2OCCE

Bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords CYTOCHROME C OXIDASE
total genus 41
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 1998-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 2occE00
5IY5E 3ABKE 1V54E 5B3SE 3ABLE 5B1AE 2EILE 2EINE 3ASNE 3X2QE 3AG3E 2EIJE 3ASOE 1V55E 1OCOE 1OCCE 1OCZE 2DYSE 2ZXWE 2DYRE 2EIME 2EIKE 3ABME 2Y69E 3AG1E 3AG2E 5B1BE 1OCRE 3WG7E 2OCCE 3AG4E
chains in the Genus database with same CATH superfamily
1Z5SC 4C0MA 4ZFHA 3MV2B 5B1AE 3ZXSA 2X3MA 3RK6A 3ZYMA 2R2LA 5EILA 1VDYA 3CVLA 3RO2A 2NXPA 4N3CA 1LF8A 1N95A 4MS6A 4BT8A 3CVUA 1DNPA 5CCMA 3NAWA 3TG5A 3RRNB 1TNBA 2Y69E 4YDYA 2WXHA 3IHYA 2WXPA 4PUCA 2KCKA 4EZKA 4K03A 3FWVA 2WXKA 4RVBA 3LY7A 2PQNA 3E30A 2P9KG 4I2ZA 2AJAA 3ZN3A 1HH8A 3QOUA 1TYQG 1JCQA 3TWVA 2IFUA 2J07A 4HFGA 1XGWA 4LSZE 5EYLA 1QYMA 5G05J 4CT4A 4YDOA 1IQRA 2LSVA 4J8YA 1D8DA 1PY1A 4JHKA 2V8SE 2BKGA 2RKKA 3HXFA 4DI4A 1SW6A 3B7SA 2UY1B 3E33A 2GRLA 3UIPC 2WXMA 3EUVA 3HDXA 1S70B 4OYSA 3RJVA 5CHEE 4HBDA 5LX8A 2GRQB 3SNXA 5ENTD 4A1GA 4PS3A 5CECB 3CIAA 4WWPA 3D9LA 4GA1A 4JPSA 5FQ7A 2F0YA 3SZ7A 4JW1A 4F6RD 2LNIA 4JD2G 3BUAA 5D66A 2IEJA 4I43A 2UY1A 2LUHA 4M7CA 3EIJA 4GA2A 2CHWA 5AJLA 4JC8A 3X2QE 3HXBA 3QJZA 5EX0A 2HYZA 4WWOA 2F8XK 4YNDA 4HNAD 3LY8A 3OXFA 2KXPC 4MKTA 4L2YA 1TJCA 4W9RA 4DK5A 2YINA 3ESKA 2L9BA 2ZISA 3MJWA 2VGYA 2GRMA 4G25A 3UQ3A 3PZ2A 5KJMA 2KZTB 3CGHA 3U64A 4Q69A 3T9KA 4GMLA 5T4YA 3TWQA 2P9PG 1U2VG 4XZ4A 4XI0A 3T5XA 2ETAA 3ULEG 1NA0A 5HRYA 3U9WA 5BW8C 3CQCB 5E76A 2VSNA 4L9PA 3EIQC 3BG0B 4RQIA 2LXMA 2XEEA 4KMOA 4G23A 4M3OA 4DI3A 2VGEA 2ONDA 4CDMA 3G2TA 2FI7A 4BTAA 1FCHA 3R9AB 4FADA 2XPZA 3PREA 2X6KA 3C3OA 2RD0A 3ASGA 1D9SA 1DCQA 4XIFA 3UPVA 1AP7A 3MYVA 4WWNA 3KS2A 1BI7B 4GZDA 4LUNU 4BFRA 3TWRA 1AWCB 3D9KA 1ELKA 4ATGA 3D9OA 3FUMA 3K9IA 1MX2A 3TWWA 2AXZA 3Q78A 4AY5A 2BKKB 3LVQE 3CSFA 4AY6A 3PNLB 4XKCA 4HLLA 3RKVA 4F53A 4U63A 4EQFA 4GU5A 1O1RA 3DBSA 2XZDG 4A55A 1JPLA 3PDNA 3TGOA 5AENA 4XE0A 3G2SA 2V4HC 3MV3B 4HOSA 4JEHA 3U4TA 3D9MA 3O4ZA 4TUUA 3UX4A 3PZ1A 4BSZB 3CK8A 1YMPA 3KEAA 3FFLA 4EBAA 4NURA 2XCBA 4F1SA 3NZSA 1HU3A 1LTXA 4HI9A 1A5EA 4LNGA 4HB5A 4I9CA 4YDEA 5BT1A 2E0IA 2QZAA 3EHNA 3ZGQA 2XRYA 3JXJA 2MRIA 2QYUA 3ZNGA 2JLBA 3LYAA 4I6JA 4JVSA 1H2TC 3QB2A 2I1KA 2ZIRA 1RW2A 3DSWA 3G2VA 2F37A 3QNKA 4B0ZA 1TNUA 1IYGA 1U3DA 4FU3A 4D10C 3VTXA 1O1TA 3UM3A 4AVXA 4U7EB 3GZ2A 4U07A 4HXIA 4RLYA 5C2YA 3SD5A 3EHQA 1ZB1A 5EDSA 3CVYA 5EN5D 4R7LA 3T5VA 4OAUC 5AQAA 3CVWA 2RFAA 3IKOB 1Q2ZA 3NOGD 4GYWA 3SFXA 4GTTA 2L0IA 2QY7A 4AIFA 1E8YA 2ZGGA 3TXMA 1TNZA 4I1OB 3KSLA 2C2LA 3ULQA 3S2AA 1HE8A 4X8QA 4L23A 1JCRA 3OXLA 3AS5A 4UWHA 2HE0A 1TJFA 3P1UA 3L6AA 3EJNA 3CKBA 2LAHA 3S7JA 2YNQA 2F8YA 2R02A 3B7UX 1ELRA 3CVQA 5D0OD 2IONA 3G2WA 2BF0X 3V30A 4P29A 4B89A 4J7WA 4FA6A 5EIBE 4J8EA 5A7DB 4JZYA 3SFYA 2P9NG 2LSUA 4GMRA 1OWOA 3HXDA 1HXIA 4DX1A 2RFMA 3RRMB 4DUIA 3RRUA 4URKA 3HHMA 3Q49B 3CVXA 5ENQD 3L16A 5FINA 3MKQA 3CQGB 3NZUA 4J6IA 3UM2A 4HRLA 5CMYA 2WB2A 1MYOA 3Q79A 1HZ4A 4AM9A 3UUXA 4AOFA 4ATZD 3C3QA 4N39A 1BU9A 4GTPA 2DIWA 5ANRA 3V31A 3UT8A 3TXNA 4L7TA 3UTMA 3ESLA 2I1JA 3PZ4A 3ZEFA 3JUIA 4GYOA 1HO8A 5BXOA 4GYYA 3ZU7B 4GZCA 4JA7A 3GZ1A 5JHBA 4Z68A 3PS6A 2WMNA 2J9QA 4BY6A 4K5BA 2VTBA 3NBNB 1BPOA 3FTSA 1X5BA 3ML9A 4G11A 2CFUA 2KM4A 2VSOE 3AU4A 2MHKA 1N4RA 2FEZA 3D9IA 3L54A 3HVEA 3UKRG 2WPVA 1NP7A 4DX7D 1BI8B 4G26A 4AJWA 4JA9A 2H6IA 2WVIA 5B3SE 3FH8A 1S0PA 1JCSA 3T8KA 5AIJA 2DYSE 1K3ZD 3MX3A 5ENNA 1IQUA 2OEWA 2XPIA 1NI1A 5JA4D 4HRMB 4WNFA 2H6FA 4Q94A 3FH5A 2P9IG 2LXLA 1OXJA 1FPPA 4I6EA 3DXMG 3O48A 3PRZA 2GRNB 4CGWA 3DSXA 5JMND 4FLBA 4HORA 4C48B 4DLOA 3D9JA 5A23A 4O6FA 2DZNA 3DWLG 2XZTG 2A5EA 3QDNA 3IHVA 2B0OE 3LS8A 3SQVA 4GZ3A 1SA4A 4MLPA 2YHCA 2OEVA 3E32A 4G2VA 4HOUA 4LNUD 3GW4A 3ZXPA 4ANVA 3OXGA 5LCWJ 1UOHA 3AG1E 2WXJA 4BEPA 4LEUA 3AG4E 3PEUB 2VQ2A 1E96B 3D9NA 3JUEA 3ZUVB 3FU3A 4AEZC 4A3VA 1KPSB 4RSYA 3NF1A 4UQYA 3CVPA 2WXQA 2WMOA 4ILHB 1E90A 4I6GA 3AS4A 2KBXA 3LEWA 3L82A 3TWSA 3FUDA 4HOQA 3C3RA 1OWPA 4HS2A 2WXIA 3FUKA 1SQMA 3LDZA 2BEDA 3C72A 3QKYA 4OAVB 5E75A 1EDUA 2DCPA 1RZ4A 3B7RL 2BTDA 3ONKA 2Y3AA 3CKCA 4EZJA 2IO2C 4UWLA 4JEUA 1OCZE 4G8LA 1L5JA 1JWGA 4WNEA 4K5AB 2WXLA 4TRQA 3FULA 4DX5D 3FUEA 4IULA 1WG0A 3I4RB 3IXEA 5ENSD 4UWKA 2R17C 5DIZA 4F1PA 2LO6A 2KATA 5LCWC 3FTVA 1H19A 4MRUA 3KEZA 3QWPA 2NSZA 2PL2A 2E2EA 5AN8A 3AAAC 3AS8A 4KT6B 4TXPA 3LXUX 1E8WA 1N0RA 4DX6D 3UM0A 5BUZA 1BLXB 1Z3YA 4IN3B 4EECA 2C0MA 3I5PA 1N0QA 4TXRA 2R03A 4G8KA 4FJZA 2MYOA 3FHEA 1N52A 3ABME 2EIKE 4OVUA 4CCAA 2LAIA 3APFA 3S7BA 1YCSB 5D0QD 5G04C 4UQXA 2DBAA 2X38A 2IY0C 5AARA 3ZRHA 2P2CP 4GAAA 4FULA 4DRXE 5J08A 1E7VA 2VGXB 2XQ0A 4I9EA 1HX8A 2PM6A 4KVOA 4U04A 2XGSA 4V3IA 4YVQC 3ZKJA 2PNNA 1N11A 2CG3A 2QFCA 3DPDA 2IO3C 2WQHA 1NZNA 1OUVA 1E8ZA 3CEQA 5B1BE 3Q5MA 4ANUA 4KVMA 1H6KA 3APDA 3VLDA 2FF4A 4LERA 2EINE 4QQIA 5FQ4A 3RAUA 4HOTA 2QC9A 2XS8A 3QK0A 1PAQA 2OOEA 4GZ6A 2X6HA 2FULA 3JQ0A 1KT0A 3Q47B 3AG2E 4XX5A 2DZOA 1QQEA 4FLHA 4NRHB 5BNWA 4K0RA 3TWXA 2DVWA 4EBAG 3GZSA 1YYHA 1Z3XA 4U0ZA 2WQ7A 1UN8A 4FP7A 4FC8A 1KT1A 3CV0A 2Y0BG 3QAQA 2XEHA 2FBNA 2EIME 4WNDA 2HM8A 2L0TB 2RG8A 5LFAA 3W9GA 3ABLE 5FIOA 2XHEA 1QZ2A 2QYJA 4WNGA 3VLFA 5BXUA 4AV7A 1N4QA 1MHQA 2VTBB 4IRUA 4PS7A 3APCA 3KD7A 3Q9UC 4Y6CA 4JB8P 4J8FA 2XEVA 3EDTB 2XGMA 3FTZA 4O1OA 4EHMA 3DXKG 4C9BB 3PE4A 2NYJA 5CBNA 2XCCA 2GW1A 4IYPA 4Q96A 3ZFWA 3E34A 3VTYA 3PE3A 4AP2A 3Q9NC 1W3BA 1MZCA 2H6GA 2XPYA 3GYZA 3TJPA 3DEOA 2ETBA 5T8IA 5FJYA 1DVPA 2YHEA 3C5RA 4KZ0A 1EPUA 4APOA 4O60A 4A3TA 5CEAA 4GB9A 1IHGA 1INZA 3ASFA 1FT2A 1SVXA 3SFZA 4C0EA 4YDWA 3RU0A 3EHRA 2P58C 3MKRA 2KC7A 1JWFA 4TUMA 3AU5A 5KWDA 5HQ8A 4G1TA 3QARA 1OY3D 5KBAA 4GA0A 5CMWA 1H2UA 1IHBA 3G2UA 4FHJA 4J8SA 1EYHA 3V79K 3FEXA 5ARFA 3ZW3A 5AJDA 2V5FA 1KZPA 3PUJA 1G3NB 4N3AA 3TG4A 4PH4B 1HFAA 3S7FA 1NL4A 5CRUA 3P2BA 4BX9A 3MCXA 1TNYA 4CDRA 3JCKC 3FU0A 3UKUG 2Y4TA 3DSUA 4KBQA 3KSQA 5AQ9A 2GRPB 5HI7A 5KNHD 2IOLA 2XENA 2WM9A 1MX4A 4DLQA 3TWUA 3OAWA 3ASOE 4ANXA 1OCOE 5EYPF 2CHXA 1S64A 3BG1B 5KNGA 1S63A 2OCCE 3IEGA 2L6BA 3DEPA 4F3VA 2UWJG 3JQ1A 5FWQA 4DPRA 4K5CA 3ULYA 4TV3A 3LJNA 4CZ2D 3LJ3A 4ACKA 4JHRA 5JHAA 5EIDA 3RSEG 3UT7A 5A6CA 1HF8A 3UT4A 3BQOA 4BX8A 3ABKE 2IOSA 3B7BA 3FY4A 3LY9A 3CHMA 1QNFA 3RIBA 3CR3A 3JXIA 4GCOA 2R5SA 2OVBA 4APFA 4UWGA 3FEYA 5AYWD 3FH7A 2V4LA 3ZYKA 3EU5A 3T8MA 3PVLA 4B94A 5AQ7A 2KCLA 2Q7FA 1FVHA 2WQ6A 4GPMA 4J0UA 2OV8A 3V2XA 4BETA 3B95A 3ASDA 2XS1A 3L13A 3SO8A 2B6CA 3CHPA 1E8XA 1U3CA 1O5MA 5LOZA 4N2QA 2NC9A 4HLEA 5C1DA 2I9CA 4ME2A 2ZGDA 3CLJA 5H7PA 1HG2A 3Q73A 3BU8A 3DSTA 1ZBPA 5KJKA 1N94A 4PDXA 2A4ZA 5AAOA 3ISMC 2AVPA 1TEZA 5FQ6A 4JHJA 2KZTA 5ARGA 2JEKA 3TWTA 3PZDA 2CFZA 5KCMA 3NOCD 3WXXA 4RG9A 5EX3A 1O1SA 3FUFA 3NB2A 2VJ8A 4ILIA 3KAEA 3NQPA 4NQ0A 4O1PA 3D9HA 4E6HA 2P9UG 3L9TA 4BERA 2ZXWE 5G55A 3J5PA 3FP3A 4G24A 4YVOA 1K8KG 4N3BA 3CHOA 3HVEB 1E7UA 3U66A 2ILRA 1LD8A 2GRRB 4GTSA 4U95D 3J5QB 3R7RA 4B8AA 2WXRA 4ACLA 4E85A 3URZA 2R05A 2H6HA 1WY6A 2AXVA 1GW6A 2PM7A 3Q75A 4I1AA 4AXHA 3ZIMA 4H7XA 4CGVA 4ABNA 2I6HA 5M72A 1PC2A 1P5QA 3AG3E 1OWMA 4XKBA 4XEIG 4FJYA 2R59A 3UI2A 2J09A 2VSYA 4HI8A 3WG7E 4UQZA 2HO1A 4U8YD 3UINC 1TN8A 4I1MA 3FUIA 2WXOA 1SZAA 3DRAA 1UW4B 2CHZA 2MOWA 3UM1A 1UJKA 4HVBA 3D9PA 1N54A 3LVRE 3VLEA 1QBQA 3ONLA 3FDHA 1Y8MA 4MBGA 3PH0C 4TXQA 2AW6A 2AXUA 5G04J 2Y4UA 4GTRA 2FO7A 4HQDA 2VSXE 5ENOD 2ETCA 4U0UA 4Y6WA 5JJ6A 3MZLB 2J4BA 3UIOC 3MA5A 1UN9A 4GTQA 3V2OA 5IY5E 4UUCA 2J49A 3FUHA 4ZHBA 4ILGA 4KZCA 1MJ0A 3PUKA 1DC2A 3DSVA 1TR4A 5D2MC 2J8SD 2J08A 4EZLA 1MX6A 2Y1LE 1N4PA 3TAXA 4L2LA 3ASNE 2A5UA 2XRZA 4GPKA 3I3NA 4GCNA 5JJ7A 3FUNA 4QFVA 3HRAA 2I2OA 1FT1A 2WXNA 2FO1E 2EQXA 4U96D 1KZOA 1IXVA 5FQ8A 2VYIA 4U0SA 1HS6A 3ZYLA 3PEVB 2YQ8A 4XI9A 3C98A 3OTNA 4GTVA 2JABA 5HS0A 5G2NA 2PZIA 1A17A 4GTMA 3ML8A 4RG6A 3CHRA 3FUJA 2WXFA 3HG0D 4JXTA 4L1BA 3CHSA 4I2WA 1ZU2A 3SI5A 2PQRA 3E4BA 3CVVA 4NIKA 3ZYQA 3FTXA 5CCLA 3CK9A 3CHQA 3B7TA 5CBOA 1BD8A 3SHFA 2IQCA 3LCAA 2KCVA 1H2VC 2EILE 2HR2A 5DBKA 1N4SA 1JUQA 3LPZA 1NFIE 4OVVA 2IU1A 1LD7A 4LRZA 3IBEA 4CT0A 3ZPJA 2X6JA 1SZ9A 4EPZA 5ANLA 4BESA 2V5QC 1OWLA 5FZRA 4ANWA 3SBSA 4HRNA 3TL5A 5LP0A 3DSSA 2VGXA 3HIZA 3LKUA 1TN6A 1H0AA 5EKQD 5KJNA 3AJIA 1V54E 3ASHA 4KYOB 1N9AA 5CRVA 3D3MA 4NACA 3RO3A 3FTYA 3ZHEB 1TNOA 3SBTB 4LCTA 4CEMA 4GTOA 3PZ3A 4CRWA 2CG2A 4JL0A 3W9FA 3E37A 3BEEA 1H6PA 1EF1C 2V0PA 4H7YA 5J90A 4BTBA 3ZHEA 4BWRA 1OCRE 5BPPA 3R9MA 3R7QA 1ELWA 4N5QA 1HG5A 4B8CB 2GROB 1OT8A 3SF4A 5ENPD 3FU5A 4UWFA 4LG6A 3N71A 2DYRE 2M63A 4CYMD 3L22A 2XGOA 1FVFA 2X6IA 5FZSA 4CDNA 4A63B 3CSTA 1WAO1 4U8VD 4GZ5A 2IF4A 5G05C 1TN7A 1Z6TA 3DPYA 2BUGA 3HYMB 1K1AA 5CERB 4DJAA 4FHKA 4KXKB 3I4GA 3MEKA 3B13A 1IKND 2P9LG 3FTUA 3FU6A 1KLXA 1DCEA 3S7DA 3SGHA 5CEDB 4BSXA 1K1BA 3Q7FA 1UG3A 5KJLA 5T3RA 3HXCA 3Q15A 2OVFA 3Q7AA 3L17A 4LNBA 4J8DA 4B93B 1V55E 3F6QA 4WAFA 3EU9A 3EHMA 3SY2A 2L6JA 3ZVVA 1Y6IA 3QWWA 2WXGA 3UMVA 3CK7A 3UXGA 4UI9J 1XNFA 5FT9A 1UJJA 3JYSA 3MGBA 5ENRD 4N5CA 5BV1A 4F7AA 2J4DA 3L08A 1NA3A 4N2SA 3MKQB 1X81A 5HKPA 4U8HA 3ENEA 1H6OA 1SA5A 2GGFA 1WDYA 3IV0A 3Q4AB 3PNTB 4UI9K 5ITZF 3FTWA 1OWNA 4I17A 1B89A 1MQSA 5AQBA 4PS8A 1OCCE 4UI9C 2P9SG 1D8EA 4DX2A 1WM5A 5JJTA 2ZU6B 2C0LA 3QC1A 2DWZA 3QWVA 4GMJA 2X6FA 5FZQA 3CVNA 5BV0A 2IJGX 3HXEA 2EIJE 2AWIA 4BT9A 5FTPA 3U3WA 4A1SA 4WUYA 1YA0A
chains in the Genus database with same CATH topology
5IY5E 3ABKE 1V54E 5B3SE 3ABLE 5B1AE 2EILE 2EINE 3ASNE 3X2QE 3AG3E 2EIJE 3ASOE 1V55E 1OCOE 1OCCE 1OCZE 2DYSE 2ZXWE 2DYRE 2EIME 2EIKE 3ABME 2Y69E 3AG1E 3AG2E 5B1BE 1OCRE 3WG7E 2OCCE 3AG4E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IY5 E;  3ABK E;  1V54 E;  5B3S E;  3ABL E;  5B1A E;  2EIL E;  2EIN E;  3ASN E;  3X2Q E;  3AG3 E;  2EIJ E;  3ASO E;  1V55 E;  1OCO E;  1OCC E;  1OCZ E;  2DYS E;  2ZXW E;  2DYR E;  2EIM E;  2EIK E;  3ABM E;  2Y69 E;  3AG1 E;  3AG2 E;  5B1B E;  1OCR E;  3WG7 E;  2OCC E;  3AG4 E; 
#chains in the Genus database with same CATH topology
 1Z5S C;  4C0M A;  4ZFH A;  3MV2 B;  5B1A E;  3ZXS A;  2X3M A;  3RK6 A;  3ZYM A;  2R2L A;  5EIL A;  1VDY A;  3CVL A;  3RO2 A;  2NXP A;  4N3C A;  1LF8 A;  1N95 A;  4MS6 A;  4BT8 A;  3CVU A;  1DNP A;  5CCM A;  3NAW A;  3TG5 A;  3RRN B;  1TNB A;  2Y69 E;  4YDY A;  2WXH A;  3IHY A;  2WXP A;  4PUC A;  2KCK A;  4EZK A;  4K03 A;  3FWV A;  2WXK A;  4RVB A;  3LY7 A;  2PQN A;  3E30 A;  2P9K G;  4I2Z A;  2AJA A;  3ZN3 A;  1HH8 A;  3QOU A;  1TYQ G;  1JCQ A;  3TWV A;  2IFU A;  2J07 A;  4HFG A;  1XGW A;  4LSZ E;  5EYL A;  1QYM A;  5G05 J;  4CT4 A;  4YDO A;  1IQR A;  2LSV A;  4J8Y A;  1D8D A;  1PY1 A;  4JHK A;  2V8S E;  2BKG A;  2RKK A;  3HXF A;  4DI4 A;  1SW6 A;  3B7S A;  2UY1 B;  3E33 A;  2GRL A;  3UIP C;  2WXM A;  3EUV A;  3HDX A;  1S70 B;  4OYS A;  3RJV A;  5CHE E;  4HBD A;  5LX8 A;  2GRQ B;  3SNX A;  5ENT D;  4A1G A;  4PS3 A;  5CEC B;  3CIA A;  4WWP A;  3D9L A;  4GA1 A;  4JPS A;  5FQ7 A;  2F0Y A;  3SZ7 A;  4JW1 A;  4F6R D;  2LNI A;  4JD2 G;  3BUA A;  5D66 A;  2IEJ A;  4I43 A;  2UY1 A;  2LUH A;  4M7C A;  3EIJ A;  4GA2 A;  2CHW A;  5AJL A;  4JC8 A;  3X2Q E;  3HXB A;  3QJZ A;  5EX0 A;  2HYZ A;  4WWO A;  2F8X K;  4YND A;  4HNA D;  3LY8 A;  3OXF A;  2KXP C;  4MKT A;  4L2Y A;  1TJC A;  4W9R A;  4DK5 A;  2YIN A;  3ESK A;  2L9B A;  2ZIS A;  3MJW A;  2VGY A;  2GRM A;  4G25 A;  3UQ3 A;  3PZ2 A;  5KJM A;  2KZT B;  3CGH A;  3U64 A;  4Q69 A;  3T9K A;  4GML A;  5T4Y A;  3TWQ A;  2P9P G;  1U2V G;  4XZ4 A;  4XI0 A;  3T5X A;  2ETA A;  3ULE G;  1NA0 A;  5HRY A;  3U9W A;  5BW8 C;  3CQC B;  5E76 A;  2VSN A;  4L9P A;  3EIQ C;  3BG0 B;  4RQI A;  2LXM A;  2XEE A;  4KMO A;  4G23 A;  4M3O A;  4DI3 A;  2VGE A;  2OND A;  4CDM A;  3G2T A;  2FI7 A;  4BTA A;  1FCH A;  3R9A B;  4FAD A;  2XPZ A;  3PRE A;  2X6K A;  3C3O A;  2RD0 A;  3ASG A;  1D9S A;  1DCQ A;  4XIF A;  3UPV A;  1AP7 A;  3MYV A;  4WWN A;  3KS2 A;  1BI7 B;  4GZD A;  4LUN U;  4BFR A;  3TWR A;  1AWC B;  3D9K A;  1ELK A;  4ATG A;  3D9O A;  3FUM A;  3K9I A;  1MX2 A;  3TWW A;  2AXZ A;  3Q78 A;  4AY5 A;  2BKK B;  3LVQ E;  3CSF A;  4AY6 A;  3PNL B;  4XKC A;  4HLL A;  3RKV A;  4F53 A;  4U63 A;  4EQF A;  4GU5 A;  1O1R A;  3DBS A;  2XZD G;  4A55 A;  1JPL A;  3PDN A;  3TGO A;  5AEN A;  4XE0 A;  3G2S A;  2V4H C;  3MV3 B;  4HOS A;  4JEH A;  3U4T A;  3D9M A;  3O4Z A;  4TUU A;  3UX4 A;  3PZ1 A;  4BSZ B;  3CK8 A;  1YMP A;  3KEA A;  3FFL A;  4EBA A;  4NUR A;  2XCB A;  4F1S A;  3NZS A;  1HU3 A;  1LTX A;  4HI9 A;  1A5E A;  4LNG A;  4HB5 A;  4I9C A;  4YDE A;  5BT1 A;  2E0I A;  2QZA A;  3EHN A;  3ZGQ A;  2XRY A;  3JXJ A;  2MRI A;  2QYU A;  3ZNG A;  2JLB A;  3LYA A;  4I6J A;  4JVS A;  1H2T C;  3QB2 A;  2I1K A;  2ZIR A;  1RW2 A;  3DSW A;  3G2V A;  2F37 A;  3QNK A;  4B0Z A;  1TNU A;  1IYG A;  1U3D A;  4FU3 A;  4D10 C;  3VTX A;  1O1T A;  3UM3 A;  4AVX A;  4U7E B;  3GZ2 A;  4U07 A;  4HXI A;  4RLY A;  5C2Y A;  3SD5 A;  3EHQ A;  1ZB1 A;  5EDS A;  3CVY A;  5EN5 D;  4R7L A;  3T5V A;  4OAU C;  5AQA A;  3CVW A;  2RFA A;  3IKO B;  1Q2Z A;  3NOG D;  4GYW A;  3SFX A;  4GTT A;  2L0I A;  2QY7 A;  4AIF A;  1E8Y A;  2ZGG A;  3TXM A;  1TNZ A;  4I1O B;  3KSL A;  2C2L A;  3ULQ A;  3S2A A;  1HE8 A;  4X8Q A;  4L23 A;  1JCR A;  3OXL A;  3AS5 A;  4UWH A;  2HE0 A;  1TJF A;  3P1U A;  3L6A A;  3EJN A;  3CKB A;  2LAH A;  3S7J A;  2YNQ A;  2F8Y A;  2R02 A;  3B7U X;  1ELR A;  3CVQ A;  5D0O D;  2ION A;  3G2W A;  2BF0 X;  3V30 A;  4P29 A;  4B89 A;  4J7W A;  4FA6 A;  5EIB E;  4J8E A;  5A7D B;  4JZY A;  3SFY A;  2P9N G;  2LSU A;  4GMR A;  1OWO A;  3HXD A;  1HXI A;  4DX1 A;  2RFM A;  3RRM B;  4DUI A;  3RRU A;  4URK A;  3HHM A;  3Q49 B;  3CVX A;  5ENQ D;  3L16 A;  5FIN A;  3MKQ A;  3CQG B;  3NZU A;  4J6I A;  3UM2 A;  4HRL A;  5CMY A;  2WB2 A;  1MYO A;  3Q79 A;  1HZ4 A;  4AM9 A;  3UUX A;  4AOF A;  4ATZ D;  3C3Q A;  4N39 A;  1BU9 A;  4GTP A;  2DIW A;  5ANR A;  3V31 A;  3UT8 A;  3TXN A;  4L7T A;  3UTM A;  3ESL A;  2I1J A;  3PZ4 A;  3ZEF A;  3JUI A;  4GYO A;  1HO8 A;  5BXO A;  4GYY A;  3ZU7 B;  4GZC A;  4JA7 A;  3GZ1 A;  5JHB A;  4Z68 A;  3PS6 A;  2WMN A;  2J9Q A;  4BY6 A;  4K5B A;  2VTB A;  3NBN B;  1BPO A;  3FTS A;  1X5B A;  3ML9 A;  4G11 A;  2CFU A;  2KM4 A;  2VSO E;  3AU4 A;  2MHK A;  1N4R A;  2FEZ A;  3D9I A;  3L54 A;  3HVE A;  3UKR G;  2WPV A;  1NP7 A;  4DX7 D;  1BI8 B;  4G26 A;  4AJW A;  4JA9 A;  2H6I A;  2WVI A;  5B3S E;  3FH8 A;  1S0P A;  1JCS A;  3T8K A;  5AIJ A;  2DYS E;  1K3Z D;  3MX3 A;  5ENN A;  1IQU A;  2OEW A;  2XPI A;  1NI1 A;  5JA4 D;  4HRM B;  4WNF A;  2H6F A;  4Q94 A;  3FH5 A;  2P9I G;  2LXL A;  1OXJ A;  1FPP A;  4I6E A;  3DXM G;  3O48 A;  3PRZ A;  2GRN B;  4CGW A;  3DSX A;  5JMN D;  4FLB A;  4HOR A;  4C48 B;  4DLO A;  3D9J A;  5A23 A;  4O6F A;  2DZN A;  3DWL G;  2XZT G;  2A5E A;  3QDN A;  3IHV A;  2B0O E;  3LS8 A;  3SQV A;  4GZ3 A;  1SA4 A;  4MLP A;  2YHC A;  2OEV A;  3E32 A;  4G2V A;  4HOU A;  4LNU D;  3GW4 A;  3ZXP A;  4ANV A;  3OXG A;  5LCW J;  1UOH A;  3AG1 E;  2WXJ A;  4BEP A;  4LEU A;  3AG4 E;  3PEU B;  2VQ2 A;  1E96 B;  3D9N A;  3JUE A;  3ZUV B;  3FU3 A;  4AEZ C;  4A3V A;  1KPS B;  4RSY A;  3NF1 A;  4UQY A;  3CVP A;  2WXQ A;  2WMO A;  4ILH B;  1E90 A;  4I6G A;  3AS4 A;  2KBX A;  3LEW A;  3L82 A;  3TWS A;  3FUD A;  4HOQ A;  3C3R A;  1OWP A;  4HS2 A;  2WXI A;  3FUK A;  1SQM A;  3LDZ A;  2BED A;  3C72 A;  3QKY A;  4OAV B;  5E75 A;  1EDU A;  2DCP A;  1RZ4 A;  3B7R L;  2BTD A;  3ONK A;  2Y3A A;  3CKC A;  4EZJ A;  2IO2 C;  4UWL A;  4JEU A;  1OCZ E;  4G8L A;  1L5J A;  1JWG A;  4WNE A;  4K5A B;  2WXL A;  4TRQ A;  3FUL A;  4DX5 D;  3FUE A;  4IUL A;  1WG0 A;  3I4R B;  3IXE A;  5ENS D;  4UWK A;  2R17 C;  5DIZ A;  4F1P A;  2LO6 A;  2KAT A;  5LCW C;  3FTV A;  1H19 A;  4MRU A;  3KEZ A;  3QWP A;  2NSZ A;  2PL2 A;  2E2E A;  5AN8 A;  3AAA C;  3AS8 A;  4KT6 B;  4TXP A;  3LXU X;  1E8W A;  1N0R A;  4DX6 D;  3UM0 A;  5BUZ A;  1BLX B;  1Z3Y A;  4IN3 B;  4EEC A;  2C0M A;  3I5P A;  1N0Q A;  4TXR A;  2R03 A;  4G8K A;  4FJZ A;  2MYO A;  3FHE A;  1N52 A;  3ABM E;  2EIK E;  4OVU A;  4CCA A;  2LAI A;  3APF A;  3S7B A;  1YCS B;  5D0Q D;  5G04 C;  4UQX A;  2DBA A;  2X38 A;  2IY0 C;  5AAR A;  3ZRH A;  2P2C P;  4GAA A;  4FUL A;  4DRX E;  5J08 A;  1E7V A;  2VGX B;  2XQ0 A;  4I9E A;  1HX8 A;  2PM6 A;  4KVO A;  4U04 A;  2XGS A;  4V3I A;  4YVQ C;  3ZKJ A;  2PNN A;  1N11 A;  2CG3 A;  2QFC A;  3DPD A;  2IO3 C;  2WQH A;  1NZN A;  1OUV A;  1E8Z A;  3CEQ A;  5B1B E;  3Q5M A;  4ANU A;  4KVM A;  1H6K A;  3APD A;  3VLD A;  2FF4 A;  4LER A;  2EIN E;  4QQI A;  5FQ4 A;  3RAU A;  4HOT A;  2QC9 A;  2XS8 A;  3QK0 A;  1PAQ A;  2OOE A;  4GZ6 A;  2X6H A;  2FUL A;  3JQ0 A;  1KT0 A;  3Q47 B;  3AG2 E;  4XX5 A;  2DZO A;  1QQE A;  4FLH A;  4NRH B;  5BNW A;  4K0R A;  3TWX A;  2DVW A;  4EBA G;  3GZS A;  1YYH A;  1Z3X A;  4U0Z A;  2WQ7 A;  1UN8 A;  4FP7 A;  4FC8 A;  1KT1 A;  3CV0 A;  2Y0B G;  3QAQ A;  2XEH A;  2FBN A;  2EIM E;  4WND A;  2HM8 A;  2L0T B;  2RG8 A;  5LFA A;  3W9G A;  3ABL E;  5FIO A;  2XHE A;  1QZ2 A;  2QYJ A;  4WNG A;  3VLF A;  5BXU A;  4AV7 A;  1N4Q A;  1MHQ A;  2VTB B;  4IRU A;  4PS7 A;  3APC A;  3KD7 A;  3Q9U C;  4Y6C A;  4JB8 P;  4J8F A;  2XEV A;  3EDT B;  2XGM A;  3FTZ A;  4O1O A;  4EHM A;  3DXK G;  4C9B B;  3PE4 A;  2NYJ A;  5CBN A;  2XCC A;  2GW1 A;  4IYP A;  4Q96 A;  3ZFW A;  3E34 A;  3VTY A;  3PE3 A;  4AP2 A;  3Q9N C;  1W3B A;  1MZC A;  2H6G A;  2XPY A;  3GYZ A;  3TJP A;  3DEO A;  2ETB A;  5T8I A;  5FJY A;  1DVP A;  2YHE A;  3C5R A;  4KZ0 A;  1EPU A;  4APO A;  4O60 A;  4A3T A;  5CEA A;  4GB9 A;  1IHG A;  1INZ A;  3ASF A;  1FT2 A;  1SVX A;  3SFZ A;  4C0E A;  4YDW A;  3RU0 A;  3EHR A;  2P58 C;  3MKR A;  2KC7 A;  1JWF A;  4TUM A;  3AU5 A;  5KWD A;  5HQ8 A;  4G1T A;  3QAR A;  1OY3 D;  5KBA A;  4GA0 A;  5CMW A;  1H2U A;  1IHB A;  3G2U A;  4FHJ A;  4J8S A;  1EYH A;  3V79 K;  3FEX A;  5ARF A;  3ZW3 A;  5AJD A;  2V5F A;  1KZP A;  3PUJ A;  1G3N B;  4N3A A;  3TG4 A;  4PH4 B;  1HFA A;  3S7F A;  1NL4 A;  5CRU A;  3P2B A;  4BX9 A;  3MCX A;  1TNY A;  4CDR A;  3JCK C;  3FU0 A;  3UKU G;  2Y4T A;  3DSU A;  4KBQ A;  3KSQ A;  5AQ9 A;  2GRP B;  5HI7 A;  5KNH D;  2IOL A;  2XEN A;  2WM9 A;  1MX4 A;  4DLQ A;  3TWU A;  3OAW A;  3ASO E;  4ANX A;  1OCO E;  5EYP F;  2CHX A;  1S64 A;  3BG1 B;  5KNG A;  1S63 A;  2OCC E;  3IEG A;  2L6B A;  3DEP A;  4F3V A;  2UWJ G;  3JQ1 A;  5FWQ A;  4DPR A;  4K5C A;  3ULY A;  4TV3 A;  3LJN A;  4CZ2 D;  3LJ3 A;  4ACK A;  4JHR A;  5JHA A;  5EID A;  3RSE G;  3UT7 A;  5A6C A;  1HF8 A;  3UT4 A;  3BQO A;  4BX8 A;  3ABK E;  2IOS A;  3B7B A;  3FY4 A;  3LY9 A;  3CHM A;  1QNF A;  3RIB A;  3CR3 A;  3JXI A;  4GCO A;  2R5S A;  2OVB A;  4APF A;  4UWG A;  3FEY A;  5AYW D;  3FH7 A;  2V4L A;  3ZYK A;  3EU5 A;  3T8M A;  3PVL A;  4B94 A;  5AQ7 A;  2KCL A;  2Q7F A;  1FVH A;  2WQ6 A;  4GPM A;  4J0U A;  2OV8 A;  3V2X A;  4BET A;  3B95 A;  3ASD A;  2XS1 A;  3L13 A;  3SO8 A;  2B6C A;  3CHP A;  1E8X A;  1U3C A;  1O5M A;  5LOZ A;  4N2Q A;  2NC9 A;  4HLE A;  5C1D A;  2I9C A;  4ME2 A;  2ZGD A;  3CLJ A;  5H7P A;  1HG2 A;  3Q73 A;  3BU8 A;  3DST A;  1ZBP A;  5KJK A;  1N94 A;  4PDX A;  2A4Z A;  5AAO A;  3ISM C;  2AVP A;  1TEZ A;  5FQ6 A;  4JHJ A;  2KZT A;  5ARG A;  2JEK A;  3TWT A;  3PZD A;  2CFZ A;  5KCM A;  3NOC D;  3WXX A;  4RG9 A;  5EX3 A;  1O1S A;  3FUF A;  3NB2 A;  2VJ8 A;  4ILI A;  3KAE A;  3NQP A;  4NQ0 A;  4O1P A;  3D9H A;  4E6H A;  2P9U G;  3L9T A;  4BER A;  2ZXW E;  5G55 A;  3J5P A;  3FP3 A;  4G24 A;  4YVO A;  1K8K G;  4N3B A;  3CHO A;  3HVE B;  1E7U A;  3U66 A;  2ILR A;  1LD8 A;  2GRR B;  4GTS A;  4U95 D;  3J5Q B;  3R7R A;  4B8A A;  2WXR A;  4ACL A;  4E85 A;  3URZ A;  2R05 A;  2H6H A;  1WY6 A;  2AXV A;  1GW6 A;  2PM7 A;  3Q75 A;  4I1A A;  4AXH A;  3ZIM A;  4H7X A;  4CGV A;  4ABN A;  2I6H A;  5M72 A;  1PC2 A;  1P5Q A;  3AG3 E;  1OWM A;  4XKB A;  4XEI G;  4FJY A;  2R59 A;  3UI2 A;  2J09 A;  2VSY A;  4HI8 A;  3WG7 E;  4UQZ A;  2HO1 A;  4U8Y D;  3UIN C;  1TN8 A;  4I1M A;  3FUI A;  2WXO A;  1SZA A;  3DRA A;  1UW4 B;  2CHZ A;  2MOW A;  3UM1 A;  1UJK A;  4HVB A;  3D9P A;  1N54 A;  3LVR E;  3VLE A;  1QBQ A;  3ONL A;  3FDH A;  1Y8M A;  4MBG A;  3PH0 C;  4TXQ A;  2AW6 A;  2AXU A;  5G04 J;  2Y4U A;  4GTR A;  2FO7 A;  4HQD A;  2VSX E;  5ENO D;  2ETC A;  4U0U A;  4Y6W A;  5JJ6 A;  3MZL B;  2J4B A;  3UIO C;  3MA5 A;  1UN9 A;  4GTQ A;  3V2O A;  5IY5 E;  4UUC A;  2J49 A;  3FUH A;  4ZHB A;  4ILG A;  4KZC A;  1MJ0 A;  3PUK A;  1DC2 A;  3DSV A;  1TR4 A;  5D2M C;  2J8S D;  2J08 A;  4EZL A;  1MX6 A;  2Y1L E;  1N4P A;  3TAX A;  4L2L A;  3ASN E;  2A5U A;  2XRZ A;  4GPK A;  3I3N A;  4GCN A;  5JJ7 A;  3FUN A;  4QFV A;  3HRA A;  2I2O A;  1FT1 A;  2WXN A;  2FO1 E;  2EQX A;  4U96 D;  1KZO A;  1IXV A;  5FQ8 A;  2VYI A;  4U0S A;  1HS6 A;  3ZYL A;  3PEV B;  2YQ8 A;  4XI9 A;  3C98 A;  3OTN A;  4GTV A;  2JAB A;  5HS0 A;  5G2N A;  2PZI A;  1A17 A;  4GTM A;  3ML8 A;  4RG6 A;  3CHR A;  3FUJ A;  2WXF A;  3HG0 D;  4JXT A;  4L1B A;  3CHS A;  4I2W A;  1ZU2 A;  3SI5 A;  2PQR A;  3E4B A;  3CVV A;  4NIK A;  3ZYQ A;  3FTX A;  5CCL A;  3CK9 A;  3CHQ A;  3B7T A;  5CBO A;  1BD8 A;  3SHF A;  2IQC A;  3LCA A;  2KCV A;  1H2V C;  2EIL E;  2HR2 A;  5DBK A;  1N4S A;  1JUQ A;  3LPZ A;  1NFI E;  4OVV A;  2IU1 A;  1LD7 A;  4LRZ A;  3IBE A;  4CT0 A;  3ZPJ A;  2X6J A;  1SZ9 A;  4EPZ A;  5ANL A;  4BES A;  2V5Q C;  1OWL A;  5FZR A;  4ANW A;  3SBS A;  4HRN A;  3TL5 A;  5LP0 A;  3DSS A;  2VGX A;  3HIZ A;  3LKU A;  1TN6 A;  1H0A A;  5EKQ D;  5KJN A;  3AJI A;  1V54 E;  3ASH A;  4KYO B;  1N9A A;  5CRV A;  3D3M A;  4NAC A;  3RO3 A;  3FTY A;  3ZHE B;  1TNO A;  3SBT B;  4LCT A;  4CEM A;  4GTO A;  3PZ3 A;  4CRW A;  2CG2 A;  4JL0 A;  3W9F A;  3E37 A;  3BEE A;  1H6P A;  1EF1 C;  2V0P A;  4H7Y A;  5J90 A;  4BTB A;  3ZHE A;  4BWR A;  1OCR E;  5BPP A;  3R9M A;  3R7Q A;  1ELW A;  4N5Q A;  1HG5 A;  4B8C B;  2GRO B;  1OT8 A;  3SF4 A;  5ENP D;  3FU5 A;  4UWF A;  4LG6 A;  3N71 A;  2DYR E;  2M63 A;  4CYM D;  3L22 A;  2XGO A;  1FVF A;  2X6I A;  5FZS A;  4CDN A;  4A63 B;  3CST A;  1WAO 1;  4U8V D;  4GZ5 A;  2IF4 A;  5G05 C;  1TN7 A;  1Z6T A;  3DPY A;  2BUG A;  3HYM B;  1K1A A;  5CER B;  4DJA A;  4FHK A;  4KXK B;  3I4G A;  3MEK A;  3B13 A;  1IKN D;  2P9L G;  3FTU A;  3FU6 A;  1KLX A;  1DCE A;  3S7D A;  3SGH A;  5CED B;  4BSX A;  1K1B A;  3Q7F A;  1UG3 A;  5KJL A;  5T3R A;  3HXC A;  3Q15 A;  2OVF A;  3Q7A A;  3L17 A;  4LNB A;  4J8D A;  4B93 B;  1V55 E;  3F6Q A;  4WAF A;  3EU9 A;  3EHM A;  3SY2 A;  2L6J A;  3ZVV A;  1Y6I A;  3QWW A;  2WXG A;  3UMV A;  3CK7 A;  3UXG A;  4UI9 J;  1XNF A;  5FT9 A;  1UJJ A;  3JYS A;  3MGB A;  5ENR D;  4N5C A;  5BV1 A;  4F7A A;  2J4D A;  3L08 A;  1NA3 A;  4N2S A;  3MKQ B;  1X81 A;  5HKP A;  4U8H A;  3ENE A;  1H6O A;  1SA5 A;  2GGF A;  1WDY A;  3IV0 A;  3Q4A B;  3PNT B;  4UI9 K;  5ITZ F;  3FTW A;  1OWN A;  4I17 A;  1B89 A;  1MQS A;  5AQB A;  4PS8 A;  1OCC E;  4UI9 C;  2P9S G;  1D8E A;  4DX2 A;  1WM5 A;  5JJT A;  2ZU6 B;  2C0L A;  3QC1 A;  2DWZ A;  3QWV A;  4GMJ A;  2X6F A;  5FZQ A;  3CVN A;  5BV0 A;  2IJG X;  3HXE A;  2EIJ E;  2AWI A;  4BT9 A;  5FTP A;  3U3W A;  4A1S A;  4WUY A;  1YA0 A; 
#chains in the Genus database with same CATH homology
 5IY5 E;  3ABK E;  1V54 E;  5B3S E;  3ABL E;  5B1A E;  2EIL E;  2EIN E;  3ASN E;  3X2Q E;  3AG3 E;  2EIJ E;  3ASO E;  1V55 E;  1OCO E;  1OCC E;  1OCZ E;  2DYS E;  2ZXW E;  2DYR E;  2EIM E;  2EIK E;  3ABM E;  2Y69 E;  3AG1 E;  3AG2 E;  5B1B E;  1OCR E;  3WG7 E;  2OCC E;  3AG4 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...