2P9KG

Crystal structure of bovine arp2/3 complex co-crystallized with atp and crosslinked with glutaraldehyde
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
136
Chain Sequence
ARFRKVDVDEYDENKFVDEAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 45
structure length 136
sequence length 143
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 2p9kG00
3DWLG 3UKRG 4JD2G 3RSEG 1K8KG 4XEIG 1TYQG 2P9LG 1U2VG 2P9NG 3UKUG 3DXMG 2P9KG 3ULEG 2P9SG 2P9IG 3DXKG 2P9UG 2P9PG
chains in the Genus database with same CATH superfamily
2GW1A 4DI4A 2VSNA 4AY5A 3C5RA 3LJNA 2IOLA 3FFLA 3SD5A 1OWLA 1S63A 4U96D 3V79K 4TXPA 4EZLA 2J9QA 3ASNE 3DSVA 2PL2A 5E76A 1H2TC 4TRQA 3ZHEA 4GU5A 1JCRA 4YVOA 4GZCA 4ACKA 3ZIMA 3Q9NC 3DPDA 4XI9A 3AS5A 4ANWA 1K8KG 4RG9A 3NB2A 3RIBA 3GYZA 4BSXA 5JJ6A 1FCHA 1HO8A 2XS8A 1OWMA 4J7WA 3Q75A 4GTQA 4NIKA 5EN5D 3U64A 1N52A 5LX8A 2H6FA 4GYWA 3HXFA 1FVFA 2WXMA 3RO2A 2LXMA 2WXNA 2P9IG 2CHZA 1KLXA 1IHBA 1TJCA 3SY2A 4MRUA 2LO6A 4PUCA 1TNOA 3L08A 5FWQA 1TN8A 1IKND 1HS6A 5DBKA 1K1BA 5ENTD 4BY6A 1V54E 2DVWA 3PZ3A 4HVBA 2XZDG 1JCQA 4OYSA 4CRWA 3Q79A 2AVPA 3HYMB 4FJZA 5AARA 1OXJA 4BSZB 4O60A 4GA1A 4MLPA 3FU6A 4B93B 4WWNA 1LTXA 5JHBA 4JPSA 3TL5A 4XX5A 4I1OB 1HH8A 1NZNA 1Z6TA 2WPVA 3UINC 3SFZA 1BI7B 3B7SA 4GTOA 2KATA 5G04J 2QY7A 3B13A 1E8YA 2GRQB 3GZ1A 4I1MA 1HXIA 4FP7A 4HOUA 3ZXPA 2WXKA 1JUQA 3FUDA 3L82A 3FTUA 1UW4B 3TWTA 3E32A 2HM8A 4P29A 4I1AA 4Q69A 3CVVA 3QWVA 2L0TB 4GZDA 4BERA 2GRNB 1TNZA 1U3CA 1E96B 4U95D 1OY3D 1N4SA 4YDYA 2VGYA 3ZN3A 1MYOA 3FY4A 2LUHA 3ML8A 2M63A 4C48B 2P9NG 2XS1A 3G2SA 2EIME 4MKTA 5G2NA 3RU0A 1S64A 1ELKA 3TWWA 4FADA 1KZPA 3ZYLA 2V5FA 3JCKC 1OCOE 3RK6A 4OAVB 3CVQA 3ABME 3TG4A 4UQZA 2P9UG 1MHQA 4U8HA 4NACA 3UPVA 3BEEA 2FI7A 4BT9A 3LDZA 4IULA 2WM9A 4L23A 4FU3A 2F8YA 4PS3A 3ZYQA 2WQ6A 1WM5A 4UI9K 2C0MA 1LF8A 3J5QB 4H7YA 3LEWA 3C3OA 1FPPA 3FEYA 4MS6A 3CEQA 2XCBA 3D9LA 4I9CA 4XEIG 3CK9A 2V5QC 5ENOD 4JEHA 3PVLA 1OWOA 3KS2A 4J8YA 1BD8A 3MJWA 3L22A 2FO7A 3D9PA 4GPKA 4GTSA 4W9RA 3CHPA 5KBAA 4JZYA 4GB9A 2ZGGA 3URZA 3O4ZA 3Q5MA 4XIFA 3TWRA 2ZU6B 1H6PA 3FTVA 4KBQA 1IHGA 2CG2A 4FA6A 4GZ6A 4UI9J 4N5QA 1MX6A 4DK5A 2LSVA 4D10C 3ZEFA 4ATZD 4RLYA 1KZOA 5ENNA 5A7DB 4HOTA 3TGOA 4DI3A 1N4RA 1YYHA 3LY9A 2OCCE 3FTXA 4GYYA 3LCAA 3APCA 4N2QA 5CCLA 3FH5A 2KCKA 2IF4A 3I3NA 3Q7FA 4UWGA 3Q73A 2BF0X 1HF8A 2HE0A 2XZTG 3CHMA 3CLJA 4HFGA 1FVHA 4HLEA 2CHXA 4HOQA 4B8AA 3FTWA 4CT4A 4UQXA 1TNYA 2IO2C 3T8MA 4IRUA 3UX4A 4UWHA 5ENPD 4KMOA 1JPLA 2V4HC 4GZ3A 5T4YA 2VJ8A 4LRZA 3CVXA 1Q2ZA 4J8DA 2DWZA 2OEWA 1E7UA 3C3RA 2PM7A 5BPPA 5G05J 3EU9A 3PEUB 5CMYA 5EX0A 4AP2A 4B89A 5BXOA 3MKQB 4I6GA 3QWPA 4EZJA 2NC9A 1Y8MA 3Q15A 2L6BA 1SZAA 4GTTA 2QFCA 3QJZA 1QBQA 2V8SE 2YINA 3ZYKA 5ARGA 2ZISA 3FTSA 2OVBA 2KBXA 1IQRA 4L9PA 1NP7A 3G2WA 1WDYA 1HE8A 5ANRA 3CIAA 2VSOE 4APOA 3ESLA 3TXNA 1EPUA 1S0PA 3ASDA 4HNAD 5AQ7A 3ZU7B 3PZ2A 5AJDA 2IO3C 3Q78A 2IONA 4B0ZA 4I43A 4GTPA 1N95A 4YDWA 3AS4A 4AJWA 4I2WA 2DZOA 2WQ7A 3UQ3A 2EIJE 1E8ZA 2NXPA 4RQIA 4F1SA 3V2OA 3U4TA 2R59A 3AS8A 4CYMD 1ELRA 2QYUA 4XZ4A 4ACLA 3U9WA 5C1DA 3UXGA 3CVLA 4G24A 3V31A 5CBOA 4WNEA 3EUVA 1OWPA 1DC2A 3QAQA 1KT1A 3FUHA 2WMNA 2GROB 3R7QA 5EX3A 3LY8A 3KAEA 5G04C 4F7AA 4EECA 3RAUA 3UM3A 3ENEA 3FEXA 3MCXA 4WNFA 2YHCA 3B7TA 4GCOA 4GPMA 3F6QA 1N4PA 1O5MA 3HXCA 3Q49B 4CT0A 2GRMA 5BNWA 5EKQD 5EILA 4BESA 4U7EB 3VLEA 5CEDB 2V4LA 3C72A 2WXPA 4FC8A 2AWIA 4X8QA 2P58C 3ZFWA 5KCMA 2QYJA 4GMJA 2VTBA 4J8EA 4K5BA 4A1GA 2P9SG 3CR3A 3ULYA 3FP3A 4J8SA 4HRNA 4TV3A 3FU3A 4BETA 3ISMC 2B6CA 5D0OD 2JEKA 2PZIA 1BPOA 4BX9A 2HO1A 1H19A 4AY6A 3PE3A 3MKQA 3NAWA 3ZUVB 3FTYA 2RFAA 3SGHA 3FUIA 3V2XA 4DX2A 2X6FA 1K1AA 3FUJA 1PC2A 2Y1LE 1NI1A 1BI8B 2CFUA 2Y3AA 3SO8A 4JHKA 3SF4A 3ABKE 1FT2A 4HXIA 5AN8A 3KSLA 1MZCA 4FULA 3VLDA 3QARA 3DPYA 3EIQC 3PZ4A 2DBAA 3UT8A 3CHSA 2X38A 1KPSB 4U07A 5HRYA 3G2UA 4U63A 5KNHD 4GA2A 2X3MA 4CDRA 5D66A 5FZQA 1YA0A 3PNTB 4WUYA 2I1JA 1PAQA 4Z68A 2I2OA 4JD2G 4C0MA 4F6RD 5KNGA 2MYOA 3X2QE 3QDNA 5B1BE 4IYPA 5HS0A 4AIFA 1P5QA 3IBEA 1NFIE 1H0AA 5CHEE 4JW1A 3OXLA 3NZSA 4H7XA 5BV0A 1SVXA 4EHMA 3DSUA 5AQAA 3CSTA 4F53A 1EYHA 2XCCA 4F1PA 4JL0A 5AQBA 2DIWA 4BTBA 4ANUA 3TWXA 2XEEA 4DX5D 4WAFA 2KC7A 3P1UA 3JUEA 2YQ8A 2XHEA 4BEPA 4J0UA 3EDTB 4Q96A 1JWFA 2PQRA 3FUFA 3ZKJA 3FTZA 4K5AB 3ZNGA 1L5JA 2R03A 2L0IA 3ULQA 3HXEA 1MJ0A 1HZ4A 5HKPA 1AWCB 1QYMA 3DSSA 3UTMA 3IEGA 5FQ6A 3DSWA 1Y6IA 2Y4TA 1IXVA 2X6KA 2VGEA 3QKYA 1PY1A 4U0SA 5G55A 1X81A 2IQCA 3CKBA 3PUKA 3FUEA 1NA0A 4U8YD 3RO3A 5AAOA 1O1TA 3FUKA 2EINE 4GYOA 2LSUA 4Y6CA 5LOZA 3QWWA 1U2VG 4BTAA 2J49A 5FT9A 2BUGA 4OAUC 1KT0A 3HXBA 3IXEA 2LNIA 4BT8A 1FT1A 3WXXA 4DPRA 3JXIA 2E2EA 4HBDA 4YVQC 3E33A 3S7FA 1LD8A 3HVEA 5AJLA 3L17A 4K5CA 3PS6A 1Z3YA 5CCMA 4OVVA 2CFZA 5T3RA 4HB5A 2PQNA 3T5VA 5ANLA 2NYJA 5HI7A 4JEUA 4MBGA 5KJMA 3AG4E 3OTNA 1D9SA 4HQDA 4TUUA 3D9IA 5JA4D 3LPZA 2KZTA 3WG7E 4RVBA 1H6OA 1D8DA 3W9GA 4DJAA 2ZXWE 3ASHA 4ZFHA 4CDMA 3T8KA 2ONDA 2L9BA 1YCSB 3I4GA 2UWJG 2XPZA 1H2VC 3AG3E 3R9AB 5EYPF 4GZ5A 4XKCA 4JC8A 4JVSA 2AXZA 3GZ2A 5BXUA 1TYQG 1SW6A 4LUNU 3SBTB 1Z5SC 3PH0C 2H6HA 3GW4A 3KEZA 4KXKB 3LYAA 1TNBA 2VGXA 4TXQA 3CGHA 2XEVA 4LNBA 2I1KA 2OVFA 4AM9A 1RZ4A 3LJ3A 2VSYA 4V3IA 5B1AE 2F37A 1DCQA 3NOGD 2FULA 3D9NA 2WXIA 3CHRA 1HX8A 1N94A 1IQUA 4LNGA 5ITZF 5BW8C 3JUIA 3V30A 3MGBA 1SA5A 2KXPC 3VTXA 3TWUA 3NQPA 4CEMA 1NA3A 4CGVA 1WAO1 3CVPA 4J6IA 4UWKA 4G8KA 2FF4A 1TR4A 2ETAA 1GW6A 2XGOA 3OXGA 4PH4B 4L2LA 4UWLA 1UJJA 1ZBPA 4G1TA 2VTBB 4FLHA 3G2VA 3L6AA 4I2ZA 4C9BB 4GCNA 2MHKA 4LG6A 2XEHA 4YNDA 5B3SE 2BKGA 3JYSA 4HLLA 3CVNA 4ILHB 4HORA 2H6GA 4O1PA 3O48A 1HG2A 3KSQA 1A17A 2IJGX 2MOWA 3AU5A 4CCAA 3ZW3A 3D9KA 4DLOA 1OT8A 3PEVB 4DX7D 5KJNA 3N71A 3SZ7A 4KYOB 1JWGA 3AG2E 5EIBE 2WXHA 4A1SA 1E8XA 4XE0A 4CZ2D 3DEPA 3FH8A 4NRHB 3ASGA 4PS7A 3P2BA 4TXRA 2FO1E 4IN3B 3E30A 3HIZA 2WQHA 4ANVA 3RRMB 4K03A 2A5EA 3TWQA 4QFVA 3FU5A 3APDA 2R5SA 4L2YA 4JHJA 5H7PA 3LY7A 4HS2A 4PDXA 5IY5E 2R2LA 4I6JA 4O6FA 2KM4A 3ZVVA 5FZRA 3MV2B 2XENA 2J07A 4A55A 2I6HA 1O1RA 1O1SA 3G2TA 3E34A 3Q9UC 4UUCA 4BFRA 3TG5A 3ZGQA 3S2AA 4Q94A 3AU4A 3S7BA 3C98A 3GZSA 3T9KA 4XKBA 1TNUA 5BUZA 2VYIA 3VTYA 1E90A 5E75A 2P9PG 4GTRA 2ILRA 4PS8A 1NL4A 3DWLG 2LAHA 2IFUA 3C3QA 4WWPA 4GTMA 1MQSA 5FQ4A 3TAXA 2WXOA 2EIKE 5KJKA 2ZGDA 4AXHA 3UM2A 4JHRA 4N2SA 3PDNA 4KZCA 2DYRE 5ENRD 1DNPA 3FUNA 2XPIA 1TN7A 3K9IA 4E6HA 3EU5A 1A5EA 4HI9A 2ETBA 4L7TA 2OEVA 2X6IA 2V0PA 3KD7A 1N11A 2YHEA 4DRXE 1H2UA 1AP7A 3Q47B 2J09A 3JQ1A 2P9KG 1BLXB 1QNFA 3SFXA 4WNGA 1SZ9A 4FJYA 5M72A 4L1BA 1EF1C 5CEAA 4C0EA 3HVEB 4UWFA 3CVWA 3CV0A 4EBAG 4ATGA 5JJTA 4JXTA 4BX8A 4ILIA 2ZIRA 5ENSD 3SBSA 3QK0A 5FZSA 3SQVA 2EQXA 1XNFA 2XGMA 3B7BA 3RJVA 1DCEA 4J8FA 1MX2A 2J4DA 5AYWD 2RKKA 4WNDA 3I4RB 4EBAA 3R7RA 3D9OA 2KZTB 4GTVA 3NBNB 3DBSA 1SQMA 3B7RL 1ELWA 5LFAA 5AIJA 1ZU2A 3UMVA 4CDNA 2R02A 2AJAA 2X6JA 1LD7A 2IEJA 5FIOA 5C2YA 1VDYA 4F3VA 2A5UA 3DSXA 3MA5A 3ONKA 2P9LG 2WXLA 4G8LA 4BWRA 1W3BA 4FHKA 1HFAA 5AQ9A 3U3WA 1N54A 3IV0A 2WXFA 5FQ8A 4G11A 3SI5A 3QNKA 4UI9C 2VGXB 2XPYA 3PE4A 4GAAA 4HRLA 1HU3A 2EILE 4N39A 3EHNA 2FEZA 3SFYA 3S7DA 5EDSA 3ZYMA 2WMOA 1OCRE 3I5PA 1N0RA 1Z3XA 5KJLA 4M3OA 2IOSA 5DIZA 3RKVA 2E0IA 4DUIA 4FHJA 2GRPB 4ANXA 3ZRHA 1H6KA 3EHMA 2R17C 2F8XK 5J08A 3ZPJA 3CVYA 1UN9A 5LCWJ 2A4ZA 2GGFA 4GA0A 2QC9A 2DYSE 4LEUA 5D0QD 3SNXA 1UOHA 3E4BA 4EQFA 1EDUA 3CKCA 2UY1A 3PNLB 5JHAA 1OUVA 3D9JA 3FU0A 3Q4AB 1S70B 3L16A 5G05C 3D3MA 5FJYA 4DX6D 3S7JA 2C0LA 2AXUA 3BUAA 1SA4A 4RG6A 3BG0B 3D9MA 2I9CA 3HG0D 1N0QA 5CBNA 3MZLB 3CSFA 4N3AA 4EPZA 3CK8A 4URKA 5EIDA 4NQ0A 4KZ0A 3D9HA 1INZA 3UT7A 4YDOA 5CECB 3FUMA 1X5BA 4N3BA 2WXGA 5ENQD 2QZAA 3IKOB 5D2MC 3FH7A 2XGSA 3EHRA 1K3ZD 2DZNA 3AJIA 4TUMA 2IY0C 4G26A 3TWSA 3AAAC 4GMRA 3CHQA 2PNNA 3Q7AA 5BV1A 3SHFA 3NF1A 2DCPA 2BTDA 5FQ7A 4ZHBA 2WXRA 2X6HA 4G2VA 4KT6B 1UG3A 3T5XA 3CVUA 3MV3B 5CERB 3PREA 3LS8A 5T8IA 5BT1A 3UKUG 3BG1B 5KWDA 2F0YA 2YNQA 2GRLA 3AG1E 3B95A 4I6EA 2P2CP 4U0ZA 4LCTA 3ONLA 2RD0A 2HYZA 1E8WA 3EHQA 3JQ0A 4KVMA 4M7CA 3TXMA 3JXJA 1YMPA 4G23A 5J90A 2CG3A 3PZ1A 1V55E 4OVUA 2Y69E 1G3NB 2HR2A 3U66A 2R05A 4R7LA 4LSZE 3UM0A 1D8EA 4RSYA 1BU9A 3RRUA 4E85A 3IHVA 3TJPA 3HRAA 1WG0A 3ESKA 3DXMG 3DXKG 3L13A 1XGWA 1N9AA 1U3DA 2IU1A 2J08A 1ZB1A 2H6IA 2ETCA 3DRAA 5AENA 1WY6A 3ABLE 1TN6A 3LVRE 4GMLA 1DVPA 3VLFA 5CRVA 4FLBA 4AOFA 3HDXA 4WWOA 1B89A 3ULEG 4DLQA 5FINA 3ZXSA 3DEOA 2GRRB 2AXVA 3FWVA 4AEZC 4U04A 2NSZA 3RSEG 3DSTA 3MYVA 4I9EA 2Y0BG 5EYLA 2PM6A 1RW2A 3UUXA 3ZHEB 4A3TA 3IHYA 1E7VA 4EZKA 3NZUA 3QC1A 4U8VD 5A6CA 4LNUD 2JLBA 5LP0A 4A3VA 4YDEA 4G25A 2JABA 4K0RA 2OOEA 2Y4UA 4ME2A 4O1OA 2RFMA 3BU8A 4UQYA 2KCVA 1HG5A 5JJ7A 4AVXA 4CGWA 3HXDA 2C2LA 3ASOE 3UT4A 2KCLA 3PUJA 3E37A 5CRUA 1QZ2A 4JB8P 3UIPC 5CMWA 2MRIA 2WXQA 3CHOA 2B0OE 3EIJA 2RG8A 3FHEA 4I17A 3UM1A 1UJKA 4B8CB 5FTPA 3L9TA 4N5CA 3PRZA 1TJFA 2CHWA 4NURA 4HOSA 3UI2A 2OV8A 3PZDA 2J8SD 4LERA 4XI0A 3MX3A 4HRMB 2XRYA 4DX1A 3W9FA 2LAIA 3UKRG 5HQ8A 1OCZE 4KVOA 4AV7A 4ABNA 1OCCE 3RRNB 2XQ0A 2Q7FA 2XRZA 2J4BA 2BKKB 2LXLA 3OXFA 4HI8A 1OWNA 3OAWA 5JMND 2WB2A 2L6JA 2WXJA 2VSXE 5LCWC 3MEKA 3APFA 3ASFA 2AW6A 1IYGA 4U0UA 2BEDA 4JA9A 3TWVA 1JCSA 3CK7A 3NOCD 4A63B 3FULA 3L54A 3LXUX 3R9MA 1TEZA 1QQEA 3LKUA 3J5PA 5ARFA 2UY1B 3B7UX 3CQGB 3MKRA 4B94A 3HHMA 4Y6WA 4APFA 2WVIA 2VQ2A 3BQOA 3CQCB 3LVQE 4ILGA 1N4QA 5A23A 1MX4A 4JA7A 3EJNA 2FBNA 3ML9A 3UIOC 3FDHA 3QB2A 4N3CA 4QQIA 1UN8A 3QOUA 3KEAA
chains in the Genus database with same CATH topology
3DWLG 3UKRG 4JD2G 3RSEG 1K8KG 4XEIG 1TYQG 2P9LG 1U2VG 2P9NG 3UKUG 3DXMG 2P9KG 3ULEG 2P9SG 2P9IG 3DXKG 2P9UG 2P9PG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DWL G;  3UKR G;  4JD2 G;  3RSE G;  1K8K G;  4XEI G;  1TYQ G;  2P9L G;  1U2V G;  2P9N G;  3UKU G;  3DXM G;  2P9K G;  3ULE G;  2P9S G;  2P9I G;  3DXK G;  2P9U G;  2P9P G; 
#chains in the Genus database with same CATH topology
 2GW1 A;  4DI4 A;  2VSN A;  4AY5 A;  3C5R A;  3LJN A;  2IOL A;  3FFL A;  3SD5 A;  1OWL A;  1S63 A;  4U96 D;  3V79 K;  4TXP A;  4EZL A;  2J9Q A;  3ASN E;  3DSV A;  2PL2 A;  5E76 A;  1H2T C;  4TRQ A;  3ZHE A;  4GU5 A;  1JCR A;  4YVO A;  4GZC A;  4ACK A;  3ZIM A;  3Q9N C;  3DPD A;  4XI9 A;  3AS5 A;  4ANW A;  1K8K G;  4RG9 A;  3NB2 A;  3RIB A;  3GYZ A;  4BSX A;  5JJ6 A;  1FCH A;  1HO8 A;  2XS8 A;  1OWM A;  4J7W A;  3Q75 A;  4GTQ A;  4NIK A;  5EN5 D;  3U64 A;  1N52 A;  5LX8 A;  2H6F A;  4GYW A;  3HXF A;  1FVF A;  2WXM A;  3RO2 A;  2LXM A;  2WXN A;  2P9I G;  2CHZ A;  1KLX A;  1IHB A;  1TJC A;  3SY2 A;  4MRU A;  2LO6 A;  4PUC A;  1TNO A;  3L08 A;  5FWQ A;  1TN8 A;  1IKN D;  1HS6 A;  5DBK A;  1K1B A;  5ENT D;  4BY6 A;  1V54 E;  2DVW A;  3PZ3 A;  4HVB A;  2XZD G;  1JCQ A;  4OYS A;  4CRW A;  3Q79 A;  2AVP A;  3HYM B;  4FJZ A;  5AAR A;  1OXJ A;  4BSZ B;  4O60 A;  4GA1 A;  4MLP A;  3FU6 A;  4B93 B;  4WWN A;  1LTX A;  5JHB A;  4JPS A;  3TL5 A;  4XX5 A;  4I1O B;  1HH8 A;  1NZN A;  1Z6T A;  2WPV A;  3UIN C;  3SFZ A;  1BI7 B;  3B7S A;  4GTO A;  2KAT A;  5G04 J;  2QY7 A;  3B13 A;  1E8Y A;  2GRQ B;  3GZ1 A;  4I1M A;  1HXI A;  4FP7 A;  4HOU A;  3ZXP A;  2WXK A;  1JUQ A;  3FUD A;  3L82 A;  3FTU A;  1UW4 B;  3TWT A;  3E32 A;  2HM8 A;  4P29 A;  4I1A A;  4Q69 A;  3CVV A;  3QWV A;  2L0T B;  4GZD A;  4BER A;  2GRN B;  1TNZ A;  1U3C A;  1E96 B;  4U95 D;  1OY3 D;  1N4S A;  4YDY A;  2VGY A;  3ZN3 A;  1MYO A;  3FY4 A;  2LUH A;  3ML8 A;  2M63 A;  4C48 B;  2P9N G;  2XS1 A;  3G2S A;  2EIM E;  4MKT A;  5G2N A;  3RU0 A;  1S64 A;  1ELK A;  3TWW A;  4FAD A;  1KZP A;  3ZYL A;  2V5F A;  3JCK C;  1OCO E;  3RK6 A;  4OAV B;  3CVQ A;  3ABM E;  3TG4 A;  4UQZ A;  2P9U G;  1MHQ A;  4U8H A;  4NAC A;  3UPV A;  3BEE A;  2FI7 A;  4BT9 A;  3LDZ A;  4IUL A;  2WM9 A;  4L23 A;  4FU3 A;  2F8Y A;  4PS3 A;  3ZYQ A;  2WQ6 A;  1WM5 A;  4UI9 K;  2C0M A;  1LF8 A;  3J5Q B;  4H7Y A;  3LEW A;  3C3O A;  1FPP A;  3FEY A;  4MS6 A;  3CEQ A;  2XCB A;  3D9L A;  4I9C A;  4XEI G;  3CK9 A;  2V5Q C;  5ENO D;  4JEH A;  3PVL A;  1OWO A;  3KS2 A;  4J8Y A;  1BD8 A;  3MJW A;  3L22 A;  2FO7 A;  3D9P A;  4GPK A;  4GTS A;  4W9R A;  3CHP A;  5KBA A;  4JZY A;  4GB9 A;  2ZGG A;  3URZ A;  3O4Z A;  3Q5M A;  4XIF A;  3TWR A;  2ZU6 B;  1H6P A;  3FTV A;  4KBQ A;  1IHG A;  2CG2 A;  4FA6 A;  4GZ6 A;  4UI9 J;  4N5Q A;  1MX6 A;  4DK5 A;  2LSV A;  4D10 C;  3ZEF A;  4ATZ D;  4RLY A;  1KZO A;  5ENN A;  5A7D B;  4HOT A;  3TGO A;  4DI3 A;  1N4R A;  1YYH A;  3LY9 A;  2OCC E;  3FTX A;  4GYY A;  3LCA A;  3APC A;  4N2Q A;  5CCL A;  3FH5 A;  2KCK A;  2IF4 A;  3I3N A;  3Q7F A;  4UWG A;  3Q73 A;  2BF0 X;  1HF8 A;  2HE0 A;  2XZT G;  3CHM A;  3CLJ A;  4HFG A;  1FVH A;  4HLE A;  2CHX A;  4HOQ A;  4B8A A;  3FTW A;  4CT4 A;  4UQX A;  1TNY A;  2IO2 C;  3T8M A;  4IRU A;  3UX4 A;  4UWH A;  5ENP D;  4KMO A;  1JPL A;  2V4H C;  4GZ3 A;  5T4Y A;  2VJ8 A;  4LRZ A;  3CVX A;  1Q2Z A;  4J8D A;  2DWZ A;  2OEW A;  1E7U A;  3C3R A;  2PM7 A;  5BPP A;  5G05 J;  3EU9 A;  3PEU B;  5CMY A;  5EX0 A;  4AP2 A;  4B89 A;  5BXO A;  3MKQ B;  4I6G A;  3QWP A;  4EZJ A;  2NC9 A;  1Y8M A;  3Q15 A;  2L6B A;  1SZA A;  4GTT A;  2QFC A;  3QJZ A;  1QBQ A;  2V8S E;  2YIN A;  3ZYK A;  5ARG A;  2ZIS A;  3FTS A;  2OVB A;  2KBX A;  1IQR A;  4L9P A;  1NP7 A;  3G2W A;  1WDY A;  1HE8 A;  5ANR A;  3CIA A;  2VSO E;  4APO A;  3ESL A;  3TXN A;  1EPU A;  1S0P A;  3ASD A;  4HNA D;  5AQ7 A;  3ZU7 B;  3PZ2 A;  5AJD A;  2IO3 C;  3Q78 A;  2ION A;  4B0Z A;  4I43 A;  4GTP A;  1N95 A;  4YDW A;  3AS4 A;  4AJW A;  4I2W A;  2DZO A;  2WQ7 A;  3UQ3 A;  2EIJ E;  1E8Z A;  2NXP A;  4RQI A;  4F1S A;  3V2O A;  3U4T A;  2R59 A;  3AS8 A;  4CYM D;  1ELR A;  2QYU A;  4XZ4 A;  4ACL A;  3U9W A;  5C1D A;  3UXG A;  3CVL A;  4G24 A;  3V31 A;  5CBO A;  4WNE A;  3EUV A;  1OWP A;  1DC2 A;  3QAQ A;  1KT1 A;  3FUH A;  2WMN A;  2GRO B;  3R7Q A;  5EX3 A;  3LY8 A;  3KAE A;  5G04 C;  4F7A A;  4EEC A;  3RAU A;  3UM3 A;  3ENE A;  3FEX A;  3MCX A;  4WNF A;  2YHC A;  3B7T A;  4GCO A;  4GPM A;  3F6Q A;  1N4P A;  1O5M A;  3HXC A;  3Q49 B;  4CT0 A;  2GRM A;  5BNW A;  5EKQ D;  5EIL A;  4BES A;  4U7E B;  3VLE A;  5CED B;  2V4L A;  3C72 A;  2WXP A;  4FC8 A;  2AWI A;  4X8Q A;  2P58 C;  3ZFW A;  5KCM A;  2QYJ A;  4GMJ A;  2VTB A;  4J8E A;  4K5B A;  4A1G A;  2P9S G;  3CR3 A;  3ULY A;  3FP3 A;  4J8S A;  4HRN A;  4TV3 A;  3FU3 A;  4BET A;  3ISM C;  2B6C A;  5D0O D;  2JEK A;  2PZI A;  1BPO A;  4BX9 A;  2HO1 A;  1H19 A;  4AY6 A;  3PE3 A;  3MKQ A;  3NAW A;  3ZUV B;  3FTY A;  2RFA A;  3SGH A;  3FUI A;  3V2X A;  4DX2 A;  2X6F A;  1K1A A;  3FUJ A;  1PC2 A;  2Y1L E;  1NI1 A;  1BI8 B;  2CFU A;  2Y3A A;  3SO8 A;  4JHK A;  3SF4 A;  3ABK E;  1FT2 A;  4HXI A;  5AN8 A;  3KSL A;  1MZC A;  4FUL A;  3VLD A;  3QAR A;  3DPY A;  3EIQ C;  3PZ4 A;  2DBA A;  3UT8 A;  3CHS A;  2X38 A;  1KPS B;  4U07 A;  5HRY A;  3G2U A;  4U63 A;  5KNH D;  4GA2 A;  2X3M A;  4CDR A;  5D66 A;  5FZQ A;  1YA0 A;  3PNT B;  4WUY A;  2I1J A;  1PAQ A;  4Z68 A;  2I2O A;  4JD2 G;  4C0M A;  4F6R D;  5KNG A;  2MYO A;  3X2Q E;  3QDN A;  5B1B E;  4IYP A;  5HS0 A;  4AIF A;  1P5Q A;  3IBE A;  1NFI E;  1H0A A;  5CHE E;  4JW1 A;  3OXL A;  3NZS A;  4H7X A;  5BV0 A;  1SVX A;  4EHM A;  3DSU A;  5AQA A;  3CST A;  4F53 A;  1EYH A;  2XCC A;  4F1P A;  4JL0 A;  5AQB A;  2DIW A;  4BTB A;  4ANU A;  3TWX A;  2XEE A;  4DX5 D;  4WAF A;  2KC7 A;  3P1U A;  3JUE A;  2YQ8 A;  2XHE A;  4BEP A;  4J0U A;  3EDT B;  4Q96 A;  1JWF A;  2PQR A;  3FUF A;  3ZKJ A;  3FTZ A;  4K5A B;  3ZNG A;  1L5J A;  2R03 A;  2L0I A;  3ULQ A;  3HXE A;  1MJ0 A;  1HZ4 A;  5HKP A;  1AWC B;  1QYM A;  3DSS A;  3UTM A;  3IEG A;  5FQ6 A;  3DSW A;  1Y6I A;  2Y4T A;  1IXV A;  2X6K A;  2VGE A;  3QKY A;  1PY1 A;  4U0S A;  5G55 A;  1X81 A;  2IQC A;  3CKB A;  3PUK A;  3FUE A;  1NA0 A;  4U8Y D;  3RO3 A;  5AAO A;  1O1T A;  3FUK A;  2EIN E;  4GYO A;  2LSU A;  4Y6C A;  5LOZ A;  3QWW A;  1U2V G;  4BTA A;  2J49 A;  5FT9 A;  2BUG A;  4OAU C;  1KT0 A;  3HXB A;  3IXE A;  2LNI A;  4BT8 A;  1FT1 A;  3WXX A;  4DPR A;  3JXI A;  2E2E A;  4HBD A;  4YVQ C;  3E33 A;  3S7F A;  1LD8 A;  3HVE A;  5AJL A;  3L17 A;  4K5C A;  3PS6 A;  1Z3Y A;  5CCM A;  4OVV A;  2CFZ A;  5T3R A;  4HB5 A;  2PQN A;  3T5V A;  5ANL A;  2NYJ A;  5HI7 A;  4JEU A;  4MBG A;  5KJM A;  3AG4 E;  3OTN A;  1D9S A;  4HQD A;  4TUU A;  3D9I A;  5JA4 D;  3LPZ A;  2KZT A;  3WG7 E;  4RVB A;  1H6O A;  1D8D A;  3W9G A;  4DJA A;  2ZXW E;  3ASH A;  4ZFH A;  4CDM A;  3T8K A;  2OND A;  2L9B A;  1YCS B;  3I4G A;  2UWJ G;  2XPZ A;  1H2V C;  3AG3 E;  3R9A B;  5EYP F;  4GZ5 A;  4XKC A;  4JC8 A;  4JVS A;  2AXZ A;  3GZ2 A;  5BXU A;  1TYQ G;  1SW6 A;  4LUN U;  3SBT B;  1Z5S C;  3PH0 C;  2H6H A;  3GW4 A;  3KEZ A;  4KXK B;  3LYA A;  1TNB A;  2VGX A;  4TXQ A;  3CGH A;  2XEV A;  4LNB A;  2I1K A;  2OVF A;  4AM9 A;  1RZ4 A;  3LJ3 A;  2VSY A;  4V3I A;  5B1A E;  2F37 A;  1DCQ A;  3NOG D;  2FUL A;  3D9N A;  2WXI A;  3CHR A;  1HX8 A;  1N94 A;  1IQU A;  4LNG A;  5ITZ F;  5BW8 C;  3JUI A;  3V30 A;  3MGB A;  1SA5 A;  2KXP C;  3VTX A;  3TWU A;  3NQP A;  4CEM A;  1NA3 A;  4CGV A;  1WAO 1;  3CVP A;  4J6I A;  4UWK A;  4G8K A;  2FF4 A;  1TR4 A;  2ETA A;  1GW6 A;  2XGO A;  3OXG A;  4PH4 B;  4L2L A;  4UWL A;  1UJJ A;  1ZBP A;  4G1T A;  2VTB B;  4FLH A;  3G2V A;  3L6A A;  4I2Z A;  4C9B B;  4GCN A;  2MHK A;  4LG6 A;  2XEH A;  4YND A;  5B3S E;  2BKG A;  3JYS A;  4HLL A;  3CVN A;  4ILH B;  4HOR A;  2H6G A;  4O1P A;  3O48 A;  1HG2 A;  3KSQ A;  1A17 A;  2IJG X;  2MOW A;  3AU5 A;  4CCA A;  3ZW3 A;  3D9K A;  4DLO A;  1OT8 A;  3PEV B;  4DX7 D;  5KJN A;  3N71 A;  3SZ7 A;  4KYO B;  1JWG A;  3AG2 E;  5EIB E;  2WXH A;  4A1S A;  1E8X A;  4XE0 A;  4CZ2 D;  3DEP A;  3FH8 A;  4NRH B;  3ASG A;  4PS7 A;  3P2B A;  4TXR A;  2FO1 E;  4IN3 B;  3E30 A;  3HIZ A;  2WQH A;  4ANV A;  3RRM B;  4K03 A;  2A5E A;  3TWQ A;  4QFV A;  3FU5 A;  3APD A;  2R5S A;  4L2Y A;  4JHJ A;  5H7P A;  3LY7 A;  4HS2 A;  4PDX A;  5IY5 E;  2R2L A;  4I6J A;  4O6F A;  2KM4 A;  3ZVV A;  5FZR A;  3MV2 B;  2XEN A;  2J07 A;  4A55 A;  2I6H A;  1O1R A;  1O1S A;  3G2T A;  3E34 A;  3Q9U C;  4UUC A;  4BFR A;  3TG5 A;  3ZGQ A;  3S2A A;  4Q94 A;  3AU4 A;  3S7B A;  3C98 A;  3GZS A;  3T9K A;  4XKB A;  1TNU A;  5BUZ A;  2VYI A;  3VTY A;  1E90 A;  5E75 A;  2P9P G;  4GTR A;  2ILR A;  4PS8 A;  1NL4 A;  3DWL G;  2LAH A;  2IFU A;  3C3Q A;  4WWP A;  4GTM A;  1MQS A;  5FQ4 A;  3TAX A;  2WXO A;  2EIK E;  5KJK A;  2ZGD A;  4AXH A;  3UM2 A;  4JHR A;  4N2S A;  3PDN A;  4KZC A;  2DYR E;  5ENR D;  1DNP A;  3FUN A;  2XPI A;  1TN7 A;  3K9I A;  4E6H A;  3EU5 A;  1A5E A;  4HI9 A;  2ETB A;  4L7T A;  2OEV A;  2X6I A;  2V0P A;  3KD7 A;  1N11 A;  2YHE A;  4DRX E;  1H2U A;  1AP7 A;  3Q47 B;  2J09 A;  3JQ1 A;  2P9K G;  1BLX B;  1QNF A;  3SFX A;  4WNG A;  1SZ9 A;  4FJY A;  5M72 A;  4L1B A;  1EF1 C;  5CEA A;  4C0E A;  3HVE B;  4UWF A;  3CVW A;  3CV0 A;  4EBA G;  4ATG A;  5JJT A;  4JXT A;  4BX8 A;  4ILI A;  2ZIR A;  5ENS D;  3SBS A;  3QK0 A;  5FZS A;  3SQV A;  2EQX A;  1XNF A;  2XGM A;  3B7B A;  3RJV A;  1DCE A;  4J8F A;  1MX2 A;  2J4D A;  5AYW D;  2RKK A;  4WND A;  3I4R B;  4EBA A;  3R7R A;  3D9O A;  2KZT B;  4GTV A;  3NBN B;  3DBS A;  1SQM A;  3B7R L;  1ELW A;  5LFA A;  5AIJ A;  1ZU2 A;  3UMV A;  4CDN A;  2R02 A;  2AJA A;  2X6J A;  1LD7 A;  2IEJ A;  5FIO A;  5C2Y A;  1VDY A;  4F3V A;  2A5U A;  3DSX A;  3MA5 A;  3ONK A;  2P9L G;  2WXL A;  4G8L A;  4BWR A;  1W3B A;  4FHK A;  1HFA A;  5AQ9 A;  3U3W A;  1N54 A;  3IV0 A;  2WXF A;  5FQ8 A;  4G11 A;  3SI5 A;  3QNK A;  4UI9 C;  2VGX B;  2XPY A;  3PE4 A;  4GAA A;  4HRL A;  1HU3 A;  2EIL E;  4N39 A;  3EHN A;  2FEZ A;  3SFY A;  3S7D A;  5EDS A;  3ZYM A;  2WMO A;  1OCR E;  3I5P A;  1N0R A;  1Z3X A;  5KJL A;  4M3O A;  2IOS A;  5DIZ A;  3RKV A;  2E0I A;  4DUI A;  4FHJ A;  2GRP B;  4ANX A;  3ZRH A;  1H6K A;  3EHM A;  2R17 C;  2F8X K;  5J08 A;  3ZPJ A;  3CVY A;  1UN9 A;  5LCW J;  2A4Z A;  2GGF A;  4GA0 A;  2QC9 A;  2DYS E;  4LEU A;  5D0Q D;  3SNX A;  1UOH A;  3E4B A;  4EQF A;  1EDU A;  3CKC A;  2UY1 A;  3PNL B;  5JHA A;  1OUV A;  3D9J A;  3FU0 A;  3Q4A B;  1S70 B;  3L16 A;  5G05 C;  3D3M A;  5FJY A;  4DX6 D;  3S7J A;  2C0L A;  2AXU A;  3BUA A;  1SA4 A;  4RG6 A;  3BG0 B;  3D9M A;  2I9C A;  3HG0 D;  1N0Q A;  5CBN A;  3MZL B;  3CSF A;  4N3A A;  4EPZ A;  3CK8 A;  4URK A;  5EID A;  4NQ0 A;  4KZ0 A;  3D9H A;  1INZ A;  3UT7 A;  4YDO A;  5CEC B;  3FUM A;  1X5B A;  4N3B A;  2WXG A;  5ENQ D;  2QZA A;  3IKO B;  5D2M C;  3FH7 A;  2XGS A;  3EHR A;  1K3Z D;  2DZN A;  3AJI A;  4TUM A;  2IY0 C;  4G26 A;  3TWS A;  3AAA C;  4GMR A;  3CHQ A;  2PNN A;  3Q7A A;  5BV1 A;  3SHF A;  3NF1 A;  2DCP A;  2BTD A;  5FQ7 A;  4ZHB A;  2WXR A;  2X6H A;  4G2V A;  4KT6 B;  1UG3 A;  3T5X A;  3CVU A;  3MV3 B;  5CER B;  3PRE A;  3LS8 A;  5T8I A;  5BT1 A;  3UKU G;  3BG1 B;  5KWD A;  2F0Y A;  2YNQ A;  2GRL A;  3AG1 E;  3B95 A;  4I6E A;  2P2C P;  4U0Z A;  4LCT A;  3ONL A;  2RD0 A;  2HYZ A;  1E8W A;  3EHQ A;  3JQ0 A;  4KVM A;  4M7C A;  3TXM A;  3JXJ A;  1YMP A;  4G23 A;  5J90 A;  2CG3 A;  3PZ1 A;  1V55 E;  4OVU A;  2Y69 E;  1G3N B;  2HR2 A;  3U66 A;  2R05 A;  4R7L A;  4LSZ E;  3UM0 A;  1D8E A;  4RSY A;  1BU9 A;  3RRU A;  4E85 A;  3IHV A;  3TJP A;  3HRA A;  1WG0 A;  3ESK A;  3DXM G;  3DXK G;  3L13 A;  1XGW A;  1N9A A;  1U3D A;  2IU1 A;  2J08 A;  1ZB1 A;  2H6I A;  2ETC A;  3DRA A;  5AEN A;  1WY6 A;  3ABL E;  1TN6 A;  3LVR E;  4GML A;  1DVP A;  3VLF A;  5CRV A;  4FLB A;  4AOF A;  3HDX A;  4WWO A;  1B89 A;  3ULE G;  4DLQ A;  5FIN A;  3ZXS A;  3DEO A;  2GRR B;  2AXV A;  3FWV A;  4AEZ C;  4U04 A;  2NSZ A;  3RSE G;  3DST A;  3MYV A;  4I9E A;  2Y0B G;  5EYL A;  2PM6 A;  1RW2 A;  3UUX A;  3ZHE B;  4A3T A;  3IHY A;  1E7V A;  4EZK A;  3NZU A;  3QC1 A;  4U8V D;  5A6C A;  4LNU D;  2JLB A;  5LP0 A;  4A3V A;  4YDE A;  4G25 A;  2JAB A;  4K0R A;  2OOE A;  2Y4U A;  4ME2 A;  4O1O A;  2RFM A;  3BU8 A;  4UQY A;  2KCV A;  1HG5 A;  5JJ7 A;  4AVX A;  4CGW A;  3HXD A;  2C2L A;  3ASO E;  3UT4 A;  2KCL A;  3PUJ A;  3E37 A;  5CRU A;  1QZ2 A;  4JB8 P;  3UIP C;  5CMW A;  2MRI A;  2WXQ A;  3CHO A;  2B0O E;  3EIJ A;  2RG8 A;  3FHE A;  4I17 A;  3UM1 A;  1UJK A;  4B8C B;  5FTP A;  3L9T A;  4N5C A;  3PRZ A;  1TJF A;  2CHW A;  4NUR A;  4HOS A;  3UI2 A;  2OV8 A;  3PZD A;  2J8S D;  4LER A;  4XI0 A;  3MX3 A;  4HRM B;  2XRY A;  4DX1 A;  3W9F A;  2LAI A;  3UKR G;  5HQ8 A;  1OCZ E;  4KVO A;  4AV7 A;  4ABN A;  1OCC E;  3RRN B;  2XQ0 A;  2Q7F A;  2XRZ A;  2J4B A;  2BKK B;  2LXL A;  3OXF A;  4HI8 A;  1OWN A;  3OAW A;  5JMN D;  2WB2 A;  2L6J A;  2WXJ A;  2VSX E;  5LCW C;  3MEK A;  3APF A;  3ASF A;  2AW6 A;  1IYG A;  4U0U A;  2BED A;  4JA9 A;  3TWV A;  1JCS A;  3CK7 A;  3NOC D;  4A63 B;  3FUL A;  3L54 A;  3LXU X;  3R9M A;  1TEZ A;  1QQE A;  3LKU A;  3J5P A;  5ARF A;  2UY1 B;  3B7U X;  3CQG B;  3MKR A;  4B94 A;  3HHM A;  4Y6W A;  4APF A;  2WVI A;  2VQ2 A;  3BQO A;  3CQC B;  3LVQ E;  4ILG A;  1N4Q A;  5A23 A;  1MX4 A;  4JA7 A;  3EJN A;  2FBN A;  3ML9 A;  3UIO C;  3FDH A;  3QB2 A;  4N3C A;  4QQI A;  1UN8 A;  3QOU A;  3KEA A; 
#chains in the Genus database with same CATH homology
 3DWL G;  3UKR G;  4JD2 G;  3RSE G;  1K8K G;  4XEI G;  1TYQ G;  2P9L G;  1U2V G;  2P9N G;  3UKU G;  3DXM G;  2P9K G;  3ULE G;  2P9S G;  2P9I G;  3DXK G;  2P9U G;  2P9P G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...