1YCSB

P53-53bp2 complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
193
structure length
193
Chain Sequence
PLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGITALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAVFAMTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYEPQNDDELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the p53 tumor suppressor bound to the ankyrin and SH3 domains of 53BP2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (anti-oncogene/ankyrin repeats)
molecule keywords P53
total genus 46
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 1996-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00018 SH3_1 SH3 domain
B PF00023 Ank Ankyrin repeat
B PF13606 Ank_3 Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1ycsB01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ycsB02
3T9KA 1H3HA 3VS1A 1MX2A 2HBWA 3PVQA 2DBMA 2XZDG 2I0NA 2XEEA 2LQNA 1ABQA 3EGUA 3Q9UC 2RPNA 5IXFA 1X2KA 2DWZA 1X27A 5HCKA 3NOCD 1BI7B 4U8VD 2JMAA 2HSPA 2GBQA 2KYMA 2OI3A 2A5EA 2ZGDA 2J7IA 4C48B 2DA9A 3UTMA 2CH4W 2KR3A 4HVVA 3V30A 2PNIA 1K0SA 2ZGGA 2EYXA 4EIKA 1NLPC 1WDXA 2EQIA 2ETBA 5IXBA 1VA7A 1RLPC 1GCQC 1QKXA 5CBOA 1G2BA 3Q9NC 2JS2A 3DEPA 2XMFA 3TWVA 3M0TA 2XENA 4BEPA 4CZ2D 3ZKJA 1G3NB 3I5SA 2KEAA 3TWSA 1T3LA 1X2QA 2RFMA 4O1PA 5D66A 1IO6A 2SEMA 4ZFHA 1UECA 1NEGA 1MX4A 5IHIA 2L3SA 4J9BA 1V1CA 1SVXA 4CC3A 2NYJA 4HVWA 1M30A 1N0QA 1GL5A 2DLPA 4QFVA 1EFNA 3I9QA 2O88A 4GMRA 1N5ZA 2GQIA 3M0SA 4RTTA 2LCSA 1AWJA 2J6FA 3TSZA 3DEOA 1AWXA 2EGEA 1JXMA 1SEMA 2ABLA 1FYNA 2L0AA 3PE0A 1S1NA 2X3XD 1T0JA 2K2MA 3VS7A 1GFCA 2EW3A 2H8HA 3A98A 3JV3A 5BXOA 1CKBA 2DE0X 2QC9A 1AOJA 3C5RA 5I11A 2DL5A 1MX6A 5ENOD 2CH4A 4BESA 2RN8A 4AFUC 1W70A 2CUBA 2KYBA 2GTOA 3EG3A 2DJQA 1FMKA 2KT1A 5GJVB 2JW4A 4HXJA 2YT6A 1TUCA 5JA4D 2C0TA 2FPDA 1WYXA 4OMOA 1NYGA 2VWFA 1ZUKA 2DRKA 2A28A 2JM8A 2FPEA 1AWCB 1GCQA 2GNCA 1UGVA 5KNGA 5FW9A 1G83A 4JZ4A 3ZU7B 1Y57A 3V31A 1UJYA 3VS2A 1NFIE 5AQ9A 1H8KA 1J3TA 4AFSC 3NBNB 2KBXA 5JMND 2NUZA 4QQIA 2JS0A 4J9FA 4ORZA 5EILA 2F2XA 1BU9A 1JQQA 2KE9A 1PNJA 1DC2A 2K9GA 2P2CP 2KRMA 2O9SA 4CC7A 4DRXE 4IIMA 1RUWA 3VS5A 2D8JA 4J9CA 4J9DA 1ZX6A 2ETCA 4DUIA 5CEAA 4OAVB 2DL4A 4DX2A 1SRLA 4X1VA 1NEBA 1K0XA 2BKKB 2KRSA 3CQTA 1KSWA 3EG0A 1MUZA 1OPLA 1PWTA 1BLXB 2CSIA 4HCKA 2YSQA 2K79A 3HG0D 3TWRA 1UG1A 4M4ZA 1QCFA 2YUOA 1OY3D 5AN8A 1KFZA 2QDLA 2V1QA 2QYJA 5ITZF 1QKWA 2FEIA 4RTYA 2SRCA 2DF6A 3TWUA 1UTIA 3UI2A 2J8SD 5AQBA 1TR4A 5FINA 4HNAD 3T8KA 3IXEA 4JB8P 2DL8A 2EBPA 2LNHB 1WA7A 2EYYA 3REAB 3V2OA 1MV0B 2ENMA 1YP5A 1AZGB 2NWMA 1UOHA 2EPDA 4HRMB 3C0CA 3UXGA 2FO0A 4Z8AA 3VS6A 2PNNA 2L3QA 5AARA 3RNJA 4JZ3A 2KGTA 3NMZC 1RLQC 2LP5A 4N5QA 1UJ0A 4F16A 1H92A 1BBZA 4B93B 5CERB 1K9AA 4DX6D 1QYMA 4KRTA 2DNUA 1WXUA 1BU1A 1ZLMA 1E6HA 4O60A 1WI7A 2BTTA 3EHRA 1TUDA 3IQLA 4LUDA 5HKPA 3LH5A 1I07A 2CT4A 4F14A 5AAOA 2P4RA 3ULRB 5AQAA 4DX1A 2LJ3A 4LSZE 4OAUC 2ESWA 4D8KA 2RNAA 3JUEA 1YCSB 2EGCA 4AFQC 3QWYA 3TWXA 2YUQA 1UHFA 3SO8A 1JEGA 1X6GA 1D9SA 5ENPD 2LX7A 4F17A 4YDYA 2ED0A 1X43A 3VS3A 1OEBA 1CKAA 2DX1A 2K6DA 1PKTA 1T0HA 2A08A 5ECAA 1U5SA 1JU5C 1GBRA 4D8DA 2PTKA 3M0PA 3UA7A 2JMCA 1AWOA 3ZUVB 2J06A 4BETA 2PZ1A 4Z89A 4RTWA 4ZHBA 2E5KA 1U3OA 1BI8B 2F2WA 2RQRA 5ENRD 1WDYA 2KXCA 2M0YA 1HSQA 1YN8A 2IIMA 4J9GA 2O2OA 1I1JA 2DM1A 2DILA 2ETAA 4Z88A 2CDTA 3LJNA 2F2VA 2KBTA 1OT8A 4K5CA 2DZNA 3F6QA 1YMPA 1MYOA 5FWCA 5ENQD 1N11A 2MCNA 1M3CA 5L23A 1NYFA 1WXTA 1QWFA 1VYVA 2JT4A 2G6FX 1UUEA 2CUDA 2MYOA 4TUMA 1IXVA 5IHKA 1AWWA 5EIDA 3JXIA 2L2PA 2W10A 4BERA 3EG1A 1KIKA 2LMJA 2BZYA 2KT8A 3V79K 4LE9A 3B95A 1NG2A 2AZSA 2LJ0A 2YUPA 3KEAA 4WCIA 2AZVA 4GLMA 1HJDA 2W0ZA 4HRNA 3O5ZA 2CSQA 4U96D 2EYZA 2RQUA 4UUCA 5CBNA 2M51A 3UATA 4JPBW 2LZ6B 2YUNA 2OJ2A 1PRMC 4K5AB 2FRYA 2RFAA 5CEDB 2XEHA 1UHCA 1YWOA 3NGPA 4RUGA 1ZUUA 2C0OA 1A0NB 3AJIA 5GJWB 1GBQA 2D1XA 2L3PA 1MV3A 4E6RA 3NPFA 4HI9A 1PKSA 2A36A 1E7OA 2J05A 1YYHA 3THKA 1S70B 1WFWA 1WIEA 2Y1LE 4QT7A 4RTXA 4ATZD 1BD8A 2HE0A 2XZTG 2V4HC 4O1OA 4G8KA 1JXOA 3REBB 1SW6A 2KRNA 3M0RA 1QLYA 4IIOA 1YNZA 2F8XK 2JXBA 1Y0MA 1M3BA 4OMLA 4LNPA 3QWXX 4DX5D 1AVZC 1K1ZA 2KXPC 1N0RA 2AJAA 2AKKA 1YWPA 3M0UA 2K3BA 2FO1E 2RQVA 4J9EA 4J8YA 1PHTA 2FRWA 2RMOA 4Y92A 4GBQA 1W6XA 4DEXA 2CT3A 5IH2A 2RQWA 3JXJA 1A5EA 3RBBB 3VS0A 2OAWA 1X69A 3AAAC 1WLPB 1I0CA 2KXDA 1ARKA 1SSHA 3GBQA 2J6OA 4J7WA 3TWWA 3H41A 2DYBA 1WX6A 2GGRA 1X6BA 3W9GA 1T3SA 2V5QC 4U8YD 1GFDA 4F6RD 2VVKA 1NM7A 3TWQA 1OV3A 2ROLA 1Z9QA 2VKNA 2KNBB 3VRYA 2BZ8A 1PRLC 1ZUYA 4J9HA 1SHGA 2RQTA 4LUEA 4CC2A 5EYPF 1AZEA 4AG1C 2DL7A 3W9FA 1AD5A 4JJCA 4JJBA 2HEQA 1QWEA 2C0IA 2KROA 1WG0A 4NIKA 5FIOA 4HI8A 1LCKA 3ZNGA 4JJDA 4RTZA 3UA6A 1K4US 1XOVA 4RTUA 3VRZA 5HRYA 3V2XA 2EKHA 4HB5A 3TSWA 2EVRA 3KFVA 1ABOA 2FPFA 3TVTA 2F8YA 3TWTA 3SEMA 2LJ1A 1U06A 3SHWA 2JABA 1E6GA 1RI9A 1VYTA 3H0FA 1JO8A 4ESRA 2B0OE 2A37A 2D8HA 1UFFA 2K7AA 2D0NA 4K11A 5ENSD 1B07A 4GPMA 4OMPA 4CC4B 1Z9ZA 1BK2A 2RF0A 3R6NA 1SHFA 3NOGD 1MJ0A 4A63B 4AG2C 2JTEA 2F37A 3EG2A 1BB9A 4U95D 4OMMA 4LNUD 4DX7D 3H0IA 5I22A 1OOTA 5BXUA 1OPKA 1K1AA 4BSZB 2HDAA 5CECB 3PVLA 3U23A 4DEYA 2GTJA 1AEYA 4K5BA 4CYMD 1AP7A 1WXBA 2O31A 4HLLA 5ENTD 5KWDA 1ZBJA 2L6BA 3D9HA 4FSSA 2YDLA 1K76A 5KNHD 4OMQA 2MIOA 5KBAA 2ECZA 3H0HA 3B7BA 2X3WD 3NHNA 1W1FA 2O9VA 1K1BA 1GRIA 3ZL7C 4HQDA 1M27C 5FWBA 1KJWA 5EYLA 2AKLA 4YDWA 4HBDA 4RLYA 2EGAA 3EHQA 3VS4A 1IHBA 5HS0A 2DMOA 2DVWA 1TG0A 5EN5D 1ZSGA 1M8MA 1NLOC 2ED1A 4LG6A 3I35A 2BZXA 2Y0BG 1SPKA 1UE9A 2MOXA 4LN2A 2DL3A 4G8LA 4RTVA 2J6KA 4OMNA 3FJ5A 4ZNXA 5AQ7A 2V1RA 5EIBE 1B3QA 3J5PA 1IKND 1SRMA 3M0QA 4Z68A 4F1PA 1HD3A 1VYUA 2JM9A 3UF4A 4HRLA 2BKGA 1GCPA 2AK5A 2DVJA 2DRMA 2DBKA 3EU9A 3I5RA 5EC7A 3HRAA 4R0KA 1K3ZD 1M3AA 2CREA 2ROTA 2B86A 2HCKA 5IHNA 4HVUA 4J9IA 2LQWA 2DZOA 1CSKA 2VGEA 4AFZC 1DCQA 2EYWA 2FG0A 3J5QB 1UDLA
chains in the Genus database with same CATH superfamily
3OYKA 3R9AB 3VS1A 4M75C 4BT9A 1VQ8Q 2XZDG 5GAOr 3B7RL 4FJZA 3Q9UC 3O4ZA 2R17C 2RPNA 4PS8A 2DWZA 3D9MA 1X27A 3CVQA 3ZRHA 4NL3A 5HK3A 3BUAA 4U8VD 2IOLA 4LDYA 5A0LA 4JJNK 1HK9A 4WWNA 4U8HA 1QP2A 1UG3A 4C48B 1IHVA 3AHUA 2CZ0B 3V30A 1ZBPA 1WM5A 1YJWQ 1RAGB 4M78B 4EIKA 2XRZA 4F53A 5B1BE 2HMAA 2ZPIB 1D3BA 3EU5A 1QZ2A 1TUGB 3L2QA 3CVNA 3R7RA 3SWNB 4ZN1A 3Q9NC 1G3YA 4DLOA 3DEPA 3ZEHA 3E34A 4BEPA 3RIBA 3I5SA 4LNBA 4QVCA 1FMWA 2VYIA 4I9EA 3O48A 4XQ3A 4C0DB 1IO6A 2SEMA 2X6FA 3DPYA 4WWPA 4M77E 2NYSA 1UECA 1NEGA 4M75E 4M77G 1EZZB 5IHIA 2VASA 4PJOG 4ZGJB 5B1AE 4CC3A 4EPCA 2NYJA 1B34A 4MDXA 4J6WA 2WSEE 1MQSA 4A3VA 3ULQA 3Q49B 3Q4AB 4LCTA 2DLPA 4F7UF 3GNGA 4MMKA 4GYOA 3JAME 2MPXC 3X25B 1Z5SC 1VQKT 4L1BA 4B89A 2JLBA 2MWOA 4F7UB 2VTBB 1M2OA 2GQIA 1OZ2A 1K9MU 2YINA 4F7AA 4TUUA 4F7UE 2CP5A 3NTKA 2Q7FA 4A54A 4EQFA 1SEMA 3P8BB 2L0AA 4HT8A 3CD6A 3QHSA 1T0JA 1VQ9Q 4M7AG 1ELWA 5CR2A 3JB9F 4UI9C 3DSXA 2H8HA 2RO0A 3CD6T 1HU3A 3CBOA 5BXOA 2DE0X 4QQGA 1AOJA 3S7DA 5KYUA 3DXMG 3DLMA 3KSLA 3OXLA 4BESA 2CUBA 5EX3A 5LCWJ 2DJQA 3LYIA 1FMKA 2KT1A 2GW1A 1U3DA 5GJVB 2B8AA 1S72A 2CZ6B 3FU0A 2A0FB 1VQ9T 3L2WA 2JM8A 4FW2A 4BACA 4KGVB 1GCQA 2CP6A 4AM9A 4PJMA 3SB2A 3HXFA 5KNGA 4B8AA 3PUKA 3D9PA 4JZ4A 4PFOA 1Y57A 3ER0A 2QY7A 3Q79A 3TQ7P 2X4WA 5AQ9A 5JMND 3URZA 4M7AB 3FUNA 5EILA 2X38A 2LNVA 5A0GA 3U64A 1VQLQ 4N4GA 4I17A 3ISMC 4CC7A 4DRXE 1RUWA 2DTHA 3G71T 3CCEQ 5LP0A 2ETCA 4ANVA 2KDSA 4KXKB 3RSEG 3CEQA 1JPLA 1K73R 1NEBA 5A0DA 4FYVB 3SHFA 3UMVA 1HG2A 1TXQA 2KRSA 1VQ4A 3CQTA 3CIAA 3EG0A 1H6KA 3UM2A 4GTVA 2K5FA 3NFCA 1BLXB 2CSIA 1HYOA 2MMPA 4HT9A 2BE9B 2YSQA 5A23A 4ELYC 1N4RA 4CRIA 5J39A 1KPSB 1OY3D 5AN8A 3ASNE 3PZ4A 4I6EA 3UM3A 5ITZF 2SRCA 4HOUA 2V26A 1TR4A 1RAAB 1UGPB 5A7DB 1BIBA 4HNAD 3IXEA 4JB8P 4XTZA 2EYYA 3H6ZA 3FTSA 2VGMA 1NL4A 3GLXA 1Q81C 4WF2A 3RRUA 3CMAA 1KLXA 4PLIA 2IVWA 5GAOp 2XDBA 1MHQA 1ZSZB 1A17A 2WXJA 3G2TA 1UOHA 3HXCA 1ZQ1A 2DD5A 4HRMB 2EPDA 3E2UA 2FO7A 2PNNA 4NRHB 5FROA 4KZ0A 5AARA 3GPLA 5T4YA 2VSNA 2I2LA 3CC7Q 1RLQC 4DQ2A 2Y4YA 1OU9A 4YDEA 3TU4K 1H92A 1D09B 2CP7A 1I8FA 4F16A 1BBZA 5GMKe 4B93B 1W4SA 4DX6D 3HXEA 3K9IA 4KRTA 4RG2A 2WXLA 2DNUA 3UIOC 1WXUA 2EJ9A 1WAO1 2H6GA 2V8JA 1E6HA 1VQNQ 1MNEA 3IQLA 3TJPA 3PUJA 4A4GA 1Q2ZA 3A8OB 1OI1A 2P0PA 5DBKA 2MAMA 5GAOm 5E75A 4F14A 2YHEA 2XKOC 3QG1A 1QP3A 5AAOA 3LGLA 3EFOA 2Y4UA 5FZRA 3X26B 3ZPJA 3M54A 4M7DG 3SF4A 3QWYA 3TWXA 2WXFA 2BEDA 4Q69A 1F1BB 4NL2A 1P5QA 1UHFA 1JEGA 3SNXA 5KYXA 4F17A 1W3BA 2ED0A 3FTWA 1YJWT 3VYGA 2PQRA 3MA5A 1CKAA 2DX1A 4XU0A 3E33A 1PKTA 3SD5A 3MGBA 3UT8A 1N8RR 8AT1B 5D6WA 5ARGA 4FHKA 2JMCA 4X9CA 1AWOA 5GAMg 4AY5A 3D7SB 5D7UA 1YITA 2RQRA 1WDYA 4J8FA 4M7CA 2XDDA 1SZ9A 2KXCA 1M90C 2HQEA 1HSQA 1YN8A 1ZHIA 2FYKA 3WVDB 2IIMA 4J9GA 3RKWA 5GAN3 2V8IA 1FT2A 2ETAA 2CDTA 2KBTA 5FLXE 5GANd 2QTVA 5CQYA 4PJOC 3F6QA 3MEAA 2XGOA 2YXYA 2PQWA 2RJEA 4FYXB 4L6V5 4HCCA 2OV8A 2KK4A 2JT4A 2HL3A 2E3HA 2UY1A 4XKCA 3F70A 2XEVA 3FTYA 1G8XA 2L2PA 1TNOA 2W10A 4ACLA 5T8IA 2BF0X 3KBGA 3TCJA 3UINC 2LMJA 4G11A 1WQ7A 1XJWB 1NG2A 3ML8A 2E4HA 5GANh 5AENA 3C94A 3CCLQ 3M5AA 1QVGP 5T3RA 1AHJB 3CCJA 1KQSS 4GTQA 3OW2P 4HRNA 1NA0A 1IREB 2MK5A 2P9UG 1TN6A 4BWRA 2AW6A 3INZA 2EYZA 1N95A 3U4TA 2JZ2A 5CKHA 2CP3A 2LVMA 5CBNA 4J6XA 4D6WA 2P84A 2LZ6B 2YUNA 4PJOD 3FB9A 1PRMC 3CVPA 2JEKA 3PZ3A 3EUVA 1ZUUA 3D9KA 3RAUA 3HYMB 3PRZA 3ZYLA 1GBQA 2D1XA 2L3PA 3CCRA 3GW4A 2M0OA 4E6RA 3MCAB 1Q81R 1PKSA 2QG9B 3D9NA 8ATCB 3CK7A 1YJWA 3C98A 4GMLA 2BKDN 1WIEA 2Y1LE 5A2QE 3HKSA 4RTXA 4FU3A 2BE7D 5GANj 3LWIA 1IYGA 2XZTG 3HRUA 4O1OA 3REBB 3RMSA 5E76A 2KRNA 3ASKA 3ME9A 1OWPA 1QLYA 1K73U 3DKMA 4ZTJA 5LJ3f 5FT9A 1M3BA 3AG4E 1VQPT 2XIDA 2YLCA 3QWXX 4EMKA 4N2SA 2X4YA 1K8KG 2AJAA 1BCOA 3MEWA 3LVQE 1LOJA 2FO1E 3EFOB 4J9EA 3U9WA 1TTHB 1WHLA 3HHMA 4GBQA 4C8QE 4DEXA 1RZ4A 5IH2A 2RQWA 4ANUA 4PJLA 1B34B 4AMCA 2QASA 1TJFA 3AAAC 1WLPB 1X69A 3LY9A 3CCVA 1W2BA 3M59A 3QO3A 3A1PA 2NUPB 4N5CA 3CLJA 1ARKA 3B7UX 2LDMA 2YHTA 4J7WA 5KYWB 2FZGB 1KQSA 3UX4A 3MKRA 4KUIA 1X6BA 3W9GA 4C8QA 3JB9D 4F6RD 1E90A 2G3RA 1SG5A 3MO8A 1NM7A 3CEYA 1Z9QA 4JS4A 2KNBB 3VRYA 2BZ8A 1ZUYA 1VQ6Q 1SHGA 2RQTA 4B6MA 5EYPF 2VV5A 1HF8A 1SQMA 4ANWA 2EIJE 4DOVA 2KROA 5BPPA 5LJ5f 4NIKA 3QDRB 2AXZA 4LD6A 2QFCA 2JTMA 2XHCA 2DIGA 4RTUA 4JEHA 2NUPA 4J6IA 2DVEA 3V2XA 4HB5A 3Q73A 3ZYQA 2DTOA 4EZJA 2GRNB 1ABOA 2AVPA 3PMIA 4OP0A 1IGUA 1U06A 5GAOn 4ATGA 1E6GA 4ESRA 3CVVA 1K9MR 2A37A 2D8HA 4UI9J 3CKBA 4FYYB 1W2BP 3LPZA 4NOYA 1VQLT 4GZ5A 5ENSD 1B07A 1I4K1 4GPMA 2E41A 2AWIA 4OMPA 4E47A 3LCAA 1BK2A 2OVFA 3PNLB 3CCMT 1NJIC 1Q7YU 3HDXA 5AJLA 5FQ4A 1YCYA 2QAZA 4BDYA 1V55E 2DXTA 1NE8A 2JTEA 5LL6S 2J49A 3ABLE 4RG9A 3SI5A 4DX7D 2K3YA 5I22A 4KULA 1OOTA 2DBAA 4PJJA 5BXUA 4TVRA 4UWFA 4JRQA 1VQMT 3LXUX 3HRTA 2E1HA 1AEYA 2O4XB 4K5BA 4CEMA 2VTBA 2L6BA 3ZFJA 3ZYKA 5KNHD 4XAXB 1WY6A 2VGXA 4R7LA 3Q47B 4HVBA 4OMQA 3MCXA 4APOA 2FF4A 3FC3A 2MIOA 4UC4A 2QGGA 1U1TA 1M1KR 2QZAA 4J5YA 5FWBA 2GRQB 3ASGA 2D0QB 2X9HA 1UJKA 3CVXA 2COWA 3VJPA 4QQ6A 3URGA 1E7VA 2EJFA 2WM9A 3S6WA 2GRPB 1NLOC 4DI3A 4C92C 1SPKA 3VLEA 3Q1JA 3HP9A 4B9WA 1OU8A 2MOXA 3I55A 3JCMh 3AS5A 1YJNQ 1QVFP 1BI1A 1M1KC 4M7AA 2J6KA 4OMNA 3FUFA 4ZNXA 4LD9K 3C3OA 2HR2A 4M75F 4GYWA 4UQZA 4M77F 4EECA 4Z68A 3SY2A 4A4HA 3UPVA 1PD1A 2E65A 2JM9A 3EGXA 3E32A 2CG3A 4WNFA 2DVJA 4ZGEB 2DBKA 3E19A 1RADB 1HFAA 2EQKA 4LDVA 1M3AA 3U3WA 5CCLA 3GZ2A 2PVGB 4OF1A 4HVUA 3SGHA 2H6HA 3OXGA 3GF5A 2A7YA 2ZPFB 3CC7A 2OVBA 4AFZC 3QKYA 4CC2A 3J5QB 5FZQA 1ELKA 3T9KA 1BI2A 1Q86C 4E7JA 4C5EA 3TG4A 4A55A 2XEEA 2LQNA 1FCHA 1ABQA 4F3VA 1SSFA 2RK2A 3RO3A 1PM3A 1N52A 2ILRA 2CHXA 3FHEA 5HCKA 2HNIA 1TNZA 1K9MC 2QA4A 3FUIA 4WWOA 2F5KA 5IAYA 2KYMA 2GBQA 2ZGDA 1QCNA 1N94A 4XTVA 3JQ0A 2CH4W 3ZEFA 3PNTB 5KCOA 5FU7B 3BG0B 2PNIA 2OOEA 3ZXSA 1K0SA 1KZOA 5IY5E 1RAIB 2EYXA 3X20B 3MKDA 4JA9A 3VUZA 3L42A 3CPWP 3ASOE 5IXBA 1VA7A 3CSTA 1TOVA 1OXJA 4F7UA 2JS2A 1RI0A 3JQ1A 3X24B 3TWVA 1KHCA 2WACA 2Y90A 1E96B 3OXFA 2XENA 1EF1C 4EMKC 3ZKJA 1G3NB 3AG1E 2VGXB 3LY8A 3TWSA 3CMEA 4M7DB 1X2QA 1NP7A 5D66A 2XCCA 2DJZA 1VUBA 4OVAA 2V4LA 1I5LA 3G6EA 4M7DF 3HIZA 2L3SA 1V1CA 2P9KG 2EIME 2C0MA 1M30A 4UQYA 3G6ET 2ZISA 1WHMA 3CBMA 4JZYA 4JLIA 4E2FB 1OX9A 4QFVA 3M56A 4BE0A 1EFNA 3OYNA 1V29B 2WXGA 3CD6Q 3M0SA 3M58A 4FP7A 2PUKB 5G04J 1AWJA 2EQUA 1I5OB 4GZCA 1VQKA 4LDUA 2YLBA 2EINE 2FZCB 4XU3A 2Y4TA 4M7DA 3PH0C 4N3CA 2QI2A 2ZPHB 4A1SA 2PQNA 3CCLT 5JJ6A 3VS7A 3EJNA 4OVUA 5DY9A 3A8HB 4AVXA 5CHEE 2EW3A 2P0KA 1CKBA 4YVOA 3OA6A 3CCLA 4KBMB 4HOQA 2KYBA 5GAN5 2VSOE 1WGSA 4IUQA 1D0XA 3OS2A 3SD4A 2QGFB 4MZMA 2UWJG 3I4GA 3EG9A 4OMOA 3ONLA 2HL5C 1NYGA 3MKQA 2MWPA 4HOSA 1VIFA 4OVVA 4Q96A 4DBQA 1UGVA 5FW9A 4CDNA 5KJLA 4BI8B 5LJ5d 1M4ZA 4ANXA 5KYNA 3FH8A 5FQ7A 2RJCA 2DEUA 1NA3A 1IZ6A 1NJIR 3LWHA 4BDZA 3V31A 3ZHEB 3VS2A 3ULEG 2WSFE 3J81E 2Y4XA 1H19A 1H8KA 1K8AR 3NBNB 2KBXA 2CHZA 1QVFA 3DSUA 3PEUB 1VQ7A 5KJKA 2AT1B 2QEXA 1H2VC 2F2XA 2P9PG 2KE9A 2P0QA 4XTUA 1EIFA 1I81A 4GCNA 2RD1A 5GMKj 3PIOA 4EBAA 3FFLA 1Z6TA 2MF2A 2RHUA 1KC8R 3OTNA 2FHDA 1PAQA 1N9SA 4KGZB 5CEAA 4OAVB 2DL4A 3G4ST 4DX2A 1TH7A 3VLDA 4M7DC 2XDPA 3OYFA 3GYZA 4C5IA 3A8MB 1VDYA 2QYUA 3APFA 4B9XA 4C5GA 2XPYA 1O1RA 3E37A 1TNYA 2IO2C 2X6JA 1HZ4A 3G2UA 3VTYA 4PJNA 1OCZE 1OUVA 1D8EA 1OCCE 3QOUA 3ZVVA 1M90R 1B89A 3L17A 5LOZA 2BIVA 5FU7C 5I2SA 1JBMA 1D1AA 2QDLA 1KD1U 2FEIA 4RTYA 1KC8U 4BTBA 1UTIA 4M7AC 2J8SD 5AQBA 4LDXA 4WNDA 3IV0A 1WA7A 3REAB 4HOTA 4FM4B 2CFUA 1YHQQ 2C0LA 1ZA1B 3KS2A 2ENMA 5FRMA 3EFSA 4EMKB 1FMVA 2WXQA 4ELZC 4E7LA 1RAFB 5D0QD 2CGHA 3ZW3A 2FO0A 4XX5A 4IUTA 4Z8AA 3VS6A 4C0DC 2XHEA 1M9SA 2AHJB 2E12A 2KGTA 3ULYA 1INZA 2ATCB 3IHVA 2J09A 2QDYB 1Q82R 2EQXA 2EQJA 4JEUA 5BUZA 1K9AA 1TN8A 1JCSA 3LYAA 3MP8A 2GRMA 1ZLMA 2ONDA 3FTZA 4O60A 2BTTA 5FTPA 2EYQA 5LJ5g 1QCOA 4AOFA 1I07A 5LCWC 1U1SA 2CT4A 1D1CA 5AT1B 2R58A 3G2WA 1XQHA 4JXTA 2P4RA 5GAOq 5AQAA 4J6YA 4OB3B 1JUQA 4OAUC 2ESWA 3JCMP 4D8KA 1E8YA 4FA6A 3EGDB 3U66A 1P92A 2JVVA 4XTWA 4AFQC 9ATCB 4KMOA 3JCMb 3SQVA 1NJIU 1X6GA 2PVDB 1Q7YC 5H7PA 2LX7A 1PSEA 1X75C 3VS3A 1YITQ 2D6FA 3HFNA 3L82A 5ECAA 4BI4A 1U5SA 1H6PA 3GZSA 1JU5C 1M1GA 1WZOA 4OMFB 2WQHA 5CCMA 2R02A 1V76A 4FJYA 4BETA 2PZ1A 3QK0A 1IXDA 3CBPA 2E5KA 1U3OA 2F2WA 3EGDA 4U0UA 5I2MA 2M0YA 4AP2A 4C92D 2LQKA 2DM1A 4PUCA 2K2VA 2V8SE 2WXRA 4FLHA 1OT8A 3CC4A 4OYSA 2RHYA 1XGWA 4II1A 2EQMA 3OYDA 5ENQD 1N9AA 5L23A 2MI6A 2D9TA 2DETA 3V8JA 3CC4T 3JCMW 2LAHA 4Q94A 1YHQT 2MYOA 4TUMA 1IXVA 1Q95G 2OEWA 2DD4A 2CG2A 2VQ2A 3OY9A 3E30A 3TXNA 3WXMB 4JHJA 4TXQA 4WCIA 3OB9A 2W0ZA 3QZ5B 3O5ZA 1JB0E 2CSQA 2HZYA 3N5BB 1QQEA 1FX7A 1M5Q1 4PL6A 1ZB1A 4TV3A 1BKBA 2DIWA 2M51A 3RMQA 2LT4A 4JHKA 4JPBW 4CDMA 4J8SA 3CCRT 1Q86U 2FRYA 1YWOA 5CEDB 2XEHA 3NGPA 3PNWC 3OW2A 2XGSA 2C0OA 4EDUA 3AJIA 1NI1A 2IONA 2KZTA 5HQ8A 4IUUA 5ANLA 3KD7A 1TYQG 1SA5A 1G3SA 3NPFA 2GROB 1MNDA 4UWGA 1HS6A 2A36A 2EJGA 1E7OA 3Q75A 2VC8A 3THKA 3CCMQ 1BD8A 1JXOA 4G8KA 5CMYA 4DLQA 1SW6A 3TXMA 2HQXA 3M0RA 4JUVA 3OYYA 4IIOA 1YNZA 2JXBA 2C2LA 3PGGA 1YIJA 2QQSA 2E6ZA 4EZLA 1JCRA 3SFXA 5KJNA 4LNPA 3RJVA 1O1SA 4DX5D 1UN8A 1QBQA 2KXPC 3FU3A 1K1ZA 1UGQB 5CMWA 2AKKA 2DTIA 3OYLA 2HAXA 2IQCA 3G6EQ 4C9BB 1Y8MA 2FRWA 4EZKA 2KQWA 1LTXA 2LSVA 3VTXA 1W6XA 2XS8A 3EGXB 3VUBA 2CT3A 2F69A 1A5EA 3OBYA 5AYFA 2VXEA 4EMGA 3CC2A 4WAFA 5GAN8 4CCAA 4QKUA 4C92B 4I1AA 3QC1A 2DEQA 3PT9A 3E9FA 4U7EB 3JSCA 2HSEB 1KD1R 3OYEA 4ZGDB 3NTIA 2VVKA 4LUEA 4L2LA 3CCJT 2VGYA 1OWLA 4AG1C 3W9FA 4H7YA 1AD5A 4JJCA 4M75D 4CRWA 4M77A 3HRSA 3BDUA 2KCVA 2C0IA 1KQ1A 3OAWA 1PG5B 1QVPA 4G26A 2IEJA 2P9IG 3ABME 4HI8A 5FIOA 4JJDA 4Y91A 3GOXA 3RRNB 5HRYA 1UW4B 4BX9A 3ONKA 2KCLA 3NQPA 1TNBA 3CCJQ 2KI7A 1BI3A 3DRAA 3I4RB 3CCSA 2LXLA 3TVTA 2HKQB 3SHWA 3QWVA 3L2UA 4KZCA 1H3ZA 2CKKA 3GIBA 3PE4A 1PD0A 3GNFB 4XI0A 3EHMA 3CSFA 2D0NA 2RI5A 2FEZA 3QBYA 5M72A 2FULA 3QJYA 4RG8A 4CC4B 1N4QA 2OX7A 4Z02A 4C8QF 4J0UA 3TAXA 4FC8A 4TRQA 2XICA 1VQLA 4A63B 2F37A 1WJSA 1BB9A 2Y69E 4OMMA 3RESA 2HYZA 3SFZA 3J80E 1OPKA 1SF9A 1WJRA 5CECB 1MZCA 3U23A 1N27A 4IYPA 2EAYA 1AP7A 2B6CA 4HLLA 2IJGX 5KWDA 1ZBJA 2R2LA 3D9HA 2YQ8A 2IPOB 4C8QC 1K76A 2I1JA 4RVBA 2M16A 3CC2T 3OSSC 3WXXA 3OS1A 4GZ3A 4X9DA 3H0HA 5IT9E 2LNIA 3B7BA 1N4SA 1W1FA 5M9OA 2CFZA 1GRIA 3S3MA 1KJWA 5GAN7 1FVHA 2AKLA 4RLYA 4BI3A 4C0EA 3I55T 1YJ9Q 3VS4A 2ZPBB 5HS0A 2DVWA 1Q81U 1ZSZA 2PZIA 1M8MA 3UDCA 2WMOA 2Y0BG 3CK9A 1WHHA 2BZXA 4PKCC 1MMNA 3CKCA 4HFGA 2DPPB 1BYMA 4G8LA 2RJFA 4RTVA 5EIBE 1B3QA 3BW1A 3E4BA 3X28B 3M0QA 1G5VA 1KC8C 4F1PA 4GA2A 4I9CA 3MHXA 4URKA 4D10C 4HRLA 3EIQC 3A8LB 5GMKh 5EC7A 1G3TA 3CC7T 2ROTA 2B86A 2HCKA 3PE3A 2XI9A 5IHNA 4A3TA 4RMOA 4J9IA 5GMKi 2DZOA 1S64A 4PDXA 3JUIA 5J08A 4K03A 1UDLA 2HBPA 4VUBA 1S63A 1JCQA 3ASHA 2HBWA 2DBMA 3PVQA 4M78A 1QVGA 3EG9B 2Y3AA 3LVRE 1Q7YR 3FTXA 4QVZA 3EGUA 5GAN6 3I56A 4BFRA 2X4JA 2X35A 4V3IA 5J26A 1X2KA 4GY5A 1YI2Q 2CP2A 4HCZA 5CRUA 1OULA 1BI7B 2ZPEB 3PDNA 2JMAA 3LW5E 2J9QA 4WUYA 2FL7A 4DA4A 2HSPA 2OI3A 1WNLA 4LNGA 1OYXA 2DA9A 3UTMA 3V7CA 3V8KA 2KR3A 1LNXA 4HVVA 3BE3A 1IQUA 1OWMA 3JCMd 4KBQA 2ZGGA 3AG3E 3CMEQ 2EQIA 2ETBA 3QB2A 5CKBA 2E70A 2RG8A 4BX8A 2RD0A 3JRZA 3WVEB 1QKXA 3D9IA 1NBEB 3RRMB 5EDSA 3M0TA 1VQOA 4CI0C 3RR6A 2QEXT 2QQBA 1T3LA 4WNGA 3R7QA 1R0BG 4G2VA 5EKQD 1VQPQ 3WG7E 1MX4A 4E7SA 3LEWA 4GAAA 4A1GA 4PJOF 3T8MA 4HVWA 3OYGA 2RJDA 2PU9B 1N0QA 3ABKE 3HPWA 6AT1B 3OYMA 1Z3XA 3I9QA 4ACKA 2O88A 1JJ2P 2V5FA 4GMRA 2NSZA 4RTTA 4N39A 1YJNT 2ZCFB 1WHKA 2J6FA 1QVFS 5CQXA 3DEOA 4O6JA 3CVLA 1AWXA 2EGEA 3S7FA 4I43A 3UT1A 1JXMA 4HS2A 1E8XA 3I3NA 2R03A 1YJNA 1FYNA 1WPYA 2KY9A 3PE0A 4OB0B 3V8LA 3EDTB 2NUTB 2DXBA 3JCMc 2LSUA 4WNEA 5KYXB 3FP3A 2XQ0A 1GFCA 4UI9K 1BIAA 3A98A 3I56T 4GZ6A 2QC9A 1UN9A 2DYSE 3C5RA 1PSFA 2YNQA 4U07A 4V2SA 5ENOD 1O9SA 3CVUA 1W70A 1NZNA 1QW1A 3EIJA 3JCMJ 3ASDA 3ZXPA 4GMJA 3DBSA 1TUCA 3KSQA 1WYXA 4OB2B 1N6AA 2VWFA 2ZGWA 1WHGA 3QXEB 2VSYA 2FPEA 4DI4A 3DXKG 3ZYMA 1G83A 3AG2E 5BNWA 1VQ7T 3KAEA 4XTXA 4FT4A 4F04B 1UJYA 4LDWA 1NFIE 1V54E 4E7IA 4AFSC 1PCXA 4B8CB 2JS0A 2K3XA 3FUJA 3C95A 1JQQA 1YA0A 4XEIG 2PUOB 3TEEA 2FZKB 3V7RA 4I6GA 1TWBA 2P2CP 4AEZC 1RAEB 2KRMA 2O9SA 2J4DA 4FLBA 5BW8C 3DB3A 3R6OA 4JRKA 5GMKl 3JCMX 1KD1C 3VS5A 2RB6A 1QMCA 4J9CA 4J9DA 3AS8A 1SRLA 4N0AC 4X1VA 3JB9G 4H7XA 2OAUA 2F0YA 2HM8A 2BKKB 4PH4B 2L3RA 4J83A 3L16A 5KCHA 3NAWA 1Y6IA 4FCYA 1DVPA 1MUZA 2OCCE 2QXFA 1PWTA 1B7TA 2WSCE 2JUFA 2PM6A 4PFPA 1M8VA 5AIJA 2ZXWE 3ESKA 3LS8A 2K79A 2YWWA 3HG0D 4C0FA 3CCQT 5G04C 2LUHA 2WXKA 3I5PA 5BV1A 1QCFA 4P5NA 3IHYA 3M9QA 2CP0A 3MV3B 2V1QA 1VQ6T 5FWQA 3FJPA 2DF6A 2ZU6B 3TWUA 3UI2A 3QZ9B 5LJ5e 1KG1A 2C06A 2LNHB 3T8KA 2DL8A 2EBPA 2P58C 4U04A 2DZCA 3L54A 4CGWA 3V2OA 1GW6A 4I1OB 2WQ7A 3FUHA 3OMCA 1YP5A 4LUNU 1AZGB 1D3BB 3LJ3A 2WXIA 2NWMA 3GP8A 4GYYA 1D0YA 3S2AA 5ARFA 1N4PA 2RA2A 4IN3B 4JZ3A 4MZTA 3MEKA 1Z3YA 3QSUA 3HXDA 4XZ4A 4N5QA 1O75A 5CERB 1KZPA 3LH0A 1VQ5A 3CPFA 3CCSQ 1TS9A 1WI7A 2V8KA 3FIFA 4L9PA 3FU6A 4AT1B 3PZ2A 4J8EA 5HKPA 2I6HA 4B0ZA 5C1DA 3LH5A 1N8RU 4DBHA 1MMGA 3PMTA 2GF7A 4AY6A 3BU8A 2DO3A 3E9GA 3FLGA 3ULRB 3IBEA 4DX1A 2CS7A 4GZDA 3VV0A 1WJQA 3ZN3A 2RNAA 2UY1B 1YCSB 5LJ3j 4JLGA 4J8DA 1PC0A 4NURA 2NXPA 3AS4A 2Z0WA 3SO8A 3CHQA 1D9SA 5ENPD 5CKEA 2CZ7B 4YDYA 1XNIA 1X43A 4PLLA 3DSWA 4ILGA 5G05C 2X6HA 1C0MA 2YRCA 3L2RA 3B7SA 2R59A 2VSXE 2DAQA 4QW2A 1GBRA 2PTKA 2E10A 3UA7A 2LTOA 1RL2A 2KCKA 3M53A 3A5ZB 4KGXB 4Z89A 4RTWA 4ZHBA 2X6KA 1BI8B 3ESLA 3LY7A 3HTRA 2DYIA 4IUVA 1KHIA 5LJ3e 1M1KU 2HD0A 4FW1A 4J8OA 4C92F 1YJ9A 3PFSA 2O2OA 1I1JA 2DILA 4L23A 4XU2A 4Z88A 3L2VA 4C92E 4MZPA 4K5CA 3T5XA 3BY7A 3SBSA 3QJ6A 2DZNA 2QYZA 1YMPA 5FWCA 4M7AF 1M3CA 1NYFA 4XI9A 1QWFA 1WXTA 4JRPA 2DXUA 3L2ZA 4YTLA 5CKDA 4BE1A 1K8AU 2F5TX 3CCUQ 1Y96A 3UT4A 2DXCA 5EIDA 5IHKA 1AWWA 2WMNA 3EG1A 3SFYA 4HLEA 3SWNA 1VQ5T 5CCAA 4BD3A 1YHQA 2KT8A 3NB2A 3V79K 2AZSA 2LCCA 2XS1A 2YUPA 3H8ZA 4HKEA 3KEAA 4ABNA 4KUDK 4GB9A 5KYYB 4MS6A 2K5IA 5FRNA 4U0SA 4GA0A 1ZU2A 2XD0A 4UUCA 3I56Q 3PZDA 3CXCA 2K57A 3UM1A 2IY0C 3FDHA 4ME7A 3JCMe 3OYJA 1UHCA 5LFAA 2NLUA 4RUGA 5GAMf 4PS7A 1U3CA 3CHMA 1QNFA 4MBGA 2IU1A 1H2TC 2DFUA 3ZFWA 2LCLA 4JW1A 2J05A 4DBFA 1S70B 1JRIA 3UT7A 1WFWA 3PZ1A 4QT7A 2MRIA 4ATZD 2WXPA 1IGQA 2HE0A 3ENEA 3PEVB 2V4HC 5CO7A 3FWVA 2NUTA 1EPUA 1SA4A 4NQ0A 2XGMA 4L59A 1OQKA 1TJCA 1OWOA 2F8XK 1Y0MA 2EILE 4J7IA 5LJ3d 1MGQA 2DERA 3E1SA 2H3EB 3CCEA 4N0AA 1N0RA 3C72A 1O1TA 3FULA 4KYOB 1YWPA 2E64A 4FIBA 3JCMg 3G71Q 4B94A 1TU0B 3CXCP 1VQPA 3CHOA 1YIJT 1MMDA 3CPWA 2EKOA 4J8YA 5G55A 3T5VA 2RMOA 4Y92A 5C6SA 2OTLQ 5J3BA 3FTVA 1TEZA 2FVUA 3DPDA 3RBBB 3VS0A 2OAWA 4M78F 3CGHA 4XTYA 3JCKC 4OGEA 1EYHA 1OCRE 3QDFA 2J07A 1SSHA 5D6YA 1HO8A 3MJXA 2DYBA 3ZBDA 4KVOA 2GGRA 4F7UG 2OTJA 1GFDA 1VOMA 1X01A 3MP6A 2HQHA 3TWQA 1OV3A 2ROLA 4JDSA 3P1UA 2OTJT 3J7AF 1AZEA 4KT6B 2VGNA 4JJBA 3FUKA 2HEQA 2P9NG 1QWEA 4ILHB 2JN0A 1WG0A 4RSYA 1LCKA 3ZNGA 4GCOA 5EX0A 3ML9A 4GTSA 3SFMA 5KJMA 2AIRB 5BT1A 2EVRA 4N3AA 2KSSA 5CVIA 3KFVA 1UEBA 2ZAEA 2FPFA 2F8YA 3TWTA 1OX8A 2LJ1A 2JABA 2KMTA 3H0FA 5GAN4 3AT1B 2B0OE 3HXBA 1D0ZA 1HH8A 3O8VA 5KE2A 2YRVA 1UFFA 5GMKm 3IEGA 1VQNA 2MYSA 2L9BA 4JRIA 1Z9ZA 2GFAA 5KH6A 3FUEA 3RERA 4P29A 3Q78A 3OS5A 2I2OA 3R6NA 4O6FA 4M75A 2QA4T 3NOGD 1MJ0A 5KYYA 2M02A 4AG2C 3EG2A 3CCET 4U95D 3CQCB 3H0IA 1H6OA 4I2ZA 3CCMA 4O5VA 1WQWA 2HDAA 4KH1B 3PVLA 1JWFA 3CPWS 4CYMD 1WXBA 1WHJA 2O31A 4JC8A 4BUGA 5G2NA 4U63A 3UKRG 4FSSA 1DJ7B 2R5MA 3NF1A 4AXHA 1YIJQ 5FQ8A 2RH2A 1QVGS 3FUMA 5GAMh 1KQSP 1XTDA 5LJ5j 1FWZA 3P8HA 5KBAA 2ECZA 3NHNA 1SKUB 3HVEB 2LAIA 1LJOA 1MHNA 1M27C 1LD7A 5KCMA 4M77C 4GA1A 3FH7A 4YDWA 2EGAA 1DNPA 5GAMd 3B7TA 2WPVA 1TG0A 5EN5D 2ED1A 4GPKA 2IOSA 3BFMA 3VYHB 4E7KA 3CC2Q 2HKNA 1M90U 2E6NA 4PJOE 4EHMA 2DL3A 2WXMA 1ZBXA 3J5PA 4JA7A 1IKND 3AU5A 3DWLG 3ZGQA 3FU5A 3MKQB 1SRMA 2WXOA 2DYRE 1HD3A 4GTRA 3EH2A 4CGVA 3FRNA 2L6JA 2PM7A 2AK5A 2BKGA 4C8QD 3SWNC 3C3RA 3EU9A 4R0KA 4JS5A 2CREA 4DJAA 2FB7A 5D6XA 1L5JA 5EG2A 2LQWA 2O4XA 1S72Q 1Q82U 2P9SG 2FG0A 3AU4A 5I21A 2J08A 3MP1A 1VIEA 1H3HA 1VQNT 1MX2A 2GCXA 2L0TB 2I0NA 2M63A 3N71A 3EAEA 4A53A 4ZTFA 1Y07A 1HXIA 3QYHB 4DK5A 1X81A 3FH5A 2E3IA 3DSSA 3SBTB 4E6HA 5IXFA 3OMGA 4A4KA 5LJ5h 3DLLA 3JB9I 4GU5A 3NOCD 3JCMV 3QKJA 2X51A 1IRXA 2RHXA 2A5EA 2J7IA 2J4BA 2XPZA 5DIZA 3FY4A 2RK1A 3G7ZA 4PS3A 5AYWD 2MOWA 1YFNA 3OSVA 4C0GA 3ZHEA 3MZLB 3UIPC 1NLPC 3MPUB 1WDXA 3P2BA 1RLPC 1GCQC 3QUIA 4XIFA 4QVDA 5CBOA 4PFZA 4GTMA 1G2BA 1N54A 1D1BA 2XMFA 1ZSZC 4CZ2D 4W9RA 4FADA 2COZA 2KEAA 3BDLA 3OYCA 3VKIA 2RFMA 4O1PA 5HK0A 3L22A 1U2VG 4ZFHA 4FYWB 2JNGA 3G2VA 2EFIA 1K73C 3FTUA 4J9BA 4I6JA 2FBNA 4IULA 1SVXA 3CR3A 2JJ9A 3HFOA 2O01E 1GL5A 3L6AA 3LLRA 2F1LA 3JB9J 4A4FA 3CC4Q 1ACMB 4F1SA 1R77A 3D9OA 1N5ZA 3QIIA 3APCA 2LC4A 3QYGB 4K0RA 2LCSA 3L9TA 4XK8E 4E7HA 3TSZA 3Q7AA 3CCUT 4X34A 3CMAQ 4M78C 3KUFA 2ABLA 3CVWA 2LX9A 3OQ5A 3CCUA 1S1NA 2X3XD 3EH1A 4GLKA 3LKUA 2GRLA 2K2MA 5CRVA 1VQ6A 1Y96B 4MDWA 1BI0A 3APDA 3JV3A 4C8QB 1JJ2A 2IG0A 3PS6A 2GQVA 2DL5A 4EMHA 5I11A 1MX6A 1S72T 3FEXA 1NZ9A 2CH4A 2RN8A 1VQ9A 4AFUC 3MEVA 2QQRA 2GTOA 1D8DA 3EG3A 4A4EA 1IQRA 1E8ZA 3QNKA 3VLFA 2JW4A 5JA4D 2C0TA 2FPDA 2YT6A 4HXJA 3C3QA 4IUPA 4RCCA 3UPUA 4M7DE 5ANRA 1ZUKA 2DRKA 2A28A 2A4ZA 1YI2T 3MYVA 4N3BA 1AWCB 2GNCA 4KT0E 4TXRA 2WB2A 3RK6A 3Q5MA 4XE0A 4M78D 1YI2A 3ZU7B 3QARA 3M57A 2E0IA 2KAFA 2H6IA 2H3JA 3L13A 3CHPA 3D3MA 1J3TA 2XRYA 1VQOT 4PJOB 4CT4A 4RKUE 2LRQA 2NUZA 4QQIA 4J9FA 4ORZA 5CK9A 3CMET 4EBAG 3JCMf 1BU9A 1PNJA 4M7AE 1DC2A 2K9GA 3NTHA 3G4SA 3MJWA 3LX7A 1PC2A 2YRDA 4EPZA 4IIMA 2D8JA 2KM4A 2GGFA 4L7TA 1ZX6A 4C92G 4DUIA 1VQ4T 1JWGA 1VQMQ 1KK7A 2ZPGB 2VJ8A 5BV0A 2WQ6A 3OW2S 5GANg 1VQOQ 3GZ1A 2ZIRA 3S3NA 3G71A 1K0XA 3MEUA 4L5GA 4BY6C 1KSWA 2QQAA 2LXMA 4G24A 4RG6A 1OPLA 5HY6A 1RACB 5JHBA 1H2UA 3C4SA 5ENNA 3CCQA 1IHWA 4TXPA 4HCKA 1C6VX 2L5QA 3M4GA 1Y71A 2KVQG 1VQ4Q 5HKCA 1JJ2S 1R0CB 2L0IA 3TWRA 2BTDA 1UG1A 3OS0A 3QWWA 4M4ZA 1OCOE 4G23A 2YUOA 5FU6B 3KXTA 1KFZA 2HO1A 2QYJA 4RQIA 1QKWA 1FVFA 3CMAT 4FULA 2RI2A 4KVMA 1ZA2B 5FINA 4FT2A 1DCEA 1FT1A 3I55Q 1YJ9T 3S3OA 1N8RC 2K4YA 1MV0B 3Q7FA 3UUXA 2RI3A 2IF4A 3UXGA 1YBYA 3C0CA 4G25A 3FEOA 2L3QA 3HHTB 4LERA 3RNJA 4AIFA 3NMZC 2M1HA 4PJOA 2LP5A 4HXIA 3S7BA 1UJ0A 4N4IA 5DLQE 1U8RA 3OBWA 1VQ8A 2XG8D 1QYMA 3P8DA 3D9LA 3C12A 1BU1A 3EHNA 4BTAA 3IKOB 4BSXA 3EHRA 1TUDA 4LUDA 3RIRA 4UWLA 4M7AD 1RABB 3OYAA 5KYWA 5GANf 2DCPA 4LRZA 3RKXA 4WTOB 5CAIA 4DOWA 1UGRB 3OYHA 1K8AC 2LJ3A 2LT1A 4N2QA 5A6CA 3QAQA 3CK8A 3META 4R55A 4LSZE 5D0OD 4AV7A 3JUEA 3CHRA 2GRRB 2EGCA 3L08A 2RHZA 2YUQA 3RDVA 2ZZDA 4HA8A 4BE2A 1ELRA 3M4YA 3RO2A 4XU1A 4ATOA 1OEBA 3MV2B 2K6DA 3DSTA 5JJTA 3R9MA 1T0HA 2A08A 2RHIA 2E5QA 3NZSA 4D8DA 3M0PA 5GAMj 4QQDA 2FI7A 3ZUVB 2J06A 4CDRA 3TGOA 3H9NA 1FXXA 5FZSA 3CXCS 4MKTA 4NACA 4BY6B 1IHGA 5ENRD 2OTLT 3FEYA 3CV0A 3L1AA 3CQGB 3CVYA 4OGCA 3HVEA 2H6FA 2EIFA 5J90A 4I2WA 5JJ7A 1EDUA 3LJNA 4JPSA 3QJZA 4JD2G 2F2VA 4RCBA 1MYOA 4LEUA 2CHWA 5FU6C 2COYA 2MCNA 1N11A 3OYBA 1UGSB 3OYIA 2IO3C 3CCVT 5DLOA 1VQKQ 1VYVA 1EX4A 2G6FX 3BG1B 1UUEA 2CUDA 4NS5A 3SDZA 4M75G 3JXIA 1RW2A 1MMAA 3A8GB 4HCBA 1VQ8T 4BERA 4CT0A 1KIKA 2NC9A 2BZYA 1C1AA 2R05A 4LE9A 3B95A 4X8QA 2LJ0A 1KQ2A 3G2SA 2QQ9A 2AZVA 4GLMA 1HJDA 1LF8A 1O5MA 3LDZA 1BPOA 2XK0A 4U96D 5LJ3g 2RQUA 3RKYA 1Q82C 3UATA 3G1JA 2OJ2A 1VQ5Q 4K5AB 3HSBA 2RFAA 1OWNA 2V0PA 4IRUA 1A0NB 5GJWB 3BEEA 3UQ3A 5B3SE 2VXFA 4M77B 4R56A 4Y28E 4YVQC 3BQOA 5FJYA 1MV3A 5D2MC 2DKGA 3QWPA 2GFUA 1TSFA 1HX8A 4HI9A 5GAOl 2AXUA 1YYHA 2I9CA 2VUBA 3VU3C 4JVSA 1TNUA 3JB9H 4HORA 3CCRQ 2LO6A 3HL8A 1VQ7Q 4G1TA 3UWNA 4KH0B 2QEXQ 4M3OA 4BT8A 2L89A 1YITT 4OMLA 1UB4A 2OTLA 4C0MA 4YNDA 1AVZC 2DIQA 1Q86R 4ILIA 2K5LA 4Y6WA 3M0UA 2K3BA 4BY6A 4GTPA 2RQVA 2MHKA 4FHJA 4XKBA 3TL5A 2R5AA 3RU0A 1PHTA 3FDRA 1OZ3A 4Y6CA 2QTXA 3EFRA 4BB7A 4E7ZA 5AJDA 3RKVA 3JXJA 1KT0A 3PTAA 1H0AA 5IN1A 4M7DD 4AJWA 7AT1B 3PREA 4YDOA 1I0CA 2KXDA 2VYTA 3GBQA 3TWWA 3H41A 4MMLA 1WX6A 2EWNA 4C5HA 2V5QC 4U8YD 1T3SA 2X6IA 4DBRA 3CCVQ 3B13A 2XPIA 2VKNA 4PNOA 4J9HA 1PRLC 5GANe 5DM7R 3ZIMA 5FQ6A 1R8OB 2PL2A 3FUDA 2DL7A 2QK0A 1M2VA 3DB4A 4OB1B 2KZTB 1LVKA 4LXCA 3DSVA 2WVIA 3JCMQ 2VB6A 5KE3A 4GTOA 3KEZA 5CKFA 4MLPA 3QDNA 1XNFA 2IFUA 3MX3A 1X6OA 1HG5A 4RTZA 2P9LG 2JTFA 2CZ1B 3UA6A 1H641 2YHCA 1K4US 1XOVA 2WXHA 3SZ7A 4M75B 4PK4A 3VRZA 4C92A 3CHSA 4ZN3A 1KT1A 2EKHA 1RAHB 3TSWA 5JHAA 1LPLA 2QA4Q 1HXDA 4MRUA 2R57A 3T9NA 4UWKA 3SEMA 1G3WA 1M2VB 3PIPA 3UKUG 2KC7A 3Q15A 1RI9A 5C2YA 2AXVA 1VYTA 5GAMe 1JO8A 2M9UA 2WXNA 1QQJA 2K7AA 1W2BS 4J7FA 4K11A 4M78E 2LQ8A 2RM4A 4M77D 5HI7A 4IKFA 3RUXA 2RF0A 2PVOB 1TN7A 1SHFA 2BUGA 4DPRA 2DK3A 4JHRA 4ME2A 5L8RE 4IURA 4LNUD 1E8WA 3G4SQ 5C0MA 1K1AA 4BSZB 1X5BA 2A5UA 2X3MA 1E7UA 2GTJA 1UJJA 4DEYA 2I1KA 1VQMA 1S0PA 5ENTD 2EIKE 2R5SA 2XU8A 2YDLA 3NZUA 1HE8A 2KATA 1SZAA 4UQXA 2L8DA 5LX8A 4APFA 2E2EA 1FPPA 2CYZB 4FSXA 1GXIE 2X3WD 3ZL7C 2O9VA 2X4XA 1K1BA 3CCQQ 4FU6A 4HQDA 2P4TA 5EYLA 1N9RA 3D9JA 1IB8A 4L2YA 4HBDA 3EHQA 1IHBA 1Y7XA 2DMOA 1M1FA 5KYUB 3TG5A 1ZSGA 4ANJA 4LG6A 4GTTA 2OEVA 3I35A 4Q5WA 5LJ3h 3JYSA 1UE9A 4N4HA 5GAN2 4U0ZA 4LN2A 1BCMA 1NPPA 3ASFA 4FL6A 3FJ5A 3QPHA 5AQ7A 2V1RA 4C8QG 2OTJQ 3X2QE 2XCBA 2RKKA 2DZ9A 2JOYA 2BUDA 4I1MA 5CIUA 1VYUA 3M55A 3UF4A 3S7JA 1GCPA 3V7SA 2DRMA 4JL0A 3I5RA 1AT1B 3HRAA 1K3ZD 1NPRA 4C0ZA 3CCST 1PY1A 3UM0A 3LGFA 2A3LA 1CSKA 4M78G 5G05J 2VGEA 4UWHA 1DCQA 2EYWA 3TREA 1LD8A 2J6OA 4E85A
chains in the Genus database with same CATH topology
3T9KA 1H3HA 3VS1A 1MX2A 2HBWA 3PVQA 2DBMA 2XZDG 2I0NA 2XEEA 2LQNA 1ABQA 3EGUA 3Q9UC 2RPNA 5IXFA 1X2KA 2DWZA 1X27A 5HCKA 3NOCD 1BI7B 4U8VD 2JMAA 2HSPA 2GBQA 2KYMA 2OI3A 2A5EA 2ZGDA 2J7IA 4C48B 2DA9A 3UTMA 2CH4W 2KR3A 4HVVA 3V30A 2PNIA 1K0SA 2ZGGA 2EYXA 4EIKA 1NLPC 1WDXA 2EQIA 2ETBA 5IXBA 1VA7A 1RLPC 1GCQC 1QKXA 5CBOA 1G2BA 3Q9NC 2JS2A 3DEPA 2XMFA 3TWVA 3M0TA 2XENA 4BEPA 4CZ2D 3ZKJA 1G3NB 3I5SA 2KEAA 3TWSA 1T3LA 1X2QA 2RFMA 4O1PA 5D66A 1IO6A 2SEMA 4ZFHA 1UECA 1NEGA 1MX4A 5IHIA 2L3SA 4J9BA 1V1CA 1SVXA 4CC3A 2NYJA 4HVWA 1M30A 1N0QA 1GL5A 2DLPA 4QFVA 1EFNA 3I9QA 2O88A 4GMRA 1N5ZA 2GQIA 3M0SA 4RTTA 2LCSA 1AWJA 2J6FA 3TSZA 3DEOA 1AWXA 2EGEA 1JXMA 1SEMA 2ABLA 1FYNA 2L0AA 3PE0A 1S1NA 2X3XD 1T0JA 2K2MA 3VS7A 1GFCA 2EW3A 2H8HA 3A98A 3JV3A 5BXOA 1CKBA 2DE0X 2QC9A 1AOJA 3C5RA 5I11A 2DL5A 1MX6A 5ENOD 2CH4A 4BESA 2RN8A 4AFUC 1W70A 2CUBA 2KYBA 2GTOA 3EG3A 2DJQA 1FMKA 2KT1A 5GJVB 2JW4A 4HXJA 2YT6A 1TUCA 5JA4D 2C0TA 2FPDA 1WYXA 4OMOA 1NYGA 2VWFA 1ZUKA 2DRKA 2A28A 2JM8A 2FPEA 1AWCB 1GCQA 2GNCA 1UGVA 5KNGA 5FW9A 1G83A 4JZ4A 3ZU7B 1Y57A 3V31A 1UJYA 3VS2A 1NFIE 5AQ9A 1H8KA 1J3TA 4AFSC 3NBNB 2KBXA 5JMND 2NUZA 4QQIA 2JS0A 4J9FA 4ORZA 5EILA 2F2XA 1BU9A 1JQQA 2KE9A 1PNJA 1DC2A 2K9GA 2P2CP 2KRMA 2O9SA 4CC7A 4DRXE 4IIMA 1RUWA 3VS5A 2D8JA 4J9CA 4J9DA 1ZX6A 2ETCA 4DUIA 5CEAA 4OAVB 2DL4A 4DX2A 1SRLA 4X1VA 1NEBA 1K0XA 2BKKB 2KRSA 3CQTA 1KSWA 3EG0A 1MUZA 1OPLA 1PWTA 1BLXB 2CSIA 4HCKA 2YSQA 2K79A 3HG0D 3TWRA 1UG1A 4M4ZA 1QCFA 2YUOA 1OY3D 5AN8A 1KFZA 2QDLA 2V1QA 2QYJA 5ITZF 1QKWA 2FEIA 4RTYA 2SRCA 2DF6A 3TWUA 1UTIA 3UI2A 2J8SD 5AQBA 1TR4A 5FINA 4HNAD 3T8KA 3IXEA 4JB8P 2DL8A 2EBPA 2LNHB 1WA7A 2EYYA 3REAB 3V2OA 1MV0B 2ENMA 1YP5A 1AZGB 2NWMA 1UOHA 2EPDA 4HRMB 3C0CA 3UXGA 2FO0A 4Z8AA 3VS6A 2PNNA 2L3QA 5AARA 3RNJA 4JZ3A 2KGTA 3NMZC 1RLQC 2LP5A 4N5QA 1UJ0A 4F16A 1H92A 1BBZA 4B93B 5CERB 1K9AA 4DX6D 1QYMA 4KRTA 2DNUA 1WXUA 1BU1A 1ZLMA 1E6HA 4O60A 1WI7A 2BTTA 3EHRA 1TUDA 3IQLA 4LUDA 5HKPA 3LH5A 1I07A 2CT4A 4F14A 5AAOA 2P4RA 3ULRB 5AQAA 4DX1A 2LJ3A 4LSZE 4OAUC 2ESWA 4D8KA 2RNAA 3JUEA 1YCSB 2EGCA 4AFQC 3QWYA 3TWXA 2YUQA 1UHFA 3SO8A 1JEGA 1X6GA 1D9SA 5ENPD 2LX7A 4F17A 4YDYA 2ED0A 1X43A 3VS3A 1OEBA 1CKAA 2DX1A 2K6DA 1PKTA 1T0HA 2A08A 5ECAA 1U5SA 1JU5C 1GBRA 4D8DA 2PTKA 3M0PA 3UA7A 2JMCA 1AWOA 3ZUVB 2J06A 4BETA 2PZ1A 4Z89A 4RTWA 4ZHBA 2E5KA 1U3OA 1BI8B 2F2WA 2RQRA 5ENRD 1WDYA 2KXCA 2M0YA 1HSQA 1YN8A 2IIMA 4J9GA 2O2OA 1I1JA 2DM1A 2DILA 2ETAA 4Z88A 2CDTA 3LJNA 2F2VA 2KBTA 1OT8A 4K5CA 2DZNA 3F6QA 1YMPA 1MYOA 5FWCA 5ENQD 1N11A 2MCNA 1M3CA 5L23A 1NYFA 1WXTA 1QWFA 1VYVA 2JT4A 2G6FX 1UUEA 2CUDA 2MYOA 4TUMA 1IXVA 5IHKA 1AWWA 5EIDA 3JXIA 2L2PA 2W10A 4BERA 3EG1A 1KIKA 2LMJA 2BZYA 2KT8A 3V79K 4LE9A 3B95A 1NG2A 2AZSA 2LJ0A 2YUPA 3KEAA 4WCIA 2AZVA 4GLMA 1HJDA 2W0ZA 4HRNA 3O5ZA 2CSQA 4U96D 2EYZA 2RQUA 4UUCA 5CBNA 2M51A 3UATA 4JPBW 2LZ6B 2YUNA 2OJ2A 1PRMC 4K5AB 2FRYA 2RFAA 5CEDB 2XEHA 1UHCA 1YWOA 3NGPA 4RUGA 1ZUUA 2C0OA 1A0NB 3AJIA 5GJWB 1GBQA 2D1XA 2L3PA 1MV3A 4E6RA 3NPFA 4HI9A 1PKSA 2A36A 1E7OA 2J05A 1YYHA 3THKA 1S70B 1WFWA 1WIEA 2Y1LE 4QT7A 4RTXA 4ATZD 1BD8A 2HE0A 2XZTG 2V4HC 4O1OA 4G8KA 1JXOA 3REBB 1SW6A 2KRNA 3M0RA 1QLYA 4IIOA 1YNZA 2F8XK 2JXBA 1Y0MA 1M3BA 4OMLA 4LNPA 3QWXX 4DX5D 1AVZC 1K1ZA 2KXPC 1N0RA 2AJAA 2AKKA 1YWPA 3M0UA 2K3BA 2FO1E 2RQVA 4J9EA 4J8YA 1PHTA 2FRWA 2RMOA 4Y92A 4GBQA 1W6XA 4DEXA 2CT3A 5IH2A 2RQWA 3JXJA 1A5EA 3RBBB 3VS0A 2OAWA 1X69A 3AAAC 1WLPB 1I0CA 2KXDA 1ARKA 1SSHA 3GBQA 2J6OA 4J7WA 3TWWA 3H41A 2DYBA 1WX6A 2GGRA 1X6BA 3W9GA 1T3SA 2V5QC 4U8YD 1GFDA 4F6RD 2VVKA 1NM7A 3TWQA 1OV3A 2ROLA 1Z9QA 2VKNA 2KNBB 3VRYA 2BZ8A 1PRLC 1ZUYA 4J9HA 1SHGA 2RQTA 4LUEA 4CC2A 5EYPF 1AZEA 4AG1C 2DL7A 3W9FA 1AD5A 4JJCA 4JJBA 2HEQA 1QWEA 2C0IA 2KROA 1WG0A 4NIKA 5FIOA 4HI8A 1LCKA 3ZNGA 4JJDA 4RTZA 3UA6A 1K4US 1XOVA 4RTUA 3VRZA 5HRYA 3V2XA 2EKHA 4HB5A 3TSWA 2EVRA 3KFVA 1ABOA 2FPFA 3TVTA 2F8YA 3TWTA 3SEMA 2LJ1A 1U06A 3SHWA 2JABA 1E6GA 1RI9A 1VYTA 3H0FA 1JO8A 4ESRA 2B0OE 2A37A 2D8HA 1UFFA 2K7AA 2D0NA 4K11A 5ENSD 1B07A 4GPMA 4OMPA 4CC4B 1Z9ZA 1BK2A 2RF0A 3R6NA 1SHFA 3NOGD 1MJ0A 4A63B 4AG2C 2JTEA 2F37A 3EG2A 1BB9A 4U95D 4OMMA 4LNUD 4DX7D 3H0IA 5I22A 1OOTA 5BXUA 1OPKA 1K1AA 4BSZB 2HDAA 5CECB 3PVLA 3U23A 4DEYA 2GTJA 1AEYA 4K5BA 4CYMD 1AP7A 1WXBA 2O31A 4HLLA 5ENTD 5KWDA 1ZBJA 2L6BA 3D9HA 4FSSA 2YDLA 1K76A 5KNHD 4OMQA 2MIOA 5KBAA 2ECZA 3H0HA 3B7BA 2X3WD 3NHNA 1W1FA 2O9VA 1K1BA 1GRIA 3ZL7C 4HQDA 1M27C 5FWBA 1KJWA 5EYLA 2AKLA 4YDWA 4HBDA 4RLYA 2EGAA 3EHQA 3VS4A 1IHBA 5HS0A 2DMOA 2DVWA 1TG0A 5EN5D 1ZSGA 1M8MA 1NLOC 2ED1A 4LG6A 3I35A 2BZXA 2Y0BG 1SPKA 1UE9A 2MOXA 4LN2A 2DL3A 4G8LA 4RTVA 2J6KA 4OMNA 3FJ5A 4ZNXA 5AQ7A 2V1RA 5EIBE 1B3QA 3J5PA 1IKND 1SRMA 3M0QA 4Z68A 4F1PA 1HD3A 1VYUA 2JM9A 3UF4A 4HRLA 2BKGA 1GCPA 2AK5A 2DVJA 2DRMA 2DBKA 3EU9A 3I5RA 5EC7A 3HRAA 4R0KA 1K3ZD 1M3AA 2CREA 2ROTA 2B86A 2HCKA 5IHNA 4HVUA 4J9IA 2LQWA 2DZOA 1CSKA 2VGEA 4AFZC 1DCQA 2EYWA 2FG0A 3J5QB 1UDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T9K A;  1H3H A;  3VS1 A;  1MX2 A;  2HBW A;  3PVQ A;  2DBM A;  2XZD G;  2I0N A;  2XEE A;  2LQN A;  1ABQ A;  3EGU A;  3Q9U C;  2RPN A;  5IXF A;  1X2K A;  2DWZ A;  1X27 A;  5HCK A;  3NOC D;  1BI7 B;  4U8V D;  2JMA A;  2HSP A;  2GBQ A;  2KYM A;  2OI3 A;  2A5E A;  2ZGD A;  2J7I A;  4C48 B;  2DA9 A;  3UTM A;  2CH4 W;  2KR3 A;  4HVV A;  3V30 A;  2PNI A;  1K0S A;  2ZGG A;  2EYX A;  4EIK A;  1NLP C;  1WDX A;  2EQI A;  2ETB A;  5IXB A;  1VA7 A;  1RLP C;  1GCQ C;  1QKX A;  5CBO A;  1G2B A;  3Q9N C;  2JS2 A;  3DEP A;  2XMF A;  3TWV A;  3M0T A;  2XEN A;  4BEP A;  4CZ2 D;  3ZKJ A;  1G3N B;  3I5S A;  2KEA A;  3TWS A;  1T3L A;  1X2Q A;  2RFM A;  4O1P A;  5D66 A;  1IO6 A;  2SEM A;  4ZFH A;  1UEC A;  1NEG A;  1MX4 A;  5IHI A;  2L3S A;  4J9B A;  1V1C A;  1SVX A;  4CC3 A;  2NYJ A;  4HVW A;  1M30 A;  1N0Q A;  1GL5 A;  2DLP A;  4QFV A;  1EFN A;  3I9Q A;  2O88 A;  4GMR A;  1N5Z A;  2GQI A;  3M0S A;  4RTT A;  2LCS A;  1AWJ A;  2J6F A;  3TSZ A;  3DEO A;  1AWX A;  2EGE A;  1JXM A;  1SEM A;  2ABL A;  1FYN A;  2L0A A;  3PE0 A;  1S1N A;  2X3X D;  1T0J A;  2K2M A;  3VS7 A;  1GFC A;  2EW3 A;  2H8H A;  3A98 A;  3JV3 A;  5BXO A;  1CKB A;  2DE0 X;  2QC9 A;  1AOJ A;  3C5R A;  5I11 A;  2DL5 A;  1MX6 A;  5ENO D;  2CH4 A;  4BES A;  2RN8 A;  4AFU C;  1W70 A;  2CUB A;  2KYB A;  2GTO A;  3EG3 A;  2DJQ A;  1FMK A;  2KT1 A;  5GJV B;  2JW4 A;  4HXJ A;  2YT6 A;  1TUC A;  5JA4 D;  2C0T A;  2FPD A;  1WYX A;  4OMO A;  1NYG A;  2VWF A;  1ZUK A;  2DRK A;  2A28 A;  2JM8 A;  2FPE A;  1AWC B;  1GCQ A;  2GNC A;  1UGV A;  5KNG A;  5FW9 A;  1G83 A;  4JZ4 A;  3ZU7 B;  1Y57 A;  3V31 A;  1UJY A;  3VS2 A;  1NFI E;  5AQ9 A;  1H8K A;  1J3T A;  4AFS C;  3NBN B;  2KBX A;  5JMN D;  2NUZ A;  4QQI A;  2JS0 A;  4J9F A;  4ORZ A;  5EIL A;  2F2X A;  1BU9 A;  1JQQ A;  2KE9 A;  1PNJ A;  1DC2 A;  2K9G A;  2P2C P;  2KRM A;  2O9S A;  4CC7 A;  4DRX E;  4IIM A;  1RUW A;  3VS5 A;  2D8J A;  4J9C A;  4J9D A;  1ZX6 A;  2ETC A;  4DUI A;  5CEA A;  4OAV B;  2DL4 A;  4DX2 A;  1SRL A;  4X1V A;  1NEB A;  1K0X A;  2BKK B;  2KRS A;  3CQT A;  1KSW A;  3EG0 A;  1MUZ A;  1OPL A;  1PWT A;  1BLX B;  2CSI A;  4HCK A;  2YSQ A;  2K79 A;  3HG0 D;  3TWR A;  1UG1 A;  4M4Z A;  1QCF A;  2YUO A;  1OY3 D;  5AN8 A;  1KFZ A;  2QDL A;  2V1Q A;  2QYJ A;  5ITZ F;  1QKW A;  2FEI A;  4RTY A;  2SRC A;  2DF6 A;  3TWU A;  1UTI A;  3UI2 A;  2J8S D;  5AQB A;  1TR4 A;  5FIN A;  4HNA D;  3T8K A;  3IXE A;  4JB8 P;  2DL8 A;  2EBP A;  2LNH B;  1WA7 A;  2EYY A;  3REA B;  3V2O A;  1MV0 B;  2ENM A;  1YP5 A;  1AZG B;  2NWM A;  1UOH A;  2EPD A;  4HRM B;  3C0C A;  3UXG A;  2FO0 A;  4Z8A A;  3VS6 A;  2PNN A;  2L3Q A;  5AAR A;  3RNJ A;  4JZ3 A;  2KGT A;  3NMZ C;  1RLQ C;  2LP5 A;  4N5Q A;  1UJ0 A;  4F16 A;  1H92 A;  1BBZ A;  4B93 B;  5CER B;  1K9A A;  4DX6 D;  1QYM A;  4KRT A;  2DNU A;  1WXU A;  1BU1 A;  1ZLM A;  1E6H A;  4O60 A;  1WI7 A;  2BTT A;  3EHR A;  1TUD A;  3IQL A;  4LUD A;  5HKP A;  3LH5 A;  1I07 A;  2CT4 A;  4F14 A;  5AAO A;  2P4R A;  3ULR B;  5AQA A;  4DX1 A;  2LJ3 A;  4LSZ E;  4OAU C;  2ESW A;  4D8K A;  2RNA A;  3JUE A;  1YCS B;  2EGC A;  4AFQ C;  3QWY A;  3TWX A;  2YUQ A;  1UHF A;  3SO8 A;  1JEG A;  1X6G A;  1D9S A;  5ENP D;  2LX7 A;  4F17 A;  4YDY A;  2ED0 A;  1X43 A;  3VS3 A;  1OEB A;  1CKA A;  2DX1 A;  2K6D A;  1PKT A;  1T0H A;  2A08 A;  5ECA A;  1U5S A;  1JU5 C;  1GBR A;  4D8D A;  2PTK A;  3M0P A;  3UA7 A;  2JMC A;  1AWO A;  3ZUV B;  2J06 A;  4BET A;  2PZ1 A;  4Z89 A;  4RTW A;  4ZHB A;  2E5K A;  1U3O A;  1BI8 B;  2F2W A;  2RQR A;  5ENR D;  1WDY A;  2KXC A;  2M0Y A;  1HSQ A;  1YN8 A;  2IIM A;  4J9G A;  2O2O A;  1I1J A;  2DM1 A;  2DIL A;  2ETA A;  4Z88 A;  2CDT A;  3LJN A;  2F2V A;  2KBT A;  1OT8 A;  4K5C A;  2DZN A;  3F6Q A;  1YMP A;  1MYO A;  5FWC A;  5ENQ D;  1N11 A;  2MCN A;  1M3C A;  5L23 A;  1NYF A;  1WXT A;  1QWF A;  1VYV A;  2JT4 A;  2G6F X;  1UUE A;  2CUD A;  2MYO A;  4TUM A;  1IXV A;  5IHK A;  1AWW A;  5EID A;  3JXI A;  2L2P A;  2W10 A;  4BER A;  3EG1 A;  1KIK A;  2LMJ A;  2BZY A;  2KT8 A;  3V79 K;  4LE9 A;  3B95 A;  1NG2 A;  2AZS A;  2LJ0 A;  2YUP A;  3KEA A;  4WCI A;  2AZV A;  4GLM A;  1HJD A;  2W0Z A;  4HRN A;  3O5Z A;  2CSQ A;  4U96 D;  2EYZ A;  2RQU A;  4UUC A;  5CBN A;  2M51 A;  3UAT A;  4JPB W;  2LZ6 B;  2YUN A;  2OJ2 A;  1PRM C;  4K5A B;  2FRY A;  2RFA A;  5CED B;  2XEH A;  1UHC A;  1YWO A;  3NGP A;  4RUG A;  1ZUU A;  2C0O A;  1A0N B;  3AJI A;  5GJW B;  1GBQ A;  2D1X A;  2L3P A;  1MV3 A;  4E6R A;  3NPF A;  4HI9 A;  1PKS A;  2A36 A;  1E7O A;  2J05 A;  1YYH A;  3THK A;  1S70 B;  1WFW A;  1WIE A;  2Y1L E;  4QT7 A;  4RTX A;  4ATZ D;  1BD8 A;  2HE0 A;  2XZT G;  2V4H C;  4O1O A;  4G8K A;  1JXO A;  3REB B;  1SW6 A;  2KRN A;  3M0R A;  1QLY A;  4IIO A;  1YNZ A;  2F8X K;  2JXB A;  1Y0M A;  1M3B A;  4OML A;  4LNP A;  3QWX X;  4DX5 D;  1AVZ C;  1K1Z A;  2KXP C;  1N0R A;  2AJA A;  2AKK A;  1YWP A;  3M0U A;  2K3B A;  2FO1 E;  2RQV A;  4J9E A;  4J8Y A;  1PHT A;  2FRW A;  2RMO A;  4Y92 A;  4GBQ A;  1W6X A;  4DEX A;  2CT3 A;  5IH2 A;  2RQW A;  3JXJ A;  1A5E A;  3RBB B;  3VS0 A;  2OAW A;  1X69 A;  3AAA C;  1WLP B;  1I0C A;  2KXD A;  1ARK A;  1SSH A;  3GBQ A;  2J6O A;  4J7W A;  3TWW A;  3H41 A;  2DYB A;  1WX6 A;  2GGR A;  1X6B A;  3W9G A;  1T3S A;  2V5Q C;  4U8Y D;  1GFD A;  4F6R D;  2VVK A;  1NM7 A;  3TWQ A;  1OV3 A;  2ROL A;  1Z9Q A;  2VKN A;  2KNB B;  3VRY A;  2BZ8 A;  1PRL C;  1ZUY A;  4J9H A;  1SHG A;  2RQT A;  4LUE A;  4CC2 A;  5EYP F;  1AZE A;  4AG1 C;  2DL7 A;  3W9F A;  1AD5 A;  4JJC A;  4JJB A;  2HEQ A;  1QWE A;  2C0I A;  2KRO A;  1WG0 A;  4NIK A;  5FIO A;  4HI8 A;  1LCK A;  3ZNG A;  4JJD A;  4RTZ A;  3UA6 A;  1K4U S;  1XOV A;  4RTU A;  3VRZ A;  5HRY A;  3V2X A;  2EKH A;  4HB5 A;  3TSW A;  2EVR A;  3KFV A;  1ABO A;  2FPF A;  3TVT A;  2F8Y A;  3TWT A;  3SEM A;  2LJ1 A;  1U06 A;  3SHW A;  2JAB A;  1E6G A;  1RI9 A;  1VYT A;  3H0F A;  1JO8 A;  4ESR A;  2B0O E;  2A37 A;  2D8H A;  1UFF A;  2K7A A;  2D0N A;  4K11 A;  5ENS D;  1B07 A;  4GPM A;  4OMP A;  4CC4 B;  1Z9Z A;  1BK2 A;  2RF0 A;  3R6N A;  1SHF A;  3NOG D;  1MJ0 A;  4A63 B;  4AG2 C;  2JTE A;  2F37 A;  3EG2 A;  1BB9 A;  4U95 D;  4OMM A;  4LNU D;  4DX7 D;  3H0I A;  5I22 A;  1OOT A;  5BXU A;  1OPK A;  1K1A A;  4BSZ B;  2HDA A;  5CEC B;  3PVL A;  3U23 A;  4DEY A;  2GTJ A;  1AEY A;  4K5B A;  4CYM D;  1AP7 A;  1WXB A;  2O31 A;  4HLL A;  5ENT D;  5KWD A;  1ZBJ A;  2L6B A;  3D9H A;  4FSS A;  2YDL A;  1K76 A;  5KNH D;  4OMQ A;  2MIO A;  5KBA A;  2ECZ A;  3H0H A;  3B7B A;  2X3W D;  3NHN A;  1W1F A;  2O9V A;  1K1B A;  1GRI A;  3ZL7 C;  4HQD A;  1M27 C;  5FWB A;  1KJW A;  5EYL A;  2AKL A;  4YDW A;  4HBD A;  4RLY A;  2EGA A;  3EHQ A;  3VS4 A;  1IHB A;  5HS0 A;  2DMO A;  2DVW A;  1TG0 A;  5EN5 D;  1ZSG A;  1M8M A;  1NLO C;  2ED1 A;  4LG6 A;  3I35 A;  2BZX A;  2Y0B G;  1SPK A;  1UE9 A;  2MOX A;  4LN2 A;  2DL3 A;  4G8L A;  4RTV A;  2J6K A;  4OMN A;  3FJ5 A;  4ZNX A;  5AQ7 A;  2V1R A;  5EIB E;  1B3Q A;  3J5P A;  1IKN D;  1SRM A;  3M0Q A;  4Z68 A;  4F1P A;  1HD3 A;  1VYU A;  2JM9 A;  3UF4 A;  4HRL A;  2BKG A;  1GCP A;  2AK5 A;  2DVJ A;  2DRM A;  2DBK A;  3EU9 A;  3I5R A;  5EC7 A;  3HRA A;  4R0K A;  1K3Z D;  1M3A A;  2CRE A;  2ROT A;  2B86 A;  2HCK A;  5IHN A;  4HVU A;  4J9I A;  2LQW A;  2DZO A;  1CSK A;  2VGE A;  4AFZ C;  1DCQ A;  2EYW A;  2FG0 A;  3J5Q B;  1UDL A; 
#chains in the Genus database with same CATH topology
 3OYK A;  3R9A B;  3VS1 A;  4M75 C;  4BT9 A;  1VQ8 Q;  2XZD G;  5GAO r;  3B7R L;  4FJZ A;  3Q9U C;  3O4Z A;  2R17 C;  2RPN A;  4PS8 A;  2DWZ A;  3D9M A;  1X27 A;  3CVQ A;  3ZRH A;  4NL3 A;  5HK3 A;  3BUA A;  4U8V D;  2IOL A;  4LDY A;  5A0L A;  4JJN K;  1HK9 A;  4WWN A;  4U8H A;  1QP2 A;  1UG3 A;  4C48 B;  1IHV A;  3AHU A;  2CZ0 B;  3V30 A;  1ZBP A;  1WM5 A;  1YJW Q;  1RAG B;  4M78 B;  4EIK A;  2XRZ A;  4F53 A;  5B1B E;  2HMA A;  2ZPI B;  1D3B A;  3EU5 A;  1QZ2 A;  1TUG B;  3L2Q A;  3CVN A;  3R7R A;  3SWN B;  4ZN1 A;  3Q9N C;  1G3Y A;  4DLO A;  3DEP A;  3ZEH A;  3E34 A;  4BEP A;  3RIB A;  3I5S A;  4LNB A;  4QVC A;  1FMW A;  2VYI A;  4I9E A;  3O48 A;  4XQ3 A;  4C0D B;  1IO6 A;  2SEM A;  2X6F A;  3DPY A;  4WWP A;  4M77 E;  2NYS A;  1UEC A;  1NEG A;  4M75 E;  4M77 G;  1EZZ B;  5IHI A;  2VAS A;  4PJO G;  4ZGJ B;  5B1A E;  4CC3 A;  4EPC A;  2NYJ A;  1B34 A;  4MDX A;  4J6W A;  2WSE E;  1MQS A;  4A3V A;  3ULQ A;  3Q49 B;  3Q4A B;  4LCT A;  2DLP A;  4F7U F;  3GNG A;  4MMK A;  4GYO A;  3JAM E;  2MPX C;  3X25 B;  1Z5S C;  1VQK T;  4L1B A;  4B89 A;  2JLB A;  2MWO A;  4F7U B;  2VTB B;  1M2O A;  2GQI A;  1OZ2 A;  1K9M U;  2YIN A;  4F7A A;  4TUU A;  4F7U E;  2CP5 A;  3NTK A;  2Q7F A;  4A54 A;  4EQF A;  1SEM A;  3P8B B;  2L0A A;  4HT8 A;  3CD6 A;  3QHS A;  1T0J A;  1VQ9 Q;  4M7A G;  1ELW A;  5CR2 A;  3JB9 F;  4UI9 C;  3DSX A;  2H8H A;  2RO0 A;  3CD6 T;  1HU3 A;  3CBO A;  5BXO A;  2DE0 X;  4QQG A;  1AOJ A;  3S7D A;  5KYU A;  3DXM G;  3DLM A;  3KSL A;  3OXL A;  4BES A;  2CUB A;  5EX3 A;  5LCW J;  2DJQ A;  3LYI A;  1FMK A;  2KT1 A;  2GW1 A;  1U3D A;  5GJV B;  2B8A A;  1S72 A;  2CZ6 B;  3FU0 A;  2A0F B;  1VQ9 T;  3L2W A;  2JM8 A;  4FW2 A;  4BAC A;  4KGV B;  1GCQ A;  2CP6 A;  4AM9 A;  4PJM A;  3SB2 A;  3HXF A;  5KNG A;  4B8A A;  3PUK A;  3D9P A;  4JZ4 A;  4PFO A;  1Y57 A;  3ER0 A;  2QY7 A;  3Q79 A;  3TQ7 P;  2X4W A;  5AQ9 A;  5JMN D;  3URZ A;  4M7A B;  3FUN A;  5EIL A;  2X38 A;  2LNV A;  5A0G A;  3U64 A;  1VQL Q;  4N4G A;  4I17 A;  3ISM C;  4CC7 A;  4DRX E;  1RUW A;  2DTH A;  3G71 T;  3CCE Q;  5LP0 A;  2ETC A;  4ANV A;  2KDS A;  4KXK B;  3RSE G;  3CEQ A;  1JPL A;  1K73 R;  1NEB A;  5A0D A;  4FYV B;  3SHF A;  3UMV A;  1HG2 A;  1TXQ A;  2KRS A;  1VQ4 A;  3CQT A;  3CIA A;  3EG0 A;  1H6K A;  3UM2 A;  4GTV A;  2K5F A;  3NFC A;  1BLX B;  2CSI A;  1HYO A;  2MMP A;  4HT9 A;  2BE9 B;  2YSQ A;  5A23 A;  4ELY C;  1N4R A;  4CRI A;  5J39 A;  1KPS B;  1OY3 D;  5AN8 A;  3ASN E;  3PZ4 A;  4I6E A;  3UM3 A;  5ITZ F;  2SRC A;  4HOU A;  2V26 A;  1TR4 A;  1RAA B;  1UGP B;  5A7D B;  1BIB A;  4HNA D;  3IXE A;  4JB8 P;  4XTZ A;  2EYY A;  3H6Z A;  3FTS A;  2VGM A;  1NL4 A;  3GLX A;  1Q81 C;  4WF2 A;  3RRU A;  3CMA A;  1KLX A;  4PLI A;  2IVW A;  5GAO p;  2XDB A;  1MHQ A;  1ZSZ B;  1A17 A;  2WXJ A;  3G2T A;  1UOH A;  3HXC A;  1ZQ1 A;  2DD5 A;  4HRM B;  2EPD A;  3E2U A;  2FO7 A;  2PNN A;  4NRH B;  5FRO A;  4KZ0 A;  5AAR A;  3GPL A;  5T4Y A;  2VSN A;  2I2L A;  3CC7 Q;  1RLQ C;  4DQ2 A;  2Y4Y A;  1OU9 A;  4YDE A;  3TU4 K;  1H92 A;  1D09 B;  2CP7 A;  1I8F A;  4F16 A;  1BBZ A;  5GMK e;  4B93 B;  1W4S A;  4DX6 D;  3HXE A;  3K9I A;  4KRT A;  4RG2 A;  2WXL A;  2DNU A;  3UIO C;  1WXU A;  2EJ9 A;  1WAO 1;  2H6G A;  2V8J A;  1E6H A;  1VQN Q;  1MNE A;  3IQL A;  3TJP A;  3PUJ A;  4A4G A;  1Q2Z A;  3A8O B;  1OI1 A;  2P0P A;  5DBK A;  2MAM A;  5GAO m;  5E75 A;  4F14 A;  2YHE A;  2XKO C;  3QG1 A;  1QP3 A;  5AAO A;  3LGL A;  3EFO A;  2Y4U A;  5FZR A;  3X26 B;  3ZPJ A;  3M54 A;  4M7D G;  3SF4 A;  3QWY A;  3TWX A;  2WXF A;  2BED A;  4Q69 A;  1F1B B;  4NL2 A;  1P5Q A;  1UHF A;  1JEG A;  3SNX A;  5KYX A;  4F17 A;  1W3B A;  2ED0 A;  3FTW A;  1YJW T;  3VYG A;  2PQR A;  3MA5 A;  1CKA A;  2DX1 A;  4XU0 A;  3E33 A;  1PKT A;  3SD5 A;  3MGB A;  3UT8 A;  1N8R R;  8AT1 B;  5D6W A;  5ARG A;  4FHK A;  2JMC A;  4X9C A;  1AWO A;  5GAM g;  4AY5 A;  3D7S B;  5D7U A;  1YIT A;  2RQR A;  1WDY A;  4J8F A;  4M7C A;  2XDD A;  1SZ9 A;  2KXC A;  1M90 C;  2HQE A;  1HSQ A;  1YN8 A;  1ZHI A;  2FYK A;  3WVD B;  2IIM A;  4J9G A;  3RKW A;  5GAN 3;  2V8I A;  1FT2 A;  2ETA A;  2CDT A;  2KBT A;  5FLX E;  5GAN d;  2QTV A;  5CQY A;  4PJO C;  3F6Q A;  3MEA A;  2XGO A;  2YXY A;  2PQW A;  2RJE A;  4FYX B;  4L6V 5;  4HCC A;  2OV8 A;  2KK4 A;  2JT4 A;  2HL3 A;  2E3H A;  2UY1 A;  4XKC A;  3F70 A;  2XEV A;  3FTY A;  1G8X A;  2L2P A;  1TNO A;  2W10 A;  4ACL A;  5T8I A;  2BF0 X;  3KBG A;  3TCJ A;  3UIN C;  2LMJ A;  4G11 A;  1WQ7 A;  1XJW B;  1NG2 A;  3ML8 A;  2E4H A;  5GAN h;  5AEN A;  3C94 A;  3CCL Q;  3M5A A;  1QVG P;  5T3R A;  1AHJ B;  3CCJ A;  1KQS S;  4GTQ A;  3OW2 P;  4HRN A;  1NA0 A;  1IRE B;  2MK5 A;  2P9U G;  1TN6 A;  4BWR A;  2AW6 A;  3INZ A;  2EYZ A;  1N95 A;  3U4T A;  2JZ2 A;  5CKH A;  2CP3 A;  2LVM A;  5CBN A;  4J6X A;  4D6W A;  2P84 A;  2LZ6 B;  2YUN A;  4PJO D;  3FB9 A;  1PRM C;  3CVP A;  2JEK A;  3PZ3 A;  3EUV A;  1ZUU A;  3D9K A;  3RAU A;  3HYM B;  3PRZ A;  3ZYL A;  1GBQ A;  2D1X A;  2L3P A;  3CCR A;  3GW4 A;  2M0O A;  4E6R A;  3MCA B;  1Q81 R;  1PKS A;  2QG9 B;  3D9N A;  8ATC B;  3CK7 A;  1YJW A;  3C98 A;  4GML A;  2BKD N;  1WIE A;  2Y1L E;  5A2Q E;  3HKS A;  4RTX A;  4FU3 A;  2BE7 D;  5GAN j;  3LWI A;  1IYG A;  2XZT G;  3HRU A;  4O1O A;  3REB B;  3RMS A;  5E76 A;  2KRN A;  3ASK A;  3ME9 A;  1OWP A;  1QLY A;  1K73 U;  3DKM A;  4ZTJ A;  5LJ3 f;  5FT9 A;  1M3B A;  3AG4 E;  1VQP T;  2XID A;  2YLC A;  3QWX X;  4EMK A;  4N2S A;  2X4Y A;  1K8K G;  2AJA A;  1BCO A;  3MEW A;  3LVQ E;  1LOJ A;  2FO1 E;  3EFO B;  4J9E A;  3U9W A;  1TTH B;  1WHL A;  3HHM A;  4GBQ A;  4C8Q E;  4DEX A;  1RZ4 A;  5IH2 A;  2RQW A;  4ANU A;  4PJL A;  1B34 B;  4AMC A;  2QAS A;  1TJF A;  3AAA C;  1WLP B;  1X69 A;  3LY9 A;  3CCV A;  1W2B A;  3M59 A;  3QO3 A;  3A1P A;  2NUP B;  4N5C A;  3CLJ A;  1ARK A;  3B7U X;  2LDM A;  2YHT A;  4J7W A;  5KYW B;  2FZG B;  1KQS A;  3UX4 A;  3MKR A;  4KUI A;  1X6B A;  3W9G A;  4C8Q A;  3JB9 D;  4F6R D;  1E90 A;  2G3R A;  1SG5 A;  3MO8 A;  1NM7 A;  3CEY A;  1Z9Q A;  4JS4 A;  2KNB B;  3VRY A;  2BZ8 A;  1ZUY A;  1VQ6 Q;  1SHG A;  2RQT A;  4B6M A;  5EYP F;  2VV5 A;  1HF8 A;  1SQM A;  4ANW A;  2EIJ E;  4DOV A;  2KRO A;  5BPP A;  5LJ5 f;  4NIK A;  3QDR B;  2AXZ A;  4LD6 A;  2QFC A;  2JTM A;  2XHC A;  2DIG A;  4RTU A;  4JEH A;  2NUP A;  4J6I A;  2DVE A;  3V2X A;  4HB5 A;  3Q73 A;  3ZYQ A;  2DTO A;  4EZJ A;  2GRN B;  1ABO A;  2AVP A;  3PMI A;  4OP0 A;  1IGU A;  1U06 A;  5GAO n;  4ATG A;  1E6G A;  4ESR A;  3CVV A;  1K9M R;  2A37 A;  2D8H A;  4UI9 J;  3CKB A;  4FYY B;  1W2B P;  3LPZ A;  4NOY A;  1VQL T;  4GZ5 A;  5ENS D;  1B07 A;  1I4K 1;  4GPM A;  2E41 A;  2AWI A;  4OMP A;  4E47 A;  3LCA A;  1BK2 A;  2OVF A;  3PNL B;  3CCM T;  1NJI C;  1Q7Y U;  3HDX A;  5AJL A;  5FQ4 A;  1YCY A;  2QAZ A;  4BDY A;  1V55 E;  2DXT A;  1NE8 A;  2JTE A;  5LL6 S;  2J49 A;  3ABL E;  4RG9 A;  3SI5 A;  4DX7 D;  2K3Y A;  5I22 A;  4KUL A;  1OOT A;  2DBA A;  4PJJ A;  5BXU A;  4TVR A;  4UWF A;  4JRQ A;  1VQM T;  3LXU X;  3HRT A;  2E1H A;  1AEY A;  2O4X B;  4K5B A;  4CEM A;  2VTB A;  2L6B A;  3ZFJ A;  3ZYK A;  5KNH D;  4XAX B;  1WY6 A;  2VGX A;  4R7L A;  3Q47 B;  4HVB A;  4OMQ A;  3MCX A;  4APO A;  2FF4 A;  3FC3 A;  2MIO A;  4UC4 A;  2QGG A;  1U1T A;  1M1K R;  2QZA A;  4J5Y A;  5FWB A;  2GRQ B;  3ASG A;  2D0Q B;  2X9H A;  1UJK A;  3CVX A;  2COW A;  3VJP A;  4QQ6 A;  3URG A;  1E7V A;  2EJF A;  2WM9 A;  3S6W A;  2GRP B;  1NLO C;  4DI3 A;  4C92 C;  1SPK A;  3VLE A;  3Q1J A;  3HP9 A;  4B9W A;  1OU8 A;  2MOX A;  3I55 A;  3JCM h;  3AS5 A;  1YJN Q;  1QVF P;  1BI1 A;  1M1K C;  4M7A A;  2J6K A;  4OMN A;  3FUF A;  4ZNX A;  4LD9 K;  3C3O A;  2HR2 A;  4M75 F;  4GYW A;  4UQZ A;  4M77 F;  4EEC A;  4Z68 A;  3SY2 A;  4A4H A;  3UPV A;  1PD1 A;  2E65 A;  2JM9 A;  3EGX A;  3E32 A;  2CG3 A;  4WNF A;  2DVJ A;  4ZGE B;  2DBK A;  3E19 A;  1RAD B;  1HFA A;  2EQK A;  4LDV A;  1M3A A;  3U3W A;  5CCL A;  3GZ2 A;  2PVG B;  4OF1 A;  4HVU A;  3SGH A;  2H6H A;  3OXG A;  3GF5 A;  2A7Y A;  2ZPF B;  3CC7 A;  2OVB A;  4AFZ C;  3QKY A;  4CC2 A;  3J5Q B;  5FZQ A;  1ELK A;  3T9K A;  1BI2 A;  1Q86 C;  4E7J A;  4C5E A;  3TG4 A;  4A55 A;  2XEE A;  2LQN A;  1FCH A;  1ABQ A;  4F3V A;  1SSF A;  2RK2 A;  3RO3 A;  1PM3 A;  1N52 A;  2ILR A;  2CHX A;  3FHE A;  5HCK A;  2HNI A;  1TNZ A;  1K9M C;  2QA4 A;  3FUI A;  4WWO A;  2F5K A;  5IAY A;  2KYM A;  2GBQ A;  2ZGD A;  1QCN A;  1N94 A;  4XTV A;  3JQ0 A;  2CH4 W;  3ZEF A;  3PNT B;  5KCO A;  5FU7 B;  3BG0 B;  2PNI A;  2OOE A;  3ZXS A;  1K0S A;  1KZO A;  5IY5 E;  1RAI B;  2EYX A;  3X20 B;  3MKD A;  4JA9 A;  3VUZ A;  3L42 A;  3CPW P;  3ASO E;  5IXB A;  1VA7 A;  3CST A;  1TOV A;  1OXJ A;  4F7U A;  2JS2 A;  1RI0 A;  3JQ1 A;  3X24 B;  3TWV A;  1KHC A;  2WAC A;  2Y90 A;  1E96 B;  3OXF A;  2XEN A;  1EF1 C;  4EMK C;  3ZKJ A;  1G3N B;  3AG1 E;  2VGX B;  3LY8 A;  3TWS A;  3CME A;  4M7D B;  1X2Q A;  1NP7 A;  5D66 A;  2XCC A;  2DJZ A;  1VUB A;  4OVA A;  2V4L A;  1I5L A;  3G6E A;  4M7D F;  3HIZ A;  2L3S A;  1V1C A;  2P9K G;  2EIM E;  2C0M A;  1M30 A;  4UQY A;  3G6E T;  2ZIS A;  1WHM A;  3CBM A;  4JZY A;  4JLI A;  4E2F B;  1OX9 A;  4QFV A;  3M56 A;  4BE0 A;  1EFN A;  3OYN A;  1V29 B;  2WXG A;  3CD6 Q;  3M0S A;  3M58 A;  4FP7 A;  2PUK B;  5G04 J;  1AWJ A;  2EQU A;  1I5O B;  4GZC A;  1VQK A;  4LDU A;  2YLB A;  2EIN E;  2FZC B;  4XU3 A;  2Y4T A;  4M7D A;  3PH0 C;  4N3C A;  2QI2 A;  2ZPH B;  4A1S A;  2PQN A;  3CCL T;  5JJ6 A;  3VS7 A;  3EJN A;  4OVU A;  5DY9 A;  3A8H B;  4AVX A;  5CHE E;  2EW3 A;  2P0K A;  1CKB A;  4YVO A;  3OA6 A;  3CCL A;  4KBM B;  4HOQ A;  2KYB A;  5GAN 5;  2VSO E;  1WGS A;  4IUQ A;  1D0X A;  3OS2 A;  3SD4 A;  2QGF B;  4MZM A;  2UWJ G;  3I4G A;  3EG9 A;  4OMO A;  3ONL A;  2HL5 C;  1NYG A;  3MKQ A;  2MWP A;  4HOS A;  1VIF A;  4OVV A;  4Q96 A;  4DBQ A;  1UGV A;  5FW9 A;  4CDN A;  5KJL A;  4BI8 B;  5LJ5 d;  1M4Z A;  4ANX A;  5KYN A;  3FH8 A;  5FQ7 A;  2RJC A;  2DEU A;  1NA3 A;  1IZ6 A;  1NJI R;  3LWH A;  4BDZ A;  3V31 A;  3ZHE B;  3VS2 A;  3ULE G;  2WSF E;  3J81 E;  2Y4X A;  1H19 A;  1H8K A;  1K8A R;  3NBN B;  2KBX A;  2CHZ A;  1QVF A;  3DSU A;  3PEU B;  1VQ7 A;  5KJK A;  2AT1 B;  2QEX A;  1H2V C;  2F2X A;  2P9P G;  2KE9 A;  2P0Q A;  4XTU A;  1EIF A;  1I81 A;  4GCN A;  2RD1 A;  5GMK j;  3PIO A;  4EBA A;  3FFL A;  1Z6T A;  2MF2 A;  2RHU A;  1KC8 R;  3OTN A;  2FHD A;  1PAQ A;  1N9S A;  4KGZ B;  5CEA A;  4OAV B;  2DL4 A;  3G4S T;  4DX2 A;  1TH7 A;  3VLD A;  4M7D C;  2XDP A;  3OYF A;  3GYZ A;  4C5I A;  3A8M B;  1VDY A;  2QYU A;  3APF A;  4B9X A;  4C5G A;  2XPY A;  1O1R A;  3E37 A;  1TNY A;  2IO2 C;  2X6J A;  1HZ4 A;  3G2U A;  3VTY A;  4PJN A;  1OCZ E;  1OUV A;  1D8E A;  1OCC E;  3QOU A;  3ZVV A;  1M90 R;  1B89 A;  3L17 A;  5LOZ A;  2BIV A;  5FU7 C;  5I2S A;  1JBM A;  1D1A A;  2QDL A;  1KD1 U;  2FEI A;  4RTY A;  1KC8 U;  4BTB A;  1UTI A;  4M7A C;  2J8S D;  5AQB A;  4LDX A;  4WND A;  3IV0 A;  1WA7 A;  3REA B;  4HOT A;  4FM4 B;  2CFU A;  1YHQ Q;  2C0L A;  1ZA1 B;  3KS2 A;  2ENM A;  5FRM A;  3EFS A;  4EMK B;  1FMV A;  2WXQ A;  4ELZ C;  4E7L A;  1RAF B;  5D0Q D;  2CGH A;  3ZW3 A;  2FO0 A;  4XX5 A;  4IUT A;  4Z8A A;  3VS6 A;  4C0D C;  2XHE A;  1M9S A;  2AHJ B;  2E12 A;  2KGT A;  3ULY A;  1INZ A;  2ATC B;  3IHV A;  2J09 A;  2QDY B;  1Q82 R;  2EQX A;  2EQJ A;  4JEU A;  5BUZ A;  1K9A A;  1TN8 A;  1JCS A;  3LYA A;  3MP8 A;  2GRM A;  1ZLM A;  2OND A;  3FTZ A;  4O60 A;  2BTT A;  5FTP A;  2EYQ A;  5LJ5 g;  1QCO A;  4AOF A;  1I07 A;  5LCW C;  1U1S A;  2CT4 A;  1D1C A;  5AT1 B;  2R58 A;  3G2W A;  1XQH A;  4JXT A;  2P4R A;  5GAO q;  5AQA A;  4J6Y A;  4OB3 B;  1JUQ A;  4OAU C;  2ESW A;  3JCM P;  4D8K A;  1E8Y A;  4FA6 A;  3EGD B;  3U66 A;  1P92 A;  2JVV A;  4XTW A;  4AFQ C;  9ATC B;  4KMO A;  3JCM b;  3SQV A;  1NJI U;  1X6G A;  2PVD B;  1Q7Y C;  5H7P A;  2LX7 A;  1PSE A;  1X75 C;  3VS3 A;  1YIT Q;  2D6F A;  3HFN A;  3L82 A;  5ECA A;  4BI4 A;  1U5S A;  1H6P A;  3GZS A;  1JU5 C;  1M1G A;  1WZO A;  4OMF B;  2WQH A;  5CCM A;  2R02 A;  1V76 A;  4FJY A;  4BET A;  2PZ1 A;  3QK0 A;  1IXD A;  3CBP A;  2E5K A;  1U3O A;  2F2W A;  3EGD A;  4U0U A;  5I2M A;  2M0Y A;  4AP2 A;  4C92 D;  2LQK A;  2DM1 A;  4PUC A;  2K2V A;  2V8S E;  2WXR A;  4FLH A;  1OT8 A;  3CC4 A;  4OYS A;  2RHY A;  1XGW A;  4II1 A;  2EQM A;  3OYD A;  5ENQ D;  1N9A A;  5L23 A;  2MI6 A;  2D9T A;  2DET A;  3V8J A;  3CC4 T;  3JCM W;  2LAH A;  4Q94 A;  1YHQ T;  2MYO A;  4TUM A;  1IXV A;  1Q95 G;  2OEW A;  2DD4 A;  2CG2 A;  2VQ2 A;  3OY9 A;  3E30 A;  3TXN A;  3WXM B;  4JHJ A;  4TXQ A;  4WCI A;  3OB9 A;  2W0Z A;  3QZ5 B;  3O5Z A;  1JB0 E;  2CSQ A;  2HZY A;  3N5B B;  1QQE A;  1FX7 A;  1M5Q 1;  4PL6 A;  1ZB1 A;  4TV3 A;  1BKB A;  2DIW A;  2M51 A;  3RMQ A;  2LT4 A;  4JHK A;  4JPB W;  4CDM A;  4J8S A;  3CCR T;  1Q86 U;  2FRY A;  1YWO A;  5CED B;  2XEH A;  3NGP A;  3PNW C;  3OW2 A;  2XGS A;  2C0O A;  4EDU A;  3AJI A;  1NI1 A;  2ION A;  2KZT A;  5HQ8 A;  4IUU A;  5ANL A;  3KD7 A;  1TYQ G;  1SA5 A;  1G3S A;  3NPF A;  2GRO B;  1MND A;  4UWG A;  1HS6 A;  2A36 A;  2EJG A;  1E7O A;  3Q75 A;  2VC8 A;  3THK A;  3CCM Q;  1BD8 A;  1JXO A;  4G8K A;  5CMY A;  4DLQ A;  1SW6 A;  3TXM A;  2HQX A;  3M0R A;  4JUV A;  3OYY A;  4IIO A;  1YNZ A;  2JXB A;  2C2L A;  3PGG A;  1YIJ A;  2QQS A;  2E6Z A;  4EZL A;  1JCR A;  3SFX A;  5KJN A;  4LNP A;  3RJV A;  1O1S A;  4DX5 D;  1UN8 A;  1QBQ A;  2KXP C;  3FU3 A;  1K1Z A;  1UGQ B;  5CMW A;  2AKK A;  2DTI A;  3OYL A;  2HAX A;  2IQC A;  3G6E Q;  4C9B B;  1Y8M A;  2FRW A;  4EZK A;  2KQW A;  1LTX A;  2LSV A;  3VTX A;  1W6X A;  2XS8 A;  3EGX B;  3VUB A;  2CT3 A;  2F69 A;  1A5E A;  3OBY A;  5AYF A;  2VXE A;  4EMG A;  3CC2 A;  4WAF A;  5GAN 8;  4CCA A;  4QKU A;  4C92 B;  4I1A A;  3QC1 A;  2DEQ A;  3PT9 A;  3E9F A;  4U7E B;  3JSC A;  2HSE B;  1KD1 R;  3OYE A;  4ZGD B;  3NTI A;  2VVK A;  4LUE A;  4L2L A;  3CCJ T;  2VGY A;  1OWL A;  4AG1 C;  3W9F A;  4H7Y A;  1AD5 A;  4JJC A;  4M75 D;  4CRW A;  4M77 A;  3HRS A;  3BDU A;  2KCV A;  2C0I A;  1KQ1 A;  3OAW A;  1PG5 B;  1QVP A;  4G26 A;  2IEJ A;  2P9I G;  3ABM E;  4HI8 A;  5FIO A;  4JJD A;  4Y91 A;  3GOX A;  3RRN B;  5HRY A;  1UW4 B;  4BX9 A;  3ONK A;  2KCL A;  3NQP A;  1TNB A;  3CCJ Q;  2KI7 A;  1BI3 A;  3DRA A;  3I4R B;  3CCS A;  2LXL A;  3TVT A;  2HKQ B;  3SHW A;  3QWV A;  3L2U A;  4KZC A;  1H3Z A;  2CKK A;  3GIB A;  3PE4 A;  1PD0 A;  3GNF B;  4XI0 A;  3EHM A;  3CSF A;  2D0N A;  2RI5 A;  2FEZ A;  3QBY A;  5M72 A;  2FUL A;  3QJY A;  4RG8 A;  4CC4 B;  1N4Q A;  2OX7 A;  4Z02 A;  4C8Q F;  4J0U A;  3TAX A;  4FC8 A;  4TRQ A;  2XIC A;  1VQL A;  4A63 B;  2F37 A;  1WJS A;  1BB9 A;  2Y69 E;  4OMM A;  3RES A;  2HYZ A;  3SFZ A;  3J80 E;  1OPK A;  1SF9 A;  1WJR A;  5CEC B;  1MZC A;  3U23 A;  1N27 A;  4IYP A;  2EAY A;  1AP7 A;  2B6C A;  4HLL A;  2IJG X;  5KWD A;  1ZBJ A;  2R2L A;  3D9H A;  2YQ8 A;  2IPO B;  4C8Q C;  1K76 A;  2I1J A;  4RVB A;  2M16 A;  3CC2 T;  3OSS C;  3WXX A;  3OS1 A;  4GZ3 A;  4X9D A;  3H0H A;  5IT9 E;  2LNI A;  3B7B A;  1N4S A;  1W1F A;  5M9O A;  2CFZ A;  1GRI A;  3S3M A;  1KJW A;  5GAN 7;  1FVH A;  2AKL A;  4RLY A;  4BI3 A;  4C0E A;  3I55 T;  1YJ9 Q;  3VS4 A;  2ZPB B;  5HS0 A;  2DVW A;  1Q81 U;  1ZSZ A;  2PZI A;  1M8M A;  3UDC A;  2WMO A;  2Y0B G;  3CK9 A;  1WHH A;  2BZX A;  4PKC C;  1MMN A;  3CKC A;  4HFG A;  2DPP B;  1BYM A;  4G8L A;  2RJF A;  4RTV A;  5EIB E;  1B3Q A;  3BW1 A;  3E4B A;  3X28 B;  3M0Q A;  1G5V A;  1KC8 C;  4F1P A;  4GA2 A;  4I9C A;  3MHX A;  4URK A;  4D10 C;  4HRL A;  3EIQ C;  3A8L B;  5GMK h;  5EC7 A;  1G3T A;  3CC7 T;  2ROT A;  2B86 A;  2HCK A;  3PE3 A;  2XI9 A;  5IHN A;  4A3T A;  4RMO A;  4J9I A;  5GMK i;  2DZO A;  1S64 A;  4PDX A;  3JUI A;  5J08 A;  4K03 A;  1UDL A;  2HBP A;  4VUB A;  1S63 A;  1JCQ A;  3ASH A;  2HBW A;  2DBM A;  3PVQ A;  4M78 A;  1QVG A;  3EG9 B;  2Y3A A;  3LVR E;  1Q7Y R;  3FTX A;  4QVZ A;  3EGU A;  5GAN 6;  3I56 A;  4BFR A;  2X4J A;  2X35 A;  4V3I A;  5J26 A;  1X2K A;  4GY5 A;  1YI2 Q;  2CP2 A;  4HCZ A;  5CRU A;  1OUL A;  1BI7 B;  2ZPE B;  3PDN A;  2JMA A;  3LW5 E;  2J9Q A;  4WUY A;  2FL7 A;  4DA4 A;  2HSP A;  2OI3 A;  1WNL A;  4LNG A;  1OYX A;  2DA9 A;  3UTM A;  3V7C A;  3V8K A;  2KR3 A;  1LNX A;  4HVV A;  3BE3 A;  1IQU A;  1OWM A;  3JCM d;  4KBQ A;  2ZGG A;  3AG3 E;  3CME Q;  2EQI A;  2ETB A;  3QB2 A;  5CKB A;  2E70 A;  2RG8 A;  4BX8 A;  2RD0 A;  3JRZ A;  3WVE B;  1QKX A;  3D9I A;  1NBE B;  3RRM B;  5EDS A;  3M0T A;  1VQO A;  4CI0 C;  3RR6 A;  2QEX T;  2QQB A;  1T3L A;  4WNG A;  3R7Q A;  1R0B G;  4G2V A;  5EKQ D;  1VQP Q;  3WG7 E;  1MX4 A;  4E7S A;  3LEW A;  4GAA A;  4A1G A;  4PJO F;  3T8M A;  4HVW A;  3OYG A;  2RJD A;  2PU9 B;  1N0Q A;  3ABK E;  3HPW A;  6AT1 B;  3OYM A;  1Z3X A;  3I9Q A;  4ACK A;  2O88 A;  1JJ2 P;  2V5F A;  4GMR A;  2NSZ A;  4RTT A;  4N39 A;  1YJN T;  2ZCF B;  1WHK A;  2J6F A;  1QVF S;  5CQX A;  3DEO A;  4O6J A;  3CVL A;  1AWX A;  2EGE A;  3S7F A;  4I43 A;  3UT1 A;  1JXM A;  4HS2 A;  1E8X A;  3I3N A;  2R03 A;  1YJN A;  1FYN A;  1WPY A;  2KY9 A;  3PE0 A;  4OB0 B;  3V8L A;  3EDT B;  2NUT B;  2DXB A;  3JCM c;  2LSU A;  4WNE A;  5KYX B;  3FP3 A;  2XQ0 A;  1GFC A;  4UI9 K;  1BIA A;  3A98 A;  3I56 T;  4GZ6 A;  2QC9 A;  1UN9 A;  2DYS E;  3C5R A;  1PSF A;  2YNQ A;  4U07 A;  4V2S A;  5ENO D;  1O9S A;  3CVU A;  1W70 A;  1NZN A;  1QW1 A;  3EIJ A;  3JCM J;  3ASD A;  3ZXP A;  4GMJ A;  3DBS A;  1TUC A;  3KSQ A;  1WYX A;  4OB2 B;  1N6A A;  2VWF A;  2ZGW A;  1WHG A;  3QXE B;  2VSY A;  2FPE A;  4DI4 A;  3DXK G;  3ZYM A;  1G83 A;  3AG2 E;  5BNW A;  1VQ7 T;  3KAE A;  4XTX A;  4FT4 A;  4F04 B;  1UJY A;  4LDW A;  1NFI E;  1V54 E;  4E7I A;  4AFS C;  1PCX A;  4B8C B;  2JS0 A;  2K3X A;  3FUJ A;  3C95 A;  1JQQ A;  1YA0 A;  4XEI G;  2PUO B;  3TEE A;  2FZK B;  3V7R A;  4I6G A;  1TWB A;  2P2C P;  4AEZ C;  1RAE B;  2KRM A;  2O9S A;  2J4D A;  4FLB A;  5BW8 C;  3DB3 A;  3R6O A;  4JRK A;  5GMK l;  3JCM X;  1KD1 C;  3VS5 A;  2RB6 A;  1QMC A;  4J9C A;  4J9D A;  3AS8 A;  1SRL A;  4N0A C;  4X1V A;  3JB9 G;  4H7X A;  2OAU A;  2F0Y A;  2HM8 A;  2BKK B;  4PH4 B;  2L3R A;  4J83 A;  3L16 A;  5KCH A;  3NAW A;  1Y6I A;  4FCY A;  1DVP A;  1MUZ A;  2OCC E;  2QXF A;  1PWT A;  1B7T A;  2WSC E;  2JUF A;  2PM6 A;  4PFP A;  1M8V A;  5AIJ A;  2ZXW E;  3ESK A;  3LS8 A;  2K79 A;  2YWW A;  3HG0 D;  4C0F A;  3CCQ T;  5G04 C;  2LUH A;  2WXK A;  3I5P A;  5BV1 A;  1QCF A;  4P5N A;  3IHY A;  3M9Q A;  2CP0 A;  3MV3 B;  2V1Q A;  1VQ6 T;  5FWQ A;  3FJP A;  2DF6 A;  2ZU6 B;  3TWU A;  3UI2 A;  3QZ9 B;  5LJ5 e;  1KG1 A;  2C06 A;  2LNH B;  3T8K A;  2DL8 A;  2EBP A;  2P58 C;  4U04 A;  2DZC A;  3L54 A;  4CGW A;  3V2O A;  1GW6 A;  4I1O B;  2WQ7 A;  3FUH A;  3OMC A;  1YP5 A;  4LUN U;  1AZG B;  1D3B B;  3LJ3 A;  2WXI A;  2NWM A;  3GP8 A;  4GYY A;  1D0Y A;  3S2A A;  5ARF A;  1N4P A;  2RA2 A;  4IN3 B;  4JZ3 A;  4MZT A;  3MEK A;  1Z3Y A;  3QSU A;  3HXD A;  4XZ4 A;  4N5Q A;  1O75 A;  5CER B;  1KZP A;  3LH0 A;  1VQ5 A;  3CPF A;  3CCS Q;  1TS9 A;  1WI7 A;  2V8K A;  3FIF A;  4L9P A;  3FU6 A;  4AT1 B;  3PZ2 A;  4J8E A;  5HKP A;  2I6H A;  4B0Z A;  5C1D A;  3LH5 A;  1N8R U;  4DBH A;  1MMG A;  3PMT A;  2GF7 A;  4AY6 A;  3BU8 A;  2DO3 A;  3E9G A;  3FLG A;  3ULR B;  3IBE A;  4DX1 A;  2CS7 A;  4GZD A;  3VV0 A;  1WJQ A;  3ZN3 A;  2RNA A;  2UY1 B;  1YCS B;  5LJ3 j;  4JLG A;  4J8D A;  1PC0 A;  4NUR A;  2NXP A;  3AS4 A;  2Z0W A;  3SO8 A;  3CHQ A;  1D9S A;  5ENP D;  5CKE A;  2CZ7 B;  4YDY A;  1XNI A;  1X43 A;  4PLL A;  3DSW A;  4ILG A;  5G05 C;  2X6H A;  1C0M A;  2YRC A;  3L2R A;  3B7S A;  2R59 A;  2VSX E;  2DAQ A;  4QW2 A;  1GBR A;  2PTK A;  2E10 A;  3UA7 A;  2LTO A;  1RL2 A;  2KCK A;  3M53 A;  3A5Z B;  4KGX B;  4Z89 A;  4RTW A;  4ZHB A;  2X6K A;  1BI8 B;  3ESL A;  3LY7 A;  3HTR A;  2DYI A;  4IUV A;  1KHI A;  5LJ3 e;  1M1K U;  2HD0 A;  4FW1 A;  4J8O A;  4C92 F;  1YJ9 A;  3PFS A;  2O2O A;  1I1J A;  2DIL A;  4L23 A;  4XU2 A;  4Z88 A;  3L2V A;  4C92 E;  4MZP A;  4K5C A;  3T5X A;  3BY7 A;  3SBS A;  3QJ6 A;  2DZN A;  2QYZ A;  1YMP A;  5FWC A;  4M7A F;  1M3C A;  1NYF A;  4XI9 A;  1QWF A;  1WXT A;  4JRP A;  2DXU A;  3L2Z A;  4YTL A;  5CKD A;  4BE1 A;  1K8A U;  2F5T X;  3CCU Q;  1Y96 A;  3UT4 A;  2DXC A;  5EID A;  5IHK A;  1AWW A;  2WMN A;  3EG1 A;  3SFY A;  4HLE A;  3SWN A;  1VQ5 T;  5CCA A;  4BD3 A;  1YHQ A;  2KT8 A;  3NB2 A;  3V79 K;  2AZS A;  2LCC A;  2XS1 A;  2YUP A;  3H8Z A;  4HKE A;  3KEA A;  4ABN A;  4KUD K;  4GB9 A;  5KYY B;  4MS6 A;  2K5I A;  5FRN A;  4U0S A;  4GA0 A;  1ZU2 A;  2XD0 A;  4UUC A;  3I56 Q;  3PZD A;  3CXC A;  2K57 A;  3UM1 A;  2IY0 C;  3FDH A;  4ME7 A;  3JCM e;  3OYJ A;  1UHC A;  5LFA A;  2NLU A;  4RUG A;  5GAM f;  4PS7 A;  1U3C A;  3CHM A;  1QNF A;  4MBG A;  2IU1 A;  1H2T C;  2DFU A;  3ZFW A;  2LCL A;  4JW1 A;  2J05 A;  4DBF A;  1S70 B;  1JRI A;  3UT7 A;  1WFW A;  3PZ1 A;  4QT7 A;  2MRI A;  4ATZ D;  2WXP A;  1IGQ A;  2HE0 A;  3ENE A;  3PEV B;  2V4H C;  5CO7 A;  3FWV A;  2NUT A;  1EPU A;  1SA4 A;  4NQ0 A;  2XGM A;  4L59 A;  1OQK A;  1TJC A;  1OWO A;  2F8X K;  1Y0M A;  2EIL E;  4J7I A;  5LJ3 d;  1MGQ A;  2DER A;  3E1S A;  2H3E B;  3CCE A;  4N0A A;  1N0R A;  3C72 A;  1O1T A;  3FUL A;  4KYO B;  1YWP A;  2E64 A;  4FIB A;  3JCM g;  3G71 Q;  4B94 A;  1TU0 B;  3CXC P;  1VQP A;  3CHO A;  1YIJ T;  1MMD A;  3CPW A;  2EKO A;  4J8Y A;  5G55 A;  3T5V A;  2RMO A;  4Y92 A;  5C6S A;  2OTL Q;  5J3B A;  3FTV A;  1TEZ A;  2FVU A;  3DPD A;  3RBB B;  3VS0 A;  2OAW A;  4M78 F;  3CGH A;  4XTY A;  3JCK C;  4OGE A;  1EYH A;  1OCR E;  3QDF A;  2J07 A;  1SSH A;  5D6Y A;  1HO8 A;  3MJX A;  2DYB A;  3ZBD A;  4KVO A;  2GGR A;  4F7U G;  2OTJ A;  1GFD A;  1VOM A;  1X01 A;  3MP6 A;  2HQH A;  3TWQ A;  1OV3 A;  2ROL A;  4JDS A;  3P1U A;  2OTJ T;  3J7A F;  1AZE A;  4KT6 B;  2VGN A;  4JJB A;  3FUK A;  2HEQ A;  2P9N G;  1QWE A;  4ILH B;  2JN0 A;  1WG0 A;  4RSY A;  1LCK A;  3ZNG A;  4GCO A;  5EX0 A;  3ML9 A;  4GTS A;  3SFM A;  5KJM A;  2AIR B;  5BT1 A;  2EVR A;  4N3A A;  2KSS A;  5CVI A;  3KFV A;  1UEB A;  2ZAE A;  2FPF A;  2F8Y A;  3TWT A;  1OX8 A;  2LJ1 A;  2JAB A;  2KMT A;  3H0F A;  5GAN 4;  3AT1 B;  2B0O E;  3HXB A;  1D0Z A;  1HH8 A;  3O8V A;  5KE2 A;  2YRV A;  1UFF A;  5GMK m;  3IEG A;  1VQN A;  2MYS A;  2L9B A;  4JRI A;  1Z9Z A;  2GFA A;  5KH6 A;  3FUE A;  3RER A;  4P29 A;  3Q78 A;  3OS5 A;  2I2O A;  3R6N A;  4O6F A;  4M75 A;  2QA4 T;  3NOG D;  1MJ0 A;  5KYY A;  2M02 A;  4AG2 C;  3EG2 A;  3CCE T;  4U95 D;  3CQC B;  3H0I A;  1H6O A;  4I2Z A;  3CCM A;  4O5V A;  1WQW A;  2HDA A;  4KH1 B;  3PVL A;  1JWF A;  3CPW S;  4CYM D;  1WXB A;  1WHJ A;  2O31 A;  4JC8 A;  4BUG A;  5G2N A;  4U63 A;  3UKR G;  4FSS A;  1DJ7 B;  2R5M A;  3NF1 A;  4AXH A;  1YIJ Q;  5FQ8 A;  2RH2 A;  1QVG S;  3FUM A;  5GAM h;  1KQS P;  1XTD A;  5LJ5 j;  1FWZ A;  3P8H A;  5KBA A;  2ECZ A;  3NHN A;  1SKU B;  3HVE B;  2LAI A;  1LJO A;  1MHN A;  1M27 C;  1LD7 A;  5KCM A;  4M77 C;  4GA1 A;  3FH7 A;  4YDW A;  2EGA A;  1DNP A;  5GAM d;  3B7T A;  2WPV A;  1TG0 A;  5EN5 D;  2ED1 A;  4GPK A;  2IOS A;  3BFM A;  3VYH B;  4E7K A;  3CC2 Q;  2HKN A;  1M90 U;  2E6N A;  4PJO E;  4EHM A;  2DL3 A;  2WXM A;  1ZBX A;  3J5P A;  4JA7 A;  1IKN D;  3AU5 A;  3DWL G;  3ZGQ A;  3FU5 A;  3MKQ B;  1SRM A;  2WXO A;  2DYR E;  1HD3 A;  4GTR A;  3EH2 A;  4CGV A;  3FRN A;  2L6J A;  2PM7 A;  2AK5 A;  2BKG A;  4C8Q D;  3SWN C;  3C3R A;  3EU9 A;  4R0K A;  4JS5 A;  2CRE A;  4DJA A;  2FB7 A;  5D6X A;  1L5J A;  5EG2 A;  2LQW A;  2O4X A;  1S72 Q;  1Q82 U;  2P9S G;  2FG0 A;  3AU4 A;  5I21 A;  2J08 A;  3MP1 A;  1VIE A;  1H3H A;  1VQN T;  1MX2 A;  2GCX A;  2L0T B;  2I0N A;  2M63 A;  3N71 A;  3EAE A;  4A53 A;  4ZTF A;  1Y07 A;  1HXI A;  3QYH B;  4DK5 A;  1X81 A;  3FH5 A;  2E3I A;  3DSS A;  3SBT B;  4E6H A;  5IXF A;  3OMG A;  4A4K A;  5LJ5 h;  3DLL A;  3JB9 I;  4GU5 A;  3NOC D;  3JCM V;  3QKJ A;  2X51 A;  1IRX A;  2RHX A;  2A5E A;  2J7I A;  2J4B A;  2XPZ A;  5DIZ A;  3FY4 A;  2RK1 A;  3G7Z A;  4PS3 A;  5AYW D;  2MOW A;  1YFN A;  3OSV A;  4C0G A;  3ZHE A;  3MZL B;  3UIP C;  1NLP C;  3MPU B;  1WDX A;  3P2B A;  1RLP C;  1GCQ C;  3QUI A;  4XIF A;  4QVD A;  5CBO A;  4PFZ A;  4GTM A;  1G2B A;  1N54 A;  1D1B A;  2XMF A;  1ZSZ C;  4CZ2 D;  4W9R A;  4FAD A;  2COZ A;  2KEA A;  3BDL A;  3OYC A;  3VKI A;  2RFM A;  4O1P A;  5HK0 A;  3L22 A;  1U2V G;  4ZFH A;  4FYW B;  2JNG A;  3G2V A;  2EFI A;  1K73 C;  3FTU A;  4J9B A;  4I6J A;  2FBN A;  4IUL A;  1SVX A;  3CR3 A;  2JJ9 A;  3HFO A;  2O01 E;  1GL5 A;  3L6A A;  3LLR A;  2F1L A;  3JB9 J;  4A4F A;  3CC4 Q;  1ACM B;  4F1S A;  1R77 A;  3D9O A;  1N5Z A;  3QII A;  3APC A;  2LC4 A;  3QYG B;  4K0R A;  2LCS A;  3L9T A;  4XK8 E;  4E7H A;  3TSZ A;  3Q7A A;  3CCU T;  4X34 A;  3CMA Q;  4M78 C;  3KUF A;  2ABL A;  3CVW A;  2LX9 A;  3OQ5 A;  3CCU A;  1S1N A;  2X3X D;  3EH1 A;  4GLK A;  3LKU A;  2GRL A;  2K2M A;  5CRV A;  1VQ6 A;  1Y96 B;  4MDW A;  1BI0 A;  3APD A;  3JV3 A;  4C8Q B;  1JJ2 A;  2IG0 A;  3PS6 A;  2GQV A;  2DL5 A;  4EMH A;  5I11 A;  1MX6 A;  1S72 T;  3FEX A;  1NZ9 A;  2CH4 A;  2RN8 A;  1VQ9 A;  4AFU C;  3MEV A;  2QQR A;  2GTO A;  1D8D A;  3EG3 A;  4A4E A;  1IQR A;  1E8Z A;  3QNK A;  3VLF A;  2JW4 A;  5JA4 D;  2C0T A;  2FPD A;  2YT6 A;  4HXJ A;  3C3Q A;  4IUP A;  4RCC A;  3UPU A;  4M7D E;  5ANR A;  1ZUK A;  2DRK A;  2A28 A;  2A4Z A;  1YI2 T;  3MYV A;  4N3B A;  1AWC B;  2GNC A;  4KT0 E;  4TXR A;  2WB2 A;  3RK6 A;  3Q5M A;  4XE0 A;  4M78 D;  1YI2 A;  3ZU7 B;  3QAR A;  3M57 A;  2E0I A;  2KAF A;  2H6I A;  2H3J A;  3L13 A;  3CHP A;  3D3M A;  1J3T A;  2XRY A;  1VQO T;  4PJO B;  4CT4 A;  4RKU E;  2LRQ A;  2NUZ A;  4QQI A;  4J9F A;  4ORZ A;  5CK9 A;  3CME T;  4EBA G;  3JCM f;  1BU9 A;  1PNJ A;  4M7A E;  1DC2 A;  2K9G A;  3NTH A;  3G4S A;  3MJW A;  3LX7 A;  1PC2 A;  2YRD A;  4EPZ A;  4IIM A;  2D8J A;  2KM4 A;  2GGF A;  4L7T A;  1ZX6 A;  4C92 G;  4DUI A;  1VQ4 T;  1JWG A;  1VQM Q;  1KK7 A;  2ZPG B;  2VJ8 A;  5BV0 A;  2WQ6 A;  3OW2 S;  5GAN g;  1VQO Q;  3GZ1 A;  2ZIR A;  3S3N A;  3G71 A;  1K0X A;  3MEU A;  4L5G A;  4BY6 C;  1KSW A;  2QQA A;  2LXM A;  4G24 A;  4RG6 A;  1OPL A;  5HY6 A;  1RAC B;  5JHB A;  1H2U A;  3C4S A;  5ENN A;  3CCQ A;  1IHW A;  4TXP A;  4HCK A;  1C6V X;  2L5Q A;  3M4G A;  1Y71 A;  2KVQ G;  1VQ4 Q;  5HKC A;  1JJ2 S;  1R0C B;  2L0I A;  3TWR A;  2BTD A;  1UG1 A;  3OS0 A;  3QWW A;  4M4Z A;  1OCO E;  4G23 A;  2YUO A;  5FU6 B;  3KXT A;  1KFZ A;  2HO1 A;  2QYJ A;  4RQI A;  1QKW A;  1FVF A;  3CMA T;  4FUL A;  2RI2 A;  4KVM A;  1ZA2 B;  5FIN A;  4FT2 A;  1DCE A;  1FT1 A;  3I55 Q;  1YJ9 T;  3S3O A;  1N8R C;  2K4Y A;  1MV0 B;  3Q7F A;  3UUX A;  2RI3 A;  2IF4 A;  3UXG A;  1YBY A;  3C0C A;  4G25 A;  3FEO A;  2L3Q A;  3HHT B;  4LER A;  3RNJ A;  4AIF A;  3NMZ C;  2M1H A;  4PJO A;  2LP5 A;  4HXI A;  3S7B A;  1UJ0 A;  4N4I A;  5DLQ E;  1U8R A;  3OBW A;  1VQ8 A;  2XG8 D;  1QYM A;  3P8D A;  3D9L A;  3C12 A;  1BU1 A;  3EHN A;  4BTA A;  3IKO B;  4BSX A;  3EHR A;  1TUD A;  4LUD A;  3RIR A;  4UWL A;  4M7A D;  1RAB B;  3OYA A;  5KYW A;  5GAN f;  2DCP A;  4LRZ A;  3RKX A;  4WTO B;  5CAI A;  4DOW A;  1UGR B;  3OYH A;  1K8A C;  2LJ3 A;  2LT1 A;  4N2Q A;  5A6C A;  3QAQ A;  3CK8 A;  3MET A;  4R55 A;  4LSZ E;  5D0O D;  4AV7 A;  3JUE A;  3CHR A;  2GRR B;  2EGC A;  3L08 A;  2RHZ A;  2YUQ A;  3RDV A;  2ZZD A;  4HA8 A;  4BE2 A;  1ELR A;  3M4Y A;  3RO2 A;  4XU1 A;  4ATO A;  1OEB A;  3MV2 B;  2K6D A;  3DST A;  5JJT A;  3R9M A;  1T0H A;  2A08 A;  2RHI A;  2E5Q A;  3NZS A;  4D8D A;  3M0P A;  5GAM j;  4QQD A;  2FI7 A;  3ZUV B;  2J06 A;  4CDR A;  3TGO A;  3H9N A;  1FXX A;  5FZS A;  3CXC S;  4MKT A;  4NAC A;  4BY6 B;  1IHG A;  5ENR D;  2OTL T;  3FEY A;  3CV0 A;  3L1A A;  3CQG B;  3CVY A;  4OGC A;  3HVE A;  2H6F A;  2EIF A;  5J90 A;  4I2W A;  5JJ7 A;  1EDU A;  3LJN A;  4JPS A;  3QJZ A;  4JD2 G;  2F2V A;  4RCB A;  1MYO A;  4LEU A;  2CHW A;  5FU6 C;  2COY A;  2MCN A;  1N11 A;  3OYB A;  1UGS B;  3OYI A;  2IO3 C;  3CCV T;  5DLO A;  1VQK Q;  1VYV A;  1EX4 A;  2G6F X;  3BG1 B;  1UUE A;  2CUD A;  4NS5 A;  3SDZ A;  4M75 G;  3JXI A;  1RW2 A;  1MMA A;  3A8G B;  4HCB A;  1VQ8 T;  4BER A;  4CT0 A;  1KIK A;  2NC9 A;  2BZY A;  1C1A A;  2R05 A;  4LE9 A;  3B95 A;  4X8Q A;  2LJ0 A;  1KQ2 A;  3G2S A;  2QQ9 A;  2AZV A;  4GLM A;  1HJD A;  1LF8 A;  1O5M A;  3LDZ A;  1BPO A;  2XK0 A;  4U96 D;  5LJ3 g;  2RQU A;  3RKY A;  1Q82 C;  3UAT A;  3G1J A;  2OJ2 A;  1VQ5 Q;  4K5A B;  3HSB A;  2RFA A;  1OWN A;  2V0P A;  4IRU A;  1A0N B;  5GJW B;  3BEE A;  3UQ3 A;  5B3S E;  2VXF A;  4M77 B;  4R56 A;  4Y28 E;  4YVQ C;  3BQO A;  5FJY A;  1MV3 A;  5D2M C;  2DKG A;  3QWP A;  2GFU A;  1TSF A;  1HX8 A;  4HI9 A;  5GAO l;  2AXU A;  1YYH A;  2I9C A;  2VUB A;  3VU3 C;  4JVS A;  1TNU A;  3JB9 H;  4HOR A;  3CCR Q;  2LO6 A;  3HL8 A;  1VQ7 Q;  4G1T A;  3UWN A;  4KH0 B;  2QEX Q;  4M3O A;  4BT8 A;  2L89 A;  1YIT T;  4OML A;  1UB4 A;  2OTL A;  4C0M A;  4YND A;  1AVZ C;  2DIQ A;  1Q86 R;  4ILI A;  2K5L A;  4Y6W A;  3M0U A;  2K3B A;  4BY6 A;  4GTP A;  2RQV A;  2MHK A;  4FHJ A;  4XKB A;  3TL5 A;  2R5A A;  3RU0 A;  1PHT A;  3FDR A;  1OZ3 A;  4Y6C A;  2QTX A;  3EFR A;  4BB7 A;  4E7Z A;  5AJD A;  3RKV A;  3JXJ A;  1KT0 A;  3PTA A;  1H0A A;  5IN1 A;  4M7D D;  4AJW A;  7AT1 B;  3PRE A;  4YDO A;  1I0C A;  2KXD A;  2VYT A;  3GBQ A;  3TWW A;  3H41 A;  4MML A;  1WX6 A;  2EWN A;  4C5H A;  2V5Q C;  4U8Y D;  1T3S A;  2X6I A;  4DBR A;  3CCV Q;  3B13 A;  2XPI A;  2VKN A;  4PNO A;  4J9H A;  1PRL C;  5GAN e;  5DM7 R;  3ZIM A;  5FQ6 A;  1R8O B;  2PL2 A;  3FUD A;  2DL7 A;  2QK0 A;  1M2V A;  3DB4 A;  4OB1 B;  2KZT B;  1LVK A;  4LXC A;  3DSV A;  2WVI A;  3JCM Q;  2VB6 A;  5KE3 A;  4GTO A;  3KEZ A;  5CKF A;  4MLP A;  3QDN A;  1XNF A;  2IFU A;  3MX3 A;  1X6O A;  1HG5 A;  4RTZ A;  2P9L G;  2JTF A;  2CZ1 B;  3UA6 A;  1H64 1;  2YHC A;  1K4U S;  1XOV A;  2WXH A;  3SZ7 A;  4M75 B;  4PK4 A;  3VRZ A;  4C92 A;  3CHS A;  4ZN3 A;  1KT1 A;  2EKH A;  1RAH B;  3TSW A;  5JHA A;  1LPL A;  2QA4 Q;  1HXD A;  4MRU A;  2R57 A;  3T9N A;  4UWK A;  3SEM A;  1G3W A;  1M2V B;  3PIP A;  3UKU G;  2KC7 A;  3Q15 A;  1RI9 A;  5C2Y A;  2AXV A;  1VYT A;  5GAM e;  1JO8 A;  2M9U A;  2WXN A;  1QQJ A;  2K7A A;  1W2B S;  4J7F A;  4K11 A;  4M78 E;  2LQ8 A;  2RM4 A;  4M77 D;  5HI7 A;  4IKF A;  3RUX A;  2RF0 A;  2PVO B;  1TN7 A;  1SHF A;  2BUG A;  4DPR A;  2DK3 A;  4JHR A;  4ME2 A;  5L8R E;  4IUR A;  4LNU D;  1E8W A;  3G4S Q;  5C0M A;  1K1A A;  4BSZ B;  1X5B A;  2A5U A;  2X3M A;  1E7U A;  2GTJ A;  1UJJ A;  4DEY A;  2I1K A;  1VQM A;  1S0P A;  5ENT D;  2EIK E;  2R5S A;  2XU8 A;  2YDL A;  3NZU A;  1HE8 A;  2KAT A;  1SZA A;  4UQX A;  2L8D A;  5LX8 A;  4APF A;  2E2E A;  1FPP A;  2CYZ B;  4FSX A;  1GXI E;  2X3W D;  3ZL7 C;  2O9V A;  2X4X A;  1K1B A;  3CCQ Q;  4FU6 A;  4HQD A;  2P4T A;  5EYL A;  1N9R A;  3D9J A;  1IB8 A;  4L2Y A;  4HBD A;  3EHQ A;  1IHB A;  1Y7X A;  2DMO A;  1M1F A;  5KYU B;  3TG5 A;  1ZSG A;  4ANJ A;  4LG6 A;  4GTT A;  2OEV A;  3I35 A;  4Q5W A;  5LJ3 h;  3JYS A;  1UE9 A;  4N4H A;  5GAN 2;  4U0Z A;  4LN2 A;  1BCM A;  1NPP A;  3ASF A;  4FL6 A;  3FJ5 A;  3QPH A;  5AQ7 A;  2V1R A;  4C8Q G;  2OTJ Q;  3X2Q E;  2XCB A;  2RKK A;  2DZ9 A;  2JOY A;  2BUD A;  4I1M A;  5CIU A;  1VYU A;  3M55 A;  3UF4 A;  3S7J A;  1GCP A;  3V7S A;  2DRM A;  4JL0 A;  3I5R A;  1AT1 B;  3HRA A;  1K3Z D;  1NPR A;  4C0Z A;  3CCS T;  1PY1 A;  3UM0 A;  3LGF A;  2A3L A;  1CSK A;  4M78 G;  5G05 J;  2VGE A;  4UWH A;  1DCQ A;  2EYW A;  3TRE A;  1LD8 A;  2J6O A;  4E85 A; 
#chains in the Genus database with same CATH homology
 3T9K A;  1H3H A;  3VS1 A;  1MX2 A;  2HBW A;  3PVQ A;  2DBM A;  2XZD G;  2I0N A;  2XEE A;  2LQN A;  1ABQ A;  3EGU A;  3Q9U C;  2RPN A;  5IXF A;  1X2K A;  2DWZ A;  1X27 A;  5HCK A;  3NOC D;  1BI7 B;  4U8V D;  2JMA A;  2HSP A;  2GBQ A;  2KYM A;  2OI3 A;  2A5E A;  2ZGD A;  2J7I A;  4C48 B;  2DA9 A;  3UTM A;  2CH4 W;  2KR3 A;  4HVV A;  3V30 A;  2PNI A;  1K0S A;  2ZGG A;  2EYX A;  4EIK A;  1NLP C;  1WDX A;  2EQI A;  2ETB A;  5IXB A;  1VA7 A;  1RLP C;  1GCQ C;  1QKX A;  5CBO A;  1G2B A;  3Q9N C;  2JS2 A;  3DEP A;  2XMF A;  3TWV A;  3M0T A;  2XEN A;  4BEP A;  4CZ2 D;  3ZKJ A;  1G3N B;  3I5S A;  2KEA A;  3TWS A;  1T3L A;  1X2Q A;  2RFM A;  4O1P A;  5D66 A;  1IO6 A;  2SEM A;  4ZFH A;  1UEC A;  1NEG A;  1MX4 A;  5IHI A;  2L3S A;  4J9B A;  1V1C A;  1SVX A;  4CC3 A;  2NYJ A;  4HVW A;  1M30 A;  1N0Q A;  1GL5 A;  2DLP A;  4QFV A;  1EFN A;  3I9Q A;  2O88 A;  4GMR A;  1N5Z A;  2GQI A;  3M0S A;  4RTT A;  2LCS A;  1AWJ A;  2J6F A;  3TSZ A;  3DEO A;  1AWX A;  2EGE A;  1JXM A;  1SEM A;  2ABL A;  1FYN A;  2L0A A;  3PE0 A;  1S1N A;  2X3X D;  1T0J A;  2K2M A;  3VS7 A;  1GFC A;  2EW3 A;  2H8H A;  3A98 A;  3JV3 A;  5BXO A;  1CKB A;  2DE0 X;  2QC9 A;  1AOJ A;  3C5R A;  5I11 A;  2DL5 A;  1MX6 A;  5ENO D;  2CH4 A;  4BES A;  2RN8 A;  4AFU C;  1W70 A;  2CUB A;  2KYB A;  2GTO A;  3EG3 A;  2DJQ A;  1FMK A;  2KT1 A;  5GJV B;  2JW4 A;  4HXJ A;  2YT6 A;  1TUC A;  5JA4 D;  2C0T A;  2FPD A;  1WYX A;  4OMO A;  1NYG A;  2VWF A;  1ZUK A;  2DRK A;  2A28 A;  2JM8 A;  2FPE A;  1AWC B;  1GCQ A;  2GNC A;  1UGV A;  5KNG A;  5FW9 A;  1G83 A;  4JZ4 A;  3ZU7 B;  1Y57 A;  3V31 A;  1UJY A;  3VS2 A;  1NFI E;  5AQ9 A;  1H8K A;  1J3T A;  4AFS C;  3NBN B;  2KBX A;  5JMN D;  2NUZ A;  4QQI A;  2JS0 A;  4J9F A;  4ORZ A;  5EIL A;  2F2X A;  1BU9 A;  1JQQ A;  2KE9 A;  1PNJ A;  1DC2 A;  2K9G A;  2P2C P;  2KRM A;  2O9S A;  4CC7 A;  4DRX E;  4IIM A;  1RUW A;  3VS5 A;  2D8J A;  4J9C A;  4J9D A;  1ZX6 A;  2ETC A;  4DUI A;  5CEA A;  4OAV B;  2DL4 A;  4DX2 A;  1SRL A;  4X1V A;  1NEB A;  1K0X A;  2BKK B;  2KRS A;  3CQT A;  1KSW A;  3EG0 A;  1MUZ A;  1OPL A;  1PWT A;  1BLX B;  2CSI A;  4HCK A;  2YSQ A;  2K79 A;  3HG0 D;  3TWR A;  1UG1 A;  4M4Z A;  1QCF A;  2YUO A;  1OY3 D;  5AN8 A;  1KFZ A;  2QDL A;  2V1Q A;  2QYJ A;  5ITZ F;  1QKW A;  2FEI A;  4RTY A;  2SRC A;  2DF6 A;  3TWU A;  1UTI A;  3UI2 A;  2J8S D;  5AQB A;  1TR4 A;  5FIN A;  4HNA D;  3T8K A;  3IXE A;  4JB8 P;  2DL8 A;  2EBP A;  2LNH B;  1WA7 A;  2EYY A;  3REA B;  3V2O A;  1MV0 B;  2ENM A;  1YP5 A;  1AZG B;  2NWM A;  1UOH A;  2EPD A;  4HRM B;  3C0C A;  3UXG A;  2FO0 A;  4Z8A A;  3VS6 A;  2PNN A;  2L3Q A;  5AAR A;  3RNJ A;  4JZ3 A;  2KGT A;  3NMZ C;  1RLQ C;  2LP5 A;  4N5Q A;  1UJ0 A;  4F16 A;  1H92 A;  1BBZ A;  4B93 B;  5CER B;  1K9A A;  4DX6 D;  1QYM A;  4KRT A;  2DNU A;  1WXU A;  1BU1 A;  1ZLM A;  1E6H A;  4O60 A;  1WI7 A;  2BTT A;  3EHR A;  1TUD A;  3IQL A;  4LUD A;  5HKP A;  3LH5 A;  1I07 A;  2CT4 A;  4F14 A;  5AAO A;  2P4R A;  3ULR B;  5AQA A;  4DX1 A;  2LJ3 A;  4LSZ E;  4OAU C;  2ESW A;  4D8K A;  2RNA A;  3JUE A;  1YCS B;  2EGC A;  4AFQ C;  3QWY A;  3TWX A;  2YUQ A;  1UHF A;  3SO8 A;  1JEG A;  1X6G A;  1D9S A;  5ENP D;  2LX7 A;  4F17 A;  4YDY A;  2ED0 A;  1X43 A;  3VS3 A;  1OEB A;  1CKA A;  2DX1 A;  2K6D A;  1PKT A;  1T0H A;  2A08 A;  5ECA A;  1U5S A;  1JU5 C;  1GBR A;  4D8D A;  2PTK A;  3M0P A;  3UA7 A;  2JMC A;  1AWO A;  3ZUV B;  2J06 A;  4BET A;  2PZ1 A;  4Z89 A;  4RTW A;  4ZHB A;  2E5K A;  1U3O A;  1BI8 B;  2F2W A;  2RQR A;  5ENR D;  1WDY A;  2KXC A;  2M0Y A;  1HSQ A;  1YN8 A;  2IIM A;  4J9G A;  2O2O A;  1I1J A;  2DM1 A;  2DIL A;  2ETA A;  4Z88 A;  2CDT A;  3LJN A;  2F2V A;  2KBT A;  1OT8 A;  4K5C A;  2DZN A;  3F6Q A;  1YMP A;  1MYO A;  5FWC A;  5ENQ D;  1N11 A;  2MCN A;  1M3C A;  5L23 A;  1NYF A;  1WXT A;  1QWF A;  1VYV A;  2JT4 A;  2G6F X;  1UUE A;  2CUD A;  2MYO A;  4TUM A;  1IXV A;  5IHK A;  1AWW A;  5EID A;  3JXI A;  2L2P A;  2W10 A;  4BER A;  3EG1 A;  1KIK A;  2LMJ A;  2BZY A;  2KT8 A;  3V79 K;  4LE9 A;  3B95 A;  1NG2 A;  2AZS A;  2LJ0 A;  2YUP A;  3KEA A;  4WCI A;  2AZV A;  4GLM A;  1HJD A;  2W0Z A;  4HRN A;  3O5Z A;  2CSQ A;  4U96 D;  2EYZ A;  2RQU A;  4UUC A;  5CBN A;  2M51 A;  3UAT A;  4JPB W;  2LZ6 B;  2YUN A;  2OJ2 A;  1PRM C;  4K5A B;  2FRY A;  2RFA A;  5CED B;  2XEH A;  1UHC A;  1YWO A;  3NGP A;  4RUG A;  1ZUU A;  2C0O A;  1A0N B;  3AJI A;  5GJW B;  1GBQ A;  2D1X A;  2L3P A;  1MV3 A;  4E6R A;  3NPF A;  4HI9 A;  1PKS A;  2A36 A;  1E7O A;  2J05 A;  1YYH A;  3THK A;  1S70 B;  1WFW A;  1WIE A;  2Y1L E;  4QT7 A;  4RTX A;  4ATZ D;  1BD8 A;  2HE0 A;  2XZT G;  2V4H C;  4O1O A;  4G8K A;  1JXO A;  3REB B;  1SW6 A;  2KRN A;  3M0R A;  1QLY A;  4IIO A;  1YNZ A;  2F8X K;  2JXB A;  1Y0M A;  1M3B A;  4OML A;  4LNP A;  3QWX X;  4DX5 D;  1AVZ C;  1K1Z A;  2KXP C;  1N0R A;  2AJA A;  2AKK A;  1YWP A;  3M0U A;  2K3B A;  2FO1 E;  2RQV A;  4J9E A;  4J8Y A;  1PHT A;  2FRW A;  2RMO A;  4Y92 A;  4GBQ A;  1W6X A;  4DEX A;  2CT3 A;  5IH2 A;  2RQW A;  3JXJ A;  1A5E A;  3RBB B;  3VS0 A;  2OAW A;  1X69 A;  3AAA C;  1WLP B;  1I0C A;  2KXD A;  1ARK A;  1SSH A;  3GBQ A;  2J6O A;  4J7W A;  3TWW A;  3H41 A;  2DYB A;  1WX6 A;  2GGR A;  1X6B A;  3W9G A;  1T3S A;  2V5Q C;  4U8Y D;  1GFD A;  4F6R D;  2VVK A;  1NM7 A;  3TWQ A;  1OV3 A;  2ROL A;  1Z9Q A;  2VKN A;  2KNB B;  3VRY A;  2BZ8 A;  1PRL C;  1ZUY A;  4J9H A;  1SHG A;  2RQT A;  4LUE A;  4CC2 A;  5EYP F;  1AZE A;  4AG1 C;  2DL7 A;  3W9F A;  1AD5 A;  4JJC A;  4JJB A;  2HEQ A;  1QWE A;  2C0I A;  2KRO A;  1WG0 A;  4NIK A;  5FIO A;  4HI8 A;  1LCK A;  3ZNG A;  4JJD A;  4RTZ A;  3UA6 A;  1K4U S;  1XOV A;  4RTU A;  3VRZ A;  5HRY A;  3V2X A;  2EKH A;  4HB5 A;  3TSW A;  2EVR A;  3KFV A;  1ABO A;  2FPF A;  3TVT A;  2F8Y A;  3TWT A;  3SEM A;  2LJ1 A;  1U06 A;  3SHW A;  2JAB A;  1E6G A;  1RI9 A;  1VYT A;  3H0F A;  1JO8 A;  4ESR A;  2B0O E;  2A37 A;  2D8H A;  1UFF A;  2K7A A;  2D0N A;  4K11 A;  5ENS D;  1B07 A;  4GPM A;  4OMP A;  4CC4 B;  1Z9Z A;  1BK2 A;  2RF0 A;  3R6N A;  1SHF A;  3NOG D;  1MJ0 A;  4A63 B;  4AG2 C;  2JTE A;  2F37 A;  3EG2 A;  1BB9 A;  4U95 D;  4OMM A;  4LNU D;  4DX7 D;  3H0I A;  5I22 A;  1OOT A;  5BXU A;  1OPK A;  1K1A A;  4BSZ B;  2HDA A;  5CEC B;  3PVL A;  3U23 A;  4DEY A;  2GTJ A;  1AEY A;  4K5B A;  4CYM D;  1AP7 A;  1WXB A;  2O31 A;  4HLL A;  5ENT D;  5KWD A;  1ZBJ A;  2L6B A;  3D9H A;  4FSS A;  2YDL A;  1K76 A;  5KNH D;  4OMQ A;  2MIO A;  5KBA A;  2ECZ A;  3H0H A;  3B7B A;  2X3W D;  3NHN A;  1W1F A;  2O9V A;  1K1B A;  1GRI A;  3ZL7 C;  4HQD A;  1M27 C;  5FWB A;  1KJW A;  5EYL A;  2AKL A;  4YDW A;  4HBD A;  4RLY A;  2EGA A;  3EHQ A;  3VS4 A;  1IHB A;  5HS0 A;  2DMO A;  2DVW A;  1TG0 A;  5EN5 D;  1ZSG A;  1M8M A;  1NLO C;  2ED1 A;  4LG6 A;  3I35 A;  2BZX A;  2Y0B G;  1SPK A;  1UE9 A;  2MOX A;  4LN2 A;  2DL3 A;  4G8L A;  4RTV A;  2J6K A;  4OMN A;  3FJ5 A;  4ZNX A;  5AQ7 A;  2V1R A;  5EIB E;  1B3Q A;  3J5P A;  1IKN D;  1SRM A;  3M0Q A;  4Z68 A;  4F1P A;  1HD3 A;  1VYU A;  2JM9 A;  3UF4 A;  4HRL A;  2BKG A;  1GCP A;  2AK5 A;  2DVJ A;  2DRM A;  2DBK A;  3EU9 A;  3I5R A;  5EC7 A;  3HRA A;  4R0K A;  1K3Z D;  1M3A A;  2CRE A;  2ROT A;  2B86 A;  2HCK A;  5IHN A;  4HVU A;  4J9I A;  2LQW A;  2DZO A;  1CSK A;  2VGE A;  4AFZ C;  1DCQ A;  2EYW A;  2FG0 A;  3J5Q B;  1UDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...