4GMRA

Crystal structure of engineered protein. northeast structural genomics consortium target or266.
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
167
structure length
167
Chain Sequence
SELGKRLIEAAENGNKDRVKDLLENGADVNASDSDGKTPLHLAAENGHKEVVKLLLSQGADPNAKDSDGKTPLHLAAENGHKEVVKLLLSQGADPNAKDSDGKTPLHLAAENGHKEVVKLLLSQGADPNTSDSDGRTPLDLAREHGNEEVVKLLEKQGGWLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OR266 DE NOVO PROTEIN
publication title Computational design of self-assembling cyclic protein homo-oligomers.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 65
structure length 167
sequence length 167
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4gmrA00
1A5EA 5AARA 4GMRA 3V2XA 3W9FA 5ITZF 5BXUA 4HRLA 4J7WA 1OY3D 3TWSA 4YDYA 4DX5D 5AQ7A 4BESA 4CZ2D 1YYHA 4RLYA 2A5EA 2Y0BG 4ATZD 2L6BA 3TWXA 5EN5D 4HNAD 5AQAA 3TWRA 3ZNGA 5EILA 4F1PA 5KNGA 5EYPF 4ZHBA 3HRAA 3T8KA 4LSZE 2RFAA 5JMND 4G8LA 3TWVA 4ZFHA 5CECB 2QC9A 1OT8A 4O60A 3HG0D 2DWZA 4K5CA 4NIKA 1K1AA 4O1OA 4F6RD 4YDWA 1NFIE 1YCSB 3B7BA 5AQ9A 1K3ZD 3B95A 4HI9A 5EYLA 4DRXE 2V5QC 4G8KA 1YMPA 5D66A 2XENA 1MJ0A 2KXPC 1MYOA 4LG6A 1QYMA 4C48B 2ZGDA 4HB5A 4U96D 4OAVB 1BLXB 3NOCD 3JXJA 3J5QB 4TUMA 2P2CP 3NOGD 3UI2A 3DEPA 2ETAA 3V30A 4K5BA 1G3NB 5EIBE 1DCQA 2F8YA 2BKKB 3Q9UC 1SVXA 5FINA 4UUCA 3V79K 3TWUA 5CBOA 1BI8B 2RFMA 3AJIA 2AJAA 3ZKJA 3D9HA 4U95D 4Z68A 3TWQA 3NBNB 3W9GA 1AWCB 3Q9NC 3IXEA 4CYMD 1BU9A 5FIOA 5CEAA 3LJNA 4HRNA 2DZOA 1TR4A 4U8VD 3AAAC 4JB8P 1IXVA 2XZTG 5HKPA 3V31A 1AP7A 3ZU7B 4K5AB 4HLLA 1N0RA 2JABA 4N5QA 5KNHD 4HQDA 5KWDA 2NYJA 3UTMA 5ENPD 5ENSD 1BD8A 1N11A 3EU9A 2ETCA 4A63B 3C5RA 3EHQA 5ENRD 1MX2A 2PNNA 2BKGA 4BSZB 5AQBA 2ZGGA 3T9KA 2KBXA 2B0OE 4QFVA 1D9SA 4DX6D 4DUIA 4OAUC 1DC2A 3J5PA 2Y1LE 3V2OA 4J8YA 3UXGA 2XZDG 4B93B 2FO1E 3EHRA 4U8YD 2ETBA 2V4HC 5CERB 4HBDA 1S70B 1N0QA 5EIDA 4DX1A 1WDYA 1SW6A 3JXIA 3ZUVB 3KEAA 4BETA 2DZNA 2VGEA 1BI7B 4DX7D 5AAOA 2F8XK 4QQIA 4GPMA 4HRMB 5ENTD 5BXOA 2J8SD 4BERA 5CBNA 5HRYA 5HS0A 3TWWA 4BEPA 1UOHA 2XEEA 1K1BA 3TWTA 5JA4D 2F37A 2DVWA 5AN8A 3SO8A 3F6QA 4DX2A 5ENOD 4LNUD 2QYJA 1MX4A 1MX6A 1WG0A 4O1PA 5CEDB 1IHBA 3DEOA 5ENQD 4HI8A 2XEHA 5KBAA 1IKND 3JUEA 2MYOA 2HE0A
chains in the Genus database with same CATH superfamily
5ENNA 4FU3A 5FJYA 1QZ2A 3P2BA 4J7WA 2Y69E 4LNBA 3CHOA 3VLEA 4ATZD 2KZTA 4WWNA 2ZU6B 3FTYA 3FUIA 5EYPF 4H7XA 3D9JA 3HRAA 3OXFA 4XE0A 2GRNB 1E8XA 2VGXA 1JUQA 1H6OA 3RJVA 2XS1A 4AOFA 3ABME 4GTMA 4Q96A 4PUCA 4K03A 3RAUA 5FZQA 2JLBA 2VTBA 3RSEG 3FULA 1KPSB 2PQRA 4L2LA 5T8IA 1HU3A 3G2TA 5BPPA 4BTAA 3OXLA 2QYUA 4A1GA 3HXFA 3EIJA 1BD8A 3Q75A 1E90A 2KATA 2ONDA 1V54E 3KS2A 4LNGA 3CHQA 3V2OA 3QB2A 2XZDG 4CRWA 5A6CA 1WDYA 3UM0A 3DSWA 3TG5A 4I2WA 4XI9A 4DX7D 4QQIA 5HRYA 3TWWA 3QKYA 3FWVA 3MGBA 1Y8MA 4C0EA 4FLBA 4JA7A 5ARGA 3ABLE 2UWJG 3RO3A 1FVHA 3AG4E 5E75A 3L17A 2ZISA 3V2XA 4BWRA 5ITZF 5BXUA 3TWSA 2ILRA 2GRQB 2Y0BG 4FP7A 5EN5D 3TG4A 3SD5A 2MOWA 1MQSA 4N3AA 1P5QA 1OT8A 1HF8A 3NZUA 3HXCA 2I1KA 5EYLA 5D66A 3DPDA 2L0IA 1WM5A 4JL0A 3QWVA 3RRMB 4CDMA 3JUIA 4UUCA 5KJLA 4AV7A 5BW8C 4GA2A 2CHWA 3D9HA 2LXLA 3DRAA 3EHMA 3S7DA 3URZA 2XZTG 4NACA 3TL5A 5KNHD 2YQ8A 5FZSA 3ISMC 2V5FA 2NXPA 1OXJA 4GMLA 5EX0A 1SQMA 3PVLA 5LOZA 2R5SA 2YNQA 1HZ4A 5D0QD 2FO1E 3DXMG 3FU3A 3U4TA 3I4GA 3CSTA 4BETA 3WG7E 3IEGA 4GTVA 3S2AA 2WXIA 3MA5A 3UT8A 1N94A 3ASFA 4X8QA 3F6QA 1MX6A 1UJKA 3LY8A 3FTVA 1IKND 2MYOA 2HE0A 1SA5A 5CMWA 3GZSA 1VDYA 3ULYA 2V4LA 3L16A 4GYYA 1O5MA 5AYWD 3U66A 1KT0A 3PEUB 4AP2A 2OV8A 5LX8A 1E8WA 4GCOA 3R9MA 2XPZA 1PY1A 2MRIA 4IRUA 4DRXE 3U3WA 2WM9A 2UY1B 3MV2B 4LG6A 3ZIMA 4JW1A 2CHZA 3DEPA 3V30A 1SVXA 3HYMB 3UQ3A 3V79K 3EJNA 1UN8A 1BI8B 2GRLA 3Q9NC 3JQ0A 4ABNA 1MHQA 4TXQA 3C3OA 4TRQA 2AXVA 3OTNA 3NZSA 3VLDA 1H2TC 4E6HA 3FTSA 2L6JA 1MX2A 5KJNA 3ZYMA 3PDNA 3T9KA 4CDRA 1NP7A 4GU5A 4NRHB 2GRRB 2VGYA 1DVPA 4U0ZA 1U2VG 3EIQC 2HR2A 3GZ2A 5H7PA 2VGEA 4JEUA 4IYPA 4N39A 3ENEA 4BERA 3UUXA 4W9RA 5AJDA 1SZ9A 5LCWJ 5FQ8A 1BPOA 3JYSA 2WXNA 3DEOA 2OVFA 2AWIA 4KZ0A 3FEYA 5C2YA 4HRLA 3E4BA 3MYVA 5AARA 3FEXA 3W9FA 3AU4A 3UM3A 3P1UA 1RZ4A 5KNGA 4DJAA 3QWWA 4G8LA 1B89A 3MCXA 2DWZA 2DYRE 4AY6A 4DI4A 2V5QC 3QWPA 4TUUA 1OWPA 5ANRA 4UQXA 4K5BA 5CMYA 2BKKB 5T4YA 2H6GA 3AS8A 2CHXA 1EPUA 3UIOC 4CYMD 3FTXA 4FHKA 4MBGA 3V31A 4HLLA 4EZLA 4L23A 3FH5A 2C0LA 4YNDA 2XGOA 2GGFA 3AG3E 3DSXA 2BKGA 3UKUG 4B8CB 4WNGA 2L0TB 1ZB1A 4J8YA 2IONA 4OVVA 4G11A 2DIWA 2ETBA 3L9TA 2J9QA 2LUHA 5ANLA 3B13A 3ASOE 5ENTD 4GTTA 2XCCA 2XCBA 2H6FA 3FUFA 2QYJA 4L9PA 4GZCA 1IQUA 4HI8A 1N52A 3MJWA 4I6EA 4GMRA 4HLEA 4JA9A 2X38A 4XKCA 3TXMA 4CZ2D 3DBSA 3ZW3A 1WY6A 2X6FA 3LKUA 3ZNGA 4I1OB 3FUHA 1E8ZA 4UQYA 2AW6A 4U07A 2XRZA 3CEQA 3Q4AB 2XGMA 4HI9A 1QNFA 2YHCA 3RKVA 3NOGD 3R7RA 2DCPA 3ML9A 3FH7A 3OAWA 5FTPA 3T5XA 2RFMA 1HO8A 5EKQD 3ZKJA 1XGWA 5HKPA 5B1AE 4HOUA 3Q7FA 4HORA 3LS8A 2XGSA 3CKCA 5ENSD 4F7AA 3D9PA 3LPZA 2I2OA 3NF1A 4GTQA 2PNNA 4F1SA 2KCLA 4HOSA 2WMOA 3J5PA 2OOEA 1HXIA 4YVOA 1IYGA 4Y6CA 4G24A 5AAOA 4HRMB 1N4PA 3BG1B 4JZYA 2FULA 1TNBA 3KSLA 1NA3A 2C0MA 1WG0A 4B8AA 2WXMA 4JD2G 3LVRE 2P9UG 1XNFA 4BESA 3E37A 4GTOA 3BEEA 5B1BE 3SF4A 2YINA 3FTZA 3TWRA 4HVBA 3UM1A 4JC8A 4P29A 4NIKA 1K1AA 1OWMA 3B7RL 1NFIE 3RIBA 3G2SA 5AQ9A 2P58C 3BG0B 3TAXA 1X5BA 4AEZC 2V8SE 3PH0C 3PRZA 4GCNA 3DSUA 3SFYA 2V0PA 3R9AB 2PL2A 1Z3YA 2XQ0A 3Q47B 1N95A 4Z68A 3NBNB 1D8EA 2VSOE 5FIOA 1ZBPA 4JXTA 2VJ8A 3ZU7B 4JVSA 4U0SA 3SBSA 4A55A 1KZPA 3QOUA 5BUZA 2ZXWE 3ZFWA 4FHJA 3QNKA 2Y4UA 4BSZB 2ZGGA 2KBXA 2IOSA 5KCMA 5G05J 1S63A 4PDXA 3PEVB 3EHRA 3L54A 1N0QA 2RD0A 5LCWC 4GTRA 4DLQA 1TYQG 1ELKA 2WVIA 3UT4A 1OCOE 2NC9A 3E32A 3CK7A 3TWTA 5EDSA 1ZU2A 3FDHA 2HYZA 3ASHA 2XPIA 4PH4B 3RU0A 4LERA 5CCMA 4DX5D 5FQ4A 3MEKA 4G25A 2A5EA 3KD7A 2CFZA 2WXOA 5KJMA 4XX5A 3SHFA 1DCEA 4N2SA 3T8KA 3EHNA 4ILIA 4GAAA 1TN7A 1HG2A 2A4ZA 4I6GA 4YDWA 4CGWA 4IN3B 3KSQA 1K3ZD 2KCVA 4Q94A 3VLFA 2R02A 5AENA 3U64A 4GMJA 1MYOA 3APFA 1UJJA 2GRPB 2ZGDA 1BLXB 1LD7A 3JXJA 3J5QB 4RG9A 1JCSA 1H2UA 4TUMA 2ETAA 3CVVA 4HS2A 2UY1A 1FPPA 2VYIA 2L9BA 3QAQA 1OCCE 4U95D 3LJNA 1IXVA 3APDA 4GZ5A 5G55A 5JJ6A 4UI9K 5KWDA 4RVBA 3HVEB 2IFUA 3ZXPA 3L82A 3VTXA 2XRYA 2OVBA 4QFVA 4OAUC 1DC2A 1TNYA 2IQCA 2LSVA 2R17C 5CERB 3LCAA 4DX1A 3FY4A 4OYSA 1KT1A 3K9IA 4AJWA 4ILHB 5JA4D 1OWNA 4ACKA 4U8HA 4LNUD 5B3SE 5HI7A 5KBAA 1ELRA 4J8FA 3FU6A 4WNEA 2IOLA 4XKBA 4G23A 1JCRA 2FF4A 5BV1A 2EIME 2H6IA 2OEVA 3ASDA 2LSUA 3T8MA 1PC2A 4JHRA 1HE8A 5CHEE 3E34A 3S7BA 4XI0A 5FQ6A 4WWPA 3LJ3A 3EUVA 4XIFA 3I3NA 3GYZA 2Y3AA 4GZ6A 3TWQA 3KAEA 2BEDA 3CVPA 4KBQA 4MRUA 1TR4A 3CK8A 4HFGA 1N0RA 4B0ZA 4L7TA 2ETCA 2FO7A 1OCRE 4HOTA 4KVMA 4A3TA 1W3BA 3X2QE 2WXGA 3PZ1A 2IO2C 1HG5A 1H6PA 2P9LG 3ZUVB 4KVOA 3PUJA 2BTDA 4PS7A 3MKRA 2F8XK 5BXOA 4GPKA 5AJLA 5A7DB 2BF0X 3SNXA 2X6JA 2QFCA 4RG6A 3PZ3A 1LF8A 2J4DA 3ML8A 4U0UA 5HQ8A 4FJZA 4EPZA 2P9IG 3GZ1A 4GYWA 2L6BA 1EDUA 4BTBA 2P9SG 3ESLA 2WXQA 1Z5SC 2I6HA 4JHKA 5E76A 2AXZA 2VSXE 1OWOA 3E33A 4CCAA 4I1MA 5CECB 3NQPA 4O60A 2PM7A 4MLPA 1L5JA 3AU5A 3FHEA 3FU0A 3C98A 3WXXA 3CGHA 3UT7A 1WAO1 4U7EB 3ZHEA 3L6AA 4HB5A 4U96D 3RO2A 2B6CA 4J0UA 5EIBE 3Q9UC 2LAHA 4RSYA 3ZYQA 3PREA 5LFAA 4ANXA 2PZIA 5KJKA 1U3DA 5M72A 2HM8A 5FQ7A 1KZOA 4I2ZA 2OEWA 3DSVA 3G2VA 1Z3XA 2VSYA 1OUVA 3FUEA 1N11A 5G05C 2WXLA 3UIPC 5ENRD 1SA4A 1N54A 3PUKA 2LO6A 5AQBA 4CDNA 1D9SA 4F53A 3Q49B 3Q15A 4ACLA 2V4HC 4GTPA 4HBDA 3PNTB 4U63A 1BI7B 2J8SD 5HS0A 4AY5A 1SZAA 3BQOA 5A23A 2EIJE 4AIFA 2FEZA 1OWLA 1A5EA 2WPVA 3SZ7A 4FA6A 5AQ7A 3VTYA 3TWXA 3HDXA 4BSXA 3PS6A 4F1PA 3EU5A 3MV3B 4H7YA 3SQVA 2LXMA 1K8KG 3ASGA 4K5CA 1H0AA 3O48A 3ZEFA 4I1AA 1RW2A 4WAFA 2KC7A 3B95A 4L2YA 3AS5A 3ONLA 2WXFA 1G3NB 2P9PG 1GW6A 2AJAA 3W9GA 1H6KA 5ARFA 2EQXA 3ZHEB 3EDTB 1UN9A 3E30A 1N4RA 3HHMA 5ENPD 1E96B 1ELWA 2X6KA 4A63B 3Q78A 3RRNB 2B0OE 4BX8A 1A17A 4KT6B 4DUIA 2CFUA 2J49A 3I4RB 3SY2A 4B93B 3FUMA 5DIZA 4GA1A 1S70B 1NL4A 5CBNA 3CVNA 2PQNA 3CHMA 3B7TA 1E7VA 5CRVA 4R7LA 2DVWA 5AN8A 4EQFA 1HH8A 3ULQA 1E8YA 3FP3A 5J90A 5G04C 2MHKA 1LD8A 4N2QA 4APFA 1X81A 4M7CA 3CIAA 1FVFA 4RLYA 3ZYLA 4CT0A 3G2UA 2EIKE 4YDEA 4C9BB 3CVXA 4G8KA 2EILE 2IJGX 4HOQA 3HXEA 5D2MC 2X3MA 2KCKA 4KYOB 2WB2A 4N5CA 4C48B 1JWFA 3NOCD 4XEIG 1LTXA 4DPRA 3IXEA 3AAAC 4JB8P 4A3VA 2F0YA 2Y4TA 3UTMA 3C72A 4KZCA 3FUJA 4WNFA 3FH8A 1Y6IA 3I5PA 3PE3A 3DPYA 3HVEA 3UINC 1UW4B 3CHRA 1TNOA 2OCCE 3CHSA 1IQRA 1OCZE 2DYSE 3SFZA 2X6HA 3DWLG 4U8YD 1TN8A 5EIDA 3JXIA 4DK5A 2DZNA 4EBAG 4GPMA 3D9NA 4BEPA 1UOHA 1K1BA 3OXGA 2F37A 4F3VA 5JHBA 4O1PA 1IHBA 2J07A 5BV0A 5IY5E 2XEHA 1N4QA 4BX9A 3ULEG 1V55E 3ZRHA 4YDOA 4OVUA 1KLXA 1NI1A 4TXRA 2WQ6A 3LEWA 3D9KA 4HNAD 5AQAA 2ZIRA 5LP0A 4ZHBA 4I6JA 3LXUX 3BU8A 4GZ3A 5BNWA 4ZFHA 2QC9A 2J08A 3HG0D 1N9AA 4O1OA 4F6RD 3FTUA 3Q79A 3NB2A 2I9CA 4N3BA 3CVUA 4BY6A 4OAVB 2F8YA 3AS4A 2VQ2A 5CCLA 3UM2A 2XHEA 2IY0C 1BU9A 4JHJA 4EBAA 1O1TA 5JHAA 3D9LA 4MKTA 3DSSA 3FFLA 4ANUA 2WQHA 1INZA 2YHEA 4I17A 4XZ4A 3N71A 4TV3A 1SW6A 3KEAA 2IEJA 5BT1A 3UPVA 2E2EA 5FZRA 3CLJA 2R05A 2JEKA 1FT2A 2PM6A 4DI3A 4J8EA 2KZTB 4V3IA 2I1JA 4ANVA 3IV0A 4ILGA 2FI7A 3JCKC 5C1DA 2VGXB 1Q2ZA 3UKRG 1HS6A 3L08A 2RFAA 1O1SA 4M3OA 3PZ4A 5EX3A 3D3MA 5DBKA 5AIJA 3RK6A 1YCSB 2LNIA 3SGHA 3LDZA 4KXKB 2VTBB 2KXPC 4LCTA 1QYMA 4UI9C 1E7UA 3R7QA 2E0IA 2GRMA 2P2CP 4GB9A 5FINA 5G04J 1NA0A 3ONKA 3AJIA 1TJCA 3D9MA 2DZOA 2R03A 4U8VD 1EYHA 4HQDA 4AXHA 3GW4A 2NYJA 3ZXSA 4B89A 2NSZA 3C5RA 3EHQA 4BT8A 4K0RA 4DX6D 3T5VA 3UXGA 4WNDA 2KM4A 1PAQA 2X6IA 3Q5MA 2GW1A 2P9NG 2WXJA 1H19A 3LY7A 2HO1A 4U04A 1MX4A 5ENQD 1D8DA 3JUEA 3AG1E 1OY3D 4G26A 4YDYA 5CRUA 1YYHA 4AM9A 2WXHA 3APCA 3C3RA 4FULA 4PS3A 4FJYA 3HXDA 1YMPA 3UI2A 1DCQA 4EZJA 3TGOA 4GZDA 1N4SA 3ESKA 2IF4A 3B7UX 5CEAA 5FT9A 2IO3C 3PZDA 4UWGA 2CG3A 4URKA 3ABKE 3IKOB 4APOA 4EHMA 4C0MA 4G2VA 1MZCA 3MKQA 3U9WA 1IHGA 4ME2A 1S0PA 2EINE 2C2LA 3CVYA 4G1TA 2J4BA 3SI5A 4BT9A 3SBTB 2IU1A 3CHPA 4UWHA 3L13A 3FTWA 4LEUA 3UX4A 3LY9A 4GA0A 4GTSA 4UWLA 1O1RA 4FADA 3ZPJA 4WUYA 3UMVA 3LVQE 3BUAA 4N3CA 3JQ1A 3QC1A 3PE4A 5JJTA 3FU5A 4E85A 4CGVA 1S64A 4J8DA 1QQEA 3MX3A 1DNPA 4I9CA 4FLHA 2AXUA 3ZYKA 1JWGA 3L22A 4D10C 4Q69A 5JJ7A 5EILA 1Z6TA 2J09A 4TXPA 4LRZA 4LSZE 2CG2A 3TWVA 1YA0A 3QDNA 4NURA 3ZGQA 4FC8A 4BFRA 3ZVVA 2XEVA 3B7BA 1TNZA 2VSNA 4PS8A 2XENA 2XPYA 4B94A 4AVXA 2WMNA 3QK0A 3QARA 2DBAA 5CBOA 2GROB 1HX8A 2RKKA 4HRNA 2RG8A 1AP7A 2Q7FA 4N5QA 3ZN3A 3PZ2A 3NAWA 3CSFA 5J08A 4NQ0A 1TNUA 3HIZA 2FBNA 3QJZA 2WXPA 3PNLB 3CKBA 3CK9A 3LYAA 4JEHA 4A1SA 2AVPA 3C3QA 3IBEA 3D9OA 2H6HA 4UI9J 5T3RA 3ASNE 5G2NA 4CEMA 3MKQB 1TJFA 3CR3A 3G2WA 2XS8A 3RRUA 3CV0A 3S7JA 4UWFA 2XEEA 4CT4A 4KMOA 4RQIA 4DX2A 1TEZA 3SFXA 5CEDB 4I9EA 4IULA 4UQZA 4EZKA 2R2LA 3IHVA 4YVQC 4HXIA 1FT1A 3TXNA 3FUKA 3DXKG 1H2VC 5JMND 4JPSA 3O4ZA 3Q7AA 2QZAA 4MS6A 3TJPA 2M63A 1FCHA 2R59A 3CQCB 1MJ0A 4J6IA 1HFAA 3HXBA 4ANWA 1NZNA 1EF1C 3TWUA 4O6FA 3D9IA 3IHYA 2WXRA 1AWCB 5D0OD 1U3CA 3FUDA 2BUGA 4Y6WA 4K5AB 2JABA 3CVQA 3S7FA 3B7SA 1JCQA 3EU9A 3AG2E 1TN6A 3MZLB 4DLOA 3CVLA 5FWQA 4L1BA 2WXKA 2Y1LE 4WWOA 4LUNU 3CQGB 3FUNA 2QY7A 4EECA 4I43A 4J8SA 4ATGA 2WQ7A 1QBQA 1UG3A 4UWKA 2LAIA 3SO8A 2P9KG 5ENOD 4GYOA 3Q73A 3KEZA 3DSTA 2A5UA 1JPLA 3CVWA
chains in the Genus database with same CATH topology
1A5EA 5AARA 4GMRA 3V2XA 3W9FA 5ITZF 5BXUA 4HRLA 4J7WA 1OY3D 3TWSA 4YDYA 4DX5D 5AQ7A 4BESA 4CZ2D 1YYHA 4RLYA 2A5EA 2Y0BG 4ATZD 2L6BA 3TWXA 5EN5D 4HNAD 5AQAA 3TWRA 3ZNGA 5EILA 4F1PA 5KNGA 5EYPF 4ZHBA 3HRAA 3T8KA 4LSZE 2RFAA 5JMND 4G8LA 3TWVA 4ZFHA 5CECB 2QC9A 1OT8A 4O60A 3HG0D 2DWZA 4K5CA 4NIKA 1K1AA 4O1OA 4F6RD 4YDWA 1NFIE 1YCSB 3B7BA 5AQ9A 1K3ZD 3B95A 4HI9A 5EYLA 4DRXE 2V5QC 4G8KA 1YMPA 5D66A 2XENA 1MJ0A 2KXPC 1MYOA 4LG6A 1QYMA 4C48B 2ZGDA 4HB5A 4U96D 4OAVB 1BLXB 3NOCD 3JXJA 3J5QB 4TUMA 2P2CP 3NOGD 3UI2A 3DEPA 2ETAA 3V30A 4K5BA 1G3NB 5EIBE 1DCQA 2F8YA 2BKKB 3Q9UC 1SVXA 5FINA 4UUCA 3V79K 3TWUA 5CBOA 1BI8B 2RFMA 3AJIA 2AJAA 3ZKJA 3D9HA 4U95D 4Z68A 3TWQA 3NBNB 3W9GA 1AWCB 3Q9NC 3IXEA 4CYMD 1BU9A 5FIOA 5CEAA 3LJNA 4HRNA 2DZOA 1TR4A 4U8VD 3AAAC 4JB8P 1IXVA 2XZTG 5HKPA 3V31A 1AP7A 3ZU7B 4K5AB 4HLLA 1N0RA 2JABA 4N5QA 5KNHD 4HQDA 5KWDA 2NYJA 3UTMA 5ENPD 5ENSD 1BD8A 1N11A 3EU9A 2ETCA 4A63B 3C5RA 3EHQA 5ENRD 1MX2A 2PNNA 2BKGA 4BSZB 5AQBA 2ZGGA 3T9KA 2KBXA 2B0OE 4QFVA 1D9SA 4DX6D 4DUIA 4OAUC 1DC2A 3J5PA 2Y1LE 3V2OA 4J8YA 3UXGA 2XZDG 4B93B 2FO1E 3EHRA 4U8YD 2ETBA 2V4HC 5CERB 4HBDA 1S70B 1N0QA 5EIDA 4DX1A 1WDYA 1SW6A 3JXIA 3ZUVB 3KEAA 4BETA 2DZNA 2VGEA 1BI7B 4DX7D 5AAOA 2F8XK 4QQIA 4GPMA 4HRMB 5ENTD 5BXOA 2J8SD 4BERA 5CBNA 5HRYA 5HS0A 3TWWA 4BEPA 1UOHA 2XEEA 1K1BA 3TWTA 5JA4D 2F37A 2DVWA 5AN8A 3SO8A 3F6QA 4DX2A 5ENOD 4LNUD 2QYJA 1MX4A 1MX6A 1WG0A 4O1PA 5CEDB 1IHBA 3DEOA 5ENQD 4HI8A 2XEHA 5KBAA 1IKND 3JUEA 2MYOA 2HE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A5E A;  5AAR A;  4GMR A;  3V2X A;  3W9F A;  5ITZ F;  5BXU A;  4HRL A;  4J7W A;  1OY3 D;  3TWS A;  4YDY A;  4DX5 D;  5AQ7 A;  4BES A;  4CZ2 D;  1YYH A;  4RLY A;  2A5E A;  2Y0B G;  4ATZ D;  2L6B A;  3TWX A;  5EN5 D;  4HNA D;  5AQA A;  3TWR A;  3ZNG A;  5EIL A;  4F1P A;  5KNG A;  5EYP F;  4ZHB A;  3HRA A;  3T8K A;  4LSZ E;  2RFA A;  5JMN D;  4G8L A;  3TWV A;  4ZFH A;  5CEC B;  2QC9 A;  1OT8 A;  4O60 A;  3HG0 D;  2DWZ A;  4K5C A;  4NIK A;  1K1A A;  4O1O A;  4F6R D;  4YDW A;  1NFI E;  1YCS B;  3B7B A;  5AQ9 A;  1K3Z D;  3B95 A;  4HI9 A;  5EYL A;  4DRX E;  2V5Q C;  4G8K A;  1YMP A;  5D66 A;  2XEN A;  1MJ0 A;  2KXP C;  1MYO A;  4LG6 A;  1QYM A;  4C48 B;  2ZGD A;  4HB5 A;  4U96 D;  4OAV B;  1BLX B;  3NOC D;  3JXJ A;  3J5Q B;  4TUM A;  2P2C P;  3NOG D;  3UI2 A;  3DEP A;  2ETA A;  3V30 A;  4K5B A;  1G3N B;  5EIB E;  1DCQ A;  2F8Y A;  2BKK B;  3Q9U C;  1SVX A;  5FIN A;  4UUC A;  3V79 K;  3TWU A;  5CBO A;  1BI8 B;  2RFM A;  3AJI A;  2AJA A;  3ZKJ A;  3D9H A;  4U95 D;  4Z68 A;  3TWQ A;  3NBN B;  3W9G A;  1AWC B;  3Q9N C;  3IXE A;  4CYM D;  1BU9 A;  5FIO A;  5CEA A;  3LJN A;  4HRN A;  2DZO A;  1TR4 A;  4U8V D;  3AAA C;  4JB8 P;  1IXV A;  2XZT G;  5HKP A;  3V31 A;  1AP7 A;  3ZU7 B;  4K5A B;  4HLL A;  1N0R A;  2JAB A;  4N5Q A;  5KNH D;  4HQD A;  5KWD A;  2NYJ A;  3UTM A;  5ENP D;  5ENS D;  1BD8 A;  1N11 A;  3EU9 A;  2ETC A;  4A63 B;  3C5R A;  3EHQ A;  5ENR D;  1MX2 A;  2PNN A;  2BKG A;  4BSZ B;  5AQB A;  2ZGG A;  3T9K A;  2KBX A;  2B0O E;  4QFV A;  1D9S A;  4DX6 D;  4DUI A;  4OAU C;  1DC2 A;  3J5P A;  2Y1L E;  3V2O A;  4J8Y A;  3UXG A;  2XZD G;  4B93 B;  2FO1 E;  3EHR A;  4U8Y D;  2ETB A;  2V4H C;  5CER B;  4HBD A;  1S70 B;  1N0Q A;  5EID A;  4DX1 A;  1WDY A;  1SW6 A;  3JXI A;  3ZUV B;  3KEA A;  4BET A;  2DZN A;  2VGE A;  1BI7 B;  4DX7 D;  5AAO A;  2F8X K;  4QQI A;  4GPM A;  4HRM B;  5ENT D;  5BXO A;  2J8S D;  4BER A;  5CBN A;  5HRY A;  5HS0 A;  3TWW A;  4BEP A;  1UOH A;  2XEE A;  1K1B A;  3TWT A;  5JA4 D;  2F37 A;  2DVW A;  5AN8 A;  3SO8 A;  3F6Q A;  4DX2 A;  5ENO D;  4LNU D;  2QYJ A;  1MX4 A;  1MX6 A;  1WG0 A;  4O1P A;  5CED B;  1IHB A;  3DEO A;  5ENQ D;  4HI8 A;  2XEH A;  5KBA A;  1IKN D;  3JUE A;  2MYO A;  2HE0 A; 
#chains in the Genus database with same CATH topology
 5ENN A;  4FU3 A;  5FJY A;  1QZ2 A;  3P2B A;  4J7W A;  2Y69 E;  4LNB A;  3CHO A;  3VLE A;  4ATZ D;  2KZT A;  4WWN A;  2ZU6 B;  3FTY A;  3FUI A;  5EYP F;  4H7X A;  3D9J A;  3HRA A;  3OXF A;  4XE0 A;  2GRN B;  1E8X A;  2VGX A;  1JUQ A;  1H6O A;  3RJV A;  2XS1 A;  4AOF A;  3ABM E;  4GTM A;  4Q96 A;  4PUC A;  4K03 A;  3RAU A;  5FZQ A;  2JLB A;  2VTB A;  3RSE G;  3FUL A;  1KPS B;  2PQR A;  4L2L A;  5T8I A;  1HU3 A;  3G2T A;  5BPP A;  4BTA A;  3OXL A;  2QYU A;  4A1G A;  3HXF A;  3EIJ A;  1BD8 A;  3Q75 A;  1E90 A;  2KAT A;  2OND A;  1V54 E;  3KS2 A;  4LNG A;  3CHQ A;  3V2O A;  3QB2 A;  2XZD G;  4CRW A;  5A6C A;  1WDY A;  3UM0 A;  3DSW A;  3TG5 A;  4I2W A;  4XI9 A;  4DX7 D;  4QQI A;  5HRY A;  3TWW A;  3QKY A;  3FWV A;  3MGB A;  1Y8M A;  4C0E A;  4FLB A;  4JA7 A;  5ARG A;  3ABL E;  2UWJ G;  3RO3 A;  1FVH A;  3AG4 E;  5E75 A;  3L17 A;  2ZIS A;  3V2X A;  4BWR A;  5ITZ F;  5BXU A;  3TWS A;  2ILR A;  2GRQ B;  2Y0B G;  4FP7 A;  5EN5 D;  3TG4 A;  3SD5 A;  2MOW A;  1MQS A;  4N3A A;  1P5Q A;  1OT8 A;  1HF8 A;  3NZU A;  3HXC A;  2I1K A;  5EYL A;  5D66 A;  3DPD A;  2L0I A;  1WM5 A;  4JL0 A;  3QWV A;  3RRM B;  4CDM A;  3JUI A;  4UUC A;  5KJL A;  4AV7 A;  5BW8 C;  4GA2 A;  2CHW A;  3D9H A;  2LXL A;  3DRA A;  3EHM A;  3S7D A;  3URZ A;  2XZT G;  4NAC A;  3TL5 A;  5KNH D;  2YQ8 A;  5FZS A;  3ISM C;  2V5F A;  2NXP A;  1OXJ A;  4GML A;  5EX0 A;  1SQM A;  3PVL A;  5LOZ A;  2R5S A;  2YNQ A;  1HZ4 A;  5D0Q D;  2FO1 E;  3DXM G;  3FU3 A;  3U4T A;  3I4G A;  3CST A;  4BET A;  3WG7 E;  3IEG A;  4GTV A;  3S2A A;  2WXI A;  3MA5 A;  3UT8 A;  1N94 A;  3ASF A;  4X8Q A;  3F6Q A;  1MX6 A;  1UJK A;  3LY8 A;  3FTV A;  1IKN D;  2MYO A;  2HE0 A;  1SA5 A;  5CMW A;  3GZS A;  1VDY A;  3ULY A;  2V4L A;  3L16 A;  4GYY A;  1O5M A;  5AYW D;  3U66 A;  1KT0 A;  3PEU B;  4AP2 A;  2OV8 A;  5LX8 A;  1E8W A;  4GCO A;  3R9M A;  2XPZ A;  1PY1 A;  2MRI A;  4IRU A;  4DRX E;  3U3W A;  2WM9 A;  2UY1 B;  3MV2 B;  4LG6 A;  3ZIM A;  4JW1 A;  2CHZ A;  3DEP A;  3V30 A;  1SVX A;  3HYM B;  3UQ3 A;  3V79 K;  3EJN A;  1UN8 A;  1BI8 B;  2GRL A;  3Q9N C;  3JQ0 A;  4ABN A;  1MHQ A;  4TXQ A;  3C3O A;  4TRQ A;  2AXV A;  3OTN A;  3NZS A;  3VLD A;  1H2T C;  4E6H A;  3FTS A;  2L6J A;  1MX2 A;  5KJN A;  3ZYM A;  3PDN A;  3T9K A;  4CDR A;  1NP7 A;  4GU5 A;  4NRH B;  2GRR B;  2VGY A;  1DVP A;  4U0Z A;  1U2V G;  3EIQ C;  2HR2 A;  3GZ2 A;  5H7P A;  2VGE A;  4JEU A;  4IYP A;  4N39 A;  3ENE A;  4BER A;  3UUX A;  4W9R A;  5AJD A;  1SZ9 A;  5LCW J;  5FQ8 A;  1BPO A;  3JYS A;  2WXN A;  3DEO A;  2OVF A;  2AWI A;  4KZ0 A;  3FEY A;  5C2Y A;  4HRL A;  3E4B A;  3MYV A;  5AAR A;  3FEX A;  3W9F A;  3AU4 A;  3UM3 A;  3P1U A;  1RZ4 A;  5KNG A;  4DJA A;  3QWW A;  4G8L A;  1B89 A;  3MCX A;  2DWZ A;  2DYR E;  4AY6 A;  4DI4 A;  2V5Q C;  3QWP A;  4TUU A;  1OWP A;  5ANR A;  4UQX A;  4K5B A;  5CMY A;  2BKK B;  5T4Y A;  2H6G A;  3AS8 A;  2CHX A;  1EPU A;  3UIO C;  4CYM D;  3FTX A;  4FHK A;  4MBG A;  3V31 A;  4HLL A;  4EZL A;  4L23 A;  3FH5 A;  2C0L A;  4YND A;  2XGO A;  2GGF A;  3AG3 E;  3DSX A;  2BKG A;  3UKU G;  4B8C B;  4WNG A;  2L0T B;  1ZB1 A;  4J8Y A;  2ION A;  4OVV A;  4G11 A;  2DIW A;  2ETB A;  3L9T A;  2J9Q A;  2LUH A;  5ANL A;  3B13 A;  3ASO E;  5ENT D;  4GTT A;  2XCC A;  2XCB A;  2H6F A;  3FUF A;  2QYJ A;  4L9P A;  4GZC A;  1IQU A;  4HI8 A;  1N52 A;  3MJW A;  4I6E A;  4GMR A;  4HLE A;  4JA9 A;  2X38 A;  4XKC A;  3TXM A;  4CZ2 D;  3DBS A;  3ZW3 A;  1WY6 A;  2X6F A;  3LKU A;  3ZNG A;  4I1O B;  3FUH A;  1E8Z A;  4UQY A;  2AW6 A;  4U07 A;  2XRZ A;  3CEQ A;  3Q4A B;  2XGM A;  4HI9 A;  1QNF A;  2YHC A;  3RKV A;  3NOG D;  3R7R A;  2DCP A;  3ML9 A;  3FH7 A;  3OAW A;  5FTP A;  3T5X A;  2RFM A;  1HO8 A;  5EKQ D;  3ZKJ A;  1XGW A;  5HKP A;  5B1A E;  4HOU A;  3Q7F A;  4HOR A;  3LS8 A;  2XGS A;  3CKC A;  5ENS D;  4F7A A;  3D9P A;  3LPZ A;  2I2O A;  3NF1 A;  4GTQ A;  2PNN A;  4F1S A;  2KCL A;  4HOS A;  2WMO A;  3J5P A;  2OOE A;  1HXI A;  4YVO A;  1IYG A;  4Y6C A;  4G24 A;  5AAO A;  4HRM B;  1N4P A;  3BG1 B;  4JZY A;  2FUL A;  1TNB A;  3KSL A;  1NA3 A;  2C0M A;  1WG0 A;  4B8A A;  2WXM A;  4JD2 G;  3LVR E;  2P9U G;  1XNF A;  4BES A;  3E37 A;  4GTO A;  3BEE A;  5B1B E;  3SF4 A;  2YIN A;  3FTZ A;  3TWR A;  4HVB A;  3UM1 A;  4JC8 A;  4P29 A;  4NIK A;  1K1A A;  1OWM A;  3B7R L;  1NFI E;  3RIB A;  3G2S A;  5AQ9 A;  2P58 C;  3BG0 B;  3TAX A;  1X5B A;  4AEZ C;  2V8S E;  3PH0 C;  3PRZ A;  4GCN A;  3DSU A;  3SFY A;  2V0P A;  3R9A B;  2PL2 A;  1Z3Y A;  2XQ0 A;  3Q47 B;  1N95 A;  4Z68 A;  3NBN B;  1D8E A;  2VSO E;  5FIO A;  1ZBP A;  4JXT A;  2VJ8 A;  3ZU7 B;  4JVS A;  4U0S A;  3SBS A;  4A55 A;  1KZP A;  3QOU A;  5BUZ A;  2ZXW E;  3ZFW A;  4FHJ A;  3QNK A;  2Y4U A;  4BSZ B;  2ZGG A;  2KBX A;  2IOS A;  5KCM A;  5G05 J;  1S63 A;  4PDX A;  3PEV B;  3EHR A;  3L54 A;  1N0Q A;  2RD0 A;  5LCW C;  4GTR A;  4DLQ A;  1TYQ G;  1ELK A;  2WVI A;  3UT4 A;  1OCO E;  2NC9 A;  3E32 A;  3CK7 A;  3TWT A;  5EDS A;  1ZU2 A;  3FDH A;  2HYZ A;  3ASH A;  2XPI A;  4PH4 B;  3RU0 A;  4LER A;  5CCM A;  4DX5 D;  5FQ4 A;  3MEK A;  4G25 A;  2A5E A;  3KD7 A;  2CFZ A;  2WXO A;  5KJM A;  4XX5 A;  3SHF A;  1DCE A;  4N2S A;  3T8K A;  3EHN A;  4ILI A;  4GAA A;  1TN7 A;  1HG2 A;  2A4Z A;  4I6G A;  4YDW A;  4CGW A;  4IN3 B;  3KSQ A;  1K3Z D;  2KCV A;  4Q94 A;  3VLF A;  2R02 A;  5AEN A;  3U64 A;  4GMJ A;  1MYO A;  3APF A;  1UJJ A;  2GRP B;  2ZGD A;  1BLX B;  1LD7 A;  3JXJ A;  3J5Q B;  4RG9 A;  1JCS A;  1H2U A;  4TUM A;  2ETA A;  3CVV A;  4HS2 A;  2UY1 A;  1FPP A;  2VYI A;  2L9B A;  3QAQ A;  1OCC E;  4U95 D;  3LJN A;  1IXV A;  3APD A;  4GZ5 A;  5G55 A;  5JJ6 A;  4UI9 K;  5KWD A;  4RVB A;  3HVE B;  2IFU A;  3ZXP A;  3L82 A;  3VTX A;  2XRY A;  2OVB A;  4QFV A;  4OAU C;  1DC2 A;  1TNY A;  2IQC A;  2LSV A;  2R17 C;  5CER B;  3LCA A;  4DX1 A;  3FY4 A;  4OYS A;  1KT1 A;  3K9I A;  4AJW A;  4ILH B;  5JA4 D;  1OWN A;  4ACK A;  4U8H A;  4LNU D;  5B3S E;  5HI7 A;  5KBA A;  1ELR A;  4J8F A;  3FU6 A;  4WNE A;  2IOL A;  4XKB A;  4G23 A;  1JCR A;  2FF4 A;  5BV1 A;  2EIM E;  2H6I A;  2OEV A;  3ASD A;  2LSU A;  3T8M A;  1PC2 A;  4JHR A;  1HE8 A;  5CHE E;  3E34 A;  3S7B A;  4XI0 A;  5FQ6 A;  4WWP A;  3LJ3 A;  3EUV A;  4XIF A;  3I3N A;  3GYZ A;  2Y3A A;  4GZ6 A;  3TWQ A;  3KAE A;  2BED A;  3CVP A;  4KBQ A;  4MRU A;  1TR4 A;  3CK8 A;  4HFG A;  1N0R A;  4B0Z A;  4L7T A;  2ETC A;  2FO7 A;  1OCR E;  4HOT A;  4KVM A;  4A3T A;  1W3B A;  3X2Q E;  2WXG A;  3PZ1 A;  2IO2 C;  1HG5 A;  1H6P A;  2P9L G;  3ZUV B;  4KVO A;  3PUJ A;  2BTD A;  4PS7 A;  3MKR A;  2F8X K;  5BXO A;  4GPK A;  5AJL A;  5A7D B;  2BF0 X;  3SNX A;  2X6J A;  2QFC A;  4RG6 A;  3PZ3 A;  1LF8 A;  2J4D A;  3ML8 A;  4U0U A;  5HQ8 A;  4FJZ A;  4EPZ A;  2P9I G;  3GZ1 A;  4GYW A;  2L6B A;  1EDU A;  4BTB A;  2P9S G;  3ESL A;  2WXQ A;  1Z5S C;  2I6H A;  4JHK A;  5E76 A;  2AXZ A;  2VSX E;  1OWO A;  3E33 A;  4CCA A;  4I1M A;  5CEC B;  3NQP A;  4O60 A;  2PM7 A;  4MLP A;  1L5J A;  3AU5 A;  3FHE A;  3FU0 A;  3C98 A;  3WXX A;  3CGH A;  3UT7 A;  1WAO 1;  4U7E B;  3ZHE A;  3L6A A;  4HB5 A;  4U96 D;  3RO2 A;  2B6C A;  4J0U A;  5EIB E;  3Q9U C;  2LAH A;  4RSY A;  3ZYQ A;  3PRE A;  5LFA A;  4ANX A;  2PZI A;  5KJK A;  1U3D A;  5M72 A;  2HM8 A;  5FQ7 A;  1KZO A;  4I2Z A;  2OEW A;  3DSV A;  3G2V A;  1Z3X A;  2VSY A;  1OUV A;  3FUE A;  1N11 A;  5G05 C;  2WXL A;  3UIP C;  5ENR D;  1SA4 A;  1N54 A;  3PUK A;  2LO6 A;  5AQB A;  4CDN A;  1D9S A;  4F53 A;  3Q49 B;  3Q15 A;  4ACL A;  2V4H C;  4GTP A;  4HBD A;  3PNT B;  4U63 A;  1BI7 B;  2J8S D;  5HS0 A;  4AY5 A;  1SZA A;  3BQO A;  5A23 A;  2EIJ E;  4AIF A;  2FEZ A;  1OWL A;  1A5E A;  2WPV A;  3SZ7 A;  4FA6 A;  5AQ7 A;  3VTY A;  3TWX A;  3HDX A;  4BSX A;  3PS6 A;  4F1P A;  3EU5 A;  3MV3 B;  4H7Y A;  3SQV A;  2LXM A;  1K8K G;  3ASG A;  4K5C A;  1H0A A;  3O48 A;  3ZEF A;  4I1A A;  1RW2 A;  4WAF A;  2KC7 A;  3B95 A;  4L2Y A;  3AS5 A;  3ONL A;  2WXF A;  1G3N B;  2P9P G;  1GW6 A;  2AJA A;  3W9G A;  1H6K A;  5ARF A;  2EQX A;  3ZHE B;  3EDT B;  1UN9 A;  3E30 A;  1N4R A;  3HHM A;  5ENP D;  1E96 B;  1ELW A;  2X6K A;  4A63 B;  3Q78 A;  3RRN B;  2B0O E;  4BX8 A;  1A17 A;  4KT6 B;  4DUI A;  2CFU A;  2J49 A;  3I4R B;  3SY2 A;  4B93 B;  3FUM A;  5DIZ A;  4GA1 A;  1S70 B;  1NL4 A;  5CBN A;  3CVN A;  2PQN A;  3CHM A;  3B7T A;  1E7V A;  5CRV A;  4R7L A;  2DVW A;  5AN8 A;  4EQF A;  1HH8 A;  3ULQ A;  1E8Y A;  3FP3 A;  5J90 A;  5G04 C;  2MHK A;  1LD8 A;  4N2Q A;  4APF A;  1X81 A;  4M7C A;  3CIA A;  1FVF A;  4RLY A;  3ZYL A;  4CT0 A;  3G2U A;  2EIK E;  4YDE A;  4C9B B;  3CVX A;  4G8K A;  2EIL E;  2IJG X;  4HOQ A;  3HXE A;  5D2M C;  2X3M A;  2KCK A;  4KYO B;  2WB2 A;  4N5C A;  4C48 B;  1JWF A;  3NOC D;  4XEI G;  1LTX A;  4DPR A;  3IXE A;  3AAA C;  4JB8 P;  4A3V A;  2F0Y A;  2Y4T A;  3UTM A;  3C72 A;  4KZC A;  3FUJ A;  4WNF A;  3FH8 A;  1Y6I A;  3I5P A;  3PE3 A;  3DPY A;  3HVE A;  3UIN C;  1UW4 B;  3CHR A;  1TNO A;  2OCC E;  3CHS A;  1IQR A;  1OCZ E;  2DYS E;  3SFZ A;  2X6H A;  3DWL G;  4U8Y D;  1TN8 A;  5EID A;  3JXI A;  4DK5 A;  2DZN A;  4EBA G;  4GPM A;  3D9N A;  4BEP A;  1UOH A;  1K1B A;  3OXG A;  2F37 A;  4F3V A;  5JHB A;  4O1P A;  1IHB A;  2J07 A;  5BV0 A;  5IY5 E;  2XEH A;  1N4Q A;  4BX9 A;  3ULE G;  1V55 E;  3ZRH A;  4YDO A;  4OVU A;  1KLX A;  1NI1 A;  4TXR A;  2WQ6 A;  3LEW A;  3D9K A;  4HNA D;  5AQA A;  2ZIR A;  5LP0 A;  4ZHB A;  4I6J A;  3LXU X;  3BU8 A;  4GZ3 A;  5BNW A;  4ZFH A;  2QC9 A;  2J08 A;  3HG0 D;  1N9A A;  4O1O A;  4F6R D;  3FTU A;  3Q79 A;  3NB2 A;  2I9C A;  4N3B A;  3CVU A;  4BY6 A;  4OAV B;  2F8Y A;  3AS4 A;  2VQ2 A;  5CCL A;  3UM2 A;  2XHE A;  2IY0 C;  1BU9 A;  4JHJ A;  4EBA A;  1O1T A;  5JHA A;  3D9L A;  4MKT A;  3DSS A;  3FFL A;  4ANU A;  2WQH A;  1INZ A;  2YHE A;  4I17 A;  4XZ4 A;  3N71 A;  4TV3 A;  1SW6 A;  3KEA A;  2IEJ A;  5BT1 A;  3UPV A;  2E2E A;  5FZR A;  3CLJ A;  2R05 A;  2JEK A;  1FT2 A;  2PM6 A;  4DI3 A;  4J8E A;  2KZT B;  4V3I A;  2I1J A;  4ANV A;  3IV0 A;  4ILG A;  2FI7 A;  3JCK C;  5C1D A;  2VGX B;  1Q2Z A;  3UKR G;  1HS6 A;  3L08 A;  2RFA A;  1O1S A;  4M3O A;  3PZ4 A;  5EX3 A;  3D3M A;  5DBK A;  5AIJ A;  3RK6 A;  1YCS B;  2LNI A;  3SGH A;  3LDZ A;  4KXK B;  2VTB B;  2KXP C;  4LCT A;  1QYM A;  4UI9 C;  1E7U A;  3R7Q A;  2E0I A;  2GRM A;  2P2C P;  4GB9 A;  5FIN A;  5G04 J;  1NA0 A;  3ONK A;  3AJI A;  1TJC A;  3D9M A;  2DZO A;  2R03 A;  4U8V D;  1EYH A;  4HQD A;  4AXH A;  3GW4 A;  2NYJ A;  3ZXS A;  4B89 A;  2NSZ A;  3C5R A;  3EHQ A;  4BT8 A;  4K0R A;  4DX6 D;  3T5V A;  3UXG A;  4WND A;  2KM4 A;  1PAQ A;  2X6I A;  3Q5M A;  2GW1 A;  2P9N G;  2WXJ A;  1H19 A;  3LY7 A;  2HO1 A;  4U04 A;  1MX4 A;  5ENQ D;  1D8D A;  3JUE A;  3AG1 E;  1OY3 D;  4G26 A;  4YDY A;  5CRU A;  1YYH A;  4AM9 A;  2WXH A;  3APC A;  3C3R A;  4FUL A;  4PS3 A;  4FJY A;  3HXD A;  1YMP A;  3UI2 A;  1DCQ A;  4EZJ A;  3TGO A;  4GZD A;  1N4S A;  3ESK A;  2IF4 A;  3B7U X;  5CEA A;  5FT9 A;  2IO3 C;  3PZD A;  4UWG A;  2CG3 A;  4URK A;  3ABK E;  3IKO B;  4APO A;  4EHM A;  4C0M A;  4G2V A;  1MZC A;  3MKQ A;  3U9W A;  1IHG A;  4ME2 A;  1S0P A;  2EIN E;  2C2L A;  3CVY A;  4G1T A;  2J4B A;  3SI5 A;  4BT9 A;  3SBT B;  2IU1 A;  3CHP A;  4UWH A;  3L13 A;  3FTW A;  4LEU A;  3UX4 A;  3LY9 A;  4GA0 A;  4GTS A;  4UWL A;  1O1R A;  4FAD A;  3ZPJ A;  4WUY A;  3UMV A;  3LVQ E;  3BUA A;  4N3C A;  3JQ1 A;  3QC1 A;  3PE4 A;  5JJT A;  3FU5 A;  4E85 A;  4CGV A;  1S64 A;  4J8D A;  1QQE A;  3MX3 A;  1DNP A;  4I9C A;  4FLH A;  2AXU A;  3ZYK A;  1JWG A;  3L22 A;  4D10 C;  4Q69 A;  5JJ7 A;  5EIL A;  1Z6T A;  2J09 A;  4TXP A;  4LRZ A;  4LSZ E;  2CG2 A;  3TWV A;  1YA0 A;  3QDN A;  4NUR A;  3ZGQ A;  4FC8 A;  4BFR A;  3ZVV A;  2XEV A;  3B7B A;  1TNZ A;  2VSN A;  4PS8 A;  2XEN A;  2XPY A;  4B94 A;  4AVX A;  2WMN A;  3QK0 A;  3QAR A;  2DBA A;  5CBO A;  2GRO B;  1HX8 A;  2RKK A;  4HRN A;  2RG8 A;  1AP7 A;  2Q7F A;  4N5Q A;  3ZN3 A;  3PZ2 A;  3NAW A;  3CSF A;  5J08 A;  4NQ0 A;  1TNU A;  3HIZ A;  2FBN A;  3QJZ A;  2WXP A;  3PNL B;  3CKB A;  3CK9 A;  3LYA A;  4JEH A;  4A1S A;  2AVP A;  3C3Q A;  3IBE A;  3D9O A;  2H6H A;  4UI9 J;  5T3R A;  3ASN E;  5G2N A;  4CEM A;  3MKQ B;  1TJF A;  3CR3 A;  3G2W A;  2XS8 A;  3RRU A;  3CV0 A;  3S7J A;  4UWF A;  2XEE A;  4CT4 A;  4KMO A;  4RQI A;  4DX2 A;  1TEZ A;  3SFX A;  5CED B;  4I9E A;  4IUL A;  4UQZ A;  4EZK A;  2R2L A;  3IHV A;  4YVQ C;  4HXI A;  1FT1 A;  3TXN A;  3FUK A;  3DXK G;  1H2V C;  5JMN D;  4JPS A;  3O4Z A;  3Q7A A;  2QZA A;  4MS6 A;  3TJP A;  2M63 A;  1FCH A;  2R59 A;  3CQC B;  1MJ0 A;  4J6I A;  1HFA A;  3HXB A;  4ANW A;  1NZN A;  1EF1 C;  3TWU A;  4O6F A;  3D9I A;  3IHY A;  2WXR A;  1AWC B;  5D0O D;  1U3C A;  3FUD A;  2BUG A;  4Y6W A;  4K5A B;  2JAB A;  3CVQ A;  3S7F A;  3B7S A;  1JCQ A;  3EU9 A;  3AG2 E;  1TN6 A;  3MZL B;  4DLO A;  3CVL A;  5FWQ A;  4L1B A;  2WXK A;  2Y1L E;  4WWO A;  4LUN U;  3CQG B;  3FUN A;  2QY7 A;  4EEC A;  4I43 A;  4J8S A;  4ATG A;  2WQ7 A;  1QBQ A;  1UG3 A;  4UWK A;  2LAI A;  3SO8 A;  2P9K G;  5ENO D;  4GYO A;  3Q73 A;  3KEZ A;  3DST A;  2A5U A;  1JPL A;  3CVW A; 
#chains in the Genus database with same CATH homology
 1A5E A;  5AAR A;  4GMR A;  3V2X A;  3W9F A;  5ITZ F;  5BXU A;  4HRL A;  4J7W A;  1OY3 D;  3TWS A;  4YDY A;  4DX5 D;  5AQ7 A;  4BES A;  4CZ2 D;  1YYH A;  4RLY A;  2A5E A;  2Y0B G;  4ATZ D;  2L6B A;  3TWX A;  5EN5 D;  4HNA D;  5AQA A;  3TWR A;  3ZNG A;  5EIL A;  4F1P A;  5KNG A;  5EYP F;  4ZHB A;  3HRA A;  3T8K A;  4LSZ E;  2RFA A;  5JMN D;  4G8L A;  3TWV A;  4ZFH A;  5CEC B;  2QC9 A;  1OT8 A;  4O60 A;  3HG0 D;  2DWZ A;  4K5C A;  4NIK A;  1K1A A;  4O1O A;  4F6R D;  4YDW A;  1NFI E;  1YCS B;  3B7B A;  5AQ9 A;  1K3Z D;  3B95 A;  4HI9 A;  5EYL A;  4DRX E;  2V5Q C;  4G8K A;  1YMP A;  5D66 A;  2XEN A;  1MJ0 A;  2KXP C;  1MYO A;  4LG6 A;  1QYM A;  4C48 B;  2ZGD A;  4HB5 A;  4U96 D;  4OAV B;  1BLX B;  3NOC D;  3JXJ A;  3J5Q B;  4TUM A;  2P2C P;  3NOG D;  3UI2 A;  3DEP A;  2ETA A;  3V30 A;  4K5B A;  1G3N B;  5EIB E;  1DCQ A;  2F8Y A;  2BKK B;  3Q9U C;  1SVX A;  5FIN A;  4UUC A;  3V79 K;  3TWU A;  5CBO A;  1BI8 B;  2RFM A;  3AJI A;  2AJA A;  3ZKJ A;  3D9H A;  4U95 D;  4Z68 A;  3TWQ A;  3NBN B;  3W9G A;  1AWC B;  3Q9N C;  3IXE A;  4CYM D;  1BU9 A;  5FIO A;  5CEA A;  3LJN A;  4HRN A;  2DZO A;  1TR4 A;  4U8V D;  3AAA C;  4JB8 P;  1IXV A;  2XZT G;  5HKP A;  3V31 A;  1AP7 A;  3ZU7 B;  4K5A B;  4HLL A;  1N0R A;  2JAB A;  4N5Q A;  5KNH D;  4HQD A;  5KWD A;  2NYJ A;  3UTM A;  5ENP D;  5ENS D;  1BD8 A;  1N11 A;  3EU9 A;  2ETC A;  4A63 B;  3C5R A;  3EHQ A;  5ENR D;  1MX2 A;  2PNN A;  2BKG A;  4BSZ B;  5AQB A;  2ZGG A;  3T9K A;  2KBX A;  2B0O E;  4QFV A;  1D9S A;  4DX6 D;  4DUI A;  4OAU C;  1DC2 A;  3J5P A;  2Y1L E;  3V2O A;  4J8Y A;  3UXG A;  2XZD G;  4B93 B;  2FO1 E;  3EHR A;  4U8Y D;  2ETB A;  2V4H C;  5CER B;  4HBD A;  1S70 B;  1N0Q A;  5EID A;  4DX1 A;  1WDY A;  1SW6 A;  3JXI A;  3ZUV B;  3KEA A;  4BET A;  2DZN A;  2VGE A;  1BI7 B;  4DX7 D;  5AAO A;  2F8X K;  4QQI A;  4GPM A;  4HRM B;  5ENT D;  5BXO A;  2J8S D;  4BER A;  5CBN A;  5HRY A;  5HS0 A;  3TWW A;  4BEP A;  1UOH A;  2XEE A;  1K1B A;  3TWT A;  5JA4 D;  2F37 A;  2DVW A;  5AN8 A;  3SO8 A;  3F6Q A;  4DX2 A;  5ENO D;  4LNU D;  2QYJ A;  1MX4 A;  1MX6 A;  1WG0 A;  4O1P A;  5CED B;  1IHB A;  3DEO A;  5ENQ D;  4HI8 A;  2XEH A;  5KBA A;  1IKN D;  3JUE A;  2MYO A;  2HE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...