2P9KG

Crystal structure of bovine arp2/3 complex co-crystallized with atp and crosslinked with glutaraldehyde
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
136
Chain Sequence
ARFRKVDVDEYDENKFVDEAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
total genus 45
structure length 136
sequence length 143
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 2p9kG00
3DWLG 3DXMG 4JD2G 3UKUG 2P9SG 1K8KG 2P9NG 2P9UG 3UKRG 2P9IG 2P9PG 3ULEG 2P9LG 1U2VG 3DXKG 2P9KG 4XEIG 1TYQG 3RSEG
chains in the Genus database with same CATH superfamily
5EILA 4JZYA 4BESA 3U64A 1N52A 3CSTA 4IULA 4UWGA 1D9SA 4URKA 4IN3B 5CEAA 3ZYKA 4LERA 3PUJA 4CRWA 4JHRA 2P9UG 3LXUX 4K5CA 2XENA 2UWJG 2C0LA 2UY1A 3NAWA 1IKND 2M63A 3RU0A 5EIBE 1OUVA 1Y6IA 2NSZA 3D9JA 5KNGA 5FT9A 1HFAA 2I2OA 2EIME 4G11A 2V5QC 5AN8A 3LVQE 4KBQA 5KCMA 1IHBA 3EHNA 3FH5A 4JHKA 3T9KA 4AIFA 1TNYA 4I2WA 3E4BA 5EDSA 3CGHA 1G3NB 3PZDA 5T4YA 3SNXA 4BTAA 4YDYA 3W9GA 1LF8A 2WXMA 4WWPA 3Q5MA 4XX5A 2LXLA 4EQFA 3ABME 1MJ0A 5KBAA 1IHGA 3CVUA 5HS0A 4ANXA 1DCQA 1E8XA 5FQ7A 4H7YA 3I4RB 3FUHA 4U07A 1IQRA 3S7JA 3QARA 4LNBA 3TXMA 3ZYLA 1MX4A 3SFZA 4F53A 2VGXB 4I43A 4HRNA 3D9LA 4U96D 2XPYA 2ILRA 3ZGQA 4ABNA 3L82A 1N4PA 2VSXE 5D2MC 2WXPA 5JHAA 4GYYA 4XI0A 2QC9A 4CGVA 2RG8A 1IQUA 3LY7A 3T8KA 4A1GA 3NBNB 2KZTB 1IXVA 3E32A 4Q94A 2R03A 3AU4A 1JWFA 3Q79A 3SI5A 2WMOA 3L54A 4BFRA 5BV1A 1AWCB 1N4RA 3PREA 4GTOA 3UXGA 4HOTA 3WG7E 1JCRA 2P9KG 4GU5A 2E0IA 4ILHB 3BG0B 2A4ZA 2XCBA 4CCAA 3ZKJA 2CHXA 1FVFA 3C98A 1UJJA 4AY6A 1HX8A 2GRLA 3ZVVA 3FTSA 2WB2A 2L6BA 5BUZA 3UT8A 2CHZA 4OAUC 3Q73A 4C9BB 1PY1A 3UPVA 3PEVB 5AARA 2EINE 4EBAG 1O5MA 4BY6A 2WVIA 5CEDB 2GW1A 4FP7A 2VTBA 1QZ2A 1NA3A 2YQ8A 3AG2E 4HI8A 4EHMA 3DWLG 2HE0A 3ULQA 1TJFA 3HIZA 1DVPA 2CG3A 3DRAA 1NP7A 5FZSA 4XKCA 3FTVA 2IU1A 2AW6A 4GTRA 3FWVA 1O1SA 4B89A 2XRZA 1MZCA 4TUMA 3GYZA 4KZCA 1D8EA 3CEQA 2PQRA 4EECA 3V31A 4AY5A 4AP2A 4FA6A 3SD5A 1EPUA 4GYWA 3FP3A 4N2SA 3QK0A 5ARFA 4UWFA 1EYHA 3AG3E 5CBNA 4LNGA 5ANRA 4ACKA 4N3BA 4N5QA 3NQPA 4R7LA 3EIQC 2A5EA 4QFVA 1S70B 1OCOE 1MHQA 1H2VC 4MRUA 3CHRA 2XRYA 3HXBA 5FQ4A 5G04J 3B7RL 3RO3A 2XEEA 2P58C 2J09A 2FULA 4DPRA 2UY1B 2VSYA 2XEHA 3DPYA 3ESLA 1DC2A 3ZW3A 1N4SA 4NACA 3BEEA 1Z5SC 1U2VG 2BF0X 5BPPA 4HLLA 4CYMD 2BKGA 4GZCA 2KATA 4WWNA 2FO1E 5ARGA 1KT0A 1Z6TA 2J49A 2J07A 3UM3A 3SZ7A 5AENA 3V2XA 5AYWD 2ETCA 2E2EA 5HRYA 1OWPA 3C5RA 3UIOC 1U3CA 3QWWA 1TR4A 2XGOA 5LCWC 1H0AA 3FTWA 3AU5A 4XEIG 4GTTA 3URZA 3VTYA 1SVXA 3N71A 4XI9A 3V30A 3ML9A 3EUVA 3FTUA 2PM7A 3ZUVB 4LSZE 4ZHBA 4CZ2D 2I1KA 5CRUA 4G24A 3PEUB 5C1DA 4UI9C 1UG3A 5HQ8A 1JCSA 4E6HA 3JQ0A 4XZ4A 3CHOA 4DRXE 3S7DA 3FUJA 4MS6A 2V0PA 2NXPA 3D9PA 1SQMA 3QJZA 1SZAA 4G1TA 2L0IA 1LTXA 1NL4A 3MEKA 2ETAA 2KC7A 2LUHA 1H6OA 5JA4D 2LNIA 2P9PG 4MKTA 4GA2A 4I6JA 5JMND 1A17A 2RD0A 5D0QD 3KEZA 3ZHEB 2DYRE 2R17C 4U8YD 1X5BA 4FULA 4KVOA 3TWUA 3ABLE 4F6RD 4TXQA 2ZIRA 4UWKA 3I3NA 2A5UA 1LD8A 1OY3D 2MHKA 5ENPD 3CR3A 5LP0A 3FH7A 5ENSD 4G8LA 3Q78A 5KNHD 3S2AA 3FU3A 3Q75A 4HRLA 2BTDA 4DI4A 5T3RA 3CQCB 2RKKA 2XQ0A 4Z68A 3UMVA 4ANUA 5HKPA 4CDRA 2I9CA 2Y1LE 1WG0A 3TGOA 2VTBB 2OEWA 4C48B 2QYJA 4DX2A 3MGBA 3E33A 3LKUA 3CKCA 4RLYA 1KT1A 5EN5D 4F1PA 5EX3A 3HG0D 3O4ZA 3LCAA 3TWRA 3CVYA 4AOFA 3MJWA 3G2UA 2QFCA 3FUKA 3ENEA 3WXXA 4UWLA 5FQ6A 1TJCA 3I5PA 4LCTA 3FFLA 3CKBA 4Y6WA 1QYMA 1P5QA 3MKQA 4CT0A 4ILGA 3T5XA 2IFUA 5JHBA 4L7TA 3W9FA 4ANVA 5KJLA 3ZU7B 3KEAA 2F0YA 3VLDA 4M7CA 3TJPA 4O60A 4I9CA 3UM2A 4AJWA 1OWOA 4DJAA 4G23A 2WXOA 2LAIA 4KT6B 4B94A 5BXOA 2F8YA 4BWRA 2OVBA 2OVFA 4YDWA 3G2SA 1H6KA 2HYZA 3GW4A 4TUUA 3D3MA 3G2WA 4CGWA 4U0SA 2L0TB 2P9IG 4OVVA 5KJMA 1KLXA 2B6CA 2MYOA 5CHEE 1E90A 4U8HA 3MV3B 4GMLA 3RK6A 5ENNA 1HE8A 3DSXA 1OT8A 4GTSA 2C0MA 1BI8B 4PUCA 3FHEA 4FJYA 3ZFWA 4DX1A 4L9PA 5FQ8A 5BW8C 3G2VA 2IJGX 4K5AB 1ZU2A 2VQ2A 5AAOA 2GRRB 3CVLA 1OWNA 5E75A 1WM5A 3EDTB 2J08A 2WXLA 5D0OD 4F1SA 1JUQA 3CVQA 2IONA 3UX4A 5BNWA 4JHJA 2P9LG 4W9RA 2LAHA 4LNUD 2R02A 2KXPC 3IEGA 5CERB 3AG1E 4HFGA 3ZNGA 3EIJA 4N3CA 5CMYA 2Y0BG 1SZ9A 2PM6A 2AWIA 3PUKA 5CRVA 3LDZA 4GA1A 4JEHA 3IXEA 1L5JA 3QWVA 2X3MA 2PZIA 4G8KA 4WWOA 4BT8A 5AQ9A 1O1RA 4WNEA 4GTVA 3ASFA 3FU0A 5ENOD 4ACLA 3ISMC 5G05C 3KSQA 3FH8A 4CDMA 3QWPA 5EX0A 2VJ8A 4GMJA 3CSFA 4F3VA 1UN9A 4DX7D 1N0RA 1N11A 4B8CB 2J8SD 4F7AA 3EHMA 4M3OA 4JD2G 2F8XK 3SHFA 1HXIA 5LCWJ 3PZ3A 2H6GA 3TXNA 3MV2B 3B7TA 3FTXA 5ENTD 4AM9A 3UT4A 2XS8A 2X6KA 3ZHEA 2YHCA 4I6EA 1H2TC 3R7RA 4I17A 1BD8A 3OAWA 3Q7AA 1WAO1 3E34A 2EIKE 1X81A 1K1BA 1INZA 5KWDA 4KXKB 4GCNA 4G2VA 5B1AE 4RSYA 2BUGA 1S0PA 5KJKA 3FULA 2X6HA 4YVOA 4U0UA 4MBGA 5ENRD 4ME2A 1TYQG 1K3ZD 3ZRHA 2YINA 4DLQA 3MZLB 3R7QA 2IOLA 4XIFA 4DLOA 1FT2A 3DEOA 4ANWA 1MX2A 1FVHA 2CFZA 3FUDA 4HS2A 3ZXSA 1N0QA 4GPMA 1Z3XA 3ZN3A 3CIAA 5AQ7A 3SFYA 4FC8A 5EIDA 4TV3A 4GAAA 3MKQB 2IO3C 5B1BE 1S64A 4YNDA 5J90A 5FTPA 3P2BA 5A23A 4DX5D 1U3DA 3R9AB 1RZ4A 3JUIA 3EHQA 4FJZA 1UW4B 1ELWA 2HM8A 2XZTG 3D9HA 4WUYA 2AJAA 1MX6A 2JABA 3CVXA 2WXJA 4B0ZA 4GPKA 4HXIA 3RSEG 3LYAA 2VSNA 3C3RA 3HDXA 4ILIA 2WMNA 3E37A 3L17A 3CK7A 1NZNA 3IHYA 4N2QA 4GTPA 2FI7A 3B95A 4FLHA 4I1AA 3PNLB 4B93B 5HI7A 3TL5A 4JW1A 1Y8MA 3JXIA 2PQNA 2V4LA 3HXEA 3F6QA 4RG6A 3D9KA 3PZ2A 2X6JA 3HXCA 3CK9A 3CK8A 3U3WA 4J8YA 3Q9NC 1GW6A 4YDOA 1HS6A 2KM4A 3MA5A 4OAVB 3ULYA 3UUXA 5JJ7A 2OEVA 1V55E 5M72A 4EPZA 3DXMG 4EZJA 2LO6A 1YMPA 4RVBA 1YA0A 1UOHA 4U7EB 2P9NG 1EDUA 5FZRA 2L9BA 1QBQA 1ZBPA 5ENQD 2AVPA 1OCZE 4BEPA 3LS8A 3AG4E 3FDHA 3TWSA 1HG5A 4HI9A 4X8QA 4HOQA 3J5PA 3ZXPA 5JJ6A 2LSVA 4HQDA 3B7SA 2FF4A 1ELRA 3NF1A 4UQYA 1MYOA 1JWGA 3LJ3A 1S63A 4J8SA 3Q47B 1NFIE 1DNPA 3IV0A 2WXQA 3FU6A 1N4QA 3BU8A 4FADA 3L22A 1O1TA 1TN7A 1HG2A 1QQEA 4YVQC 5KJNA 4U95D 3OTNA 1OWLA 4WNFA 2EIJE 3PS6A 1OXJA 2WQHA 3HVEA 3L13A 3B13A 1TN6A 4GYOA 4JA9A 4JXTA 4HBDA 2PNNA 1K1AA 2XS1A 1TEZA 3FY4A 3TWXA 1H19A 3CVWA 4O6FA 4NURA 1OWMA 2Y3AA 4G25A 1BPOA 2WM9A 4UWHA 4KVMA 4IYPA 3I4GA 4LG6A 2YNQA 3SBTB 3TWWA 1UJKA 3D9OA 4V3IA 1V54E 1E7VA 4GCOA 3RJVA 4A3VA 1SW6A 3TG5A 5DIZA 3DEPA 5G05J 3FU5A 3LPZA 4NQ0A 4FHJA 4Y6CA 4XE0A 4N5CA 4LRZA 3JCKC 3QOUA 3L9TA 5E76A 2DVWA 3EU9A 4JL0A 3K9IA 3ML8A 4IRUA 3FEYA 2XGMA 4HORA 3KD7A 2WPVA 1BI7B 1HF8A 4Q69A 1EF1C 3TAXA 2R5SA 4JVSA 5EYPF 4CT4A 5IY5E 3D9NA 4UUCA 5AIJA 5D66A 2CHWA 3TG4A 1LD7A 3O48A 3X2QE 2XCCA 4MLPA 4BX8A 3L16A 4JC8A 1PC2A 1KPSB 2VSOE 3FEXA 3PE3A 2DYSE 4K5BA 2H6FA 2EQXA 2V5FA 2FEZA 3SQVA 3BG1B 3UT7A 4ZFHA 3L08A 2ZGGA 4EZLA 3QB2A 1Q2ZA 4NRHB 3EJNA 3ASNE 4FHKA 4BTBA 3TWQA 2WXGA 3HRAA 4A3TA 2H6IA 1KZOA 4ATGA 1QNFA 3DPDA 1OCRE 4TXRA 1ZB1A 4APOA 2WQ7A 2H6HA 3DBSA 4BSZB 3U4TA 3RIBA 3FUFA 2VGYA 1TNUA 2Y4UA 3UQ3A 3D9IA 2WXKA 4QQIA 4U04A 3Q15A 2GRMA 4J8FA 3PNTB 4GA0A 1TN8A 3HXDA 3FUIA 3CLJA 2JLBA 4GZDA 2L6JA 2ZGDA 5G55A 5G2NA 3RO2A 2J4DA 4BT9A 3ONLA 3PE4A 4TXPA 3QAQA 3D9MA 3APCA 3U9WA 3ASHA 3ZYMA 3PVLA 2X6IA 3UI2A 3SFXA 3DXKG 4KYOB 3JUEA 1HH8A 5FZQA 3SGHA 4PS8A 4J8DA 5BT1A 4CEMA 2I1JA 1TNOA 4Q96A 3FTZA 5BV0A 5EKQD 1B89A 3BQOA 2MRIA 4L2LA 4D10C 3SY2A 1HU3A 3ONKA 3LVRE 5FJYA 2VGEA 3U66A 2FBNA 1FCHA 3ZYQA 2XHEA 1HO8A 3CHQA 1K8KG 3S7FA 2GRQB 2C2LA 3CVPA 2GGFA 2KCKA 1TNZA 2DWZA 2WXHA 3HVEB 2XPZA 1YCSB 2X6FA 5B3SE 4EBAA 3Q4AB 2IOSA 4U8VD 4GZ3A 4HLEA 2BKKB 3KS2A 2IY0C 3JQ1A 3VLEA 3UIPC 2WQ6A 2V8SE 4JPSA 1E7UA 4RG9A 4I1OB 4BX9A 4U0ZA 4J7WA 4P29A 4AXHA 2KCLA 1DCEA 3UKRG 3HYMB 4UI9J 3CHSA 2OOEA 5FINA 2WXFA 3MYVA 2IEJA 3JYSA 5ANLA 3AS4A 3NOGD 4A1SA 5CCMA 4HB5A 1NI1A 3B7BA 2QYUA 4BERA 1HZ4A 4A55A 2ZXWE 3ZEFA 3S7BA 3IKOB 3DSWA 3LJNA 3NOCD 2DBAA 4G26A 3BUAA 4LEUA 3EHRA 3DSVA 3RRMB 4HNAD 1WY6A 4E85A 3DSUA 1N9AA 1BLXB 3R9MA 3SBSA 4GTQA 1N94A 4O1OA 4UI9K 5LFAA 4YDEA 2CFUA 3Q9UC 4GMRA 3GZ2A 3C3QA 1Z3YA 3QKYA 2R59A 3RRUA 3QDNA 3L6AA 4APFA 4B8AA 3Q49B 3GZSA 1SA5A 2XPIA 2RFAA 4J8EA 2YHEA 2DIWA 3E30A 4PS7A 5CMWA 2DZNA 2GROB 5H7PA 4K03A 1N95A 4JEUA 3JXJA 3FUEA 2NC9A 3FTYA 3AJIA 3T5VA 1H2UA 4N3AA 4C0MA 3MCXA 2R2LA 2MOWA 5A7DB 3KAEA 1D8DA 5FWQA 3TWTA 3HXFA 3ZPJA 2J9QA 4UQZA 4NIKA 3C72A 3B7UX 4O1PA 5CECB 2R05A 3FUMA 1AP7A 3CQGB 3DSTA 4EZKA 4CDNA 2Q7FA 4LUNU 4TRQA 3VLFA 1OCCE 4I9EA 1H6PA 4DK5A 3QC1A 3DSSA 5JJTA 5LOZA 2PL2A 2Y4TA 3HHMA 3SF4A 5AQBA 2ONDA 1YYHA 3OXLA 3P1UA 4AV7A 1E8ZA 3Q7FA 5T8IA 1NA0A 2XGSA 4H7XA 2KBXA 4HVBA 3PH0C 3VTXA 5EYLA 1ELKA 1UN8A 2DZOA 3GZ1A 2XEVA 3PRZA 3ESKA 3MKRA 2WXRA 2CG2A 3ZIMA 3AAAC 3PZ1A 1E96B 3LY8A 4GZ5A 4DX6D 4I2ZA 4HRMB 4RQIA 3ASDA 1FPPA 3UINC 4J6IA 1PAQA 2ZU6B 1E8WA 3OXGA 3TWVA 1MQSA 2BEDA 2XZDG 1RW2A 4GTMA 5CBOA 3EU5A 4UQXA 2HO1A 4PDXA 4L23A 3CVVA 3ASOE 3AS8A 2VGXA 3V79K 4GB9A 2I6HA 4OYSA 1FT1A 3C3OA 3RRNB 3FUNA 2HR2A 1JPLA 2AXZA 5AJDA 3CHMA 4N39A 1JCQA 2FO7A 5FIOA 2DCPA 4JA7A 4BSXA 2JEKA 1E8YA 3IHVA 1SA4A 3LEWA 2KZTA 2RFMA 3ABKE 3OXFA 4PH4B 3PZ4A 2AXVA 4J0UA 2LXMA 5DBKA 5ITZF 2Y69E 3UM1A 4WAFA 2ETBA 4GZ6A 3QNKA 3AS5A 4JB8P 3IBEA 2ZISA 4DI3A 3ULEG 4U63A 2NYJA 2IQCA 2GRNB 4L2YA 2EILE 1WDYA 5A6CA 3V2OA 2QY7A 4KMOA 3LY9A 1KZPA 1W3BA 5J08A 1XNFA 4I6GA 2B0OE 3KSLA 4A63B 1XGWA 2X38A 4I1MA 5C2YA 3RAUA 3APDA 5LX8A 2IO2C 5AQAA 3UM0A 4HOUA 4XKBA 3J5QB 3MX3A 4K0RA 3NZUA 4FU3A 3APFA 1A5EA 2V4HC 5G04C 3CV0A 2OV8A 3CHPA 2WXNA 2WXIA 3UTMA 4FLBA 2OCCE 1TNBA 4WNGA 3CVNA 5AJLA 3RKVA 2P9SG 3T8MA 3SO8A 4BETA 3PDNA 4PS3A 2J4BA 3NZSA 2P2CP 4ATZD 4AVXA 4HOSA 2LSUA 2F37A 5CCLA 3UKUG 4L1BA 5BXUA 1VDYA 4AEZC 2QZAA 4OVUA 4C0EA 2IF4A 3ASGA 4DUIA 4KZ0A 2GRPB 2VYIA 4WNDA 1IYGA 2KCVA 2AXUA 1BU9A 3G2TA 1N54A 3NB2A
chains in the Genus database with same CATH topology
3DWLG 3DXMG 4JD2G 3UKUG 2P9SG 1K8KG 2P9NG 2P9UG 3UKRG 2P9IG 2P9PG 3ULEG 2P9LG 1U2VG 3DXKG 2P9KG 4XEIG 1TYQG 3RSEG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DWL G;  3DXM G;  4JD2 G;  3UKU G;  2P9S G;  1K8K G;  2P9N G;  2P9U G;  3UKR G;  2P9I G;  2P9P G;  3ULE G;  2P9L G;  1U2V G;  3DXK G;  2P9K G;  4XEI G;  1TYQ G;  3RSE G; 
#chains in the Genus database with same CATH topology
 5EIL A;  4JZY A;  4BES A;  3U64 A;  1N52 A;  3CST A;  4IUL A;  4UWG A;  1D9S A;  4URK A;  4IN3 B;  5CEA A;  3ZYK A;  4LER A;  3PUJ A;  4CRW A;  4JHR A;  2P9U G;  3LXU X;  4K5C A;  2XEN A;  2UWJ G;  2C0L A;  2UY1 A;  3NAW A;  1IKN D;  2M63 A;  3RU0 A;  5EIB E;  1OUV A;  1Y6I A;  2NSZ A;  3D9J A;  5KNG A;  5FT9 A;  1HFA A;  2I2O A;  2EIM E;  4G11 A;  2V5Q C;  5AN8 A;  3LVQ E;  4KBQ A;  5KCM A;  1IHB A;  3EHN A;  3FH5 A;  4JHK A;  3T9K A;  4AIF A;  1TNY A;  4I2W A;  3E4B A;  5EDS A;  3CGH A;  1G3N B;  3PZD A;  5T4Y A;  3SNX A;  4BTA A;  4YDY A;  3W9G A;  1LF8 A;  2WXM A;  4WWP A;  3Q5M A;  4XX5 A;  2LXL A;  4EQF A;  3ABM E;  1MJ0 A;  5KBA A;  1IHG A;  3CVU A;  5HS0 A;  4ANX A;  1DCQ A;  1E8X A;  5FQ7 A;  4H7Y A;  3I4R B;  3FUH A;  4U07 A;  1IQR A;  3S7J A;  3QAR A;  4LNB A;  3TXM A;  3ZYL A;  1MX4 A;  3SFZ A;  4F53 A;  2VGX B;  4I43 A;  4HRN A;  3D9L A;  4U96 D;  2XPY A;  2ILR A;  3ZGQ A;  4ABN A;  3L82 A;  1N4P A;  2VSX E;  5D2M C;  2WXP A;  5JHA A;  4GYY A;  4XI0 A;  2QC9 A;  4CGV A;  2RG8 A;  1IQU A;  3LY7 A;  3T8K A;  4A1G A;  3NBN B;  2KZT B;  1IXV A;  3E32 A;  4Q94 A;  2R03 A;  3AU4 A;  1JWF A;  3Q79 A;  3SI5 A;  2WMO A;  3L54 A;  4BFR A;  5BV1 A;  1AWC B;  1N4R A;  3PRE A;  4GTO A;  3UXG A;  4HOT A;  3WG7 E;  1JCR A;  2P9K G;  4GU5 A;  2E0I A;  4ILH B;  3BG0 B;  2A4Z A;  2XCB A;  4CCA A;  3ZKJ A;  2CHX A;  1FVF A;  3C98 A;  1UJJ A;  4AY6 A;  1HX8 A;  2GRL A;  3ZVV A;  3FTS A;  2WB2 A;  2L6B A;  5BUZ A;  3UT8 A;  2CHZ A;  4OAU C;  3Q73 A;  4C9B B;  1PY1 A;  3UPV A;  3PEV B;  5AAR A;  2EIN E;  4EBA G;  1O5M A;  4BY6 A;  2WVI A;  5CED B;  2GW1 A;  4FP7 A;  2VTB A;  1QZ2 A;  1NA3 A;  2YQ8 A;  3AG2 E;  4HI8 A;  4EHM A;  3DWL G;  2HE0 A;  3ULQ A;  1TJF A;  3HIZ A;  1DVP A;  2CG3 A;  3DRA A;  1NP7 A;  5FZS A;  4XKC A;  3FTV A;  2IU1 A;  2AW6 A;  4GTR A;  3FWV A;  1O1S A;  4B89 A;  2XRZ A;  1MZC A;  4TUM A;  3GYZ A;  4KZC A;  1D8E A;  3CEQ A;  2PQR A;  4EEC A;  3V31 A;  4AY5 A;  4AP2 A;  4FA6 A;  3SD5 A;  1EPU A;  4GYW A;  3FP3 A;  4N2S A;  3QK0 A;  5ARF A;  4UWF A;  1EYH A;  3AG3 E;  5CBN A;  4LNG A;  5ANR A;  4ACK A;  4N3B A;  4N5Q A;  3NQP A;  4R7L A;  3EIQ C;  2A5E A;  4QFV A;  1S70 B;  1OCO E;  1MHQ A;  1H2V C;  4MRU A;  3CHR A;  2XRY A;  3HXB A;  5FQ4 A;  5G04 J;  3B7R L;  3RO3 A;  2XEE A;  2P58 C;  2J09 A;  2FUL A;  4DPR A;  2UY1 B;  2VSY A;  2XEH A;  3DPY A;  3ESL A;  1DC2 A;  3ZW3 A;  1N4S A;  4NAC A;  3BEE A;  1Z5S C;  1U2V G;  2BF0 X;  5BPP A;  4HLL A;  4CYM D;  2BKG A;  4GZC A;  2KAT A;  4WWN A;  2FO1 E;  5ARG A;  1KT0 A;  1Z6T A;  2J49 A;  2J07 A;  3UM3 A;  3SZ7 A;  5AEN A;  3V2X A;  5AYW D;  2ETC A;  2E2E A;  5HRY A;  1OWP A;  3C5R A;  3UIO C;  1U3C A;  3QWW A;  1TR4 A;  2XGO A;  5LCW C;  1H0A A;  3FTW A;  3AU5 A;  4XEI G;  4GTT A;  3URZ A;  3VTY A;  1SVX A;  3N71 A;  4XI9 A;  3V30 A;  3ML9 A;  3EUV A;  3FTU A;  2PM7 A;  3ZUV B;  4LSZ E;  4ZHB A;  4CZ2 D;  2I1K A;  5CRU A;  4G24 A;  3PEU B;  5C1D A;  4UI9 C;  1UG3 A;  5HQ8 A;  1JCS A;  4E6H A;  3JQ0 A;  4XZ4 A;  3CHO A;  4DRX E;  3S7D A;  3FUJ A;  4MS6 A;  2V0P A;  2NXP A;  3D9P A;  1SQM A;  3QJZ A;  1SZA A;  4G1T A;  2L0I A;  1LTX A;  1NL4 A;  3MEK A;  2ETA A;  2KC7 A;  2LUH A;  1H6O A;  5JA4 D;  2LNI A;  2P9P G;  4MKT A;  4GA2 A;  4I6J A;  5JMN D;  1A17 A;  2RD0 A;  5D0Q D;  3KEZ A;  3ZHE B;  2DYR E;  2R17 C;  4U8Y D;  1X5B A;  4FUL A;  4KVO A;  3TWU A;  3ABL E;  4F6R D;  4TXQ A;  2ZIR A;  4UWK A;  3I3N A;  2A5U A;  1LD8 A;  1OY3 D;  2MHK A;  5ENP D;  3CR3 A;  5LP0 A;  3FH7 A;  5ENS D;  4G8L A;  3Q78 A;  5KNH D;  3S2A A;  3FU3 A;  3Q75 A;  4HRL A;  2BTD A;  4DI4 A;  5T3R A;  3CQC B;  2RKK A;  2XQ0 A;  4Z68 A;  3UMV A;  4ANU A;  5HKP A;  4CDR A;  2I9C A;  2Y1L E;  1WG0 A;  3TGO A;  2VTB B;  2OEW A;  4C48 B;  2QYJ A;  4DX2 A;  3MGB A;  3E33 A;  3LKU A;  3CKC A;  4RLY A;  1KT1 A;  5EN5 D;  4F1P A;  5EX3 A;  3HG0 D;  3O4Z A;  3LCA A;  3TWR A;  3CVY A;  4AOF A;  3MJW A;  3G2U A;  2QFC A;  3FUK A;  3ENE A;  3WXX A;  4UWL A;  5FQ6 A;  1TJC A;  3I5P A;  4LCT A;  3FFL A;  3CKB A;  4Y6W A;  1QYM A;  1P5Q A;  3MKQ A;  4CT0 A;  4ILG A;  3T5X A;  2IFU A;  5JHB A;  4L7T A;  3W9F A;  4ANV A;  5KJL A;  3ZU7 B;  3KEA A;  2F0Y A;  3VLD A;  4M7C A;  3TJP A;  4O60 A;  4I9C A;  3UM2 A;  4AJW A;  1OWO A;  4DJA A;  4G23 A;  2WXO A;  2LAI A;  4KT6 B;  4B94 A;  5BXO A;  2F8Y A;  4BWR A;  2OVB A;  2OVF A;  4YDW A;  3G2S A;  1H6K A;  2HYZ A;  3GW4 A;  4TUU A;  3D3M A;  3G2W A;  4CGW A;  4U0S A;  2L0T B;  2P9I G;  4OVV A;  5KJM A;  1KLX A;  2B6C A;  2MYO A;  5CHE E;  1E90 A;  4U8H A;  3MV3 B;  4GML A;  3RK6 A;  5ENN A;  1HE8 A;  3DSX A;  1OT8 A;  4GTS A;  2C0M A;  1BI8 B;  4PUC A;  3FHE A;  4FJY A;  3ZFW A;  4DX1 A;  4L9P A;  5FQ8 A;  5BW8 C;  3G2V A;  2IJG X;  4K5A B;  1ZU2 A;  2VQ2 A;  5AAO A;  2GRR B;  3CVL A;  1OWN A;  5E75 A;  1WM5 A;  3EDT B;  2J08 A;  2WXL A;  5D0O D;  4F1S A;  1JUQ A;  3CVQ A;  2ION A;  3UX4 A;  5BNW A;  4JHJ A;  2P9L G;  4W9R A;  2LAH A;  4LNU D;  2R02 A;  2KXP C;  3IEG A;  5CER B;  3AG1 E;  4HFG A;  3ZNG A;  3EIJ A;  4N3C A;  5CMY A;  2Y0B G;  1SZ9 A;  2PM6 A;  2AWI A;  3PUK A;  5CRV A;  3LDZ A;  4GA1 A;  4JEH A;  3IXE A;  1L5J A;  3QWV A;  2X3M A;  2PZI A;  4G8K A;  4WWO A;  4BT8 A;  5AQ9 A;  1O1R A;  4WNE A;  4GTV A;  3ASF A;  3FU0 A;  5ENO D;  4ACL A;  3ISM C;  5G05 C;  3KSQ A;  3FH8 A;  4CDM A;  3QWP A;  5EX0 A;  2VJ8 A;  4GMJ A;  3CSF A;  4F3V A;  1UN9 A;  4DX7 D;  1N0R A;  1N11 A;  4B8C B;  2J8S D;  4F7A A;  3EHM A;  4M3O A;  4JD2 G;  2F8X K;  3SHF A;  1HXI A;  5LCW J;  3PZ3 A;  2H6G A;  3TXN A;  3MV2 B;  3B7T A;  3FTX A;  5ENT D;  4AM9 A;  3UT4 A;  2XS8 A;  2X6K A;  3ZHE A;  2YHC A;  4I6E A;  1H2T C;  3R7R A;  4I17 A;  1BD8 A;  3OAW A;  3Q7A A;  1WAO 1;  3E34 A;  2EIK E;  1X81 A;  1K1B A;  1INZ A;  5KWD A;  4KXK B;  4GCN A;  4G2V A;  5B1A E;  4RSY A;  2BUG A;  1S0P A;  5KJK A;  3FUL A;  2X6H A;  4YVO A;  4U0U A;  4MBG A;  5ENR D;  4ME2 A;  1TYQ G;  1K3Z D;  3ZRH A;  2YIN A;  4DLQ A;  3MZL B;  3R7Q A;  2IOL A;  4XIF A;  4DLO A;  1FT2 A;  3DEO A;  4ANW A;  1MX2 A;  1FVH A;  2CFZ A;  3FUD A;  4HS2 A;  3ZXS A;  1N0Q A;  4GPM A;  1Z3X A;  3ZN3 A;  3CIA A;  5AQ7 A;  3SFY A;  4FC8 A;  5EID A;  4TV3 A;  4GAA A;  3MKQ B;  2IO3 C;  5B1B E;  1S64 A;  4YND A;  5J90 A;  5FTP A;  3P2B A;  5A23 A;  4DX5 D;  1U3D A;  3R9A B;  1RZ4 A;  3JUI A;  3EHQ A;  4FJZ A;  1UW4 B;  1ELW A;  2HM8 A;  2XZT G;  3D9H A;  4WUY A;  2AJA A;  1MX6 A;  2JAB A;  3CVX A;  2WXJ A;  4B0Z A;  4GPK A;  4HXI A;  3RSE G;  3LYA A;  2VSN A;  3C3R A;  3HDX A;  4ILI A;  2WMN A;  3E37 A;  3L17 A;  3CK7 A;  1NZN A;  3IHY A;  4N2Q A;  4GTP A;  2FI7 A;  3B95 A;  4FLH A;  4I1A A;  3PNL B;  4B93 B;  5HI7 A;  3TL5 A;  4JW1 A;  1Y8M A;  3JXI A;  2PQN A;  2V4L A;  3HXE A;  3F6Q A;  4RG6 A;  3D9K A;  3PZ2 A;  2X6J A;  3HXC A;  3CK9 A;  3CK8 A;  3U3W A;  4J8Y A;  3Q9N C;  1GW6 A;  4YDO A;  1HS6 A;  2KM4 A;  3MA5 A;  4OAV B;  3ULY A;  3UUX A;  5JJ7 A;  2OEV A;  1V55 E;  5M72 A;  4EPZ A;  3DXM G;  4EZJ A;  2LO6 A;  1YMP A;  4RVB A;  1YA0 A;  1UOH A;  4U7E B;  2P9N G;  1EDU A;  5FZR A;  2L9B A;  1QBQ A;  1ZBP A;  5ENQ D;  2AVP A;  1OCZ E;  4BEP A;  3LS8 A;  3AG4 E;  3FDH A;  3TWS A;  1HG5 A;  4HI9 A;  4X8Q A;  4HOQ A;  3J5P A;  3ZXP A;  5JJ6 A;  2LSV A;  4HQD A;  3B7S A;  2FF4 A;  1ELR A;  3NF1 A;  4UQY A;  1MYO A;  1JWG A;  3LJ3 A;  1S63 A;  4J8S A;  3Q47 B;  1NFI E;  1DNP A;  3IV0 A;  2WXQ A;  3FU6 A;  1N4Q A;  3BU8 A;  4FAD A;  3L22 A;  1O1T A;  1TN7 A;  1HG2 A;  1QQE A;  4YVQ C;  5KJN A;  4U95 D;  3OTN A;  1OWL A;  4WNF A;  2EIJ E;  3PS6 A;  1OXJ A;  2WQH A;  3HVE A;  3L13 A;  3B13 A;  1TN6 A;  4GYO A;  4JA9 A;  4JXT A;  4HBD A;  2PNN A;  1K1A A;  2XS1 A;  1TEZ A;  3FY4 A;  3TWX A;  1H19 A;  3CVW A;  4O6F A;  4NUR A;  1OWM A;  2Y3A A;  4G25 A;  1BPO A;  2WM9 A;  4UWH A;  4KVM A;  4IYP A;  3I4G A;  4LG6 A;  2YNQ A;  3SBT B;  3TWW A;  1UJK A;  3D9O A;  4V3I A;  1V54 E;  1E7V A;  4GCO A;  3RJV A;  4A3V A;  1SW6 A;  3TG5 A;  5DIZ A;  3DEP A;  5G05 J;  3FU5 A;  3LPZ A;  4NQ0 A;  4FHJ A;  4Y6C A;  4XE0 A;  4N5C A;  4LRZ A;  3JCK C;  3QOU A;  3L9T A;  5E76 A;  2DVW A;  3EU9 A;  4JL0 A;  3K9I A;  3ML8 A;  4IRU A;  3FEY A;  2XGM A;  4HOR A;  3KD7 A;  2WPV A;  1BI7 B;  1HF8 A;  4Q69 A;  1EF1 C;  3TAX A;  2R5S A;  4JVS A;  5EYP F;  4CT4 A;  5IY5 E;  3D9N A;  4UUC A;  5AIJ A;  5D66 A;  2CHW A;  3TG4 A;  1LD7 A;  3O48 A;  3X2Q E;  2XCC A;  4MLP A;  4BX8 A;  3L16 A;  4JC8 A;  1PC2 A;  1KPS B;  2VSO E;  3FEX A;  3PE3 A;  2DYS E;  4K5B A;  2H6F A;  2EQX A;  2V5F A;  2FEZ A;  3SQV A;  3BG1 B;  3UT7 A;  4ZFH A;  3L08 A;  2ZGG A;  4EZL A;  3QB2 A;  1Q2Z A;  4NRH B;  3EJN A;  3ASN E;  4FHK A;  4BTB A;  3TWQ A;  2WXG A;  3HRA A;  4A3T A;  2H6I A;  1KZO A;  4ATG A;  1QNF A;  3DPD A;  1OCR E;  4TXR A;  1ZB1 A;  4APO A;  2WQ7 A;  2H6H A;  3DBS A;  4BSZ B;  3U4T A;  3RIB A;  3FUF A;  2VGY A;  1TNU A;  2Y4U A;  3UQ3 A;  3D9I A;  2WXK A;  4QQI A;  4U04 A;  3Q15 A;  2GRM A;  4J8F A;  3PNT B;  4GA0 A;  1TN8 A;  3HXD A;  3FUI A;  3CLJ A;  2JLB A;  4GZD A;  2L6J A;  2ZGD A;  5G55 A;  5G2N A;  3RO2 A;  2J4D A;  4BT9 A;  3ONL A;  3PE4 A;  4TXP A;  3QAQ A;  3D9M A;  3APC A;  3U9W A;  3ASH A;  3ZYM A;  3PVL A;  2X6I A;  3UI2 A;  3SFX A;  3DXK G;  4KYO B;  3JUE A;  1HH8 A;  5FZQ A;  3SGH A;  4PS8 A;  4J8D A;  5BT1 A;  4CEM A;  2I1J A;  1TNO A;  4Q96 A;  3FTZ A;  5BV0 A;  5EKQ D;  1B89 A;  3BQO A;  2MRI A;  4L2L A;  4D10 C;  3SY2 A;  1HU3 A;  3ONK A;  3LVR E;  5FJY A;  2VGE A;  3U66 A;  2FBN A;  1FCH A;  3ZYQ A;  2XHE A;  1HO8 A;  3CHQ A;  1K8K G;  3S7F A;  2GRQ B;  2C2L A;  3CVP A;  2GGF A;  2KCK A;  1TNZ A;  2DWZ A;  2WXH A;  3HVE B;  2XPZ A;  1YCS B;  2X6F A;  5B3S E;  4EBA A;  3Q4A B;  2IOS A;  4U8V D;  4GZ3 A;  4HLE A;  2BKK B;  3KS2 A;  2IY0 C;  3JQ1 A;  3VLE A;  3UIP C;  2WQ6 A;  2V8S E;  4JPS A;  1E7U A;  4RG9 A;  4I1O B;  4BX9 A;  4U0Z A;  4J7W A;  4P29 A;  4AXH A;  2KCL A;  1DCE A;  3UKR G;  3HYM B;  4UI9 J;  3CHS A;  2OOE A;  5FIN A;  2WXF A;  3MYV A;  2IEJ A;  3JYS A;  5ANL A;  3AS4 A;  3NOG D;  4A1S A;  5CCM A;  4HB5 A;  1NI1 A;  3B7B A;  2QYU A;  4BER A;  1HZ4 A;  4A55 A;  2ZXW E;  3ZEF A;  3S7B A;  3IKO B;  3DSW A;  3LJN A;  3NOC D;  2DBA A;  4G26 A;  3BUA A;  4LEU A;  3EHR A;  3DSV A;  3RRM B;  4HNA D;  1WY6 A;  4E85 A;  3DSU A;  1N9A A;  1BLX B;  3R9M A;  3SBS A;  4GTQ A;  1N94 A;  4O1O A;  4UI9 K;  5LFA A;  4YDE A;  2CFU A;  3Q9U C;  4GMR A;  3GZ2 A;  3C3Q A;  1Z3Y A;  3QKY A;  2R59 A;  3RRU A;  3QDN A;  3L6A A;  4APF A;  4B8A A;  3Q49 B;  3GZS A;  1SA5 A;  2XPI A;  2RFA A;  4J8E A;  2YHE A;  2DIW A;  3E30 A;  4PS7 A;  5CMW A;  2DZN A;  2GRO B;  5H7P A;  4K03 A;  1N95 A;  4JEU A;  3JXJ A;  3FUE A;  2NC9 A;  3FTY A;  3AJI A;  3T5V A;  1H2U A;  4N3A A;  4C0M A;  3MCX A;  2R2L A;  2MOW A;  5A7D B;  3KAE A;  1D8D A;  5FWQ A;  3TWT A;  3HXF A;  3ZPJ A;  2J9Q A;  4UQZ A;  4NIK A;  3C72 A;  3B7U X;  4O1P A;  5CEC B;  2R05 A;  3FUM A;  1AP7 A;  3CQG B;  3DST A;  4EZK A;  4CDN A;  2Q7F A;  4LUN U;  4TRQ A;  3VLF A;  1OCC E;  4I9E A;  1H6P A;  4DK5 A;  3QC1 A;  3DSS A;  5JJT A;  5LOZ A;  2PL2 A;  2Y4T A;  3HHM A;  3SF4 A;  5AQB A;  2OND A;  1YYH A;  3OXL A;  3P1U A;  4AV7 A;  1E8Z A;  3Q7F A;  5T8I A;  1NA0 A;  2XGS A;  4H7X A;  2KBX A;  4HVB A;  3PH0 C;  3VTX A;  5EYL A;  1ELK A;  1UN8 A;  2DZO A;  3GZ1 A;  2XEV A;  3PRZ A;  3ESK A;  3MKR A;  2WXR A;  2CG2 A;  3ZIM A;  3AAA C;  3PZ1 A;  1E96 B;  3LY8 A;  4GZ5 A;  4DX6 D;  4I2Z A;  4HRM B;  4RQI A;  3ASD A;  1FPP A;  3UIN C;  4J6I A;  1PAQ A;  2ZU6 B;  1E8W A;  3OXG A;  3TWV A;  1MQS A;  2BED A;  2XZD G;  1RW2 A;  4GTM A;  5CBO A;  3EU5 A;  4UQX A;  2HO1 A;  4PDX A;  4L23 A;  3CVV A;  3ASO E;  3AS8 A;  2VGX A;  3V79 K;  4GB9 A;  2I6H A;  4OYS A;  1FT1 A;  3C3O A;  3RRN B;  3FUN A;  2HR2 A;  1JPL A;  2AXZ A;  5AJD A;  3CHM A;  4N39 A;  1JCQ A;  2FO7 A;  5FIO A;  2DCP A;  4JA7 A;  4BSX A;  2JEK A;  1E8Y A;  3IHV A;  1SA4 A;  3LEW A;  2KZT A;  2RFM A;  3ABK E;  3OXF A;  4PH4 B;  3PZ4 A;  2AXV A;  4J0U A;  2LXM A;  5DBK A;  5ITZ F;  2Y69 E;  3UM1 A;  4WAF A;  2ETB A;  4GZ6 A;  3QNK A;  3AS5 A;  4JB8 P;  3IBE A;  2ZIS A;  4DI3 A;  3ULE G;  4U63 A;  2NYJ A;  2IQC A;  2GRN B;  4L2Y A;  2EIL E;  1WDY A;  5A6C A;  3V2O A;  2QY7 A;  4KMO A;  3LY9 A;  1KZP A;  1W3B A;  5J08 A;  1XNF A;  4I6G A;  2B0O E;  3KSL A;  4A63 B;  1XGW A;  2X38 A;  4I1M A;  5C2Y A;  3RAU A;  3APD A;  5LX8 A;  2IO2 C;  5AQA A;  3UM0 A;  4HOU A;  4XKB A;  3J5Q B;  3MX3 A;  4K0R A;  3NZU A;  4FU3 A;  3APF A;  1A5E A;  2V4H C;  5G04 C;  3CV0 A;  2OV8 A;  3CHP A;  2WXN A;  2WXI A;  3UTM A;  4FLB A;  2OCC E;  1TNB A;  4WNG A;  3CVN A;  5AJL A;  3RKV A;  2P9S G;  3T8M A;  3SO8 A;  4BET A;  3PDN A;  4PS3 A;  2J4B A;  3NZS A;  2P2C P;  4ATZ D;  4AVX A;  4HOS A;  2LSU A;  2F37 A;  5CCL A;  3UKU G;  4L1B A;  5BXU A;  1VDY A;  4AEZ C;  2QZA A;  4OVU A;  4C0E A;  2IF4 A;  3ASG A;  4DUI A;  4KZ0 A;  2GRP B;  2VYI A;  4WND A;  1IYG A;  2KCV A;  2AXU A;  1BU9 A;  3G2T A;  1N54 A;  3NB2 A; 
#chains in the Genus database with same CATH homology
 3DWL G;  3DXM G;  4JD2 G;  3UKU G;  2P9S G;  1K8K G;  2P9N G;  2P9U G;  3UKR G;  2P9I G;  2P9P G;  3ULE G;  2P9L G;  1U2V G;  3DXK G;  2P9K G;  4XEI G;  1TYQ G;  3RSE G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...