5KNG A;  2AJA A;  1SRL A;  3Q9N C;  1K0S A;  2HE0 A;  2YT6 A;  2NYJ A;  1VYT A;  3VRZ A;  1QWE A;  1J3T A;  1GFD A;  2A28 A;  2ROL A;  1ABO A;  4RUG A;  2OI3 A;  2JAB A;  4GBQ A;  2AZV A;  2KT8 A;  5ENQ D;  1G3N B;  4Y92 A;  2EYZ A;  1GCQ C;  5EYP F;  5I11 A;  4QT7 A;  2KRN A;  5IHN A;  1AWX A;  4D8D A;  5CED B;  1GFC A;  1ARK A;  1AD5 A;  2GQI A;  4RTU A;  1UFF A;  1D9S A;  1G2B A;  2AK5 A;  3EG1 A;  2KYB A;  2L3S A;  2FRY A;  3T9K A;  3EGU A;  2EPD A;  1H3H A;  3H0I A;  4UUC A;  4D8K A;  3VS0 A;  1WXB A;  2DVJ A;  2O2O A;  4RTZ A;  4J9C A;  4K5B A;  4C48 B;  2LX7 A;  4BET A;  3M0U A;  2KR3 A;  1B3Q A;  2KGT A;  3AAA C;  3TWT A;  2RQV A;  3I5R A;  3TWR A;  2PNI A;  1BB9 A;  1WX6 A;  2FPD A;  3M0Q A;  2SEM A;  1E6G A;  3LH5 A;  1WDY A;  1YP5 A;  1UJY A;  4LG6 A;  5IH2 A;  2LJ0 A;  4J9G A;  2ZGG A;  3REA B;  2JXB A;  2FEI A;  2XEN A;  2EBP A;  4R0K A;  2JW4 A;  3KEA A;  3UF4 A;  2KEA A;  2B0O E;  4OMQ A;  1PHT A;  1WA7 A;  4AFU C;  1K0X A;  1MV0 B;  2DBK A;  3RBB B;  2RNA A;  4EIK A;  5IXB A;  2YUP A;  1RLQ C;  2B86 A;  3I5S A;  5FIN A;  4BER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...