1YCSB

P53-53bp2 complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
193
structure length
193
Chain Sequence
PLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGITALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAVFAMTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYEPQNDDELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the p53 tumor suppressor bound to the ankyrin and SH3 domains of 53BP2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (anti-oncogene/ankyrin repeats)
molecule keywords P53
total genus 46
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 1996-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00018 SH3_1 SH3 domain
B PF00023 Ank Ankyrin repeat
B PF13606 Ank_3 Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1ycsB01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ycsB02
4GLMA 4OMNA 1SRMA 2CT3A 3VS3A 3AJIA 3EGUA 1GBRA 4HRLA 4BETA 2F8YA 2BKKB 3D9HA 3VS7A 2XEHA 2I0NA 4O1OA 4JZ4A 2A37A 1OPKA 1WG0A 2KXCA 4AFSC 2K79A 1TG0A 2EBPA 3M0RA 4JJDA 1A0NB 3VS1A 2B86A 1VYVA 2A36A 2BTTA 1E6HA 2KNBB 5FWBA 1BI7B 3EG1A 5ITZF 3JV3A 3ZKJA 2V1RA 1M27C 1GL5A 2JM9A 2Y1LE 4J8YA 1X43A 4CZ2D 2V1QA 2J06A 3T8KA 3V79K 2LX7A 3M0PA 3QWYA 3TWSA 2J05A 2J6OA 3SEMA 1A5EA 5IH2A 1W70A 5KNGA 2JMAA 1BU1A 2JMCA 4K5AB 2L6BA 1X2KA 3VS0A 5EYPF 3ULRB 3UTMA 2LZ6B 2YUOA 4CC4B 4JJBA 4DX6D 2MOXA 3EG0A 1GFCA 1PNJA 3R6NA 2CT4A 2C0OA 1ARKA 5ENSD 1AWJA 2LQNA 2ROTA 2XENA 1YWPA 2ED1A 5CBOA 2VGEA 1U06A 2GQIA 3AAAC 2VKNA 1M3BA 1HD3A 2VVKA 4B93B 5CBNA 2ED0A 2EW3A 2W0ZA 4AG2C 2Y0BG 2DM1A 3B7BA 1RUWA 2RPNA 2DWZA 1PKTA 1MX6A 2DZNA 1N0RA 4D8KA 2X3XD 1MX2A 1NEGA 5EN5D 1UUEA 2K6DA 2D1XA 1W6XA 2DYBA 2KBTA 4GPMA 2HDAA 4OMPA 1X6BA 5FIOA 4OAUC 2BZ8A 2KEAA 1S1NA 2CSIA 1VYUA 1OV3A 1WA7A 2GGRA 2O88A 3PE0A 4Y92A 1H3HA 1X69A 1NFIE 2RQRA 4E6RA 2FRYA 2LJ0A 4A63B 2FRWA 2ESWA 4J9GA 1SHFA 4BESA 1AWOA 5AQBA 5IHIA 5D66A 2JW4A 4JB8P 2O9SA 2KYBA 2KGTA 4G8LA 5FWCA 1NYFA 4HCKA 4DUIA 2GTJA 4OMQA 1GBQA 4RTUA 3NBNB 2KE9A 1BD8A 2JTEA 4RLYA 1KJWA 4U95D 4DX2A 1OOTA 1AWWA 1RLPC 2QDLA 4LN2A 5CERB 5AQ9A 1JQQA 2FPFA 4F6RD 4C48B 3A98A 4G8KA 2EYYA 4AFZC 2LMJA 4LE9A 3UA6A 3VS5A 1N5ZA 1CKAA 1WLPB 1JXMA 4YDYA 2D8HA 5HS0A 4RTWA 3W9GA 4LUDA 3F6QA 1WXUA 2DILA 2AKKA 1W1FA 2C0IA 1HJDA 1G2BA 4YDWA 1Z9ZA 1K0XA 2EYXA 1FYNA 1TUCA 1ZBJA 3TWQA 1Z9QA 2KBXA 3EG3A 1K1AA 4QQIA 1MJ0A 1N0QA 2M0YA 5CECB 1UE9A 1MUZA 1NLPC 2AK5A 2K2MA 1KIKA 4HVUA 1V1CA 1K76A 1KFZA 1GCQA 1T0HA 4LUEA 4J9BA 2FO0A 3JXIA 2J6KA 3LJNA 4N5QA 2DL5A 4OMOA 4CC7A 1WIEA 2X3WD 5EYLA 5CEDB 1UTIA 3UF4A 2LNHB 5ENPD 1HSQA 1BK2A 5EIDA 4HQDA 3IQLA 4J9EA 3CQTA 3C0CA 2MCNA 2V5QC 3EG2A 4HRNA 2DVWA 2PNIA 5IHKA 2A28A 3ZNGA 1MYOA 3KEAA 4R0KA 4LSZE 1QKXA 2JXBA 2KR3A 1Y57A 4NIKA 4O60A 2L2PA 2GTOA 3VS4A 3Q9UC 1MV3A 4ESRA 4K5BA 2IIMA 3HG0D 3UXGA 1UDLA 1H8KA 1K4US 3THKA 2CDTA 2CUBA 4ZFHA 2DL7A 2DL4A 1AVZC 4HLLA 5EC7A 3RNJA 3NHNA 4K5CA 3J5QB 3NOCD 3H0HA 5IXBA 5AARA 1NYGA 2GBQA 3DEPA 1YMPA 2LP5A 3DEOA 3JUEA 4RUGA 2D0NA 2XZTG 4HI9A 1TR4A 1BBZA 1WX6A 2KT8A 1E6GA 2RQWA 2DJQA 2EKHA 1JXOA 2DMOA 4HBDA 2G6FX 3V30A 2FG0A 2KT1A 3I5SA 3TSWA 2L0AA 2YUPA 1LCKA 4BERA 2XZDG 5ENTD 4DX5D 2ABLA 2YUNA 1JO8A 4ZHBA 4D8DA 4HXJA 2HBWA 4LNUD 3J5PA 2KRMA 4CC2A 4LNPA 4EIKA 1E7OA 4KRTA 1ZLMA 3V2XA 1SPKA 5CEAA 2P2CP 2L3SA 2EYZA 2OAWA 3VRZA 1BU9A 3JXJA 1WXTA 2E5KA 2BZXA 1X2QA 2BZYA 4Z89A 1Y0MA 2F2XA 1G3NB 2DNUA 4TUMA 4HI8A 2DBMA 3FJ5A 2JABA 4JJCA 2QC9A 2DVJA 4HB5A 3LH5A 5EIBE 2DLPA 1ABQA 2LJ3A 1QCFA 2XEEA 2RQUA 3I9QA 4HNAD 1BLXB 2KROA 3HRAA 4F14A 4X1VA 3H0IA 2LJ1A 5ENRD 5BXOA 2FO1E 1YP5A 2ETCA 1I07A 2CH4A 2DX1A 1IO6A 3PVLA 3T9KA 4HVWA 5KWDA 2NWMA 2PZ1A 2RN8A 3M0QA 5ECAA 3C5RA 1JEGA 3I5RA 1SW6A 3NGPA 1WDYA 2FEIA 1K9AA 4AG1C 1BI8B 1X6GA 1G83A 2DF6A 3EHRA 1QLYA 3W9FA 3TWTA 3V2OA 4OMLA 1N11A 5HRYA 1NM7A 1SEMA 3ZU7B 1SSHA 3TVTA 3PVQA 1QYMA 2RQTA 1WFWA 3ZL7C 2W10A 2M51A 2LCSA 4F17A 3O5ZA 2J7IA 5JA4D 2EGAA 2DBKA 4BEPA 1M3AA 2SEMA 4J9IA 2KRNA 4Z68A 1OY3D 2F2WA 1YNZA 1ZUKA 1U5SA 1IXVA 1UJYA 4FSSA 4J9DA 1PWTA 1K3ZD 2F2VA 2EGEA 2RMOA 2F37A 1FMKA 2NUZA 4RTVA 1SRLA 2AZVA 4U96D 3NMZC 3ZUVB 1BB9A 4BSZB 3GBQA 2CH4W 2RNAA 5I11A 4F16A 1J3TA 2EGCA 3H41A 3QWXX 4K11A 1PRMC 2HEQA 2DRMA 2ZGGA 2JM8A 2CREA 2KYMA 1XOVA 2GNCA 2L3QA 1OPLA 1GFDA 1NLOC 3M0SA 1QWEA 1I0CA 2ENMA 2FPEA 2L3PA 1UHCA 5JMND 2HE0A 4IIMA 1UECA 4RTXA 1RLQC 2V4HC 2ROLA 1EFNA 1M8MA 2LQWA 4AFQC 1UGVA 1NEBA 5FINA 3NOGD 4LG6A 2C0TA 2DL8A 2ZGDA 5IXFA 1NG2A 4U8YD 1QWFA 4F1PA 1UFFA 4ATZD 1U3OA 1VA7A 2AKLA 1DC2A 3VS2A 3VRYA 2OJ2A 3H0FA 1D9SA 3KFVA 4Z88A 1ZX6A 2KRSA 4Z8AA 5FW9A 1UOHA 1GRIA 1S70B 3EU9A 1AP7A 2MIOA 2O31A 1ZUUA 1AWCB 2H8HA 1K1BA 4ORZA 2DE0X 1B3QA 2HCKA 2F8XK 3M0UA 5ENQD 4DEXA 2DA9A 4OAVB 2RFAA 2YSQA 4AFUC 3TWXA 4J9HA 4CYMD 2EPDA 5HCKA 2JS2A 1WDXA 1T3SA 1GCPA 2EVRA 1AOJA 3TWVA 1AWXA 5L23A 2PNNA 3TWWA 2MYOA 4J9FA 1AZGB 1AD5A 1ZUYA 1M3CA 2EYWA 4GMRA 3REAB 3TWRA 1I1JA 1VYTA 4J9CA 1B07A 2DRKA 2NYJA 2QYJA 2P4RA 4HVVA 5IHNA 2OI3A 3EHQA 4JPBW 2KXDA 5GJVB 1H92A 2EQIA 4M4ZA 1T0JA 4DX7D 2SRCA 4GBQA 3UATA 1K1ZA 5AQ7A 3RBBB 1K0SA 1M30A 1PKSA 2ECZA 5AQAA 4RTYA 3NPFA 2J8SD 4DX1A 2DL3A 1ABOA 2HSPA 2K3BA 4RTTA 2RFMA 1IKND 5HKPA 1CKBA 1T3LA 1X27A 3UI2A 3M0TA 3SO8A 4ZNXA 5KBAA 3IXEA 2J6FA 1OEBA 2YDLA 3REBB 1YWOA 4IIOA 2B0OE 3SHWA 1OT8A 1YYHA 1SHGA 2JS0A 1IHBA 1UJ0A 1KSWA 2FPDA 1DCQA 2K9GA 1QKWA 2CSQA 4DEYA 1AEYA 3I35A 2JT4A 1WYXA 2K7AA 3B95A 5I22A 1AZEA 4HRMB 4QFVA 4U8VD 5AAOA 2AJAA 2DZOA 4O1PA 1UHFA 2O9VA 1JU5C 2VWFA 4JZ3A 2YUQA 4DRXE 3TSZA 3U23A 1WI7A 1GCQC 2RF0A 1RI9A 1WXBA 5AN8A 2YT6A 2A5EA 2PTKA 2CUDA 2D8JA 4QT7A 2RQVA 1SVXA 2AZSA 5BXUA 2BKGA 3TWUA 2XMFA 4OMMA 1ZSGA 1PRLC 5KNHD 4RTZA 1UG1A 5GJWB 2O2OA 1TUDA 4UUCA 5ENOD 2ETBA 1CSKA 1PHTA 4CC3A 1YN8A 3V31A 4WCIA 3VS6A 5EILA 2KXPC 2A08A 1MV0B 1MX4A 4J7WA 3Q9NC 3UA7A 2ETAA 1YCSB
chains in the Genus database with same CATH superfamily
4GLMA 3VS3A 4NOYA 4O6JA 5LCWJ 4HRLA 1VQ8A 2BKKB 3D9HA 1VQLA 2GRPB 1OPKA 4GY5A 1WG0A 1O9SA 5FT9A 1TG0A 2XCCA 2B6CA 3FWVA 3JB9I 1HXDA 3M0RA 3CCUT 2OTLQ 2XDPA 2ZPIB 3HPWA 2JTMA 3QO3A 2BEDA 2A36A 3KBGA 1E6HA 2R5AA 3X26B 4EDUA 4AY5A 2NUTA 1OCZE 4ZGDB 3BU8A 1BI7B 2FZGB 5HY6A 2AHJB 3JV3A 3DSUA 1Y96A 4CRWA 2V1QA 4BY6B 2J06A 3ML8A 3CCQQ 2FI7A 3M0PA 2J05A 2J6OA 4YVOA 3X24B 3RR6A 3B7UX 1BU1A 2RM4A 1XNFA 2L6BA 3LKUA 4BE1A 2DERA 5EYPF 3ULRB 3G2WA 2F69A 5FTPA 1HF8A 2LZ6B 3FHEA 3MEKA 3M53A 2MOXA 3R6NA 4HOUA 1ELKA 4U63A 3B7SA 3L54A 2C0OA 3RKWA 4I2ZA 4I9EA 2C06A 2LQNA 3B13A 3L9TA 1H2TC 5CBOA 3L2WA 4JRQA 2LCCA 2VVKA 5CBNA 4DPRA 2Y0BG 1N54A 2RPNA 1VQNT 5EX3A 1MX6A 1N0RA 1MX2A 5B1AE 5EN5D 2CG2A 2D1XA 4F7UE 1W6XA 2KBTA 4GPMA 2HDAA 2MMPA 4OAUC 4ZGJB 3HKSA 3NZSA 2CHXA 2KEAA 1S1NA 5DLOA 5G04J 2L8DA 3CK7A 1WA7A 3INZA 3ZFJA 2WXMA 1H3HA 1X69A 1NPRA 4XU2A 3SZ7A 2XU8A 4W9RA 5T3RA 5CCMA 4M78G 4A63B 2KM4A 1OX9A 2NLUA 3QWWA 3EG9B 1SHFA 4BESA 1H641 1AWOA 3E9FA 5AQBA 3UKUG 2JW4A 2O9SA 3MZLB 1VQ5A 4M7AA 3CMAT 3RO2A 4B0ZA 1X01A 2FHDA 2GTJA 2QYUA 4PL6A 3P1UA 3TXMA 2KE9A 5J3BA 1AT1B 3JB9J 3V8LA 4N0AC 4U95D 5DLQE 1AWWA 1N95A 3M4YA 1XJWB 2G3RA 2QDLA 4OF1A 1UJKA 2H6FA 2FZKB 5CERB 4LN2A 3A98A 4F6RD 3OW2S 4GA2A 3LEWA 1SZ9A 4XI0A 4AOFA 4C5EA 2H6HA 5I21A 2PQWA 3CSFA 2PQRA 4E85A 3CCET 3MCXA 3VS5A 1CKAA 3VUBA 2RK2A 2I9CA 4G2VA 1JXMA 3FTUA 1LPLA 4YDYA 2D8HA 5CRVA 2CP7A 2WMOA 3ZHEB 4OVUA 1OU9A 3HRUA 3NQPA 1MMNA 2RI2A 4YDWA 3A8OB 1VQOA 4X8QA 5GMKh 1PSEA 4EZLA 4JW1A 4APOA 1TUCA 2X4WA 2UWJG 3FRNA 3UIOC 4PJJA 2X9HA 3JCMh 3OYCA 1ZA1B 3AT1B 4TVRA 4ELZC 1NLPC 1MMGA 5CKEA 1KIKA 4HVUA 4ANWA 3PT9A 1K76A 1PD0A 1SKUB 5CAIA 1T0HA 3I4GA 2DXTA 2J6KA 1I4K1 4FCYA 3TXNA 1YITQ 1G3WA 4N4GA 4M75G 3R9MA 4C8QD 3JB9D 2X4XA 2IQCA 3ASHA 3PUJA 3GNFB 3DXMG 2BE7D 4B9XA 4M75F 1WHMA 2HMAA 1M8VA 1X81A 4J9EA 4MZTA 2V8SE 2H3JA 2M63A 3OYYA 1WQWA 1N9SA 4EBAG 2QY7A 2K5LA 3ESLA 8AT1B 3RDVA 2J09A 3CHMA 1MYOA 3KEAA 3HFNA 2MRIA 4I2WA 2LX9A 3CVQA 4BACA 4R0KA 2JXBA 1YJWQ 4VUBA 4O60A 5GAMe 5CIUA 4JD2G 3G6ET 4ESRA 3WXMB 3HG0D 1D0XA 2YRCA 1UDLA 4WNEA 1D1AA 5CHEE 1IXDA 3Q49B 2CDTA 3OYBA 1G8XA 1AVZC 4HLLA 3RNJA 3NHNA 2HL5C 2ZISA 2MI6A 2P58C 2QASA 2GBQA 3ASNE 4RKUE 1VQ9T 1KPSB 2X4YA 2M02A 4XE0A 2LP5A 3DEOA 3JUEA 3OSSC 2PVDB 3J7AF 4M77B 4C0EA 1TR4A 3LGFA 2R58A 2DCPA 3E1SA 5A2QE 1LOJA 2RQWA 4GMLA 5G2NA 1D8EA 5FJYA 1D1CA 3UUXA 1JXOA 2VSYA 1U1TA 4ZGEB 3L2VA 4YNDA 4J6IA 4QW2A 2KT1A 1VQ4A 3Q7AA 3C4SA 2RHUA 2HNIA 4DX5D 1JO8A 2FULA 4ZHBA 3TREA 2EFIA 3QXEB 1VQ7T 3BW1A 1JCQA 4AMCA 3OYDA 4UQXA 3CV0A 4EIKA 1Q81C 3LY8A 5KYUA 3JB9G 3JUIA 1YIJA 3LVRE 2CP3A 4B6MA 1OCRE 1EYHA 1ZA2B 1M2VB 1N9RA 1OXJA 2E5KA 3JXJA 3MEWA 1Z3XA 4Z89A 2VYIA 1G3NB 1Q82C 1DNPA 3AS4A 2H6IA 4IYPA 4M7AD 4ILHB 1O1RA 4HB5A 2R57A 4X9DA 5A7DB 5EIBE 2K57A 3E19A 3LH0A 1N4RA 3D9NA 4RG6A 2R05A 2C2LA 4C5GA 3DSSA 2KROA 5G55A 4F14A 5BV0A 3H0IA 4JA7A 4XTUA 4KT0E 2ETCA 2YNQA 5D6XA 3T9KA 5GMKj 4A4FA 3META 4L2LA 1N9AA 2XDDA 3GF5A 1M1KC 1EDUA 1RI0A 2LAHA 3WVEB 1SW6A 3VUZA 4LDXA 1IREB 2CZ7B 3G2SA 1WM5A 1S64A 4N39A 4C8QE 3LJ3A 1KHIA 3EHRA 2VTBB 2DIQA 3TWTA 1N11A 4M7AC 1SEMA 1FX7A 2QZAA 2LXLA 2P9UG 3PVQA 1WHHA 1VQ7Q 3SDZA 4AJWA 4F17A 2PL2A 3O5ZA 2EIKE 4E7IA 3SFMA 2SEMA 1VQMA 2L0TB 3UM3A 1Y7XA 2CHWA 2HQEA 2DXUA 1GW6A 4FSSA 5J08A 1OX8A 4ANXA 5LJ3g 2COYA 1G3TA 4L9PA 3L2QA 2WXNA 2XPZA 2F5TX 4XI9A 1H6OA 3KD7A 4U96D 2LQ8A 2EILE 1KQ1A 2VGNA 5CVIA 4F1SA 1VQ8T 3CD6A 4E47A 4F16A 3CCSA 1R8OB 4LERA 2BF0X 1PRMC 3HHTB 3PMIA 2CREA 2WB2A 4HOTA 1OCCE 2HO1A 2V5FA 2X3MA 3C3OA 1NI1A 1NLOC 1V76A 2CP0A 2K5FA 1GFDA 4L7TA 5JMND 3G71T 2XD0A 4GPKA 4JHRA 2EJGA 3QJ6A 3OYLA 3O48A 1B7TA 1KQSS 4B89A 2V4HC 1MNEA 2ROLA 3RUXA 3BDUA 1M8MA 2LQWA 3DLLA 3CCUQ 2OTLT 2OTJQ 4AFQC 1UGVA 2EWNA 3PZ3A 2E41A 1YHQQ 4HFGA 5IXFA 1NG2A 6AT1B 3CKBA 3C95A 1K9MU 2QYZA 3CPWP 1DC2A 3RKYA 4M7AB 4Z88A 2QQAA 4TUUA 2KRSA 3SFYA 3AS8A 3ZHEA 3CK9A 2JLBA 1YCYA 5FW9A 1KD1C 2R5MA 2DYRE 2MIOA 2RJCA 1RAGB 1AWCB 4ORZA 3FTXA 3QZ9B 2PM7A 4KBMB 3LYIA 1Q82R 3GZ1A 4GTPA 2XG8D 1E90A 3CCLA 3PZ1A 2RFAA 4CRIA 3UM2A 4AFUC 2XICA 4CDRA 1OU8A 1U1SA 4J9HA 2DZ9A 3D9OA 4CYMD 4A4HA 3HVEA 3CPWS 4I1AA 4XTXA 2DKGA 2EVRA 3QZ5B 4KH0B 1AWXA 5L23A 3QSUA 1TNYA 2FB7A 4FYXB 5FU7B 3FU6A 1YBYA 3APCA 1NJIU 2LT1A 5FLXE 3TWRA 4J9CA 3A8MB 3CMET 2NYJA 2YHCA 3JYSA 3MHXA 3SWNB 2OTJT 3B7RL 1BI2A 3AHUA 4PUCA 3FC3A 1EF1C 4ANJA 5GAMj 3FB9A 3F70A 4M4ZA 1T0JA 3E30A 1K1ZA 1K0SA 1M30A 1PKSA 4A3VA 1QVFP 2RA2A 1H2VC 5AQAA 5LL6S 4MZMA 4QVCA 2J8SD 3WG7E 4DX1A 5KJNA 4RTTA 3UDCA 3OYMA 2DXBA 3CC4A 5HKPA 1T3LA 2XGMA 4HVBA 3UI2A 3M0TA 3SO8A 3HRSA 3CBPA 3FEYA 1IB8A 3IXEA 2R02A 2J6FA 4UI9K 2B0OE 2AXZA 2DYSE 3ABLE 2A5UA 3CHQA 5M72A 3SHWA 1YYHA 3OB9A 4RVBA 1UJ0A 1KSWA 1NA3A 2FPDA 2QEXQ 2ZIRA 1QKWA 5CKBA 4A55A 5EDSA 5FRNA 1HG5A 3MV3B 4M7CA 2IY0C 2GF7A 2K7AA 4L1BA 3RSEG 3LWHA 3ASOE 3B95A 3JRZA 3S7DA 5I22A 3CK8A 1VQKQ 1C6VX 5AAOA 2AJAA 2DZOA 5KJKA 2KAFA 4GU5A 5M9OA 4O5VA 2E6ZA 3U23A 3BE3A 3PZ4A 4J8DA 1IZ6A 1GCQC 4CDMA 1TEZA 1WXBA 4HCBA 2YT6A 4C8QG 4XX5A 1KD1R 3ZYMA 2QFCA 2XRYA 1D3BA 2MYSA 3OYNA 5CR2A 4U0UA 3GNGA 1ZSGA 1VQ4T 1TH7A 1PRLC 2IOLA 1QQEA 5GJWB 2O2OA 2OV8A 2DO3A 4JLIA 3JSCA 4XKBA 4OYSA 1QZ2A 3ULYA 5EILA 1IGQA 2KXPC 1BKBA 3EAEA 2XKOC 1VQ9A 4I43A 3UA7A 2EJ9A 5IAYA 2E3HA 3RKVA 2CT3A 4OMNA 2CFZA 3KSLA 3LPZA 1VQKT 1GBRA 4BETA 2WQ6A 2F8YA 2IONA 1TN8A 4BWRA 4EMKA 3PRZA 1YI2A 3FEOA 3CHOA 4O1OA 4N2SA 2KXCA 2K79A 1QW1A 5C2YA 2YWWA 3NFCA 1A0NB 2YLBA 2B86A 2KNBB 1QP2A 4I6JA 2M0OA 4M78A 1ZB1A 4C8QA 4CEMA 5KE2A 4C92D 3MPUB 3ZKJA 1PY1A 4NL3A 1EZZB 3HXBA 2E1HA 1GL5A 3OAWA 3CVYA 4Y28E 3OYJA 3T8KA 3QWYA 4MRUA 4AVXA 2CP5A 3FUIA 3MKRA 2KQWA 3SEMA 1A5EA 3VLDA 1W70A 4QQ6A 3L1AA 3OW2P 1FMWA 4E7HA 5KNGA 2JMAA 3CMAQ 4K5AB 3DSWA 5E76A 1X2KA 4C0DB 3EH1A 1VQ9Q 3Q4AB 4M75B 4CC4B 3DB4A 4XZ4A 4PS8A 1TWBA 4QQDA 4JJBA 4DX6D 3T9NA 4IUQA 4PKCC 2RJDA 1I5LA 1SA5A 1ARKA 2VGMA 1VQ6T 5ENSD 4MLPA 1AWJA 3N71A 3FY4A 3M57A 3VLEA 2GQIA 3DLMA 3U66A 5KJLA 1HD3A 2W0ZA 4B93B 2ED0A 2XS8A 1K73C 5GAN4 2DM1A 1RUWA 2X4JA 5EG2A 1L5JA 2DZNA 4D8KA 3ZW3A 2CZ0B 1NEGA 2DK3A 5GMKl 3PNLB 3BDLA 2WQHA 3L08A 2DPPB 2DTIA 3M58A 1YJ9A 2BZ8A 2RD0A 5FIOA 1VQKA 2UY1B 2DIWA 5LX8A 1HFAA 5FQ8A 2HKNA 4QVDA 4BE0A 3BEEA 5KJMA 5KE3A 4J7IA 3HYMB 2O88A 3PE0A 2J4BA 1V29B 2RQRA 1RZ4A 4E6RA 1N52A 2QEXA 1KT1A 1YITT 3MX3A 2FRWA 5H7PA 5ENNA 2ESWA 5AYFA 2K3XA 4N4HA 4BI3A 4KVMA 1Z3YA 3PREA 1M90U 1UGRB 2KGTA 2GW1A 5FWCA 1NYFA 3CGHA 5CMWA 3CC4Q 4DUIA 3EGXB 1Q7YR 2WXFA 2XIDA 3NBNB 3CEYA 3MYVA 3PNWC 2YLCA 4FJZA 3M5AA 4DX2A 1UB4A 4XTYA 3G4SA 3ABME 4DEXA 2FPFA 2X35A 1IQUA 1JQQA 4EMKB 4G8KA 4AFZC 2X38A 2P9NG 1D8DA 3CVLA 1N5ZA 5CRUA 2DYIA 4KH1B 3Q75A 4PJMA 4DI4A 1WHJA 5HS0A 1Q81R 2KVQG 4EZKA 4LUDA 4ILGA 4GZDA 2DILA 1HJDA 2WXHA 3HXDA 1FT1A 2EYXA 5C0MA 4UC4A 4WNDA 1Z9QA 2KBXA 2BKDN 3IV0A 1K1AA 2E12A 4C8QC 5GAN5 3OYFA 4UWGA 3HSBA 3OXLA 5CECB 2JTFA 5AIJA 1MUZA 4F7UB 2K2MA 2QI2A 3I4RB 2AT1B 1V1CA 2R5SA 3EGDA 2CG3A 4EHMA 1NBEB 2E65A 4N5QA 4DQ2A 3ZRHA 1WIEA 4OB3B 2EIFA 5EYLA 4A4EA 1UTIA 1QVPA 3CCLQ 4XU3A 1ELRA 1BK2A 4DBQA 1S72Q 1N8RU 3M56A 3UT8A 2KSSA 4IURA 3I56T 4GTRA 3IQLA 1HK9A 4U07A 4PLIA 3CPFA 4PJOA 3D9KA 3EG2A 5CMYA 3E9GA 3CC2T 4ZTJA 2PNIA 4NL2A 5IHKA 2A28A 3ZNGA 2KC7A 3HRTA 4JPSA 1V54E 4LSZE 4FYVB 1Y57A 3K9IA 1Q86C 5LJ3d 1R0CB 2L2PA 2GTOA 2LXMA 4EMKC 3VS4A 2I2LA 1KT0A 2CZ6B 2OTJA 4K5BA 3CCUA 2A0FB 1RABB 3RKXA 3V7SA 4GA0A 1NZNA 1VQ6Q 2BIVA 3FTSA 3THKA 4A53A 4ZFHA 2DTOA 1P92A 3FH7A 2DD5A 1RAFB 1VQLT 2K3YA 1Z5SC 4GYWA 3TGOA 3NOCD 4RCBA 4BUGA 5IXBA 5FZSA 5IN1A 1TJFA 3HTRA 3DEPA 3RRMB 5GAN7 4RUGA 2D0NA 2XZTG 1NA0A 3VKIA 4TRQA 2Y4XA 3OYKA 3MO8A 2LTOA 4F3VA 2EKHA 2RHXA 2F0YA 2FG0A 2K4YA 3I5SA 5BW8C 1OWOA 2DFUA 2L0AA 3JCMd 2RO0A 4ZN3A 4BERA 2JVVA 5GAOq 4KT6B 3MP6A 3ZFWA 1VUBA 4IUUA 1TNUA 4PH4B 5ANRA 4HXJA 1SSFA 4JRKA 4I6EA 4KGVB 4LNUD 1WZOA 3ASGA 1VQMQ 3CC7Q 1N4PA 4B8AA 2KRMA 3TG4A 4CC2A 1PAQA 1YA0A 4LNPA 2KZTA 3QYHB 4KRTA 1BPOA 3JCMb 1LJOA 1Q86U 1JWFA 2ONDA 4J0UA 3EFOA 4CDNA 4M78B 3HIZA 3RERA 4F53A 2Y4UA 3CCJQ 3UKRG 3CPWA 2F2XA 1UGSB 3NTHA 1MQSA 2WQ7A 4TUMA 3PEVB 4K0RA 4FT4A 3FJ5A 5KYYA 3OYGA 2JZ2A 1KQSP 3LH5A 2DLPA 2LJ3A 4Y91A 2VXEA 3DXKG 1I5OB 3E33A 5I2MA 4XIFA 2WSCE 2ZZDA 5BNWA 3EH2A 1Y8MA 4O6FA 3PZDA 4FIBA 5BXOA 5LOZA 2FO1E 3H8ZA 1I07A 3HDXA 2CH4A 1IO6A 5GANg 2QK0A 4GTSA 4HVWA 4FULA 4U8HA 4F7UF 1U3DA 3M0QA 3C5RA 3I5RA 4RSYA 5FU7C 1MNDA 1BI8B 5CKFA 5GAOl 1QLYA 3E4BA 3SHFA 2AW6A 1ZU2A 3W9FA 5KH6A 1YJNA 4JS4A 1NM7A 2WXLA 3CVUA 1SSHA 2KATA 3CXCS 5FZRA 2MPXC 1YIJQ 2HKQB 2RHYA 1QYMA 1VQMT 3ZL7C 1MGQA 1M90R 4Q69A 3QJZA 2KDSA 2LCSA 2RHIA 1KC8C 5JA4D 1S63A 4C9BB 2F2WA 1YNZA 3TCJA 1IXVA 2X6IA 3BUAA 4J9DA 3RJVA 2F2VA 1FCHA 2MOWA 3UM0A 2QQSA 2F37A 1FMKA 3EJNA 2NUZA 1QVGS 2I1KA 4BTBA 4HCZA 3LDZA 4L23A 4GYOA 4J5YA 1VQ4Q 3OXGA 4CT0A 1O75A 1UG3A 3NMZC 3QKJA 2IO3C 3LWIA 4Y6WA 1BB9A 3FUHA 3AS5A 3GBQA 1HH8A 3S3NA 1YJNQ 2RNAA 4XTVA 1M90C 1J3TA 2YHEA 2EGCA 4K11A 4WTOB 2RHZA 3FH5A 3MP1A 2DRMA 3MEUA 3DPYA 2ZGGA 4NS5A 2COWA 4V2SA 3M0SA 1QWEA 2ENMA 2FPEA 1KLXA 1RLQC 3RMSA 4J6XA 3CHPA 2EQKA 3LCAA 2LNVA 1QVFS 1XNIA 3GZSA 1K9MR 3QUIA 4AY6A 5FINA 4GMJA 5HQ8A 2C0TA 2DL8A 1QWFA 1TOVA 1YJWA 1HYOA 1U3CA 4F1PA 4R7LA 1KD1U 2AKLA 4ME2A 4UQYA 3VRYA 3G4ST 1D9SA 1N8RR 3L16A 5AYWD 3CCJA 1N4QA 1TNBA 2P9SG 3KSQA 3X28B 3EU5A 3C3QA 3UPVA 3EFOB 4II1A 3EIJA 2BUGA 4LD9K 1GRIA 1S70B 1M4ZA 4KZCA 4K03A 3FTYA 5L8RE 2O31A 1ZUUA 3RRUA 3APFA 3FJPA 1PC0A 1KC8U 5FRMA 1B3QA 5GANd 2F8XK 4PS7A 3JCKC 3CC7A 2R2LA 4GZ5A 4OP0A 1WGSA 1YITA 4BT9A 2J08A 4R55A 2CHZA 3WVDB 5C6SA 5LJ5h 4MDXA 1W2BP 5BPPA 3QYGB 2RI5A 4L6V5 5HCKA 1WDXA 1GCPA 3ASKA 3CLJA 3TWVA 2XRZA 1AOJA 1WJSA 2PNNA 2MYOA 2EAYA 1ACMB 5IY5E 3UWNA 1VQOQ 4QVZA 3JCMf 3FH8A 2IO2C 4JHKA 1R0BG 4GMRA 4XTWA 3R9AB 2VTBA 4A1GA 2BUDA 1I1JA 1VYTA 3C3RA 1B07A 8ATCB 2HZYA 3UQ3A 3FUEA 2DRKA 2P4RA 3JCMX 5D2MC 3R7RA 3E2UA 2A4ZA 4E7LA 1JJ2A 3TQ7P 1TNOA 3ENEA 4EQFA 3OS0A 4M7DG 1VQ6A 3UATA 4AXHA 3U3WA 4LXCA 3RBBB 2XDBA 2ECZA 3TL5A 2FF4A 3NPFA 2R03A 1ABOA 2RFMA 1IKND 2DD4A 3SBSA 1A17A 4KYOB 5J39A 4ZNXA 5KBAA 2IF4A 1VQ5Q 1C0MA 4XU0A 3REBB 1YWOA 1E8ZA 2ZAEA 2MF2A 1OT8A 3RMQA 1IHWA 4LRZA 2JS0A 2P4TA 1QBQA 3ZEHA 3CQGB 3LW5E 1DCQA 3DSXA 3M55A 4J6WA 3KAEA 3I35A 1WYXA 1S72A 2XI9A 3LS8A 2FVUA 2NUPA 4MS6A 1AZEA 4GB9A 2PUKB 4P5NA 2JN0A 2QEXT 4U8VD 2R59A 1N27A 3EFRA 3KS2A 5CKDA 2EQUA 3RIRA 1TSFA 3BQOA 4APFA 4UI9J 1TS9A 4WNGA 1NJIC 2RF0A 1JJ2S 5AN8A 4KGZB 2CUDA 2D8JA 3FTVA 4DBRA 2AZSA 5BXUA 4Y6CA 1W3BA 2ZXWE 1Q2ZA 4OB0B 4RTZA 1UG1A 5GANe 5ENOD 1I8FA 1YN8A 3VS6A 4WCIA 3UPUA 4J7WA 1X6OA 5FU6B 1JBMA 2CS7A 1QMCA 3Q47B 4QKUA 4BY6C 2ETAA 4HT9A 1FT2A 1YCSB 1SRMA 4JVSA 3G4SQ 3CVNA 3AJIA 3EGUA 2XS1A 4HKEA 3GZ2A 2M9UA 5FWQA 1JJ2P 3Q5MA 2L89A 4G25A 4DI3A 1DVPA 2I0NA 2A37A 3C12A 3P8HA 3R7QA 5GMKe 3V7RA 2KZTB 2H6GA 3JB9H 3G2VA 4M7AE 2XPIA 2Y69E 4JJDA 4PNOA 3SGHA 3M9QA 3Q7FA 4TXPA 5FWBA 2GRRB 1E8XA 2Q7FA 4J7FA 4UQZA 1KG1A 2LQKA 5GANj 2AXVA 3QARA 2L3RA 3O4ZA 2VC8A 3SI5A 1X43A 3G2TA 3V79K 2GFAA 3S6WA 1K8AU 2HBPA 3HVEB 1YJ9Q 1TU0B 3MGBA 1IYGA 4AM9A 4U04A 3Q73A 4EECA 3UTMA 3FULA 2YUOA 3SD5A 1OWPA 4L5GA 2HAXA 4WNFA 3T5XA 3EG0A 1PNJA 4GZ3A 3OY9A 1QP3A 2LRQA 4MBGA 4F04B 3LY7A 2E3IA 2GRMA 2YRDA 4KGXB 4FC8A 2R17C 4LEUA 3SY2A 2XENA 2XHCA 5LJ3h 4ME7A 4KULA 2ED1A 4ZTFA 4D6WA 2P9IG 1U06A 2LSUA 1ZBPA 3CCJT 2I6HA 5G04C 1M3BA 3TG5A 4AG2C 1MZCA 3B7BA 4BFRA 2WMNA 1SG5A 1U8RA 5CQXA 3Q78A 1INZA 1UUEA 2K6DA 3CMAA 2PQNA 1W2BA 4OMPA 2E0IA 1RACB 1X6BA 4RMOA 1N6AA 4UI9C 1Q86R 3GLXA 3JB9F 1M1KR 2CSIA 3CBOA 3A8GB 1FVFA 3FUFA 3NZUA 4GTTA 2GGRA 3GIBA 4DBFA 1NFIE 4M7DC 3L17A 4FJYA 2RI3A 4I6GA 2LJ0A 1OWMA 2KY9A 3G1JA 3M59A 1Q7YU 4PJOG 5FZQA 2KYBA 2OCCE 4Q5WA 1KC8R 2L5QA 4M7DE 2V8KA 2VXFA 2FBNA 3IBEA 4OMQA 4PJNA 1G3SA 1BD8A 2A3LA 4RLYA 3S7BA 1YI2Q 2DEQA 2CZ1B 2DETA 2PU9B 1RLPC 3SB2A 2LSVA 5D6WA 5CK9A 3L2RA 2BTDA 2EYYA 2RK1A 2LMJA 1WNLA 4ILIA 3UA6A 1WLPB 4MMLA 4IN3B 3JCMP 4KBQA 2LT4A 2CYZB 3AU4A 1HS6A 3W9GA 2WM9A 3F6QA 3G71A 1W1FA 2EQMA 4IUVA 2YHTA 3BY7A 3TWQA 3UIPC 3EG3A 2V8IA 2OVBA 1Y07A 1N0QA 3ISMC 3ZYKA 2M0YA 2AK5A 1UE9A 1OZ2A 3R6OA 3CD6T 4EZJA 3UM1A 2XQ0A 4NURA 1GCQA 4LUEA 4OMOA 3PIOA 3JXIA 1RAEB 2DL5A 2OVFA 4CC7A 2D0QB 2V26A 5CEDB 3UF4A 2ILRA 2AIRB 5ENPD 2LNHB 2PZIA 3FU3A 4GYYA 3D9IA 2RJEA 2PM6A 4J8SA 3I5PA 1IQRA 3IEGA 4UWLA 4FADA 4XK8E 4HQDA 3CVXA 3L22A 3Q1JA 4FSXA 5J90A 3CQTA 3V7CA 4C92E 1K73R 4LCTA 2MCNA 4RG8A 4M3OA 3VYGA 4C0ZA 3NTIA 4BY6A 4RG2A 1QKXA 2ATCB 4YVQC 3ZGQA 4WWPA 3M4GA 4GTOA 4LDVA 1BI3A 3Q9UC 3RIBA 3P8DA 4GZCA 4JUVA 2DVEA 3ME9A 1VDYA 4C5IA 2QA4T 2JNGA 1N4SA 2NSZA 2HQXA 1IHVA 2CUBA 2DL7A 2DL4A 3LXUX 5EC7A 1B89A 4JRPA 4K5CA 1DCEA 3G7ZA 5GAMd 1SQMA 4BDZA 5FQ7A 2Y3AA 3H0HA 4WUYA 5AARA 3JQ0A 1TUGB 1OUVA 3MKDA 5DM7R 1TN7A 5G05J 2HD0A 4GCNA 3C98A 2CFUA 4HI9A 3CCEQ 1VIFA 4JS5A 3FDRA 1D3BB 2DJQA 3QPHA 2QQRA 2WXKA 2G6FX 3V30A 4E7KA 1UN8A 3CCST 3P8BB 3HP9A 2YUPA 1LCKA 2VB6A 2XZDG 1E8WA 2VSXE 5ENTD 4L2YA 2ABLA 2X51A 4OVAA 1HU3A 2YUNA 4D8DA 4M77F 2HBWA 4JLGA 4XU1A 1YIJT 3OBYA 5GAN6 3ONLA 4WAFA 1E7OA 2F1LA 5GMKm 4BD3A 1ZLMA 1K8KG 4HORA 1SPKA 4FL6A 4XQ3A 2P2CP 2L3SA 4M75D 2OAWA 2ZPHB 3KUFA 3I55Q 4JDSA 3VRZA 1FWZA 1BU9A 1WXTA 5LJ5g 1OWNA 2BZXA 3CVWA 3UT7A 4BTAA 4WWOA 1MHNA 2DEUA 1H0AA 2NXPA 4HI8A 2DBMA 4U7EB 2CKKA 2JABA 4JJCA 2DJZA 3CBMA 2DVJA 2QQ9A 1YHQA 4JZYA 1ZHIA 1P5QA 1ABQA 3L2ZA 5HKCA 3I9QA 1NJIR 3HRAA 3Q15A 1BI1A 2DIGA 1VOMA 3PVLA 5ENRD 2DX1A 3CC2A 5AJLA 5KWDA 3D9PA 3ULEG 4IRUA 2RJFA 3SFXA 2XCBA 1JEGA 2E4HA 2CP2A 1WDYA 1H19A 3URZA 2FEIA 1K9AA 4JRIA 4FU3A 4HT8A 4MZPA 3CCSQ 3CD6Q 2WXGA 3SFZA 3HXEA 3V2OA 2JOYA 1G5VA 3UT4A 2F5KA 2LC4A 4OMLA 4P29A 3KXTA 4DK5A 3E37A 3ZU7B 3TVTA 4PJOC 3BG0B 2B8AA 3M54A 2RQTA 1WFWA 4J83A 1EX4A 4GA1A 2W10A 4XKCA 2M51A 3UX4A 3RESA 2EGAA 3DRAA 4BEPA 2DBKA 4F7UG 4J9IA 4I17A 4Z68A 5D6YA 1U5SA 4FLHA 1MMAA 2P9PG 4KXKB 5FQ4A 1BCMA 1PWTA 1K3ZD 1Y71A 2IU1A 1W2BS 5CCLA 5I2SA 3VLFA 4UWFA 2QTXA 3QHSA 2P0KA 2GGFA 1SRLA 4DOWA 1VQ7A 2AZVA 1K9MC 1X5BA 1JRIA 5G05C 3ZUVB 4MDWA 3D3MA 4BSZB 4M78E 3PUKA 5KYWB 4N4IA 2CH4W 3DBSA 5I11A 3HHMA 3B7TA 1UW4B 4LUNU 1E7UA 4KMOA 3MJWA 1ZSZA 2KYMA 3UMVA 1OPLA 2IEJA 3IKOB 5GAN3 3VJPA 4M7AF 2L3PA 1UHCA 4TXQA 2HE0A 4IIMA 5LJ3f 4RTXA 3VV0A 2AXUA 4IKFA 3EGDB 1EFNA 5GAOr 5ANLA 3GW4A 3DWLG 2KMTA 4LG6A 4C92G 4U8YD 3X2QE 1UFFA 4C0DC 3RAUA 3VTXA 3H0FA 3KFVA 2KCVA 3G2UA 1ZX6A 3G6EA 5EX0A 4Z8AA 2D6FA 4ATGA 4LDYA 3GP8A 3OS5A 4FHKA 2QTVA 1AP7A 4LDUA 2YINA 1YJ9T 1K1BA 5JHAA 1BIAA 4FYWB 2GRLA 5JHBA 4DA4A 2DTHA 2HCKA 3M0UA 4FHJA 5GANf 5ENQD 1UJJA 4DLQA 2L6JA 2DA9A 5GAOp 4OAVB 2WSEE 4PJLA 1JWGA 4M75E 2UY1A 4FT2A 3OYHA 3AU5A 2JJ9A 4FLBA 3L6AA 4U0ZA 4WWNA 2JS2A 3JCMV 5LCWC 5KYWA 2MHKA 3SQVA 5DIZA 1QVGP 5T8IA 3EHNA 1RL2A 3TWWA 5DY9A 3JCMQ 3CCMT 4J9FA 1AZGB 4H7XA 3ABKE 5A23A 1M3CA 1Q95G 5GAMh 4WF2A 3EG9A 2OAUA 4DOVA 2NUTB 4CCAA 2A7YA 2L9BA 4PFZA 1WQ7A 1VQNA 4MKTA 4HVVA 5IHNA 4LNGA 3OS2A 1S0PA 2OI3A 1KZOA 4JA9A 3EHQA 4FYYB 4JPBW 2KXDA 1VQOT 5GJVB 1H92A 3RRNB 5FU6C 3L2UA 1H3ZA 2EQXA 4ABNA 3FUKA 2EQIA 2V8JA 4L59A 5B3SE 4DX7D 2KI7A 2SRCA 5J26A 2E10A 3OYAA 5AT1B 3FU0A 5GAMf 4RTYA 2X6HA 2IG0A 4B94A 2I2OA 4URKA 1KQ2A 3T5VA 1CKBA 4KZ0A 3C72A 4FA6A 1OQKA 3NTKA 4XAXB 3JCMJ 3HXCA 1OEBA 3ASFA 2YDLA 1H6PA 1HXIA 1SHGA 1IHBA 4HA8A 4C92F 2ZPBB 1YI2T 2K9GA 1NE8A 3QOUA 1OZ3A 2RG8A 3U4TA 4DEYA 2JT4A 3OW2A 3SNXA 1UGPB 5KYYB 2J4DA 4IULA 1C1AA 4BB7A 4QFVA 4RG9A 4O1PA 1FMVA 4JEUA 1O5MA 4UWHA 3S7JA 2YUQA 4DRXE 4HS2A 3FUNA 4ANUA 4M78F 1N8RC 1HZ4A 5LJ3j 1NL4A 1G3YA 1OULA 5KCHA 5HK3A 3QKYA 4GZ6A 4JEHA 2PTKA 3FLGA 1FXXA 3A8LB 3PTAA 1QNFA 4QT7A 2RQVA 4BDYA 2IVWA 2BKGA 3TWUA 2XMFA 4LD6A 1BYMA 2EKOA 4M7DD 2E6NA 1Q82U 1RADB 1ZQ1A 1TUDA 1QVGA 4UUCA 1WHGA 2DXCA 3QDFA 3QDRB 5A0GA 2ETBA 1B34B 4FP7A 3CCVA 1Q7YC 4CC3A 5HI7A 2QG9B 4HCCA 2VGXB 4C0FA 3C94A 5GAN8 1MX4A 3QWVA 3QBYA 4C92C 3BG1B 3GOXA 1RAHB 3CMEQ 3FTWA 3OTNA 4A3TA 4N3CA 3CCRA 4JHJA 1Q81U 3ER0A 1OYXA 2XEVA 3S7FA 2M16A 4PS3A 3TU4K 2QA4Q 3VS7A 4GTMA 2EIME 2XEHA 3LLRA 1K73U 5DBKA 4JZ4A 3T8MA 3QB2A 2I1JA 5C1DA 4JJNK 4F7AA 4AFSC 5KYUB 4ATOA 1BCOA 2EBPA 4G1TA 2O4XB 1QVFA 1U2VG 5GAN2 3EFSA 3VS1A 4OGCA 4M7AG 1VYVA 3CSTA 2BTTA 3ML9A 2WSFE 4IUPA 3CHSA 4DBHA 4AIFA 3CCQT 2D9TA 2ZU6B 3EG1A 5ITZF 3EHMA 4CI0C 2WXRA 2V1RA 3U9WA 1M27C 4I1OB 2JM9A 2QGGA 4PJOD 2Y1LE 3PIPA 3RK6A 4J8YA 3ONKA 4CZ2D 3FTZA 4G26A 2LX7A 1HX8A 2QA4A 3QNKA 3TWSA 4HOSA 1TNZA 1WHLA 4AT1B 2GQVA 3PZ2A 3MJXA 5IH2A 1YHQT 3FUJA 1DJ7B 3CCRQ 2JMCA 3VS0A 5CCAA 4BE2A 1PSFA 3CMEA 3PH0C 3CIAA 1TJCA 5FQ6A 1Z6TA 5BT1A 2WXIA 5KYXB 1GFCA 2IJGX 2CT4A 5A0LA 3CCVQ 4M77G 4FU6A 1M1FA 2ROTA 4M77E 1LD8A 2HYZA 1MHQA 1YWPA 1GXIE 2VGEA 4C0MA 3AAAC 2FL7A 4E7JA 2VKNA 1M2VA 2X6KA 4NRHB 1BI0A 2EW3A 3E34A 2Y4YA 3UT1A 3TJPA 2DWZA 3AG1E 1PKTA 5D0QD 2X3XD 2MK5A 4V3IA 2X6FA 5GAMg 2AVPA 3LY9A 2DYBA 1RAIB 2GRNB 2L0IA 3JCMW 2K5IA 2GROB 3CCQA 4CGWA 3CCRT 4HXIA 1VYUA 1OV3A 3OA6A 4YDEA 2WXJA 3CEQA 4M7DA 1NP7A 1OCOE 4Y92A 3JQ1A 4E2FB 4NQ0A 1IHGA 4XEIG 2FRYA 4FM4B 4GAAA 4ELYC 4I9CA 2PVOB 4C0GA 1NZ9A 4J9GA 3JCMg 4A1SA 3PMTA 4R56A 5IHIA 5D66A 2OTLA 4JB8P 4J8OA 1TYQG 1AHJB 1QCNA 4G8LA 4HCKA 1GBQA 4RTUA 1SZAA 4N0AA 2JTEA 1KJWA 3JAME 1VQLQ 2ZPFB 4PFPA 2OEWA 1OOTA 3QJYA 1VQ8Q 1D1BA 2J49A 3CQCB 3D9MA 5GANh 3FU5A 5AQ9A 2GFUA 4C48B 2WXOA 1M1GA 3TAXA 5LFAA 4LE9A 3JCMc 3L42A 4BI8B 1TXQA 1QQJA 1LVKA 1VQNQ 3ZBDA 5FROA 5CO7A 2XHEA 4RTWA 2QDYB 4RCCA 3VTYA 1WXUA 2RKKA 2AKKA 3H6ZA 2C0IA 2E64A 1FVHA 1G2BA 1OI1A 1Z9ZA 1K0XA 2NUPB 1FYNA 2EYQA 2VUBA 1ZBJA 4LDWA 3PFSA 4TV3A 3VYHB 5LJ5e 4QQIA 3ZPJA 1VQPQ 1MJ0A 3PE4A 1FPPA 4OGEA 1XTDA 4FW2A 4GTQA 3ZYLA 4DJAA 3LX7A 1KFZA 4A4KA 3S3OA 1PG5B 2FO0A 1Y6IA 3SBTB 3LJNA 4J9BA 2KK4A 1HE8A 3MV2B 5GMKi 2XGSA 3OS1A 2X3WD 4PK4A 3CHRA 2JEKA 3I56A 4N3BA 2QXFA 1HSQA 4N5CA 5KCOA 3OMCA 5EIDA 2C0LA 4RQIA 4M77C 4EMHA 3PGGA 3AG3E 3FEXA 1D0ZA 3C0CA 3ZEFA 2V5QC 4ACLA 3CKCA 4B8CB 4AEZC 2E70A 4HRNA 3GPLA 2DVWA 4X34A 2MWPA 4C92A 3G6EQ 1KQSA 5A6CA 1RW2A 3LGLA 2KR3A 3QC1A 4NIKA 1SA4A 3A5ZB 4HLEA 3RU0A 1MV3A 3APDA 2IIMA 3CCVT 4C8QF 3UXGA 1H8KA 1K4US 2FO7A 4CT4A 1O1SA 3FP3A 5LJ3e 3MKQA 4M77D 4E7ZA 2V0PA 2RD1A 3J5QB 3RO3A 1V55E 3MA5A 1XQHA 3CCMA 1NYGA 3HL8A 1YMPA 1PC2A 5E75A 3D9LA 2VGYA 3CR3A 2IFUA 3QK0A 2LUHA 1BBZA 1WX6A 2KT8A 4OB1B 1E6GA 2VQ2A 4U0SA 2YRVA 2DMOA 1W4SA 4HBDA 3LVQE 2IPOB 3SWNA 3OYIA 5GAOn 1Y96B 4G11A 5BUZA 5D7UA 1M2OA 5LJ5d 3TSWA 4QQGA 1LNXA 4G23A 2VV5A 1B34A 5CKHA 4Q94A 4M75A 1SF9A 3ZN3A 4M75C 2WVIA 2P9LG 1ELWA 4PDXA 3J5PA 4GCOA 3V8KA 2HM8A 4BX8A 3TEEA 4MMKA 2KCKA 3JCMe 2LO6A 5LP0A 1KHCA 4KUIA 3V2XA 3QAQA 5CEAA 1WAO1 2LAIA 3S2AA 4EBAA 2EYZA 2OX7A 3EDTB 2VASA 1S72T 4GLKA 1F1BB 2O01E 3MCAB 3WXXA 3A1PA 2Y90A 2EINE 1X2QA 2BZYA 1Y0MA 4YTLA 3Q79A 3AG4E 4FW1A 2OEVA 3DPDA 2QQBA 2DNUA 3L13A 2VGXA 3CXCP 2ZPEB 3X20B 3BFMA 2GRQB 1JCRA 2QC9A 4OB2B 2NYSA 4D10C 3CC2Q 1H2UA 3J81E 1QCFA 9ATCB 2IOSA 2XEEA 4KVOA 2VJ8A 3CVPA 4HNAD 2LDMA 2RQUA 1BLXB 5HK0A 3OXFA 3ASDA 4DLOA 4X1VA 2LJ1A 3PE3A 1X75C 1H6KA 4JL0A 1YP5A 1BIBA 3ZXSA 4E7SA 2NWMA 2PZ1A 2RN8A 4X9CA 5ECAA 5AJDA 4M7DB 4Z02A 3NGPA 3I55T 5T4YA 3OMGA 4AG1C 1X6GA 1G83A 2DF6A 2NC9A 1TN6A 5KCMA 2P0PA 1KZPA 3D7SB 3HXFA 1M1KU 3I55A 2QGFB 4BI4A 3PEUB 5HRYA 3I3NA 5KYNA 1K8AC 2HQHA 3DSTA 1TTHB 4CGVA 2P84A 2DZCA 4TXRA 4AV7A 2CGHA 2Y4TA 4OVVA 2ZPGB 2J7IA 3X25B 1M3AA 2YQ8A 2KRNA 3H9NA 3FFLA 1OY3D 1YFNA 2PUOB 2VSOE 4GTVA 2PVGB 1ZUKA 1M9SA 1ZBXA 4YDOA 1UJYA 3L82A 3LYAA 1WJQA 1EIFA 2E5QA 3IHYA 2EGEA 1E96B 2JUFA 2RMOA 4RTVA 1O1TA 4ACKA 3KEZA 4Q96A 1PM3A 2DAQA 2RB6A 5CQYA 3CC7T 2E2EA 1JB0E 3P2BA 3IHVA 3PNTB 3CCEA 4A4GA 5GAOm 3H41A 3QWXX 1HG2A 2EJFA 3QDNA 1KK7A 5JJTA 1ZSZC 2HEQA 2HSEB 4IUTA 3DKMA 2JM8A 1XOVA 2GNCA 2L3QA 2LVMA 3FUMA 3OSVA 1I0CA 5B1BE 3MEVA 3SWNC 2M1HA 1E7VA 1UECA 2COZA 1D0YA 3ESKA 2C0MA 1LD7A 4BX9A 2ZGWA 1NEBA 3DB3A 3QG1A 4AP2A 1E8YA 3NOGD 3NB2A 1IRXA 2ZGDA 4J8FA 1VQ5T 3EUVA 4G24A 1RAAB 2MWOA 5KYXA 2Z0WA 1HO8A 4PFOA 2QAZA 4ATZD 1U3OA 1VA7A 3N5BB 2XPYA 3A8HB 3VS2A 3NAWA 2OJ2A 3PDNA 1WJRA 4ZN1A 5JJ6A 4PJOB 5EKQD 1UOHA 2HL3A 1LF8A 4N3AA 2FEZA 3EU9A 2XK0A 4PJOE 2V4LA 4N2QA 4OMFB 2H8HA 2DBAA 1YJWT 2DE0X 5LJ5j 3AG2E 2X6JA 3MEAA 2AWIA 3S3MA 1UGQB 2YSQA 2OOEA 2P9KG 2HR2A 3TWXA 3QIIA 1LTXA 4F7UA 3SF4A 4B9WA 1I81A 3OBWA 2EPDA 2XGOA 4LNBA 4EMGA 1PD1A 3O8VA 3MKQB 3ZVVA 1T3SA 2LNIA 2P0QA 1PCXA 3CC4T 4M78C 1UEBA 1K8AR 1JPLA 2KCLA 1AD5A 1ZUYA 2EYWA 3V8JA 3G71Q 2WACA 5LJ5f 1WY6A 2J9QA 3REAB 2EQJA 3DSVA 3SD4A 2QYJA 3ULQA 1D09B 4EPCA 3CCMQ 3HFOA 2FZCB 1EPUA 4ANVA 4PLLA 3D9JA 1M5Q1 3EGXA 1XGWA 3FDHA 4C92B 1WHKA 4A54A 2EIJE 3E32A 4GBQA 5AQ7A 3CVVA 3ZYQA 3U64A 2RH2A 5ARFA 5A0DA 1UN9A 3MP8A 2DL3A 2HSPA 2WXPA 2K3BA 4XTZA 3URGA 4KUDK 3GYZA 4M78D 4BT8A 3J80E 3QWPA 1X27A 3VU3C 4J8EA 3OQ5A 1YJNT 4IIOA 2MAMA 2WPVA 4NACA 1R77A 3CXCA 5JJ7A 2BE9B 5AENA 3CCLT 2O4XA 4M7DF 2CP6A 3NF1A 7AT1B 2CSQA 1AEYA 4I1MA 3ZIMA 1ZSZB 3ZXPA 5D0OD 4C8QB 2FYKA 4JC8A 3I56Q 1OWLA 4HRMB 5IT9E 1MMDA 1UHFA 4E6HA 2YXYA 2ZCFB 2O9VA 1JU5C 4H7YA 2H3EB 2VWFA 4JZ3A 3TSZA 4J6YA 1WI7A 1RI9A 2WXQA 2A5EA 3FIFA 1VQPA 1JUQA 2J07A 4BSXA 2VYTA 1N94A 1JCSA 1VIEA 1SVXA 3PS6A 2VSNA 4OMMA 1VQPT 5KNHD 1QCOA 4M77A 2LCLA 3EIQC 3FUDA 1CSKA 1NPPA 1WPYA 3UINC 1PHTA 4UWKA 4C5HA 4HOQA 3V31A 4JXTA 2A08A 5ARGA 4EPZA 1MV0B 3OYEA 3Q9NC 5BV1A 2GCXA 1IGUA 2K2VA 4PJOF
chains in the Genus database with same CATH topology
4GLMA 4OMNA 1SRMA 2CT3A 3VS3A 3AJIA 3EGUA 1GBRA 4HRLA 4BETA 2F8YA 2BKKB 3D9HA 3VS7A 2XEHA 2I0NA 4O1OA 4JZ4A 2A37A 1OPKA 1WG0A 2KXCA 4AFSC 2K79A 1TG0A 2EBPA 3M0RA 4JJDA 1A0NB 3VS1A 2B86A 1VYVA 2A36A 2BTTA 1E6HA 2KNBB 5FWBA 1BI7B 3EG1A 5ITZF 3JV3A 3ZKJA 2V1RA 1M27C 1GL5A 2JM9A 2Y1LE 4J8YA 1X43A 4CZ2D 2V1QA 2J06A 3T8KA 3V79K 2LX7A 3M0PA 3QWYA 3TWSA 2J05A 2J6OA 3SEMA 1A5EA 5IH2A 1W70A 5KNGA 2JMAA 1BU1A 2JMCA 4K5AB 2L6BA 1X2KA 3VS0A 5EYPF 3ULRB 3UTMA 2LZ6B 2YUOA 4CC4B 4JJBA 4DX6D 2MOXA 3EG0A 1GFCA 1PNJA 3R6NA 2CT4A 2C0OA 1ARKA 5ENSD 1AWJA 2LQNA 2ROTA 2XENA 1YWPA 2ED1A 5CBOA 2VGEA 1U06A 2GQIA 3AAAC 2VKNA 1M3BA 1HD3A 2VVKA 4B93B 5CBNA 2ED0A 2EW3A 2W0ZA 4AG2C 2Y0BG 2DM1A 3B7BA 1RUWA 2RPNA 2DWZA 1PKTA 1MX6A 2DZNA 1N0RA 4D8KA 2X3XD 1MX2A 1NEGA 5EN5D 1UUEA 2K6DA 2D1XA 1W6XA 2DYBA 2KBTA 4GPMA 2HDAA 4OMPA 1X6BA 5FIOA 4OAUC 2BZ8A 2KEAA 1S1NA 2CSIA 1VYUA 1OV3A 1WA7A 2GGRA 2O88A 3PE0A 4Y92A 1H3HA 1X69A 1NFIE 2RQRA 4E6RA 2FRYA 2LJ0A 4A63B 2FRWA 2ESWA 4J9GA 1SHFA 4BESA 1AWOA 5AQBA 5IHIA 5D66A 2JW4A 4JB8P 2O9SA 2KYBA 2KGTA 4G8LA 5FWCA 1NYFA 4HCKA 4DUIA 2GTJA 4OMQA 1GBQA 4RTUA 3NBNB 2KE9A 1BD8A 2JTEA 4RLYA 1KJWA 4U95D 4DX2A 1OOTA 1AWWA 1RLPC 2QDLA 4LN2A 5CERB 5AQ9A 1JQQA 2FPFA 4F6RD 4C48B 3A98A 4G8KA 2EYYA 4AFZC 2LMJA 4LE9A 3UA6A 3VS5A 1N5ZA 1CKAA 1WLPB 1JXMA 4YDYA 2D8HA 5HS0A 4RTWA 3W9GA 4LUDA 3F6QA 1WXUA 2DILA 2AKKA 1W1FA 2C0IA 1HJDA 1G2BA 4YDWA 1Z9ZA 1K0XA 2EYXA 1FYNA 1TUCA 1ZBJA 3TWQA 1Z9QA 2KBXA 3EG3A 1K1AA 4QQIA 1MJ0A 1N0QA 2M0YA 5CECB 1UE9A 1MUZA 1NLPC 2AK5A 2K2MA 1KIKA 4HVUA 1V1CA 1K76A 1KFZA 1GCQA 1T0HA 4LUEA 4J9BA 2FO0A 3JXIA 2J6KA 3LJNA 4N5QA 2DL5A 4OMOA 4CC7A 1WIEA 2X3WD 5EYLA 5CEDB 1UTIA 3UF4A 2LNHB 5ENPD 1HSQA 1BK2A 5EIDA 4HQDA 3IQLA 4J9EA 3CQTA 3C0CA 2MCNA 2V5QC 3EG2A 4HRNA 2DVWA 2PNIA 5IHKA 2A28A 3ZNGA 1MYOA 3KEAA 4R0KA 4LSZE 1QKXA 2JXBA 2KR3A 1Y57A 4NIKA 4O60A 2L2PA 2GTOA 3VS4A 3Q9UC 1MV3A 4ESRA 4K5BA 2IIMA 3HG0D 3UXGA 1UDLA 1H8KA 1K4US 3THKA 2CDTA 2CUBA 4ZFHA 2DL7A 2DL4A 1AVZC 4HLLA 5EC7A 3RNJA 3NHNA 4K5CA 3J5QB 3NOCD 3H0HA 5IXBA 5AARA 1NYGA 2GBQA 3DEPA 1YMPA 2LP5A 3DEOA 3JUEA 4RUGA 2D0NA 2XZTG 4HI9A 1TR4A 1BBZA 1WX6A 2KT8A 1E6GA 2RQWA 2DJQA 2EKHA 1JXOA 2DMOA 4HBDA 2G6FX 3V30A 2FG0A 2KT1A 3I5SA 3TSWA 2L0AA 2YUPA 1LCKA 4BERA 2XZDG 5ENTD 4DX5D 2ABLA 2YUNA 1JO8A 4ZHBA 4D8DA 4HXJA 2HBWA 4LNUD 3J5PA 2KRMA 4CC2A 4LNPA 4EIKA 1E7OA 4KRTA 1ZLMA 3V2XA 1SPKA 5CEAA 2P2CP 2L3SA 2EYZA 2OAWA 3VRZA 1BU9A 3JXJA 1WXTA 2E5KA 2BZXA 1X2QA 2BZYA 4Z89A 1Y0MA 2F2XA 1G3NB 2DNUA 4TUMA 4HI8A 2DBMA 3FJ5A 2JABA 4JJCA 2QC9A 2DVJA 4HB5A 3LH5A 5EIBE 2DLPA 1ABQA 2LJ3A 1QCFA 2XEEA 2RQUA 3I9QA 4HNAD 1BLXB 2KROA 3HRAA 4F14A 4X1VA 3H0IA 2LJ1A 5ENRD 5BXOA 2FO1E 1YP5A 2ETCA 1I07A 2CH4A 2DX1A 1IO6A 3PVLA 3T9KA 4HVWA 5KWDA 2NWMA 2PZ1A 2RN8A 3M0QA 5ECAA 3C5RA 1JEGA 3I5RA 1SW6A 3NGPA 1WDYA 2FEIA 1K9AA 4AG1C 1BI8B 1X6GA 1G83A 2DF6A 3EHRA 1QLYA 3W9FA 3TWTA 3V2OA 4OMLA 1N11A 5HRYA 1NM7A 1SEMA 3ZU7B 1SSHA 3TVTA 3PVQA 1QYMA 2RQTA 1WFWA 3ZL7C 2W10A 2M51A 2LCSA 4F17A 3O5ZA 2J7IA 5JA4D 2EGAA 2DBKA 4BEPA 1M3AA 2SEMA 4J9IA 2KRNA 4Z68A 1OY3D 2F2WA 1YNZA 1ZUKA 1U5SA 1IXVA 1UJYA 4FSSA 4J9DA 1PWTA 1K3ZD 2F2VA 2EGEA 2RMOA 2F37A 1FMKA 2NUZA 4RTVA 1SRLA 2AZVA 4U96D 3NMZC 3ZUVB 1BB9A 4BSZB 3GBQA 2CH4W 2RNAA 5I11A 4F16A 1J3TA 2EGCA 3H41A 3QWXX 4K11A 1PRMC 2HEQA 2DRMA 2ZGGA 2JM8A 2CREA 2KYMA 1XOVA 2GNCA 2L3QA 1OPLA 1GFDA 1NLOC 3M0SA 1QWEA 1I0CA 2ENMA 2FPEA 2L3PA 1UHCA 5JMND 2HE0A 4IIMA 1UECA 4RTXA 1RLQC 2V4HC 2ROLA 1EFNA 1M8MA 2LQWA 4AFQC 1UGVA 1NEBA 5FINA 3NOGD 4LG6A 2C0TA 2DL8A 2ZGDA 5IXFA 1NG2A 4U8YD 1QWFA 4F1PA 1UFFA 4ATZD 1U3OA 1VA7A 2AKLA 1DC2A 3VS2A 3VRYA 2OJ2A 3H0FA 1D9SA 3KFVA 4Z88A 1ZX6A 2KRSA 4Z8AA 5FW9A 1UOHA 1GRIA 1S70B 3EU9A 1AP7A 2MIOA 2O31A 1ZUUA 1AWCB 2H8HA 1K1BA 4ORZA 2DE0X 1B3QA 2HCKA 2F8XK 3M0UA 5ENQD 4DEXA 2DA9A 4OAVB 2RFAA 2YSQA 4AFUC 3TWXA 4J9HA 4CYMD 2EPDA 5HCKA 2JS2A 1WDXA 1T3SA 1GCPA 2EVRA 1AOJA 3TWVA 1AWXA 5L23A 2PNNA 3TWWA 2MYOA 4J9FA 1AZGB 1AD5A 1ZUYA 1M3CA 2EYWA 4GMRA 3REAB 3TWRA 1I1JA 1VYTA 4J9CA 1B07A 2DRKA 2NYJA 2QYJA 2P4RA 4HVVA 5IHNA 2OI3A 3EHQA 4JPBW 2KXDA 5GJVB 1H92A 2EQIA 4M4ZA 1T0JA 4DX7D 2SRCA 4GBQA 3UATA 1K1ZA 5AQ7A 3RBBB 1K0SA 1M30A 1PKSA 2ECZA 5AQAA 4RTYA 3NPFA 2J8SD 4DX1A 2DL3A 1ABOA 2HSPA 2K3BA 4RTTA 2RFMA 1IKND 5HKPA 1CKBA 1T3LA 1X27A 3UI2A 3M0TA 3SO8A 4ZNXA 5KBAA 3IXEA 2J6FA 1OEBA 2YDLA 3REBB 1YWOA 4IIOA 2B0OE 3SHWA 1OT8A 1YYHA 1SHGA 2JS0A 1IHBA 1UJ0A 1KSWA 2FPDA 1DCQA 2K9GA 1QKWA 2CSQA 4DEYA 1AEYA 3I35A 2JT4A 1WYXA 2K7AA 3B95A 5I22A 1AZEA 4HRMB 4QFVA 4U8VD 5AAOA 2AJAA 2DZOA 4O1PA 1UHFA 2O9VA 1JU5C 2VWFA 4JZ3A 2YUQA 4DRXE 3TSZA 3U23A 1WI7A 1GCQC 2RF0A 1RI9A 1WXBA 5AN8A 2YT6A 2A5EA 2PTKA 2CUDA 2D8JA 4QT7A 2RQVA 1SVXA 2AZSA 5BXUA 2BKGA 3TWUA 2XMFA 4OMMA 1ZSGA 1PRLC 5KNHD 4RTZA 1UG1A 5GJWB 2O2OA 1TUDA 4UUCA 5ENOD 2ETBA 1CSKA 1PHTA 4CC3A 1YN8A 3V31A 4WCIA 3VS6A 5EILA 2KXPC 2A08A 1MV0B 1MX4A 4J7WA 3Q9NC 3UA7A 2ETAA 1YCSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GLM A;  4OMN A;  1SRM A;  2CT3 A;  3VS3 A;  3AJI A;  3EGU A;  1GBR A;  4HRL A;  4BET A;  2F8Y A;  2BKK B;  3D9H A;  3VS7 A;  2XEH A;  2I0N A;  4O1O A;  4JZ4 A;  2A37 A;  1OPK A;  1WG0 A;  2KXC A;  4AFS C;  2K79 A;  1TG0 A;  2EBP A;  3M0R A;  4JJD A;  1A0N B;  3VS1 A;  2B86 A;  1VYV A;  2A36 A;  2BTT A;  1E6H A;  2KNB B;  5FWB A;  1BI7 B;  3EG1 A;  5ITZ F;  3JV3 A;  3ZKJ A;  2V1R A;  1M27 C;  1GL5 A;  2JM9 A;  2Y1L E;  4J8Y A;  1X43 A;  4CZ2 D;  2V1Q A;  2J06 A;  3T8K A;  3V79 K;  2LX7 A;  3M0P A;  3QWY A;  3TWS A;  2J05 A;  2J6O A;  3SEM A;  1A5E A;  5IH2 A;  1W70 A;  5KNG A;  2JMA A;  1BU1 A;  2JMC A;  4K5A B;  2L6B A;  1X2K A;  3VS0 A;  5EYP F;  3ULR B;  3UTM A;  2LZ6 B;  2YUO A;  4CC4 B;  4JJB A;  4DX6 D;  2MOX A;  3EG0 A;  1GFC A;  1PNJ A;  3R6N A;  2CT4 A;  2C0O A;  1ARK A;  5ENS D;  1AWJ A;  2LQN A;  2ROT A;  2XEN A;  1YWP A;  2ED1 A;  5CBO A;  2VGE A;  1U06 A;  2GQI A;  3AAA C;  2VKN A;  1M3B A;  1HD3 A;  2VVK A;  4B93 B;  5CBN A;  2ED0 A;  2EW3 A;  2W0Z A;  4AG2 C;  2Y0B G;  2DM1 A;  3B7B A;  1RUW A;  2RPN A;  2DWZ A;  1PKT A;  1MX6 A;  2DZN A;  1N0R A;  4D8K A;  2X3X D;  1MX2 A;  1NEG A;  5EN5 D;  1UUE A;  2K6D A;  2D1X A;  1W6X A;  2DYB A;  2KBT A;  4GPM A;  2HDA A;  4OMP A;  1X6B A;  5FIO A;  4OAU C;  2BZ8 A;  2KEA A;  1S1N A;  2CSI A;  1VYU A;  1OV3 A;  1WA7 A;  2GGR A;  2O88 A;  3PE0 A;  4Y92 A;  1H3H A;  1X69 A;  1NFI E;  2RQR A;  4E6R A;  2FRY A;  2LJ0 A;  4A63 B;  2FRW A;  2ESW A;  4J9G A;  1SHF A;  4BES A;  1AWO A;  5AQB A;  5IHI A;  5D66 A;  2JW4 A;  4JB8 P;  2O9S A;  2KYB A;  2KGT A;  4G8L A;  5FWC A;  1NYF A;  4HCK A;  4DUI A;  2GTJ A;  4OMQ A;  1GBQ A;  4RTU A;  3NBN B;  2KE9 A;  1BD8 A;  2JTE A;  4RLY A;  1KJW A;  4U95 D;  4DX2 A;  1OOT A;  1AWW A;  1RLP C;  2QDL A;  4LN2 A;  5CER B;  5AQ9 A;  1JQQ A;  2FPF A;  4F6R D;  4C48 B;  3A98 A;  4G8K A;  2EYY A;  4AFZ C;  2LMJ A;  4LE9 A;  3UA6 A;  3VS5 A;  1N5Z A;  1CKA A;  1WLP B;  1JXM A;  4YDY A;  2D8H A;  5HS0 A;  4RTW A;  3W9G A;  4LUD A;  3F6Q A;  1WXU A;  2DIL A;  2AKK A;  1W1F A;  2C0I A;  1HJD A;  1G2B A;  4YDW A;  1Z9Z A;  1K0X A;  2EYX A;  1FYN A;  1TUC A;  1ZBJ A;  3TWQ A;  1Z9Q A;  2KBX A;  3EG3 A;  1K1A A;  4QQI A;  1MJ0 A;  1N0Q A;  2M0Y A;  5CEC B;  1UE9 A;  1MUZ A;  1NLP C;  2AK5 A;  2K2M A;  1KIK A;  4HVU A;  1V1C A;  1K76 A;  1KFZ A;  1GCQ A;  1T0H A;  4LUE A;  4J9B A;  2FO0 A;  3JXI A;  2J6K A;  3LJN A;  4N5Q A;  2DL5 A;  4OMO A;  4CC7 A;  1WIE A;  2X3W D;  5EYL A;  5CED B;  1UTI A;  3UF4 A;  2LNH B;  5ENP D;  1HSQ A;  1BK2 A;  5EID A;  4HQD A;  3IQL A;  4J9E A;  3CQT A;  3C0C A;  2MCN A;  2V5Q C;  3EG2 A;  4HRN A;  2DVW A;  2PNI A;  5IHK A;  2A28 A;  3ZNG A;  1MYO A;  3KEA A;  4R0K A;  4LSZ E;  1QKX A;  2JXB A;  2KR3 A;  1Y57 A;  4NIK A;  4O60 A;  2L2P A;  2GTO A;  3VS4 A;  3Q9U C;  1MV3 A;  4ESR A;  4K5B A;  2IIM A;  3HG0 D;  3UXG A;  1UDL A;  1H8K A;  1K4U S;  3THK A;  2CDT A;  2CUB A;  4ZFH A;  2DL7 A;  2DL4 A;  1AVZ C;  4HLL A;  5EC7 A;  3RNJ A;  3NHN A;  4K5C A;  3J5Q B;  3NOC D;  3H0H A;  5IXB A;  5AAR A;  1NYG A;  2GBQ A;  3DEP A;  1YMP A;  2LP5 A;  3DEO A;  3JUE A;  4RUG A;  2D0N A;  2XZT G;  4HI9 A;  1TR4 A;  1BBZ A;  1WX6 A;  2KT8 A;  1E6G A;  2RQW A;  2DJQ A;  2EKH A;  1JXO A;  2DMO A;  4HBD A;  2G6F X;  3V30 A;  2FG0 A;  2KT1 A;  3I5S A;  3TSW A;  2L0A A;  2YUP A;  1LCK A;  4BER A;  2XZD G;  5ENT D;  4DX5 D;  2ABL A;  2YUN A;  1JO8 A;  4ZHB A;  4D8D A;  4HXJ A;  2HBW A;  4LNU D;  3J5P A;  2KRM A;  4CC2 A;  4LNP A;  4EIK A;  1E7O A;  4KRT A;  1ZLM A;  3V2X A;  1SPK A;  5CEA A;  2P2C P;  2L3S A;  2EYZ A;  2OAW A;  3VRZ A;  1BU9 A;  3JXJ A;  1WXT A;  2E5K A;  2BZX A;  1X2Q A;  2BZY A;  4Z89 A;  1Y0M A;  2F2X A;  1G3N B;  2DNU A;  4TUM A;  4HI8 A;  2DBM A;  3FJ5 A;  2JAB A;  4JJC A;  2QC9 A;  2DVJ A;  4HB5 A;  3LH5 A;  5EIB E;  2DLP A;  1ABQ A;  2LJ3 A;  1QCF A;  2XEE A;  2RQU A;  3I9Q A;  4HNA D;  1BLX B;  2KRO A;  3HRA A;  4F14 A;  4X1V A;  3H0I A;  2LJ1 A;  5ENR D;  5BXO A;  2FO1 E;  1YP5 A;  2ETC A;  1I07 A;  2CH4 A;  2DX1 A;  1IO6 A;  3PVL A;  3T9K A;  4HVW A;  5KWD A;  2NWM A;  2PZ1 A;  2RN8 A;  3M0Q A;  5ECA A;  3C5R A;  1JEG A;  3I5R A;  1SW6 A;  3NGP A;  1WDY A;  2FEI A;  1K9A A;  4AG1 C;  1BI8 B;  1X6G A;  1G83 A;  2DF6 A;  3EHR A;  1QLY A;  3W9F A;  3TWT A;  3V2O A;  4OML A;  1N11 A;  5HRY A;  1NM7 A;  1SEM A;  3ZU7 B;  1SSH A;  3TVT A;  3PVQ A;  1QYM A;  2RQT A;  1WFW A;  3ZL7 C;  2W10 A;  2M51 A;  2LCS A;  4F17 A;  3O5Z A;  2J7I A;  5JA4 D;  2EGA A;  2DBK A;  4BEP A;  1M3A A;  2SEM A;  4J9I A;  2KRN A;  4Z68 A;  1OY3 D;  2F2W A;  1YNZ A;  1ZUK A;  1U5S A;  1IXV A;  1UJY A;  4FSS A;  4J9D A;  1PWT A;  1K3Z D;  2F2V A;  2EGE A;  2RMO A;  2F37 A;  1FMK A;  2NUZ A;  4RTV A;  1SRL A;  2AZV A;  4U96 D;  3NMZ C;  3ZUV B;  1BB9 A;  4BSZ B;  3GBQ A;  2CH4 W;  2RNA A;  5I11 A;  4F16 A;  1J3T A;  2EGC A;  3H41 A;  3QWX X;  4K11 A;  1PRM C;  2HEQ A;  2DRM A;  2ZGG A;  2JM8 A;  2CRE A;  2KYM A;  1XOV A;  2GNC A;  2L3Q A;  1OPL A;  1GFD A;  1NLO C;  3M0S A;  1QWE A;  1I0C A;  2ENM A;  2FPE A;  2L3P A;  1UHC A;  5JMN D;  2HE0 A;  4IIM A;  1UEC A;  4RTX A;  1RLQ C;  2V4H C;  2ROL A;  1EFN A;  1M8M A;  2LQW A;  4AFQ C;  1UGV A;  1NEB A;  5FIN A;  3NOG D;  4LG6 A;  2C0T A;  2DL8 A;  2ZGD A;  5IXF A;  1NG2 A;  4U8Y D;  1QWF A;  4F1P A;  1UFF A;  4ATZ D;  1U3O A;  1VA7 A;  2AKL A;  1DC2 A;  3VS2 A;  3VRY A;  2OJ2 A;  3H0F A;  1D9S A;  3KFV A;  4Z88 A;  1ZX6 A;  2KRS A;  4Z8A A;  5FW9 A;  1UOH A;  1GRI A;  1S70 B;  3EU9 A;  1AP7 A;  2MIO A;  2O31 A;  1ZUU A;  1AWC B;  2H8H A;  1K1B A;  4ORZ A;  2DE0 X;  1B3Q A;  2HCK A;  2F8X K;  3M0U A;  5ENQ D;  4DEX A;  2DA9 A;  4OAV B;  2RFA A;  2YSQ A;  4AFU C;  3TWX A;  4J9H A;  4CYM D;  2EPD A;  5HCK A;  2JS2 A;  1WDX A;  1T3S A;  1GCP A;  2EVR A;  1AOJ A;  3TWV A;  1AWX A;  5L23 A;  2PNN A;  3TWW A;  2MYO A;  4J9F A;  1AZG B;  1AD5 A;  1ZUY A;  1M3C A;  2EYW A;  4GMR A;  3REA B;  3TWR A;  1I1J A;  1VYT A;  4J9C A;  1B07 A;  2DRK A;  2NYJ A;  2QYJ A;  2P4R A;  4HVV A;  5IHN A;  2OI3 A;  3EHQ A;  4JPB W;  2KXD A;  5GJV B;  1H92 A;  2EQI A;  4M4Z A;  1T0J A;  4DX7 D;  2SRC A;  4GBQ A;  3UAT A;  1K1Z A;  5AQ7 A;  3RBB B;  1K0S A;  1M30 A;  1PKS A;  2ECZ A;  5AQA A;  4RTY A;  3NPF A;  2J8S D;  4DX1 A;  2DL3 A;  1ABO A;  2HSP A;  2K3B A;  4RTT A;  2RFM A;  1IKN D;  5HKP A;  1CKB A;  1T3L A;  1X27 A;  3UI2 A;  3M0T A;  3SO8 A;  4ZNX A;  5KBA A;  3IXE A;  2J6F A;  1OEB A;  2YDL A;  3REB B;  1YWO A;  4IIO A;  2B0O E;  3SHW A;  1OT8 A;  1YYH A;  1SHG A;  2JS0 A;  1IHB A;  1UJ0 A;  1KSW A;  2FPD A;  1DCQ A;  2K9G A;  1QKW A;  2CSQ A;  4DEY A;  1AEY A;  3I35 A;  2JT4 A;  1WYX A;  2K7A A;  3B95 A;  5I22 A;  1AZE A;  4HRM B;  4QFV A;  4U8V D;  5AAO A;  2AJA A;  2DZO A;  4O1P A;  1UHF A;  2O9V A;  1JU5 C;  2VWF A;  4JZ3 A;  2YUQ A;  4DRX E;  3TSZ A;  3U23 A;  1WI7 A;  1GCQ C;  2RF0 A;  1RI9 A;  1WXB A;  5AN8 A;  2YT6 A;  2A5E A;  2PTK A;  2CUD A;  2D8J A;  4QT7 A;  2RQV A;  1SVX A;  2AZS A;  5BXU A;  2BKG A;  3TWU A;  2XMF A;  4OMM A;  1ZSG A;  1PRL C;  5KNH D;  4RTZ A;  1UG1 A;  5GJW B;  2O2O A;  1TUD A;  4UUC A;  5ENO D;  2ETB A;  1CSK A;  1PHT A;  4CC3 A;  1YN8 A;  3V31 A;  4WCI A;  3VS6 A;  5EIL A;  2KXP C;  2A08 A;  1MV0 B;  1MX4 A;  4J7W A;  3Q9N C;  3UA7 A;  2ETA A;  1YCS B; 
#chains in the Genus database with same CATH topology
 4GLM A;  3VS3 A;  4NOY A;  4O6J A;  5LCW J;  4HRL A;  1VQ8 A;  2BKK B;  3D9H A;  1VQL A;  2GRP B;  1OPK A;  4GY5 A;  1WG0 A;  1O9S A;  5FT9 A;  1TG0 A;  2XCC A;  2B6C A;  3FWV A;  3JB9 I;  1HXD A;  3M0R A;  3CCU T;  2OTL Q;  2XDP A;  2ZPI B;  3HPW A;  2JTM A;  3QO3 A;  2BED A;  2A36 A;  3KBG A;  1E6H A;  2R5A A;  3X26 B;  4EDU A;  4AY5 A;  2NUT A;  1OCZ E;  4ZGD B;  3BU8 A;  1BI7 B;  2FZG B;  5HY6 A;  2AHJ B;  3JV3 A;  3DSU A;  1Y96 A;  4CRW A;  2V1Q A;  4BY6 B;  2J06 A;  3ML8 A;  3CCQ Q;  2FI7 A;  3M0P A;  2J05 A;  2J6O A;  4YVO A;  3X24 B;  3RR6 A;  3B7U X;  1BU1 A;  2RM4 A;  1XNF A;  2L6B A;  3LKU A;  4BE1 A;  2DER A;  5EYP F;  3ULR B;  3G2W A;  2F69 A;  5FTP A;  1HF8 A;  2LZ6 B;  3FHE A;  3MEK A;  3M53 A;  2MOX A;  3R6N A;  4HOU A;  1ELK A;  4U63 A;  3B7S A;  3L54 A;  2C0O A;  3RKW A;  4I2Z A;  4I9E A;  2C06 A;  2LQN A;  3B13 A;  3L9T A;  1H2T C;  5CBO A;  3L2W A;  4JRQ A;  2LCC A;  2VVK A;  5CBN A;  4DPR A;  2Y0B G;  1N54 A;  2RPN A;  1VQN T;  5EX3 A;  1MX6 A;  1N0R A;  1MX2 A;  5B1A E;  5EN5 D;  2CG2 A;  2D1X A;  4F7U E;  1W6X A;  2KBT A;  4GPM A;  2HDA A;  2MMP A;  4OAU C;  4ZGJ B;  3HKS A;  3NZS A;  2CHX A;  2KEA A;  1S1N A;  5DLO A;  5G04 J;  2L8D A;  3CK7 A;  1WA7 A;  3INZ A;  3ZFJ A;  2WXM A;  1H3H A;  1X69 A;  1NPR A;  4XU2 A;  3SZ7 A;  2XU8 A;  4W9R A;  5T3R A;  5CCM A;  4M78 G;  4A63 B;  2KM4 A;  1OX9 A;  2NLU A;  3QWW A;  3EG9 B;  1SHF A;  4BES A;  1H64 1;  1AWO A;  3E9F A;  5AQB A;  3UKU G;  2JW4 A;  2O9S A;  3MZL B;  1VQ5 A;  4M7A A;  3CMA T;  3RO2 A;  4B0Z A;  1X01 A;  2FHD A;  2GTJ A;  2QYU A;  4PL6 A;  3P1U A;  3TXM A;  2KE9 A;  5J3B A;  1AT1 B;  3JB9 J;  3V8L A;  4N0A C;  4U95 D;  5DLQ E;  1AWW A;  1N95 A;  3M4Y A;  1XJW B;  2G3R A;  2QDL A;  4OF1 A;  1UJK A;  2H6F A;  2FZK B;  5CER B;  4LN2 A;  3A98 A;  4F6R D;  3OW2 S;  4GA2 A;  3LEW A;  1SZ9 A;  4XI0 A;  4AOF A;  4C5E A;  2H6H A;  5I21 A;  2PQW A;  3CSF A;  2PQR A;  4E85 A;  3CCE T;  3MCX A;  3VS5 A;  1CKA A;  3VUB A;  2RK2 A;  2I9C A;  4G2V A;  1JXM A;  3FTU A;  1LPL A;  4YDY A;  2D8H A;  5CRV A;  2CP7 A;  2WMO A;  3ZHE B;  4OVU A;  1OU9 A;  3HRU A;  3NQP A;  1MMN A;  2RI2 A;  4YDW A;  3A8O B;  1VQO A;  4X8Q A;  5GMK h;  1PSE A;  4EZL A;  4JW1 A;  4APO A;  1TUC A;  2X4W A;  2UWJ G;  3FRN A;  3UIO C;  4PJJ A;  2X9H A;  3JCM h;  3OYC A;  1ZA1 B;  3AT1 B;  4TVR A;  4ELZ C;  1NLP C;  1MMG A;  5CKE A;  1KIK A;  4HVU A;  4ANW A;  3PT9 A;  1K76 A;  1PD0 A;  1SKU B;  5CAI A;  1T0H A;  3I4G A;  2DXT A;  2J6K A;  1I4K 1;  4FCY A;  3TXN A;  1YIT Q;  1G3W A;  4N4G A;  4M75 G;  3R9M A;  4C8Q D;  3JB9 D;  2X4X A;  2IQC A;  3ASH A;  3PUJ A;  3GNF B;  3DXM G;  2BE7 D;  4B9X A;  4M75 F;  1WHM A;  2HMA A;  1M8V A;  1X81 A;  4J9E A;  4MZT A;  2V8S E;  2H3J A;  2M63 A;  3OYY A;  1WQW A;  1N9S A;  4EBA G;  2QY7 A;  2K5L A;  3ESL A;  8AT1 B;  3RDV A;  2J09 A;  3CHM A;  1MYO A;  3KEA A;  3HFN A;  2MRI A;  4I2W A;  2LX9 A;  3CVQ A;  4BAC A;  4R0K A;  2JXB A;  1YJW Q;  4VUB A;  4O60 A;  5GAM e;  5CIU A;  4JD2 G;  3G6E T;  4ESR A;  3WXM B;  3HG0 D;  1D0X A;  2YRC A;  1UDL A;  4WNE A;  1D1A A;  5CHE E;  1IXD A;  3Q49 B;  2CDT A;  3OYB A;  1G8X A;  1AVZ C;  4HLL A;  3RNJ A;  3NHN A;  2HL5 C;  2ZIS A;  2MI6 A;  2P58 C;  2QAS A;  2GBQ A;  3ASN E;  4RKU E;  1VQ9 T;  1KPS B;  2X4Y A;  2M02 A;  4XE0 A;  2LP5 A;  3DEO A;  3JUE A;  3OSS C;  2PVD B;  3J7A F;  4M77 B;  4C0E A;  1TR4 A;  3LGF A;  2R58 A;  2DCP A;  3E1S A;  5A2Q E;  1LOJ A;  2RQW A;  4GML A;  5G2N A;  1D8E A;  5FJY A;  1D1C A;  3UUX A;  1JXO A;  2VSY A;  1U1T A;  4ZGE B;  3L2V A;  4YND A;  4J6I A;  4QW2 A;  2KT1 A;  1VQ4 A;  3Q7A A;  3C4S A;  2RHU A;  2HNI A;  4DX5 D;  1JO8 A;  2FUL A;  4ZHB A;  3TRE A;  2EFI A;  3QXE B;  1VQ7 T;  3BW1 A;  1JCQ A;  4AMC A;  3OYD A;  4UQX A;  3CV0 A;  4EIK A;  1Q81 C;  3LY8 A;  5KYU A;  3JB9 G;  3JUI A;  1YIJ A;  3LVR E;  2CP3 A;  4B6M A;  1OCR E;  1EYH A;  1ZA2 B;  1M2V B;  1N9R A;  1OXJ A;  2E5K A;  3JXJ A;  3MEW A;  1Z3X A;  4Z89 A;  2VYI A;  1G3N B;  1Q82 C;  1DNP A;  3AS4 A;  2H6I A;  4IYP A;  4M7A D;  4ILH B;  1O1R A;  4HB5 A;  2R57 A;  4X9D A;  5A7D B;  5EIB E;  2K57 A;  3E19 A;  3LH0 A;  1N4R A;  3D9N A;  4RG6 A;  2R05 A;  2C2L A;  4C5G A;  3DSS A;  2KRO A;  5G55 A;  4F14 A;  5BV0 A;  3H0I A;  4JA7 A;  4XTU A;  4KT0 E;  2ETC A;  2YNQ A;  5D6X A;  3T9K A;  5GMK j;  4A4F A;  3MET A;  4L2L A;  1N9A A;  2XDD A;  3GF5 A;  1M1K C;  1EDU A;  1RI0 A;  2LAH A;  3WVE B;  1SW6 A;  3VUZ A;  4LDX A;  1IRE B;  2CZ7 B;  3G2S A;  1WM5 A;  1S64 A;  4N39 A;  4C8Q E;  3LJ3 A;  1KHI A;  3EHR A;  2VTB B;  2DIQ A;  3TWT A;  1N11 A;  4M7A C;  1SEM A;  1FX7 A;  2QZA A;  2LXL A;  2P9U G;  3PVQ A;  1WHH A;  1VQ7 Q;  3SDZ A;  4AJW A;  4F17 A;  2PL2 A;  3O5Z A;  2EIK E;  4E7I A;  3SFM A;  2SEM A;  1VQM A;  2L0T B;  3UM3 A;  1Y7X A;  2CHW A;  2HQE A;  2DXU A;  1GW6 A;  4FSS A;  5J08 A;  1OX8 A;  4ANX A;  5LJ3 g;  2COY A;  1G3T A;  4L9P A;  3L2Q A;  2WXN A;  2XPZ A;  2F5T X;  4XI9 A;  1H6O A;  3KD7 A;  4U96 D;  2LQ8 A;  2EIL E;  1KQ1 A;  2VGN A;  5CVI A;  4F1S A;  1VQ8 T;  3CD6 A;  4E47 A;  4F16 A;  3CCS A;  1R8O B;  4LER A;  2BF0 X;  1PRM C;  3HHT B;  3PMI A;  2CRE A;  2WB2 A;  4HOT A;  1OCC E;  2HO1 A;  2V5F A;  2X3M A;  3C3O A;  1NI1 A;  1NLO C;  1V76 A;  2CP0 A;  2K5F A;  1GFD A;  4L7T A;  5JMN D;  3G71 T;  2XD0 A;  4GPK A;  4JHR A;  2EJG A;  3QJ6 A;  3OYL A;  3O48 A;  1B7T A;  1KQS S;  4B89 A;  2V4H C;  1MNE A;  2ROL A;  3RUX A;  3BDU A;  1M8M A;  2LQW A;  3DLL A;  3CCU Q;  2OTL T;  2OTJ Q;  4AFQ C;  1UGV A;  2EWN A;  3PZ3 A;  2E41 A;  1YHQ Q;  4HFG A;  5IXF A;  1NG2 A;  6AT1 B;  3CKB A;  3C95 A;  1K9M U;  2QYZ A;  3CPW P;  1DC2 A;  3RKY A;  4M7A B;  4Z88 A;  2QQA A;  4TUU A;  2KRS A;  3SFY A;  3AS8 A;  3ZHE A;  3CK9 A;  2JLB A;  1YCY A;  5FW9 A;  1KD1 C;  2R5M A;  2DYR E;  2MIO A;  2RJC A;  1RAG B;  1AWC B;  4ORZ A;  3FTX A;  3QZ9 B;  2PM7 A;  4KBM B;  3LYI A;  1Q82 R;  3GZ1 A;  4GTP A;  2XG8 D;  1E90 A;  3CCL A;  3PZ1 A;  2RFA A;  4CRI A;  3UM2 A;  4AFU C;  2XIC A;  4CDR A;  1OU8 A;  1U1S A;  4J9H A;  2DZ9 A;  3D9O A;  4CYM D;  4A4H A;  3HVE A;  3CPW S;  4I1A A;  4XTX A;  2DKG A;  2EVR A;  3QZ5 B;  4KH0 B;  1AWX A;  5L23 A;  3QSU A;  1TNY A;  2FB7 A;  4FYX B;  5FU7 B;  3FU6 A;  1YBY A;  3APC A;  1NJI U;  2LT1 A;  5FLX E;  3TWR A;  4J9C A;  3A8M B;  3CME T;  2NYJ A;  2YHC A;  3JYS A;  3MHX A;  3SWN B;  2OTJ T;  3B7R L;  1BI2 A;  3AHU A;  4PUC A;  3FC3 A;  1EF1 C;  4ANJ A;  5GAM j;  3FB9 A;  3F70 A;  4M4Z A;  1T0J A;  3E30 A;  1K1Z A;  1K0S A;  1M30 A;  1PKS A;  4A3V A;  1QVF P;  2RA2 A;  1H2V C;  5AQA A;  5LL6 S;  4MZM A;  4QVC A;  2J8S D;  3WG7 E;  4DX1 A;  5KJN A;  4RTT A;  3UDC A;  3OYM A;  2DXB A;  3CC4 A;  5HKP A;  1T3L A;  2XGM A;  4HVB A;  3UI2 A;  3M0T A;  3SO8 A;  3HRS A;  3CBP A;  3FEY A;  1IB8 A;  3IXE A;  2R02 A;  2J6F A;  4UI9 K;  2B0O E;  2AXZ A;  2DYS E;  3ABL E;  2A5U A;  3CHQ A;  5M72 A;  3SHW A;  1YYH A;  3OB9 A;  4RVB A;  1UJ0 A;  1KSW A;  1NA3 A;  2FPD A;  2QEX Q;  2ZIR A;  1QKW A;  5CKB A;  4A55 A;  5EDS A;  5FRN A;  1HG5 A;  3MV3 B;  4M7C A;  2IY0 C;  2GF7 A;  2K7A A;  4L1B A;  3RSE G;  3LWH A;  3ASO E;  3B95 A;  3JRZ A;  3S7D A;  5I22 A;  3CK8 A;  1VQK Q;  1C6V X;  5AAO A;  2AJA A;  2DZO A;  5KJK A;  2KAF A;  4GU5 A;  5M9O A;  4O5V A;  2E6Z A;  3U23 A;  3BE3 A;  3PZ4 A;  4J8D A;  1IZ6 A;  1GCQ C;  4CDM A;  1TEZ A;  1WXB A;  4HCB A;  2YT6 A;  4C8Q G;  4XX5 A;  1KD1 R;  3ZYM A;  2QFC A;  2XRY A;  1D3B A;  2MYS A;  3OYN A;  5CR2 A;  4U0U A;  3GNG A;  1ZSG A;  1VQ4 T;  1TH7 A;  1PRL C;  2IOL A;  1QQE A;  5GJW B;  2O2O A;  2OV8 A;  2DO3 A;  4JLI A;  3JSC A;  4XKB A;  4OYS A;  1QZ2 A;  3ULY A;  5EIL A;  1IGQ A;  2KXP C;  1BKB A;  3EAE A;  2XKO C;  1VQ9 A;  4I43 A;  3UA7 A;  2EJ9 A;  5IAY A;  2E3H A;  3RKV A;  2CT3 A;  4OMN A;  2CFZ A;  3KSL A;  3LPZ A;  1VQK T;  1GBR A;  4BET A;  2WQ6 A;  2F8Y A;  2ION A;  1TN8 A;  4BWR A;  4EMK A;  3PRZ A;  1YI2 A;  3FEO A;  3CHO A;  4O1O A;  4N2S A;  2KXC A;  2K79 A;  1QW1 A;  5C2Y A;  2YWW A;  3NFC A;  1A0N B;  2YLB A;  2B86 A;  2KNB B;  1QP2 A;  4I6J A;  2M0O A;  4M78 A;  1ZB1 A;  4C8Q A;  4CEM A;  5KE2 A;  4C92 D;  3MPU B;  3ZKJ A;  1PY1 A;  4NL3 A;  1EZZ B;  3HXB A;  2E1H A;  1GL5 A;  3OAW A;  3CVY A;  4Y28 E;  3OYJ A;  3T8K A;  3QWY A;  4MRU A;  4AVX A;  2CP5 A;  3FUI A;  3MKR A;  2KQW A;  3SEM A;  1A5E A;  3VLD A;  1W70 A;  4QQ6 A;  3L1A A;  3OW2 P;  1FMW A;  4E7H A;  5KNG A;  2JMA A;  3CMA Q;  4K5A B;  3DSW A;  5E76 A;  1X2K A;  4C0D B;  3EH1 A;  1VQ9 Q;  3Q4A B;  4M75 B;  4CC4 B;  3DB4 A;  4XZ4 A;  4PS8 A;  1TWB A;  4QQD A;  4JJB A;  4DX6 D;  3T9N A;  4IUQ A;  4PKC C;  2RJD A;  1I5L A;  1SA5 A;  1ARK A;  2VGM A;  1VQ6 T;  5ENS D;  4MLP A;  1AWJ A;  3N71 A;  3FY4 A;  3M57 A;  3VLE A;  2GQI A;  3DLM A;  3U66 A;  5KJL A;  1HD3 A;  2W0Z A;  4B93 B;  2ED0 A;  2XS8 A;  1K73 C;  5GAN 4;  2DM1 A;  1RUW A;  2X4J A;  5EG2 A;  1L5J A;  2DZN A;  4D8K A;  3ZW3 A;  2CZ0 B;  1NEG A;  2DK3 A;  5GMK l;  3PNL B;  3BDL A;  2WQH A;  3L08 A;  2DPP B;  2DTI A;  3M58 A;  1YJ9 A;  2BZ8 A;  2RD0 A;  5FIO A;  1VQK A;  2UY1 B;  2DIW A;  5LX8 A;  1HFA A;  5FQ8 A;  2HKN A;  4QVD A;  4BE0 A;  3BEE A;  5KJM A;  5KE3 A;  4J7I A;  3HYM B;  2O88 A;  3PE0 A;  2J4B A;  1V29 B;  2RQR A;  1RZ4 A;  4E6R A;  1N52 A;  2QEX A;  1KT1 A;  1YIT T;  3MX3 A;  2FRW A;  5H7P A;  5ENN A;  2ESW A;  5AYF A;  2K3X A;  4N4H A;  4BI3 A;  4KVM A;  1Z3Y A;  3PRE A;  1M90 U;  1UGR B;  2KGT A;  2GW1 A;  5FWC A;  1NYF A;  3CGH A;  5CMW A;  3CC4 Q;  4DUI A;  3EGX B;  1Q7Y R;  2WXF A;  2XID A;  3NBN B;  3CEY A;  3MYV A;  3PNW C;  2YLC A;  4FJZ A;  3M5A A;  4DX2 A;  1UB4 A;  4XTY A;  3G4S A;  3ABM E;  4DEX A;  2FPF A;  2X35 A;  1IQU A;  1JQQ A;  4EMK B;  4G8K A;  4AFZ C;  2X38 A;  2P9N G;  1D8D A;  3CVL A;  1N5Z A;  5CRU A;  2DYI A;  4KH1 B;  3Q75 A;  4PJM A;  4DI4 A;  1WHJ A;  5HS0 A;  1Q81 R;  2KVQ G;  4EZK A;  4LUD A;  4ILG A;  4GZD A;  2DIL A;  1HJD A;  2WXH A;  3HXD A;  1FT1 A;  2EYX A;  5C0M A;  4UC4 A;  4WND A;  1Z9Q A;  2KBX A;  2BKD N;  3IV0 A;  1K1A A;  2E12 A;  4C8Q C;  5GAN 5;  3OYF A;  4UWG A;  3HSB A;  3OXL A;  5CEC B;  2JTF A;  5AIJ A;  1MUZ A;  4F7U B;  2K2M A;  2QI2 A;  3I4R B;  2AT1 B;  1V1C A;  2R5S A;  3EGD A;  2CG3 A;  4EHM A;  1NBE B;  2E65 A;  4N5Q A;  4DQ2 A;  3ZRH A;  1WIE A;  4OB3 B;  2EIF A;  5EYL A;  4A4E A;  1UTI A;  1QVP A;  3CCL Q;  4XU3 A;  1ELR A;  1BK2 A;  4DBQ A;  1S72 Q;  1N8R U;  3M56 A;  3UT8 A;  2KSS A;  4IUR A;  3I56 T;  4GTR A;  3IQL A;  1HK9 A;  4U07 A;  4PLI A;  3CPF A;  4PJO A;  3D9K A;  3EG2 A;  5CMY A;  3E9G A;  3CC2 T;  4ZTJ A;  2PNI A;  4NL2 A;  5IHK A;  2A28 A;  3ZNG A;  2KC7 A;  3HRT A;  4JPS A;  1V54 E;  4LSZ E;  4FYV B;  1Y57 A;  3K9I A;  1Q86 C;  5LJ3 d;  1R0C B;  2L2P A;  2GTO A;  2LXM A;  4EMK C;  3VS4 A;  2I2L A;  1KT0 A;  2CZ6 B;  2OTJ A;  4K5B A;  3CCU A;  2A0F B;  1RAB B;  3RKX A;  3V7S A;  4GA0 A;  1NZN A;  1VQ6 Q;  2BIV A;  3FTS A;  3THK A;  4A53 A;  4ZFH A;  2DTO A;  1P92 A;  3FH7 A;  2DD5 A;  1RAF B;  1VQL T;  2K3Y A;  1Z5S C;  4GYW A;  3TGO A;  3NOC D;  4RCB A;  4BUG A;  5IXB A;  5FZS A;  5IN1 A;  1TJF A;  3HTR A;  3DEP A;  3RRM B;  5GAN 7;  4RUG A;  2D0N A;  2XZT G;  1NA0 A;  3VKI A;  4TRQ A;  2Y4X A;  3OYK A;  3MO8 A;  2LTO A;  4F3V A;  2EKH A;  2RHX A;  2F0Y A;  2FG0 A;  2K4Y A;  3I5S A;  5BW8 C;  1OWO A;  2DFU A;  2L0A A;  3JCM d;  2RO0 A;  4ZN3 A;  4BER A;  2JVV A;  5GAO q;  4KT6 B;  3MP6 A;  3ZFW A;  1VUB A;  4IUU A;  1TNU A;  4PH4 B;  5ANR A;  4HXJ A;  1SSF A;  4JRK A;  4I6E A;  4KGV B;  4LNU D;  1WZO A;  3ASG A;  1VQM Q;  3CC7 Q;  1N4P A;  4B8A A;  2KRM A;  3TG4 A;  4CC2 A;  1PAQ A;  1YA0 A;  4LNP A;  2KZT A;  3QYH B;  4KRT A;  1BPO A;  3JCM b;  1LJO A;  1Q86 U;  1JWF A;  2OND A;  4J0U A;  3EFO A;  4CDN A;  4M78 B;  3HIZ A;  3RER A;  4F53 A;  2Y4U A;  3CCJ Q;  3UKR G;  3CPW A;  2F2X A;  1UGS B;  3NTH A;  1MQS A;  2WQ7 A;  4TUM A;  3PEV B;  4K0R A;  4FT4 A;  3FJ5 A;  5KYY A;  3OYG A;  2JZ2 A;  1KQS P;  3LH5 A;  2DLP A;  2LJ3 A;  4Y91 A;  2VXE A;  3DXK G;  1I5O B;  3E33 A;  5I2M A;  4XIF A;  2WSC E;  2ZZD A;  5BNW A;  3EH2 A;  1Y8M A;  4O6F A;  3PZD A;  4FIB A;  5BXO A;  5LOZ A;  2FO1 E;  3H8Z A;  1I07 A;  3HDX A;  2CH4 A;  1IO6 A;  5GAN g;  2QK0 A;  4GTS A;  4HVW A;  4FUL A;  4U8H A;  4F7U F;  1U3D A;  3M0Q A;  3C5R A;  3I5R A;  4RSY A;  5FU7 C;  1MND A;  1BI8 B;  5CKF A;  5GAO l;  1QLY A;  3E4B A;  3SHF A;  2AW6 A;  1ZU2 A;  3W9F A;  5KH6 A;  1YJN A;  4JS4 A;  1NM7 A;  2WXL A;  3CVU A;  1SSH A;  2KAT A;  3CXC S;  5FZR A;  2MPX C;  1YIJ Q;  2HKQ B;  2RHY A;  1QYM A;  1VQM T;  3ZL7 C;  1MGQ A;  1M90 R;  4Q69 A;  3QJZ A;  2KDS A;  2LCS A;  2RHI A;  1KC8 C;  5JA4 D;  1S63 A;  4C9B B;  2F2W A;  1YNZ A;  3TCJ A;  1IXV A;  2X6I A;  3BUA A;  4J9D A;  3RJV A;  2F2V A;  1FCH A;  2MOW A;  3UM0 A;  2QQS A;  2F37 A;  1FMK A;  3EJN A;  2NUZ A;  1QVG S;  2I1K A;  4BTB A;  4HCZ A;  3LDZ A;  4L23 A;  4GYO A;  4J5Y A;  1VQ4 Q;  3OXG A;  4CT0 A;  1O75 A;  1UG3 A;  3NMZ C;  3QKJ A;  2IO3 C;  3LWI A;  4Y6W A;  1BB9 A;  3FUH A;  3AS5 A;  3GBQ A;  1HH8 A;  3S3N A;  1YJN Q;  2RNA A;  4XTV A;  1M90 C;  1J3T A;  2YHE A;  2EGC A;  4K11 A;  4WTO B;  2RHZ A;  3FH5 A;  3MP1 A;  2DRM A;  3MEU A;  3DPY A;  2ZGG A;  4NS5 A;  2COW A;  4V2S A;  3M0S A;  1QWE A;  2ENM A;  2FPE A;  1KLX A;  1RLQ C;  3RMS A;  4J6X A;  3CHP A;  2EQK A;  3LCA A;  2LNV A;  1QVF S;  1XNI A;  3GZS A;  1K9M R;  3QUI A;  4AY6 A;  5FIN A;  4GMJ A;  5HQ8 A;  2C0T A;  2DL8 A;  1QWF A;  1TOV A;  1YJW A;  1HYO A;  1U3C A;  4F1P A;  4R7L A;  1KD1 U;  2AKL A;  4ME2 A;  4UQY A;  3VRY A;  3G4S T;  1D9S A;  1N8R R;  3L16 A;  5AYW D;  3CCJ A;  1N4Q A;  1TNB A;  2P9S G;  3KSQ A;  3X28 B;  3EU5 A;  3C3Q A;  3UPV A;  3EFO B;  4II1 A;  3EIJ A;  2BUG A;  4LD9 K;  1GRI A;  1S70 B;  1M4Z A;  4KZC A;  4K03 A;  3FTY A;  5L8R E;  2O31 A;  1ZUU A;  3RRU A;  3APF A;  3FJP A;  1PC0 A;  1KC8 U;  5FRM A;  1B3Q A;  5GAN d;  2F8X K;  4PS7 A;  3JCK C;  3CC7 A;  2R2L A;  4GZ5 A;  4OP0 A;  1WGS A;  1YIT A;  4BT9 A;  2J08 A;  4R55 A;  2CHZ A;  3WVD B;  5C6S A;  5LJ5 h;  4MDX A;  1W2B P;  5BPP A;  3QYG B;  2RI5 A;  4L6V 5;  5HCK A;  1WDX A;  1GCP A;  3ASK A;  3CLJ A;  3TWV A;  2XRZ A;  1AOJ A;  1WJS A;  2PNN A;  2MYO A;  2EAY A;  1ACM B;  5IY5 E;  3UWN A;  1VQO Q;  4QVZ A;  3JCM f;  3FH8 A;  2IO2 C;  4JHK A;  1R0B G;  4GMR A;  4XTW A;  3R9A B;  2VTB A;  4A1G A;  2BUD A;  1I1J A;  1VYT A;  3C3R A;  1B07 A;  8ATC B;  2HZY A;  3UQ3 A;  3FUE A;  2DRK A;  2P4R A;  3JCM X;  5D2M C;  3R7R A;  3E2U A;  2A4Z A;  4E7L A;  1JJ2 A;  3TQ7 P;  1TNO A;  3ENE A;  4EQF A;  3OS0 A;  4M7D G;  1VQ6 A;  3UAT A;  4AXH A;  3U3W A;  4LXC A;  3RBB B;  2XDB A;  2ECZ A;  3TL5 A;  2FF4 A;  3NPF A;  2R03 A;  1ABO A;  2RFM A;  1IKN D;  2DD4 A;  3SBS A;  1A17 A;  4KYO B;  5J39 A;  4ZNX A;  5KBA A;  2IF4 A;  1VQ5 Q;  1C0M A;  4XU0 A;  3REB B;  1YWO A;  1E8Z A;  2ZAE A;  2MF2 A;  1OT8 A;  3RMQ A;  1IHW A;  4LRZ A;  2JS0 A;  2P4T A;  1QBQ A;  3ZEH A;  3CQG B;  3LW5 E;  1DCQ A;  3DSX A;  3M55 A;  4J6W A;  3KAE A;  3I35 A;  1WYX A;  1S72 A;  2XI9 A;  3LS8 A;  2FVU A;  2NUP A;  4MS6 A;  1AZE A;  4GB9 A;  2PUK B;  4P5N A;  2JN0 A;  2QEX T;  4U8V D;  2R59 A;  1N27 A;  3EFR A;  3KS2 A;  5CKD A;  2EQU A;  3RIR A;  1TSF A;  3BQO A;  4APF A;  4UI9 J;  1TS9 A;  4WNG A;  1NJI C;  2RF0 A;  1JJ2 S;  5AN8 A;  4KGZ B;  2CUD A;  2D8J A;  3FTV A;  4DBR A;  2AZS A;  5BXU A;  4Y6C A;  1W3B A;  2ZXW E;  1Q2Z A;  4OB0 B;  4RTZ A;  1UG1 A;  5GAN e;  5ENO D;  1I8F A;  1YN8 A;  3VS6 A;  4WCI A;  3UPU A;  4J7W A;  1X6O A;  5FU6 B;  1JBM A;  2CS7 A;  1QMC A;  3Q47 B;  4QKU A;  4BY6 C;  2ETA A;  4HT9 A;  1FT2 A;  1YCS B;  1SRM A;  4JVS A;  3G4S Q;  3CVN A;  3AJI A;  3EGU A;  2XS1 A;  4HKE A;  3GZ2 A;  2M9U A;  5FWQ A;  1JJ2 P;  3Q5M A;  2L89 A;  4G25 A;  4DI3 A;  1DVP A;  2I0N A;  2A37 A;  3C12 A;  3P8H A;  3R7Q A;  5GMK e;  3V7R A;  2KZT B;  2H6G A;  3JB9 H;  3G2V A;  4M7A E;  2XPI A;  2Y69 E;  4JJD A;  4PNO A;  3SGH A;  3M9Q A;  3Q7F A;  4TXP A;  5FWB A;  2GRR B;  1E8X A;  2Q7F A;  4J7F A;  4UQZ A;  1KG1 A;  2LQK A;  5GAN j;  2AXV A;  3QAR A;  2L3R A;  3O4Z A;  2VC8 A;  3SI5 A;  1X43 A;  3G2T A;  3V79 K;  2GFA A;  3S6W A;  1K8A U;  2HBP A;  3HVE B;  1YJ9 Q;  1TU0 B;  3MGB A;  1IYG A;  4AM9 A;  4U04 A;  3Q73 A;  4EEC A;  3UTM A;  3FUL A;  2YUO A;  3SD5 A;  1OWP A;  4L5G A;  2HAX A;  4WNF A;  3T5X A;  3EG0 A;  1PNJ A;  4GZ3 A;  3OY9 A;  1QP3 A;  2LRQ A;  4MBG A;  4F04 B;  3LY7 A;  2E3I A;  2GRM A;  2YRD A;  4KGX B;  4FC8 A;  2R17 C;  4LEU A;  3SY2 A;  2XEN A;  2XHC A;  5LJ3 h;  4ME7 A;  4KUL A;  2ED1 A;  4ZTF A;  4D6W A;  2P9I G;  1U06 A;  2LSU A;  1ZBP A;  3CCJ T;  2I6H A;  5G04 C;  1M3B A;  3TG5 A;  4AG2 C;  1MZC A;  3B7B A;  4BFR A;  2WMN A;  1SG5 A;  1U8R A;  5CQX A;  3Q78 A;  1INZ A;  1UUE A;  2K6D A;  3CMA A;  2PQN A;  1W2B A;  4OMP A;  2E0I A;  1RAC B;  1X6B A;  4RMO A;  1N6A A;  4UI9 C;  1Q86 R;  3GLX A;  3JB9 F;  1M1K R;  2CSI A;  3CBO A;  3A8G B;  1FVF A;  3FUF A;  3NZU A;  4GTT A;  2GGR A;  3GIB A;  4DBF A;  1NFI E;  4M7D C;  3L17 A;  4FJY A;  2RI3 A;  4I6G A;  2LJ0 A;  1OWM A;  2KY9 A;  3G1J A;  3M59 A;  1Q7Y U;  4PJO G;  5FZQ A;  2KYB A;  2OCC E;  4Q5W A;  1KC8 R;  2L5Q A;  4M7D E;  2V8K A;  2VXF A;  2FBN A;  3IBE A;  4OMQ A;  4PJN A;  1G3S A;  1BD8 A;  2A3L A;  4RLY A;  3S7B A;  1YI2 Q;  2DEQ A;  2CZ1 B;  2DET A;  2PU9 B;  1RLP C;  3SB2 A;  2LSV A;  5D6W A;  5CK9 A;  3L2R A;  2BTD A;  2EYY A;  2RK1 A;  2LMJ A;  1WNL A;  4ILI A;  3UA6 A;  1WLP B;  4MML A;  4IN3 B;  3JCM P;  4KBQ A;  2LT4 A;  2CYZ B;  3AU4 A;  1HS6 A;  3W9G A;  2WM9 A;  3F6Q A;  3G71 A;  1W1F A;  2EQM A;  4IUV A;  2YHT A;  3BY7 A;  3TWQ A;  3UIP C;  3EG3 A;  2V8I A;  2OVB A;  1Y07 A;  1N0Q A;  3ISM C;  3ZYK A;  2M0Y A;  2AK5 A;  1UE9 A;  1OZ2 A;  3R6O A;  3CD6 T;  4EZJ A;  3UM1 A;  2XQ0 A;  4NUR A;  1GCQ A;  4LUE A;  4OMO A;  3PIO A;  3JXI A;  1RAE B;  2DL5 A;  2OVF A;  4CC7 A;  2D0Q B;  2V26 A;  5CED B;  3UF4 A;  2ILR A;  2AIR B;  5ENP D;  2LNH B;  2PZI A;  3FU3 A;  4GYY A;  3D9I A;  2RJE A;  2PM6 A;  4J8S A;  3I5P A;  1IQR A;  3IEG A;  4UWL A;  4FAD A;  4XK8 E;  4HQD A;  3CVX A;  3L22 A;  3Q1J A;  4FSX A;  5J90 A;  3CQT A;  3V7C A;  4C92 E;  1K73 R;  4LCT A;  2MCN A;  4RG8 A;  4M3O A;  3VYG A;  4C0Z A;  3NTI A;  4BY6 A;  4RG2 A;  1QKX A;  2ATC B;  4YVQ C;  3ZGQ A;  4WWP A;  3M4G A;  4GTO A;  4LDV A;  1BI3 A;  3Q9U C;  3RIB A;  3P8D A;  4GZC A;  4JUV A;  2DVE A;  3ME9 A;  1VDY A;  4C5I A;  2QA4 T;  2JNG A;  1N4S A;  2NSZ A;  2HQX A;  1IHV A;  2CUB A;  2DL7 A;  2DL4 A;  3LXU X;  5EC7 A;  1B89 A;  4JRP A;  4K5C A;  1DCE A;  3G7Z A;  5GAM d;  1SQM A;  4BDZ A;  5FQ7 A;  2Y3A A;  3H0H A;  4WUY A;  5AAR A;  3JQ0 A;  1TUG B;  1OUV A;  3MKD A;  5DM7 R;  1TN7 A;  5G05 J;  2HD0 A;  4GCN A;  3C98 A;  2CFU A;  4HI9 A;  3CCE Q;  1VIF A;  4JS5 A;  3FDR A;  1D3B B;  2DJQ A;  3QPH A;  2QQR A;  2WXK A;  2G6F X;  3V30 A;  4E7K A;  1UN8 A;  3CCS T;  3P8B B;  3HP9 A;  2YUP A;  1LCK A;  2VB6 A;  2XZD G;  1E8W A;  2VSX E;  5ENT D;  4L2Y A;  2ABL A;  2X51 A;  4OVA A;  1HU3 A;  2YUN A;  4D8D A;  4M77 F;  2HBW A;  4JLG A;  4XU1 A;  1YIJ T;  3OBY A;  5GAN 6;  3ONL A;  4WAF A;  1E7O A;  2F1L A;  5GMK m;  4BD3 A;  1ZLM A;  1K8K G;  4HOR A;  1SPK A;  4FL6 A;  4XQ3 A;  2P2C P;  2L3S A;  4M75 D;  2OAW A;  2ZPH B;  3KUF A;  3I55 Q;  4JDS A;  3VRZ A;  1FWZ A;  1BU9 A;  1WXT A;  5LJ5 g;  1OWN A;  2BZX A;  3CVW A;  3UT7 A;  4BTA A;  4WWO A;  1MHN A;  2DEU A;  1H0A A;  2NXP A;  4HI8 A;  2DBM A;  4U7E B;  2CKK A;  2JAB A;  4JJC A;  2DJZ A;  3CBM A;  2DVJ A;  2QQ9 A;  1YHQ A;  4JZY A;  1ZHI A;  1P5Q A;  1ABQ A;  3L2Z A;  5HKC A;  3I9Q A;  1NJI R;  3HRA A;  3Q15 A;  1BI1 A;  2DIG A;  1VOM A;  3PVL A;  5ENR D;  2DX1 A;  3CC2 A;  5AJL A;  5KWD A;  3D9P A;  3ULE G;  4IRU A;  2RJF A;  3SFX A;  2XCB A;  1JEG A;  2E4H A;  2CP2 A;  1WDY A;  1H19 A;  3URZ A;  2FEI A;  1K9A A;  4JRI A;  4FU3 A;  4HT8 A;  4MZP A;  3CCS Q;  3CD6 Q;  2WXG A;  3SFZ A;  3HXE A;  3V2O A;  2JOY A;  1G5V A;  3UT4 A;  2F5K A;  2LC4 A;  4OML A;  4P29 A;  3KXT A;  4DK5 A;  3E37 A;  3ZU7 B;  3TVT A;  4PJO C;  3BG0 B;  2B8A A;  3M54 A;  2RQT A;  1WFW A;  4J83 A;  1EX4 A;  4GA1 A;  2W10 A;  4XKC A;  2M51 A;  3UX4 A;  3RES A;  2EGA A;  3DRA A;  4BEP A;  2DBK A;  4F7U G;  4J9I A;  4I17 A;  4Z68 A;  5D6Y A;  1U5S A;  4FLH A;  1MMA A;  2P9P G;  4KXK B;  5FQ4 A;  1BCM A;  1PWT A;  1K3Z D;  1Y71 A;  2IU1 A;  1W2B S;  5CCL A;  5I2S A;  3VLF A;  4UWF A;  2QTX A;  3QHS A;  2P0K A;  2GGF A;  1SRL A;  4DOW A;  1VQ7 A;  2AZV A;  1K9M C;  1X5B A;  1JRI A;  5G05 C;  3ZUV B;  4MDW A;  3D3M A;  4BSZ B;  4M78 E;  3PUK A;  5KYW B;  4N4I A;  2CH4 W;  3DBS A;  5I11 A;  3HHM A;  3B7T A;  1UW4 B;  4LUN U;  1E7U A;  4KMO A;  3MJW A;  1ZSZ A;  2KYM A;  3UMV A;  1OPL A;  2IEJ A;  3IKO B;  5GAN 3;  3VJP A;  4M7A F;  2L3P A;  1UHC A;  4TXQ A;  2HE0 A;  4IIM A;  5LJ3 f;  4RTX A;  3VV0 A;  2AXU A;  4IKF A;  3EGD B;  1EFN A;  5GAO r;  5ANL A;  3GW4 A;  3DWL G;  2KMT A;  4LG6 A;  4C92 G;  4U8Y D;  3X2Q E;  1UFF A;  4C0D C;  3RAU A;  3VTX A;  3H0F A;  3KFV A;  2KCV A;  3G2U A;  1ZX6 A;  3G6E A;  5EX0 A;  4Z8A A;  2D6F A;  4ATG A;  4LDY A;  3GP8 A;  3OS5 A;  4FHK A;  2QTV A;  1AP7 A;  4LDU A;  2YIN A;  1YJ9 T;  1K1B A;  5JHA A;  1BIA A;  4FYW B;  2GRL A;  5JHB A;  4DA4 A;  2DTH A;  2HCK A;  3M0U A;  4FHJ A;  5GAN f;  5ENQ D;  1UJJ A;  4DLQ A;  2L6J A;  2DA9 A;  5GAO p;  4OAV B;  2WSE E;  4PJL A;  1JWG A;  4M75 E;  2UY1 A;  4FT2 A;  3OYH A;  3AU5 A;  2JJ9 A;  4FLB A;  3L6A A;  4U0Z A;  4WWN A;  2JS2 A;  3JCM V;  5LCW C;  5KYW A;  2MHK A;  3SQV A;  5DIZ A;  1QVG P;  5T8I A;  3EHN A;  1RL2 A;  3TWW A;  5DY9 A;  3JCM Q;  3CCM T;  4J9F A;  1AZG B;  4H7X A;  3ABK E;  5A23 A;  1M3C A;  1Q95 G;  5GAM h;  4WF2 A;  3EG9 A;  2OAU A;  4DOV A;  2NUT B;  4CCA A;  2A7Y A;  2L9B A;  4PFZ A;  1WQ7 A;  1VQN A;  4MKT A;  4HVV A;  5IHN A;  4LNG A;  3OS2 A;  1S0P A;  2OI3 A;  1KZO A;  4JA9 A;  3EHQ A;  4FYY B;  4JPB W;  2KXD A;  1VQO T;  5GJV B;  1H92 A;  3RRN B;  5FU6 C;  3L2U A;  1H3Z A;  2EQX A;  4ABN A;  3FUK A;  2EQI A;  2V8J A;  4L59 A;  5B3S E;  4DX7 D;  2KI7 A;  2SRC A;  5J26 A;  2E10 A;  3OYA A;  5AT1 B;  3FU0 A;  5GAM f;  4RTY A;  2X6H A;  2IG0 A;  4B94 A;  2I2O A;  4URK A;  1KQ2 A;  3T5V A;  1CKB A;  4KZ0 A;  3C72 A;  4FA6 A;  1OQK A;  3NTK A;  4XAX B;  3JCM J;  3HXC A;  1OEB A;  3ASF A;  2YDL A;  1H6P A;  1HXI A;  1SHG A;  1IHB A;  4HA8 A;  4C92 F;  2ZPB B;  1YI2 T;  2K9G A;  1NE8 A;  3QOU A;  1OZ3 A;  2RG8 A;  3U4T A;  4DEY A;  2JT4 A;  3OW2 A;  3SNX A;  1UGP B;  5KYY B;  2J4D A;  4IUL A;  1C1A A;  4BB7 A;  4QFV A;  4RG9 A;  4O1P A;  1FMV A;  4JEU A;  1O5M A;  4UWH A;  3S7J A;  2YUQ A;  4DRX E;  4HS2 A;  3FUN A;  4ANU A;  4M78 F;  1N8R C;  1HZ4 A;  5LJ3 j;  1NL4 A;  1G3Y A;  1OUL A;  5KCH A;  5HK3 A;  3QKY A;  4GZ6 A;  4JEH A;  2PTK A;  3FLG A;  1FXX A;  3A8L B;  3PTA A;  1QNF A;  4QT7 A;  2RQV A;  4BDY A;  2IVW A;  2BKG A;  3TWU A;  2XMF A;  4LD6 A;  1BYM A;  2EKO A;  4M7D D;  2E6N A;  1Q82 U;  1RAD B;  1ZQ1 A;  1TUD A;  1QVG A;  4UUC A;  1WHG A;  2DXC A;  3QDF A;  3QDR B;  5A0G A;  2ETB A;  1B34 B;  4FP7 A;  3CCV A;  1Q7Y C;  4CC3 A;  5HI7 A;  2QG9 B;  4HCC A;  2VGX B;  4C0F A;  3C94 A;  5GAN 8;  1MX4 A;  3QWV A;  3QBY A;  4C92 C;  3BG1 B;  3GOX A;  1RAH B;  3CME Q;  3FTW A;  3OTN A;  4A3T A;  4N3C A;  3CCR A;  4JHJ A;  1Q81 U;  3ER0 A;  1OYX A;  2XEV A;  3S7F A;  2M16 A;  4PS3 A;  3TU4 K;  2QA4 Q;  3VS7 A;  4GTM A;  2EIM E;  2XEH A;  3LLR A;  1K73 U;  5DBK A;  4JZ4 A;  3T8M A;  3QB2 A;  2I1J A;  5C1D A;  4JJN K;  4F7A A;  4AFS C;  5KYU B;  4ATO A;  1BCO A;  2EBP A;  4G1T A;  2O4X B;  1QVF A;  1U2V G;  5GAN 2;  3EFS A;  3VS1 A;  4OGC A;  4M7A G;  1VYV A;  3CST A;  2BTT A;  3ML9 A;  2WSF E;  4IUP A;  3CHS A;  4DBH A;  4AIF A;  3CCQ T;  2D9T A;  2ZU6 B;  3EG1 A;  5ITZ F;  3EHM A;  4CI0 C;  2WXR A;  2V1R A;  3U9W A;  1M27 C;  4I1O B;  2JM9 A;  2QGG A;  4PJO D;  2Y1L E;  3PIP A;  3RK6 A;  4J8Y A;  3ONK A;  4CZ2 D;  3FTZ A;  4G26 A;  2LX7 A;  1HX8 A;  2QA4 A;  3QNK A;  3TWS A;  4HOS A;  1TNZ A;  1WHL A;  4AT1 B;  2GQV A;  3PZ2 A;  3MJX A;  5IH2 A;  1YHQ T;  3FUJ A;  1DJ7 B;  3CCR Q;  2JMC A;  3VS0 A;  5CCA A;  4BE2 A;  1PSF A;  3CME A;  3PH0 C;  3CIA A;  1TJC A;  5FQ6 A;  1Z6T A;  5BT1 A;  2WXI A;  5KYX B;  1GFC A;  2IJG X;  2CT4 A;  5A0L A;  3CCV Q;  4M77 G;  4FU6 A;  1M1F A;  2ROT A;  4M77 E;  1LD8 A;  2HYZ A;  1MHQ A;  1YWP A;  1GXI E;  2VGE A;  4C0M A;  3AAA C;  2FL7 A;  4E7J A;  2VKN A;  1M2V A;  2X6K A;  4NRH B;  1BI0 A;  2EW3 A;  3E34 A;  2Y4Y A;  3UT1 A;  3TJP A;  2DWZ A;  3AG1 E;  1PKT A;  5D0Q D;  2X3X D;  2MK5 A;  4V3I A;  2X6F A;  5GAM g;  2AVP A;  3LY9 A;  2DYB A;  1RAI B;  2GRN B;  2L0I A;  3JCM W;  2K5I A;  2GRO B;  3CCQ A;  4CGW A;  3CCR T;  4HXI A;  1VYU A;  1OV3 A;  3OA6 A;  4YDE A;  2WXJ A;  3CEQ A;  4M7D A;  1NP7 A;  1OCO E;  4Y92 A;  3JQ1 A;  4E2F B;  4NQ0 A;  1IHG A;  4XEI G;  2FRY A;  4FM4 B;  4GAA A;  4ELY C;  4I9C A;  2PVO B;  4C0G A;  1NZ9 A;  4J9G A;  3JCM g;  4A1S A;  3PMT A;  4R56 A;  5IHI A;  5D66 A;  2OTL A;  4JB8 P;  4J8O A;  1TYQ G;  1AHJ B;  1QCN A;  4G8L A;  4HCK A;  1GBQ A;  4RTU A;  1SZA A;  4N0A A;  2JTE A;  1KJW A;  3JAM E;  1VQL Q;  2ZPF B;  4PFP A;  2OEW A;  1OOT A;  3QJY A;  1VQ8 Q;  1D1B A;  2J49 A;  3CQC B;  3D9M A;  5GAN h;  3FU5 A;  5AQ9 A;  2GFU A;  4C48 B;  2WXO A;  1M1G A;  3TAX A;  5LFA A;  4LE9 A;  3JCM c;  3L42 A;  4BI8 B;  1TXQ A;  1QQJ A;  1LVK A;  1VQN Q;  3ZBD A;  5FRO A;  5CO7 A;  2XHE A;  4RTW A;  2QDY B;  4RCC A;  3VTY A;  1WXU A;  2RKK A;  2AKK A;  3H6Z A;  2C0I A;  2E64 A;  1FVH A;  1G2B A;  1OI1 A;  1Z9Z A;  1K0X A;  2NUP B;  1FYN A;  2EYQ A;  2VUB A;  1ZBJ A;  4LDW A;  3PFS A;  4TV3 A;  3VYH B;  5LJ5 e;  4QQI A;  3ZPJ A;  1VQP Q;  1MJ0 A;  3PE4 A;  1FPP A;  4OGE A;  1XTD A;  4FW2 A;  4GTQ A;  3ZYL A;  4DJA A;  3LX7 A;  1KFZ A;  4A4K A;  3S3O A;  1PG5 B;  2FO0 A;  1Y6I A;  3SBT B;  3LJN A;  4J9B A;  2KK4 A;  1HE8 A;  3MV2 B;  5GMK i;  2XGS A;  3OS1 A;  2X3W D;  4PK4 A;  3CHR A;  2JEK A;  3I56 A;  4N3B A;  2QXF A;  1HSQ A;  4N5C A;  5KCO A;  3OMC A;  5EID A;  2C0L A;  4RQI A;  4M77 C;  4EMH A;  3PGG A;  3AG3 E;  3FEX A;  1D0Z A;  3C0C A;  3ZEF A;  2V5Q C;  4ACL A;  3CKC A;  4B8C B;  4AEZ C;  2E70 A;  4HRN A;  3GPL A;  2DVW A;  4X34 A;  2MWP A;  4C92 A;  3G6E Q;  1KQS A;  5A6C A;  1RW2 A;  3LGL A;  2KR3 A;  3QC1 A;  4NIK A;  1SA4 A;  3A5Z B;  4HLE A;  3RU0 A;  1MV3 A;  3APD A;  2IIM A;  3CCV T;  4C8Q F;  3UXG A;  1H8K A;  1K4U S;  2FO7 A;  4CT4 A;  1O1S A;  3FP3 A;  5LJ3 e;  3MKQ A;  4M77 D;  4E7Z A;  2V0P A;  2RD1 A;  3J5Q B;  3RO3 A;  1V55 E;  3MA5 A;  1XQH A;  3CCM A;  1NYG A;  3HL8 A;  1YMP A;  1PC2 A;  5E75 A;  3D9L A;  2VGY A;  3CR3 A;  2IFU A;  3QK0 A;  2LUH A;  1BBZ A;  1WX6 A;  2KT8 A;  4OB1 B;  1E6G A;  2VQ2 A;  4U0S A;  2YRV A;  2DMO A;  1W4S A;  4HBD A;  3LVQ E;  2IPO B;  3SWN A;  3OYI A;  5GAO n;  1Y96 B;  4G11 A;  5BUZ A;  5D7U A;  1M2O A;  5LJ5 d;  3TSW A;  4QQG A;  1LNX A;  4G23 A;  2VV5 A;  1B34 A;  5CKH A;  4Q94 A;  4M75 A;  1SF9 A;  3ZN3 A;  4M75 C;  2WVI A;  2P9L G;  1ELW A;  4PDX A;  3J5P A;  4GCO A;  3V8K A;  2HM8 A;  4BX8 A;  3TEE A;  4MMK A;  2KCK A;  3JCM e;  2LO6 A;  5LP0 A;  1KHC A;  4KUI A;  3V2X A;  3QAQ A;  5CEA A;  1WAO 1;  2LAI A;  3S2A A;  4EBA A;  2EYZ A;  2OX7 A;  3EDT B;  2VAS A;  1S72 T;  4GLK A;  1F1B B;  2O01 E;  3MCA B;  3WXX A;  3A1P A;  2Y90 A;  2EIN E;  1X2Q A;  2BZY A;  1Y0M A;  4YTL A;  3Q79 A;  3AG4 E;  4FW1 A;  2OEV A;  3DPD A;  2QQB A;  2DNU A;  3L13 A;  2VGX A;  3CXC P;  2ZPE B;  3X20 B;  3BFM A;  2GRQ B;  1JCR A;  2QC9 A;  4OB2 B;  2NYS A;  4D10 C;  3CC2 Q;  1H2U A;  3J81 E;  1QCF A;  9ATC B;  2IOS A;  2XEE A;  4KVO A;  2VJ8 A;  3CVP A;  4HNA D;  2LDM A;  2RQU A;  1BLX B;  5HK0 A;  3OXF A;  3ASD A;  4DLO A;  4X1V A;  2LJ1 A;  3PE3 A;  1X75 C;  1H6K A;  4JL0 A;  1YP5 A;  1BIB A;  3ZXS A;  4E7S A;  2NWM A;  2PZ1 A;  2RN8 A;  4X9C A;  5ECA A;  5AJD A;  4M7D B;  4Z02 A;  3NGP A;  3I55 T;  5T4Y A;  3OMG A;  4AG1 C;  1X6G A;  1G83 A;  2DF6 A;  2NC9 A;  1TN6 A;  5KCM A;  2P0P A;  1KZP A;  3D7S B;  3HXF A;  1M1K U;  3I55 A;  2QGF B;  4BI4 A;  3PEU B;  5HRY A;  3I3N A;  5KYN A;  1K8A C;  2HQH A;  3DST A;  1TTH B;  4CGV A;  2P84 A;  2DZC A;  4TXR A;  4AV7 A;  2CGH A;  2Y4T A;  4OVV A;  2ZPG B;  2J7I A;  3X25 B;  1M3A A;  2YQ8 A;  2KRN A;  3H9N A;  3FFL A;  1OY3 D;  1YFN A;  2PUO B;  2VSO E;  4GTV A;  2PVG B;  1ZUK A;  1M9S A;  1ZBX A;  4YDO A;  1UJY A;  3L82 A;  3LYA A;  1WJQ A;  1EIF A;  2E5Q A;  3IHY A;  2EGE A;  1E96 B;  2JUF A;  2RMO A;  4RTV A;  1O1T A;  4ACK A;  3KEZ A;  4Q96 A;  1PM3 A;  2DAQ A;  2RB6 A;  5CQY A;  3CC7 T;  2E2E A;  1JB0 E;  3P2B A;  3IHV A;  3PNT B;  3CCE A;  4A4G A;  5GAO m;  3H41 A;  3QWX X;  1HG2 A;  2EJF A;  3QDN A;  1KK7 A;  5JJT A;  1ZSZ C;  2HEQ A;  2HSE B;  4IUT A;  3DKM A;  2JM8 A;  1XOV A;  2GNC A;  2L3Q A;  2LVM A;  3FUM A;  3OSV A;  1I0C A;  5B1B E;  3MEV A;  3SWN C;  2M1H A;  1E7V A;  1UEC A;  2COZ A;  1D0Y A;  3ESK A;  2C0M A;  1LD7 A;  4BX9 A;  2ZGW A;  1NEB A;  3DB3 A;  3QG1 A;  4AP2 A;  1E8Y A;  3NOG D;  3NB2 A;  1IRX A;  2ZGD A;  4J8F A;  1VQ5 T;  3EUV A;  4G24 A;  1RAA B;  2MWO A;  5KYX A;  2Z0W A;  1HO8 A;  4PFO A;  2QAZ A;  4ATZ D;  1U3O A;  1VA7 A;  3N5B B;  2XPY A;  3A8H B;  3VS2 A;  3NAW A;  2OJ2 A;  3PDN A;  1WJR A;  4ZN1 A;  5JJ6 A;  4PJO B;  5EKQ D;  1UOH A;  2HL3 A;  1LF8 A;  4N3A A;  2FEZ A;  3EU9 A;  2XK0 A;  4PJO E;  2V4L A;  4N2Q A;  4OMF B;  2H8H A;  2DBA A;  1YJW T;  2DE0 X;  5LJ5 j;  3AG2 E;  2X6J A;  3MEA A;  2AWI A;  3S3M A;  1UGQ B;  2YSQ A;  2OOE A;  2P9K G;  2HR2 A;  3TWX A;  3QII A;  1LTX A;  4F7U A;  3SF4 A;  4B9W A;  1I81 A;  3OBW A;  2EPD A;  2XGO A;  4LNB A;  4EMG A;  1PD1 A;  3O8V A;  3MKQ B;  3ZVV A;  1T3S A;  2LNI A;  2P0Q A;  1PCX A;  3CC4 T;  4M78 C;  1UEB A;  1K8A R;  1JPL A;  2KCL A;  1AD5 A;  1ZUY A;  2EYW A;  3V8J A;  3G71 Q;  2WAC A;  5LJ5 f;  1WY6 A;  2J9Q A;  3REA B;  2EQJ A;  3DSV A;  3SD4 A;  2QYJ A;  3ULQ A;  1D09 B;  4EPC A;  3CCM Q;  3HFO A;  2FZC B;  1EPU A;  4ANV A;  4PLL A;  3D9J A;  1M5Q 1;  3EGX A;  1XGW A;  3FDH A;  4C92 B;  1WHK A;  4A54 A;  2EIJ E;  3E32 A;  4GBQ A;  5AQ7 A;  3CVV A;  3ZYQ A;  3U64 A;  2RH2 A;  5ARF A;  5A0D A;  1UN9 A;  3MP8 A;  2DL3 A;  2HSP A;  2WXP A;  2K3B A;  4XTZ A;  3URG A;  4KUD K;  3GYZ A;  4M78 D;  4BT8 A;  3J80 E;  3QWP A;  1X27 A;  3VU3 C;  4J8E A;  3OQ5 A;  1YJN T;  4IIO A;  2MAM A;  2WPV A;  4NAC A;  1R77 A;  3CXC A;  5JJ7 A;  2BE9 B;  5AEN A;  3CCL T;  2O4X A;  4M7D F;  2CP6 A;  3NF1 A;  7AT1 B;  2CSQ A;  1AEY A;  4I1M A;  3ZIM A;  1ZSZ B;  3ZXP A;  5D0O D;  4C8Q B;  2FYK A;  4JC8 A;  3I56 Q;  1OWL A;  4HRM B;  5IT9 E;  1MMD A;  1UHF A;  4E6H A;  2YXY A;  2ZCF B;  2O9V A;  1JU5 C;  4H7Y A;  2H3E B;  2VWF A;  4JZ3 A;  3TSZ A;  4J6Y A;  1WI7 A;  1RI9 A;  2WXQ A;  2A5E A;  3FIF A;  1VQP A;  1JUQ A;  2J07 A;  4BSX A;  2VYT A;  1N94 A;  1JCS A;  1VIE A;  1SVX A;  3PS6 A;  2VSN A;  4OMM A;  1VQP T;  5KNH D;  1QCO A;  4M77 A;  2LCL A;  3EIQ C;  3FUD A;  1CSK A;  1NPP A;  1WPY A;  3UIN C;  1PHT A;  4UWK A;  4C5H A;  4HOQ A;  3V31 A;  4JXT A;  2A08 A;  5ARG A;  4EPZ A;  1MV0 B;  3OYE A;  3Q9N C;  5BV1 A;  2GCX A;  1IGU A;  2K2V A;  4PJO F; 
#chains in the Genus database with same CATH homology
 4GLM A;  4OMN A;  1SRM A;  2CT3 A;  3VS3 A;  3AJI A;  3EGU A;  1GBR A;  4HRL A;  4BET A;  2F8Y A;  2BKK B;  3D9H A;  3VS7 A;  2XEH A;  2I0N A;  4O1O A;  4JZ4 A;  2A37 A;  1OPK A;  1WG0 A;  2KXC A;  4AFS C;  2K79 A;  1TG0 A;  2EBP A;  3M0R A;  4JJD A;  1A0N B;  3VS1 A;  2B86 A;  1VYV A;  2A36 A;  2BTT A;  1E6H A;  2KNB B;  5FWB A;  1BI7 B;  3EG1 A;  5ITZ F;  3JV3 A;  3ZKJ A;  2V1R A;  1M27 C;  1GL5 A;  2JM9 A;  2Y1L E;  4J8Y A;  1X43 A;  4CZ2 D;  2V1Q A;  2J06 A;  3T8K A;  3V79 K;  2LX7 A;  3M0P A;  3QWY A;  3TWS A;  2J05 A;  2J6O A;  3SEM A;  1A5E A;  5IH2 A;  1W70 A;  5KNG A;  2JMA A;  1BU1 A;  2JMC A;  4K5A B;  2L6B A;  1X2K A;  3VS0 A;  5EYP F;  3ULR B;  3UTM A;  2LZ6 B;  2YUO A;  4CC4 B;  4JJB A;  4DX6 D;  2MOX A;  3EG0 A;  1GFC A;  1PNJ A;  3R6N A;  2CT4 A;  2C0O A;  1ARK A;  5ENS D;  1AWJ A;  2LQN A;  2ROT A;  2XEN A;  1YWP A;  2ED1 A;  5CBO A;  2VGE A;  1U06 A;  2GQI A;  3AAA C;  2VKN A;  1M3B A;  1HD3 A;  2VVK A;  4B93 B;  5CBN A;  2ED0 A;  2EW3 A;  2W0Z A;  4AG2 C;  2Y0B G;  2DM1 A;  3B7B A;  1RUW A;  2RPN A;  2DWZ A;  1PKT A;  1MX6 A;  2DZN A;  1N0R A;  4D8K A;  2X3X D;  1MX2 A;  1NEG A;  5EN5 D;  1UUE A;  2K6D A;  2D1X A;  1W6X A;  2DYB A;  2KBT A;  4GPM A;  2HDA A;  4OMP A;  1X6B A;  5FIO A;  4OAU C;  2BZ8 A;  2KEA A;  1S1N A;  2CSI A;  1VYU A;  1OV3 A;  1WA7 A;  2GGR A;  2O88 A;  3PE0 A;  4Y92 A;  1H3H A;  1X69 A;  1NFI E;  2RQR A;  4E6R A;  2FRY A;  2LJ0 A;  4A63 B;  2FRW A;  2ESW A;  4J9G A;  1SHF A;  4BES A;  1AWO A;  5AQB A;  5IHI A;  5D66 A;  2JW4 A;  4JB8 P;  2O9S A;  2KYB A;  2KGT A;  4G8L A;  5FWC A;  1NYF A;  4HCK A;  4DUI A;  2GTJ A;  4OMQ A;  1GBQ A;  4RTU A;  3NBN B;  2KE9 A;  1BD8 A;  2JTE A;  4RLY A;  1KJW A;  4U95 D;  4DX2 A;  1OOT A;  1AWW A;  1RLP C;  2QDL A;  4LN2 A;  5CER B;  5AQ9 A;  1JQQ A;  2FPF A;  4F6R D;  4C48 B;  3A98 A;  4G8K A;  2EYY A;  4AFZ C;  2LMJ A;  4LE9 A;  3UA6 A;  3VS5 A;  1N5Z A;  1CKA A;  1WLP B;  1JXM A;  4YDY A;  2D8H A;  5HS0 A;  4RTW A;  3W9G A;  4LUD A;  3F6Q A;  1WXU A;  2DIL A;  2AKK A;  1W1F A;  2C0I A;  1HJD A;  1G2B A;  4YDW A;  1Z9Z A;  1K0X A;  2EYX A;  1FYN A;  1TUC A;  1ZBJ A;  3TWQ A;  1Z9Q A;  2KBX A;  3EG3 A;  1K1A A;  4QQI A;  1MJ0 A;  1N0Q A;  2M0Y A;  5CEC B;  1UE9 A;  1MUZ A;  1NLP C;  2AK5 A;  2K2M A;  1KIK A;  4HVU A;  1V1C A;  1K76 A;  1KFZ A;  1GCQ A;  1T0H A;  4LUE A;  4J9B A;  2FO0 A;  3JXI A;  2J6K A;  3LJN A;  4N5Q A;  2DL5 A;  4OMO A;  4CC7 A;  1WIE A;  2X3W D;  5EYL A;  5CED B;  1UTI A;  3UF4 A;  2LNH B;  5ENP D;  1HSQ A;  1BK2 A;  5EID A;  4HQD A;  3IQL A;  4J9E A;  3CQT A;  3C0C A;  2MCN A;  2V5Q C;  3EG2 A;  4HRN A;  2DVW A;  2PNI A;  5IHK A;  2A28 A;  3ZNG A;  1MYO A;  3KEA A;  4R0K A;  4LSZ E;  1QKX A;  2JXB A;  2KR3 A;  1Y57 A;  4NIK A;  4O60 A;  2L2P A;  2GTO A;  3VS4 A;  3Q9U C;  1MV3 A;  4ESR A;  4K5B A;  2IIM A;  3HG0 D;  3UXG A;  1UDL A;  1H8K A;  1K4U S;  3THK A;  2CDT A;  2CUB A;  4ZFH A;  2DL7 A;  2DL4 A;  1AVZ C;  4HLL A;  5EC7 A;  3RNJ A;  3NHN A;  4K5C A;  3J5Q B;  3NOC D;  3H0H A;  5IXB A;  5AAR A;  1NYG A;  2GBQ A;  3DEP A;  1YMP A;  2LP5 A;  3DEO A;  3JUE A;  4RUG A;  2D0N A;  2XZT G;  4HI9 A;  1TR4 A;  1BBZ A;  1WX6 A;  2KT8 A;  1E6G A;  2RQW A;  2DJQ A;  2EKH A;  1JXO A;  2DMO A;  4HBD A;  2G6F X;  3V30 A;  2FG0 A;  2KT1 A;  3I5S A;  3TSW A;  2L0A A;  2YUP A;  1LCK A;  4BER A;  2XZD G;  5ENT D;  4DX5 D;  2ABL A;  2YUN A;  1JO8 A;  4ZHB A;  4D8D A;  4HXJ A;  2HBW A;  4LNU D;  3J5P A;  2KRM A;  4CC2 A;  4LNP A;  4EIK A;  1E7O A;  4KRT A;  1ZLM A;  3V2X A;  1SPK A;  5CEA A;  2P2C P;  2L3S A;  2EYZ A;  2OAW A;  3VRZ A;  1BU9 A;  3JXJ A;  1WXT A;  2E5K A;  2BZX A;  1X2Q A;  2BZY A;  4Z89 A;  1Y0M A;  2F2X A;  1G3N B;  2DNU A;  4TUM A;  4HI8 A;  2DBM A;  3FJ5 A;  2JAB A;  4JJC A;  2QC9 A;  2DVJ A;  4HB5 A;  3LH5 A;  5EIB E;  2DLP A;  1ABQ A;  2LJ3 A;  1QCF A;  2XEE A;  2RQU A;  3I9Q A;  4HNA D;  1BLX B;  2KRO A;  3HRA A;  4F14 A;  4X1V A;  3H0I A;  2LJ1 A;  5ENR D;  5BXO A;  2FO1 E;  1YP5 A;  2ETC A;  1I07 A;  2CH4 A;  2DX1 A;  1IO6 A;  3PVL A;  3T9K A;  4HVW A;  5KWD A;  2NWM A;  2PZ1 A;  2RN8 A;  3M0Q A;  5ECA A;  3C5R A;  1JEG A;  3I5R A;  1SW6 A;  3NGP A;  1WDY A;  2FEI A;  1K9A A;  4AG1 C;  1BI8 B;  1X6G A;  1G83 A;  2DF6 A;  3EHR A;  1QLY A;  3W9F A;  3TWT A;  3V2O A;  4OML A;  1N11 A;  5HRY A;  1NM7 A;  1SEM A;  3ZU7 B;  1SSH A;  3TVT A;  3PVQ A;  1QYM A;  2RQT A;  1WFW A;  3ZL7 C;  2W10 A;  2M51 A;  2LCS A;  4F17 A;  3O5Z A;  2J7I A;  5JA4 D;  2EGA A;  2DBK A;  4BEP A;  1M3A A;  2SEM A;  4J9I A;  2KRN A;  4Z68 A;  1OY3 D;  2F2W A;  1YNZ A;  1ZUK A;  1U5S A;  1IXV A;  1UJY A;  4FSS A;  4J9D A;  1PWT A;  1K3Z D;  2F2V A;  2EGE A;  2RMO A;  2F37 A;  1FMK A;  2NUZ A;  4RTV A;  1SRL A;  2AZV A;  4U96 D;  3NMZ C;  3ZUV B;  1BB9 A;  4BSZ B;  3GBQ A;  2CH4 W;  2RNA A;  5I11 A;  4F16 A;  1J3T A;  2EGC A;  3H41 A;  3QWX X;  4K11 A;  1PRM C;  2HEQ A;  2DRM A;  2ZGG A;  2JM8 A;  2CRE A;  2KYM A;  1XOV A;  2GNC A;  2L3Q A;  1OPL A;  1GFD A;  1NLO C;  3M0S A;  1QWE A;  1I0C A;  2ENM A;  2FPE A;  2L3P A;  1UHC A;  5JMN D;  2HE0 A;  4IIM A;  1UEC A;  4RTX A;  1RLQ C;  2V4H C;  2ROL A;  1EFN A;  1M8M A;  2LQW A;  4AFQ C;  1UGV A;  1NEB A;  5FIN A;  3NOG D;  4LG6 A;  2C0T A;  2DL8 A;  2ZGD A;  5IXF A;  1NG2 A;  4U8Y D;  1QWF A;  4F1P A;  1UFF A;  4ATZ D;  1U3O A;  1VA7 A;  2AKL A;  1DC2 A;  3VS2 A;  3VRY A;  2OJ2 A;  3H0F A;  1D9S A;  3KFV A;  4Z88 A;  1ZX6 A;  2KRS A;  4Z8A A;  5FW9 A;  1UOH A;  1GRI A;  1S70 B;  3EU9 A;  1AP7 A;  2MIO A;  2O31 A;  1ZUU A;  1AWC B;  2H8H A;  1K1B A;  4ORZ A;  2DE0 X;  1B3Q A;  2HCK A;  2F8X K;  3M0U A;  5ENQ D;  4DEX A;  2DA9 A;  4OAV B;  2RFA A;  2YSQ A;  4AFU C;  3TWX A;  4J9H A;  4CYM D;  2EPD A;  5HCK A;  2JS2 A;  1WDX A;  1T3S A;  1GCP A;  2EVR A;  1AOJ A;  3TWV A;  1AWX A;  5L23 A;  2PNN A;  3TWW A;  2MYO A;  4J9F A;  1AZG B;  1AD5 A;  1ZUY A;  1M3C A;  2EYW A;  4GMR A;  3REA B;  3TWR A;  1I1J A;  1VYT A;  4J9C A;  1B07 A;  2DRK A;  2NYJ A;  2QYJ A;  2P4R A;  4HVV A;  5IHN A;  2OI3 A;  3EHQ A;  4JPB W;  2KXD A;  5GJV B;  1H92 A;  2EQI A;  4M4Z A;  1T0J A;  4DX7 D;  2SRC A;  4GBQ A;  3UAT A;  1K1Z A;  5AQ7 A;  3RBB B;  1K0S A;  1M30 A;  1PKS A;  2ECZ A;  5AQA A;  4RTY A;  3NPF A;  2J8S D;  4DX1 A;  2DL3 A;  1ABO A;  2HSP A;  2K3B A;  4RTT A;  2RFM A;  1IKN D;  5HKP A;  1CKB A;  1T3L A;  1X27 A;  3UI2 A;  3M0T A;  3SO8 A;  4ZNX A;  5KBA A;  3IXE A;  2J6F A;  1OEB A;  2YDL A;  3REB B;  1YWO A;  4IIO A;  2B0O E;  3SHW A;  1OT8 A;  1YYH A;  1SHG A;  2JS0 A;  1IHB A;  1UJ0 A;  1KSW A;  2FPD A;  1DCQ A;  2K9G A;  1QKW A;  2CSQ A;  4DEY A;  1AEY A;  3I35 A;  2JT4 A;  1WYX A;  2K7A A;  3B95 A;  5I22 A;  1AZE A;  4HRM B;  4QFV A;  4U8V D;  5AAO A;  2AJA A;  2DZO A;  4O1P A;  1UHF A;  2O9V A;  1JU5 C;  2VWF A;  4JZ3 A;  2YUQ A;  4DRX E;  3TSZ A;  3U23 A;  1WI7 A;  1GCQ C;  2RF0 A;  1RI9 A;  1WXB A;  5AN8 A;  2YT6 A;  2A5E A;  2PTK A;  2CUD A;  2D8J A;  4QT7 A;  2RQV A;  1SVX A;  2AZS A;  5BXU A;  2BKG A;  3TWU A;  2XMF A;  4OMM A;  1ZSG A;  1PRL C;  5KNH D;  4RTZ A;  1UG1 A;  5GJW B;  2O2O A;  1TUD A;  4UUC A;  5ENO D;  2ETB A;  1CSK A;  1PHT A;  4CC3 A;  1YN8 A;  3V31 A;  4WCI A;  3VS6 A;  5EIL A;  2KXP C;  2A08 A;  1MV0 B;  1MX4 A;  4J7W A;  3Q9N C;  3UA7 A;  2ETA A;  1YCS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...