4GMRA

Crystal structure of engineered protein. northeast structural genomics consortium target or266.
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
167
structure length
167
Chain Sequence
SELGKRLIEAAENGNKDRVKDLLENGADVNASDSDGKTPLHLAAENGHKEVVKLLLSQGADPNAKDSDGKTPLHLAAENGHKEVVKLLLSQGADPNAKDSDGKTPLHLAAENGHKEVVKLLLSQGADPNTSDSDGRTPLDLAREHGNEEVVKLLEKQGGWLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords OR266 DE NOVO PROTEIN
publication title Computational design of self-assembling cyclic protein homo-oligomers.
pubmed doi rcsb
source organism Synthetic construct
total genus 65
structure length 167
sequence length 167
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4gmrA00
3V31A 2ETAA 3EHRA 3W9FA 5CERB 4G8KA 3D9HA 4ATZD 5CEDB 1D9SA 4HBDA 2F8YA 5AQBA 4K5CA 3ZKJA 1MX4A 2F37A 4DUIA 1IHBA 3JXJA 2DZNA 2ZGGA 5ENQD 2QYJA 5KNHD 3T8KA 3DEOA 4JB8P 5ENTD 4J7WA 4TUMA 3UXGA 4YDWA 1MJ0A 2P2CP 2PNNA 4HQDA 3F6QA 3V2XA 2FO1E 4BERA 2XEHA 3LJNA 4QFVA 3TWSA 1AWCB 3JUEA 2J8SD 4O1OA 5ENOD 1K1AA 4G8LA 1BD8A 5EYPF 5JMND 3V2OA 4BSZB 1WDYA 2MYOA 4BEPA 1MYOA 3NOGD 5EILA 4C48B 5EIBE 2JABA 1SW6A 1UOHA 3TWXA 5BXUA 1QYMA 3IXEA 5AAOA 5AARA 5AN8A 3ZU7B 4DX1A 3AJIA 4HI9A 1IKND 2KXPC 4CZ2D 4K5BA 4DX5D 2KBXA 2BKKB 4DX7D 2HE0A 5ITZF 2RFMA 3EHQA 5ENSD 4O60A 4Z68A 4B93B 2BKGA 3HG0D 1A5EA 3TWRA 4U8VD 4LSZE 1NFIE 2V4HC 2AJAA 4N5QA 3EU9A 5CBOA 1K1BA 5HRYA 5EYLA 5JA4D 4K5AB 4QQIA 5FIOA 5HS0A 1BU9A 5FINA 1S70B 3J5PA 4HI8A 1OT8A 3Q9NC 4OAVB 2ETBA 3TWQA 3TWWA 5AQAA 3KEAA 4O1PA 5KNGA 1DCQA 4U95D 5EIDA 5EN5D 4U8YD 3TWUA 4DX2A 3UI2A 2XENA 4UUCA 1WG0A 1BLXB 2L6BA 1MX6A 3C5RA 2DWZA 3TWVA 1N11A 4F6RD 3V30A 4CYMD 4RLYA 3Q9UC 3T9KA 4OAUC 3V79K 4GMRA 3ZNGA 2ETCA 2A5EA 1G3NB 1N0RA 1OY3D 4HNAD 2F8XK 2VGEA 4BESA 2B0OE 4YDYA 1BI7B 1BI8B 4ZFHA 3W9GA 2QC9A 2Y1LE 4J8YA 3NBNB 2V5QC 5BXOA 5CEAA 3JXIA 3HRAA 4F1PA 5KBAA 1DC2A 1MX2A 2DZOA 2Y0BG 4DX6D 5HKPA 5KWDA 1YMPA 3NOCD 2ZGDA 4BETA 4A63B 5AQ7A 4HLLA 1TR4A 5CBNA 1IXVA 2XZDG 4GPMA 5ENPD 3UTMA 4HB5A 2DVWA 1SVXA 1K3ZD 2XZTG 3B95A 5ENRD 1YCSB 3J5QB 3B7BA 5AQ9A 3ZUVB 2NYJA 4LNUD 5D66A 1AP7A 2XEEA 4DRXE 3AAAC 4HRMB 4NIKA 5CECB 3TWTA 4LG6A 4ZHBA 3DEPA 4HRNA 3SO8A 2RFAA 4HRLA 1YYHA 1N0QA 4U96D
chains in the Genus database with same CATH superfamily
4F3VA 3HVEA 3CHQA 3QC1A 2P9SG 4OYSA 3CHMA 4DUIA 3JXJA 5KJLA 2AVPA 4PDXA 4BTBA 2AXUA 1OWPA 3LJNA 5ENOD 1K1AA 1BD8A 5EDSA 5LCWC 5LX8A 1OUVA 2XGMA 3T5VA 3PEVB 1D8EA 5EIBE 3NAWA 3TWXA 4FJYA 2I1JA 1SA4A 1NZNA 5FQ7A 4DX7D 3WG7E 3FDHA 4O60A 3AG3E 4JC8A 4LERA 3TXMA 5FIOA 2LAIA 5EX3A 2ETBA 4LRZA 3TWQA 4U95D 3VLFA 5AYWD 2XENA 2WXPA 1HZ4A 3ZYLA 1IYGA 1HH8A 4AVXA 3D9IA 3JYSA 4EECA 1Q2ZA 1UJJA 3UM2A 3D9JA 2OEVA 2Y0BG 3UKRG 3C3RA 5AQ7A 2LXMA 4CEMA 5CBNA 5KJKA 1N4PA 3Q47B 3FUFA 5KBAA 2XZTG 3ZVVA 5D66A 1SQMA 2A4ZA 3ASFA 3UKUG 3FU0A 3AU4A 3FTZA 2P9LG 4UI9J 3FUIA 4BY6A 5J08A 1GW6A 3HIZA 2B6CA 3D9HA 3MEKA 3ZKJA 5ENQD 2JEKA 3U3WA 1FT1A 4HQDA 1N95A 1U3CA 4AOFA 1NA0A 3UIPC 2WMNA 1H0AA 4NURA 2Y4UA 3MA5A 4I6EA 2M63A 5ENNA 3VTYA 1FPPA 3LY7A 4AJWA 5HQ8A 5ENSD 3RRUA 2XS8A 3JCKC 2LNIA 3EU9A 5EYLA 1SZAA 2CHWA 1EF1C 4HI8A 2DYRE 1X5BA 4DJAA 2CG3A 4AIFA 3V30A 4ATGA 4YVQC 3U66A 4L23A 4WUYA 4N39A 2B0OE 3B13A 1E8WA 4ZFHA 2HYZA 1TEZA 4XEIG 5G05J 3QWWA 3MKRA 3D9KA 4GTTA 4GTPA 4A63B 1XGWA 4GZDA 3L08A 5ENRD 4U63A 3Q73A 2NYJA 3T5XA 4JA7A 3CVLA 4NQ0A 3MJWA 4U0SA 4C0MA 4CT4A 4ILGA 3ABME 3FH7A 2PZIA 4RQIA 5BNWA 4F53A 5AENA 3ASGA 2F8YA 4A1SA 1TN8A 3BQOA 4XI9A 4RVBA 2HM8A 3CVNA 3S7JA 2VGYA 3MGBA 4HOQA 2WQHA 4C9BB 1Z6TA 4Y6CA 4DPRA 2BUGA 2P58C 2P9UG 3TL5A 2QFCA 3JQ0A 3DXMG 4U8VD 3KAEA 4F1SA 1FT2A 2IEJA 5FT9A 2XRYA 4CDRA 2DIWA 3AS8A 3PE3A 3QWPA 4XKBA 4JD2G 4U8YD 3L82A 3UI2A 3JQ1A 2EIJE 3D9MA 4I9CA 1TN7A 2XS1A 4OAUC 4HOSA 3AS4A 3PS6A 3PZ4A 4I2ZA 2OVFA 3CGHA 3CK9A 2X6HA 2QC9A 2Y4TA 2ZISA 4I17A 4J8EA 2WVIA 1PC2A 3DSSA 4BWRA 3KSLA 3K9IA 3OXLA 1NP7A 4HB5A 4PS3A 4W9RA 4GB9A 2I6HA 1N94A 4TRQA 1TNYA 1S63A 3CKCA 4EZLA 3GZ2A 4ZHBA 3ZN3A 3RKVA 1H2VC 3Q7AA 4BX8A 3ESKA 4JW1A 1PAQA 3E30A 4UWFA 1JWFA 3MKQB 3EHRA 4D10C 5A7DB 2R02A 3BG0B 2DZNA 2VQ2A 4A3TA 3CVVA 1MJ0A 3RU0A 5BPPA 4XE0A 3L6AA 2ZXWE 4APOA 3I3NA 3ZHEA 1LD8A 2BF0X 2R2LA 3QDNA 1OWOA 4LNGA 4BTAA 2XGOA 3GW4A 1OWNA 4GA2A 2EIKE 3DSWA 4QQIA 5BW8C 3FTYA 1OT8A 2P9PG 3URZA 2AXVA 4ME2A 4GZ6A 4DX2A 4GZCA 3TWUA 2E2EA 3TWVA 2J4BA 3LY8A 2A5EA 1OWLA 4U0ZA 3NBNB 4JEUA 2JLBA 4I9EA 3O48A 4GA0A 5B1AE 3OXFA 4JXTA 2YINA 3FUDA 4XZ4A 5FZSA 5FQ4A 2NC9A 1ZB1A 3ABLE 1VDYA 2GROB 3PH0C 1IQUA 1E90A 2XEVA 4HBDA 2GRQB 4K5CA 3DSXA 3DWLG 2XPZA 3CK8A 2L9BA 3KD7A 2J8SD 3UX4A 4G8LA 4A55A 1UN8A 2L6JA 1B89A 3ASOE 3SI5A 2H6GA 4I1MA 3FTUA 2JABA 1TN6A 4DX1A 2KXPC 2HE0A 1EYHA 1Z3YA 3MV3B 5BT1A 2CFUA 3RO3A 5JA4D 3DBSA 4U7EB 3QOUA 2J09A 2XRZA 5G2NA 2GRMA 2NSZA 5CMYA 4O1PA 4HFGA 4ACKA 4UUCA 3CV0A 5DIZA 3D9LA 4N3BA 1INZA 2XQ0A 2R17C 4FP7A 4GMRA 1OY3D 4L2YA 1WAO1 2IU1A 4O6FA 4J8DA 4YNDA 4KZ0A 2E0IA 5KJNA 5JJ7A 3Q78A 3HXCA 1YMPA 2QY7A 3CQGB 2CFZA 4GYWA 2IFUA 4M7CA 5FJYA 3B7RL 5G04J 3CVYA 1TJFA 1YCSB 4KXKB 3CVXA 3ZEFA 4JL0A 4NIKA 3ZXSA 4DK5A 2IOLA 3BG1B 1Y6IA 1JUQA 3UMVA 2C2LA 2WXGA 3FU5A 1UJKA 4E6HA 2F37A 1H6PA 5BV1A 3ZXPA 4LUNU 2XEHA 1AWCB 3FUMA 3UT8A 3QJZA 5KJMA 1WDYA 2WXQA 4B89A 5B3SE 4JEHA 5AARA 4CCAA 4GCOA 4CZ2D 3Q7FA 2BKKB 3HDXA 2YNQA 3N71A 4Q69A 3APFA 4YDEA 3FTXA 1LTXA 1SZ9A 3FEYA 1LD7A 2LSVA 3MZLB 4G11A 5AQAA 5IY5E 5FWQA 1WG0A 1E8ZA 4A3VA 3AG2E 3PZDA 5EX0A 3V79K 3U9WA 2XGSA 2FULA 4LNBA 1N0RA 1X81A 3PEUB 3W9GA 1HS6A 3G2VA 4J8YA 3EDTB 4AY5A 4F1PA 3S7DA 1HF8A 2PM6A 3RSEG 1O1TA 4HORA 4OVVA 4AP2A 1K3ZD 3B7BA 1TNUA 1LF8A 1O1RA 1V55E 2VTBA 4DRXE 1OCCE 4K03A 4J6IA 4N3CA 1HG5A 2XCCA 3RAUA 1DVPA 3CLJA 1YA0A 2WXLA 2XPYA 2XCBA 4CDNA 1N4SA 5KNHD 4BX9A 3UINC 4FA6A 5FTPA 4QFVA 4H7XA 5D0OD 2HO1A 4FHJA 3ESLA 4U04A 3DPYA 2RFMA 4UWGA 4B93B 2ILRA 4CGVA 4G24A 1HO8A 3SY2A 1EDUA 3CHRA 1BU9A 3Q9NC 3UT4A 3ZYMA 4LEUA 3FUJA 3ULEG 3FULA 1UG3A 3Q9UC 3LPZA 2J07A 2UY1A 5KCMA 2ZU6B 2OCCE 2UWJG 2BTDA 2KZTB 4CT0A 5CEAA 1KT1A 2H6FA 4DLOA 1UN9A 3CSTA 2XZDG 2I2OA 4UI9C 3DSVA 3MKQA 5AJLA 2VJ8A 3ZUVB 1HX8A 4G26A 4G2VA 4L2LA 3QARA 4Q94A 4JPSA 3AAAC 5CHEE 3UM0A 3P2BA 3PDNA 3DEPA 5CCMA 2BEDA 4BESA 1QNFA 2ETAA 5CERB 4G8KA 3WXXA 1IHBA 3LDZA 3T8KA 4JB8P 4FADA 4YDWA 3ZIMA 3F6QA 2FO1E 2WXFA 3VTXA 3C3QA 4L7TA 2MYOA 4BEPA 5LP0A 1N4RA 2V4LA 4ANXA 4C48B 3UPVA 3LCAA 4I2WA 3UT7A 4HI9A 1IKND 3LJ3A 2WXRA 4IULA 3SF4A 4Z68A 3PRZA 5T3RA 3O4ZA 1S0PA 4AXHA 2OEWA 1E7VA 5HRYA 4ILIA 2CG2A 2NXPA 4KT6B 4BFRA 3FWVA 2PM7A 5EIDA 4G25A 2KCKA 4ANWA 3T9KA 5G05C 3FTSA 2X38A 4HNAD 5JJ6A 3R9MA 3ZFWA 1JCQA 1Z3XA 5HKPA 4EHMA 4BETA 3BEEA 4BT8A 3Q79A 2VYIA 3NZSA 4FU3A 1OCZE 3IV0A 4N3AA 2VGXA 2L0TB 4ANVA 2VSOE 3FU6A 1H2TC 4TXQA 1XNFA 3DEOA 3HXDA 3PNLB 3FU3A 3CSFA 3JUEA 5EYPF 5ANRA 4AEZC 4F7AA 3L22A 3S7BA 4AY6A 2RD0A 3PVLA 3CVQA 3AJIA 4GTVA 2X6KA 4DX5D 2MHKA 4UQYA 1L5JA 5ITZF 4UQZA 2BKGA 3SFXA 4HS2A 1HE8A 3SBSA 2WXNA 3CHPA 1WM5A 2V4HC 4N5QA 4NACA 1HU3A 2ZIRA 2GW1A 3FUKA 2KATA 4RG9A 3LVRE 3JUIA 1O1SA 1IHGA 2WXHA 4ABNA 4E85A 4DI4A 2ETCA 4EZJA 5A23A 4B0ZA 2PQRA 3ZGQA 4ANUA 3DRAA 3ENEA 2Y1LE 3RK6A 4YDOA 4C0EA 1FCHA 3JXIA 2Y69E 4GZ3A 3LEWA 5KWDA 1JCRA 2IQCA 3UTMA 1U2VG 3TWTA 2P9IG 3NF1A 4HRNA 1UW4B 3APCA 1YYHA 4GZ5A 5B1BE 3TG4A 3FY4A 3DSTA 2AW6A 5DBKA 1KLXA 3LKUA 1EPUA 3E37A 2P2CP 1Z5SC 3Q4AB 1HG2A 3E32A 4PS8A 4HOTA 5AIJA 1MYOA 1HFAA 1JCSA 3FUEA 3PZ2A 3APDA 1QYMA 3OAWA 2EINE 3SQVA 4U8HA 3ONLA 2V8SE 4WWOA 3TGOA 3MYVA 4MKTA 3D9NA 4DLQA 3C72A 3L16A 4CRWA 4GTOA 4K5AB 5HS0A 4V3IA 5FINA 1S70B 1OXJA 3NZUA 5D2MC 2QZAA 4U07A 4HLEA 4LCTA 1E8XA 4HVBA 3BU8A 1NA3A 3C5RA 3C98A 4L1BA 3GZ1A 3G2SA 4EBAA 4F6RD 3ASHA 3IBEA 2FO7A 4B8AA 2WMOA 2VSYA 1S64A 5CCLA 4YDYA 3UUXA 1O5MA 2R59A 3GYZA 2IY0C 4BT9A 2V5QC 2CHZA 3D9OA 1P5QA 2V0PA 4HLLA 3MV2B 5ENPD 4N5CA 2RG8A 4XIFA 5G55A 3J5QB 2LXLA 3L54A 3EIQC 5LOZA 3SO8A 4HRLA 3HYMB 3EU5A 1D9SA 4KYOB 3B7SA 1MX4A 3FH5A 4WNGA 2J4DA 2R5SA 3UIOC 3TXNA 5T4YA 3ABKE 4GTMA 4GTRA 4FHKA 5ARGA 2VSNA 1Y8MA 3NOGD 4PUCA 3CKBA 3D9PA 4J8SA 1RZ4A 4JVSA 2GRNB 3EHMA 5AAOA 2L0IA 4GTQA 3G2WA 2GRLA 3CVWA 4B8CB 2FF4A 2IONA 4MS6A 1NFIE 3IKOB 2AJAA 4PS7A 3Q49B 4M3OA 3RJVA 1ELRA 3TWWA 4KZCA 2PL2A 3PUKA 2XPIA 5EN5D 4FLBA 2AXZA 3AG4E 4R7LA 3ML8A 4CYMD 4RLYA 5ANLA 3ASNE 4ACLA 2IO3C 4JHJA 2VGEA 3ZW3A 2PQNA 3LS8A 2C0LA 2EQXA 5G04C 2X6IA 3NB2A 5BXOA 3NQPA 2X3MA 2A5UA 3FH8A 2HR2A 4AM9A 3B7TA 4H7YA 3B7UX 5AQ9A 5JHBA 2WB2A 2WXMA 4FULA 3LY9A 3BUAA 2RFAA 2V5FA 4Q96A 2DBAA 2WQ6A 3FTVA 4WAFA 3RO2A 4KBQA 1W3BA 5AQBA 2OV8A 3T8MA 1N54A 3TJPA 2PNNA 4BERA 3KEZA 3V2OA 2H6HA 3CK7A 4WNEA 1OWMA 3FUHA 2AWIA 4G23A 2FBNA 4IN3B 1UOHA 3QKYA 1TNBA 3PUJA 2KBXA 5M72A 3TG5A 3EHQA 4JHRA 4A1GA 3ZPJA 1KT0A 3CHOA 1H19A 4J8FA 3SGHA 4GCNA 3J5PA 4KVOA 3CVUA 1TNZA 5FZRA 1QBQA 5KNGA 4UWKA 4EPZA 2FEZA 3FUNA 3SD5A 1N11A 4KMOA 2IO2C 1NL4A 3UQ3A 3RIBA 1BPOA 4I6JA 3ISMC 5AJDA 4XKCA 3U64A 3ASDA 3U4TA 4GAAA 4DX6D 2ZGDA 3UM1A 3S7FA 2WXIA 3B95A 2I1KA 1KPSB 4TV3A 3E34A 4GPKA 4HRMB 4WNDA 4K0RA 3ZYKA 1JPLA 2IJGX 1N0QA 5BV0A 3I5PA 4GA1A 1K8KG 1TNOA 2LUHA 4ATZD 3VLDA 4GYYA 4J0UA 2QYJA 4FLHA 1HXIA 2DYSE 2GRRB 5CRUA 1FVFA 3HVEB 2YHEA 4I1OB 3CHSA 2C0MA 2IF4A 3EHNA 3QAQA 2F0YA 4IRUA 4GTSA 3GZSA 4NRHB 3RRMB 1K1BA 1DNPA 3CQCB 1N52A 4GYOA 4JA9A 2DWZA 2I9CA 3IHYA 2VSXE 1FVHA 1U3DA 1H6KA 4OVUA 1BI8B 1A17A 4APFA 3AS5A 1ZBPA 1H6OA 1OCRE 1DC2A 3SFZA 4CGWA 4WWPA 3EIJA 2VTBB 2WPVA 2DVWA 4UQXA 1RW2A 3D3MA 4HOUA 3CIAA 2XEEA 3ZRHA 2GRPB 3DXKG 4X8QA 4LG6A 2MOWA 3QNKA 3CEQA 2WXOA 4TXRA 3SBTB 3R9AB 3V31A 3W9FA 2KM4A 4WWNA 2MRIA 4L9PA 2Y3AA 3V2XA 1E8YA 1WY6A 4BSZB 5H7PA 5D0QD 2R05A 1MHQA 3SHFA 2LO6A 4P29A 3OXGA 1E96B 5AN8A 4MLPA 3PZ3A 4K5BA 4MBGA 3MX3A 3HXFA 1IQRA 4I43A 5J90A 3HG0D 3DSUA 1A5EA 3ONKA 3C3OA 1ZU2A 4AV7A 4RSYA 5CBOA 5ARFA 4XX5A 4BSXA 3PZ1A 1H2UA 1KZOA 2P9KG 2UY1B 4HXIA 2L6BA 1MX6A 4EZKA 4MRUA 3QWVA 4N2QA 4WNFA 1G3NB 3G2TA 4GU5A 1BI7B 4FJZA 5JJTA 4B94A 1SA5A 1D8DA 5FQ6A 2DZOA 4TUUA 1MQSA 2WQ7A 4U0UA 3FHEA 1TR4A 1TJCA 4GPMA 4EBAG 2QYUA 3Q15A 3HXBA 1AP7A 5CECB 4GMJA 2H6IA 4U96D 3IEGA 2GGFA 2LSUA 2P9NG 5EKQD 1N9AA 3UM3A 3KSQA 4JHKA 5CEDB 3PNTB 2LAHA 2OOEA 3QB2A 1QQEA 2CHXA 1PY1A 4J7WA 4TUMA 4URKA 3HXEA 1NI1A 5JMND 5C1DA 2X6JA 4PH4B 3L17A 5EILA 3SFYA 5LFAA 5E76A 3L9TA 2FI7A 3IXEA 3L13A 3LVQE 4TXPA 3FP3A 4IYPA 1ELKA 4LSZE 3DPDA 1KZPA 4UI9K 4XI0A 3X2QE 3IHVA 2J9QA 4UWHA 3SNXA 2DCPA 1DCQA 3Q5MA 3HHMA 2KC7A 3ZNGA 5HI7A 4UWLA 4N2SA 5BUZA 2WM9A 3KS2A 2Q7FA 3P1UA 2ONDA 2KCLA 3E4BA 4DI3A 3TAXA 3MCXA 2J49A 3CVPA 1MZCA 3NOCD 1TYQG 1N4QA 1IXVA 3QK0A 4ILHB 1JWGA 2R03A 4LNUD 2J08A 4I6GA 2VGXB 3G2UA 3R7QA 3R7RA 2KCVA 2YHCA 3VLEA 4I1AA 3Q75A 3FTWA 2ZGGA 3FEXA 5ENTD 3UXGA 4RG6A 5CRVA 1E7UA 5T8IA 3TWSA 4O1OA 5FZQA 1ELWA 2IOSA 3AG1E 1DCEA 3RRNB 3LXUX 3LYAA 3OTNA 1SW6A 4KVMA 5BXUA 3ZU7B 4GMLA 3PREA 2YQ8A 2WXJA 4YVOA 3ZHEB 3TWRA 4Y6WA 5E75A 4FC8A 3EUVA 2XHEA 3ML9A 3ULQA 4JZYA 4OAVB 3I4GA 2OVBA 3KEAA 3E33A 2EIME 3EJNA 1BLXB 5FQ8A 5LCWJ 3ULYA 5C2YA 2WXKA 2F8XK 4G1TA 3CR3A 2EILE 3PE4A 3HRAA 2KZTA 3ZYQA 1MX2A 2X6FA 4EQFA 4CDMA 1SVXA 5JHAA 3S2AA 1QZ2A 1OCOE 3I4RB 3AU5A 5A6CA 5CMWA 1V54E 2RKKA 3FFLA 3SZ7A
chains in the Genus database with same CATH topology
3V31A 2ETAA 3EHRA 3W9FA 5CERB 4G8KA 3D9HA 4ATZD 5CEDB 1D9SA 4HBDA 2F8YA 5AQBA 4K5CA 3ZKJA 1MX4A 2F37A 4DUIA 1IHBA 3JXJA 2DZNA 2ZGGA 5ENQD 2QYJA 5KNHD 3T8KA 3DEOA 4JB8P 5ENTD 4J7WA 4TUMA 3UXGA 4YDWA 1MJ0A 2P2CP 2PNNA 4HQDA 3F6QA 3V2XA 2FO1E 4BERA 2XEHA 3LJNA 4QFVA 3TWSA 1AWCB 3JUEA 2J8SD 4O1OA 5ENOD 1K1AA 4G8LA 1BD8A 5EYPF 5JMND 3V2OA 4BSZB 1WDYA 2MYOA 4BEPA 1MYOA 3NOGD 5EILA 4C48B 5EIBE 2JABA 1SW6A 1UOHA 3TWXA 5BXUA 1QYMA 3IXEA 5AAOA 5AARA 5AN8A 3ZU7B 4DX1A 3AJIA 4HI9A 1IKND 2KXPC 4CZ2D 4K5BA 4DX5D 2KBXA 2BKKB 4DX7D 2HE0A 5ITZF 2RFMA 3EHQA 5ENSD 4O60A 4Z68A 4B93B 2BKGA 3HG0D 1A5EA 3TWRA 4U8VD 4LSZE 1NFIE 2V4HC 2AJAA 4N5QA 3EU9A 5CBOA 1K1BA 5HRYA 5EYLA 5JA4D 4K5AB 4QQIA 5FIOA 5HS0A 1BU9A 5FINA 1S70B 3J5PA 4HI8A 1OT8A 3Q9NC 4OAVB 2ETBA 3TWQA 3TWWA 5AQAA 3KEAA 4O1PA 5KNGA 1DCQA 4U95D 5EIDA 5EN5D 4U8YD 3TWUA 4DX2A 3UI2A 2XENA 4UUCA 1WG0A 1BLXB 2L6BA 1MX6A 3C5RA 2DWZA 3TWVA 1N11A 4F6RD 3V30A 4CYMD 4RLYA 3Q9UC 3T9KA 4OAUC 3V79K 4GMRA 3ZNGA 2ETCA 2A5EA 1G3NB 1N0RA 1OY3D 4HNAD 2F8XK 2VGEA 4BESA 2B0OE 4YDYA 1BI7B 1BI8B 4ZFHA 3W9GA 2QC9A 2Y1LE 4J8YA 3NBNB 2V5QC 5BXOA 5CEAA 3JXIA 3HRAA 4F1PA 5KBAA 1DC2A 1MX2A 2DZOA 2Y0BG 4DX6D 5HKPA 5KWDA 1YMPA 3NOCD 2ZGDA 4BETA 4A63B 5AQ7A 4HLLA 1TR4A 5CBNA 1IXVA 2XZDG 4GPMA 5ENPD 3UTMA 4HB5A 2DVWA 1SVXA 1K3ZD 2XZTG 3B95A 5ENRD 1YCSB 3J5QB 3B7BA 5AQ9A 3ZUVB 2NYJA 4LNUD 5D66A 1AP7A 2XEEA 4DRXE 3AAAC 4HRMB 4NIKA 5CECB 3TWTA 4LG6A 4ZHBA 3DEPA 4HRNA 3SO8A 2RFAA 4HRLA 1YYHA 1N0QA 4U96D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V31 A;  2ETA A;  3EHR A;  3W9F A;  5CER B;  4G8K A;  3D9H A;  4ATZ D;  5CED B;  1D9S A;  4HBD A;  2F8Y A;  5AQB A;  4K5C A;  3ZKJ A;  1MX4 A;  2F37 A;  4DUI A;  1IHB A;  3JXJ A;  2DZN A;  2ZGG A;  5ENQ D;  2QYJ A;  5KNH D;  3T8K A;  3DEO A;  4JB8 P;  5ENT D;  4J7W A;  4TUM A;  3UXG A;  4YDW A;  1MJ0 A;  2P2C P;  2PNN A;  4HQD A;  3F6Q A;  3V2X A;  2FO1 E;  4BER A;  2XEH A;  3LJN A;  4QFV A;  3TWS A;  1AWC B;  3JUE A;  2J8S D;  4O1O A;  5ENO D;  1K1A A;  4G8L A;  1BD8 A;  5EYP F;  5JMN D;  3V2O A;  4BSZ B;  1WDY A;  2MYO A;  4BEP A;  1MYO A;  3NOG D;  5EIL A;  4C48 B;  5EIB E;  2JAB A;  1SW6 A;  1UOH A;  3TWX A;  5BXU A;  1QYM A;  3IXE A;  5AAO A;  5AAR A;  5AN8 A;  3ZU7 B;  4DX1 A;  3AJI A;  4HI9 A;  1IKN D;  2KXP C;  4CZ2 D;  4K5B A;  4DX5 D;  2KBX A;  2BKK B;  4DX7 D;  2HE0 A;  5ITZ F;  2RFM A;  3EHQ A;  5ENS D;  4O60 A;  4Z68 A;  4B93 B;  2BKG A;  3HG0 D;  1A5E A;  3TWR A;  4U8V D;  4LSZ E;  1NFI E;  2V4H C;  2AJA A;  4N5Q A;  3EU9 A;  5CBO A;  1K1B A;  5HRY A;  5EYL A;  5JA4 D;  4K5A B;  4QQI A;  5FIO A;  5HS0 A;  1BU9 A;  5FIN A;  1S70 B;  3J5P A;  4HI8 A;  1OT8 A;  3Q9N C;  4OAV B;  2ETB A;  3TWQ A;  3TWW A;  5AQA A;  3KEA A;  4O1P A;  5KNG A;  1DCQ A;  4U95 D;  5EID A;  5EN5 D;  4U8Y D;  3TWU A;  4DX2 A;  3UI2 A;  2XEN A;  4UUC A;  1WG0 A;  1BLX B;  2L6B A;  1MX6 A;  3C5R A;  2DWZ A;  3TWV A;  1N11 A;  4F6R D;  3V30 A;  4CYM D;  4RLY A;  3Q9U C;  3T9K A;  4OAU C;  3V79 K;  4GMR A;  3ZNG A;  2ETC A;  2A5E A;  1G3N B;  1N0R A;  1OY3 D;  4HNA D;  2F8X K;  2VGE A;  4BES A;  2B0O E;  4YDY A;  1BI7 B;  1BI8 B;  4ZFH A;  3W9G A;  2QC9 A;  2Y1L E;  4J8Y A;  3NBN B;  2V5Q C;  5BXO A;  5CEA A;  3JXI A;  3HRA A;  4F1P A;  5KBA A;  1DC2 A;  1MX2 A;  2DZO A;  2Y0B G;  4DX6 D;  5HKP A;  5KWD A;  1YMP A;  3NOC D;  2ZGD A;  4BET A;  4A63 B;  5AQ7 A;  4HLL A;  1TR4 A;  5CBN A;  1IXV A;  2XZD G;  4GPM A;  5ENP D;  3UTM A;  4HB5 A;  2DVW A;  1SVX A;  1K3Z D;  2XZT G;  3B95 A;  5ENR D;  1YCS B;  3J5Q B;  3B7B A;  5AQ9 A;  3ZUV B;  2NYJ A;  4LNU D;  5D66 A;  1AP7 A;  2XEE A;  4DRX E;  3AAA C;  4HRM B;  4NIK A;  5CEC B;  3TWT A;  4LG6 A;  4ZHB A;  3DEP A;  4HRN A;  3SO8 A;  2RFA A;  4HRL A;  1YYH A;  1N0Q A;  4U96 D; 
#chains in the Genus database with same CATH topology
 4F3V A;  3HVE A;  3CHQ A;  3QC1 A;  2P9S G;  4OYS A;  3CHM A;  4DUI A;  3JXJ A;  5KJL A;  2AVP A;  4PDX A;  4BTB A;  2AXU A;  1OWP A;  3LJN A;  5ENO D;  1K1A A;  1BD8 A;  5EDS A;  5LCW C;  5LX8 A;  1OUV A;  2XGM A;  3T5V A;  3PEV B;  1D8E A;  5EIB E;  3NAW A;  3TWX A;  4FJY A;  2I1J A;  1SA4 A;  1NZN A;  5FQ7 A;  4DX7 D;  3WG7 E;  3FDH A;  4O60 A;  3AG3 E;  4JC8 A;  4LER A;  3TXM A;  5FIO A;  2LAI A;  5EX3 A;  2ETB A;  4LRZ A;  3TWQ A;  4U95 D;  3VLF A;  5AYW D;  2XEN A;  2WXP A;  1HZ4 A;  3ZYL A;  1IYG A;  1HH8 A;  4AVX A;  3D9I A;  3JYS A;  4EEC A;  1Q2Z A;  1UJJ A;  3UM2 A;  3D9J A;  2OEV A;  2Y0B G;  3UKR G;  3C3R A;  5AQ7 A;  2LXM A;  4CEM A;  5CBN A;  5KJK A;  1N4P A;  3Q47 B;  3FUF A;  5KBA A;  2XZT G;  3ZVV A;  5D66 A;  1SQM A;  2A4Z A;  3ASF A;  3UKU G;  3FU0 A;  3AU4 A;  3FTZ A;  2P9L G;  4UI9 J;  3FUI A;  4BY6 A;  5J08 A;  1GW6 A;  3HIZ A;  2B6C A;  3D9H A;  3MEK A;  3ZKJ A;  5ENQ D;  2JEK A;  3U3W A;  1FT1 A;  4HQD A;  1N95 A;  1U3C A;  4AOF A;  1NA0 A;  3UIP C;  2WMN A;  1H0A A;  4NUR A;  2Y4U A;  3MA5 A;  4I6E A;  2M63 A;  5ENN A;  3VTY A;  1FPP A;  3LY7 A;  4AJW A;  5HQ8 A;  5ENS D;  3RRU A;  2XS8 A;  3JCK C;  2LNI A;  3EU9 A;  5EYL A;  1SZA A;  2CHW A;  1EF1 C;  4HI8 A;  2DYR E;  1X5B A;  4DJA A;  2CG3 A;  4AIF A;  3V30 A;  4ATG A;  4YVQ C;  3U66 A;  4L23 A;  4WUY A;  4N39 A;  2B0O E;  3B13 A;  1E8W A;  4ZFH A;  2HYZ A;  1TEZ A;  4XEI G;  5G05 J;  3QWW A;  3MKR A;  3D9K A;  4GTT A;  4GTP A;  4A63 B;  1XGW A;  4GZD A;  3L08 A;  5ENR D;  4U63 A;  3Q73 A;  2NYJ A;  3T5X A;  4JA7 A;  3CVL A;  4NQ0 A;  3MJW A;  4U0S A;  4C0M A;  4CT4 A;  4ILG A;  3ABM E;  3FH7 A;  2PZI A;  4RQI A;  5BNW A;  4F53 A;  5AEN A;  3ASG A;  2F8Y A;  4A1S A;  1TN8 A;  3BQO A;  4XI9 A;  4RVB A;  2HM8 A;  3CVN A;  3S7J A;  2VGY A;  3MGB A;  4HOQ A;  2WQH A;  4C9B B;  1Z6T A;  4Y6C A;  4DPR A;  2BUG A;  2P58 C;  2P9U G;  3TL5 A;  2QFC A;  3JQ0 A;  3DXM G;  4U8V D;  3KAE A;  4F1S A;  1FT2 A;  2IEJ A;  5FT9 A;  2XRY A;  4CDR A;  2DIW A;  3AS8 A;  3PE3 A;  3QWP A;  4XKB A;  4JD2 G;  4U8Y D;  3L82 A;  3UI2 A;  3JQ1 A;  2EIJ E;  3D9M A;  4I9C A;  1TN7 A;  2XS1 A;  4OAU C;  4HOS A;  3AS4 A;  3PS6 A;  3PZ4 A;  4I2Z A;  2OVF A;  3CGH A;  3CK9 A;  2X6H A;  2QC9 A;  2Y4T A;  2ZIS A;  4I17 A;  4J8E A;  2WVI A;  1PC2 A;  3DSS A;  4BWR A;  3KSL A;  3K9I A;  3OXL A;  1NP7 A;  4HB5 A;  4PS3 A;  4W9R A;  4GB9 A;  2I6H A;  1N94 A;  4TRQ A;  1TNY A;  1S63 A;  3CKC A;  4EZL A;  3GZ2 A;  4ZHB A;  3ZN3 A;  3RKV A;  1H2V C;  3Q7A A;  4BX8 A;  3ESK A;  4JW1 A;  1PAQ A;  3E30 A;  4UWF A;  1JWF A;  3MKQ B;  3EHR A;  4D10 C;  5A7D B;  2R02 A;  3BG0 B;  2DZN A;  2VQ2 A;  4A3T A;  3CVV A;  1MJ0 A;  3RU0 A;  5BPP A;  4XE0 A;  3L6A A;  2ZXW E;  4APO A;  3I3N A;  3ZHE A;  1LD8 A;  2BF0 X;  2R2L A;  3QDN A;  1OWO A;  4LNG A;  4BTA A;  2XGO A;  3GW4 A;  1OWN A;  4GA2 A;  2EIK E;  3DSW A;  4QQI A;  5BW8 C;  3FTY A;  1OT8 A;  2P9P G;  3URZ A;  2AXV A;  4ME2 A;  4GZ6 A;  4DX2 A;  4GZC A;  3TWU A;  2E2E A;  3TWV A;  2J4B A;  3LY8 A;  2A5E A;  1OWL A;  4U0Z A;  3NBN B;  4JEU A;  2JLB A;  4I9E A;  3O48 A;  4GA0 A;  5B1A E;  3OXF A;  4JXT A;  2YIN A;  3FUD A;  4XZ4 A;  5FZS A;  5FQ4 A;  2NC9 A;  1ZB1 A;  3ABL E;  1VDY A;  2GRO B;  3PH0 C;  1IQU A;  1E90 A;  2XEV A;  4HBD A;  2GRQ B;  4K5C A;  3DSX A;  3DWL G;  2XPZ A;  3CK8 A;  2L9B A;  3KD7 A;  2J8S D;  3UX4 A;  4G8L A;  4A55 A;  1UN8 A;  2L6J A;  1B89 A;  3ASO E;  3SI5 A;  2H6G A;  4I1M A;  3FTU A;  2JAB A;  1TN6 A;  4DX1 A;  2KXP C;  2HE0 A;  1EYH A;  1Z3Y A;  3MV3 B;  5BT1 A;  2CFU A;  3RO3 A;  5JA4 D;  3DBS A;  4U7E B;  3QOU A;  2J09 A;  2XRZ A;  5G2N A;  2GRM A;  2NSZ A;  5CMY A;  4O1P A;  4HFG A;  4ACK A;  4UUC A;  3CV0 A;  5DIZ A;  3D9L A;  4N3B A;  1INZ A;  2XQ0 A;  2R17 C;  4FP7 A;  4GMR A;  1OY3 D;  4L2Y A;  1WAO 1;  2IU1 A;  4O6F A;  4J8D A;  4YND A;  4KZ0 A;  2E0I A;  5KJN A;  5JJ7 A;  3Q78 A;  3HXC A;  1YMP A;  2QY7 A;  3CQG B;  2CFZ A;  4GYW A;  2IFU A;  4M7C A;  5FJY A;  3B7R L;  5G04 J;  3CVY A;  1TJF A;  1YCS B;  4KXK B;  3CVX A;  3ZEF A;  4JL0 A;  4NIK A;  3ZXS A;  4DK5 A;  2IOL A;  3BG1 B;  1Y6I A;  1JUQ A;  3UMV A;  2C2L A;  2WXG A;  3FU5 A;  1UJK A;  4E6H A;  2F37 A;  1H6P A;  5BV1 A;  3ZXP A;  4LUN U;  2XEH A;  1AWC B;  3FUM A;  3UT8 A;  3QJZ A;  5KJM A;  1WDY A;  2WXQ A;  4B89 A;  5B3S E;  4JEH A;  5AAR A;  4CCA A;  4GCO A;  4CZ2 D;  3Q7F A;  2BKK B;  3HDX A;  2YNQ A;  3N71 A;  4Q69 A;  3APF A;  4YDE A;  3FTX A;  1LTX A;  1SZ9 A;  3FEY A;  1LD7 A;  2LSV A;  3MZL B;  4G11 A;  5AQA A;  5IY5 E;  5FWQ A;  1WG0 A;  1E8Z A;  4A3V A;  3AG2 E;  3PZD A;  5EX0 A;  3V79 K;  3U9W A;  2XGS A;  2FUL A;  4LNB A;  1N0R A;  1X81 A;  3PEU B;  3W9G A;  1HS6 A;  3G2V A;  4J8Y A;  3EDT B;  4AY5 A;  4F1P A;  3S7D A;  1HF8 A;  2PM6 A;  3RSE G;  1O1T A;  4HOR A;  4OVV A;  4AP2 A;  1K3Z D;  3B7B A;  1TNU A;  1LF8 A;  1O1R A;  1V55 E;  2VTB A;  4DRX E;  1OCC E;  4K03 A;  4J6I A;  4N3C A;  1HG5 A;  2XCC A;  3RAU A;  1DVP A;  3CLJ A;  1YA0 A;  2WXL A;  2XPY A;  2XCB A;  4CDN A;  1N4S A;  5KNH D;  4BX9 A;  3UIN C;  4FA6 A;  5FTP A;  4QFV A;  4H7X A;  5D0O D;  2HO1 A;  4FHJ A;  3ESL A;  4U04 A;  3DPY A;  2RFM A;  4UWG A;  4B93 B;  2ILR A;  4CGV A;  4G24 A;  1HO8 A;  3SY2 A;  1EDU A;  3CHR A;  1BU9 A;  3Q9N C;  3UT4 A;  3ZYM A;  4LEU A;  3FUJ A;  3ULE G;  3FUL A;  1UG3 A;  3Q9U C;  3LPZ A;  2J07 A;  2UY1 A;  5KCM A;  2ZU6 B;  2OCC E;  2UWJ G;  2BTD A;  2KZT B;  4CT0 A;  5CEA A;  1KT1 A;  2H6F A;  4DLO A;  1UN9 A;  3CST A;  2XZD G;  2I2O A;  4UI9 C;  3DSV A;  3MKQ A;  5AJL A;  2VJ8 A;  3ZUV B;  1HX8 A;  4G26 A;  4G2V A;  4L2L A;  3QAR A;  4Q94 A;  4JPS A;  3AAA C;  5CHE E;  3UM0 A;  3P2B A;  3PDN A;  3DEP A;  5CCM A;  2BED A;  4BES A;  1QNF A;  2ETA A;  5CER B;  4G8K A;  3WXX A;  1IHB A;  3LDZ A;  3T8K A;  4JB8 P;  4FAD A;  4YDW A;  3ZIM A;  3F6Q A;  2FO1 E;  2WXF A;  3VTX A;  3C3Q A;  4L7T A;  2MYO A;  4BEP A;  5LP0 A;  1N4R A;  2V4L A;  4ANX A;  4C48 B;  3UPV A;  3LCA A;  4I2W A;  3UT7 A;  4HI9 A;  1IKN D;  3LJ3 A;  2WXR A;  4IUL A;  3SF4 A;  4Z68 A;  3PRZ A;  5T3R A;  3O4Z A;  1S0P A;  4AXH A;  2OEW A;  1E7V A;  5HRY A;  4ILI A;  2CG2 A;  2NXP A;  4KT6 B;  4BFR A;  3FWV A;  2PM7 A;  5EID A;  4G25 A;  2KCK A;  4ANW A;  3T9K A;  5G05 C;  3FTS A;  2X38 A;  4HNA D;  5JJ6 A;  3R9M A;  3ZFW A;  1JCQ A;  1Z3X A;  5HKP A;  4EHM A;  4BET A;  3BEE A;  4BT8 A;  3Q79 A;  2VYI A;  3NZS A;  4FU3 A;  1OCZ E;  3IV0 A;  4N3A A;  2VGX A;  2L0T B;  4ANV A;  2VSO E;  3FU6 A;  1H2T C;  4TXQ A;  1XNF A;  3DEO A;  3HXD A;  3PNL B;  3FU3 A;  3CSF A;  3JUE A;  5EYP F;  5ANR A;  4AEZ C;  4F7A A;  3L22 A;  3S7B A;  4AY6 A;  2RD0 A;  3PVL A;  3CVQ A;  3AJI A;  4GTV A;  2X6K A;  4DX5 D;  2MHK A;  4UQY A;  1L5J A;  5ITZ F;  4UQZ A;  2BKG A;  3SFX A;  4HS2 A;  1HE8 A;  3SBS A;  2WXN A;  3CHP A;  1WM5 A;  2V4H C;  4N5Q A;  4NAC A;  1HU3 A;  2ZIR A;  2GW1 A;  3FUK A;  2KAT A;  4RG9 A;  3LVR E;  3JUI A;  1O1S A;  1IHG A;  2WXH A;  4ABN A;  4E85 A;  4DI4 A;  2ETC A;  4EZJ A;  5A23 A;  4B0Z A;  2PQR A;  3ZGQ A;  4ANU A;  3DRA A;  3ENE A;  2Y1L E;  3RK6 A;  4YDO A;  4C0E A;  1FCH A;  3JXI A;  2Y69 E;  4GZ3 A;  3LEW A;  5KWD A;  1JCR A;  2IQC A;  3UTM A;  1U2V G;  3TWT A;  2P9I G;  3NF1 A;  4HRN A;  1UW4 B;  3APC A;  1YYH A;  4GZ5 A;  5B1B E;  3TG4 A;  3FY4 A;  3DST A;  2AW6 A;  5DBK A;  1KLX A;  3LKU A;  1EPU A;  3E37 A;  2P2C P;  1Z5S C;  3Q4A B;  1HG2 A;  3E32 A;  4PS8 A;  4HOT A;  5AIJ A;  1MYO A;  1HFA A;  1JCS A;  3FUE A;  3PZ2 A;  3APD A;  1QYM A;  3OAW A;  2EIN E;  3SQV A;  4U8H A;  3ONL A;  2V8S E;  4WWO A;  3TGO A;  3MYV A;  4MKT A;  3D9N A;  4DLQ A;  3C72 A;  3L16 A;  4CRW A;  4GTO A;  4K5A B;  5HS0 A;  4V3I A;  5FIN A;  1S70 B;  1OXJ A;  3NZU A;  5D2M C;  2QZA A;  4U07 A;  4HLE A;  4LCT A;  1E8X A;  4HVB A;  3BU8 A;  1NA3 A;  3C5R A;  3C98 A;  4L1B A;  3GZ1 A;  3G2S A;  4EBA A;  4F6R D;  3ASH A;  3IBE A;  2FO7 A;  4B8A A;  2WMO A;  2VSY A;  1S64 A;  5CCL A;  4YDY A;  3UUX A;  1O5M A;  2R59 A;  3GYZ A;  2IY0 C;  4BT9 A;  2V5Q C;  2CHZ A;  3D9O A;  1P5Q A;  2V0P A;  4HLL A;  3MV2 B;  5ENP D;  4N5C A;  2RG8 A;  4XIF A;  5G55 A;  3J5Q B;  2LXL A;  3L54 A;  3EIQ C;  5LOZ A;  3SO8 A;  4HRL A;  3HYM B;  3EU5 A;  1D9S A;  4KYO B;  3B7S A;  1MX4 A;  3FH5 A;  4WNG A;  2J4D A;  2R5S A;  3UIO C;  3TXN A;  5T4Y A;  3ABK E;  4GTM A;  4GTR A;  4FHK A;  5ARG A;  2VSN A;  1Y8M A;  3NOG D;  4PUC A;  3CKB A;  3D9P A;  4J8S A;  1RZ4 A;  4JVS A;  2GRN B;  3EHM A;  5AAO A;  2L0I A;  4GTQ A;  3G2W A;  2GRL A;  3CVW A;  4B8C B;  2FF4 A;  2ION A;  4MS6 A;  1NFI E;  3IKO B;  2AJA A;  4PS7 A;  3Q49 B;  4M3O A;  3RJV A;  1ELR A;  3TWW A;  4KZC A;  2PL2 A;  3PUK A;  2XPI A;  5EN5 D;  4FLB A;  2AXZ A;  3AG4 E;  4R7L A;  3ML8 A;  4CYM D;  4RLY A;  5ANL A;  3ASN E;  4ACL A;  2IO3 C;  4JHJ A;  2VGE A;  3ZW3 A;  2PQN A;  3LS8 A;  2C0L A;  2EQX A;  5G04 C;  2X6I A;  3NB2 A;  5BXO A;  3NQP A;  2X3M A;  2A5U A;  3FH8 A;  2HR2 A;  4AM9 A;  3B7T A;  4H7Y A;  3B7U X;  5AQ9 A;  5JHB A;  2WB2 A;  2WXM A;  4FUL A;  3LY9 A;  3BUA A;  2RFA A;  2V5F A;  4Q96 A;  2DBA A;  2WQ6 A;  3FTV A;  4WAF A;  3RO2 A;  4KBQ A;  1W3B A;  5AQB A;  2OV8 A;  3T8M A;  1N54 A;  3TJP A;  2PNN A;  4BER A;  3KEZ A;  3V2O A;  2H6H A;  3CK7 A;  4WNE A;  1OWM A;  3FUH A;  2AWI A;  4G23 A;  2FBN A;  4IN3 B;  1UOH A;  3QKY A;  1TNB A;  3PUJ A;  2KBX A;  5M72 A;  3TG5 A;  3EHQ A;  4JHR A;  4A1G A;  3ZPJ A;  1KT0 A;  3CHO A;  1H19 A;  4J8F A;  3SGH A;  4GCN A;  3J5P A;  4KVO A;  3CVU A;  1TNZ A;  5FZR A;  1QBQ A;  5KNG A;  4UWK A;  4EPZ A;  2FEZ A;  3FUN A;  3SD5 A;  1N11 A;  4KMO A;  2IO2 C;  1NL4 A;  3UQ3 A;  3RIB A;  1BPO A;  4I6J A;  3ISM C;  5AJD A;  4XKC A;  3U64 A;  3ASD A;  3U4T A;  4GAA A;  4DX6 D;  2ZGD A;  3UM1 A;  3S7F A;  2WXI A;  3B95 A;  2I1K A;  1KPS B;  4TV3 A;  3E34 A;  4GPK A;  4HRM B;  4WND A;  4K0R A;  3ZYK A;  1JPL A;  2IJG X;  1N0Q A;  5BV0 A;  3I5P A;  4GA1 A;  1K8K G;  1TNO A;  2LUH A;  4ATZ D;  3VLD A;  4GYY A;  4J0U A;  2QYJ A;  4FLH A;  1HXI A;  2DYS E;  2GRR B;  5CRU A;  1FVF A;  3HVE B;  2YHE A;  4I1O B;  3CHS A;  2C0M A;  2IF4 A;  3EHN A;  3QAQ A;  2F0Y A;  4IRU A;  4GTS A;  3GZS A;  4NRH B;  3RRM B;  1K1B A;  1DNP A;  3CQC B;  1N52 A;  4GYO A;  4JA9 A;  2DWZ A;  2I9C A;  3IHY A;  2VSX E;  1FVH A;  1U3D A;  1H6K A;  4OVU A;  1BI8 B;  1A17 A;  4APF A;  3AS5 A;  1ZBP A;  1H6O A;  1OCR E;  1DC2 A;  3SFZ A;  4CGW A;  4WWP A;  3EIJ A;  2VTB B;  2WPV A;  2DVW A;  4UQX A;  1RW2 A;  3D3M A;  4HOU A;  3CIA A;  2XEE A;  3ZRH A;  2GRP B;  3DXK G;  4X8Q A;  4LG6 A;  2MOW A;  3QNK A;  3CEQ A;  2WXO A;  4TXR A;  3SBT B;  3R9A B;  3V31 A;  3W9F A;  2KM4 A;  4WWN A;  2MRI A;  4L9P A;  2Y3A A;  3V2X A;  1E8Y A;  1WY6 A;  4BSZ B;  5H7P A;  5D0Q D;  2R05 A;  1MHQ A;  3SHF A;  2LO6 A;  4P29 A;  3OXG A;  1E96 B;  5AN8 A;  4MLP A;  3PZ3 A;  4K5B A;  4MBG A;  3MX3 A;  3HXF A;  1IQR A;  4I43 A;  5J90 A;  3HG0 D;  3DSU A;  1A5E A;  3ONK A;  3C3O A;  1ZU2 A;  4AV7 A;  4RSY A;  5CBO A;  5ARF A;  4XX5 A;  4BSX A;  3PZ1 A;  1H2U A;  1KZO A;  2P9K G;  2UY1 B;  4HXI A;  2L6B A;  1MX6 A;  4EZK A;  4MRU A;  3QWV A;  4N2Q A;  4WNF A;  1G3N B;  3G2T A;  4GU5 A;  1BI7 B;  4FJZ A;  5JJT A;  4B94 A;  1SA5 A;  1D8D A;  5FQ6 A;  2DZO A;  4TUU A;  1MQS A;  2WQ7 A;  4U0U A;  3FHE A;  1TR4 A;  1TJC A;  4GPM A;  4EBA G;  2QYU A;  3Q15 A;  3HXB A;  1AP7 A;  5CEC B;  4GMJ A;  2H6I A;  4U96 D;  3IEG A;  2GGF A;  2LSU A;  2P9N G;  5EKQ D;  1N9A A;  3UM3 A;  3KSQ A;  4JHK A;  5CED B;  3PNT B;  2LAH A;  2OOE A;  3QB2 A;  1QQE A;  2CHX A;  1PY1 A;  4J7W A;  4TUM A;  4URK A;  3HXE A;  1NI1 A;  5JMN D;  5C1D A;  2X6J A;  4PH4 B;  3L17 A;  5EIL A;  3SFY A;  5LFA A;  5E76 A;  3L9T A;  2FI7 A;  3IXE A;  3L13 A;  3LVQ E;  4TXP A;  3FP3 A;  4IYP A;  1ELK A;  4LSZ E;  3DPD A;  1KZP A;  4UI9 K;  4XI0 A;  3X2Q E;  3IHV A;  2J9Q A;  4UWH A;  3SNX A;  2DCP A;  1DCQ A;  3Q5M A;  3HHM A;  2KC7 A;  3ZNG A;  5HI7 A;  4UWL A;  4N2S A;  5BUZ A;  2WM9 A;  3KS2 A;  2Q7F A;  3P1U A;  2OND A;  2KCL A;  3E4B A;  4DI3 A;  3TAX A;  3MCX A;  2J49 A;  3CVP A;  1MZC A;  3NOC D;  1TYQ G;  1N4Q A;  1IXV A;  3QK0 A;  4ILH B;  1JWG A;  2R03 A;  4LNU D;  2J08 A;  4I6G A;  2VGX B;  3G2U A;  3R7Q A;  3R7R A;  2KCV A;  2YHC A;  3VLE A;  4I1A A;  3Q75 A;  3FTW A;  2ZGG A;  3FEX A;  5ENT D;  3UXG A;  4RG6 A;  5CRV A;  1E7U A;  5T8I A;  3TWS A;  4O1O A;  5FZQ A;  1ELW A;  2IOS A;  3AG1 E;  1DCE A;  3RRN B;  3LXU X;  3LYA A;  3OTN A;  1SW6 A;  4KVM A;  5BXU A;  3ZU7 B;  4GML A;  3PRE A;  2YQ8 A;  2WXJ A;  4YVO A;  3ZHE B;  3TWR A;  4Y6W A;  5E75 A;  4FC8 A;  3EUV A;  2XHE A;  3ML9 A;  3ULQ A;  4JZY A;  4OAV B;  3I4G A;  2OVB A;  3KEA A;  3E33 A;  2EIM E;  3EJN A;  1BLX B;  5FQ8 A;  5LCW J;  3ULY A;  5C2Y A;  2WXK A;  2F8X K;  4G1T A;  3CR3 A;  2EIL E;  3PE4 A;  3HRA A;  2KZT A;  3ZYQ A;  1MX2 A;  2X6F A;  4EQF A;  4CDM A;  1SVX A;  5JHA A;  3S2A A;  1QZ2 A;  1OCO E;  3I4R B;  3AU5 A;  5A6C A;  5CMW A;  1V54 E;  2RKK A;  3FFL A;  3SZ7 A; 
#chains in the Genus database with same CATH homology
 3V31 A;  2ETA A;  3EHR A;  3W9F A;  5CER B;  4G8K A;  3D9H A;  4ATZ D;  5CED B;  1D9S A;  4HBD A;  2F8Y A;  5AQB A;  4K5C A;  3ZKJ A;  1MX4 A;  2F37 A;  4DUI A;  1IHB A;  3JXJ A;  2DZN A;  2ZGG A;  5ENQ D;  2QYJ A;  5KNH D;  3T8K A;  3DEO A;  4JB8 P;  5ENT D;  4J7W A;  4TUM A;  3UXG A;  4YDW A;  1MJ0 A;  2P2C P;  2PNN A;  4HQD A;  3F6Q A;  3V2X A;  2FO1 E;  4BER A;  2XEH A;  3LJN A;  4QFV A;  3TWS A;  1AWC B;  3JUE A;  2J8S D;  4O1O A;  5ENO D;  1K1A A;  4G8L A;  1BD8 A;  5EYP F;  5JMN D;  3V2O A;  4BSZ B;  1WDY A;  2MYO A;  4BEP A;  1MYO A;  3NOG D;  5EIL A;  4C48 B;  5EIB E;  2JAB A;  1SW6 A;  1UOH A;  3TWX A;  5BXU A;  1QYM A;  3IXE A;  5AAO A;  5AAR A;  5AN8 A;  3ZU7 B;  4DX1 A;  3AJI A;  4HI9 A;  1IKN D;  2KXP C;  4CZ2 D;  4K5B A;  4DX5 D;  2KBX A;  2BKK B;  4DX7 D;  2HE0 A;  5ITZ F;  2RFM A;  3EHQ A;  5ENS D;  4O60 A;  4Z68 A;  4B93 B;  2BKG A;  3HG0 D;  1A5E A;  3TWR A;  4U8V D;  4LSZ E;  1NFI E;  2V4H C;  2AJA A;  4N5Q A;  3EU9 A;  5CBO A;  1K1B A;  5HRY A;  5EYL A;  5JA4 D;  4K5A B;  4QQI A;  5FIO A;  5HS0 A;  1BU9 A;  5FIN A;  1S70 B;  3J5P A;  4HI8 A;  1OT8 A;  3Q9N C;  4OAV B;  2ETB A;  3TWQ A;  3TWW A;  5AQA A;  3KEA A;  4O1P A;  5KNG A;  1DCQ A;  4U95 D;  5EID A;  5EN5 D;  4U8Y D;  3TWU A;  4DX2 A;  3UI2 A;  2XEN A;  4UUC A;  1WG0 A;  1BLX B;  2L6B A;  1MX6 A;  3C5R A;  2DWZ A;  3TWV A;  1N11 A;  4F6R D;  3V30 A;  4CYM D;  4RLY A;  3Q9U C;  3T9K A;  4OAU C;  3V79 K;  4GMR A;  3ZNG A;  2ETC A;  2A5E A;  1G3N B;  1N0R A;  1OY3 D;  4HNA D;  2F8X K;  2VGE A;  4BES A;  2B0O E;  4YDY A;  1BI7 B;  1BI8 B;  4ZFH A;  3W9G A;  2QC9 A;  2Y1L E;  4J8Y A;  3NBN B;  2V5Q C;  5BXO A;  5CEA A;  3JXI A;  3HRA A;  4F1P A;  5KBA A;  1DC2 A;  1MX2 A;  2DZO A;  2Y0B G;  4DX6 D;  5HKP A;  5KWD A;  1YMP A;  3NOC D;  2ZGD A;  4BET A;  4A63 B;  5AQ7 A;  4HLL A;  1TR4 A;  5CBN A;  1IXV A;  2XZD G;  4GPM A;  5ENP D;  3UTM A;  4HB5 A;  2DVW A;  1SVX A;  1K3Z D;  2XZT G;  3B95 A;  5ENR D;  1YCS B;  3J5Q B;  3B7B A;  5AQ9 A;  3ZUV B;  2NYJ A;  4LNU D;  5D66 A;  1AP7 A;  2XEE A;  4DRX E;  3AAA C;  4HRM B;  4NIK A;  5CEC B;  3TWT A;  4LG6 A;  4ZHB A;  3DEP A;  4HRN A;  3SO8 A;  2RFA A;  4HRL A;  1YYH A;  1N0Q A;  4U96 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...