1YCSB

P53-53bp2 complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
193
structure length
193
Chain Sequence
PLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGITALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAVFAMTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYEPQNDDELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords P53
publication title Structure of the p53 tumor suppressor bound to the ankyrin and SH3 domains of 53BP2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (anti-oncogene/ankyrin repeats)
total genus 46
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 1996-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00018 SH3_1 SH3 domain
B PF00023 Ank Ankyrin repeat
B PF13606 Ank_3 Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1ycsB01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ycsB02
3THKA 3RBBB 2CT3A 2V1RA 2LMJA 2DBKA 3O5ZA 3EHQA 1EFNA 4ORZA 3TSZA 1GCQA 1S1NA 1G2BA 1N11A 1JO8A 2CUBA 2DL7A 3TWXA 1ZUUA 3DEPA 3Q9UC 4CC4B 4F16A 2EW3A 5AARA 1AWCB 2DL8A 2G6FX 2KGTA 1Y0MA 2QYJA 3V31A 4K5CA 1UG1A 2FRYA 3VS6A 4HXJA 1ZUKA 2FG0A 1KJWA 5JMND 3ZU7B 4RTWA 5EYLA 2GGRA 3SEMA 3IXEA 4GLMA 3JXJA 1HSQA 2JM9A 5FW9A 3R6NA 5IXFA 4JZ4A 3D9HA 2V4HC 3HG0D 4NIKA 5IHKA 1CKAA 5IXBA 2DBMA 4OMMA 3ZUVB 2L3PA 2AZVA 2B0OE 1YCSB 3TWWA 3TWRA 4OMNA 1WXTA 1OEBA 1HJDA 1M3AA 1WYXA 2BZYA 3EG0A 5FWCA 1TR4A 2JXBA 2VGEA 2PNNA 1SPKA 2J8SD 1PRLC 2C0IA 3SO8A 1RI9A 1MX6A 3ZNGA 4F1PA 2AK5A 4HRLA 4RTTA 1IHBA 3M0QA 1T0JA 3KFVA 3UA6A 2O9SA 2J6OA 4TUMA 4M4ZA 4F6RD 5AQBA 2V1QA 4HI8A 2JMCA 2YUOA 4G8LA 5KBAA 4LUEA 4AFQC 1IO6A 4J9IA 1ZLMA 5AN8A 1SHFA 2DMOA 2LP5A 2VVKA 1YYHA 4JZ3A 2LCSA 1QKXA 1MX4A 1M3BA 3ZL7C 4DX6D 1Y57A 2GTOA 2HEQA 3REBB 3AAAC 1VA7A 1QLYA 4G8KA 1PRMC 4HRMB 1QWEA 2RN8A 3M0SA 1NM7A 2XEHA 1YWPA 3TWTA 2K6DA 1JEGA 2EBPA 2YUQA 4RUGA 2HDAA 1BK2A 4R0KA 5L23A 4YDYA 4HI9A 2OAWA 1BI7B 1KSWA 2GTJA 4RTUA 4GBQA 2DILA 2NWMA 1H92A 1YN8A 2DA9A 3B7BA 4Z68A 4JJDA 4K5BA 2OI3A 5BXUA 1ZUYA 2AKKA 2A5EA 4GPMA 4J9GA 1OPKA 2EGEA 1AWWA 3LJNA 4Y92A 1QKWA 2RF0A 2A08A 2K2MA 3M0RA 2RFMA 1W70A 2XZDG 3V2OA 3JUEA 3I5SA 1UOHA 3TVTA 2EYWA 1M3CA 2RNAA 1NLOC 5AQ9A 2C0TA 1X2KA 3H0FA 2JMAA 3M0UA 1UE9A 4J9BA 1GRIA 1SSHA 2KXCA 5EC7A 1JU5C 2L3SA 1UJYA 1K0SA 1SW6A 1UTIA 2H8HA 2NYJA 1PWTA 1UDLA 2GBQA 3TWVA 2RQTA 2KRMA 3EGUA 2BZXA 4HVWA 5FWBA 1MV0B 3VS7A 4F14A 2FO1E 1K3ZD 5EYPF 3W9GA 1HD3A 1WXBA 2FPEA 4QFVA 4DX7D 1WI7A 2O9VA 1YNZA 4D8DA 4RTZA 4GMRA 1N0QA 4HQDA 2CUDA 3QWYA 3NOGD 2JS2A 2KBTA 1WFWA 5CECB 2CH4A 3PE0A 1H3HA 1AWJA 3I35A 2GNCA 4RTXA 2XENA 3GBQA 3VS3A 2RMOA 3T8KA 2HCKA 2AZSA 2RQUA 4DX1A 4QT7A 3V79K 2E5KA 5ENTD 1OV3A 5EIBE 2BZ8A 4QQIA 2VKNA 5CERB 2ROLA 4CC7A 2LZ6B 5CBOA 1FMKA 2CSIA 4HBDA 2L2PA 2J6KA 5ECAA 1OOTA 1UJ0A 1RUWA 2W10A 2DWZA 3Q9NC 1U5SA 4J9EA 3HRAA 1B3QA 3M0TA 1IKND 3NBNB 2ECZA 2EGCA 2YDLA 3QWXX 1TUDA 4IIMA 1YMPA 1AEYA 1QYMA 4BSZB 1QCFA 2EYXA 4KRTA 1A0NB 4DRXE 2LQWA 4ZNXA 4D8KA 5FINA 1K9AA 4ZHBA 1NEGA 3SHWA 1WDYA 1UHFA 1H8KA 1WDXA 5IH2A 2F2VA 2YSQA 4CC3A 2K79A 1GCPA 4BETA 2F8YA 4HVUA 4Z89A 2AKLA 2DJQA 2EYYA 1MUZA 1BD8A 2FPFA 2FO0A 4E6RA 1G3NB 2J05A 3VS5A 4RTYA 1DCQA 4DX2A 2PZ1A 1GFDA 2HSPA 1OT8A 1X27A 2KYBA 1NLPC 4DX5D 4A63B 1TG0A 4F17A 1UGVA 4HLLA 1SRMA 1X6BA 3TSWA 3VS2A 1LCKA 1Z9QA 3VRYA 2KEAA 1UHCA 2DLPA 2DX1A 2KYMA 3NPFA 4WCIA 3J5QB 2DZNA 2F37A 3EG2A 1BU1A 1VYVA 1W6XA 3M0PA 5ENSD 5IHIA 5EN5D 3CQTA 4HCKA 4O1PA 2YT6A 5HRYA 1W1FA 1E6HA 2F8XK 5HKPA 4LUDA 2X3WD 2J06A 2D8JA 3FJ5A 3ZKJA 2D0NA 2FEIA 1X69A 2XMFA 5ENQD 2J7IA 2I0NA 1NYGA 4YDWA 2LJ0A 2QDLA 4LG6A 1T3SA 4B93B 5ITZF 2IIMA 1T0HA 2CDTA 4JB8P 2BKKB 2EVRA 2A36A 5GJVB 1WXUA 1E7OA 4N5QA 4AG1C 1FYNA 1UFFA 2EGAA 2MIOA 5GJWB 1J3TA 2CSQA 1SVXA 1AZEA 2KXDA 2LNHB 3H0HA 1BI8B 2KNBB 2YUNA 4ATZD 5AQAA 3VRZA 2K3BA 3NGPA 3B95A 3NHNA 2A37A 1AD5A 5ENOD 2KT1A 2LJ3A 3PVLA 1M27C 1M8MA 2OJ2A 5HCKA 2ETAA 4HVVA 2L0AA 2NUZA 3REAB 1I0CA 4RLYA 3NMZC 1PKTA 2YUPA 3AJIA 1AWXA 3V2XA 1TUCA 2M0YA 5ENPD 4OAUC 2PTKA 2DVJA 1UECA 3LH5A 1CKBA 1ABQA 2ABLA 4O60A 5FIOA 1RLPC 1KIKA 1N0RA 3PVQA 2XZTG 1I07A 4LN2A 3JXIA 1PKSA 2JABA 1X6GA 2RPNA 3I9QA 1K1ZA 3DEOA 5ENRD 2CH4W 4ESRA 1MJ0A 4JJCA 4OMOA 2K7AA 1NFIE 2DL3A 2W0ZA 1ZBJA 1K1AA 3J5PA 3T9KA 2JTEA 4X1VA 2EYZA 2DE0X 1NG2A 1WIEA 4OMQA 3UTMA 2KT8A 1PNJA 3I5RA 4OMLA 3C0CA 3RNJA 4OMPA 1MYOA 2EQIA 5KWDA 4RTVA 5I11A 3W9FA 2L6BA 2LQNA 3KEAA 2KE9A 4U96D 4FSSA 1JXMA 3VS0A 2Y0BG 4DEYA 4J9CA 4UUCA 2RFAA 1U06A 2CREA 2DL5A 1KFZA 1ABOA 5I22A 2KBXA 2KXPC 1V1CA 2Y1LE 3UI2A 4HRNA 2VWFA 4J9DA 4BESA 1A5EA 2M51A 1K0XA 2AJAA 3EG1A 1QWFA 2P4RA 3EG3A 4Z8AA 1PHTA 5HS0A 1OY3D 1ZX6A 1WA7A 1NEBA 2KROA 1T3LA 3V30A 4Z88A 5IHNA 2JS0A 2HBWA 1N5ZA 2EKHA 2O88A 1GCQC 4DUIA 1K1BA 2JT4A 3UF4A 3UA7A 2HE0A 1NYFA 1SRLA 2SEMA 1BLXB 2C0OA 4AG2C 2SRCA 2DL4A 4BEPA 2ROTA 2V5QC 4CC2A 3U23A 4OAVB 1WG0A 1UUEA 4LE9A 5D66A 2DF6A 4AFUC 5AAOA 1YP5A 1WLPB 1AWOA 2XEEA 1GBQA 5BXOA 3UATA 2P2CP 1BB9A 2DNUA 1SEMA 2FRWA 1XOVA 1X2QA 4EIKA 2ED1A 3NOCD 4DEXA 5CEDB 3A98A 2K9GA 3ULRB 2ETBA 4ZFHA 1BU9A 5CEAA 3IQLA 4LNPA 2RQRA 3JV3A 1CSKA 3H41A 5KNHD 1VYUA 2RQVA 3H0IA 5AQ7A 5EIDA 2JW4A 4AFZC 4CZ2D 3C5RA 2F2XA 2DM1A 2O2OA 3VS1A 1OPLA 4U8YD 2BTTA 1RLQC 2JM8A 4C48B 4JPBW 2DRKA 3VS4A 5JA4D 1JXOA 4K5AB 2ETCA 2BKGA 1K76A 1AP7A 2KRSA 4J9FA 3TWQA 4J9HA 2DRMA 2MCNA 4U8VD 2QC9A 2MYOA 4BERA 2RQWA 3UXGA 2KRNA 4U95D 1E6GA 1VYTA 1AVZC 1MX2A 1K4US 1GFCA 1AOJA 2FPDA 2X3XD 2ZGDA 2D8HA 2DYBA 5CBNA 2ZGGA 1BBZA 1M30A 1ARKA 2J6FA 1JQQA 3EHRA 1Z9ZA 2PNIA 2LJ1A 2O31A 2B86A 1U3OA 4LSZE 1X43A 1S70B 4JJBA 4LNUD 2MOXA 4IIOA 1IXVA 2GQIA 2D1XA 1WX6A 2KR3A 3EU9A 5KNGA 1SHGA 2DZOA 3TWSA 1ZSGA 4J7WA 2A28A 2EPDA 4J8YA 4O1OA 4AFSC 4HB5A 2DVWA 2ED0A 4HNAD 1YWOA 3F6QA 2F2WA 2LX7A 1GBRA 1G83A 1I1JA 1GL5A 2L3QA 4CYMD 1MV3A 2ENMA 4K11A 1B07A 5EILA 3TWUA 1DC2A 1D9SA 2CT4A 1AZGB 2ESWA
chains in the Genus database with same CATH superfamily
3THKA 4JRPA 3FTXA 4J8FA 3DSXA 3CK9A 3UM3A 5FJYA 4C0EA 2IO2C 3Q73A 5CAIA 5E76A 3TSZA 5BNWA 3SNXA 1N4QA 4C8QE 1GXIE 3DEPA 3Q9UC 4RG2A 2EW3A 1OZ2A 3QUIA 3G6EQ 1VQ4T 2G6FX 4P29A 2KGTA 1Y0MA 4BB7A 3E33A 3V31A 1UG1A 2FRYA 4I43A 4WAFA 3ZIMA 2VGMA 2FG0A 1KJWA 3N5BB 1PY1A 4B9XA 3L13A 4RTWA 5DBKA 3OY9A 2GGRA 5A0GA 1K4US 3JXJA 5FW9A 2V0PA 5IXFA 2WXGA 3D9HA 2V4HC 4NIKA 4DK5A 3T5VA 2AVPA 1CKAA 4ANVA 5HY6A 1H2VC 1OXJA 4E85A 4WF2A 3DLMA 3MJWA 5D2MC 4PJOD 2QQAA 4OMNA 1WXTA 1KK7A 1OEBA 2MWOA 1M3AA 1Q2ZA 4MMKA 3V7SA 3IEGA 5A0DA 2PNNA 1SPKA 3U64A 1I8FA 3EU5A 1MZCA 3BQOA 4GTTA 2LXLA 4EMHA 2CFUA 2AK5A 1IHBA 2IPOB 3KFVA 3M0QA 3UA6A 2QEXQ 1S0PA 1BKBA 4B9WA 1JB0E 1H6PA 1N8RR 2JMCA 5BV0A 4BX9A 4LUEA 4J9IA 5AN8A 1SHFA 3HRUA 1B34B 2LP5A 4FCYA 1YYHA 3CVNA 1YHQA 1VQ9A 1OYXA 3APDA 3RRNB 3L2RA 2P9SG 4DX6D 2CKKA 1Y57A 2QYZA 3DXKG 1G3WA 1RABB 2HEQA 3REBB 1QLYA 4G8KA 1PRMC 3CCMQ 1JCQA 3TWTA 1ZQ1A 4JC8A 2K6DA 4AXHA 3OXLA 3ASNE 2CP5A 2YUQA 3SDZA 3OYIA 2HDAA 3RMSA 4RSYA 2MI6A 5IT9E 2A3LA 4HI9A 4FW2A 1BI7B 3L2UA 2DILA 4OVVA 1H92A 2XDPA 3K9IA 2DA9A 1PSEA 1Y71A 4GLKA 2OOEA 3MP1A 4JJDA 3E1SA 2DBAA 3SF4A 2OI3A 3I55Q 2A5EA 4IN3B 2EGEA 5GAN7 1QKWA 2RF0A 2LCCA 4U63A 2EYWA 1Y7XA 3BFMA 3QYGB 5GAMe 3GW4A 2C0TA 1X2KA 2QAZA 3CVVA 3CCLT 3CHPA 3OW2A 1YJ9T 3AS8A 1RAGB 2QA4A 2J4BA 5CRVA 5LX8A 2KXCA 2QY7A 3ZN3A 4HORA 1Q95G 1H6OA 4XU2A 1Q86R 5KE3A 1PWTA 3FEOA 2DVEA 1FVFA 2FHDA 1RW2A 2L8DA 4X34A 5CMWA 2KRMA 1VQ8T 4GU5A 2QFCA 2BZXA 3LY9A 3ME9A 4CEMA 4C0DB 1MNEA 5IN1A 4C92A 2RA2A 3CXCA 2R03A 3BE3A 4J6IA 4DA4A 4QFVA 1HXDA 4NURA 4J6WA 1YNZA 3OYGA 1DCEA 2GGFA 5C1DA 3KSQA 4JRKA 1VQLA 4W9RA 5ARGA 1OCCE 4HQDA 1GW6A 2LNIA 3L2ZA 3NOGD 3QWYA 2CG3A 4U7EB 4IKFA 4NACA 3QKJA 3HFOA 1AWJA 3FUKA 5GANd 2XENA 1N6AA 4C5IA 4J83A 2RMOA 2HCKA 1M1KU 2XD0A 4QT7A 1M90R 3V79K 3QWWA 1UGRB 2E5KA 3MP6A 5GANh 2BZ8A 2PQWA 1U3CA 4JS4A 4CC7A 5JJTA 3G6ET 4XU0A 2LDMA 3FIFA 1WM5A 1UGPB 3GIBA 2H6GA 4HBDA 4EBAG 2OX7A 3JCMh 1EPUA 1SKUB 5J39A 5ECAA 1D3BA 4URKA 2ZU6B 1UJ0A 1M8VA 3C94A 2VSXE 3Q9NC 3R6OA 1YI2Q 2R2LA 4ATGA 3L9TA 4J9EA 2IOSA 3M0TA 2ECZA 4IIMA 1YMPA 4C92D 2VGXB 1QCFA 4PS7A 4KRTA 1VQMA 4DLQA 4DRXE 2WQ6A 2VQ2A 4ZNXA 4D8KA 5FINA 1K9AA 1NEGA 3D9NA 1OCOE 5KCMA 2CP0A 1I4K1 5IH2A 2F2VA 2OTJT 2D0QB 4CC3A 2K79A 1GCPA 4FA6A 4XTVA 3H6ZA 4HVUA 2CZ0B 2X35A 2AKLA 2V8SE 4OF1A 3UT7A 4M7DF 2NUTA 1QBQA 2PQNA 2MF2A 4E6RA 3CEYA 1HFAA 2J05A 3EGXA 1RAIB 3S3OA 2QEXT 1DCQA 4DX2A 4GA1A 2PVDB 2HSPA 2O4XB 3PZDA 5KJKA 4A63B 1TG0A 4PFPA 4F17A 4XKBA 3CPWA 2DZCA 4HLLA 3TU4K 2FZCB 3TSWA 3T8MA 1ELKA 3CVYA 1IYGA 2KEAA 1UHCA 2OEWA 1OWOA 4G26A 4DBRA 2DZNA 2F37A 4J0UA 4GPKA 5ENSD 5EN5D 2E64A 3APCA 4O1PA 4U8HA 3M4YA 4X8QA 2CZ1B 4LUDA 2ZPIB 3FJ5A 3ZKJA 1IQUA 4L7TA 5BUZA 4N5CA 5ENQD 3QDRB 4M75E 5ARFA 3ER0A 4B93B 4JW1A 1VQ5A 1T0HA 2CDTA 3I55T 3TXNA 1G3SA 2BKKB 4QQGA 2A36A 3RO3A 2M16A 3DSVA 3CCET 3PRZA 3EFSA 5GJVB 2P9IG 1WXUA 1VQKA 3CHRA 3EFOA 3NTKA 3QO3A 1I5OB 3QKYA 3OSSC 2EYQA 3KAEA 2QQRA 3EHMA 3FTYA 1X81A 2J07A 4ZN1A 1Q82U 1NJIU 3LDZA 1INZA 4E47A 1SVXA 4FLBA 3ZGQA 4C0GA 3H0HA 3HXDA 4GY5A 5D7UA 1LVKA 5GMKi 4M75G 2KNBB 3ZEHA 4CT4A 5LJ5e 3EH1A 3URGA 2GRPB 4JEUA 4LNGA 3VRZA 2WMNA 1E8XA 3CHMA 3NHNA 3JRZA 3RIRA 3JCMf 3PVLA 4NQ0A 2LJ3A 4UQZA 1M27C 2WXNA 4M78G 3FTVA 3JCMg 2E65A 4C8QF 3ESKA 4KT0E 2E10A 2I9CA 2NUZA 3B7UX 1OX8A 1UJJA 3CBOA 2XRYA 3FJPA 1TS9A 1XNIA 5CKBA 3AG1E 1B7TA 3ASDA 3JCKC 5ENPD 2VTBA 2DVJA 1UECA 1TOVA 1WJQA 2RK1A 3OS0A 3GYZA 2ZAEA 1Y96A 2ABLA 4O60A 1KIKA 5CKEA 4BE2A 3FTZA 3PVQA 1I07A 3IV0A 3CD6Q 1YJ9A 2X4WA 4J8OA 4ILHB 3PEUB 1K1ZA 3DEOA 4C5GA 1MJ0A 3NAWA 3UKUG 1QVFA 5J08A 4JZYA 1K1AA 2VB6A 4X1VA 2EYZA 3UTMA 1PNJA 3I4GA 4B8CB 1VQ8A 2X51A 1DVPA 4OMPA 1YI2T 1S64A 2MRIA 1R77A 2GRRB 3SBSA 1WHLA 5CK9A 4HVBA 1OULA 5I11A 1VQ6Q 2L6BA 4BI3A 3OYLA 2KE9A 5FQ8A 5KJMA 3RK6A 4BWRA 2KMTA 1JXMA 4ZTFA 2ZGWA 3L82A 3A8MB 3RR6A 2Y0BG 4DEYA 3FTWA 4UUCA 2RFAA 3PUJA 2CREA 2DL5A 1TH7A 4QW2A 3Q75A 3VYGA 4RQIA 3TG4A 2HL3A 4E7LA 4C92B 1KHIA 3CKCA 1A5EA 3C98A 1N94A 3PZ4A 4PJOC 5CQXA 2AJAA 3CIAA 5KYUA 4HKEA 5AJLA 4Q94A 1ZA2B 1PHTA 1VQNQ 3QBYA 5G05C 2NYSA 2PU9B 4Q5WA 4Q69A 5HS0A 1OY3D 3V30A 1LTXA 4TXPA 3OS5A 2RO0A 5L8RE 1AT1B 2E1HA 4PJOE 1Q81R 4DUIA 3C72A 1G3TA 3SZ7A 2HE0A 1NYFA 3HRSA 2ZPBB 1VQ9Q 2RHXA 3UKRG 2COWA 3LLRA 4EMGA 2DL4A 1H0AA 3SI5A 2ROTA 2VGYA 5CKFA 3U23A 4D6WA 1WG0A 3LY7A 4AFUC 3JB9D 3HVEA 1D3BB 3BUAA 5HK3A 1KPSB 2F69A 1OU9A 4M77F 5BXOA 1O75A 2P2CP 3UATA 1BB9A 4NS5A 4KGZB 2E4HA 2DNUA 4BACA 2FRWA 4UWFA 4M7CA 5FZSA 1QVPA 2PVOB 2XK0A 3QDFA 2ED1A 3NOCD 3VKIA 3C95A 4HT8A 2QEXA 4M7DB 2FI7A 2DYRE 1N54A 2RQRA 4GZCA 4C9BB 2E41A 4QQ6A 3MKDA 5DM7R 2I1KA 1VYUA 4ANWA 3ZXSA 1MHNA 3WXXA 4L9PA 2HNIA 1FWZA 5AQ7A 1M1GA 5EIDA 5G2NA 3D9LA 2E6ZA 2F2XA 2DM1A 2RB6A 1OPLA 3AS5A 1QVGA 3FWVA 4B89A 3MJXA 3U66A 5GAMh 1LD7A 3I5PA 3J81E 4JPBW 3CCMA 4BY6C 5IY5E 1BCMA 1XJWB 3QZ9B 3INZA 1AP7A 2KRSA 3TWQA 2QDYB 1UGQB 2GQVA 2JTFA 4N3BA 3FEXA 3RDVA 4QVDA 5ANLA 3PMIA 2EIFA 3TG5A 1H6KA 3PT9A 4GMLA 2KRNA 5C6SA 3I55A 1VYTA 1AVZC 3QAQA 2RI3A 4WWOA 4GMJA 2BE9B 1VQLQ 5DLQE 1N4RA 3GZ2A 2ZGDA 2D9TA 4JUVA 1PG5B 5CBNA 2ZGGA 5FT9A 1BBZA 2LCLA 4LD6A 3V8JA 4J6XA 1M30A 1ARKA 3OYBA 1QQEA 4RG9A 2HO1A 2ZCFB 4QQDA 1OZ3A 1EIFA 4EMKC 1UW4B 3RIBA 4RVBA 3E19A 3SB2A 5J26A 3PZ1A 3EU9A 1UEBA 1SHGA 3X25B 2BF0X 3DSTA 3SFYA 3AS4A 4HB5A 3RAUA 1YITQ 4WNGA 5EDSA 5M9OA 4UWGA 4HA8A 1VQ6T 3ZYMA 2WM9A 3CSTA 4UQXA 2L3QA 1B89A 1VQOQ 4N3CA 3JQ1A 5G04J 1K8AC 4LRZA 1QP2A 3JCMP 4U0SA 3D9KA 4C8QB 2CFZA 2LVMA 2DXBA 1U3DA 1TN8A 1ZSZC 2LO6A 3SQVA 5FU6B 4E7SA 4AOFA 1ZBPA 1EFNA 2M63A 4MDXA 2HSEB 2COZA 1HXIA 1N11A 1E8ZA 3TWXA 1YBYA 4F16A 5JHBA 2CYZB 4LEUA 4OGEA 4E7JA 1K73C 3D9PA 1HU3A 1LNXA 4K5CA 3VS6A 2LAHA 3SFXA 3CXCS 1Y96B 4M75A 1RAHB 1N4SA 3QYHB 3SEMA 3V7CA 3E32A 4DQ2A 1Q7YC 4GLMA 2DZ9A 5LJ3f 4PJNA 1VQ9T 2R5MA 3HPWA 1HS6A 1LD8A 3PREA 5KYWA 5LJ3g 2HZYA 1NZNA 3D9OA 4O6FA 3DB3A 1U1TA 3ZUVB 4M78A 1YCSB 1D1CA 3TWRA 1K9MC 1HJDA 2LQKA 3OYYA 1WYXA 2DD4A 4CRIA 2BZYA 3EG0A 5GAMg 1VQ7Q 3MGBA 2J8SD 1PRLC 5GMKj 2WVIA 1D0XA 2QK0A 2C0IA 1RI9A 3TQ7P 1MX6A 2J49A 4F1PA 3JB9J 4RTTA 5IAYA 3OYJA 1T0JA 3OYKA 1UN8A 2O9SA 2M02A 3Q79A 1JCRA 4TUMA 4M4ZA 2V1QA 3FTUA 5EKQD 4HI8A 1MNDA 2MOWA 4G8LA 3GZSA 2A5UA 1BI3A 1IO6A 5AYFA 1H3ZA 1ZLMA 4II1A 2GF7A 4M75D 3LVQE 2UWJG 1QKXA 1M3BA 3ZL7C 2RHUA 1HH8A 1VA7A 2YWWA 5KYNA 3L54A 4HRMB 2RN8A 1NM7A 2XEHA 4RKUE 4UI9J 1WNLA 1RACB 1S72A 4RUGA 1AHJB 4M78D 1ELRA 2MHKA 4R0KA 5L23A 3CCVQ 4EECA 1RZ4A 1QP3A 4RTUA 2C0MA 4OYSA 4YDOA 4A53A 1HG5A 2QYUA 3B7BA 4Z68A 4K5BA 3CSFA 5LJ5h 4GPMA 4J9GA 4M77B 4AY6A 3CPWS 2X6JA 2A08A 3JAME 2RFMA 1EYHA 2ATCB 3FUDA 1MMGA 1W70A 2XZDG 3PIOA 1VQLT 3I5SA 3DB4A 1UOHA 4G25A 4WNDA 2RNAA 1NLOC 2RKKA 3DLLA 4ANXA 2OTLQ 2OV8A 4XAXB 3LVRE 4A55A 3H0FA 3M0UA 4PKCC 3C3QA 5GAN2 3PE4A 3SGHA 5KH6A 1SSHA 4EZLA 1JU5C 3LX7A 1UJYA 4FYYB 2PM6A 2H8HA 1UDLA 1VDYA 1TNOA 2JUFA 2GBQA 3RU0A 3UDCA 3Q4AB 4N0AA 2RQTA 1DJ7B 3EGUA 1R0BG 4HVWA 1MV0B 1YITT 3OYFA 1Z5SC 4DLOA 2VSNA 5FROA 4TXQA 4BI8B 1SA4A 5EYPF 3CC7Q 1HD3A 4UWLA 1Z3YA 3B7TA 1VQOT 2GW1A 1OWNA 3EJNA 4G23A 1N0QA 4N3AA 4GMRA 1MGQA 4KH1B 2AXVA 3JQ0A 2JS2A 1WFWA 5CECB 3PE0A 1H3HA 4I6GA 4PJOF 4PL6A 3GBQA 4A4KA 2FF4A 4E6HA 1IB8A 4CGVA 3E9GA 1WAO1 2RQUA 4QVZA 3CCJQ 1G3YA 3LGFA 5ENTD 3CD6A 2L89A 2VKNA 4C0ZA 2LZ6B 4KGXB 2P58C 4MDWA 1M2VA 2DD5A 4XI0A 3L17A 1BI2A 3OXFA 4LERA 5KCOA 3QXEB 3KS2A 2DXUA 2DWZA 2VGNA 1ZHIA 1B3QA 2JJ9A 4G24A 3WG7E 3ML9A 2YDLA 4OB1B 1VQ6A 1AEYA 1OCRE 4BSZB 4HOSA 2EYXA 2LT1A 4JD2G 2Z0WA 2LRQA 5CO7A 1FMVA 4F7UG 1UGSB 1H8KA 1Q82C 3CMEQ 1NJIC 4I9CA 3NZSA 3M53A 5DY9A 3BG0B 2F8YA 4L23A 4Z89A 1VQ7T 3D7SB 2HYZA 2BUGA 3X2QE 1G8XA 1MUZA 1BD8A 3PDNA 2FO0A 2DERA 2WXMA 5HKCA 4XK8E 2WXFA 1G3NB 2F5TX 4BDYA 4JS5A 1VQ5T 2JZ2A 3HL8A 1VQNA 2IG0A 1GFDA 1X27A 1NLPC 5LJ5g 3TL5A 1VQKT 4CDRA 5GAN4 3EIQC 3MKQB 2VC8A 4JHRA 1SRMA 4EDUA 2LUHA 1TJFA 2I6HA 1ZBXA 3VRYA 1VIFA 1IXDA 2UY1A 2DLPA 1K8AU 2DX1A 4BY6A 2KYMA 3J5QB 4FU6A 4XQ3A 4JL0A 3O4ZA 1BU1A 1W6XA 4FSXA 4UI9C 5B1BE 2FZGB 5EG2A 3FH7A 1E6HA 3MPUB 4N4HA 5HKPA 2X3WD 2D8JA 2D0NA 2FEIA 2XMFA 4IUQA 1MMDA 4KULA 3CCVT 3ZW3A 1K73U 4P5NA 4YDWA 2LJ0A 4J8EA 4ABNA 3UIPC 4ME2A 4LDVA 3FUNA 3G2VA 1T3SA 1KQ1A 4J8SA 3H8ZA 5D6XA 4A1SA 2X6HA 4RG8A 2EQMA 1Q7YU 3EH2A 2B8AA 2DIQA 1FYNA 4U0UA 1UFFA 1WHGA 3GLXA 4EMKA 1KT0A 1WQWA 3G4SQ 3QJ6A 4BT8A 3KEZA 1J3TA 1K9MU 3CVQA 4N39A 2XG8D 5A0LA 3M55A 4IUUA 2HQEA 3NF1A 2RJEA 3CC2Q 2K3BA 4DI4A 2A37A 1E7UA 2DAQA 5ENOD 3O48A 4TV3A 3ZHEA 5HCKA 2AT1B 2OJ2A 5GAOp 2ETAA 3ZFJA 4GYWA 3CKBA 5GAOm 2DKGA 3REAB 1I0CA 1ZSZA 5HI7A 4PS8A 4C92F 5EX3A 1MMAA 2X9HA 3MEWA 1TUCA 4BX8A 2M0YA 4OB0B 4OAUC 3ESLA 1RAEB 2RHIA 3ZBDA 1XGWA 2HR2A 4FJZA 4L1BA 2KVQG 1QVGS 2AWIA 3TGOA 1N0RA 3CCJT 1M1KR 2XZTG 2YRDA 1X6GA 2JABA 2V8KA 4RCBA 1HYOA 5ENRD 1JRIA 5G55A 4JJCA 4OMOA 2K7AA 1NFIE 3S7BA 3RRUA 5JJ6A 2YRVA 3TAXA 4UI9K 2EQKA 4M77G 1NG2A 4OMQA 4X9DA 2KT8A 3AU4A 2QQ9A 3I5RA 1FXXA 1UG3A 3UM2A 3PZ3A 2ZPFB 1MYOA 3VLEA 1YITA 2EQIA 4RTVA 2E3IA 2LQNA 3P8DA 2ZIRA 2NUPB 4FSSA 1LPLA 1NI1A 3PNTB 4ACLA 5CHEE 1QZ2A 1VQOA 3CLJA 1D1BA 1KFZA 4KUDK 1ABOA 2KBXA 1YCYA 1QCOA 4HRNA 4J9DA 4BESA 3PIPA 1BI0A 3JB9H 2X6KA 2G3RA 4FIBA 3EUVA 1VUBA 2K5IA 3SHFA 3QJYA 3MEAA 3CQCB 5BPPA 3EG3A 7AT1B 4PJOB 4Q96A 2X4YA 3C4SA 5G05J 2V8JA 1N5ZA 1SQMA 3P8HA 4NOYA 1K1BA 2JT4A 2RI2A 4M7AG 3CV0A 5A23A 2SEMA 2PQRA 4HCCA 5KYYA 1N95A 1YA0A 3CCQA 4EHMA 1GBRA 2GRQB 4BEPA 4NL3A 4PFOA 1D09B 4BD3A 3RO2A 4M75C 5D66A 1YP5A 3CMAQ 4KMOA 2GFUA 4TVRA 1AWOA 2XEEA 5J90A 5KCHA 2J09A 4OB3B 3CCMT 1S72Q 4GTMA 4XE0A 4GYOA 4XX5A 3AT1B 4FLHA 3QZ5B 1SEMA 2KZTA 3NTIA 1VQ7A 2FULA 4BTBA 5LCWC 4M78C 3HIZA 2L6JA 5AYWD 4OVAA 2BEDA 3SBTB 5CEAA 3T5XA 4LNPA 3JV3A 1KQSP 4G11A 3LCAA 3QIIA 2I2LA 3G4ST 3KSLA 5KNHD 1KD1C 3OBWA 4M78E 2RQVA 2C0LA 3H0IA 4MZPA 4C0FA 3DXMG 2FVUA 4AFZC 3FU3A 4CZ2D 3C5RA 1I5LA 2O2OA 4PH4B 1BCOA 4I2WA 3LPZA 4KZ0A 2BTTA 8ATCB 2LSUA 2EQUA 4JPSA 3DSUA 3Q1JA 2IJGX 4N2SA 2DRKA 3VS4A 1JJ2P 3HXCA 5GANf 3V8KA 5FWQA 2ETCA 2HQXA 2IONA 2GRLA 5GANg 4F7UA 3UT4A 4QKUA 3UINC 2MCNA 2CHZA 3CCVA 4R7LA 4U8VD 2QC9A 1R8OB 3G7ZA 4H7XA 4XEIG 2RQWA 1LF8A 4Z02A 4VUBA 1TU0B 3FUHA 4GZ5A 4UQYA 3BG1B 1E6GA 2CP2A 5GAOq 1MX2A 3EDTB 4ILGA 2FPDA 2P0KA 2X3XD 1PCXA 1M2OA 2D8HA 5M72A 3QC1A 4HS2A 2COYA 1JQQA 3BY7A 3FEYA 4IULA 1Z9ZA 2R58A 2OTLA 3U9WA 3HXFA 4YVQC 2O31A 3EGDA 3SD4A 3LWIA 1W2BP 4LSZE 4JJBA 1VQPA 4IIOA 1IXVA 4KXKB 4AVXA 3LYAA 1TEZA 2KR3A 5KNGA 2RHZA 4LUNU 2HAXA 1PSFA 2EPDA 4J8YA 3HHMA 4DBHA 3O8VA 2ED0A 1O1RA 3EG9A 1YJWA 2H3JA 4HNAD 1YWOA 3F6QA 4FM4B 1FVHA 3CC7A 1I1JA 1IZ6A 4FHKA 1MV3A 3DSSA 2ENMA 3M58A 1B07A 2NSZA 3PTAA 4FYVB 4N0AC 3VV0A 1D9SA 2CT4A 1AZGB 2ESWA 3RBBB 4MBGA 2V1RA 3FHEA 3OYDA 2LMJA 2VSYA 3L16A 3VJPA 3CK7A 3G2SA 3JB9F 1UB4A 2DBKA 3UIOC 3EHQA 1WHJA 3O5ZA 1IHWA 2F1LA 1U2VG 1S1NA 1NL4A 2XKOC 2IU1A 2H6HA 3IKOB 1ZSZB 2DIGA 4RMOA 4CC4B 4JXTA 3CCJA 4L59A 2DK3A 3M9QA 4I2ZA 2QYJA 4BUGA 4DI3A 1ZUKA 1TYQG 2ZZDA 3F70A 3H9NA 5FU7C 5JMND 3ZU7B 5EYLA 2OEVA 4JZ4A 3HG0D 1UN9A 3TCJA 1UJKA 3FU6A 3HYMB 3CCRQ 5A6CA 2IY0C 4XTYA 4OMMA 2HMAA 3X26B 4LDWA 4TRQA 3AG3E 3IHVA 1BIBA 3CMAT 1S72T 4FJYA 4OVUA 5FZRA 1I81A 1WHHA 3CMEA 4KGVB 5FWCA 1TR4A 1FMWA 3VLDA 1Z3XA 1F1BB 2JVVA 3AG4E 2JNGA 1NA3A 5T3RA 2CGHA 2FZKB 3QDNA 5AQBA 1QCNA 4JRIA 2EQXA 3ISMC 2IVWA 1H2UA 2DPPB 4UWHA 4KUIA 3PH0C 2WXHA 2DTOA 2YLCA 4AFQC 4IUTA 2DMOA 3G71Q 3B7RL 2DYSE 5I21A 2KDSA 1SZAA 2XGMA 2NUTB 3DRAA 2GTOA 2K3XA 1D0YA 2GFAA 5CKHA 3AAAC 3PS6A 4EBAA 3EGXB 1BYMA 1YIJQ 1LOJA 1QWEA 3M0SA 2L3RA 3FU0A 2VJ8A 1KC8C 2XDBA 2P0QA 3EFRA 2OVFA 1YJNQ 3RKYA 4OB2B 5CCAA 2VYIA 1KSWA 2GTJA 4GBQA 4AV7A 3CCSQ 1YN8A 1HK9A 3QK0A 4C5HA 5CVIA 3CVPA 2AKKA 2WB2A 1OPKA 2XIDA 2ZPHB 4Y92A 1OWLA 2VSOE 2GRNB 2K2MA 3J7AF 1TNYA 4TXRA 3JUEA 4R55A 4FW1A 2EJ9A 3P2BA 1M3CA 4DOVA 3UX4A 4J7IA 3G4SA 2P9NG 4WNEA 1UE9A 1GRIA 4M7AA 2F0YA 2XCBA 1OUVA 2L3SA 3CD6T 3DPDA 4DPRA 3ZVVA 2LT4A 3EFOB 3MZLB 2RJCA 3S6WA 5KJNA 2WXJA 4E7KA 3A8LB 3CC2A 1O1SA 4YTLA 4AJWA 3VS7A 3P1UA 2FO1E 1BPOA 3W9GA 3E37A 3RMQA 2XI9A 3CCQQ 3BEEA 3KD7A 4LCTA 2FPEA 3FDRA 2YXYA 2KSSA 2O9VA 4RTZA 1KD1U 2RG8A 2WXQA 4A3VA 4X9CA 2YHEA 3JCMc 1N4PA 2CH4A 1QNFA 2GNCA 3I35A 1YFNA 3FU5A 4GTRA 4U04A 3VS3A 3OW2S 5D6WA 3FH5A 3FY4A 4I6JA 3T8KA 3FUMA 4GZ3A 1E96B 4F7AA 2OVBA 2JLBA 4JLIA 4QQIA 4YNDA 2PZIA 5CERB 2ROLA 3QHSA 4AT1B 1V55E 4FULA 3HKSA 3ULQA 3L2WA 1FMKA 3M5AA 3D9JA 3MO8A 2CSIA 4M7AD 4KH0B 1VQNT 2EIJE 4BE1A 1KQ2A 3CCUA 1SZ9A 2J08A 5A7DB 2VTBB 4A4FA 5BV1A 2ZXWE 2W10A 2DO3A 3QOUA 1U5SA 4IUVA 5D6YA 3HRAA 1WGSA 4M75F 2E70A 2LQWA 4BI4A 4ZHBA 3ONLA 2D6FA 1UHFA 4HT9A 1H641 2E12A 4AP2A 1WDXA 1C6VX 4GTOA 3S7JA 2YSQA 1ELWA 2QZAA 1B34A 2E0IA 4BETA 3EG9B 5GAMf 1NP7A 4M78F 2EJFA 2EYYA 1D8DA 5FRMA 1VQ4Q 3SWNC 3WVDB 1OT8A 2KYBA 2ZPGB 3TREA 2RD0A 3R7RA 4DX5D 3S2AA 4GTQA 1X6BA 2KCKA 1Z6TA 1QVGP 1LCKA 8AT1B 3A5ZB 3EIJA 1W3BA 3MEUA 3BW1A 4ELZC 2HKQB 4WCIA 5KYUB 5CRUA 4A1GA 3UWNA 3UPUA 1RI0A 3ZYKA 5I2MA 4C92G 1YIJT 3ASGA 3OB9A 3IBEA 3Q7AA 1E7VA 5T8IA 5CIUA 4L2LA 3V8LA 2CHXA 1W1FA 3FUJA 2X4XA 3CMAA 1YJNT 2MWPA 3BU8A 1O5MA 1Q86C 3DBSA 2J7IA 2I0NA 1NYGA 2QDLA 5A2QE 3ZYQA 4CCAA 2LQ8A 3CCST 1BIAA 4LG6A 5LL6S 3OMCA 3G2UA 4CT0A 5ITZF 2IIMA 3HFNA 3PUKA 4JB8P 2E5QA 5LJ3j 3CQGB 1E90A 4BFRA 4JHKA 2KCLA 2PL2A 1E7OA 4FL6A 1NA0A 2EGAA 5BW8C 2XPYA 3HVEB 2MIOA 4M7DE 2DEUA 5GMKl 2EQJA 1N8RC 1TNUA 2XS1A 3RESA 2WXOA 2KXDA 5EX0A 3MX3A 9ATCB 2OAUA 2FYKA 2K57A 1L5JA 2WSFE 1ZU2A 3I56Q 2A4ZA 2V26A 2EJGA 5HK0A 4C0MA 3KUFA 2LAIA 1VQPQ 2YUNA 2DIWA 1M90C 3L2VA 4NRHB 5AQAA 1Y07A 3RJVA 3NGPA 3E34A 3B95A 1AD5A 4PJMA 4I6EA 3E9FA 3SFMA 3VU3C 2HBPA 2WQ7A 1SG5A 4M7DG 3QG1A 1KG1A 3CCQT 1YJWQ 3QWVA 3A8OB 4HOTA 4RLYA 4A4EA 4ME7A 2R05A 3X20B 4PNOA 4WNFA 2R5AA 4H7YA 3ASFA 4KYOB 4HCBA 3M56A 1PD1A 2PTKA 4FYWB 3UM1A 3CGHA 3PNLB 4ILIA 3OYAA 1D0ZA 3BDLA 4GTVA 2YRCA 1WZOA 3JXIA 1KC8U 3ZXPA 2VGXA 3L08A 3GZ1A 5JHAA 3CC4Q 4NL2A 2CH4W 4FHJA 3WVEB 2HQHA 2X3MA 4F7UE 2JTEA 4Y91A 4APFA 1TN6A 5GAOl 4OMLA 4DBFA 2CZ6B 2GCXA 2XPZA 2X6FA 5KWDA 3P8BB 3W9FA 4IURA 3CVWA 3CCEQ 4U96D 1VIEA 3VS0A 2O4XA 1X6OA 1PC2A 1DNPA 4MMLA 3ULYA 1V76A 4L5GA 3A8HB 4KT6B 4XTZA 3HXBA 3X28B 1U1SA 3NQPA 3MKRA 5HQ8A 3UI2A 4A4HA 1LJOA 2VWFA 2X6IA 3JCMQ 4XIFA 2M51A 3META 2IFUA 3EG1A 4XZ4A 1QWFA 3L2QA 3CVXA 2BUDA 3HRTA 1QVFS 4LDYA 5D0QD 5E75A 2P9LG 1RADB 4HLEA 1ZB1A 3FULA 4GA2A 2KROA 1T3LA 3L42A 5IHNA 5LJ5f 4B94A 3LXUX 3PNWC 3S7FA 2MYSA 3GP8A 4WWNA 3UF4A 2QASA 4Y28E 1BLXB 2C0OA 2VASA 4AG2C 1K8AR 3ZRHA 2RI5A 4GCOA 4HFGA 4C8QG 4CI0C 2XRZA 2P4TA 2XGOA 3VLFA 4GB9A 2V5QC 3TJPA 1IGUA 2EILE 3CCRA 2DJZA 2DYIA 2OTJQ 2JN0A 4LE9A 5GMKm 5AAOA 5GAOn 2YHCA 1FPPA 3EAEA 4GYYA 3C3OA 3TXMA 3HHTB 4M75B 1O9SA 2XHCA 1K8KG 1PM3A 1K73R 5GMKe 5LFAA 1X2QA 3ASKA 3G2TA 2OCCE 4HOUA 4EIKA 2CG2A 2LC4A 4JLGA 3ASOE 3DSWA 4DEXA 2RD1A 3UT1A 3FRNA 5KYWB 2K9GA 4UC4A 3ULRB 2GROB 4ZFHA 2YLBA 5LCWJ 1Q7YR 1BU9A 3IQLA 4M78B 4QVCA 3WXMB 1IRXA 3SFZA 4E7ZA 6AT1B 2WXLA 3H41A 3JCMb 1RL2A 3R7QA 2LX9A 4U07A 5D0OD 3D3MA 3G71A 2X4JA 4E7HA 4B0ZA 3ASHA 3ZYLA 4Y6WA 2R02A 2JW4A 1K9MR 2LSVA 3ONKA 4A3TA 2OTLT 4GZDA 2DTIA 3VS1A 3DPYA 1X5BA 4RG6A 3I56T 4LNBA 4JRQA 4J7FA 4FT4A 3Q7FA 1QMCA 2JM8A 1YIJA 2DTHA 4PDXA 4C48B 1VQPT 3E30A 4I17A 3Q47B 5LJ5j 3JB9G 4K5AB 1FT1A 4M77C 4DJAA 1K76A 4J9FA 2AXUA 1YJNA 3ABLE 1KHCA 5ENNA 1XQHA 2DRMA 2MK5A 3JUIA 4PJLA 5LJ3e 4BERA 1WJSA 3CCSA 4A4GA 1YJWT 4WUYA 1ACMB 3CC7T 1R0CB 2GRMA 4JA7A 3RKVA 1GFCA 4M77E 1AOJA 5T4YA 4CDNA 3ZFWA 2Q7FA 2WMOA 1JPLA 2JTMA 3MYVA 5CMYA 2HKNA 1KQSA 3M54A 2HM8A 4GZ6A 1QW1A 2K5LA 2ZPEB 2LJ1A 2WQHA 4XKCA 1PC0A 3CC4T 4MS6A 2ONDA 3CBPA 5AJDA 1S70B 1Q86U 2GQIA 5FQ4A 2D1XA 3LH0A 1NPRA 2XEVA 4APOA 4FP7A 3TWSA 1ZSGA 3UMVA 4I1MA 3R9MA 1TWBA 2A28A 2BE7D 3LW5E 4LDUA 3CCUQ 1JJ2A 4AFSC 2AHJB 4AMCA 2DVWA 3I4RB 2QI2A 4M7AC 1MMNA 1OWMA 2F2WA 1Q81C 1TXQA 3VUZA 1EZZB 2QGGA 1G83A 3NB2A 2RJFA 3VUBA 5KE2A 2BTDA 4CYMD 1XNFA 3UUXA 4IUPA 1N8RU 3TWUA 1DC2A 2C06A 3M59A 2VXEA 2CT3A 3CHOA 4EZJA 1SSFA 3PGGA 3SWNA 1MQSA 4KVMA 3OYCA 4M7AE 5FLXE 1EX4A 4JEHA 4ORZA 3CMET 3JCMd 1GCQA 1G2BA 2XICA 1M90U 1JO8A 2DL7A 2CUBA 5GAN3 3HSBA 4F1SA 2Y3AA 2IEJA 1TJCA 1ZUUA 4A54A 5AARA 3TEEA 5CR2A 1HF8A 1AWCB 2DL8A 2A0FB 2XDDA 1W2BA 4WWPA 4HXJA 1V54E 5CCLA 3CVUA 1U8RA 1SA5A 2EWNA 4O6JA 2CP3A 2ILRA 3IXEA 3LJ3A 4PS3A 1HSQA 1OQKA 4N2QA 2HL5C 2JM9A 3R6NA 2L5QA 2Y90A 5IHKA 5FU7B 3GPLA 4GA0A 3URZA 5IXBA 4K0RA 2DBMA 4L2YA 2Y4XA 1WHMA 2L3PA 4M7DA 4I1AA 2AZVA 2B0OE 4Y6CA 3TWWA 1OWPA 3FUFA 1H2TC 1M2VB 4BTAA 2A7YA 2I1JA 3PFSA 3DWLG 4MLPA 3A1PA 4I1OB 2PUKB 2JXBA 4R56A 2VGEA 2BIVA 1C1AA 1OX9A 3SO8A 3S3MA 3ZNGA 3LEWA 2MMPA 4HRLA 2WXIA 1VQ4A 4ZGDB 3FTSA 4EPZA 2J6OA 2PUOB 4F6RD 2B6CA 2KQWA 2YUOA 2MAMA 4MKTA 3HXEA 2RM4A 5KBAA 3JCMV 3OMGA 2VVKA 3OW2P 5FRNA 4LDXA 1OI1A 4JZ3A 2LCSA 2E3HA 1MX4A 3D9MA 4MZTA 4FT2A 3MEVA 3OBYA 1Q82R 1NJIR 2KM4A 2WXPA 3RKXA 5LP0A 1G5VA 4V3IA 1YWPA 3QB2A 3LWHA 1NPPA 2EBPA 1JEGA 4FADA 4L6V5 3MCAB 4M7DD 1BK2A 4IYPA 4YDYA 5B1AE 2OAWA 3CXCP 1FT2A 4F53A 3CC2T 2NWMA 3M57A 3HDXA 3PZ2A 3S3NA 3OYEA 4HOQA 2UY1B 5BXUA 1ZUYA 4BY6B 4OP0A 1AWWA 3LJNA 4MRUA 4F7UF 3M0RA 1X01A 2BKDN 1Y8MA 5FTPA 3V2OA 3PMTA 2DETA 4C5EA 3B7SA 3MV3B 3ML8A 3TVTA 5GAN8 2QTVA 2P9PG 5AQ9A 3QNKA 1WY6A 3MP8A 3IHYA 3QARA 4F3VA 1JWFA 1FX7A 1IHVA 2JMAA 3OAWA 4JDSA 3FP3A 1OCZE 2YQ8A 4J5YA 4J9BA 1TN7A 3VTYA 1TNZA 4UWKA 4D10C 5EC7A 1TSFA 4ZN3A 3FUEA 1K0SA 1SW6A 4DOWA 5KYXA 1UTIA 3I56A 2NYJA 3OS1A 1E8WA 3KXTA 1TNBA 4N4IA 4C8QA 2K2VA 2JEKA 3JYSA 4C0DC 1RAFB 3FC3A 3TWVA 4ELYC 4G1TA 2QGFB 3CCUT 2XU8A 4EMKB 2L9BA 2XHEA 2HD0A 5FWBA 4F14A 3Q5MA 2XS8A 1JBMA 2XCCA 1MHQA 2KC7A 1VOMA 1K3ZD 2JOYA 2KCVA 1WXBA 4DX7D 3NZUA 2K5FA 1WI7A 2QG9B 3QPHA 2I2OA 4D8DA 2CUDA 2P84A 2RK2A 1M1FA 2KBTA 5GAOr 2Y4YA 1EDUA 3FUIA 4RTXA 3CCLA 5GANj 4I9EA 2AZSA 3ZHEB 3HP9A 4DX1A 3PE3A 4XTXA 1OV3A 2FBNA 5EIBE 2IO3C 4PLLA 5CBOA 3CC4A 5KJLA 3MCXA 3CPWP 5ANRA 2F5KA 1E8YA 1IQRA 2L2PA 2J6KA 4LXCA 5FQ6A 3ABME 4CGWA 1OOTA 2CZ7B 4C8QD 1RUWA 4GTSA 3OXGA 3GOXA 3AG2E 1IKND 1RAAB 3NBNB 4CDMA 2DXTA 1JUQA 2FO7A 1TUDA 2EGCA 3CBMA 3QWXX 2IF4A 2KY9A 4AY5A 1QYMA 1V29B 1A0NB 3M4GA 3CCEA 3C3RA 1N52A 2P9UG 3Q49B 3R9AB 4KBMB 2R17C 2O01E 3SHWA 1WDYA 1A17A 2K4YA 5H7PA 3QSUA 1TTHB 3RKWA 5BT1A 1PD0A 1WJRA 2WXKA 3LY8A 4PLIA 1KZPA 2EINE 2DJQA 2M1HA 2FPFA 4EQFA 4CRWA 3VS5A 3G6EA 4B6MA 2EKOA 3ULEG 4RTYA 2PZ1A 4PUCA 2WACA 2X38A 3SWNB 2L0IA 5GMKh 2KAFA 2CHWA 3FDHA 1UGVA 1YHQQ 1HG2A 3CK8A 3CPFA 1Q81U 3VS2A 1KT1A 2KK4A 1Z9QA 5J3BA 4U0ZA 1M4ZA 2IOLA 4GCNA 2WPVA 3GF5A 3NPFA 4DBQA 3RRMB 3MHXA 4M77A 5CCMA 5IHIA 3EG2A 3M0PA 1QQJA 1VYVA 2XPIA 3CQTA 1Y6IA 4HCKA 3VYHB 2YT6A 2EAYA 2OTJA 5HRYA 4F04B 1TUGB 2F8XK 4M3OA 2EIKE 2J06A 2LTOA 3L22A 5GAN6 4PJOG 1X69A 4ANUA 3E4BA 3NTHA 1IHGA 4ZTJA 3SD5A 1HO8A 1KZOA 3UPVA 5KYYB 5LJ3d 2C2LA 2EVRA 3J80E 4ANJA 4E2FB 4GAAA 1OU8A 4N5QA 4AG1C 5LJ3h 4GTPA 1P92A 3LGLA 5GAMd 5GJWB 2VXFA 4EZKA 4MZMA 2CSQA 2QA4Q 3AU5A 2KZTB 1AZEA 2LNHB 3U4TA 1QVFP 3L6AA 1BI8B 3ENEA 3JB9I 3C12A 2L0TB 3HTRA 4M77D 4ATZD 5CQYA 3U3WA 4BDZA 4M7AF 3GNFB 3S7DA 1N9AA 2AW6A 2KT1A 4XTWA 3T9NA 1M8MA 2VUBA 4BT9A 2VV5A 2PM7A 2M0OA 3A8GB 2WXRA 5GAN5 4HVVA 2L0AA 4FYXB 2DFUA 3NMZC 1PKTA 1D8EA 2LNVA 2YUPA 5LOZA 3DKMA 2V4LA 3AHUA 4J6YA 3FLGA 3AJIA 2Y4TA 1KD1R 4EPCA 1AWXA 2Y69E 3V2XA 2QQSA 3KBGA 3LYIA 2XQ0A 2P9KG 3MV2B 4ATOA 3LH5A 1CKBA 2E6NA 1S63A 1ABQA 3L1AA 5FIOA 3APFA 1RLPC 4F7UB 2IQCA 4LN2A 4ACKA 1PKSA 2RPNA 3ZEFA 2QQBA 3I9QA 4LD9K 4ESRA 4AEZC 2NLUA 2EIME 2DL3A 2YINA 2CS7A 2W0ZA 4N4GA 1ZBJA 5C0MA 3OYHA 3J5PA 3FH8A 3T9KA 2DE0X 1WIEA 1M5Q1 4XU1A 3CHSA 3D9IA 3Q15A 4XI9A 2DCPA 4B8AA 3MEKA 2YHTA 3UM0A 2AXZA 2DEQA 2WSEE 3C0CA 3RNJA 4WTOB 5AIJA 1M9SA 2H6IA 3QWPA 3KEAA 5FZQA 3PEVB 2RH2A 4RCCA 1VQMQ 5KYXB 2WSCE 3EGDB 3CEQA 1W4SA 1ZA1B 2PVGB 3OYNA 4C92C 3CCRT 4PFZA 1KQSS 1H19A 1NZ9A 1U06A 4AM9A 1WQ7A 4J9CA 5GANe 3MKQA 5I22A 2R57A 2KXPC 4XU3A 1V1CA 2E2EA 2Y1LE 3G2WA 3UQ3A 1C0MA 1K0XA 4TUUA 3UT8A 3JCMe 2P4RA 4JJNK 3CR3A 4K03A 2RHYA 4Z8AA 4C92E 3RERA 1IGQA 1JJ2S 2FEZA 3B13A 4KZCA 1WA7A 1ZX6A 1NEBA 1WPYA 4Z88A 3Q78A 2EFIA 3OYMA 1NE8A 2JS0A 3E2UA 3JCMW 3EHNA 1PAQA 2HBWA 1YHQT 2EKHA 3OA6A 2O88A 4PK4A 1GCQC 3QJZA 1YI2A 2CP6A 3UA7A 1SRLA 2M9UA 4JA9A 2FB7A 3G71T 2SRCA 4JVSA 1X75C 4XTUA 4ZGEB 3JCMX 3ZPJA 4CC2A 4OAVB 1UUEA 3N71A 1D1AA 2NC9A 2DF6A 1WLPB 3JSCA 2DXCA 1GBQA 1HX8A 3I3NA 4HCZA 5AENA 3MA5A 5B3SE 1XOVA 1VQ5Q 2V8IA 2H6FA 1W2BS 1WHKA 1HE8A 2QXFA 4M7DC 3SY2A 5CEDB 3A98A 5AT1B 3OS2A 3V7RA 1VQKQ 2ETBA 4IRUA 1N27A 4E7IA 4YDEA 2LXMA 1CSKA 1XTDA 5DLOA 3JCMJ 3OSVA 3BDUA 2QA4T 1FCHA 2ZISA 4OMFB 5GAMj 1N9RA 2H3EB 2KATA 4U8YD 1RLQC 1IREB 1M1KC 5LJ5d 3RSEG 5JA4D 1SF9A 1JXOA 2BKGA 4KVOA 4J9HA 2YNQA 4BE0A 4PJJA 1HZ4A 2MYOA 2V5FA 4FC8A 4HXIA 3VTXA 2VYTA 2FL7A 3UXGA 4U95D 3LS8A 5DIZA 3NFCA 5I2SA 1N9SA 2P0PA 4ZGJB 2DYBA 1JCSA 3OTNA 3FFLA 4V2SA 2J6FA 3CCLQ 5CKDA 3EHRA 4FU3A 4J8DA 4YVOA 1YJ9Q 5JJ7A 1KC8R 2PNIA 2NUPA 3X24B 2B86A 3RUXA 2R59A 1U3OA 2CP7A 1X43A 1EF1C 4LNUD 2MOXA 2RJDA 2NXPA 4BSXA 1NBEB 1O1TA 4KBQA 3FB9A 1P5QA 1KLXA 2K3YA 4OGCA 1WX6A 4AIFA 2XGSA 4JHJA 2DZOA 2KI7A 4J7WA 2Y4UA 1VQ8Q 4G2VA 4O1OA 3GNGA 2J9QA 3CVLA 2AIRB 2MPXC 4O5VA 3OQ5A 2QTXA 3ABKE 5G04C 2LX7A 4PJOA 1VQMT 5C2YA 5FQ7A 1GL5A 3LKUA 4M7AB 3G1JA 4C8QC 1JWGA 3CHQA 4K11A 2R5SA 5EILA 1BI1A 5FU6C 2J4DA
chains in the Genus database with same CATH topology
3THKA 3RBBB 2CT3A 2V1RA 2LMJA 2DBKA 3O5ZA 3EHQA 1EFNA 4ORZA 3TSZA 1GCQA 1S1NA 1G2BA 1N11A 1JO8A 2CUBA 2DL7A 3TWXA 1ZUUA 3DEPA 3Q9UC 4CC4B 4F16A 2EW3A 5AARA 1AWCB 2DL8A 2G6FX 2KGTA 1Y0MA 2QYJA 3V31A 4K5CA 1UG1A 2FRYA 3VS6A 4HXJA 1ZUKA 2FG0A 1KJWA 5JMND 3ZU7B 4RTWA 5EYLA 2GGRA 3SEMA 3IXEA 4GLMA 3JXJA 1HSQA 2JM9A 5FW9A 3R6NA 5IXFA 4JZ4A 3D9HA 2V4HC 3HG0D 4NIKA 5IHKA 1CKAA 5IXBA 2DBMA 4OMMA 3ZUVB 2L3PA 2AZVA 2B0OE 1YCSB 3TWWA 3TWRA 4OMNA 1WXTA 1OEBA 1HJDA 1M3AA 1WYXA 2BZYA 3EG0A 5FWCA 1TR4A 2JXBA 2VGEA 2PNNA 1SPKA 2J8SD 1PRLC 2C0IA 3SO8A 1RI9A 1MX6A 3ZNGA 4F1PA 2AK5A 4HRLA 4RTTA 1IHBA 3M0QA 1T0JA 3KFVA 3UA6A 2O9SA 2J6OA 4TUMA 4M4ZA 4F6RD 5AQBA 2V1QA 4HI8A 2JMCA 2YUOA 4G8LA 5KBAA 4LUEA 4AFQC 1IO6A 4J9IA 1ZLMA 5AN8A 1SHFA 2DMOA 2LP5A 2VVKA 1YYHA 4JZ3A 2LCSA 1QKXA 1MX4A 1M3BA 3ZL7C 4DX6D 1Y57A 2GTOA 2HEQA 3REBB 3AAAC 1VA7A 1QLYA 4G8KA 1PRMC 4HRMB 1QWEA 2RN8A 3M0SA 1NM7A 2XEHA 1YWPA 3TWTA 2K6DA 1JEGA 2EBPA 2YUQA 4RUGA 2HDAA 1BK2A 4R0KA 5L23A 4YDYA 4HI9A 2OAWA 1BI7B 1KSWA 2GTJA 4RTUA 4GBQA 2DILA 2NWMA 1H92A 1YN8A 2DA9A 3B7BA 4Z68A 4JJDA 4K5BA 2OI3A 5BXUA 1ZUYA 2AKKA 2A5EA 4GPMA 4J9GA 1OPKA 2EGEA 1AWWA 3LJNA 4Y92A 1QKWA 2RF0A 2A08A 2K2MA 3M0RA 2RFMA 1W70A 2XZDG 3V2OA 3JUEA 3I5SA 1UOHA 3TVTA 2EYWA 1M3CA 2RNAA 1NLOC 5AQ9A 2C0TA 1X2KA 3H0FA 2JMAA 3M0UA 1UE9A 4J9BA 1GRIA 1SSHA 2KXCA 5EC7A 1JU5C 2L3SA 1UJYA 1K0SA 1SW6A 1UTIA 2H8HA 2NYJA 1PWTA 1UDLA 2GBQA 3TWVA 2RQTA 2KRMA 3EGUA 2BZXA 4HVWA 5FWBA 1MV0B 3VS7A 4F14A 2FO1E 1K3ZD 5EYPF 3W9GA 1HD3A 1WXBA 2FPEA 4QFVA 4DX7D 1WI7A 2O9VA 1YNZA 4D8DA 4RTZA 4GMRA 1N0QA 4HQDA 2CUDA 3QWYA 3NOGD 2JS2A 2KBTA 1WFWA 5CECB 2CH4A 3PE0A 1H3HA 1AWJA 3I35A 2GNCA 4RTXA 2XENA 3GBQA 3VS3A 2RMOA 3T8KA 2HCKA 2AZSA 2RQUA 4DX1A 4QT7A 3V79K 2E5KA 5ENTD 1OV3A 5EIBE 2BZ8A 4QQIA 2VKNA 5CERB 2ROLA 4CC7A 2LZ6B 5CBOA 1FMKA 2CSIA 4HBDA 2L2PA 2J6KA 5ECAA 1OOTA 1UJ0A 1RUWA 2W10A 2DWZA 3Q9NC 1U5SA 4J9EA 3HRAA 1B3QA 3M0TA 1IKND 3NBNB 2ECZA 2EGCA 2YDLA 3QWXX 1TUDA 4IIMA 1YMPA 1AEYA 1QYMA 4BSZB 1QCFA 2EYXA 4KRTA 1A0NB 4DRXE 2LQWA 4ZNXA 4D8KA 5FINA 1K9AA 4ZHBA 1NEGA 3SHWA 1WDYA 1UHFA 1H8KA 1WDXA 5IH2A 2F2VA 2YSQA 4CC3A 2K79A 1GCPA 4BETA 2F8YA 4HVUA 4Z89A 2AKLA 2DJQA 2EYYA 1MUZA 1BD8A 2FPFA 2FO0A 4E6RA 1G3NB 2J05A 3VS5A 4RTYA 1DCQA 4DX2A 2PZ1A 1GFDA 2HSPA 1OT8A 1X27A 2KYBA 1NLPC 4DX5D 4A63B 1TG0A 4F17A 1UGVA 4HLLA 1SRMA 1X6BA 3TSWA 3VS2A 1LCKA 1Z9QA 3VRYA 2KEAA 1UHCA 2DLPA 2DX1A 2KYMA 3NPFA 4WCIA 3J5QB 2DZNA 2F37A 3EG2A 1BU1A 1VYVA 1W6XA 3M0PA 5ENSD 5IHIA 5EN5D 3CQTA 4HCKA 4O1PA 2YT6A 5HRYA 1W1FA 1E6HA 2F8XK 5HKPA 4LUDA 2X3WD 2J06A 2D8JA 3FJ5A 3ZKJA 2D0NA 2FEIA 1X69A 2XMFA 5ENQD 2J7IA 2I0NA 1NYGA 4YDWA 2LJ0A 2QDLA 4LG6A 1T3SA 4B93B 5ITZF 2IIMA 1T0HA 2CDTA 4JB8P 2BKKB 2EVRA 2A36A 5GJVB 1WXUA 1E7OA 4N5QA 4AG1C 1FYNA 1UFFA 2EGAA 2MIOA 5GJWB 1J3TA 2CSQA 1SVXA 1AZEA 2KXDA 2LNHB 3H0HA 1BI8B 2KNBB 2YUNA 4ATZD 5AQAA 3VRZA 2K3BA 3NGPA 3B95A 3NHNA 2A37A 1AD5A 5ENOD 2KT1A 2LJ3A 3PVLA 1M27C 1M8MA 2OJ2A 5HCKA 2ETAA 4HVVA 2L0AA 2NUZA 3REAB 1I0CA 4RLYA 3NMZC 1PKTA 2YUPA 3AJIA 1AWXA 3V2XA 1TUCA 2M0YA 5ENPD 4OAUC 2PTKA 2DVJA 1UECA 3LH5A 1CKBA 1ABQA 2ABLA 4O60A 5FIOA 1RLPC 1KIKA 1N0RA 3PVQA 2XZTG 1I07A 4LN2A 3JXIA 1PKSA 2JABA 1X6GA 2RPNA 3I9QA 1K1ZA 3DEOA 5ENRD 2CH4W 4ESRA 1MJ0A 4JJCA 4OMOA 2K7AA 1NFIE 2DL3A 2W0ZA 1ZBJA 1K1AA 3J5PA 3T9KA 2JTEA 4X1VA 2EYZA 2DE0X 1NG2A 1WIEA 4OMQA 3UTMA 2KT8A 1PNJA 3I5RA 4OMLA 3C0CA 3RNJA 4OMPA 1MYOA 2EQIA 5KWDA 4RTVA 5I11A 3W9FA 2L6BA 2LQNA 3KEAA 2KE9A 4U96D 4FSSA 1JXMA 3VS0A 2Y0BG 4DEYA 4J9CA 4UUCA 2RFAA 1U06A 2CREA 2DL5A 1KFZA 1ABOA 5I22A 2KBXA 2KXPC 1V1CA 2Y1LE 3UI2A 4HRNA 2VWFA 4J9DA 4BESA 1A5EA 2M51A 1K0XA 2AJAA 3EG1A 1QWFA 2P4RA 3EG3A 4Z8AA 1PHTA 5HS0A 1OY3D 1ZX6A 1WA7A 1NEBA 2KROA 1T3LA 3V30A 4Z88A 5IHNA 2JS0A 2HBWA 1N5ZA 2EKHA 2O88A 1GCQC 4DUIA 1K1BA 2JT4A 3UF4A 3UA7A 2HE0A 1NYFA 1SRLA 2SEMA 1BLXB 2C0OA 4AG2C 2SRCA 2DL4A 4BEPA 2ROTA 2V5QC 4CC2A 3U23A 4OAVB 1WG0A 1UUEA 4LE9A 5D66A 2DF6A 4AFUC 5AAOA 1YP5A 1WLPB 1AWOA 2XEEA 1GBQA 5BXOA 3UATA 2P2CP 1BB9A 2DNUA 1SEMA 2FRWA 1XOVA 1X2QA 4EIKA 2ED1A 3NOCD 4DEXA 5CEDB 3A98A 2K9GA 3ULRB 2ETBA 4ZFHA 1BU9A 5CEAA 3IQLA 4LNPA 2RQRA 3JV3A 1CSKA 3H41A 5KNHD 1VYUA 2RQVA 3H0IA 5AQ7A 5EIDA 2JW4A 4AFZC 4CZ2D 3C5RA 2F2XA 2DM1A 2O2OA 3VS1A 1OPLA 4U8YD 2BTTA 1RLQC 2JM8A 4C48B 4JPBW 2DRKA 3VS4A 5JA4D 1JXOA 4K5AB 2ETCA 2BKGA 1K76A 1AP7A 2KRSA 4J9FA 3TWQA 4J9HA 2DRMA 2MCNA 4U8VD 2QC9A 2MYOA 4BERA 2RQWA 3UXGA 2KRNA 4U95D 1E6GA 1VYTA 1AVZC 1MX2A 1K4US 1GFCA 1AOJA 2FPDA 2X3XD 2ZGDA 2D8HA 2DYBA 5CBNA 2ZGGA 1BBZA 1M30A 1ARKA 2J6FA 1JQQA 3EHRA 1Z9ZA 2PNIA 2LJ1A 2O31A 2B86A 1U3OA 4LSZE 1X43A 1S70B 4JJBA 4LNUD 2MOXA 4IIOA 1IXVA 2GQIA 2D1XA 1WX6A 2KR3A 3EU9A 5KNGA 1SHGA 2DZOA 3TWSA 1ZSGA 4J7WA 2A28A 2EPDA 4J8YA 4O1OA 4AFSC 4HB5A 2DVWA 2ED0A 4HNAD 1YWOA 3F6QA 2F2WA 2LX7A 1GBRA 1G83A 1I1JA 1GL5A 2L3QA 4CYMD 1MV3A 2ENMA 4K11A 1B07A 5EILA 3TWUA 1DC2A 1D9SA 2CT4A 1AZGB 2ESWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3THK A;  3RBB B;  2CT3 A;  2V1R A;  2LMJ A;  2DBK A;  3O5Z A;  3EHQ A;  1EFN A;  4ORZ A;  3TSZ A;  1GCQ A;  1S1N A;  1G2B A;  1N11 A;  1JO8 A;  2CUB A;  2DL7 A;  3TWX A;  1ZUU A;  3DEP A;  3Q9U C;  4CC4 B;  4F16 A;  2EW3 A;  5AAR A;  1AWC B;  2DL8 A;  2G6F X;  2KGT A;  1Y0M A;  2QYJ A;  3V31 A;  4K5C A;  1UG1 A;  2FRY A;  3VS6 A;  4HXJ A;  1ZUK A;  2FG0 A;  1KJW A;  5JMN D;  3ZU7 B;  4RTW A;  5EYL A;  2GGR A;  3SEM A;  3IXE A;  4GLM A;  3JXJ A;  1HSQ A;  2JM9 A;  5FW9 A;  3R6N A;  5IXF A;  4JZ4 A;  3D9H A;  2V4H C;  3HG0 D;  4NIK A;  5IHK A;  1CKA A;  5IXB A;  2DBM A;  4OMM A;  3ZUV B;  2L3P A;  2AZV A;  2B0O E;  1YCS B;  3TWW A;  3TWR A;  4OMN A;  1WXT A;  1OEB A;  1HJD A;  1M3A A;  1WYX A;  2BZY A;  3EG0 A;  5FWC A;  1TR4 A;  2JXB A;  2VGE A;  2PNN A;  1SPK A;  2J8S D;  1PRL C;  2C0I A;  3SO8 A;  1RI9 A;  1MX6 A;  3ZNG A;  4F1P A;  2AK5 A;  4HRL A;  4RTT A;  1IHB A;  3M0Q A;  1T0J A;  3KFV A;  3UA6 A;  2O9S A;  2J6O A;  4TUM A;  4M4Z A;  4F6R D;  5AQB A;  2V1Q A;  4HI8 A;  2JMC A;  2YUO A;  4G8L A;  5KBA A;  4LUE A;  4AFQ C;  1IO6 A;  4J9I A;  1ZLM A;  5AN8 A;  1SHF A;  2DMO A;  2LP5 A;  2VVK A;  1YYH A;  4JZ3 A;  2LCS A;  1QKX A;  1MX4 A;  1M3B A;  3ZL7 C;  4DX6 D;  1Y57 A;  2GTO A;  2HEQ A;  3REB B;  3AAA C;  1VA7 A;  1QLY A;  4G8K A;  1PRM C;  4HRM B;  1QWE A;  2RN8 A;  3M0S A;  1NM7 A;  2XEH A;  1YWP A;  3TWT A;  2K6D A;  1JEG A;  2EBP A;  2YUQ A;  4RUG A;  2HDA A;  1BK2 A;  4R0K A;  5L23 A;  4YDY A;  4HI9 A;  2OAW A;  1BI7 B;  1KSW A;  2GTJ A;  4RTU A;  4GBQ A;  2DIL A;  2NWM A;  1H92 A;  1YN8 A;  2DA9 A;  3B7B A;  4Z68 A;  4JJD A;  4K5B A;  2OI3 A;  5BXU A;  1ZUY A;  2AKK A;  2A5E A;  4GPM A;  4J9G A;  1OPK A;  2EGE A;  1AWW A;  3LJN A;  4Y92 A;  1QKW A;  2RF0 A;  2A08 A;  2K2M A;  3M0R A;  2RFM A;  1W70 A;  2XZD G;  3V2O A;  3JUE A;  3I5S A;  1UOH A;  3TVT A;  2EYW A;  1M3C A;  2RNA A;  1NLO C;  5AQ9 A;  2C0T A;  1X2K A;  3H0F A;  2JMA A;  3M0U A;  1UE9 A;  4J9B A;  1GRI A;  1SSH A;  2KXC A;  5EC7 A;  1JU5 C;  2L3S A;  1UJY A;  1K0S A;  1SW6 A;  1UTI A;  2H8H A;  2NYJ A;  1PWT A;  1UDL A;  2GBQ A;  3TWV A;  2RQT A;  2KRM A;  3EGU A;  2BZX A;  4HVW A;  5FWB A;  1MV0 B;  3VS7 A;  4F14 A;  2FO1 E;  1K3Z D;  5EYP F;  3W9G A;  1HD3 A;  1WXB A;  2FPE A;  4QFV A;  4DX7 D;  1WI7 A;  2O9V A;  1YNZ A;  4D8D A;  4RTZ A;  4GMR A;  1N0Q A;  4HQD A;  2CUD A;  3QWY A;  3NOG D;  2JS2 A;  2KBT A;  1WFW A;  5CEC B;  2CH4 A;  3PE0 A;  1H3H A;  1AWJ A;  3I35 A;  2GNC A;  4RTX A;  2XEN A;  3GBQ A;  3VS3 A;  2RMO A;  3T8K A;  2HCK A;  2AZS A;  2RQU A;  4DX1 A;  4QT7 A;  3V79 K;  2E5K A;  5ENT D;  1OV3 A;  5EIB E;  2BZ8 A;  4QQI A;  2VKN A;  5CER B;  2ROL A;  4CC7 A;  2LZ6 B;  5CBO A;  1FMK A;  2CSI A;  4HBD A;  2L2P A;  2J6K A;  5ECA A;  1OOT A;  1UJ0 A;  1RUW A;  2W10 A;  2DWZ A;  3Q9N C;  1U5S A;  4J9E A;  3HRA A;  1B3Q A;  3M0T A;  1IKN D;  3NBN B;  2ECZ A;  2EGC A;  2YDL A;  3QWX X;  1TUD A;  4IIM A;  1YMP A;  1AEY A;  1QYM A;  4BSZ B;  1QCF A;  2EYX A;  4KRT A;  1A0N B;  4DRX E;  2LQW A;  4ZNX A;  4D8K A;  5FIN A;  1K9A A;  4ZHB A;  1NEG A;  3SHW A;  1WDY A;  1UHF A;  1H8K A;  1WDX A;  5IH2 A;  2F2V A;  2YSQ A;  4CC3 A;  2K79 A;  1GCP A;  4BET A;  2F8Y A;  4HVU A;  4Z89 A;  2AKL A;  2DJQ A;  2EYY A;  1MUZ A;  1BD8 A;  2FPF A;  2FO0 A;  4E6R A;  1G3N B;  2J05 A;  3VS5 A;  4RTY A;  1DCQ A;  4DX2 A;  2PZ1 A;  1GFD A;  2HSP A;  1OT8 A;  1X27 A;  2KYB A;  1NLP C;  4DX5 D;  4A63 B;  1TG0 A;  4F17 A;  1UGV A;  4HLL A;  1SRM A;  1X6B A;  3TSW A;  3VS2 A;  1LCK A;  1Z9Q A;  3VRY A;  2KEA A;  1UHC A;  2DLP A;  2DX1 A;  2KYM A;  3NPF A;  4WCI A;  3J5Q B;  2DZN A;  2F37 A;  3EG2 A;  1BU1 A;  1VYV A;  1W6X A;  3M0P A;  5ENS D;  5IHI A;  5EN5 D;  3CQT A;  4HCK A;  4O1P A;  2YT6 A;  5HRY A;  1W1F A;  1E6H A;  2F8X K;  5HKP A;  4LUD A;  2X3W D;  2J06 A;  2D8J A;  3FJ5 A;  3ZKJ A;  2D0N A;  2FEI A;  1X69 A;  2XMF A;  5ENQ D;  2J7I A;  2I0N A;  1NYG A;  4YDW A;  2LJ0 A;  2QDL A;  4LG6 A;  1T3S A;  4B93 B;  5ITZ F;  2IIM A;  1T0H A;  2CDT A;  4JB8 P;  2BKK B;  2EVR A;  2A36 A;  5GJV B;  1WXU A;  1E7O A;  4N5Q A;  4AG1 C;  1FYN A;  1UFF A;  2EGA A;  2MIO A;  5GJW B;  1J3T A;  2CSQ A;  1SVX A;  1AZE A;  2KXD A;  2LNH B;  3H0H A;  1BI8 B;  2KNB B;  2YUN A;  4ATZ D;  5AQA A;  3VRZ A;  2K3B A;  3NGP A;  3B95 A;  3NHN A;  2A37 A;  1AD5 A;  5ENO D;  2KT1 A;  2LJ3 A;  3PVL A;  1M27 C;  1M8M A;  2OJ2 A;  5HCK A;  2ETA A;  4HVV A;  2L0A A;  2NUZ A;  3REA B;  1I0C A;  4RLY A;  3NMZ C;  1PKT A;  2YUP A;  3AJI A;  1AWX A;  3V2X A;  1TUC A;  2M0Y A;  5ENP D;  4OAU C;  2PTK A;  2DVJ A;  1UEC A;  3LH5 A;  1CKB A;  1ABQ A;  2ABL A;  4O60 A;  5FIO A;  1RLP C;  1KIK A;  1N0R A;  3PVQ A;  2XZT G;  1I07 A;  4LN2 A;  3JXI A;  1PKS A;  2JAB A;  1X6G A;  2RPN A;  3I9Q A;  1K1Z A;  3DEO A;  5ENR D;  2CH4 W;  4ESR A;  1MJ0 A;  4JJC A;  4OMO A;  2K7A A;  1NFI E;  2DL3 A;  2W0Z A;  1ZBJ A;  1K1A A;  3J5P A;  3T9K A;  2JTE A;  4X1V A;  2EYZ A;  2DE0 X;  1NG2 A;  1WIE A;  4OMQ A;  3UTM A;  2KT8 A;  1PNJ A;  3I5R A;  4OML A;  3C0C A;  3RNJ A;  4OMP A;  1MYO A;  2EQI A;  5KWD A;  4RTV A;  5I11 A;  3W9F A;  2L6B A;  2LQN A;  3KEA A;  2KE9 A;  4U96 D;  4FSS A;  1JXM A;  3VS0 A;  2Y0B G;  4DEY A;  4J9C A;  4UUC A;  2RFA A;  1U06 A;  2CRE A;  2DL5 A;  1KFZ A;  1ABO A;  5I22 A;  2KBX A;  2KXP C;  1V1C A;  2Y1L E;  3UI2 A;  4HRN A;  2VWF A;  4J9D A;  4BES A;  1A5E A;  2M51 A;  1K0X A;  2AJA A;  3EG1 A;  1QWF A;  2P4R A;  3EG3 A;  4Z8A A;  1PHT A;  5HS0 A;  1OY3 D;  1ZX6 A;  1WA7 A;  1NEB A;  2KRO A;  1T3L A;  3V30 A;  4Z88 A;  5IHN A;  2JS0 A;  2HBW A;  1N5Z A;  2EKH A;  2O88 A;  1GCQ C;  4DUI A;  1K1B A;  2JT4 A;  3UF4 A;  3UA7 A;  2HE0 A;  1NYF A;  1SRL A;  2SEM A;  1BLX B;  2C0O A;  4AG2 C;  2SRC A;  2DL4 A;  4BEP A;  2ROT A;  2V5Q C;  4CC2 A;  3U23 A;  4OAV B;  1WG0 A;  1UUE A;  4LE9 A;  5D66 A;  2DF6 A;  4AFU C;  5AAO A;  1YP5 A;  1WLP B;  1AWO A;  2XEE A;  1GBQ A;  5BXO A;  3UAT A;  2P2C P;  1BB9 A;  2DNU A;  1SEM A;  2FRW A;  1XOV A;  1X2Q A;  4EIK A;  2ED1 A;  3NOC D;  4DEX A;  5CED B;  3A98 A;  2K9G A;  3ULR B;  2ETB A;  4ZFH A;  1BU9 A;  5CEA A;  3IQL A;  4LNP A;  2RQR A;  3JV3 A;  1CSK A;  3H41 A;  5KNH D;  1VYU A;  2RQV A;  3H0I A;  5AQ7 A;  5EID A;  2JW4 A;  4AFZ C;  4CZ2 D;  3C5R A;  2F2X A;  2DM1 A;  2O2O A;  3VS1 A;  1OPL A;  4U8Y D;  2BTT A;  1RLQ C;  2JM8 A;  4C48 B;  4JPB W;  2DRK A;  3VS4 A;  5JA4 D;  1JXO A;  4K5A B;  2ETC A;  2BKG A;  1K76 A;  1AP7 A;  2KRS A;  4J9F A;  3TWQ A;  4J9H A;  2DRM A;  2MCN A;  4U8V D;  2QC9 A;  2MYO A;  4BER A;  2RQW A;  3UXG A;  2KRN A;  4U95 D;  1E6G A;  1VYT A;  1AVZ C;  1MX2 A;  1K4U S;  1GFC A;  1AOJ A;  2FPD A;  2X3X D;  2ZGD A;  2D8H A;  2DYB A;  5CBN A;  2ZGG A;  1BBZ A;  1M30 A;  1ARK A;  2J6F A;  1JQQ A;  3EHR A;  1Z9Z A;  2PNI A;  2LJ1 A;  2O31 A;  2B86 A;  1U3O A;  4LSZ E;  1X43 A;  1S70 B;  4JJB A;  4LNU D;  2MOX A;  4IIO A;  1IXV A;  2GQI A;  2D1X A;  1WX6 A;  2KR3 A;  3EU9 A;  5KNG A;  1SHG A;  2DZO A;  3TWS A;  1ZSG A;  4J7W A;  2A28 A;  2EPD A;  4J8Y A;  4O1O A;  4AFS C;  4HB5 A;  2DVW A;  2ED0 A;  4HNA D;  1YWO A;  3F6Q A;  2F2W A;  2LX7 A;  1GBR A;  1G83 A;  1I1J A;  1GL5 A;  2L3Q A;  4CYM D;  1MV3 A;  2ENM A;  4K11 A;  1B07 A;  5EIL A;  3TWU A;  1DC2 A;  1D9S A;  2CT4 A;  1AZG B;  2ESW A; 
#chains in the Genus database with same CATH topology
 3THK A;  4JRP A;  3FTX A;  4J8F A;  3DSX A;  3CK9 A;  3UM3 A;  5FJY A;  4C0E A;  2IO2 C;  3Q73 A;  5CAI A;  5E76 A;  3TSZ A;  5BNW A;  3SNX A;  1N4Q A;  4C8Q E;  1GXI E;  3DEP A;  3Q9U C;  4RG2 A;  2EW3 A;  1OZ2 A;  3QUI A;  3G6E Q;  1VQ4 T;  2G6F X;  4P29 A;  2KGT A;  1Y0M A;  4BB7 A;  3E33 A;  3V31 A;  1UG1 A;  2FRY A;  4I43 A;  4WAF A;  3ZIM A;  2VGM A;  2FG0 A;  1KJW A;  3N5B B;  1PY1 A;  4B9X A;  3L13 A;  4RTW A;  5DBK A;  3OY9 A;  2GGR A;  5A0G A;  1K4U S;  3JXJ A;  5FW9 A;  2V0P A;  5IXF A;  2WXG A;  3D9H A;  2V4H C;  4NIK A;  4DK5 A;  3T5V A;  2AVP A;  1CKA A;  4ANV A;  5HY6 A;  1H2V C;  1OXJ A;  4E85 A;  4WF2 A;  3DLM A;  3MJW A;  5D2M C;  4PJO D;  2QQA A;  4OMN A;  1WXT A;  1KK7 A;  1OEB A;  2MWO A;  1M3A A;  1Q2Z A;  4MMK A;  3V7S A;  3IEG A;  5A0D A;  2PNN A;  1SPK A;  3U64 A;  1I8F A;  3EU5 A;  1MZC A;  3BQO A;  4GTT A;  2LXL A;  4EMH A;  2CFU A;  2AK5 A;  1IHB A;  2IPO B;  3KFV A;  3M0Q A;  3UA6 A;  2QEX Q;  1S0P A;  1BKB A;  4B9W A;  1JB0 E;  1H6P A;  1N8R R;  2JMC A;  5BV0 A;  4BX9 A;  4LUE A;  4J9I A;  5AN8 A;  1SHF A;  3HRU A;  1B34 B;  2LP5 A;  4FCY A;  1YYH A;  3CVN A;  1YHQ A;  1VQ9 A;  1OYX A;  3APD A;  3RRN B;  3L2R A;  2P9S G;  4DX6 D;  2CKK A;  1Y57 A;  2QYZ A;  3DXK G;  1G3W A;  1RAB B;  2HEQ A;  3REB B;  1QLY A;  4G8K A;  1PRM C;  3CCM Q;  1JCQ A;  3TWT A;  1ZQ1 A;  4JC8 A;  2K6D A;  4AXH A;  3OXL A;  3ASN E;  2CP5 A;  2YUQ A;  3SDZ A;  3OYI A;  2HDA A;  3RMS A;  4RSY A;  2MI6 A;  5IT9 E;  2A3L A;  4HI9 A;  4FW2 A;  1BI7 B;  3L2U A;  2DIL A;  4OVV A;  1H92 A;  2XDP A;  3K9I A;  2DA9 A;  1PSE A;  1Y71 A;  4GLK A;  2OOE A;  3MP1 A;  4JJD A;  3E1S A;  2DBA A;  3SF4 A;  2OI3 A;  3I55 Q;  2A5E A;  4IN3 B;  2EGE A;  5GAN 7;  1QKW A;  2RF0 A;  2LCC A;  4U63 A;  2EYW A;  1Y7X A;  3BFM A;  3QYG B;  5GAM e;  3GW4 A;  2C0T A;  1X2K A;  2QAZ A;  3CVV A;  3CCL T;  3CHP A;  3OW2 A;  1YJ9 T;  3AS8 A;  1RAG B;  2QA4 A;  2J4B A;  5CRV A;  5LX8 A;  2KXC A;  2QY7 A;  3ZN3 A;  4HOR A;  1Q95 G;  1H6O A;  4XU2 A;  1Q86 R;  5KE3 A;  1PWT A;  3FEO A;  2DVE A;  1FVF A;  2FHD A;  1RW2 A;  2L8D A;  4X34 A;  5CMW A;  2KRM A;  1VQ8 T;  4GU5 A;  2QFC A;  2BZX A;  3LY9 A;  3ME9 A;  4CEM A;  4C0D B;  1MNE A;  5IN1 A;  4C92 A;  2RA2 A;  3CXC A;  2R03 A;  3BE3 A;  4J6I A;  4DA4 A;  4QFV A;  1HXD A;  4NUR A;  4J6W A;  1YNZ A;  3OYG A;  1DCE A;  2GGF A;  5C1D A;  3KSQ A;  4JRK A;  1VQL A;  4W9R A;  5ARG A;  1OCC E;  4HQD A;  1GW6 A;  2LNI A;  3L2Z A;  3NOG D;  3QWY A;  2CG3 A;  4U7E B;  4IKF A;  4NAC A;  3QKJ A;  3HFO A;  1AWJ A;  3FUK A;  5GAN d;  2XEN A;  1N6A A;  4C5I A;  4J83 A;  2RMO A;  2HCK A;  1M1K U;  2XD0 A;  4QT7 A;  1M90 R;  3V79 K;  3QWW A;  1UGR B;  2E5K A;  3MP6 A;  5GAN h;  2BZ8 A;  2PQW A;  1U3C A;  4JS4 A;  4CC7 A;  5JJT A;  3G6E T;  4XU0 A;  2LDM A;  3FIF A;  1WM5 A;  1UGP B;  3GIB A;  2H6G A;  4HBD A;  4EBA G;  2OX7 A;  3JCM h;  1EPU A;  1SKU B;  5J39 A;  5ECA A;  1D3B A;  4URK A;  2ZU6 B;  1UJ0 A;  1M8V A;  3C94 A;  2VSX E;  3Q9N C;  3R6O A;  1YI2 Q;  2R2L A;  4ATG A;  3L9T A;  4J9E A;  2IOS A;  3M0T A;  2ECZ A;  4IIM A;  1YMP A;  4C92 D;  2VGX B;  1QCF A;  4PS7 A;  4KRT A;  1VQM A;  4DLQ A;  4DRX E;  2WQ6 A;  2VQ2 A;  4ZNX A;  4D8K A;  5FIN A;  1K9A A;  1NEG A;  3D9N A;  1OCO E;  5KCM A;  2CP0 A;  1I4K 1;  5IH2 A;  2F2V A;  2OTJ T;  2D0Q B;  4CC3 A;  2K79 A;  1GCP A;  4FA6 A;  4XTV A;  3H6Z A;  4HVU A;  2CZ0 B;  2X35 A;  2AKL A;  2V8S E;  4OF1 A;  3UT7 A;  4M7D F;  2NUT A;  1QBQ A;  2PQN A;  2MF2 A;  4E6R A;  3CEY A;  1HFA A;  2J05 A;  3EGX A;  1RAI B;  3S3O A;  2QEX T;  1DCQ A;  4DX2 A;  4GA1 A;  2PVD B;  2HSP A;  2O4X B;  3PZD A;  5KJK A;  4A63 B;  1TG0 A;  4PFP A;  4F17 A;  4XKB A;  3CPW A;  2DZC A;  4HLL A;  3TU4 K;  2FZC B;  3TSW A;  3T8M A;  1ELK A;  3CVY A;  1IYG A;  2KEA A;  1UHC A;  2OEW A;  1OWO A;  4G26 A;  4DBR A;  2DZN A;  2F37 A;  4J0U A;  4GPK A;  5ENS D;  5EN5 D;  2E64 A;  3APC A;  4O1P A;  4U8H A;  3M4Y A;  4X8Q A;  2CZ1 B;  4LUD A;  2ZPI B;  3FJ5 A;  3ZKJ A;  1IQU A;  4L7T A;  5BUZ A;  4N5C A;  5ENQ D;  3QDR B;  4M75 E;  5ARF A;  3ER0 A;  4B93 B;  4JW1 A;  1VQ5 A;  1T0H A;  2CDT A;  3I55 T;  3TXN A;  1G3S A;  2BKK B;  4QQG A;  2A36 A;  3RO3 A;  2M16 A;  3DSV A;  3CCE T;  3PRZ A;  3EFS A;  5GJV B;  2P9I G;  1WXU A;  1VQK A;  3CHR A;  3EFO A;  3NTK A;  3QO3 A;  1I5O B;  3QKY A;  3OSS C;  2EYQ A;  3KAE A;  2QQR A;  3EHM A;  3FTY A;  1X81 A;  2J07 A;  4ZN1 A;  1Q82 U;  1NJI U;  3LDZ A;  1INZ A;  4E47 A;  1SVX A;  4FLB A;  3ZGQ A;  4C0G A;  3H0H A;  3HXD A;  4GY5 A;  5D7U A;  1LVK A;  5GMK i;  4M75 G;  2KNB B;  3ZEH A;  4CT4 A;  5LJ5 e;  3EH1 A;  3URG A;  2GRP B;  4JEU A;  4LNG A;  3VRZ A;  2WMN A;  1E8X A;  3CHM A;  3NHN A;  3JRZ A;  3RIR A;  3JCM f;  3PVL A;  4NQ0 A;  2LJ3 A;  4UQZ A;  1M27 C;  2WXN A;  4M78 G;  3FTV A;  3JCM g;  2E65 A;  4C8Q F;  3ESK A;  4KT0 E;  2E10 A;  2I9C A;  2NUZ A;  3B7U X;  1OX8 A;  1UJJ A;  3CBO A;  2XRY A;  3FJP A;  1TS9 A;  1XNI A;  5CKB A;  3AG1 E;  1B7T A;  3ASD A;  3JCK C;  5ENP D;  2VTB A;  2DVJ A;  1UEC A;  1TOV A;  1WJQ A;  2RK1 A;  3OS0 A;  3GYZ A;  2ZAE A;  1Y96 A;  2ABL A;  4O60 A;  1KIK A;  5CKE A;  4BE2 A;  3FTZ A;  3PVQ A;  1I07 A;  3IV0 A;  3CD6 Q;  1YJ9 A;  2X4W A;  4J8O A;  4ILH B;  3PEU B;  1K1Z A;  3DEO A;  4C5G A;  1MJ0 A;  3NAW A;  3UKU G;  1QVF A;  5J08 A;  4JZY A;  1K1A A;  2VB6 A;  4X1V A;  2EYZ A;  3UTM A;  1PNJ A;  3I4G A;  4B8C B;  1VQ8 A;  2X51 A;  1DVP A;  4OMP A;  1YI2 T;  1S64 A;  2MRI A;  1R77 A;  2GRR B;  3SBS A;  1WHL A;  5CK9 A;  4HVB A;  1OUL A;  5I11 A;  1VQ6 Q;  2L6B A;  4BI3 A;  3OYL A;  2KE9 A;  5FQ8 A;  5KJM A;  3RK6 A;  4BWR A;  2KMT A;  1JXM A;  4ZTF A;  2ZGW A;  3L82 A;  3A8M B;  3RR6 A;  2Y0B G;  4DEY A;  3FTW A;  4UUC A;  2RFA A;  3PUJ A;  2CRE A;  2DL5 A;  1TH7 A;  4QW2 A;  3Q75 A;  3VYG A;  4RQI A;  3TG4 A;  2HL3 A;  4E7L A;  4C92 B;  1KHI A;  3CKC A;  1A5E A;  3C98 A;  1N94 A;  3PZ4 A;  4PJO C;  5CQX A;  2AJA A;  3CIA A;  5KYU A;  4HKE A;  5AJL A;  4Q94 A;  1ZA2 B;  1PHT A;  1VQN Q;  3QBY A;  5G05 C;  2NYS A;  2PU9 B;  4Q5W A;  4Q69 A;  5HS0 A;  1OY3 D;  3V30 A;  1LTX A;  4TXP A;  3OS5 A;  2RO0 A;  5L8R E;  1AT1 B;  2E1H A;  4PJO E;  1Q81 R;  4DUI A;  3C72 A;  1G3T A;  3SZ7 A;  2HE0 A;  1NYF A;  3HRS A;  2ZPB B;  1VQ9 Q;  2RHX A;  3UKR G;  2COW A;  3LLR A;  4EMG A;  2DL4 A;  1H0A A;  3SI5 A;  2ROT A;  2VGY A;  5CKF A;  3U23 A;  4D6W A;  1WG0 A;  3LY7 A;  4AFU C;  3JB9 D;  3HVE A;  1D3B B;  3BUA A;  5HK3 A;  1KPS B;  2F69 A;  1OU9 A;  4M77 F;  5BXO A;  1O75 A;  2P2C P;  3UAT A;  1BB9 A;  4NS5 A;  4KGZ B;  2E4H A;  2DNU A;  4BAC A;  2FRW A;  4UWF A;  4M7C A;  5FZS A;  1QVP A;  2PVO B;  2XK0 A;  3QDF A;  2ED1 A;  3NOC D;  3VKI A;  3C95 A;  4HT8 A;  2QEX A;  4M7D B;  2FI7 A;  2DYR E;  1N54 A;  2RQR A;  4GZC A;  4C9B B;  2E41 A;  4QQ6 A;  3MKD A;  5DM7 R;  2I1K A;  1VYU A;  4ANW A;  3ZXS A;  1MHN A;  3WXX A;  4L9P A;  2HNI A;  1FWZ A;  5AQ7 A;  1M1G A;  5EID A;  5G2N A;  3D9L A;  2E6Z A;  2F2X A;  2DM1 A;  2RB6 A;  1OPL A;  3AS5 A;  1QVG A;  3FWV A;  4B89 A;  3MJX A;  3U66 A;  5GAM h;  1LD7 A;  3I5P A;  3J81 E;  4JPB W;  3CCM A;  4BY6 C;  5IY5 E;  1BCM A;  1XJW B;  3QZ9 B;  3INZ A;  1AP7 A;  2KRS A;  3TWQ A;  2QDY B;  1UGQ B;  2GQV A;  2JTF A;  4N3B A;  3FEX A;  3RDV A;  4QVD A;  5ANL A;  3PMI A;  2EIF A;  3TG5 A;  1H6K A;  3PT9 A;  4GML A;  2KRN A;  5C6S A;  3I55 A;  1VYT A;  1AVZ C;  3QAQ A;  2RI3 A;  4WWO A;  4GMJ A;  2BE9 B;  1VQL Q;  5DLQ E;  1N4R A;  3GZ2 A;  2ZGD A;  2D9T A;  4JUV A;  1PG5 B;  5CBN A;  2ZGG A;  5FT9 A;  1BBZ A;  2LCL A;  4LD6 A;  3V8J A;  4J6X A;  1M30 A;  1ARK A;  3OYB A;  1QQE A;  4RG9 A;  2HO1 A;  2ZCF B;  4QQD A;  1OZ3 A;  1EIF A;  4EMK C;  1UW4 B;  3RIB A;  4RVB A;  3E19 A;  3SB2 A;  5J26 A;  3PZ1 A;  3EU9 A;  1UEB A;  1SHG A;  3X25 B;  2BF0 X;  3DST A;  3SFY A;  3AS4 A;  4HB5 A;  3RAU A;  1YIT Q;  4WNG A;  5EDS A;  5M9O A;  4UWG A;  4HA8 A;  1VQ6 T;  3ZYM A;  2WM9 A;  3CST A;  4UQX A;  2L3Q A;  1B89 A;  1VQO Q;  4N3C A;  3JQ1 A;  5G04 J;  1K8A C;  4LRZ A;  1QP2 A;  3JCM P;  4U0S A;  3D9K A;  4C8Q B;  2CFZ A;  2LVM A;  2DXB A;  1U3D A;  1TN8 A;  1ZSZ C;  2LO6 A;  3SQV A;  5FU6 B;  4E7S A;  4AOF A;  1ZBP A;  1EFN A;  2M63 A;  4MDX A;  2HSE B;  2COZ A;  1HXI A;  1N11 A;  1E8Z A;  3TWX A;  1YBY A;  4F16 A;  5JHB A;  2CYZ B;  4LEU A;  4OGE A;  4E7J A;  1K73 C;  3D9P A;  1HU3 A;  1LNX A;  4K5C A;  3VS6 A;  2LAH A;  3SFX A;  3CXC S;  1Y96 B;  4M75 A;  1RAH B;  1N4S A;  3QYH B;  3SEM A;  3V7C A;  3E32 A;  4DQ2 A;  1Q7Y C;  4GLM A;  2DZ9 A;  5LJ3 f;  4PJN A;  1VQ9 T;  2R5M A;  3HPW A;  1HS6 A;  1LD8 A;  3PRE A;  5KYW A;  5LJ3 g;  2HZY A;  1NZN A;  3D9O A;  4O6F A;  3DB3 A;  1U1T A;  3ZUV B;  4M78 A;  1YCS B;  1D1C A;  3TWR A;  1K9M C;  1HJD A;  2LQK A;  3OYY A;  1WYX A;  2DD4 A;  4CRI A;  2BZY A;  3EG0 A;  5GAM g;  1VQ7 Q;  3MGB A;  2J8S D;  1PRL C;  5GMK j;  2WVI A;  1D0X A;  2QK0 A;  2C0I A;  1RI9 A;  3TQ7 P;  1MX6 A;  2J49 A;  4F1P A;  3JB9 J;  4RTT A;  5IAY A;  3OYJ A;  1T0J A;  3OYK A;  1UN8 A;  2O9S A;  2M02 A;  3Q79 A;  1JCR A;  4TUM A;  4M4Z A;  2V1Q A;  3FTU A;  5EKQ D;  4HI8 A;  1MND A;  2MOW A;  4G8L A;  3GZS A;  2A5U A;  1BI3 A;  1IO6 A;  5AYF A;  1H3Z A;  1ZLM A;  4II1 A;  2GF7 A;  4M75 D;  3LVQ E;  2UWJ G;  1QKX A;  1M3B A;  3ZL7 C;  2RHU A;  1HH8 A;  1VA7 A;  2YWW A;  5KYN A;  3L54 A;  4HRM B;  2RN8 A;  1NM7 A;  2XEH A;  4RKU E;  4UI9 J;  1WNL A;  1RAC B;  1S72 A;  4RUG A;  1AHJ B;  4M78 D;  1ELR A;  2MHK A;  4R0K A;  5L23 A;  3CCV Q;  4EEC A;  1RZ4 A;  1QP3 A;  4RTU A;  2C0M A;  4OYS A;  4YDO A;  4A53 A;  1HG5 A;  2QYU A;  3B7B A;  4Z68 A;  4K5B A;  3CSF A;  5LJ5 h;  4GPM A;  4J9G A;  4M77 B;  4AY6 A;  3CPW S;  2X6J A;  2A08 A;  3JAM E;  2RFM A;  1EYH A;  2ATC B;  3FUD A;  1MMG A;  1W70 A;  2XZD G;  3PIO A;  1VQL T;  3I5S A;  3DB4 A;  1UOH A;  4G25 A;  4WND A;  2RNA A;  1NLO C;  2RKK A;  3DLL A;  4ANX A;  2OTL Q;  2OV8 A;  4XAX B;  3LVR E;  4A55 A;  3H0F A;  3M0U A;  4PKC C;  3C3Q A;  5GAN 2;  3PE4 A;  3SGH A;  5KH6 A;  1SSH A;  4EZL A;  1JU5 C;  3LX7 A;  1UJY A;  4FYY B;  2PM6 A;  2H8H A;  1UDL A;  1VDY A;  1TNO A;  2JUF A;  2GBQ A;  3RU0 A;  3UDC A;  3Q4A B;  4N0A A;  2RQT A;  1DJ7 B;  3EGU A;  1R0B G;  4HVW A;  1MV0 B;  1YIT T;  3OYF A;  1Z5S C;  4DLO A;  2VSN A;  5FRO A;  4TXQ A;  4BI8 B;  1SA4 A;  5EYP F;  3CC7 Q;  1HD3 A;  4UWL A;  1Z3Y A;  3B7T A;  1VQO T;  2GW1 A;  1OWN A;  3EJN A;  4G23 A;  1N0Q A;  4N3A A;  4GMR A;  1MGQ A;  4KH1 B;  2AXV A;  3JQ0 A;  2JS2 A;  1WFW A;  5CEC B;  3PE0 A;  1H3H A;  4I6G A;  4PJO F;  4PL6 A;  3GBQ A;  4A4K A;  2FF4 A;  4E6H A;  1IB8 A;  4CGV A;  3E9G A;  1WAO 1;  2RQU A;  4QVZ A;  3CCJ Q;  1G3Y A;  3LGF A;  5ENT D;  3CD6 A;  2L89 A;  2VKN A;  4C0Z A;  2LZ6 B;  4KGX B;  2P58 C;  4MDW A;  1M2V A;  2DD5 A;  4XI0 A;  3L17 A;  1BI2 A;  3OXF A;  4LER A;  5KCO A;  3QXE B;  3KS2 A;  2DXU A;  2DWZ A;  2VGN A;  1ZHI A;  1B3Q A;  2JJ9 A;  4G24 A;  3WG7 E;  3ML9 A;  2YDL A;  4OB1 B;  1VQ6 A;  1AEY A;  1OCR E;  4BSZ B;  4HOS A;  2EYX A;  2LT1 A;  4JD2 G;  2Z0W A;  2LRQ A;  5CO7 A;  1FMV A;  4F7U G;  1UGS B;  1H8K A;  1Q82 C;  3CME Q;  1NJI C;  4I9C A;  3NZS A;  3M53 A;  5DY9 A;  3BG0 B;  2F8Y A;  4L23 A;  4Z89 A;  1VQ7 T;  3D7S B;  2HYZ A;  2BUG A;  3X2Q E;  1G8X A;  1MUZ A;  1BD8 A;  3PDN A;  2FO0 A;  2DER A;  2WXM A;  5HKC A;  4XK8 E;  2WXF A;  1G3N B;  2F5T X;  4BDY A;  4JS5 A;  1VQ5 T;  2JZ2 A;  3HL8 A;  1VQN A;  2IG0 A;  1GFD A;  1X27 A;  1NLP C;  5LJ5 g;  3TL5 A;  1VQK T;  4CDR A;  5GAN 4;  3EIQ C;  3MKQ B;  2VC8 A;  4JHR A;  1SRM A;  4EDU A;  2LUH A;  1TJF A;  2I6H A;  1ZBX A;  3VRY A;  1VIF A;  1IXD A;  2UY1 A;  2DLP A;  1K8A U;  2DX1 A;  4BY6 A;  2KYM A;  3J5Q B;  4FU6 A;  4XQ3 A;  4JL0 A;  3O4Z A;  1BU1 A;  1W6X A;  4FSX A;  4UI9 C;  5B1B E;  2FZG B;  5EG2 A;  3FH7 A;  1E6H A;  3MPU B;  4N4H A;  5HKP A;  2X3W D;  2D8J A;  2D0N A;  2FEI A;  2XMF A;  4IUQ A;  1MMD A;  4KUL A;  3CCV T;  3ZW3 A;  1K73 U;  4P5N A;  4YDW A;  2LJ0 A;  4J8E A;  4ABN A;  3UIP C;  4ME2 A;  4LDV A;  3FUN A;  3G2V A;  1T3S A;  1KQ1 A;  4J8S A;  3H8Z A;  5D6X A;  4A1S A;  2X6H A;  4RG8 A;  2EQM A;  1Q7Y U;  3EH2 A;  2B8A A;  2DIQ A;  1FYN A;  4U0U A;  1UFF A;  1WHG A;  3GLX A;  4EMK A;  1KT0 A;  1WQW A;  3G4S Q;  3QJ6 A;  4BT8 A;  3KEZ A;  1J3T A;  1K9M U;  3CVQ A;  4N39 A;  2XG8 D;  5A0L A;  3M55 A;  4IUU A;  2HQE A;  3NF1 A;  2RJE A;  3CC2 Q;  2K3B A;  4DI4 A;  2A37 A;  1E7U A;  2DAQ A;  5ENO D;  3O48 A;  4TV3 A;  3ZHE A;  5HCK A;  2AT1 B;  2OJ2 A;  5GAO p;  2ETA A;  3ZFJ A;  4GYW A;  3CKB A;  5GAO m;  2DKG A;  3REA B;  1I0C A;  1ZSZ A;  5HI7 A;  4PS8 A;  4C92 F;  5EX3 A;  1MMA A;  2X9H A;  3MEW A;  1TUC A;  4BX8 A;  2M0Y A;  4OB0 B;  4OAU C;  3ESL A;  1RAE B;  2RHI A;  3ZBD A;  1XGW A;  2HR2 A;  4FJZ A;  4L1B A;  2KVQ G;  1QVG S;  2AWI A;  3TGO A;  1N0R A;  3CCJ T;  1M1K R;  2XZT G;  2YRD A;  1X6G A;  2JAB A;  2V8K A;  4RCB A;  1HYO A;  5ENR D;  1JRI A;  5G55 A;  4JJC A;  4OMO A;  2K7A A;  1NFI E;  3S7B A;  3RRU A;  5JJ6 A;  2YRV A;  3TAX A;  4UI9 K;  2EQK A;  4M77 G;  1NG2 A;  4OMQ A;  4X9D A;  2KT8 A;  3AU4 A;  2QQ9 A;  3I5R A;  1FXX A;  1UG3 A;  3UM2 A;  3PZ3 A;  2ZPF B;  1MYO A;  3VLE A;  1YIT A;  2EQI A;  4RTV A;  2E3I A;  2LQN A;  3P8D A;  2ZIR A;  2NUP B;  4FSS A;  1LPL A;  1NI1 A;  3PNT B;  4ACL A;  5CHE E;  1QZ2 A;  1VQO A;  3CLJ A;  1D1B A;  1KFZ A;  4KUD K;  1ABO A;  2KBX A;  1YCY A;  1QCO A;  4HRN A;  4J9D A;  4BES A;  3PIP A;  1BI0 A;  3JB9 H;  2X6K A;  2G3R A;  4FIB A;  3EUV A;  1VUB A;  2K5I A;  3SHF A;  3QJY A;  3MEA A;  3CQC B;  5BPP A;  3EG3 A;  7AT1 B;  4PJO B;  4Q96 A;  2X4Y A;  3C4S A;  5G05 J;  2V8J A;  1N5Z A;  1SQM A;  3P8H A;  4NOY A;  1K1B A;  2JT4 A;  2RI2 A;  4M7A G;  3CV0 A;  5A23 A;  2SEM A;  2PQR A;  4HCC A;  5KYY A;  1N95 A;  1YA0 A;  3CCQ A;  4EHM A;  1GBR A;  2GRQ B;  4BEP A;  4NL3 A;  4PFO A;  1D09 B;  4BD3 A;  3RO2 A;  4M75 C;  5D66 A;  1YP5 A;  3CMA Q;  4KMO A;  2GFU A;  4TVR A;  1AWO A;  2XEE A;  5J90 A;  5KCH A;  2J09 A;  4OB3 B;  3CCM T;  1S72 Q;  4GTM A;  4XE0 A;  4GYO A;  4XX5 A;  3AT1 B;  4FLH A;  3QZ5 B;  1SEM A;  2KZT A;  3NTI A;  1VQ7 A;  2FUL A;  4BTB A;  5LCW C;  4M78 C;  3HIZ A;  2L6J A;  5AYW D;  4OVA A;  2BED A;  3SBT B;  5CEA A;  3T5X A;  4LNP A;  3JV3 A;  1KQS P;  4G11 A;  3LCA A;  3QII A;  2I2L A;  3G4S T;  3KSL A;  5KNH D;  1KD1 C;  3OBW A;  4M78 E;  2RQV A;  2C0L A;  3H0I A;  4MZP A;  4C0F A;  3DXM G;  2FVU A;  4AFZ C;  3FU3 A;  4CZ2 D;  3C5R A;  1I5L A;  2O2O A;  4PH4 B;  1BCO A;  4I2W A;  3LPZ A;  4KZ0 A;  2BTT A;  8ATC B;  2LSU A;  2EQU A;  4JPS A;  3DSU A;  3Q1J A;  2IJG X;  4N2S A;  2DRK A;  3VS4 A;  1JJ2 P;  3HXC A;  5GAN f;  3V8K A;  5FWQ A;  2ETC A;  2HQX A;  2ION A;  2GRL A;  5GAN g;  4F7U A;  3UT4 A;  4QKU A;  3UIN C;  2MCN A;  2CHZ A;  3CCV A;  4R7L A;  4U8V D;  2QC9 A;  1R8O B;  3G7Z A;  4H7X A;  4XEI G;  2RQW A;  1LF8 A;  4Z02 A;  4VUB A;  1TU0 B;  3FUH A;  4GZ5 A;  4UQY A;  3BG1 B;  1E6G A;  2CP2 A;  5GAO q;  1MX2 A;  3EDT B;  4ILG A;  2FPD A;  2P0K A;  2X3X D;  1PCX A;  1M2O A;  2D8H A;  5M72 A;  3QC1 A;  4HS2 A;  2COY A;  1JQQ A;  3BY7 A;  3FEY A;  4IUL A;  1Z9Z A;  2R58 A;  2OTL A;  3U9W A;  3HXF A;  4YVQ C;  2O31 A;  3EGD A;  3SD4 A;  3LWI A;  1W2B P;  4LSZ E;  4JJB A;  1VQP A;  4IIO A;  1IXV A;  4KXK B;  4AVX A;  3LYA A;  1TEZ A;  2KR3 A;  5KNG A;  2RHZ A;  4LUN U;  2HAX A;  1PSF A;  2EPD A;  4J8Y A;  3HHM A;  4DBH A;  3O8V A;  2ED0 A;  1O1R A;  3EG9 A;  1YJW A;  2H3J A;  4HNA D;  1YWO A;  3F6Q A;  4FM4 B;  1FVH A;  3CC7 A;  1I1J A;  1IZ6 A;  4FHK A;  1MV3 A;  3DSS A;  2ENM A;  3M58 A;  1B07 A;  2NSZ A;  3PTA A;  4FYV B;  4N0A C;  3VV0 A;  1D9S A;  2CT4 A;  1AZG B;  2ESW A;  3RBB B;  4MBG A;  2V1R A;  3FHE A;  3OYD A;  2LMJ A;  2VSY A;  3L16 A;  3VJP A;  3CK7 A;  3G2S A;  3JB9 F;  1UB4 A;  2DBK A;  3UIO C;  3EHQ A;  1WHJ A;  3O5Z A;  1IHW A;  2F1L A;  1U2V G;  1S1N A;  1NL4 A;  2XKO C;  2IU1 A;  2H6H A;  3IKO B;  1ZSZ B;  2DIG A;  4RMO A;  4CC4 B;  4JXT A;  3CCJ A;  4L59 A;  2DK3 A;  3M9Q A;  4I2Z A;  2QYJ A;  4BUG A;  4DI3 A;  1ZUK A;  1TYQ G;  2ZZD A;  3F70 A;  3H9N A;  5FU7 C;  5JMN D;  3ZU7 B;  5EYL A;  2OEV A;  4JZ4 A;  3HG0 D;  1UN9 A;  3TCJ A;  1UJK A;  3FU6 A;  3HYM B;  3CCR Q;  5A6C A;  2IY0 C;  4XTY A;  4OMM A;  2HMA A;  3X26 B;  4LDW A;  4TRQ A;  3AG3 E;  3IHV A;  1BIB A;  3CMA T;  1S72 T;  4FJY A;  4OVU A;  5FZR A;  1I81 A;  1WHH A;  3CME A;  4KGV B;  5FWC A;  1TR4 A;  1FMW A;  3VLD A;  1Z3X A;  1F1B B;  2JVV A;  3AG4 E;  2JNG A;  1NA3 A;  5T3R A;  2CGH A;  2FZK B;  3QDN A;  5AQB A;  1QCN A;  4JRI A;  2EQX A;  3ISM C;  2IVW A;  1H2U A;  2DPP B;  4UWH A;  4KUI A;  3PH0 C;  2WXH A;  2DTO A;  2YLC A;  4AFQ C;  4IUT A;  2DMO A;  3G71 Q;  3B7R L;  2DYS E;  5I21 A;  2KDS A;  1SZA A;  2XGM A;  2NUT B;  3DRA A;  2GTO A;  2K3X A;  1D0Y A;  2GFA A;  5CKH A;  3AAA C;  3PS6 A;  4EBA A;  3EGX B;  1BYM A;  1YIJ Q;  1LOJ A;  1QWE A;  3M0S A;  2L3R A;  3FU0 A;  2VJ8 A;  1KC8 C;  2XDB A;  2P0Q A;  3EFR A;  2OVF A;  1YJN Q;  3RKY A;  4OB2 B;  5CCA A;  2VYI A;  1KSW A;  2GTJ A;  4GBQ A;  4AV7 A;  3CCS Q;  1YN8 A;  1HK9 A;  3QK0 A;  4C5H A;  5CVI A;  3CVP A;  2AKK A;  2WB2 A;  1OPK A;  2XID A;  2ZPH B;  4Y92 A;  1OWL A;  2VSO E;  2GRN B;  2K2M A;  3J7A F;  1TNY A;  4TXR A;  3JUE A;  4R55 A;  4FW1 A;  2EJ9 A;  3P2B A;  1M3C A;  4DOV A;  3UX4 A;  4J7I A;  3G4S A;  2P9N G;  4WNE A;  1UE9 A;  1GRI A;  4M7A A;  2F0Y A;  2XCB A;  1OUV A;  2L3S A;  3CD6 T;  3DPD A;  4DPR A;  3ZVV A;  2LT4 A;  3EFO B;  3MZL B;  2RJC A;  3S6W A;  5KJN A;  2WXJ A;  4E7K A;  3A8L B;  3CC2 A;  1O1S A;  4YTL A;  4AJW A;  3VS7 A;  3P1U A;  2FO1 E;  1BPO A;  3W9G A;  3E37 A;  3RMQ A;  2XI9 A;  3CCQ Q;  3BEE A;  3KD7 A;  4LCT A;  2FPE A;  3FDR A;  2YXY A;  2KSS A;  2O9V A;  4RTZ A;  1KD1 U;  2RG8 A;  2WXQ A;  4A3V A;  4X9C A;  2YHE A;  3JCM c;  1N4P A;  2CH4 A;  1QNF A;  2GNC A;  3I35 A;  1YFN A;  3FU5 A;  4GTR A;  4U04 A;  3VS3 A;  3OW2 S;  5D6W A;  3FH5 A;  3FY4 A;  4I6J A;  3T8K A;  3FUM A;  4GZ3 A;  1E96 B;  4F7A A;  2OVB A;  2JLB A;  4JLI A;  4QQI A;  4YND A;  2PZI A;  5CER B;  2ROL A;  3QHS A;  4AT1 B;  1V55 E;  4FUL A;  3HKS A;  3ULQ A;  3L2W A;  1FMK A;  3M5A A;  3D9J A;  3MO8 A;  2CSI A;  4M7A D;  4KH0 B;  1VQN T;  2EIJ E;  4BE1 A;  1KQ2 A;  3CCU A;  1SZ9 A;  2J08 A;  5A7D B;  2VTB B;  4A4F A;  5BV1 A;  2ZXW E;  2W10 A;  2DO3 A;  3QOU A;  1U5S A;  4IUV A;  5D6Y A;  3HRA A;  1WGS A;  4M75 F;  2E70 A;  2LQW A;  4BI4 A;  4ZHB A;  3ONL A;  2D6F A;  1UHF A;  4HT9 A;  1H64 1;  2E12 A;  4AP2 A;  1WDX A;  1C6V X;  4GTO A;  3S7J A;  2YSQ A;  1ELW A;  2QZA A;  1B34 A;  2E0I A;  4BET A;  3EG9 B;  5GAM f;  1NP7 A;  4M78 F;  2EJF A;  2EYY A;  1D8D A;  5FRM A;  1VQ4 Q;  3SWN C;  3WVD B;  1OT8 A;  2KYB A;  2ZPG B;  3TRE A;  2RD0 A;  3R7R A;  4DX5 D;  3S2A A;  4GTQ A;  1X6B A;  2KCK A;  1Z6T A;  1QVG P;  1LCK A;  8AT1 B;  3A5Z B;  3EIJ A;  1W3B A;  3MEU A;  3BW1 A;  4ELZ C;  2HKQ B;  4WCI A;  5KYU B;  5CRU A;  4A1G A;  3UWN A;  3UPU A;  1RI0 A;  3ZYK A;  5I2M A;  4C92 G;  1YIJ T;  3ASG A;  3OB9 A;  3IBE A;  3Q7A A;  1E7V A;  5T8I A;  5CIU A;  4L2L A;  3V8L A;  2CHX A;  1W1F A;  3FUJ A;  2X4X A;  3CMA A;  1YJN T;  2MWP A;  3BU8 A;  1O5M A;  1Q86 C;  3DBS A;  2J7I A;  2I0N A;  1NYG A;  2QDL A;  5A2Q E;  3ZYQ A;  4CCA A;  2LQ8 A;  3CCS T;  1BIA A;  4LG6 A;  5LL6 S;  3OMC A;  3G2U A;  4CT0 A;  5ITZ F;  2IIM A;  3HFN A;  3PUK A;  4JB8 P;  2E5Q A;  5LJ3 j;  3CQG B;  1E90 A;  4BFR A;  4JHK A;  2KCL A;  2PL2 A;  1E7O A;  4FL6 A;  1NA0 A;  2EGA A;  5BW8 C;  2XPY A;  3HVE B;  2MIO A;  4M7D E;  2DEU A;  5GMK l;  2EQJ A;  1N8R C;  1TNU A;  2XS1 A;  3RES A;  2WXO A;  2KXD A;  5EX0 A;  3MX3 A;  9ATC B;  2OAU A;  2FYK A;  2K57 A;  1L5J A;  2WSF E;  1ZU2 A;  3I56 Q;  2A4Z A;  2V26 A;  2EJG A;  5HK0 A;  4C0M A;  3KUF A;  2LAI A;  1VQP Q;  2YUN A;  2DIW A;  1M90 C;  3L2V A;  4NRH B;  5AQA A;  1Y07 A;  3RJV A;  3NGP A;  3E34 A;  3B95 A;  1AD5 A;  4PJM A;  4I6E A;  3E9F A;  3SFM A;  3VU3 C;  2HBP A;  2WQ7 A;  1SG5 A;  4M7D G;  3QG1 A;  1KG1 A;  3CCQ T;  1YJW Q;  3QWV A;  3A8O B;  4HOT A;  4RLY A;  4A4E A;  4ME7 A;  2R05 A;  3X20 B;  4PNO A;  4WNF A;  2R5A A;  4H7Y A;  3ASF A;  4KYO B;  4HCB A;  3M56 A;  1PD1 A;  2PTK A;  4FYW B;  3UM1 A;  3CGH A;  3PNL B;  4ILI A;  3OYA A;  1D0Z A;  3BDL A;  4GTV A;  2YRC A;  1WZO A;  3JXI A;  1KC8 U;  3ZXP A;  2VGX A;  3L08 A;  3GZ1 A;  5JHA A;  3CC4 Q;  4NL2 A;  2CH4 W;  4FHJ A;  3WVE B;  2HQH A;  2X3M A;  4F7U E;  2JTE A;  4Y91 A;  4APF A;  1TN6 A;  5GAO l;  4OML A;  4DBF A;  2CZ6 B;  2GCX A;  2XPZ A;  2X6F A;  5KWD A;  3P8B B;  3W9F A;  4IUR A;  3CVW A;  3CCE Q;  4U96 D;  1VIE A;  3VS0 A;  2O4X A;  1X6O A;  1PC2 A;  1DNP A;  4MML A;  3ULY A;  1V76 A;  4L5G A;  3A8H B;  4KT6 B;  4XTZ A;  3HXB A;  3X28 B;  1U1S A;  3NQP A;  3MKR A;  5HQ8 A;  3UI2 A;  4A4H A;  1LJO A;  2VWF A;  2X6I A;  3JCM Q;  4XIF A;  2M51 A;  3MET A;  2IFU A;  3EG1 A;  4XZ4 A;  1QWF A;  3L2Q A;  3CVX A;  2BUD A;  3HRT A;  1QVF S;  4LDY A;  5D0Q D;  5E75 A;  2P9L G;  1RAD B;  4HLE A;  1ZB1 A;  3FUL A;  4GA2 A;  2KRO A;  1T3L A;  3L42 A;  5IHN A;  5LJ5 f;  4B94 A;  3LXU X;  3PNW C;  3S7F A;  2MYS A;  3GP8 A;  4WWN A;  3UF4 A;  2QAS A;  4Y28 E;  1BLX B;  2C0O A;  2VAS A;  4AG2 C;  1K8A R;  3ZRH A;  2RI5 A;  4GCO A;  4HFG A;  4C8Q G;  4CI0 C;  2XRZ A;  2P4T A;  2XGO A;  3VLF A;  4GB9 A;  2V5Q C;  3TJP A;  1IGU A;  2EIL E;  3CCR A;  2DJZ A;  2DYI A;  2OTJ Q;  2JN0 A;  4LE9 A;  5GMK m;  5AAO A;  5GAO n;  2YHC A;  1FPP A;  3EAE A;  4GYY A;  3C3O A;  3TXM A;  3HHT B;  4M75 B;  1O9S A;  2XHC A;  1K8K G;  1PM3 A;  1K73 R;  5GMK e;  5LFA A;  1X2Q A;  3ASK A;  3G2T A;  2OCC E;  4HOU A;  4EIK A;  2CG2 A;  2LC4 A;  4JLG A;  3ASO E;  3DSW A;  4DEX A;  2RD1 A;  3UT1 A;  3FRN A;  5KYW B;  2K9G A;  4UC4 A;  3ULR B;  2GRO B;  4ZFH A;  2YLB A;  5LCW J;  1Q7Y R;  1BU9 A;  3IQL A;  4M78 B;  4QVC A;  3WXM B;  1IRX A;  3SFZ A;  4E7Z A;  6AT1 B;  2WXL A;  3H41 A;  3JCM b;  1RL2 A;  3R7Q A;  2LX9 A;  4U07 A;  5D0O D;  3D3M A;  3G71 A;  2X4J A;  4E7H A;  4B0Z A;  3ASH A;  3ZYL A;  4Y6W A;  2R02 A;  2JW4 A;  1K9M R;  2LSV A;  3ONK A;  4A3T A;  2OTL T;  4GZD A;  2DTI A;  3VS1 A;  3DPY A;  1X5B A;  4RG6 A;  3I56 T;  4LNB A;  4JRQ A;  4J7F A;  4FT4 A;  3Q7F A;  1QMC A;  2JM8 A;  1YIJ A;  2DTH A;  4PDX A;  4C48 B;  1VQP T;  3E30 A;  4I17 A;  3Q47 B;  5LJ5 j;  3JB9 G;  4K5A B;  1FT1 A;  4M77 C;  4DJA A;  1K76 A;  4J9F A;  2AXU A;  1YJN A;  3ABL E;  1KHC A;  5ENN A;  1XQH A;  2DRM A;  2MK5 A;  3JUI A;  4PJL A;  5LJ3 e;  4BER A;  1WJS A;  3CCS A;  4A4G A;  1YJW T;  4WUY A;  1ACM B;  3CC7 T;  1R0C B;  2GRM A;  4JA7 A;  3RKV A;  1GFC A;  4M77 E;  1AOJ A;  5T4Y A;  4CDN A;  3ZFW A;  2Q7F A;  2WMO A;  1JPL A;  2JTM A;  3MYV A;  5CMY A;  2HKN A;  1KQS A;  3M54 A;  2HM8 A;  4GZ6 A;  1QW1 A;  2K5L A;  2ZPE B;  2LJ1 A;  2WQH A;  4XKC A;  1PC0 A;  3CC4 T;  4MS6 A;  2OND A;  3CBP A;  5AJD A;  1S70 B;  1Q86 U;  2GQI A;  5FQ4 A;  2D1X A;  3LH0 A;  1NPR A;  2XEV A;  4APO A;  4FP7 A;  3TWS A;  1ZSG A;  3UMV A;  4I1M A;  3R9M A;  1TWB A;  2A28 A;  2BE7 D;  3LW5 E;  4LDU A;  3CCU Q;  1JJ2 A;  4AFS C;  2AHJ B;  4AMC A;  2DVW A;  3I4R B;  2QI2 A;  4M7A C;  1MMN A;  1OWM A;  2F2W A;  1Q81 C;  1TXQ A;  3VUZ A;  1EZZ B;  2QGG A;  1G83 A;  3NB2 A;  2RJF A;  3VUB A;  5KE2 A;  2BTD A;  4CYM D;  1XNF A;  3UUX A;  4IUP A;  1N8R U;  3TWU A;  1DC2 A;  2C06 A;  3M59 A;  2VXE A;  2CT3 A;  3CHO A;  4EZJ A;  1SSF A;  3PGG A;  3SWN A;  1MQS A;  4KVM A;  3OYC A;  4M7A E;  5FLX E;  1EX4 A;  4JEH A;  4ORZ A;  3CME T;  3JCM d;  1GCQ A;  1G2B A;  2XIC A;  1M90 U;  1JO8 A;  2DL7 A;  2CUB A;  5GAN 3;  3HSB A;  4F1S A;  2Y3A A;  2IEJ A;  1TJC A;  1ZUU A;  4A54 A;  5AAR A;  3TEE A;  5CR2 A;  1HF8 A;  1AWC B;  2DL8 A;  2A0F B;  2XDD A;  1W2B A;  4WWP A;  4HXJ A;  1V54 E;  5CCL A;  3CVU A;  1U8R A;  1SA5 A;  2EWN A;  4O6J A;  2CP3 A;  2ILR A;  3IXE A;  3LJ3 A;  4PS3 A;  1HSQ A;  1OQK A;  4N2Q A;  2HL5 C;  2JM9 A;  3R6N A;  2L5Q A;  2Y90 A;  5IHK A;  5FU7 B;  3GPL A;  4GA0 A;  3URZ A;  5IXB A;  4K0R A;  2DBM A;  4L2Y A;  2Y4X A;  1WHM A;  2L3P A;  4M7D A;  4I1A A;  2AZV A;  2B0O E;  4Y6C A;  3TWW A;  1OWP A;  3FUF A;  1H2T C;  1M2V B;  4BTA A;  2A7Y A;  2I1J A;  3PFS A;  3DWL G;  4MLP A;  3A1P A;  4I1O B;  2PUK B;  2JXB A;  4R56 A;  2VGE A;  2BIV A;  1C1A A;  1OX9 A;  3SO8 A;  3S3M A;  3ZNG A;  3LEW A;  2MMP A;  4HRL A;  2WXI A;  1VQ4 A;  4ZGD B;  3FTS A;  4EPZ A;  2J6O A;  2PUO B;  4F6R D;  2B6C A;  2KQW A;  2YUO A;  2MAM A;  4MKT A;  3HXE A;  2RM4 A;  5KBA A;  3JCM V;  3OMG A;  2VVK A;  3OW2 P;  5FRN A;  4LDX A;  1OI1 A;  4JZ3 A;  2LCS A;  2E3H A;  1MX4 A;  3D9M A;  4MZT A;  4FT2 A;  3MEV A;  3OBY A;  1Q82 R;  1NJI R;  2KM4 A;  2WXP A;  3RKX A;  5LP0 A;  1G5V A;  4V3I A;  1YWP A;  3QB2 A;  3LWH A;  1NPP A;  2EBP A;  1JEG A;  4FAD A;  4L6V 5;  3MCA B;  4M7D D;  1BK2 A;  4IYP A;  4YDY A;  5B1A E;  2OAW A;  3CXC P;  1FT2 A;  4F53 A;  3CC2 T;  2NWM A;  3M57 A;  3HDX A;  3PZ2 A;  3S3N A;  3OYE A;  4HOQ A;  2UY1 B;  5BXU A;  1ZUY A;  4BY6 B;  4OP0 A;  1AWW A;  3LJN A;  4MRU A;  4F7U F;  3M0R A;  1X01 A;  2BKD N;  1Y8M A;  5FTP A;  3V2O A;  3PMT A;  2DET A;  4C5E A;  3B7S A;  3MV3 B;  3ML8 A;  3TVT A;  5GAN 8;  2QTV A;  2P9P G;  5AQ9 A;  3QNK A;  1WY6 A;  3MP8 A;  3IHY A;  3QAR A;  4F3V A;  1JWF A;  1FX7 A;  1IHV A;  2JMA A;  3OAW A;  4JDS A;  3FP3 A;  1OCZ E;  2YQ8 A;  4J5Y A;  4J9B A;  1TN7 A;  3VTY A;  1TNZ A;  4UWK A;  4D10 C;  5EC7 A;  1TSF A;  4ZN3 A;  3FUE A;  1K0S A;  1SW6 A;  4DOW A;  5KYX A;  1UTI A;  3I56 A;  2NYJ A;  3OS1 A;  1E8W A;  3KXT A;  1TNB A;  4N4I A;  4C8Q A;  2K2V A;  2JEK A;  3JYS A;  4C0D C;  1RAF B;  3FC3 A;  3TWV A;  4ELY C;  4G1T A;  2QGF B;  3CCU T;  2XU8 A;  4EMK B;  2L9B A;  2XHE A;  2HD0 A;  5FWB A;  4F14 A;  3Q5M A;  2XS8 A;  1JBM A;  2XCC A;  1MHQ A;  2KC7 A;  1VOM A;  1K3Z D;  2JOY A;  2KCV A;  1WXB A;  4DX7 D;  3NZU A;  2K5F A;  1WI7 A;  2QG9 B;  3QPH A;  2I2O A;  4D8D A;  2CUD A;  2P84 A;  2RK2 A;  1M1F A;  2KBT A;  5GAO r;  2Y4Y A;  1EDU A;  3FUI A;  4RTX A;  3CCL A;  5GAN j;  4I9E A;  2AZS A;  3ZHE B;  3HP9 A;  4DX1 A;  3PE3 A;  4XTX A;  1OV3 A;  2FBN A;  5EIB E;  2IO3 C;  4PLL A;  5CBO A;  3CC4 A;  5KJL A;  3MCX A;  3CPW P;  5ANR A;  2F5K A;  1E8Y A;  1IQR A;  2L2P A;  2J6K A;  4LXC A;  5FQ6 A;  3ABM E;  4CGW A;  1OOT A;  2CZ7 B;  4C8Q D;  1RUW A;  4GTS A;  3OXG A;  3GOX A;  3AG2 E;  1IKN D;  1RAA B;  3NBN B;  4CDM A;  2DXT A;  1JUQ A;  2FO7 A;  1TUD A;  2EGC A;  3CBM A;  3QWX X;  2IF4 A;  2KY9 A;  4AY5 A;  1QYM A;  1V29 B;  1A0N B;  3M4G A;  3CCE A;  3C3R A;  1N52 A;  2P9U G;  3Q49 B;  3R9A B;  4KBM B;  2R17 C;  2O01 E;  3SHW A;  1WDY A;  1A17 A;  2K4Y A;  5H7P A;  3QSU A;  1TTH B;  3RKW A;  5BT1 A;  1PD0 A;  1WJR A;  2WXK A;  3LY8 A;  4PLI A;  1KZP A;  2EIN E;  2DJQ A;  2M1H A;  2FPF A;  4EQF A;  4CRW A;  3VS5 A;  3G6E A;  4B6M A;  2EKO A;  3ULE G;  4RTY A;  2PZ1 A;  4PUC A;  2WAC A;  2X38 A;  3SWN B;  2L0I A;  5GMK h;  2KAF A;  2CHW A;  3FDH A;  1UGV A;  1YHQ Q;  1HG2 A;  3CK8 A;  3CPF A;  1Q81 U;  3VS2 A;  1KT1 A;  2KK4 A;  1Z9Q A;  5J3B A;  4U0Z A;  1M4Z A;  2IOL A;  4GCN A;  2WPV A;  3GF5 A;  3NPF A;  4DBQ A;  3RRM B;  3MHX A;  4M77 A;  5CCM A;  5IHI A;  3EG2 A;  3M0P A;  1QQJ A;  1VYV A;  2XPI A;  3CQT A;  1Y6I A;  4HCK A;  3VYH B;  2YT6 A;  2EAY A;  2OTJ A;  5HRY A;  4F04 B;  1TUG B;  2F8X K;  4M3O A;  2EIK E;  2J06 A;  2LTO A;  3L22 A;  5GAN 6;  4PJO G;  1X69 A;  4ANU A;  3E4B A;  3NTH A;  1IHG A;  4ZTJ A;  3SD5 A;  1HO8 A;  1KZO A;  3UPV A;  5KYY B;  5LJ3 d;  2C2L A;  2EVR A;  3J80 E;  4ANJ A;  4E2F B;  4GAA A;  1OU8 A;  4N5Q A;  4AG1 C;  5LJ3 h;  4GTP A;  1P92 A;  3LGL A;  5GAM d;  5GJW B;  2VXF A;  4EZK A;  4MZM A;  2CSQ A;  2QA4 Q;  3AU5 A;  2KZT B;  1AZE A;  2LNH B;  3U4T A;  1QVF P;  3L6A A;  1BI8 B;  3ENE A;  3JB9 I;  3C12 A;  2L0T B;  3HTR A;  4M77 D;  4ATZ D;  5CQY A;  3U3W A;  4BDZ A;  4M7A F;  3GNF B;  3S7D A;  1N9A A;  2AW6 A;  2KT1 A;  4XTW A;  3T9N A;  1M8M A;  2VUB A;  4BT9 A;  2VV5 A;  2PM7 A;  2M0O A;  3A8G B;  2WXR A;  5GAN 5;  4HVV A;  2L0A A;  4FYX B;  2DFU A;  3NMZ C;  1PKT A;  1D8E A;  2LNV A;  2YUP A;  5LOZ A;  3DKM A;  2V4L A;  3AHU A;  4J6Y A;  3FLG A;  3AJI A;  2Y4T A;  1KD1 R;  4EPC A;  1AWX A;  2Y69 E;  3V2X A;  2QQS A;  3KBG A;  3LYI A;  2XQ0 A;  2P9K G;  3MV2 B;  4ATO A;  3LH5 A;  1CKB A;  2E6N A;  1S63 A;  1ABQ A;  3L1A A;  5FIO A;  3APF A;  1RLP C;  4F7U B;  2IQC A;  4LN2 A;  4ACK A;  1PKS A;  2RPN A;  3ZEF A;  2QQB A;  3I9Q A;  4LD9 K;  4ESR A;  4AEZ C;  2NLU A;  2EIM E;  2DL3 A;  2YIN A;  2CS7 A;  2W0Z A;  4N4G A;  1ZBJ A;  5C0M A;  3OYH A;  3J5P A;  3FH8 A;  3T9K A;  2DE0 X;  1WIE A;  1M5Q 1;  4XU1 A;  3CHS A;  3D9I A;  3Q15 A;  4XI9 A;  2DCP A;  4B8A A;  3MEK A;  2YHT A;  3UM0 A;  2AXZ A;  2DEQ A;  2WSE E;  3C0C A;  3RNJ A;  4WTO B;  5AIJ A;  1M9S A;  2H6I A;  3QWP A;  3KEA A;  5FZQ A;  3PEV B;  2RH2 A;  4RCC A;  1VQM Q;  5KYX B;  2WSC E;  3EGD B;  3CEQ A;  1W4S A;  1ZA1 B;  2PVG B;  3OYN A;  4C92 C;  3CCR T;  4PFZ A;  1KQS S;  1H19 A;  1NZ9 A;  1U06 A;  4AM9 A;  1WQ7 A;  4J9C A;  5GAN e;  3MKQ A;  5I22 A;  2R57 A;  2KXP C;  4XU3 A;  1V1C A;  2E2E A;  2Y1L E;  3G2W A;  3UQ3 A;  1C0M A;  1K0X A;  4TUU A;  3UT8 A;  3JCM e;  2P4R A;  4JJN K;  3CR3 A;  4K03 A;  2RHY A;  4Z8A A;  4C92 E;  3RER A;  1IGQ A;  1JJ2 S;  2FEZ A;  3B13 A;  4KZC A;  1WA7 A;  1ZX6 A;  1NEB A;  1WPY A;  4Z88 A;  3Q78 A;  2EFI A;  3OYM A;  1NE8 A;  2JS0 A;  3E2U A;  3JCM W;  3EHN A;  1PAQ A;  2HBW A;  1YHQ T;  2EKH A;  3OA6 A;  2O88 A;  4PK4 A;  1GCQ C;  3QJZ A;  1YI2 A;  2CP6 A;  3UA7 A;  1SRL A;  2M9U A;  4JA9 A;  2FB7 A;  3G71 T;  2SRC A;  4JVS A;  1X75 C;  4XTU A;  4ZGE B;  3JCM X;  3ZPJ A;  4CC2 A;  4OAV B;  1UUE A;  3N71 A;  1D1A A;  2NC9 A;  2DF6 A;  1WLP B;  3JSC A;  2DXC A;  1GBQ A;  1HX8 A;  3I3N A;  4HCZ A;  5AEN A;  3MA5 A;  5B3S E;  1XOV A;  1VQ5 Q;  2V8I A;  2H6F A;  1W2B S;  1WHK A;  1HE8 A;  2QXF A;  4M7D C;  3SY2 A;  5CED B;  3A98 A;  5AT1 B;  3OS2 A;  3V7R A;  1VQK Q;  2ETB A;  4IRU A;  1N27 A;  4E7I A;  4YDE A;  2LXM A;  1CSK A;  1XTD A;  5DLO A;  3JCM J;  3OSV A;  3BDU A;  2QA4 T;  1FCH A;  2ZIS A;  4OMF B;  5GAM j;  1N9R A;  2H3E B;  2KAT A;  4U8Y D;  1RLQ C;  1IRE B;  1M1K C;  5LJ5 d;  3RSE G;  5JA4 D;  1SF9 A;  1JXO A;  2BKG A;  4KVO A;  4J9H A;  2YNQ A;  4BE0 A;  4PJJ A;  1HZ4 A;  2MYO A;  2V5F A;  4FC8 A;  4HXI A;  3VTX A;  2VYT A;  2FL7 A;  3UXG A;  4U95 D;  3LS8 A;  5DIZ A;  3NFC A;  5I2S A;  1N9S A;  2P0P A;  4ZGJ B;  2DYB A;  1JCS A;  3OTN A;  3FFL A;  4V2S A;  2J6F A;  3CCL Q;  5CKD A;  3EHR A;  4FU3 A;  4J8D A;  4YVO A;  1YJ9 Q;  5JJ7 A;  1KC8 R;  2PNI A;  2NUP A;  3X24 B;  2B86 A;  3RUX A;  2R59 A;  1U3O A;  2CP7 A;  1X43 A;  1EF1 C;  4LNU D;  2MOX A;  2RJD A;  2NXP A;  4BSX A;  1NBE B;  1O1T A;  4KBQ A;  3FB9 A;  1P5Q A;  1KLX A;  2K3Y A;  4OGC A;  1WX6 A;  4AIF A;  2XGS A;  4JHJ A;  2DZO A;  2KI7 A;  4J7W A;  2Y4U A;  1VQ8 Q;  4G2V A;  4O1O A;  3GNG A;  2J9Q A;  3CVL A;  2AIR B;  2MPX C;  4O5V A;  3OQ5 A;  2QTX A;  3ABK E;  5G04 C;  2LX7 A;  4PJO A;  1VQM T;  5C2Y A;  5FQ7 A;  1GL5 A;  3LKU A;  4M7A B;  3G1J A;  4C8Q C;  1JWG A;  3CHQ A;  4K11 A;  2R5S A;  5EIL A;  1BI1 A;  5FU6 C;  2J4D A; 
#chains in the Genus database with same CATH homology
 3THK A;  3RBB B;  2CT3 A;  2V1R A;  2LMJ A;  2DBK A;  3O5Z A;  3EHQ A;  1EFN A;  4ORZ A;  3TSZ A;  1GCQ A;  1S1N A;  1G2B A;  1N11 A;  1JO8 A;  2CUB A;  2DL7 A;  3TWX A;  1ZUU A;  3DEP A;  3Q9U C;  4CC4 B;  4F16 A;  2EW3 A;  5AAR A;  1AWC B;  2DL8 A;  2G6F X;  2KGT A;  1Y0M A;  2QYJ A;  3V31 A;  4K5C A;  1UG1 A;  2FRY A;  3VS6 A;  4HXJ A;  1ZUK A;  2FG0 A;  1KJW A;  5JMN D;  3ZU7 B;  4RTW A;  5EYL A;  2GGR A;  3SEM A;  3IXE A;  4GLM A;  3JXJ A;  1HSQ A;  2JM9 A;  5FW9 A;  3R6N A;  5IXF A;  4JZ4 A;  3D9H A;  2V4H C;  3HG0 D;  4NIK A;  5IHK A;  1CKA A;  5IXB A;  2DBM A;  4OMM A;  3ZUV B;  2L3P A;  2AZV A;  2B0O E;  1YCS B;  3TWW A;  3TWR A;  4OMN A;  1WXT A;  1OEB A;  1HJD A;  1M3A A;  1WYX A;  2BZY A;  3EG0 A;  5FWC A;  1TR4 A;  2JXB A;  2VGE A;  2PNN A;  1SPK A;  2J8S D;  1PRL C;  2C0I A;  3SO8 A;  1RI9 A;  1MX6 A;  3ZNG A;  4F1P A;  2AK5 A;  4HRL A;  4RTT A;  1IHB A;  3M0Q A;  1T0J A;  3KFV A;  3UA6 A;  2O9S A;  2J6O A;  4TUM A;  4M4Z A;  4F6R D;  5AQB A;  2V1Q A;  4HI8 A;  2JMC A;  2YUO A;  4G8L A;  5KBA A;  4LUE A;  4AFQ C;  1IO6 A;  4J9I A;  1ZLM A;  5AN8 A;  1SHF A;  2DMO A;  2LP5 A;  2VVK A;  1YYH A;  4JZ3 A;  2LCS A;  1QKX A;  1MX4 A;  1M3B A;  3ZL7 C;  4DX6 D;  1Y57 A;  2GTO A;  2HEQ A;  3REB B;  3AAA C;  1VA7 A;  1QLY A;  4G8K A;  1PRM C;  4HRM B;  1QWE A;  2RN8 A;  3M0S A;  1NM7 A;  2XEH A;  1YWP A;  3TWT A;  2K6D A;  1JEG A;  2EBP A;  2YUQ A;  4RUG A;  2HDA A;  1BK2 A;  4R0K A;  5L23 A;  4YDY A;  4HI9 A;  2OAW A;  1BI7 B;  1KSW A;  2GTJ A;  4RTU A;  4GBQ A;  2DIL A;  2NWM A;  1H92 A;  1YN8 A;  2DA9 A;  3B7B A;  4Z68 A;  4JJD A;  4K5B A;  2OI3 A;  5BXU A;  1ZUY A;  2AKK A;  2A5E A;  4GPM A;  4J9G A;  1OPK A;  2EGE A;  1AWW A;  3LJN A;  4Y92 A;  1QKW A;  2RF0 A;  2A08 A;  2K2M A;  3M0R A;  2RFM A;  1W70 A;  2XZD G;  3V2O A;  3JUE A;  3I5S A;  1UOH A;  3TVT A;  2EYW A;  1M3C A;  2RNA A;  1NLO C;  5AQ9 A;  2C0T A;  1X2K A;  3H0F A;  2JMA A;  3M0U A;  1UE9 A;  4J9B A;  1GRI A;  1SSH A;  2KXC A;  5EC7 A;  1JU5 C;  2L3S A;  1UJY A;  1K0S A;  1SW6 A;  1UTI A;  2H8H A;  2NYJ A;  1PWT A;  1UDL A;  2GBQ A;  3TWV A;  2RQT A;  2KRM A;  3EGU A;  2BZX A;  4HVW A;  5FWB A;  1MV0 B;  3VS7 A;  4F14 A;  2FO1 E;  1K3Z D;  5EYP F;  3W9G A;  1HD3 A;  1WXB A;  2FPE A;  4QFV A;  4DX7 D;  1WI7 A;  2O9V A;  1YNZ A;  4D8D A;  4RTZ A;  4GMR A;  1N0Q A;  4HQD A;  2CUD A;  3QWY A;  3NOG D;  2JS2 A;  2KBT A;  1WFW A;  5CEC B;  2CH4 A;  3PE0 A;  1H3H A;  1AWJ A;  3I35 A;  2GNC A;  4RTX A;  2XEN A;  3GBQ A;  3VS3 A;  2RMO A;  3T8K A;  2HCK A;  2AZS A;  2RQU A;  4DX1 A;  4QT7 A;  3V79 K;  2E5K A;  5ENT D;  1OV3 A;  5EIB E;  2BZ8 A;  4QQI A;  2VKN A;  5CER B;  2ROL A;  4CC7 A;  2LZ6 B;  5CBO A;  1FMK A;  2CSI A;  4HBD A;  2L2P A;  2J6K A;  5ECA A;  1OOT A;  1UJ0 A;  1RUW A;  2W10 A;  2DWZ A;  3Q9N C;  1U5S A;  4J9E A;  3HRA A;  1B3Q A;  3M0T A;  1IKN D;  3NBN B;  2ECZ A;  2EGC A;  2YDL A;  3QWX X;  1TUD A;  4IIM A;  1YMP A;  1AEY A;  1QYM A;  4BSZ B;  1QCF A;  2EYX A;  4KRT A;  1A0N B;  4DRX E;  2LQW A;  4ZNX A;  4D8K A;  5FIN A;  1K9A A;  4ZHB A;  1NEG A;  3SHW A;  1WDY A;  1UHF A;  1H8K A;  1WDX A;  5IH2 A;  2F2V A;  2YSQ A;  4CC3 A;  2K79 A;  1GCP A;  4BET A;  2F8Y A;  4HVU A;  4Z89 A;  2AKL A;  2DJQ A;  2EYY A;  1MUZ A;  1BD8 A;  2FPF A;  2FO0 A;  4E6R A;  1G3N B;  2J05 A;  3VS5 A;  4RTY A;  1DCQ A;  4DX2 A;  2PZ1 A;  1GFD A;  2HSP A;  1OT8 A;  1X27 A;  2KYB A;  1NLP C;  4DX5 D;  4A63 B;  1TG0 A;  4F17 A;  1UGV A;  4HLL A;  1SRM A;  1X6B A;  3TSW A;  3VS2 A;  1LCK A;  1Z9Q A;  3VRY A;  2KEA A;  1UHC A;  2DLP A;  2DX1 A;  2KYM A;  3NPF A;  4WCI A;  3J5Q B;  2DZN A;  2F37 A;  3EG2 A;  1BU1 A;  1VYV A;  1W6X A;  3M0P A;  5ENS D;  5IHI A;  5EN5 D;  3CQT A;  4HCK A;  4O1P A;  2YT6 A;  5HRY A;  1W1F A;  1E6H A;  2F8X K;  5HKP A;  4LUD A;  2X3W D;  2J06 A;  2D8J A;  3FJ5 A;  3ZKJ A;  2D0N A;  2FEI A;  1X69 A;  2XMF A;  5ENQ D;  2J7I A;  2I0N A;  1NYG A;  4YDW A;  2LJ0 A;  2QDL A;  4LG6 A;  1T3S A;  4B93 B;  5ITZ F;  2IIM A;  1T0H A;  2CDT A;  4JB8 P;  2BKK B;  2EVR A;  2A36 A;  5GJV B;  1WXU A;  1E7O A;  4N5Q A;  4AG1 C;  1FYN A;  1UFF A;  2EGA A;  2MIO A;  5GJW B;  1J3T A;  2CSQ A;  1SVX A;  1AZE A;  2KXD A;  2LNH B;  3H0H A;  1BI8 B;  2KNB B;  2YUN A;  4ATZ D;  5AQA A;  3VRZ A;  2K3B A;  3NGP A;  3B95 A;  3NHN A;  2A37 A;  1AD5 A;  5ENO D;  2KT1 A;  2LJ3 A;  3PVL A;  1M27 C;  1M8M A;  2OJ2 A;  5HCK A;  2ETA A;  4HVV A;  2L0A A;  2NUZ A;  3REA B;  1I0C A;  4RLY A;  3NMZ C;  1PKT A;  2YUP A;  3AJI A;  1AWX A;  3V2X A;  1TUC A;  2M0Y A;  5ENP D;  4OAU C;  2PTK A;  2DVJ A;  1UEC A;  3LH5 A;  1CKB A;  1ABQ A;  2ABL A;  4O60 A;  5FIO A;  1RLP C;  1KIK A;  1N0R A;  3PVQ A;  2XZT G;  1I07 A;  4LN2 A;  3JXI A;  1PKS A;  2JAB A;  1X6G A;  2RPN A;  3I9Q A;  1K1Z A;  3DEO A;  5ENR D;  2CH4 W;  4ESR A;  1MJ0 A;  4JJC A;  4OMO A;  2K7A A;  1NFI E;  2DL3 A;  2W0Z A;  1ZBJ A;  1K1A A;  3J5P A;  3T9K A;  2JTE A;  4X1V A;  2EYZ A;  2DE0 X;  1NG2 A;  1WIE A;  4OMQ A;  3UTM A;  2KT8 A;  1PNJ A;  3I5R A;  4OML A;  3C0C A;  3RNJ A;  4OMP A;  1MYO A;  2EQI A;  5KWD A;  4RTV A;  5I11 A;  3W9F A;  2L6B A;  2LQN A;  3KEA A;  2KE9 A;  4U96 D;  4FSS A;  1JXM A;  3VS0 A;  2Y0B G;  4DEY A;  4J9C A;  4UUC A;  2RFA A;  1U06 A;  2CRE A;  2DL5 A;  1KFZ A;  1ABO A;  5I22 A;  2KBX A;  2KXP C;  1V1C A;  2Y1L E;  3UI2 A;  4HRN A;  2VWF A;  4J9D A;  4BES A;  1A5E A;  2M51 A;  1K0X A;  2AJA A;  3EG1 A;  1QWF A;  2P4R A;  3EG3 A;  4Z8A A;  1PHT A;  5HS0 A;  1OY3 D;  1ZX6 A;  1WA7 A;  1NEB A;  2KRO A;  1T3L A;  3V30 A;  4Z88 A;  5IHN A;  2JS0 A;  2HBW A;  1N5Z A;  2EKH A;  2O88 A;  1GCQ C;  4DUI A;  1K1B A;  2JT4 A;  3UF4 A;  3UA7 A;  2HE0 A;  1NYF A;  1SRL A;  2SEM A;  1BLX B;  2C0O A;  4AG2 C;  2SRC A;  2DL4 A;  4BEP A;  2ROT A;  2V5Q C;  4CC2 A;  3U23 A;  4OAV B;  1WG0 A;  1UUE A;  4LE9 A;  5D66 A;  2DF6 A;  4AFU C;  5AAO A;  1YP5 A;  1WLP B;  1AWO A;  2XEE A;  1GBQ A;  5BXO A;  3UAT A;  2P2C P;  1BB9 A;  2DNU A;  1SEM A;  2FRW A;  1XOV A;  1X2Q A;  4EIK A;  2ED1 A;  3NOC D;  4DEX A;  5CED B;  3A98 A;  2K9G A;  3ULR B;  2ETB A;  4ZFH A;  1BU9 A;  5CEA A;  3IQL A;  4LNP A;  2RQR A;  3JV3 A;  1CSK A;  3H41 A;  5KNH D;  1VYU A;  2RQV A;  3H0I A;  5AQ7 A;  5EID A;  2JW4 A;  4AFZ C;  4CZ2 D;  3C5R A;  2F2X A;  2DM1 A;  2O2O A;  3VS1 A;  1OPL A;  4U8Y D;  2BTT A;  1RLQ C;  2JM8 A;  4C48 B;  4JPB W;  2DRK A;  3VS4 A;  5JA4 D;  1JXO A;  4K5A B;  2ETC A;  2BKG A;  1K76 A;  1AP7 A;  2KRS A;  4J9F A;  3TWQ A;  4J9H A;  2DRM A;  2MCN A;  4U8V D;  2QC9 A;  2MYO A;  4BER A;  2RQW A;  3UXG A;  2KRN A;  4U95 D;  1E6G A;  1VYT A;  1AVZ C;  1MX2 A;  1K4U S;  1GFC A;  1AOJ A;  2FPD A;  2X3X D;  2ZGD A;  2D8H A;  2DYB A;  5CBN A;  2ZGG A;  1BBZ A;  1M30 A;  1ARK A;  2J6F A;  1JQQ A;  3EHR A;  1Z9Z A;  2PNI A;  2LJ1 A;  2O31 A;  2B86 A;  1U3O A;  4LSZ E;  1X43 A;  1S70 B;  4JJB A;  4LNU D;  2MOX A;  4IIO A;  1IXV A;  2GQI A;  2D1X A;  1WX6 A;  2KR3 A;  3EU9 A;  5KNG A;  1SHG A;  2DZO A;  3TWS A;  1ZSG A;  4J7W A;  2A28 A;  2EPD A;  4J8Y A;  4O1O A;  4AFS C;  4HB5 A;  2DVW A;  2ED0 A;  4HNA D;  1YWO A;  3F6Q A;  2F2W A;  2LX7 A;  1GBR A;  1G83 A;  1I1J A;  1GL5 A;  2L3Q A;  4CYM D;  1MV3 A;  2ENM A;  4K11 A;  1B07 A;  5EIL A;  3TWU A;  1DC2 A;  1D9S A;  2CT4 A;  1AZG B;  2ESW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...