2OCCE

Bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords CYTOCHROME C OXIDASE
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
total genus 41
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 1998-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 2occE00
1V55E 5B3SE 2DYRE 1V54E 3ABLE 3AG4E 2EILE 2EIJE 2Y69E 2EINE 1OCZE 3ABKE 2EIME 5B1BE 3ASNE 3ASOE 1OCOE 1OCRE 2DYSE 1OCCE 5B1AE 3AG2E 3WG7E 2EIKE 2ZXWE 3ABME 5IY5E 3AG3E 3AG1E 2OCCE 3X2QE
chains in the Genus database with same CATH superfamily
5AQ7A 3UKUG 1HFAA 2OVFA 3LJNA 3Q49B 3FTXA 4EECA 3Q5MA 4HRMB 4C48B 1EF1C 1N52A 1UJJA 3PEVB 3ML9A 3OAWA 2BTDA 3TWRA 2ETAA 4GCNA 2FULA 4GTVA 4GB9A 1P5QA 3CHRA 4GMJA 3MJWA 3QDNA 3CVXA 5EYLA 4AY5A 4Q69A 3E37A 3UM3A 1D8EA 3PH0C 4NQ0A 3NB2A 2EIJE 4GA1A 4GZ5A 3LVQE 1E8XA 4XIFA 5AQBA 3KSLA 3DPDA 2XZTG 4URKA 3ZU7B 4BTAA 1XNFA 3AU4A 4WWPA 4TXPA 3UXGA 3E30A 3ZIMA 4I1OB 2YQ8A 4AJWA 5EDSA 1QQEA 5FZSA 5DIZA 1UG3A 5JJ7A 2E2EA 4FHKA 4U8HA 4ABNA 3CVQA 4GTRA 3DSSA 3L82A 5G05J 4P29A 4RQIA 4BT9A 3ZYQA 1U3DA 4HRLA 4JHJA 5HS0A 3B7UX 4QFVA 2QY7A 3R9MA 4A3VA 3D9NA 4ANUA 4DJAA 4B0ZA 5M72A 4WWOA 2LXLA 5AIJA 3C5RA 3KEZA 1ZBPA 3FWVA 3Q4AB 4CCAA 1N54A 4CYMD 5FQ7A 3V2XA 4B94A 1HXIA 5BPPA 4RVBA 3JUEA 2H6FA 4YDOA 3BUAA 4Q94A 3CHSA 1S70B 3RU0A 2GGFA 3DXMG 5KNHD 3CK9A 3CVNA 2X6JA 2HE0A 4CT4A 3QB2A 2WXIA 3G2TA 4HQDA 4BFRA 1N0QA 4OAVB 3BG1B 2PM6A 5FJYA 2OCCE 4BEPA 1TJFA 5EILA 4EZKA 3PZ1A 3D3MA 1PC2A 2E0IA 3CVYA 3URZA 1MQSA 1Z6TA 3SBTB 2I1KA 1FVFA 3TL5A 2WQ6A 1Y6IA 4YNDA 2BKKB 4AOFA 2DZOA 3GW4A 1LD7A 5BW8C 4TUUA 2IU1A 3CHOA 4EPZA 2L0IA 3E33A 4J7WA 1N95A 3ZGQA 2CHXA 2XEVA 4GTPA 4F1SA 3LY9A 4BX8A 4KZCA 4OVUA 3B7TA 2WM9A 3PS6A 4GYWA 3IEGA 3CVVA 2ZISA 3TG5A 3QOUA 3G2WA 2F8YA 4JHKA 2Q7FA 4HI8A 4UWKA 1TNBA 4ILGA 4I6GA 2XRYA 1INZA 4C0MA 4FLBA 3IV0A 4G1TA 4UWLA 4G25A 2KBXA 3FUDA 5E76A 5FT9A 3FTWA 2IEJA 4W9RA 3AS4A 2VJ8A 4L23A 3TAXA 4N2SA 3B95A 4K5CA 3UIOC 4RLYA 3FTZA 5B3SE 2NC9A 5JJ6A 1DCEA 4LERA 2P9KG 3Q79A 1N4SA 4L2YA 3QC1A 2A4ZA 1TNYA 4A63B 5G55A 4GZ6A 1RW2A 1WDYA 3NOCD 3FHEA 3AS5A 3GZSA 2P9LG 3JQ0A 3E32A 2Y69E 3U9WA 3B7SA 4RSYA 4KYOB 1X5BA 1Z3XA 3FUKA 4B93B 3EU9A 2V8SE 5BNWA 4LRZA 2BF0X 2VSXE 4FULA 1H6PA 4YDEA 1O1TA 3NAWA 2EINE 4ILHB 4MBGA 1SW6A 3PUKA 1OCRE 5KJNA 1OCCE 2Y0BG 2R05A 5A7DB 3FU5A 3Q7AA 3QWWA 2C0LA 1JWFA 1JWGA 2AXUA 3MGBA 3ZN3A 3CKBA 5G04J 5AYWD 3FUEA 4HBDA 2AW6A 2OEWA 3WG7E 3LDZA 3UM0A 3OXFA 4Y6WA 5CHEE 3JYSA 1SA5A 3FEXA 3C3RA 3SFZA 4GYOA 1YMPA 3T5VA 5BT1A 4DI3A 4EZLA 1K8KG 4U0SA 3RRMB 2L0TB 5ANLA 3PNTB 3G2SA 4OAUC 3U64A 1SZAA 4B89A 3HHMA 4FJYA 4D10C 4XI9A 5JA4D 2XZDG 4HNAD 4UI9J 2L6JA 2PNNA 1E96B 5EN5D 2LAHA 3AJIA 5FTPA 3L6AA 3CHMA 5JHBA 3MX3A 2XEHA 5FZRA 3MEKA 4YDYA 1FCHA 3RO3A 1DVPA 1IQUA 4I1MA 4MRUA 3SY2A 1EYHA 4APOA 2V4LA 3G2VA 4GZDA 5CERB 4N39A 2P9NG 1H2VC 4GA0A 4G8LA 2HR2A 2CHZA 4Z68A 3ZNGA 1AWCB 2XGSA 4CDMA 4L1BA 2I6HA 3L22A 4I9EA 1WAO1 3EHMA 3OXGA 2B0OE 1BU9A 1HU3A 4N2QA 4YDWA 1N4PA 4CGWA 2WXKA 5T3RA 1WY6A 3KAEA 3I3NA 2GRNB 4ACKA 1JCRA 3FTUA 4CGVA 4QQIA 4KT6B 2P58C 2VYIA 2VGEA 3L17A 4KVOA 2H6IA 3VLEA 4MS6A 3CSTA 5AN8A 3W9FA 3LY7A 2AVPA 1KZOA 4GZ3A 2A5UA 3CK8A 5KWDA 3OXLA 4J8FA 1V55E 4UQXA 3UT8A 1G3NB 5FQ4A 3FFLA 2DBAA 4I9CA 3HXFA 5LFAA 2JABA 1IYGA 2WXOA 1MX2A 2WXFA 3Q9UC 2DVWA 2V4HC 4LG6A 3E34A 4TXQA 5EYPF 5EIBE 2Y4UA 3J5QB 3I5PA 3FUMA 3DWLG 4JA9A 2J9QA 3SNXA 2A5EA 4U63A 2GW1A 3S7FA 1OCOE 5EX3A 5B1AE 2LSVA 1TNOA 2KCVA 3LCAA 5HRYA 1OWMA 4EZJA 3LS8A 3EIJA 2XS8A 3FTYA 3EDTB 1WG0A 2UWJG 1L5JA 3EIQC 2XEEA 4Y6CA 3ASNE 1DCQA 4WNEA 1WM5A 2JLBA 2AXZA 4EBAG 4ZFHA 2KXPC 4KXKB 2J8SD 2XHEA 2WXGA 4HB5A 3QNKA 2MHKA 4GA2A 2EQXA 3HG0D 2KZTB 1OWPA 1LD8A 3UKRG 1H6KA 4I17A 3L13A 2WXLA 3TXMA 1QZ2A 1N0RA 3CVPA 3MV2B 1OUVA 3UINC 3HIZA 3FUJA 4ZHBA 4TUMA 4J8EA 3GYZA 1KLXA 5LCWC 3BQOA 5CECB 3LVRE 2IO2C 3PZ3A 5JJTA 1K3ZD 1IKND 1X81A 3LY8A 1S63A 2L9BA 3ONKA 4YVOA 2WXPA 4GZCA 2ZGGA 3ONLA 2EILE 2GRPB 4HORA 3RAUA 4LCTA 3Q78A 4U07A 3ESKA 4J8SA 2H6HA 2PZIA 5CBNA 3ISMC 3MA5A 3ABME 3ZXSA 2Y4TA 3KSQA 5EX0A 2LNIA 3SBSA 4DX2A 4N5QA 3W9GA 2VSYA 1ZB1A 4HRNA 4F1PA 2KZTA 4BESA 1Z5SC 1H19A 2GRMA 2YHEA 3UM2A 4K0RA 4J0UA 1TNZA 3AG2E 2P9UG 2WVIA 1PAQA 5CRVA 3T9KA 3ASHA 5KNGA 3ESLA 4XI0A 3ABLE 3FH5A 3Q7FA 4G26A 2R02A 2RD0A 4A1SA 1OWNA 1MZCA 4KZ0A 4C9BB 4RG6A 4AVXA 1KZPA 3DBSA 3B13A 5E75A 3LJ3A 2I1JA 3MV3B 2J4DA 2J08A 3N71A 2WXQA 3TWTA 3L9TA 2P9PG 3FU6A 3PE4A 1IHGA 2R17C 2QYJA 2OEVA 2WB2A 4AIFA 4JVSA 4YVQC 3D9MA 1D9SA 3JXIA 2WQHA 3DSVA 3S7BA 2BEDA 4U7EB 4CRWA 2KCKA 1E7VA 4N5CA 2DCPA 4U04A 1E8YA 3LXUX 4J8DA 5BV1A 1OWLA 1BI7B 4BERA 2BKGA 2IONA 3P1UA 1N11A 3ABKE 4X8QA 2AWIA 3NZUA 1NI1A 3U4TA 3BEEA 4AXHA 2ZXWE 3G2UA 4GCOA 4GTMA 5CRUA 2V5FA 4Q96A 4HOTA 1NL4A 2WMNA 3FULA 2FF4A 5LX8A 5AARA 1HE8A 3CIAA 5T8IA 2QC9A 4HOQA 3TXNA 3J5PA 1TN7A 3D9PA 5C1DA 2F37A 4I43A 4LNBA 3CQCB 3ML8A 2JEKA 3UX4A 3VLDA 2XGMA 4G24A 3T8KA 2HM8A 2DIWA 4JW1A 3PUJA 4G11A 4FJZA 2PL2A 1YA0A 3RRNB 2FEZA 4ANVA 4FP7A 3Q9NC 3K9IA 4I1AA 4MKTA 4APFA 3SF4A 2C0MA 2B6CA 2R59A 3ZYMA 2GRLA 3FP3A 2LXMA 2Y1LE 3QWVA 3APCA 2ZGDA 4HOSA 3D9KA 4LEUA 5D0OD 3HXEA 4IRUA 3UMVA 1W3BA 4WNDA 4JZYA 1IHBA 3HXCA 4GTQA 3CKCA 2ETCA 1RZ4A 4LUNU 3EJNA 4UUCA 3EU5A 4ANXA 5ENSD 4PUCA 2LSUA 3PREA 1E90A 4FHJA 3L54A 2XPIA 4AY6A 5ENNA 5FIOA 4XKCA 3UT4A 3UIPC 3QAQA 4UWGA 3CGHA 4GPMA 5ENRD 4CDNA 4BSXA 3ZYLA 2WXJA 4BWRA 4JXTA 3AU5A 2C2LA 2LO6A 2MYOA 3Q73A 5HKPA 4UQZA 5CMWA 4ATGA 4AP2A 3AG1E 4A3TA 4OVVA 2J07A 3SFXA 2ZIRA 3JQ1A 4ACLA 4FU3A 3FY4A 5T4YA 3DXKG 3EHRA 3PE3A 3UM1A 4L9PA 1NZNA 2RFMA 3RIBA 2P9SG 3SFYA 4LNGA 4HVBA 4GTTA 3LYAA 1O5MA 3S7JA 1E8WA 4JHRA 2IFUA 4DRXE 3ZXPA 3SO8A 3RK6A 3SD5A 2R2LA 3LEWA 4WWNA 2VTBB 4DX6D 4LSZE 4MLPA 1EDUA 1B89A 1SQMA 2QYUA 4U0UA 3C3QA 3L16A 4NACA 2R03A 5AJDA 3FUIA 3APFA 2IOSA 4ME2A 3ZHEB 5IY5E 3U3WA 4V3IA 4DI4A 4XKBA 5J90A 3DSTA 4E85A 1TEZA 3VTXA 2V0PA 5D2MC 1MX6A 4TV3A 4NIKA 1SA4A 1OT8A 3FH8A 2GRRB 4JEUA 5HI7A 4HFGA 3S2AA 4I2ZA 4XX5A 2WXHA 3PZ2A 2MOWA 1JPLA 2XCCA 1HF8A 4RG9A 4JEHA 4FC8A 4CT0A 1HG2A 3HYMB 4HS2A 5JHAA 5CBOA 2KC7A 4GPKA 3ASOE 1BPOA 2GROB 3T8MA 5ENTD 1TN8A 4DLQA 1H2UA 1BD8A 4GYYA 3C72A 2VTBA 5JMND 1UW4B 3UPVA 2LAIA 3D9JA 1TR4A 4K5BA 4AV7A 2V5QC 3CHPA 1QNFA 3QJZA 2RG8A 1NFIE 1DNPA 2ZU6B 2AJAA 5EKQD 1QBQA 3ZHEA 3GZ2A 4DK5A 3PNLB 5FZQA 1BI8B 3CSFA 5AJLA 4HLLA 2KM4A 4JA7A 1UN9A 1V54E 1IQRA 3VLFA 4G2VA 4IYPA 2NYJA 3NBNB 1K1BA 2DWZA 4I6JA 1K1AA 3CHQA 3I4RB 4DLOA 1OXJA 1S0PA 2X3MA 3FUHA 3C3OA 3T5XA 5LOZA 4BT8A 4EBAA 2FO7A 3TWWA 3D9IA 3FU3A 3ULQA 2M63A 2YHCA 4JB8P 5CCLA 3NQPA 2WXMA 2RFAA 3AG4E 4UI9C 5ARFA 2NXPA 3IKOB 3WXXA 3KD7A 3CVLA 2YINA 2PM7A 3RO2A 5DBKA 2DYSE 1U3CA 4L7TA 3RSEG 3UTMA 1OWOA 1DC2A 2XGOA 3IHVA 2RKKA 5AENA 2MRIA 1TYQG 2GRQB 3TGOA 3DPYA 1HS6A 2UY1B 3UT7A 3DRAA 3QKYA 3ZPJA 2KCLA 5FQ8A 3HXDA 4FLHA 4U8VD 2F8XK 4C0EA 5CCMA 4CEMA 3EUVA 3RKVA 1HH8A 3ULEG 3V30A 4F3VA 3UI2A 4H7YA 2WPVA 4EQFA 1SVXA 2EIME 2XQ0A 3IHYA 4O60A 3VTYA 2X6HA 4NRHB 1KT1A 2P2CP 3FTSA 1Q2ZA 1SZ9A 2FBNA 4XZ4A 2H6GA 1BLXB 4WAFA 1TJCA 1YCSB 2KATA 4KMOA 1EPUA 1O1SA 3CLJA 4J8YA 2UY1A 4OYSA 2P9IG 3PEUB 2VQ2A 1IXVA 1N4RA 4CDRA 1N94A 3KEAA 2WXRA 4BX9A 5EIDA 4WNFA 1MJ0A 3DSXA 2X6KA 1ELWA 2J49A 1E7UA 2ILRA 5C2YA 3QARA 4I6EA 3PDNA 3HDXA 2XPYA 5BXOA 2WMOA 1JUQA 5AQ9A 2BUGA 1VDYA 4PS3A 5KJKA 4PS8A 3TWVA 3CV0A 3ASGA 4I2WA 1D8DA 2L6BA 5H7PA 3CQGB 4TXRA 3JUIA 1FVHA 3R9AB 2X6IA 3R7RA 3QWPA 1MYOA 4G23A 2OOEA 3NOGD 4O1OA 3ENEA 1HG5A 2WQ7A 2LUHA 2AXVA 4IN3B 3SZ7A 1H6OA 3ZYKA 1O1RA 4BTBA 1A5EA 3DEOA 2XENA 3JCKC 4FA6A 5BV0A 2I9CA 3CK7A 3ZUVB 3FDHA 3AAAC 4F53A 4HLEA 5AQAA 3PVLA 3ZVVA 3MYVA 3OTNA 5BXUA 3ASFA 5FINA 4AM9A 4M7CA 4EHMA 4PH4B 4JPSA 1FPPA 5G05C 3X2QE 4K5AB 2R5SA 2IF4A 4HXIA 5HQ8A 1UJKA 1N9AA 4GMRA 4K03A 1HX8A 3V31A 4ANWA 3RJVA 4GMLA 1MHQA 5ENQD 1E8ZA 4DX1A 2PQRA 3DSUA 2VGYA 1HZ4A 4XE0A 3DEPA 4L2LA 4M3OA 1GW6A 5KBAA 3KS2A 3Q47B 3ULYA 2HYZA 1JCQA 4H7XA 2XCBA 2XRZA 3FH7A 1Y8MA 3C98A 3ZRHA 1OY3D 5ARGA 3S7DA 2F0YA 3TWUA 4DX7D 5BUZA 3FUFA 1UN8A 3B7BA 5D0QD 2IO3C 2IY0C 2IQCA 4DX5D 2X38A 5ENOD 3UQ3A 2FI7A 4BETA 4PDXA 2QZAA 2CG3A 3BG0B 4J6IA 3AS8A 5G2NA 3P2BA 3V2OA 4HOUA 2Y3AA 3FEYA 1KPSB 3Q15A 3RRUA 4G8KA 3SHFA 2CG2A 1H2TC 5CEAA 2DZNA 4UI9K 4DPRA 4LNUD 3JXJA 3MKQB 1ZU2A 5CEDB 3I4GA 5A6CA 1S64A 3LKUA 2J09A 2OVBA 3B7RL 3MKRA 3PRZA 3SQVA 4TRQA 3TWXA 2ONDA 1AP7A 4KVMA 3BU8A 4UWFA 2OV8A 3ZW3A 3CEQA 3D9LA 3NF1A 4KBQA 5KCMA 3CVUA 4GTSA 1H0AA 1TNUA 4BSZB 1UOHA 2VSOE 4F7AA 2IJGX 5B1BE 2I2OA 5CMYA 4O1PA 4U0ZA 4U96D 4B8CB 1YYHA 5FWQA 1TN6A 1MX4A 3MCXA 3E4BA 3MZLB 2XS1A 2DYRE 2XPZA 4NURA 3SI5A 5FQ6A 4CZ2D 3FU0A 3TJPA 4O6FA 3ZFWA 4WNGA 3TG4A 4UWHA 2CFZA 5KJLA 5LP0A 5ITZF 4N3CA 4HI9A 5ANRA 3UUXA 3HXBA 4F6RD 3LPZA 1ELKA 1HO8A 4R7LA 3MKQA 2VGXB 3D9HA 4FADA 2HO1A 1KT0A 4U95D 2IOLA 1U2VG 2J4BA 2X6FA 1OCZE 3CR3A 4IULA 4UQYA 4JL0A 5LCWJ 3IXEA 2ETBA 3APDA 3DSWA 3O48A 5A23A 3AG3E 3HVEB 3D9OA 4ATZD 2VSNA 3FTVA 5AAOA 4WUYA 3SGHA 5ENPD 3TWQA 2WXNA 4GAAA 4DUIA 4A55A 1NP7A 3NZSA 4B8AA 4XEIG 5KJMA 2CFUA 1A17A 2EIKE 3ASDA 3PZ4A 4A1GA 3IBEA 3ZKJA 2NSZA 2FO1E 3TWSA 3EHQA 3O4ZA 4GTOA 4JD2G 1QYMA 4N3BA 3Q75A 4E6HA 4U8YD 4BY6A 3V79K 4GU5A 3U66A 1ELRA 1JCSA 3GZ1A 1NA3A 3CVWA 5J08A 1Z3YA 2VGXA 1LF8A 3FUNA 1PY1A 1LTXA 4N3AA 1FT2A 5G04C 1N4QA 3F6QA 4JC8A 3HRAA 2QFCA 1FT1A 2CHWA 4PS7A 3L08A 1NA0A 2YNQA 3ZEFA 3R7QA 1XGWA 3EHNA 5D66A 2PQNA 3QK0A 4ILIA 3HVEA 4AEZC 3PZDA
chains in the Genus database with same CATH topology
1V55E 5B3SE 2DYRE 1V54E 3ABLE 3AG4E 2EILE 2EIJE 2Y69E 2EINE 1OCZE 3ABKE 2EIME 5B1BE 3ASNE 3ASOE 1OCOE 1OCRE 2DYSE 1OCCE 5B1AE 3AG2E 3WG7E 2EIKE 2ZXWE 3ABME 5IY5E 3AG3E 3AG1E 2OCCE 3X2QE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V55 E;  5B3S E;  2DYR E;  1V54 E;  3ABL E;  3AG4 E;  2EIL E;  2EIJ E;  2Y69 E;  2EIN E;  1OCZ E;  3ABK E;  2EIM E;  5B1B E;  3ASN E;  3ASO E;  1OCO E;  1OCR E;  2DYS E;  1OCC E;  5B1A E;  3AG2 E;  3WG7 E;  2EIK E;  2ZXW E;  3ABM E;  5IY5 E;  3AG3 E;  3AG1 E;  2OCC E;  3X2Q E; 
#chains in the Genus database with same CATH topology
 5AQ7 A;  3UKU G;  1HFA A;  2OVF A;  3LJN A;  3Q49 B;  3FTX A;  4EEC A;  3Q5M A;  4HRM B;  4C48 B;  1EF1 C;  1N52 A;  1UJJ A;  3PEV B;  3ML9 A;  3OAW A;  2BTD A;  3TWR A;  2ETA A;  4GCN A;  2FUL A;  4GTV A;  4GB9 A;  1P5Q A;  3CHR A;  4GMJ A;  3MJW A;  3QDN A;  3CVX A;  5EYL A;  4AY5 A;  4Q69 A;  3E37 A;  3UM3 A;  1D8E A;  3PH0 C;  4NQ0 A;  3NB2 A;  2EIJ E;  4GA1 A;  4GZ5 A;  3LVQ E;  1E8X A;  4XIF A;  5AQB A;  3KSL A;  3DPD A;  2XZT G;  4URK A;  3ZU7 B;  4BTA A;  1XNF A;  3AU4 A;  4WWP A;  4TXP A;  3UXG A;  3E30 A;  3ZIM A;  4I1O B;  2YQ8 A;  4AJW A;  5EDS A;  1QQE A;  5FZS A;  5DIZ A;  1UG3 A;  5JJ7 A;  2E2E A;  4FHK A;  4U8H A;  4ABN A;  3CVQ A;  4GTR A;  3DSS A;  3L82 A;  5G05 J;  4P29 A;  4RQI A;  4BT9 A;  3ZYQ A;  1U3D A;  4HRL A;  4JHJ A;  5HS0 A;  3B7U X;  4QFV A;  2QY7 A;  3R9M A;  4A3V A;  3D9N A;  4ANU A;  4DJA A;  4B0Z A;  5M72 A;  4WWO A;  2LXL A;  5AIJ A;  3C5R A;  3KEZ A;  1ZBP A;  3FWV A;  3Q4A B;  4CCA A;  1N54 A;  4CYM D;  5FQ7 A;  3V2X A;  4B94 A;  1HXI A;  5BPP A;  4RVB A;  3JUE A;  2H6F A;  4YDO A;  3BUA A;  4Q94 A;  3CHS A;  1S70 B;  3RU0 A;  2GGF A;  3DXM G;  5KNH D;  3CK9 A;  3CVN A;  2X6J A;  2HE0 A;  4CT4 A;  3QB2 A;  2WXI A;  3G2T A;  4HQD A;  4BFR A;  1N0Q A;  4OAV B;  3BG1 B;  2PM6 A;  5FJY A;  2OCC E;  4BEP A;  1TJF A;  5EIL A;  4EZK A;  3PZ1 A;  3D3M A;  1PC2 A;  2E0I A;  3CVY A;  3URZ A;  1MQS A;  1Z6T A;  3SBT B;  2I1K A;  1FVF A;  3TL5 A;  2WQ6 A;  1Y6I A;  4YND A;  2BKK B;  4AOF A;  2DZO A;  3GW4 A;  1LD7 A;  5BW8 C;  4TUU A;  2IU1 A;  3CHO A;  4EPZ A;  2L0I A;  3E33 A;  4J7W A;  1N95 A;  3ZGQ A;  2CHX A;  2XEV A;  4GTP A;  4F1S A;  3LY9 A;  4BX8 A;  4KZC A;  4OVU A;  3B7T A;  2WM9 A;  3PS6 A;  4GYW A;  3IEG A;  3CVV A;  2ZIS A;  3TG5 A;  3QOU A;  3G2W A;  2F8Y A;  4JHK A;  2Q7F A;  4HI8 A;  4UWK A;  1TNB A;  4ILG A;  4I6G A;  2XRY A;  1INZ A;  4C0M A;  4FLB A;  3IV0 A;  4G1T A;  4UWL A;  4G25 A;  2KBX A;  3FUD A;  5E76 A;  5FT9 A;  3FTW A;  2IEJ A;  4W9R A;  3AS4 A;  2VJ8 A;  4L23 A;  3TAX A;  4N2S A;  3B95 A;  4K5C A;  3UIO C;  4RLY A;  3FTZ A;  5B3S E;  2NC9 A;  5JJ6 A;  1DCE A;  4LER A;  2P9K G;  3Q79 A;  1N4S A;  4L2Y A;  3QC1 A;  2A4Z A;  1TNY A;  4A63 B;  5G55 A;  4GZ6 A;  1RW2 A;  1WDY A;  3NOC D;  3FHE A;  3AS5 A;  3GZS A;  2P9L G;  3JQ0 A;  3E32 A;  2Y69 E;  3U9W A;  3B7S A;  4RSY A;  4KYO B;  1X5B A;  1Z3X A;  3FUK A;  4B93 B;  3EU9 A;  2V8S E;  5BNW A;  4LRZ A;  2BF0 X;  2VSX E;  4FUL A;  1H6P A;  4YDE A;  1O1T A;  3NAW A;  2EIN E;  4ILH B;  4MBG A;  1SW6 A;  3PUK A;  1OCR E;  5KJN A;  1OCC E;  2Y0B G;  2R05 A;  5A7D B;  3FU5 A;  3Q7A A;  3QWW A;  2C0L A;  1JWF A;  1JWG A;  2AXU A;  3MGB A;  3ZN3 A;  3CKB A;  5G04 J;  5AYW D;  3FUE A;  4HBD A;  2AW6 A;  2OEW A;  3WG7 E;  3LDZ A;  3UM0 A;  3OXF A;  4Y6W A;  5CHE E;  3JYS A;  1SA5 A;  3FEX A;  3C3R A;  3SFZ A;  4GYO A;  1YMP A;  3T5V A;  5BT1 A;  4DI3 A;  4EZL A;  1K8K G;  4U0S A;  3RRM B;  2L0T B;  5ANL A;  3PNT B;  3G2S A;  4OAU C;  3U64 A;  1SZA A;  4B89 A;  3HHM A;  4FJY A;  4D10 C;  4XI9 A;  5JA4 D;  2XZD G;  4HNA D;  4UI9 J;  2L6J A;  2PNN A;  1E96 B;  5EN5 D;  2LAH A;  3AJI A;  5FTP A;  3L6A A;  3CHM A;  5JHB A;  3MX3 A;  2XEH A;  5FZR A;  3MEK A;  4YDY A;  1FCH A;  3RO3 A;  1DVP A;  1IQU A;  4I1M A;  4MRU A;  3SY2 A;  1EYH A;  4APO A;  2V4L A;  3G2V A;  4GZD A;  5CER B;  4N39 A;  2P9N G;  1H2V C;  4GA0 A;  4G8L A;  2HR2 A;  2CHZ A;  4Z68 A;  3ZNG A;  1AWC B;  2XGS A;  4CDM A;  4L1B A;  2I6H A;  3L22 A;  4I9E A;  1WAO 1;  3EHM A;  3OXG A;  2B0O E;  1BU9 A;  1HU3 A;  4N2Q A;  4YDW A;  1N4P A;  4CGW A;  2WXK A;  5T3R A;  1WY6 A;  3KAE A;  3I3N A;  2GRN B;  4ACK A;  1JCR A;  3FTU A;  4CGV A;  4QQI A;  4KT6 B;  2P58 C;  2VYI A;  2VGE A;  3L17 A;  4KVO A;  2H6I A;  3VLE A;  4MS6 A;  3CST A;  5AN8 A;  3W9F A;  3LY7 A;  2AVP A;  1KZO A;  4GZ3 A;  2A5U A;  3CK8 A;  5KWD A;  3OXL A;  4J8F A;  1V55 E;  4UQX A;  3UT8 A;  1G3N B;  5FQ4 A;  3FFL A;  2DBA A;  4I9C A;  3HXF A;  5LFA A;  2JAB A;  1IYG A;  2WXO A;  1MX2 A;  2WXF A;  3Q9U C;  2DVW A;  2V4H C;  4LG6 A;  3E34 A;  4TXQ A;  5EYP F;  5EIB E;  2Y4U A;  3J5Q B;  3I5P A;  3FUM A;  3DWL G;  4JA9 A;  2J9Q A;  3SNX A;  2A5E A;  4U63 A;  2GW1 A;  3S7F A;  1OCO E;  5EX3 A;  5B1A E;  2LSV A;  1TNO A;  2KCV A;  3LCA A;  5HRY A;  1OWM A;  4EZJ A;  3LS8 A;  3EIJ A;  2XS8 A;  3FTY A;  3EDT B;  1WG0 A;  2UWJ G;  1L5J A;  3EIQ C;  2XEE A;  4Y6C A;  3ASN E;  1DCQ A;  4WNE A;  1WM5 A;  2JLB A;  2AXZ A;  4EBA G;  4ZFH A;  2KXP C;  4KXK B;  2J8S D;  2XHE A;  2WXG A;  4HB5 A;  3QNK A;  2MHK A;  4GA2 A;  2EQX A;  3HG0 D;  2KZT B;  1OWP A;  1LD8 A;  3UKR G;  1H6K A;  4I17 A;  3L13 A;  2WXL A;  3TXM A;  1QZ2 A;  1N0R A;  3CVP A;  3MV2 B;  1OUV A;  3UIN C;  3HIZ A;  3FUJ A;  4ZHB A;  4TUM A;  4J8E A;  3GYZ A;  1KLX A;  5LCW C;  3BQO A;  5CEC B;  3LVR E;  2IO2 C;  3PZ3 A;  5JJT A;  1K3Z D;  1IKN D;  1X81 A;  3LY8 A;  1S63 A;  2L9B A;  3ONK A;  4YVO A;  2WXP A;  4GZC A;  2ZGG A;  3ONL A;  2EIL E;  2GRP B;  4HOR A;  3RAU A;  4LCT A;  3Q78 A;  4U07 A;  3ESK A;  4J8S A;  2H6H A;  2PZI A;  5CBN A;  3ISM C;  3MA5 A;  3ABM E;  3ZXS A;  2Y4T A;  3KSQ A;  5EX0 A;  2LNI A;  3SBS A;  4DX2 A;  4N5Q A;  3W9G A;  2VSY A;  1ZB1 A;  4HRN A;  4F1P A;  2KZT A;  4BES A;  1Z5S C;  1H19 A;  2GRM A;  2YHE A;  3UM2 A;  4K0R A;  4J0U A;  1TNZ A;  3AG2 E;  2P9U G;  2WVI A;  1PAQ A;  5CRV A;  3T9K A;  3ASH A;  5KNG A;  3ESL A;  4XI0 A;  3ABL E;  3FH5 A;  3Q7F A;  4G26 A;  2R02 A;  2RD0 A;  4A1S A;  1OWN A;  1MZC A;  4KZ0 A;  4C9B B;  4RG6 A;  4AVX A;  1KZP A;  3DBS A;  3B13 A;  5E75 A;  3LJ3 A;  2I1J A;  3MV3 B;  2J4D A;  2J08 A;  3N71 A;  2WXQ A;  3TWT A;  3L9T A;  2P9P G;  3FU6 A;  3PE4 A;  1IHG A;  2R17 C;  2QYJ A;  2OEV A;  2WB2 A;  4AIF A;  4JVS A;  4YVQ C;  3D9M A;  1D9S A;  3JXI A;  2WQH A;  3DSV A;  3S7B A;  2BED A;  4U7E B;  4CRW A;  2KCK A;  1E7V A;  4N5C A;  2DCP A;  4U04 A;  1E8Y A;  3LXU X;  4J8D A;  5BV1 A;  1OWL A;  1BI7 B;  4BER A;  2BKG A;  2ION A;  3P1U A;  1N11 A;  3ABK E;  4X8Q A;  2AWI A;  3NZU A;  1NI1 A;  3U4T A;  3BEE A;  4AXH A;  2ZXW E;  3G2U A;  4GCO A;  4GTM A;  5CRU A;  2V5F A;  4Q96 A;  4HOT A;  1NL4 A;  2WMN A;  3FUL A;  2FF4 A;  5LX8 A;  5AAR A;  1HE8 A;  3CIA A;  5T8I A;  2QC9 A;  4HOQ A;  3TXN A;  3J5P A;  1TN7 A;  3D9P A;  5C1D A;  2F37 A;  4I43 A;  4LNB A;  3CQC B;  3ML8 A;  2JEK A;  3UX4 A;  3VLD A;  2XGM A;  4G24 A;  3T8K A;  2HM8 A;  2DIW A;  4JW1 A;  3PUJ A;  4G11 A;  4FJZ A;  2PL2 A;  1YA0 A;  3RRN B;  2FEZ A;  4ANV A;  4FP7 A;  3Q9N C;  3K9I A;  4I1A A;  4MKT A;  4APF A;  3SF4 A;  2C0M A;  2B6C A;  2R59 A;  3ZYM A;  2GRL A;  3FP3 A;  2LXM A;  2Y1L E;  3QWV A;  3APC A;  2ZGD A;  4HOS A;  3D9K A;  4LEU A;  5D0O D;  3HXE A;  4IRU A;  3UMV A;  1W3B A;  4WND A;  4JZY A;  1IHB A;  3HXC A;  4GTQ A;  3CKC A;  2ETC A;  1RZ4 A;  4LUN U;  3EJN A;  4UUC A;  3EU5 A;  4ANX A;  5ENS D;  4PUC A;  2LSU A;  3PRE A;  1E90 A;  4FHJ A;  3L54 A;  2XPI A;  4AY6 A;  5ENN A;  5FIO A;  4XKC A;  3UT4 A;  3UIP C;  3QAQ A;  4UWG A;  3CGH A;  4GPM A;  5ENR D;  4CDN A;  4BSX A;  3ZYL A;  2WXJ A;  4BWR A;  4JXT A;  3AU5 A;  2C2L A;  2LO6 A;  2MYO A;  3Q73 A;  5HKP A;  4UQZ A;  5CMW A;  4ATG A;  4AP2 A;  3AG1 E;  4A3T A;  4OVV A;  2J07 A;  3SFX A;  2ZIR A;  3JQ1 A;  4ACL A;  4FU3 A;  3FY4 A;  5T4Y A;  3DXK G;  3EHR A;  3PE3 A;  3UM1 A;  4L9P A;  1NZN A;  2RFM A;  3RIB A;  2P9S G;  3SFY A;  4LNG A;  4HVB A;  4GTT A;  3LYA A;  1O5M A;  3S7J A;  1E8W A;  4JHR A;  2IFU A;  4DRX E;  3ZXP A;  3SO8 A;  3RK6 A;  3SD5 A;  2R2L A;  3LEW A;  4WWN A;  2VTB B;  4DX6 D;  4LSZ E;  4MLP A;  1EDU A;  1B89 A;  1SQM A;  2QYU A;  4U0U A;  3C3Q A;  3L16 A;  4NAC A;  2R03 A;  5AJD A;  3FUI A;  3APF A;  2IOS A;  4ME2 A;  3ZHE B;  5IY5 E;  3U3W A;  4V3I A;  4DI4 A;  4XKB A;  5J90 A;  3DST A;  4E85 A;  1TEZ A;  3VTX A;  2V0P A;  5D2M C;  1MX6 A;  4TV3 A;  4NIK A;  1SA4 A;  1OT8 A;  3FH8 A;  2GRR B;  4JEU A;  5HI7 A;  4HFG A;  3S2A A;  4I2Z A;  4XX5 A;  2WXH A;  3PZ2 A;  2MOW A;  1JPL A;  2XCC A;  1HF8 A;  4RG9 A;  4JEH A;  4FC8 A;  4CT0 A;  1HG2 A;  3HYM B;  4HS2 A;  5JHA A;  5CBO A;  2KC7 A;  4GPK A;  3ASO E;  1BPO A;  2GRO B;  3T8M A;  5ENT D;  1TN8 A;  4DLQ A;  1H2U A;  1BD8 A;  4GYY A;  3C72 A;  2VTB A;  5JMN D;  1UW4 B;  3UPV A;  2LAI A;  3D9J A;  1TR4 A;  4K5B A;  4AV7 A;  2V5Q C;  3CHP A;  1QNF A;  3QJZ A;  2RG8 A;  1NFI E;  1DNP A;  2ZU6 B;  2AJA A;  5EKQ D;  1QBQ A;  3ZHE A;  3GZ2 A;  4DK5 A;  3PNL B;  5FZQ A;  1BI8 B;  3CSF A;  5AJL A;  4HLL A;  2KM4 A;  4JA7 A;  1UN9 A;  1V54 E;  1IQR A;  3VLF A;  4G2V A;  4IYP A;  2NYJ A;  3NBN B;  1K1B A;  2DWZ A;  4I6J A;  1K1A A;  3CHQ A;  3I4R B;  4DLO A;  1OXJ A;  1S0P A;  2X3M A;  3FUH A;  3C3O A;  3T5X A;  5LOZ A;  4BT8 A;  4EBA A;  2FO7 A;  3TWW A;  3D9I A;  3FU3 A;  3ULQ A;  2M63 A;  2YHC A;  4JB8 P;  5CCL A;  3NQP A;  2WXM A;  2RFA A;  3AG4 E;  4UI9 C;  5ARF A;  2NXP A;  3IKO B;  3WXX A;  3KD7 A;  3CVL A;  2YIN A;  2PM7 A;  3RO2 A;  5DBK A;  2DYS E;  1U3C A;  4L7T A;  3RSE G;  3UTM A;  1OWO A;  1DC2 A;  2XGO A;  3IHV A;  2RKK A;  5AEN A;  2MRI A;  1TYQ G;  2GRQ B;  3TGO A;  3DPY A;  1HS6 A;  2UY1 B;  3UT7 A;  3DRA A;  3QKY A;  3ZPJ A;  2KCL A;  5FQ8 A;  3HXD A;  4FLH A;  4U8V D;  2F8X K;  4C0E A;  5CCM A;  4CEM A;  3EUV A;  3RKV A;  1HH8 A;  3ULE G;  3V30 A;  4F3V A;  3UI2 A;  4H7Y A;  2WPV A;  4EQF A;  1SVX A;  2EIM E;  2XQ0 A;  3IHY A;  4O60 A;  3VTY A;  2X6H A;  4NRH B;  1KT1 A;  2P2C P;  3FTS A;  1Q2Z A;  1SZ9 A;  2FBN A;  4XZ4 A;  2H6G A;  1BLX B;  4WAF A;  1TJC A;  1YCS B;  2KAT A;  4KMO A;  1EPU A;  1O1S A;  3CLJ A;  4J8Y A;  2UY1 A;  4OYS A;  2P9I G;  3PEU B;  2VQ2 A;  1IXV A;  1N4R A;  4CDR A;  1N94 A;  3KEA A;  2WXR A;  4BX9 A;  5EID A;  4WNF A;  1MJ0 A;  3DSX A;  2X6K A;  1ELW A;  2J49 A;  1E7U A;  2ILR A;  5C2Y A;  3QAR A;  4I6E A;  3PDN A;  3HDX A;  2XPY A;  5BXO A;  2WMO A;  1JUQ A;  5AQ9 A;  2BUG A;  1VDY A;  4PS3 A;  5KJK A;  4PS8 A;  3TWV A;  3CV0 A;  3ASG A;  4I2W A;  1D8D A;  2L6B A;  5H7P A;  3CQG B;  4TXR A;  3JUI A;  1FVH A;  3R9A B;  2X6I A;  3R7R A;  3QWP A;  1MYO A;  4G23 A;  2OOE A;  3NOG D;  4O1O A;  3ENE A;  1HG5 A;  2WQ7 A;  2LUH A;  2AXV A;  4IN3 B;  3SZ7 A;  1H6O A;  3ZYK A;  1O1R A;  4BTB A;  1A5E A;  3DEO A;  2XEN A;  3JCK C;  4FA6 A;  5BV0 A;  2I9C A;  3CK7 A;  3ZUV B;  3FDH A;  3AAA C;  4F53 A;  4HLE A;  5AQA A;  3PVL A;  3ZVV A;  3MYV A;  3OTN A;  5BXU A;  3ASF A;  5FIN A;  4AM9 A;  4M7C A;  4EHM A;  4PH4 B;  4JPS A;  1FPP A;  5G05 C;  3X2Q E;  4K5A B;  2R5S A;  2IF4 A;  4HXI A;  5HQ8 A;  1UJK A;  1N9A A;  4GMR A;  4K03 A;  1HX8 A;  3V31 A;  4ANW A;  3RJV A;  4GML A;  1MHQ A;  5ENQ D;  1E8Z A;  4DX1 A;  2PQR A;  3DSU A;  2VGY A;  1HZ4 A;  4XE0 A;  3DEP A;  4L2L A;  4M3O A;  1GW6 A;  5KBA A;  3KS2 A;  3Q47 B;  3ULY A;  2HYZ A;  1JCQ A;  4H7X A;  2XCB A;  2XRZ A;  3FH7 A;  1Y8M A;  3C98 A;  3ZRH A;  1OY3 D;  5ARG A;  3S7D A;  2F0Y A;  3TWU A;  4DX7 D;  5BUZ A;  3FUF A;  1UN8 A;  3B7B A;  5D0Q D;  2IO3 C;  2IY0 C;  2IQC A;  4DX5 D;  2X38 A;  5ENO D;  3UQ3 A;  2FI7 A;  4BET A;  4PDX A;  2QZA A;  2CG3 A;  3BG0 B;  4J6I A;  3AS8 A;  5G2N A;  3P2B A;  3V2O A;  4HOU A;  2Y3A A;  3FEY A;  1KPS B;  3Q15 A;  3RRU A;  4G8K A;  3SHF A;  2CG2 A;  1H2T C;  5CEA A;  2DZN A;  4UI9 K;  4DPR A;  4LNU D;  3JXJ A;  3MKQ B;  1ZU2 A;  5CED B;  3I4G A;  5A6C A;  1S64 A;  3LKU A;  2J09 A;  2OVB A;  3B7R L;  3MKR A;  3PRZ A;  3SQV A;  4TRQ A;  3TWX A;  2OND A;  1AP7 A;  4KVM A;  3BU8 A;  4UWF A;  2OV8 A;  3ZW3 A;  3CEQ A;  3D9L A;  3NF1 A;  4KBQ A;  5KCM A;  3CVU A;  4GTS A;  1H0A A;  1TNU A;  4BSZ B;  1UOH A;  2VSO E;  4F7A A;  2IJG X;  5B1B E;  2I2O A;  5CMY A;  4O1P A;  4U0Z A;  4U96 D;  4B8C B;  1YYH A;  5FWQ A;  1TN6 A;  1MX4 A;  3MCX A;  3E4B A;  3MZL B;  2XS1 A;  2DYR E;  2XPZ A;  4NUR A;  3SI5 A;  5FQ6 A;  4CZ2 D;  3FU0 A;  3TJP A;  4O6F A;  3ZFW A;  4WNG A;  3TG4 A;  4UWH A;  2CFZ A;  5KJL A;  5LP0 A;  5ITZ F;  4N3C A;  4HI9 A;  5ANR A;  3UUX A;  3HXB A;  4F6R D;  3LPZ A;  1ELK A;  1HO8 A;  4R7L A;  3MKQ A;  2VGX B;  3D9H A;  4FAD A;  2HO1 A;  1KT0 A;  4U95 D;  2IOL A;  1U2V G;  2J4B A;  2X6F A;  1OCZ E;  3CR3 A;  4IUL A;  4UQY A;  4JL0 A;  5LCW J;  3IXE A;  2ETB A;  3APD A;  3DSW A;  3O48 A;  5A23 A;  3AG3 E;  3HVE B;  3D9O A;  4ATZ D;  2VSN A;  3FTV A;  5AAO A;  4WUY A;  3SGH A;  5ENP D;  3TWQ A;  2WXN A;  4GAA A;  4DUI A;  4A55 A;  1NP7 A;  3NZS A;  4B8A A;  4XEI G;  5KJM A;  2CFU A;  1A17 A;  2EIK E;  3ASD A;  3PZ4 A;  4A1G A;  3IBE A;  3ZKJ A;  2NSZ A;  2FO1 E;  3TWS A;  3EHQ A;  3O4Z A;  4GTO A;  4JD2 G;  1QYM A;  4N3B A;  3Q75 A;  4E6H A;  4U8Y D;  4BY6 A;  3V79 K;  4GU5 A;  3U66 A;  1ELR A;  1JCS A;  3GZ1 A;  1NA3 A;  3CVW A;  5J08 A;  1Z3Y A;  2VGX A;  1LF8 A;  3FUN A;  1PY1 A;  1LTX A;  4N3A A;  1FT2 A;  5G04 C;  1N4Q A;  3F6Q A;  4JC8 A;  3HRA A;  2QFC A;  1FT1 A;  2CHW A;  4PS7 A;  3L08 A;  1NA0 A;  2YNQ A;  3ZEF A;  3R7Q A;  1XGW A;  3EHN A;  5D66 A;  2PQN A;  3QK0 A;  4ILI A;  3HVE A;  4AEZ C;  3PZD A; 
#chains in the Genus database with same CATH homology
 1V55 E;  5B3S E;  2DYR E;  1V54 E;  3ABL E;  3AG4 E;  2EIL E;  2EIJ E;  2Y69 E;  2EIN E;  1OCZ E;  3ABK E;  2EIM E;  5B1B E;  3ASN E;  3ASO E;  1OCO E;  1OCR E;  2DYS E;  1OCC E;  5B1A E;  3AG2 E;  3WG7 E;  2EIK E;  2ZXW E;  3ABM E;  5IY5 E;  3AG3 E;  3AG1 E;  2OCC E;  3X2Q E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...