2OCCE

Bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 41
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 1998-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 2occE00
2ZXWE 3AG1E 2OCCE 2DYRE 3ASNE 3X2QE 3ABKE 5B1BE 5IY5E 3AG2E 3ASOE 1OCRE 3AG3E 1V54E 3ABLE 3ABME 1OCOE 5B1AE 2Y69E 3AG4E 5B3SE 1OCCE 2EIJE 2EIME 2EILE 2EINE 1OCZE 3WG7E 2EIKE 2DYSE 1V55E
chains in the Genus database with same CATH superfamily
4AIFA 1EPUA 2FO1E 4GTQA 2ETBA 3S7JA 3PEUB 2M63A 3PE4A 1HXIA 2H6GA 3HXFA 2WPVA 1OWNA 3ZKJA 3MKQA 3SFZA 2AXZA 4N3BA 4G1TA 5JJTA 3AU5A 3CSFA 1FT2A 3HHMA 1TJCA 2XEEA 2BUGA 3CVWA 4N3CA 2R2LA 3VLDA 2AJAA 1OY3D 4GTOA 3MKRA 2PL2A 3HVEB 2LAHA 3ZNGA 1IXVA 3ZYQA 3RU0A 3ZVVA 1DCEA 3SBTB 3S7FA 3PVLA 2VYIA 2KCKA 4K5BA 3NF1A 4H7XA 1AP7A 2AVPA 4WNFA 4CEMA 3NBNB 4FA6A 3FDHA 3QWWA 5AYWD 3RRMB 3HXEA 1H19A 2B6CA 1TNZA 1N0RA 4WWNA 2WXLA 2DCPA 3CSTA 3ULQA 3KAEA 3Q73A 2HYZA 3U64A 1EF1C 3FTSA 2BKKB 4G8KA 3ZW3A 4J8DA 2IF4A 2IEJA 4GTVA 3EJNA 1OWLA 4XI9A 4HRLA 1LTXA 3JCKC 4HRNA 1QQEA 4UWLA 4HVBA 2J4BA 4LNUD 1HX8A 4MBGA 4G26A 2XGSA 4J7WA 2CG3A 4ILGA 3EU9A 1JCRA 5CCLA 4BSZB 3KEAA 4MLPA 3OTNA 3PUKA 4HOUA 5KNGA 1V55E 3LY7A 2V5FA 3SI5A 2X6JA 1HO8A 1ELWA 2P58C 4Z68A 3LYAA 4BEPA 4B93B 2UY1A 3FHEA 1MX4A 1QBQA 4GTSA 3SO8A 3G2WA 3ZXPA 1BPOA 2CFUA 3APDA 4HLLA 4HOSA 2LXMA 3TWXA 1HG2A 5FQ6A 2YHEA 3RKVA 1BI8B 3S7BA 3ZRHA 2P9NG 4N2SA 3UMVA 4QQIA 3CHOA 1YCSB 3U3WA 4Q69A 4BFRA 4KBQA 4DX5D 4PS8A 2QC9A 3JUIA 4KXKB 4GMJA 4U0SA 1IQRA 3BG0B 2PZIA 2C0LA 4GTTA 4GPMA 4L23A 3U4TA 4KMOA 3QARA 2YINA 4ATGA 1MX6A 4CGVA 2WXHA 2QYJA 5LOZA 5G2NA 2PNNA 1TNUA 3DBSA 2KZTA 2BF0X 2YNQA 3FU5A 1TJFA 5AQAA 2J07A 4XEIG 2WMOA 4P29A 3AAAC 2OEVA 1KT1A 1H6PA 1TN6A 3ASFA 2KATA 3D9LA 3BU8A 4TUUA 3BQOA 3R9AB 1UN8A 3V31A 3SNXA 3FUEA 4U95D 5BT1A 4NIKA 4AVXA 4GZ3A 3U9WA 4UQYA 3UUXA 2OOEA 4O1OA 2I1JA 3WXXA 2I1KA 5FIOA 4U63A 4HI9A 1O1TA 4ILIA 2MHKA 2GROB 2PQNA 5ARFA 4GYWA 4WNDA 3FEXA 5FZSA 1SZ9A 5FZQA 1QNFA 3CLJA 2FO7A 4K03A 3FTWA 3ML8A 2ZGDA 2IOLA 1OUVA 1X5BA 1H6KA 4GPKA 3DSTA 2L0IA 3ASHA 3EDTB 4XKBA 5AQBA 2VSYA 5T4YA 4CGWA 3D9IA 2F8XK 4BSXA 3PZ1A 4JZYA 1PC2A 3MGBA 2IOSA 5BV1A 4U8HA 5EILA 2I9CA 3MJWA 4J6IA 1KT0A 4HORA 3MA5A 4ANVA 4BY6A 3ZXSA 2C2LA 4APOA 3FU6A 3HG0D 3ZYLA 2MRIA 2F8YA 4EZKA 2BEDA 5DIZA 2OCCE 3PREA 3CIAA 3TJPA 2HR2A 1RW2A 2XGOA 3FU3A 3ISMC 3PZDA 3CQGB 1GW6A 2EIME 3PNTB 4F7AA 3DSWA 2CHXA 2JABA 4F1PA 3UKUG 2F37A 3S2AA 4XKCA 2GRPB 2XCCA 2R59A 5CRVA 2RD0A 4OAVB 3CHSA 3UT4A 1NP7A 3IKOB 3NQPA 1FCHA 2AXUA 4KT6B 1X81A 2GRRB 4WWOA 4GYOA 3DWLG 3SGHA 1OT8A 3O4ZA 3LJNA 1KZOA 4MS6A 2XGMA 3ZUVB 3Q49B 4Q96A 5ENOD 3TWWA 3D3MA 3FH5A 2XPIA 4QFVA 5A6CA 2R03A 2QFCA 1N11A 2FULA 5ITZF 3GZ2A 3MCXA 3Q15A 4J8YA 3CVXA 3G2SA 2DYSE 4F53A 5JJ6A 3DRAA 4I2WA 1LF8A 4I9CA 3MYVA 1UJKA 4K0RA 1HE8A 2IJGX 3HDXA 5CMWA 4EECA 5G05C 2EIKE 3EU5A 2I2OA 3ONLA 4BWRA 4WUYA 2VJ8A 2XRYA 5D66A 4O1PA 2P9LG 4ACLA 3ASGA 4L2LA 4DI3A 1O1RA 3HIZA 5B3SE 3Q4AB 3CEQA 5FZRA 2EINE 1NL4A 2KXPC 2WVIA 1YA0A 4JB8P 2IFUA 4GAAA 5CECB 3JYSA 3T9KA 3F6QA 4MRUA 1O1SA 2AWIA 1HH8A 2WXGA 5C2YA 4DX1A 4L1BA 4PDXA 4HRMB 1N0QA 1YMPA 4OAUC 4HB5A 3C5RA 3DSVA 2HE0A 4PUCA 3TXNA 3LVQE 5AQ9A 3OAWA 5FTPA 4DRXE 4WWPA 5EYPF 5AENA 3ZIMA 4HXIA 4EBAA 3KSLA 3UI2A 3Q79A 5ENTD 2A4ZA 4DX6D 3RSEG 4JPSA 4JXTA 1TNBA 1N9AA 4C48B 4J8SA 2OEWA 4GZ5A 3SBSA 3L82A 1H0AA 2X6IA 1OXJA 5CCMA 2VGXA 5BPPA 2X6HA 3FTXA 5KNHD 2KCVA 4C9BB 1XGWA 4NACA 1BD8A 1H2TC 4I9EA 3IV0A 3TGOA 4UWHA 3D9MA 2X6KA 3EHNA 4IYPA 3W9FA 4AXHA 1FT1A 4A55A 4G24A 3U66A 1SVXA 4DX2A 3FTYA 3CHMA 3I3NA 4EQFA 3FY4A 4DPRA 3AG3E 3RIBA 3OXGA 2NXPA 2L9BA 3TWTA 5CEAA 3NOCD 3UTMA 1HFAA 5FWQA 3FTUA 4AJWA 2WXJA 1Y8MA 4DLOA 2X3MA 4I2ZA 4FHKA 5EN5D 4J8EA 2AXVA 3UT7A 1JUQA 2LNIA 4U04A 3CHQA 4JA9A 3MV2B 3T5VA 1W3BA 3RO2A 3TXMA 5KBAA 3UM1A 2LAIA 1D8DA 4BETA 2Q7FA 3C72A 2WQ6A 2CFZA 2UY1B 3ONKA 1SQMA 3HVEA 2EIJE 1SW6A 4CT4A 3QOUA 4YDYA 4LSZE 4TUMA 4JW1A 2DWZA 1Z5SC 4FU3A 3I4GA 5HS0A 4N3AA 4WNGA 3KSQA 4I17A 4K5AB 4XIFA 5KWDA 1KPSB 4HI8A 2J49A 4HOTA 4G23A 2LO6A 1TR4A 4FULA 4ANXA 1K1BA 2GGFA 3E37A 3E34A 3IEGA 1FVHA 3AU4A 2ZIRA 3W9GA 1E8WA 2WXOA 1U3DA 2H6HA 4AM9A 2KBXA 4A1SA 3UM3A 2QZAA 2DBAA 4A1GA 3HXCA 5G04C 3E33A 3LY9A 2ONDA 2JLBA 1MYOA 1MX2A 3UQ3A 1NA3A 1E8ZA 5ARGA 3QKYA 1IKND 4UWKA 5ENNA 3ESKA 3ZGQA 5AIJA 4LUNU 3FH7A 3Q7FA 4A3VA 3IXEA 5BXOA 4B8AA 1H2UA 1JCSA 5LFAA 2Y4TA 1HS6A 3D9HA 5T8IA 4DUIA 2FEZA 5HKPA 3C3RA 4PS7A 3LEWA 2GRQB 3ZYKA 4KYOB 4G8LA 1V54E 3FUJA 2NYJA 3UT8A 3D9JA 4N5QA 2OVFA 5AJLA 1VDYA 4FJYA 4F1SA 2UWJG 4ABNA 4TRQA 3ASOE 1N54A 4B89A 5C1DA 1UN9A 3IBEA 4LRZA 3SHFA 4LNGA 1D9SA 4DJAA 1TN7A 3T5XA 3TWSA 4UWFA 3ZFWA 2P9UG 4GCOA 3QJZA 4A63B 4FP7A 3DSSA 4NQ0A 5EIDA 3FUIA 4UUCA 4IULA 3PZ4A 1OCCE 3LKUA 1FPPA 1U2VG 3B7BA 4JHKA 3VTYA 3FH8A 2VSXE 3CVYA 1IQUA 2RG8A 5BNWA 4M3OA 1Z3YA 3ABKE 3C98A 5EDSA 3VTXA 2V4HC 2VSNA 3QDNA 3UM0A 3ML9A 1EYHA 3CVVA 4ATZD 3RK6A 3PNLB 4DI4A 2XPYA 4GMRA 3OXFA 3WG7E 3PH0C 1E8XA 3ESLA 4LERA 3CKCA 4CRWA 3S7DA 3Q47B 1UJJA 2B0OE 2WQHA 4CDNA 3I5PA 4XZ4A 1S64A 3P1UA 5LP0A 3CKBA 1G3NB 1TNYA 2EQXA 2NC9A 3G2VA 3Q9NC 3DEPA 4ANWA 3QC1A 2IU1A 4G25A 2FI7A 2CHZA 4ZFHA 2QYUA 4OVVA 1ELKA 4LCTA 4BX9A 2XEVA 3FTZA 4K5CA 1INZA 5B1AE 5AARA 4CDRA 3C3OA 3ULYA 4JEHA 3CGHA 5A7DB 4KVMA 4N5CA 4H7YA 3P2BA 4HQDA 3EHMA 4NRHB 1RZ4A 4UI9C 3SZ7A 4F6RD 3R7QA 2H6IA 3B7SA 3KS2A 1UG3A 5ANRA 2IQCA 5ENRD 3CVLA 2VGYA 3DXMG 3FTVA 2J4DA 5IY5E 2HO1A 2ILRA 2Y3AA 4GZDA 2WXFA 5AAOA 2GRNB 1A5EA 4WAFA 3ZHEB 4FLBA 1ZB1A 2XS8A 3EHQA 4B94A 1N94A 3LY8A 2NSZA 3SFXA 5J90A 4BTBA 1JCQA 3T8MA 4HFGA 3VLFA 1SA4A 5JHBA 2F0YA 2R5SA 3JQ1A 3LDZA 5HQ8A 5EIBE 5G05J 3HXDA 3NB2A 1L5JA 1WG0A 3FUKA 4BT8A 1MJ0A 3FFLA 3UX4A 5LCWC 4BESA 2XZTG 4TXQA 1ELRA 3UPVA 3G2TA 2GW1A 3AJIA 2AW6A 4U0ZA 3B13A 4E6HA 2XS1A 5T3RA 3PS6A 3LPZA 2Y0BG 4JC8A 4BT9A 5CHEE 3CHPA 1MHQA 3B7UX 4L7TA 3FU0A 5JHAA 4I43A 3B7RL 5HRYA 4DK5A 4GA2A 3MKQB 3AG1E 3EUVA 1Z3XA 5EX3A 3ZYMA 4M7CA 4UQXA 4URKA 3DSUA 3CHRA 3R7RA 3UKRG 5CBNA 1TNOA 2GRMA 2R02A 3MZLB 2R17C 5A23A 4JHRA 2WXKA 2ZGGA 4J0UA 3N71A 1H6OA 3X2QE 2RFMA 2QY7A 2VTBA 1H2VC 5LX8A 5CEDB 3UIOC 3AS8A 3OXLA 4GZCA 4EPZA 3LJ3A 3VLEA 2H6FA 4JL0A 3L13A 3BEEA 1Y6IA 3FP3A 4GTPA 3HXBA 3NZSA 3SF4A 4G2VA 3Q7AA 2X6FA 3ABME 3BG1B 3I4RB 1NFIE 3ZEFA 4I6EA 4N39A 3FULA 3SFYA 5FQ7A 5CMYA 4A3TA 2P9PG 1UOHA 1BLXB 3Q5MA 3FWVA 3FUNA 2DYRE 5J08A 2V0PA 3NZUA 1TEZA 4BX8A 1MZCA 4HNAD 5KJNA 4HBDA 1HU3A 4DLQA 2LSUA 1MQSA 3GZSA 4BERA 3PRZA 3QAQA 1OWPA 1HZ4A 4CZ2D 4YDEA 4GYYA 4RG6A 4R7LA 3V79K 4ZHBA 2E0IA 4BTAA 3GZ1A 4PH4B 4UI9K 2XCBA 5E75A 1S63A 4RVBA 3HRAA 2J08A 2LXLA 4I1OB 3PE3A 4FLHA 5CRUA 2VGEA 3NAWA 4I1AA 3PUJA 3MV3B 4RQIA 3PZ2A 2IY0C 1TN8A 2WM9A 2ZISA 3V30A 2CG2A 2P9IG 3B7TA 3TWRA 4JA7A 3Q78A 4Q94A 1HF8A 3FUHA 2XQ0A 4UQZA 3L6AA 2LUHA 4RLYA 1DNPA 4YNDA 4APFA 1SA5A 4GB9A 3DPYA 1SZAA 1IHBA 2A5EA 2MYOA 3SQVA 4XI0A 4ANUA 4ME2A 4AEZC 4HLEA 2KCLA 2CHWA 5D2MC 3JXIA 4DX7D 2Y69E 2KM4A 5G04J 3FUDA 3SY2A 4GTMA 4HOQA 3TG4A 3AG2E 1YYHA 3JXJA 2Y4UA 3B95A 1JWFA 1K1AA 4EBAG 4GCNA 3C3QA 3FUFA 3EIQC 1FVFA 1E96B 4TXPA 2C0MA 3TAXA 3CVUA 3L9TA 2PQRA 3TL5A 1E8YA 4KZ0A 3EHRA 4V3IA 3QNKA 4KVOA 2KZTB 3CV0A 5ENSD 5G55A 4HS2A 4O6FA 1JWGA 1ZBPA 2L6JA 3L17A 2YHCA 3LCAA 3PEVB 1NZNA 1Q2ZA 4W9RA 4O60A 2HM8A 1KZPA 4I6JA 4FJZA 1QZ2A 2P9SG 4CYMD 3D9OA 3TG5A 4XE0A 3UINC 2IO3C 2WB2A 3QB2A 4GA1A 3CK9A 1PAQA 3APFA 3TWVA 4L2YA 4U8YD 5EX0A 4YDWA 4PS3A 2L6BA 1DCQA 3CK8A 5JMND 4FHJA 1S70B 3L22A 3SD5A 5BV0A 2YQ8A 3ASDA 3JQ0A 1UW4B 3CR3A 3E4BA 5FT9A 5JJ7A 2R05A 5JA4D 2V5QC 3DPDA 3CVPA 5ENPD 2BTDA 4IN3B 4XX5A 3CVQA 2LSVA 4TXRA 3TWUA 1N4QA 5BUZA 2OV8A 3CK7A 5HI7A 2EILE 2ZU6B 4U7EB 4LNBA 5KJMA 2JEKA 2P9KG 3ZPJA 5FQ4A 1EDUA 2ETCA 3FEYA 2PM6A 3RAUA 4AY5A 4AV7A 4FC8A 1DVPA 2J9QA 3D9NA 3T8KA 2ETAA 2XEHA 3QWPA 2WXRA 4IRUA 2WXMA 1PY1A 1N52A 3IHVA 5CBOA 3QWVA 3AS4A 2E2EA 1K3ZD 3UXGA 3ZN3A 1ZU2A 3O48A 3PZ3A 5AQ7A 1P5QA 2RFAA 5EKQD 4OYSA 1U3CA 2XRZA 3URZA 3AG4E 4WNEA 2WQ7A 4FADA 2PM7A 2V4LA 2MOWA 4YVOA 4EZLA 2P2CP 2XPZA 1IHGA 3Q75A 3ASNE 3ULEG 2DVWA 1QYMA 3GYZA 3NOGD 3FUMA 1WM5A 4CDMA 3LVRE 4UI9J 3AS5A 4JHJA 3ZU7B 2WXPA 4ACKA 4X8QA 4RG9A 3V2XA 2BKGA 4JVSA 3BUAA 4AP2A 3DSXA 2Y1LE 2WXNA 3R9MA 2DIWA 1DC2A 1LD7A 3CVNA 3RO3A 1BU9A 2FF4A 5DBKA 5FJYA 4B0ZA 2XENA 4J8FA 3TWQA 3L08A 3V2OA 4CCAA 4G11A 4Y6WA 2FBNA 1E7UA 1K8KG 4I6GA 5D0QD 2DZOA 5BW8C 1AWCB 3DXKG 4I1MA 2VQ2A 2DZNA 4GZ6A 4F3VA 5KCMA 1N95A 1D8EA 4N2QA 1OWMA 3EIJA 1NI1A 3D9KA 4OVUA 2XHEA 4GU5A 3ABLE 1XNFA 5LCWJ 4GMLA 1KLXA 4C0EA 3E32A 3MEKA 2V8SE 4AY6A 4RSYA 2A5UA 4U8VD 4EHMA 4YDOA 1A17A 1Z6TA 1WAO1 4MKTA 2J8SD 4C0MA 4CT0A 3ENEA 4JD2G 5KJKA 2L0TB 1B89A 4GTRA 3L16A 3JUEA 1OCOE 5ANLA 5H7PA 5BXUA 4TV3A 2KC7A 1E7VA 1JPLA 3DEOA 3RRNB 3RRUA 3D9PA 2OVBA 4KZCA 5AJDA 1WDYA 2WMNA 1BI7B 3L54A 1S0PA 1HG5A 2XZDG 3G2UA 2IO2C 5B1BE 4E85A 3KEZA 3GW4A 2I6HA 1OCRE 2IONA 4U07A 2VTBB 3LXUX 3APCA 1LD8A 1WY6A 3ZHEA 1TYQG 3J5PA 3MX3A 1N4PA 5CERB 4U0UA 3IHYA 4ILHB 3Q9UC 3E30A 5FINA 3UIPC 3LS8A 2ZXWE 3CQCB 4AOFA 1N4RA 3RJVA 3PDNA 5AN8A 1N4SA 2WXIA 2VGXB 4U96D 5ENQD 2VSOE 4NURA 4JEUA 4UWGA 1OWOA 3J5QB 3K9IA 4GA0A 5D0OD 3UM2A 4Y6CA 2RKKA 4YVQC 2J09A 1NA0A 2X38A 5E76A 1E90A 3KD7A 4LG6A 4B8CB 5M72A 5EYLA 4D10C 3HYMB 5FQ8A 4LEUA 4L9PA 1IYGA 2GRLA 5KJLA 1OCZE 1O5MA 4EZJA 2WXQA 3QK0A
chains in the Genus database with same CATH topology
2ZXWE 3AG1E 2OCCE 2DYRE 3ASNE 3X2QE 3ABKE 5B1BE 5IY5E 3AG2E 3ASOE 1OCRE 3AG3E 1V54E 3ABLE 3ABME 1OCOE 5B1AE 2Y69E 3AG4E 5B3SE 1OCCE 2EIJE 2EIME 2EILE 2EINE 1OCZE 3WG7E 2EIKE 2DYSE 1V55E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZXW E;  3AG1 E;  2OCC E;  2DYR E;  3ASN E;  3X2Q E;  3ABK E;  5B1B E;  5IY5 E;  3AG2 E;  3ASO E;  1OCR E;  3AG3 E;  1V54 E;  3ABL E;  3ABM E;  1OCO E;  5B1A E;  2Y69 E;  3AG4 E;  5B3S E;  1OCC E;  2EIJ E;  2EIM E;  2EIL E;  2EIN E;  1OCZ E;  3WG7 E;  2EIK E;  2DYS E;  1V55 E; 
#chains in the Genus database with same CATH topology
 4AIF A;  1EPU A;  2FO1 E;  4GTQ A;  2ETB A;  3S7J A;  3PEU B;  2M63 A;  3PE4 A;  1HXI A;  2H6G A;  3HXF A;  2WPV A;  1OWN A;  3ZKJ A;  3MKQ A;  3SFZ A;  2AXZ A;  4N3B A;  4G1T A;  5JJT A;  3AU5 A;  3CSF A;  1FT2 A;  3HHM A;  1TJC A;  2XEE A;  2BUG A;  3CVW A;  4N3C A;  2R2L A;  3VLD A;  2AJA A;  1OY3 D;  4GTO A;  3MKR A;  2PL2 A;  3HVE B;  2LAH A;  3ZNG A;  1IXV A;  3ZYQ A;  3RU0 A;  3ZVV A;  1DCE A;  3SBT B;  3S7F A;  3PVL A;  2VYI A;  2KCK A;  4K5B A;  3NF1 A;  4H7X A;  1AP7 A;  2AVP A;  4WNF A;  4CEM A;  3NBN B;  4FA6 A;  3FDH A;  3QWW A;  5AYW D;  3RRM B;  3HXE A;  1H19 A;  2B6C A;  1TNZ A;  1N0R A;  4WWN A;  2WXL A;  2DCP A;  3CST A;  3ULQ A;  3KAE A;  3Q73 A;  2HYZ A;  3U64 A;  1EF1 C;  3FTS A;  2BKK B;  4G8K A;  3ZW3 A;  4J8D A;  2IF4 A;  2IEJ A;  4GTV A;  3EJN A;  1OWL A;  4XI9 A;  4HRL A;  1LTX A;  3JCK C;  4HRN A;  1QQE A;  4UWL A;  4HVB A;  2J4B A;  4LNU D;  1HX8 A;  4MBG A;  4G26 A;  2XGS A;  4J7W A;  2CG3 A;  4ILG A;  3EU9 A;  1JCR A;  5CCL A;  4BSZ B;  3KEA A;  4MLP A;  3OTN A;  3PUK A;  4HOU A;  5KNG A;  1V55 E;  3LY7 A;  2V5F A;  3SI5 A;  2X6J A;  1HO8 A;  1ELW A;  2P58 C;  4Z68 A;  3LYA A;  4BEP A;  4B93 B;  2UY1 A;  3FHE A;  1MX4 A;  1QBQ A;  4GTS A;  3SO8 A;  3G2W A;  3ZXP A;  1BPO A;  2CFU A;  3APD A;  4HLL A;  4HOS A;  2LXM A;  3TWX A;  1HG2 A;  5FQ6 A;  2YHE A;  3RKV A;  1BI8 B;  3S7B A;  3ZRH A;  2P9N G;  4N2S A;  3UMV A;  4QQI A;  3CHO A;  1YCS B;  3U3W A;  4Q69 A;  4BFR A;  4KBQ A;  4DX5 D;  4PS8 A;  2QC9 A;  3JUI A;  4KXK B;  4GMJ A;  4U0S A;  1IQR A;  3BG0 B;  2PZI A;  2C0L A;  4GTT A;  4GPM A;  4L23 A;  3U4T A;  4KMO A;  3QAR A;  2YIN A;  4ATG A;  1MX6 A;  4CGV A;  2WXH A;  2QYJ A;  5LOZ A;  5G2N A;  2PNN A;  1TNU A;  3DBS A;  2KZT A;  2BF0 X;  2YNQ A;  3FU5 A;  1TJF A;  5AQA A;  2J07 A;  4XEI G;  2WMO A;  4P29 A;  3AAA C;  2OEV A;  1KT1 A;  1H6P A;  1TN6 A;  3ASF A;  2KAT A;  3D9L A;  3BU8 A;  4TUU A;  3BQO A;  3R9A B;  1UN8 A;  3V31 A;  3SNX A;  3FUE A;  4U95 D;  5BT1 A;  4NIK A;  4AVX A;  4GZ3 A;  3U9W A;  4UQY A;  3UUX A;  2OOE A;  4O1O A;  2I1J A;  3WXX A;  2I1K A;  5FIO A;  4U63 A;  4HI9 A;  1O1T A;  4ILI A;  2MHK A;  2GRO B;  2PQN A;  5ARF A;  4GYW A;  4WND A;  3FEX A;  5FZS A;  1SZ9 A;  5FZQ A;  1QNF A;  3CLJ A;  2FO7 A;  4K03 A;  3FTW A;  3ML8 A;  2ZGD A;  2IOL A;  1OUV A;  1X5B A;  1H6K A;  4GPK A;  3DST A;  2L0I A;  3ASH A;  3EDT B;  4XKB A;  5AQB A;  2VSY A;  5T4Y A;  4CGW A;  3D9I A;  2F8X K;  4BSX A;  3PZ1 A;  4JZY A;  1PC2 A;  3MGB A;  2IOS A;  5BV1 A;  4U8H A;  5EIL A;  2I9C A;  3MJW A;  4J6I A;  1KT0 A;  4HOR A;  3MA5 A;  4ANV A;  4BY6 A;  3ZXS A;  2C2L A;  4APO A;  3FU6 A;  3HG0 D;  3ZYL A;  2MRI A;  2F8Y A;  4EZK A;  2BED A;  5DIZ A;  2OCC E;  3PRE A;  3CIA A;  3TJP A;  2HR2 A;  1RW2 A;  2XGO A;  3FU3 A;  3ISM C;  3PZD A;  3CQG B;  1GW6 A;  2EIM E;  3PNT B;  4F7A A;  3DSW A;  2CHX A;  2JAB A;  4F1P A;  3UKU G;  2F37 A;  3S2A A;  4XKC A;  2GRP B;  2XCC A;  2R59 A;  5CRV A;  2RD0 A;  4OAV B;  3CHS A;  3UT4 A;  1NP7 A;  3IKO B;  3NQP A;  1FCH A;  2AXU A;  4KT6 B;  1X81 A;  2GRR B;  4WWO A;  4GYO A;  3DWL G;  3SGH A;  1OT8 A;  3O4Z A;  3LJN A;  1KZO A;  4MS6 A;  2XGM A;  3ZUV B;  3Q49 B;  4Q96 A;  5ENO D;  3TWW A;  3D3M A;  3FH5 A;  2XPI A;  4QFV A;  5A6C A;  2R03 A;  2QFC A;  1N11 A;  2FUL A;  5ITZ F;  3GZ2 A;  3MCX A;  3Q15 A;  4J8Y A;  3CVX A;  3G2S A;  2DYS E;  4F53 A;  5JJ6 A;  3DRA A;  4I2W A;  1LF8 A;  4I9C A;  3MYV A;  1UJK A;  4K0R A;  1HE8 A;  2IJG X;  3HDX A;  5CMW A;  4EEC A;  5G05 C;  2EIK E;  3EU5 A;  2I2O A;  3ONL A;  4BWR A;  4WUY A;  2VJ8 A;  2XRY A;  5D66 A;  4O1P A;  2P9L G;  4ACL A;  3ASG A;  4L2L A;  4DI3 A;  1O1R A;  3HIZ A;  5B3S E;  3Q4A B;  3CEQ A;  5FZR A;  2EIN E;  1NL4 A;  2KXP C;  2WVI A;  1YA0 A;  4JB8 P;  2IFU A;  4GAA A;  5CEC B;  3JYS A;  3T9K A;  3F6Q A;  4MRU A;  1O1S A;  2AWI A;  1HH8 A;  2WXG A;  5C2Y A;  4DX1 A;  4L1B A;  4PDX A;  4HRM B;  1N0Q A;  1YMP A;  4OAU C;  4HB5 A;  3C5R A;  3DSV A;  2HE0 A;  4PUC A;  3TXN A;  3LVQ E;  5AQ9 A;  3OAW A;  5FTP A;  4DRX E;  4WWP A;  5EYP F;  5AEN A;  3ZIM A;  4HXI A;  4EBA A;  3KSL A;  3UI2 A;  3Q79 A;  5ENT D;  2A4Z A;  4DX6 D;  3RSE G;  4JPS A;  4JXT A;  1TNB A;  1N9A A;  4C48 B;  4J8S A;  2OEW A;  4GZ5 A;  3SBS A;  3L82 A;  1H0A A;  2X6I A;  1OXJ A;  5CCM A;  2VGX A;  5BPP A;  2X6H A;  3FTX A;  5KNH D;  2KCV A;  4C9B B;  1XGW A;  4NAC A;  1BD8 A;  1H2T C;  4I9E A;  3IV0 A;  3TGO A;  4UWH A;  3D9M A;  2X6K A;  3EHN A;  4IYP A;  3W9F A;  4AXH A;  1FT1 A;  4A55 A;  4G24 A;  3U66 A;  1SVX A;  4DX2 A;  3FTY A;  3CHM A;  3I3N A;  4EQF A;  3FY4 A;  4DPR A;  3AG3 E;  3RIB A;  3OXG A;  2NXP A;  2L9B A;  3TWT A;  5CEA A;  3NOC D;  3UTM A;  1HFA A;  5FWQ A;  3FTU A;  4AJW A;  2WXJ A;  1Y8M A;  4DLO A;  2X3M A;  4I2Z A;  4FHK A;  5EN5 D;  4J8E A;  2AXV A;  3UT7 A;  1JUQ A;  2LNI A;  4U04 A;  3CHQ A;  4JA9 A;  3MV2 B;  3T5V A;  1W3B A;  3RO2 A;  3TXM A;  5KBA A;  3UM1 A;  2LAI A;  1D8D A;  4BET A;  2Q7F A;  3C72 A;  2WQ6 A;  2CFZ A;  2UY1 B;  3ONK A;  1SQM A;  3HVE A;  2EIJ E;  1SW6 A;  4CT4 A;  3QOU A;  4YDY A;  4LSZ E;  4TUM A;  4JW1 A;  2DWZ A;  1Z5S C;  4FU3 A;  3I4G A;  5HS0 A;  4N3A A;  4WNG A;  3KSQ A;  4I17 A;  4K5A B;  4XIF A;  5KWD A;  1KPS B;  4HI8 A;  2J49 A;  4HOT A;  4G23 A;  2LO6 A;  1TR4 A;  4FUL A;  4ANX A;  1K1B A;  2GGF A;  3E37 A;  3E34 A;  3IEG A;  1FVH A;  3AU4 A;  2ZIR A;  3W9G A;  1E8W A;  2WXO A;  1U3D A;  2H6H A;  4AM9 A;  2KBX A;  4A1S A;  3UM3 A;  2QZA A;  2DBA A;  4A1G A;  3HXC A;  5G04 C;  3E33 A;  3LY9 A;  2OND A;  2JLB A;  1MYO A;  1MX2 A;  3UQ3 A;  1NA3 A;  1E8Z A;  5ARG A;  3QKY A;  1IKN D;  4UWK A;  5ENN A;  3ESK A;  3ZGQ A;  5AIJ A;  4LUN U;  3FH7 A;  3Q7F A;  4A3V A;  3IXE A;  5BXO A;  4B8A A;  1H2U A;  1JCS A;  5LFA A;  2Y4T A;  1HS6 A;  3D9H A;  5T8I A;  4DUI A;  2FEZ A;  5HKP A;  3C3R A;  4PS7 A;  3LEW A;  2GRQ B;  3ZYK A;  4KYO B;  4G8L A;  1V54 E;  3FUJ A;  2NYJ A;  3UT8 A;  3D9J A;  4N5Q A;  2OVF A;  5AJL A;  1VDY A;  4FJY A;  4F1S A;  2UWJ G;  4ABN A;  4TRQ A;  3ASO E;  1N54 A;  4B89 A;  5C1D A;  1UN9 A;  3IBE A;  4LRZ A;  3SHF A;  4LNG A;  1D9S A;  4DJA A;  1TN7 A;  3T5X A;  3TWS A;  4UWF A;  3ZFW A;  2P9U G;  4GCO A;  3QJZ A;  4A63 B;  4FP7 A;  3DSS A;  4NQ0 A;  5EID A;  3FUI A;  4UUC A;  4IUL A;  3PZ4 A;  1OCC E;  3LKU A;  1FPP A;  1U2V G;  3B7B A;  4JHK A;  3VTY A;  3FH8 A;  2VSX E;  3CVY A;  1IQU A;  2RG8 A;  5BNW A;  4M3O A;  1Z3Y A;  3ABK E;  3C98 A;  5EDS A;  3VTX A;  2V4H C;  2VSN A;  3QDN A;  3UM0 A;  3ML9 A;  1EYH A;  3CVV A;  4ATZ D;  3RK6 A;  3PNL B;  4DI4 A;  2XPY A;  4GMR A;  3OXF A;  3WG7 E;  3PH0 C;  1E8X A;  3ESL A;  4LER A;  3CKC A;  4CRW A;  3S7D A;  3Q47 B;  1UJJ A;  2B0O E;  2WQH A;  4CDN A;  3I5P A;  4XZ4 A;  1S64 A;  3P1U A;  5LP0 A;  3CKB A;  1G3N B;  1TNY A;  2EQX A;  2NC9 A;  3G2V A;  3Q9N C;  3DEP A;  4ANW A;  3QC1 A;  2IU1 A;  4G25 A;  2FI7 A;  2CHZ A;  4ZFH A;  2QYU A;  4OVV A;  1ELK A;  4LCT A;  4BX9 A;  2XEV A;  3FTZ A;  4K5C A;  1INZ A;  5B1A E;  5AAR A;  4CDR A;  3C3O A;  3ULY A;  4JEH A;  3CGH A;  5A7D B;  4KVM A;  4N5C A;  4H7Y A;  3P2B A;  4HQD A;  3EHM A;  4NRH B;  1RZ4 A;  4UI9 C;  3SZ7 A;  4F6R D;  3R7Q A;  2H6I A;  3B7S A;  3KS2 A;  1UG3 A;  5ANR A;  2IQC A;  5ENR D;  3CVL A;  2VGY A;  3DXM G;  3FTV A;  2J4D A;  5IY5 E;  2HO1 A;  2ILR A;  2Y3A A;  4GZD A;  2WXF A;  5AAO A;  2GRN B;  1A5E A;  4WAF A;  3ZHE B;  4FLB A;  1ZB1 A;  2XS8 A;  3EHQ A;  4B94 A;  1N94 A;  3LY8 A;  2NSZ A;  3SFX A;  5J90 A;  4BTB A;  1JCQ A;  3T8M A;  4HFG A;  3VLF A;  1SA4 A;  5JHB A;  2F0Y A;  2R5S A;  3JQ1 A;  3LDZ A;  5HQ8 A;  5EIB E;  5G05 J;  3HXD A;  3NB2 A;  1L5J A;  1WG0 A;  3FUK A;  4BT8 A;  1MJ0 A;  3FFL A;  3UX4 A;  5LCW C;  4BES A;  2XZT G;  4TXQ A;  1ELR A;  3UPV A;  3G2T A;  2GW1 A;  3AJI A;  2AW6 A;  4U0Z A;  3B13 A;  4E6H A;  2XS1 A;  5T3R A;  3PS6 A;  3LPZ A;  2Y0B G;  4JC8 A;  4BT9 A;  5CHE E;  3CHP A;  1MHQ A;  3B7U X;  4L7T A;  3FU0 A;  5JHA A;  4I43 A;  3B7R L;  5HRY A;  4DK5 A;  4GA2 A;  3MKQ B;  3AG1 E;  3EUV A;  1Z3X A;  5EX3 A;  3ZYM A;  4M7C A;  4UQX A;  4URK A;  3DSU A;  3CHR A;  3R7R A;  3UKR G;  5CBN A;  1TNO A;  2GRM A;  2R02 A;  3MZL B;  2R17 C;  5A23 A;  4JHR A;  2WXK A;  2ZGG A;  4J0U A;  3N71 A;  1H6O A;  3X2Q E;  2RFM A;  2QY7 A;  2VTB A;  1H2V C;  5LX8 A;  5CED B;  3UIO C;  3AS8 A;  3OXL A;  4GZC A;  4EPZ A;  3LJ3 A;  3VLE A;  2H6F A;  4JL0 A;  3L13 A;  3BEE A;  1Y6I A;  3FP3 A;  4GTP A;  3HXB A;  3NZS A;  3SF4 A;  4G2V A;  3Q7A A;  2X6F A;  3ABM E;  3BG1 B;  3I4R B;  1NFI E;  3ZEF A;  4I6E A;  4N39 A;  3FUL A;  3SFY A;  5FQ7 A;  5CMY A;  4A3T A;  2P9P G;  1UOH A;  1BLX B;  3Q5M A;  3FWV A;  3FUN A;  2DYR E;  5J08 A;  2V0P A;  3NZU A;  1TEZ A;  4BX8 A;  1MZC A;  4HNA D;  5KJN A;  4HBD A;  1HU3 A;  4DLQ A;  2LSU A;  1MQS A;  3GZS A;  4BER A;  3PRZ A;  3QAQ A;  1OWP A;  1HZ4 A;  4CZ2 D;  4YDE A;  4GYY A;  4RG6 A;  4R7L A;  3V79 K;  4ZHB A;  2E0I A;  4BTA A;  3GZ1 A;  4PH4 B;  4UI9 K;  2XCB A;  5E75 A;  1S63 A;  4RVB A;  3HRA A;  2J08 A;  2LXL A;  4I1O B;  3PE3 A;  4FLH A;  5CRU A;  2VGE A;  3NAW A;  4I1A A;  3PUJ A;  3MV3 B;  4RQI A;  3PZ2 A;  2IY0 C;  1TN8 A;  2WM9 A;  2ZIS A;  3V30 A;  2CG2 A;  2P9I G;  3B7T A;  3TWR A;  4JA7 A;  3Q78 A;  4Q94 A;  1HF8 A;  3FUH A;  2XQ0 A;  4UQZ A;  3L6A A;  2LUH A;  4RLY A;  1DNP A;  4YND A;  4APF A;  1SA5 A;  4GB9 A;  3DPY A;  1SZA A;  1IHB A;  2A5E A;  2MYO A;  3SQV A;  4XI0 A;  4ANU A;  4ME2 A;  4AEZ C;  4HLE A;  2KCL A;  2CHW A;  5D2M C;  3JXI A;  4DX7 D;  2Y69 E;  2KM4 A;  5G04 J;  3FUD A;  3SY2 A;  4GTM A;  4HOQ A;  3TG4 A;  3AG2 E;  1YYH A;  3JXJ A;  2Y4U A;  3B95 A;  1JWF A;  1K1A A;  4EBA G;  4GCN A;  3C3Q A;  3FUF A;  3EIQ C;  1FVF A;  1E96 B;  4TXP A;  2C0M A;  3TAX A;  3CVU A;  3L9T A;  2PQR A;  3TL5 A;  1E8Y A;  4KZ0 A;  3EHR A;  4V3I A;  3QNK A;  4KVO A;  2KZT B;  3CV0 A;  5ENS D;  5G55 A;  4HS2 A;  4O6F A;  1JWG A;  1ZBP A;  2L6J A;  3L17 A;  2YHC A;  3LCA A;  3PEV B;  1NZN A;  1Q2Z A;  4W9R A;  4O60 A;  2HM8 A;  1KZP A;  4I6J A;  4FJZ A;  1QZ2 A;  2P9S G;  4CYM D;  3D9O A;  3TG5 A;  4XE0 A;  3UIN C;  2IO3 C;  2WB2 A;  3QB2 A;  4GA1 A;  3CK9 A;  1PAQ A;  3APF A;  3TWV A;  4L2Y A;  4U8Y D;  5EX0 A;  4YDW A;  4PS3 A;  2L6B A;  1DCQ A;  3CK8 A;  5JMN D;  4FHJ A;  1S70 B;  3L22 A;  3SD5 A;  5BV0 A;  2YQ8 A;  3ASD A;  3JQ0 A;  1UW4 B;  3CR3 A;  3E4B A;  5FT9 A;  5JJ7 A;  2R05 A;  5JA4 D;  2V5Q C;  3DPD A;  3CVP A;  5ENP D;  2BTD A;  4IN3 B;  4XX5 A;  3CVQ A;  2LSV A;  4TXR A;  3TWU A;  1N4Q A;  5BUZ A;  2OV8 A;  3CK7 A;  5HI7 A;  2EIL E;  2ZU6 B;  4U7E B;  4LNB A;  5KJM A;  2JEK A;  2P9K G;  3ZPJ A;  5FQ4 A;  1EDU A;  2ETC A;  3FEY A;  2PM6 A;  3RAU A;  4AY5 A;  4AV7 A;  4FC8 A;  1DVP A;  2J9Q A;  3D9N A;  3T8K A;  2ETA A;  2XEH A;  3QWP A;  2WXR A;  4IRU A;  2WXM A;  1PY1 A;  1N52 A;  3IHV A;  5CBO A;  3QWV A;  3AS4 A;  2E2E A;  1K3Z D;  3UXG A;  3ZN3 A;  1ZU2 A;  3O48 A;  3PZ3 A;  5AQ7 A;  1P5Q A;  2RFA A;  5EKQ D;  4OYS A;  1U3C A;  2XRZ A;  3URZ A;  3AG4 E;  4WNE A;  2WQ7 A;  4FAD A;  2PM7 A;  2V4L A;  2MOW A;  4YVO A;  4EZL A;  2P2C P;  2XPZ A;  1IHG A;  3Q75 A;  3ASN E;  3ULE G;  2DVW A;  1QYM A;  3GYZ A;  3NOG D;  3FUM A;  1WM5 A;  4CDM A;  3LVR E;  4UI9 J;  3AS5 A;  4JHJ A;  3ZU7 B;  2WXP A;  4ACK A;  4X8Q A;  4RG9 A;  3V2X A;  2BKG A;  4JVS A;  3BUA A;  4AP2 A;  3DSX A;  2Y1L E;  2WXN A;  3R9M A;  2DIW A;  1DC2 A;  1LD7 A;  3CVN A;  3RO3 A;  1BU9 A;  2FF4 A;  5DBK A;  5FJY A;  4B0Z A;  2XEN A;  4J8F A;  3TWQ A;  3L08 A;  3V2O A;  4CCA A;  4G11 A;  4Y6W A;  2FBN A;  1E7U A;  1K8K G;  4I6G A;  5D0Q D;  2DZO A;  5BW8 C;  1AWC B;  3DXK G;  4I1M A;  2VQ2 A;  2DZN A;  4GZ6 A;  4F3V A;  5KCM A;  1N95 A;  1D8E A;  4N2Q A;  1OWM A;  3EIJ A;  1NI1 A;  3D9K A;  4OVU A;  2XHE A;  4GU5 A;  3ABL E;  1XNF A;  5LCW J;  4GML A;  1KLX A;  4C0E A;  3E32 A;  3MEK A;  2V8S E;  4AY6 A;  4RSY A;  2A5U A;  4U8V D;  4EHM A;  4YDO A;  1A17 A;  1Z6T A;  1WAO 1;  4MKT A;  2J8S D;  4C0M A;  4CT0 A;  3ENE A;  4JD2 G;  5KJK A;  2L0T B;  1B89 A;  4GTR A;  3L16 A;  3JUE A;  1OCO E;  5ANL A;  5H7P A;  5BXU A;  4TV3 A;  2KC7 A;  1E7V A;  1JPL A;  3DEO A;  3RRN B;  3RRU A;  3D9P A;  2OVB A;  4KZC A;  5AJD A;  1WDY A;  2WMN A;  1BI7 B;  3L54 A;  1S0P A;  1HG5 A;  2XZD G;  3G2U A;  2IO2 C;  5B1B E;  4E85 A;  3KEZ A;  3GW4 A;  2I6H A;  1OCR E;  2ION A;  4U07 A;  2VTB B;  3LXU X;  3APC A;  1LD8 A;  1WY6 A;  3ZHE A;  1TYQ G;  3J5P A;  3MX3 A;  1N4P A;  5CER B;  4U0U A;  3IHY A;  4ILH B;  3Q9U C;  3E30 A;  5FIN A;  3UIP C;  3LS8 A;  2ZXW E;  3CQC B;  4AOF A;  1N4R A;  3RJV A;  3PDN A;  5AN8 A;  1N4S A;  2WXI A;  2VGX B;  4U96 D;  5ENQ D;  2VSO E;  4NUR A;  4JEU A;  4UWG A;  1OWO A;  3J5Q B;  3K9I A;  4GA0 A;  5D0O D;  3UM2 A;  4Y6C A;  2RKK A;  4YVQ C;  2J09 A;  1NA0 A;  2X38 A;  5E76 A;  1E90 A;  3KD7 A;  4LG6 A;  4B8C B;  5M72 A;  5EYL A;  4D10 C;  3HYM B;  5FQ8 A;  4LEU A;  4L9P A;  1IYG A;  2GRL A;  5KJL A;  1OCZ E;  1O5M A;  4EZJ A;  2WXQ A;  3QK0 A; 
#chains in the Genus database with same CATH homology
 2ZXW E;  3AG1 E;  2OCC E;  2DYR E;  3ASN E;  3X2Q E;  3ABK E;  5B1B E;  5IY5 E;  3AG2 E;  3ASO E;  1OCR E;  3AG3 E;  1V54 E;  3ABL E;  3ABM E;  1OCO E;  5B1A E;  2Y69 E;  3AG4 E;  5B3S E;  1OCC E;  2EIJ E;  2EIM E;  2EIL E;  2EIN E;  1OCZ E;  3WG7 E;  2EIK E;  2DYS E;  1V55 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...