4GMRA

Crystal structure of engineered protein. northeast structural genomics consortium target or266.
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
167
structure length
167
Chain Sequence
SELGKRLIEAAENGNKDRVKDLLENGADVNASDSDGKTPLHLAAENGHKEVVKLLLSQGADPNAKDSDGKTPLHLAAENGHKEVVKLLLSQGADPNAKDSDGKTPLHLAAENGHKEVVKLLLSQGADPNTSDSDGRTPLDLAREHGNEEVVKLLEKQGGWLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computational design of self-assembling cyclic protein homo-oligomers.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
molecule keywords OR266 DE NOVO PROTEIN
total genus 65
structure length 167
sequence length 167
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4gmrA00
4LG6A 1MX4A 2AJAA 4DUIA 4OAUC 4YDWA 4DX5D 3DEPA 4U96D 5EYLA 4LNUD 2ETAA 2RFAA 5AAOA 1NFIE 5FINA 2F8YA 1BI8B 5KWDA 2BKKB 1WG0A 2JABA 4F6RD 4BETA 2P2CP 1MX2A 1OY3D 5AQBA 5KNGA 3W9FA 4BSZB 1MJ0A 1K3ZD 2XENA 5ENRD 5AQ7A 4G8LA 3V30A 3UXGA 1OT8A 2QC9A 1SVXA 4U8VD 1IKND 5EN5D 5HS0A 1K1AA 1YMPA 4DRXE 5D66A 2ZGDA 4YDYA 2RFMA 1AWCB 3JUEA 2ETCA 4HRMB 4GPMA 2V5QC 4QFVA 5EILA 5HKPA 3TWVA 3TWUA 1BI7B 4G8KA 5ENTD 2F37A 4TUMA 1WDYA 4ZHBA 5KBAA 5BXOA 4O60A 3TWWA 5AQ9A 1BLXB 3UTMA 4HRNA 4HBDA 2MYOA 3B95A 3IXEA 4HI8A 4CYMD 5CBNA 1MX6A 5FIOA 3NOGD 4JB8P 2J8SD 2XEEA 4HNAD 3V31A 1BD8A 2L6BA 4K5BA 4LSZE 3KEAA 4C48B 4O1OA 4HQDA 2ZGGA 4DX2A 4DX6D 4ATZD 4OAVB 3AJIA 1D9SA 2BKGA 3B7BA 2A5EA 3V2OA 2VGEA 2Y1LE 4RLYA 1DC2A 5EYPF 5AQAA 3JXJA 3J5QB 3SO8A 3TWQA 5ENPD 1TR4A 2KBXA 3C5RA 3JXIA 5EIDA 4Z68A 4HI9A 4A63B 2F8XK 2QYJA 4U8YD 1AP7A 3TWSA 4HB5A 4GMRA 3LJNA 2XZTG 3Q9UC 4QQIA 1UOHA 2DVWA 5AN8A 1N11A 3ZNGA 1IXVA 3ZUVB 2FO1E 1BU9A 3NOCD 4ZFHA 1A5EA 2DZOA 5ENOD 1K1BA 3NBNB 3HRAA 4K5AB 2XZDG 2XEHA 3T9KA 2Y0BG 3D9HA 3W9GA 5BXUA 5KNHD 3AAAC 2NYJA 3V79K 2B0OE 3F6QA 5ITZF 5JMND 4HRLA 5ENQD 4BEPA 4BERA 1DCQA 1IHBA 1N0RA 2HE0A 5EIBE 4J8YA 3Q9NC 4N5QA 4UUCA 4CZ2D 1YYHA 3J5PA 2ETBA 3ZKJA 1S70B 4O1PA 1QYMA 3TWXA 3ZU7B 1N0QA 4F1PA 3TWTA 2KXPC 1MYOA 2DWZA 5AARA 5CEDB 3T8KA 3DEOA 5ENSD 4DX1A 1SW6A 2DZNA 4NIKA 4U95D 2PNNA 5HRYA 3EHRA 3V2XA 5JA4D 4DX7D 4K5CA 3TWRA 1YCSB 5CERB 4HLLA 4BESA 1G3NB 5CECB 3UI2A 5CBOA 2V4HC 4B93B 3EHQA 3EU9A 4J7WA 3HG0D 5CEAA
chains in the Genus database with same CATH superfamily
2H6FA 4GMJA 4G11A 3HVEB 3DRAA 4YDOA 1PAQA 1TNUA 4CDRA 1TNYA 3HIZA 4CDMA 2P9IG 1SZ9A 1SZAA 3DPYA 4K0RA 1YMPA 4DRXE 3L17A 4J8DA 1NP7A 4N2SA 1FVHA 3QWWA 2DBAA 3Q79A 3SFZA 5LOZA 1E8YA 3GZ1A 1HO8A 2IU1A 2KZTA 2WQHA 2X6HA 3IEGA 3LPZA 4I9EA 4ILHB 4G1TA 3ZHEB 3CEQA 4LCTA 4I1AA 4E85A 3FEXA 4DLQA 3AG4E 1PC2A 4BWRA 1IHGA 2J08A 5EX3A 2L6JA 1ZBPA 1HXIA 3ZFWA 2WXGA 3MEKA 3AS5A 2WXOA 4EQFA 4J8FA 1DCQA 2WQ7A 3UT8A 1UJJA 4CZ2D 3SF4A 2ETBA 4LEUA 3JQ0A 3UMVA 3S7FA 2DWZA 3T8KA 4CT0A 5DIZA 4W9RA 3ZYKA 4ANWA 4A3TA 2XPYA 1SA5A 4FU3A 3CKBA 3P1UA 3SY2A 3DBSA 4NQ0A 3L82A 2WXQA 2XGOA 5AAOA 4L7TA 4F6RD 4YNDA 3MYVA 1W3BA 3AG2E 1JWGA 3EIJA 3I4GA 4U07A 5D66A 3ZN3A 2V5QC 1H6OA 4U04A 2I2OA 3FTWA 4ZHBA 5CMYA 4J6IA 4HRNA 2MYOA 3AU5A 3BUAA 5D0QD 3DPDA 3D9IA 4P29A 3HXBA 3MZLB 4U63A 4BX8A 4DX6D 3TWQA 1EYHA 4ANVA 4RQIA 3SI5A 3DSXA 3CHMA 2OVBA 3CVNA 1BU9A 3FHEA 4BY6A 1E8ZA 3G2TA 1NI1A 1OUVA 2V8SE 4L1BA 1H2UA 1NA3A 5C1DA 3D9HA 3BG0B 4GA1A 1WY6A 2HE0A 2H6HA 1B89A 1HX8A 3ULEG 3LXUX 1OWLA 2AW6A 3TWXA 2M63A 3RSEG 4GAAA 3VTXA 1N4QA 2NXPA 3UI2A 2PZIA 1P5QA 4XZ4A 2CG3A 3HXDA 1Q2ZA 3LVQE 5FINA 2RD0A 4GYOA 2P58C 1HFAA 4GPKA 3W9FA 1H19A 5G2NA 2QC9A 1SVXA 3C3RA 2R2LA 3S7DA 3SBSA 3LDZA 1U3CA 4FJZA 2X38A 2ZISA 3TWVA 2ZU6B 4TUMA 1HE8A 4L9PA 4GCNA 1MZCA 3B95A 4I6GA 3D9MA 4WWPA 3IHVA 3N71A 1KT1A 4HQDA 5CCLA 1D9SA 4GCOA 4RG9A 2IQCA 5A6CA 2VGEA 3PVLA 2GRPB 3FTSA 1HF8A 3PE3A 4UWFA 4ABNA 3ASGA 4LRZA 3BEEA 2OEWA 2FO1E 4DPRA 4MKTA 3TG4A 3DSWA 2WXHA 2JLBA 1N4SA 3EHMA 3LKUA 2IO3C 5ITZF 1N52A 3SGHA 3WG7E 4GU5A 3FH5A 1IHBA 2LSVA 5EIBE 4XKCA 3ZXPA 3ESLA 3J5PA 5HI7A 5BNWA 1E8WA 5G05J 4JVSA 2R05A 4JEHA 4HFGA 1LTXA 5CHEE 2CHZA 2LXMA 2VGYA 4APOA 4J7WA 3TG5A 4B8AA 4BETA 3TJPA 3DXMG 2BUGA 4BSZB 3QOUA 1TN6A 4G8LA 1EPUA 3TAXA 1OT8A 2WVIA 3ASFA 1HG2A 4QFVA 4HLEA 4HI8A 4CYMD 4JHRA 4TRQA 3PZ4A 5EX0A 1XGWA 3CKCA 4GTRA 3MV3B 4LNGA 3CQGB 4RG6A 4U7EB 1UN9A 2KCKA 2BKGA 5J08A 3V2OA 3UT4A 3UPVA 1OCOE 4RLYA 5EYPF 1GW6A 4I17A 1QQEA 2YNQA 4A63B 2PM6A 2LSUA 3EU5A 3TWSA 4AP2A 3Q9UC 5FTPA 1N11A 3SHFA 2OVFA 3EDTB 2I1KA 4K5AB 5B1BE 2Y0BG 3FU3A 3RRUA 3CIAA 3ISMC 3ASHA 4FC8A 1E96B 3RK6A 3MJWA 3FWVA 2UWJG 3ZU7B 1MYOA 2DYSE 4AOFA 1NL4A 4GTTA 4NIKA 3UUXA 5HRYA 3V2XA 1UW4B 4TV3A 3FUIA 5LFAA 1YCSB 3HVEA 3KSLA 1HH8A 5G55A 4KBQA 2V4HC 3QWVA 4C0EA 1JUQA 3Q47B 5FZSA 4DX5D 4CRWA 3FUJA 1FVFA 3T8MA 2C0LA 4I43A 3CGHA 4DK5A 3GYZA 4A1GA 3UXGA 3NF1A 3T5VA 3HYMB 5M72A 3LY7A 3TL5A 5ARFA 4A3VA 4GZDA 5HKPA 2FI7A 3FTVA 2V5FA 3BQOA 3ZPJA 4UWHA 3CR3A 4HOTA 4BX9A 1MX6A 5FQ7A 2VTBA 3VLEA 1TJFA 3L22A 2KM4A 4K5BA 3CK7A 3PS6A 3JQ1A 4LSZE 4C48B 5FZQA 3Q15A 4ACKA 3ZHEA 2XS1A 3OAWA 3S7JA 3CK9A 2GROB 3E33A 4U0ZA 2KBXA 3CHOA 3JXIA 4ACLA 3L6AA 3FH8A 3NOCD 3SZ7A 4CCAA 3MA5A 3ONKA 3R7QA 1N4RA 2L9BA 3MKQA 4N3BA 2XZDG 4YDEA 5JJ7A 4I1OB 3UKUG 1O5MA 1BPOA 3F6QA 2NC9A 5CCMA 2V0PA 3Q9NC 3GZSA 4UQXA 5CRUA 1D8DA 4O1PA 4H7YA 1QBQA 4F1PA 3GZ2A 2VSNA 4UWKA 4DX1A 4U95D 2F0YA 2R03A 3D9OA 1G3NB 3CLJA 4TXRA 3PZDA 1U3DA 2ETAA 1E8XA 1BI8B 4LNBA 5C2YA 4JD2G 3PH0C 3L54A 3PZ2A 4BTBA 3APCA 3Q4AB 1FT2A 4JC8A 3RJVA 2OEVA 3RO3A 3MKRA 3CHRA 4GTMA 4PDXA 2F37A 3SFYA 3IXEA 2XHEA 4U8HA 3D9KA 3NOGD 5CRVA 5FQ8A 4UQZA 4K03A 4PUCA 1FT1A 2EIKE 5B1AE 4HORA 4IULA 4LERA 3PZ1A 2WPVA 2OCCE 2JEKA 3RRMB 4WUYA 1HG5A 4GMRA 2FBNA 4AEZC 3RIBA 4EHMA 3EHNA 1VDYA 5HQ8A 2WXPA 3W9GA 3QC1A 4FADA 4XKBA 2WB2A 1N0RA 5FQ4A 4N5QA 5KJMA 5B3SE 1EF1C 3Q7FA 4DLOA 1KLXA 1TNOA 3DEOA 5ENSD 3KEZA 2WXFA 5D0OD 1NA0A 4ATGA 2YQ8A 5G04C 1D8EA 4BFRA 3ABLE 2XENA 4HOUA 3FUKA 4GTSA 4U8VD 2YHCA 1JPLA 3FUMA 2WXRA 4GB9A 2QZAA 3APDA 3PDNA 1Y6IA 4G8KA 3IKOB 1TEZA 4PS7A 4JHJA 2XEEA 3SQVA 3LEWA 4M7CA 1V55E 1OWMA 2ZGGA 1ZB1A 3JYSA 2GRRB 3D9JA 2LAHA 4NACA 5EIDA 1JCRA 2F8XK 3Q5MA 5BW8C 1Y8MA 2Y3AA 2IY0C 4QQIA 3DSSA 1O1RA 4GTVA 2IOSA 2VJ8A 4JA9A 4GTPA 3B13A 5KNHD 3CHSA 3Q49B 4FHKA 3TXNA 2Y4TA 4M3OA 3FTYA 1QYMA 3UM3A 5AARA 3HXCA 1HU3A 4DX7D 5JJ6A 3ZEFA 3ONLA 4GZ6A 4K5CA 5CERB 2WMNA 4HLLA 1PY1A 5CECB 1H2VC 5H7PA 4Q94A 4B0ZA 4CDNA 2ILRA 2OOEA 3S7BA 3O4ZA 2F8YA 3UIOC 2BKKB 4H7XA 5AQBA 2J4DA 3CHPA 2HO1A 4WNFA 3IHYA 3CVUA 5ENNA 4FLHA 3BG1B 3HDXA 5EN5D 3ESKA 3ULYA 1N95A 3PUKA 4XI0A 5ENTD 1UG3A 2X6KA 1Z3YA 5LX8A 2WM9A 1UJKA 1DNPA 3ASDA 3FTXA 5FIOA 3CVQA 3V31A 2HR2A 3FUDA 4U0SA 2AWIA 3P2BA 4LUNU 4O1OA 3FH7A 4KVMA 4OAVB 2BEDA 2DYRE 2A5EA 2NSZA 3PRZA 2H6GA 3EIQC 3T5XA 2DCPA 4WWOA 3ZNGA 3ZIMA 1TNZA 3UQ3A 4L2YA 2KC7A 5AENA 4ZFHA 5KJLA 2IO2C 3OXLA 3MV2B 4GA0A 3C98A 3T9KA 4B8CB 3RAUA 3UKRG 2XQ0A 5JMND 2WXMA 2AVPA 3LY8A 1ELWA 1N4PA 3AS4A 3R9AB 1RZ4A 1TNBA 2ZXWE 5ANRA 1N0QA 1JCSA 3D9NA 2FULA 4MS6A 5KJKA 3ZGQA 3SD5A 3C3OA 1Z6TA 1SQMA 3U4TA 2CHWA 2WXKA 2WQ6A 3HG0D 4EZLA 4DUIA 4NURA 4EBAA 3OXFA 1UN8A 3DSTA 2HYZA 2RFAA 2LXLA 1OY3D 1MHQA 5KNGA 3RU0A 3V30A 4CT4A 1YA0A 3R7RA 3B7SA 2ZGDA 2RFMA 4PS3A 5KBAA 4AM9A 3ZYQA 4ANXA 1OCCE 1OCRE 1DCEA 5CBNA 3FEYA 4R7LA 1TN8A 2PL2A 3EJNA 3UM0A 4BT9A 2PQRA 2CG2A 5DBKA 3QJZA 2ONDA 4ATZD 2KZTB 2XS8A 1XNFA 3Q78A 4WAFA 5AQAA 3JXJA 3QKYA 2P9PG 2L0IA 3C5RA 3X2QE 3MX3A 3PEUB 3ASNE 2WXIA 2MOWA 3RRNB 1K1BA 3CSTA 4JA7A 5E75A 3GW4A 2NYJA 3V79K 4C0MA 2YHEA 1H6PA 2VQ2A 5T3RA 3TGOA 5T8IA 4ILGA 4KXKB 2FEZA 4HS2A 2BF0X 2PNNA 3FFLA 4KZCA 4BESA 4I1MA 2P9KG 4LG6A 4CGVA 4U96D 4F3VA 4XE0A 3CVVA 5G04J 5AJLA 5AYWD 4U0UA 3B7RL 3TXMA 3NAWA 1MJ0A 1LD7A 3PNTB 3DXKG 3HXEA 4IN3B 4JL0A 4GTOA 4AJWA 3CQCB 3ULQA 2I6HA 4HRMB 2OV8A 1BI7B 4I2ZA 4JPSA 1O1TA 4F53A 2XRZA 2V4LA 2XPIA 3VLFA 2PM7A 3I5PA 3KD7A 1IQUA 2H6IA 3LCAA 3KEAA 4G24A 3FUNA 4EECA 4Q69A 2J9QA 4Q96A 3QDNA 3J5QB 3U3WA 3I4RB 1OXJA 4WNGA 3C72A 5G05C 1WAO1 3URZA 4GA2A 3CVPA 3AG1E 3ZRHA 4F1SA 3L08A 3IV0A 4TUUA 2B0OE 4B89A 5ARGA 4BEPA 4KZ0A 2IF4A 1YYHA 4G26A 4Y6WA 4XI9A 4N3AA 5D2MC 1Z5SC 2KCVA 4D10C 1JCQA 1OWOA 2R5SA 4HVBA 1SW6A 4CEMA 2HM8A 2EIJE 4HOQA 4UI9K 3PE4A 3E4BA 4AY5A 3ABME 5IY5E 4YDWA 3FU0A 3E34A 3CK8A 5EKQD 4J8SA 1WG0A 3FTUA 3WXXA 1E7VA 4F7AA 1JWFA 3SFXA 3UT7A 3AS8A 4UWLA 4OYSA 2KCLA 5EILA 4G25A 3DWLG 4HXIA 5AQ9A 4HBDA 3ZXSA 3RO2A 2UY1A 3SBTB 1HS6A 2QFCA 5FZRA 3HXFA 4AXHA 4G23A 4X8QA 1RW2A 4N3CA 4TXPA 1DC2A 1TJCA 2R59A 3Q7AA 4N5CA 1FPPA 1KPSB 2KATA 3G2UA 2R02A 4OVVA 5T4YA 2XEHA 4FLBA 3OXGA 3ASOE 4DI4A 3E32A 5ENQD 3IBEA 3D9PA 1KZPA 4JEUA 4C9BB 1S70B 3TWTA 3LS8A 4XX5A 3FUEA 2DZNA 4TXQA 2CHXA 4KVOA 5BPPA 5A7DB 3RKVA 1N54A 2AJAA 2LUHA 3DEPA 3CVXA 4JXTA 2JABA 1MX2A 5ENRD 2X6IA 1OWNA 4ILIA 3CHQA 5HS0A 4L2LA 3JUEA 2ETCA 1OCZE 2P9UG 3D9LA 4IRUA 4O60A 4WNEA 2FF4A 1X81A 3LJ3A 3MCXA 3CV0A 1BD8A 4UWGA 5FJYA 1U2VG 1E7UA 3CSFA 5BUZA 2EILE 4O6FA 1O1SA 3VLDA 2B6CA 3LVRE 3Q73A 2XCBA 4N2QA 4EZJA 2QYJA 2VGXA 2E0IA 3FU5A 4RVBA 3LJNA 5BXOA 3MKQB 3ZUVB 5AN8A 4B94A 1A17A 5KJNA 2DZOA 2XGMA 4IYPA 2LAIA 5LCWJ 3B7UX 3L16A 2J07A 2YINA 3NQPA 2X6FA 3KS2A 2WXJA 5EDSA 2KXPC 4GMLA 2IJGX 5JHAA 5JA4D 3TWRA 4CGWA 5FQ6A 1TYQG 2GRLA 4GTQA 3R9MA 4YVQC 3UX4A 3EU9A 4Y6CA 1E90A 2LO6A 4OAUC 4YVOA 3FDHA 5KWDA 3CVYA 2P9SG 1K3ZD 5AQ7A 1SA4A 2UY1B 4PS8A 3KAEA 4I6JA 3G2SA 3ENEA 1IQRA 2IOLA 3UTMA 2XPZA 3L9TA 4KT6B 2J8SD 2GGFA 2RG8A 3QARA 4FJYA 3NB2A 3I3NA 1EDUA 5JHBA 1V54E 4APFA 3NZUA 3VTYA 3ZW3A 2C0MA 4MBGA 1A5EA 5ENOD 2VSYA 2IFUA 3U9WA 5BXUA 3AAAC 4ANUA 4HRLA 4UUCA 3QB2A 1NZNA 2XGSA 5CEDB 5FT9A 4I9CA 3G2VA 4DJAA 4V3IA 2VSXE 3QWPA 5LCWC 4RSYA 3APFA 2MRIA 4B93B 5CEAA 3LYAA 5EYLA 3NZSA 2L0TB 2DIWA 3Q75A 2P2CP 2EIME 2GW1A 5AIJA 2IEJA 3FULA 2AXUA 4JW1A 4FA6A 1QNFA 4FULA 1IKND 3U64A 1K1AA 2Q7FA 2GRQB 3PREA 3FY4A 1OWPA 4GPMA 1QZ2A 4AIFA 3B7TA 4J0UA 3G2WA 4ME2A 4JB8P 4HNAD 2VGXB 4I2WA 1N94A 1IYGA 1FCHA 1INZA 3D3MA 4GZ3A 4DX2A 1KT0A 1MQSA 3PUJA 2MHKA 5E76A 3UM2A 4DI3A 3EUVA 3S2AA 3U66A 4HI9A 3O48A 5FWQA 4U8YD 4HB5A 2XZTG 2XCCA 2C2LA 1LD8A 2XEVA 5BV1A 3UM1A 5BV0A 1H2TC 3DSVA 5A23A 2IONA 1H0AA 5JJTA 2WXNA 3UIPC 3L13A 4EZKA 2A5UA 2Y69E 2P9NG 5AJDA 2P9LG 4OVUA 4A55A 3FU6A 2EQXA 5CBOA 3EHQA 3E30A 2R17C 1WM5A 3FP3A 1NFIE 3BU8A 4UI9C 5BT1A 3SNXA 2LNIA 4XEIG 3JUIA 3OTNA 3JCKC 4NRHB 4EBAG 3QAQA 2X3MA 4YDYA 1AWCB 4EPZA 3PEVB 4I6EA 1WDYA 3FUFA 4GZ5A 3ZYLA 4AV7A 3PNLB 2AXZA 2L6BA 4GZCA 2WXLA 4FHJA 1ELKA 1DVPA 1X5BA 5J90A 3B7BA 2Y1LE 4WWNA 4GYWA 4Z68A 1TR4A 1L5JA 1AP7A 3CVWA 2DVWA 3ML9A 3NBNB 2QYUA 5KCMA 1S64A 4AVXA 4BERA 2GRNB 2GRMA 1H6KA 1S63A 1TN7A 2J09A 3AG3E 3QK0A 3EHRA 2VTBB 3AU4A 3C3QA 5LP0A 3QNKA 1KZOA 3ABKE 3E37A 4KYOB 3FUHA 1MX4A 3ZVVA 2J4BA 4LNUD 5CMWA 3UINC 1HZ4A 5ANLA 2X6JA 4N39A 4HOSA 3KSQA 2FO7A 3FTZA 4FP7A 2A4ZA 3ML8A 1S0PA 2Y4UA 3TWUA 4AY6A 4MRUA 2VSOE 2E2EA 3TWWA 1BLXB 3LY9A 2I1JA 2I9CA 4UQYA 3ZYMA 3DSUA 2PQNA 3PZ3A 4WNDA 2AXVA 3AJIA 1Z3XA 3CVLA 3HHMA 4URKA 3SO8A 4MLPA 5ENPD 2CFUA 1UOHA 1IXVA 1ELRA 2WMOA 4L23A 4UI9J 4G2VA 2QY7A 2VYIA 3HRAA 4PH4B 3K9IA 1K8KG 4JZYA 4KMOA 2XRYA 2CFZA 2ZIRA 3MGBA 4E6HA 2EINE 4J8EA 4J8YA 1N9AA 2RKKA 3ZKJA 4GYYA 1LF8A 4JHKA 4BSXA 2BTDA 1ZU2A 4BT8A 4XIFA 2J49A 4A1SA 4BTAA
chains in the Genus database with same CATH topology
4LG6A 1MX4A 2AJAA 4DUIA 4OAUC 4YDWA 4DX5D 3DEPA 4U96D 5EYLA 4LNUD 2ETAA 2RFAA 5AAOA 1NFIE 5FINA 2F8YA 1BI8B 5KWDA 2BKKB 1WG0A 2JABA 4F6RD 4BETA 2P2CP 1MX2A 1OY3D 5AQBA 5KNGA 3W9FA 4BSZB 1MJ0A 1K3ZD 2XENA 5ENRD 5AQ7A 4G8LA 3V30A 3UXGA 1OT8A 2QC9A 1SVXA 4U8VD 1IKND 5EN5D 5HS0A 1K1AA 1YMPA 4DRXE 5D66A 2ZGDA 4YDYA 2RFMA 1AWCB 3JUEA 2ETCA 4HRMB 4GPMA 2V5QC 4QFVA 5EILA 5HKPA 3TWVA 3TWUA 1BI7B 4G8KA 5ENTD 2F37A 4TUMA 1WDYA 4ZHBA 5KBAA 5BXOA 4O60A 3TWWA 5AQ9A 1BLXB 3UTMA 4HRNA 4HBDA 2MYOA 3B95A 3IXEA 4HI8A 4CYMD 5CBNA 1MX6A 5FIOA 3NOGD 4JB8P 2J8SD 2XEEA 4HNAD 3V31A 1BD8A 2L6BA 4K5BA 4LSZE 3KEAA 4C48B 4O1OA 4HQDA 2ZGGA 4DX2A 4DX6D 4ATZD 4OAVB 3AJIA 1D9SA 2BKGA 3B7BA 2A5EA 3V2OA 2VGEA 2Y1LE 4RLYA 1DC2A 5EYPF 5AQAA 3JXJA 3J5QB 3SO8A 3TWQA 5ENPD 1TR4A 2KBXA 3C5RA 3JXIA 5EIDA 4Z68A 4HI9A 4A63B 2F8XK 2QYJA 4U8YD 1AP7A 3TWSA 4HB5A 4GMRA 3LJNA 2XZTG 3Q9UC 4QQIA 1UOHA 2DVWA 5AN8A 1N11A 3ZNGA 1IXVA 3ZUVB 2FO1E 1BU9A 3NOCD 4ZFHA 1A5EA 2DZOA 5ENOD 1K1BA 3NBNB 3HRAA 4K5AB 2XZDG 2XEHA 3T9KA 2Y0BG 3D9HA 3W9GA 5BXUA 5KNHD 3AAAC 2NYJA 3V79K 2B0OE 3F6QA 5ITZF 5JMND 4HRLA 5ENQD 4BEPA 4BERA 1DCQA 1IHBA 1N0RA 2HE0A 5EIBE 4J8YA 3Q9NC 4N5QA 4UUCA 4CZ2D 1YYHA 3J5PA 2ETBA 3ZKJA 1S70B 4O1PA 1QYMA 3TWXA 3ZU7B 1N0QA 4F1PA 3TWTA 2KXPC 1MYOA 2DWZA 5AARA 5CEDB 3T8KA 3DEOA 5ENSD 4DX1A 1SW6A 2DZNA 4NIKA 4U95D 2PNNA 5HRYA 3EHRA 3V2XA 5JA4D 4DX7D 4K5CA 3TWRA 1YCSB 5CERB 4HLLA 4BESA 1G3NB 5CECB 3UI2A 5CBOA 2V4HC 4B93B 3EHQA 3EU9A 4J7WA 3HG0D 5CEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LG6 A;  1MX4 A;  2AJA A;  4DUI A;  4OAU C;  4YDW A;  4DX5 D;  3DEP A;  4U96 D;  5EYL A;  4LNU D;  2ETA A;  2RFA A;  5AAO A;  1NFI E;  5FIN A;  2F8Y A;  1BI8 B;  5KWD A;  2BKK B;  1WG0 A;  2JAB A;  4F6R D;  4BET A;  2P2C P;  1MX2 A;  1OY3 D;  5AQB A;  5KNG A;  3W9F A;  4BSZ B;  1MJ0 A;  1K3Z D;  2XEN A;  5ENR D;  5AQ7 A;  4G8L A;  3V30 A;  3UXG A;  1OT8 A;  2QC9 A;  1SVX A;  4U8V D;  1IKN D;  5EN5 D;  5HS0 A;  1K1A A;  1YMP A;  4DRX E;  5D66 A;  2ZGD A;  4YDY A;  2RFM A;  1AWC B;  3JUE A;  2ETC A;  4HRM B;  4GPM A;  2V5Q C;  4QFV A;  5EIL A;  5HKP A;  3TWV A;  3TWU A;  1BI7 B;  4G8K A;  5ENT D;  2F37 A;  4TUM A;  1WDY A;  4ZHB A;  5KBA A;  5BXO A;  4O60 A;  3TWW A;  5AQ9 A;  1BLX B;  3UTM A;  4HRN A;  4HBD A;  2MYO A;  3B95 A;  3IXE A;  4HI8 A;  4CYM D;  5CBN A;  1MX6 A;  5FIO A;  3NOG D;  4JB8 P;  2J8S D;  2XEE A;  4HNA D;  3V31 A;  1BD8 A;  2L6B A;  4K5B A;  4LSZ E;  3KEA A;  4C48 B;  4O1O A;  4HQD A;  2ZGG A;  4DX2 A;  4DX6 D;  4ATZ D;  4OAV B;  3AJI A;  1D9S A;  2BKG A;  3B7B A;  2A5E A;  3V2O A;  2VGE A;  2Y1L E;  4RLY A;  1DC2 A;  5EYP F;  5AQA A;  3JXJ A;  3J5Q B;  3SO8 A;  3TWQ A;  5ENP D;  1TR4 A;  2KBX A;  3C5R A;  3JXI A;  5EID A;  4Z68 A;  4HI9 A;  4A63 B;  2F8X K;  2QYJ A;  4U8Y D;  1AP7 A;  3TWS A;  4HB5 A;  4GMR A;  3LJN A;  2XZT G;  3Q9U C;  4QQI A;  1UOH A;  2DVW A;  5AN8 A;  1N11 A;  3ZNG A;  1IXV A;  3ZUV B;  2FO1 E;  1BU9 A;  3NOC D;  4ZFH A;  1A5E A;  2DZO A;  5ENO D;  1K1B A;  3NBN B;  3HRA A;  4K5A B;  2XZD G;  2XEH A;  3T9K A;  2Y0B G;  3D9H A;  3W9G A;  5BXU A;  5KNH D;  3AAA C;  2NYJ A;  3V79 K;  2B0O E;  3F6Q A;  5ITZ F;  5JMN D;  4HRL A;  5ENQ D;  4BEP A;  4BER A;  1DCQ A;  1IHB A;  1N0R A;  2HE0 A;  5EIB E;  4J8Y A;  3Q9N C;  4N5Q A;  4UUC A;  4CZ2 D;  1YYH A;  3J5P A;  2ETB A;  3ZKJ A;  1S70 B;  4O1P A;  1QYM A;  3TWX A;  3ZU7 B;  1N0Q A;  4F1P A;  3TWT A;  2KXP C;  1MYO A;  2DWZ A;  5AAR A;  5CED B;  3T8K A;  3DEO A;  5ENS D;  4DX1 A;  1SW6 A;  2DZN A;  4NIK A;  4U95 D;  2PNN A;  5HRY A;  3EHR A;  3V2X A;  5JA4 D;  4DX7 D;  4K5C A;  3TWR A;  1YCS B;  5CER B;  4HLL A;  4BES A;  1G3N B;  5CEC B;  3UI2 A;  5CBO A;  2V4H C;  4B93 B;  3EHQ A;  3EU9 A;  4J7W A;  3HG0 D;  5CEA A; 
#chains in the Genus database with same CATH topology
 2H6F A;  4GMJ A;  4G11 A;  3HVE B;  3DRA A;  4YDO A;  1PAQ A;  1TNU A;  4CDR A;  1TNY A;  3HIZ A;  4CDM A;  2P9I G;  1SZ9 A;  1SZA A;  3DPY A;  4K0R A;  1YMP A;  4DRX E;  3L17 A;  4J8D A;  1NP7 A;  4N2S A;  1FVH A;  3QWW A;  2DBA A;  3Q79 A;  3SFZ A;  5LOZ A;  1E8Y A;  3GZ1 A;  1HO8 A;  2IU1 A;  2KZT A;  2WQH A;  2X6H A;  3IEG A;  3LPZ A;  4I9E A;  4ILH B;  4G1T A;  3ZHE B;  3CEQ A;  4LCT A;  4I1A A;  4E85 A;  3FEX A;  4DLQ A;  3AG4 E;  1PC2 A;  4BWR A;  1IHG A;  2J08 A;  5EX3 A;  2L6J A;  1ZBP A;  1HXI A;  3ZFW A;  2WXG A;  3MEK A;  3AS5 A;  2WXO A;  4EQF A;  4J8F A;  1DCQ A;  2WQ7 A;  3UT8 A;  1UJJ A;  4CZ2 D;  3SF4 A;  2ETB A;  4LEU A;  3JQ0 A;  3UMV A;  3S7F A;  2DWZ A;  3T8K A;  4CT0 A;  5DIZ A;  4W9R A;  3ZYK A;  4ANW A;  4A3T A;  2XPY A;  1SA5 A;  4FU3 A;  3CKB A;  3P1U A;  3SY2 A;  3DBS A;  4NQ0 A;  3L82 A;  2WXQ A;  2XGO A;  5AAO A;  4L7T A;  4F6R D;  4YND A;  3MYV A;  1W3B A;  3AG2 E;  1JWG A;  3EIJ A;  3I4G A;  4U07 A;  5D66 A;  3ZN3 A;  2V5Q C;  1H6O A;  4U04 A;  2I2O A;  3FTW A;  4ZHB A;  5CMY A;  4J6I A;  4HRN A;  2MYO A;  3AU5 A;  3BUA A;  5D0Q D;  3DPD A;  3D9I A;  4P29 A;  3HXB A;  3MZL B;  4U63 A;  4BX8 A;  4DX6 D;  3TWQ A;  1EYH A;  4ANV A;  4RQI A;  3SI5 A;  3DSX A;  3CHM A;  2OVB A;  3CVN A;  1BU9 A;  3FHE A;  4BY6 A;  1E8Z A;  3G2T A;  1NI1 A;  1OUV A;  2V8S E;  4L1B A;  1H2U A;  1NA3 A;  5C1D A;  3D9H A;  3BG0 B;  4GA1 A;  1WY6 A;  2HE0 A;  2H6H A;  1B89 A;  1HX8 A;  3ULE G;  3LXU X;  1OWL A;  2AW6 A;  3TWX A;  2M63 A;  3RSE G;  4GAA A;  3VTX A;  1N4Q A;  2NXP A;  3UI2 A;  2PZI A;  1P5Q A;  4XZ4 A;  2CG3 A;  3HXD A;  1Q2Z A;  3LVQ E;  5FIN A;  2RD0 A;  4GYO A;  2P58 C;  1HFA A;  4GPK A;  3W9F A;  1H19 A;  5G2N A;  2QC9 A;  1SVX A;  3C3R A;  2R2L A;  3S7D A;  3SBS A;  3LDZ A;  1U3C A;  4FJZ A;  2X38 A;  2ZIS A;  3TWV A;  2ZU6 B;  4TUM A;  1HE8 A;  4L9P A;  4GCN A;  1MZC A;  3B95 A;  4I6G A;  3D9M A;  4WWP A;  3IHV A;  3N71 A;  1KT1 A;  4HQD A;  5CCL A;  1D9S A;  4GCO A;  4RG9 A;  2IQC A;  5A6C A;  2VGE A;  3PVL A;  2GRP B;  3FTS A;  1HF8 A;  3PE3 A;  4UWF A;  4ABN A;  3ASG A;  4LRZ A;  3BEE A;  2OEW A;  2FO1 E;  4DPR A;  4MKT A;  3TG4 A;  3DSW A;  2WXH A;  2JLB A;  1N4S A;  3EHM A;  3LKU A;  2IO3 C;  5ITZ F;  1N52 A;  3SGH A;  3WG7 E;  4GU5 A;  3FH5 A;  1IHB A;  2LSV A;  5EIB E;  4XKC A;  3ZXP A;  3ESL A;  3J5P A;  5HI7 A;  5BNW A;  1E8W A;  5G05 J;  4JVS A;  2R05 A;  4JEH A;  4HFG A;  1LTX A;  5CHE E;  2CHZ A;  2LXM A;  2VGY A;  4APO A;  4J7W A;  3TG5 A;  4B8A A;  4BET A;  3TJP A;  3DXM G;  2BUG A;  4BSZ B;  3QOU A;  1TN6 A;  4G8L A;  1EPU A;  3TAX A;  1OT8 A;  2WVI A;  3ASF A;  1HG2 A;  4QFV A;  4HLE A;  4HI8 A;  4CYM D;  4JHR A;  4TRQ A;  3PZ4 A;  5EX0 A;  1XGW A;  3CKC A;  4GTR A;  3MV3 B;  4LNG A;  3CQG B;  4RG6 A;  4U7E B;  1UN9 A;  2KCK A;  2BKG A;  5J08 A;  3V2O A;  3UT4 A;  3UPV A;  1OCO E;  4RLY A;  5EYP F;  1GW6 A;  4I17 A;  1QQE A;  2YNQ A;  4A63 B;  2PM6 A;  2LSU A;  3EU5 A;  3TWS A;  4AP2 A;  3Q9U C;  5FTP A;  1N11 A;  3SHF A;  2OVF A;  3EDT B;  2I1K A;  4K5A B;  5B1B E;  2Y0B G;  3FU3 A;  3RRU A;  3CIA A;  3ISM C;  3ASH A;  4FC8 A;  1E96 B;  3RK6 A;  3MJW A;  3FWV A;  2UWJ G;  3ZU7 B;  1MYO A;  2DYS E;  4AOF A;  1NL4 A;  4GTT A;  4NIK A;  3UUX A;  5HRY A;  3V2X A;  1UW4 B;  4TV3 A;  3FUI A;  5LFA A;  1YCS B;  3HVE A;  3KSL A;  1HH8 A;  5G55 A;  4KBQ A;  2V4H C;  3QWV A;  4C0E A;  1JUQ A;  3Q47 B;  5FZS A;  4DX5 D;  4CRW A;  3FUJ A;  1FVF A;  3T8M A;  2C0L A;  4I43 A;  3CGH A;  4DK5 A;  3GYZ A;  4A1G A;  3UXG A;  3NF1 A;  3T5V A;  3HYM B;  5M72 A;  3LY7 A;  3TL5 A;  5ARF A;  4A3V A;  4GZD A;  5HKP A;  2FI7 A;  3FTV A;  2V5F A;  3BQO A;  3ZPJ A;  4UWH A;  3CR3 A;  4HOT A;  4BX9 A;  1MX6 A;  5FQ7 A;  2VTB A;  3VLE A;  1TJF A;  3L22 A;  2KM4 A;  4K5B A;  3CK7 A;  3PS6 A;  3JQ1 A;  4LSZ E;  4C48 B;  5FZQ A;  3Q15 A;  4ACK A;  3ZHE A;  2XS1 A;  3OAW A;  3S7J A;  3CK9 A;  2GRO B;  3E33 A;  4U0Z A;  2KBX A;  3CHO A;  3JXI A;  4ACL A;  3L6A A;  3FH8 A;  3NOC D;  3SZ7 A;  4CCA A;  3MA5 A;  3ONK A;  3R7Q A;  1N4R A;  2L9B A;  3MKQ A;  4N3B A;  2XZD G;  4YDE A;  5JJ7 A;  4I1O B;  3UKU G;  1O5M A;  1BPO A;  3F6Q A;  2NC9 A;  5CCM A;  2V0P A;  3Q9N C;  3GZS A;  4UQX A;  5CRU A;  1D8D A;  4O1P A;  4H7Y A;  1QBQ A;  4F1P A;  3GZ2 A;  2VSN A;  4UWK A;  4DX1 A;  4U95 D;  2F0Y A;  2R03 A;  3D9O A;  1G3N B;  3CLJ A;  4TXR A;  3PZD A;  1U3D A;  2ETA A;  1E8X A;  1BI8 B;  4LNB A;  5C2Y A;  4JD2 G;  3PH0 C;  3L54 A;  3PZ2 A;  4BTB A;  3APC A;  3Q4A B;  1FT2 A;  4JC8 A;  3RJV A;  2OEV A;  3RO3 A;  3MKR A;  3CHR A;  4GTM A;  4PDX A;  2F37 A;  3SFY A;  3IXE A;  2XHE A;  4U8H A;  3D9K A;  3NOG D;  5CRV A;  5FQ8 A;  4UQZ A;  4K03 A;  4PUC A;  1FT1 A;  2EIK E;  5B1A E;  4HOR A;  4IUL A;  4LER A;  3PZ1 A;  2WPV A;  2OCC E;  2JEK A;  3RRM B;  4WUY A;  1HG5 A;  4GMR A;  2FBN A;  4AEZ C;  3RIB A;  4EHM A;  3EHN A;  1VDY A;  5HQ8 A;  2WXP A;  3W9G A;  3QC1 A;  4FAD A;  4XKB A;  2WB2 A;  1N0R A;  5FQ4 A;  4N5Q A;  5KJM A;  5B3S E;  1EF1 C;  3Q7F A;  4DLO A;  1KLX A;  1TNO A;  3DEO A;  5ENS D;  3KEZ A;  2WXF A;  5D0O D;  1NA0 A;  4ATG A;  2YQ8 A;  5G04 C;  1D8E A;  4BFR A;  3ABL E;  2XEN A;  4HOU A;  3FUK A;  4GTS A;  4U8V D;  2YHC A;  1JPL A;  3FUM A;  2WXR A;  4GB9 A;  2QZA A;  3APD A;  3PDN A;  1Y6I A;  4G8K A;  3IKO B;  1TEZ A;  4PS7 A;  4JHJ A;  2XEE A;  3SQV A;  3LEW A;  4M7C A;  1V55 E;  1OWM A;  2ZGG A;  1ZB1 A;  3JYS A;  2GRR B;  3D9J A;  2LAH A;  4NAC A;  5EID A;  1JCR A;  2F8X K;  3Q5M A;  5BW8 C;  1Y8M A;  2Y3A A;  2IY0 C;  4QQI A;  3DSS A;  1O1R A;  4GTV A;  2IOS A;  2VJ8 A;  4JA9 A;  4GTP A;  3B13 A;  5KNH D;  3CHS A;  3Q49 B;  4FHK A;  3TXN A;  2Y4T A;  4M3O A;  3FTY A;  1QYM A;  3UM3 A;  5AAR A;  3HXC A;  1HU3 A;  4DX7 D;  5JJ6 A;  3ZEF A;  3ONL A;  4GZ6 A;  4K5C A;  5CER B;  2WMN A;  4HLL A;  1PY1 A;  5CEC B;  1H2V C;  5H7P A;  4Q94 A;  4B0Z A;  4CDN A;  2ILR A;  2OOE A;  3S7B A;  3O4Z A;  2F8Y A;  3UIO C;  2BKK B;  4H7X A;  5AQB A;  2J4D A;  3CHP A;  2HO1 A;  4WNF A;  3IHY A;  3CVU A;  5ENN A;  4FLH A;  3BG1 B;  3HDX A;  5EN5 D;  3ESK A;  3ULY A;  1N95 A;  3PUK A;  4XI0 A;  5ENT D;  1UG3 A;  2X6K A;  1Z3Y A;  5LX8 A;  2WM9 A;  1UJK A;  1DNP A;  3ASD A;  3FTX A;  5FIO A;  3CVQ A;  3V31 A;  2HR2 A;  3FUD A;  4U0S A;  2AWI A;  3P2B A;  4LUN U;  4O1O A;  3FH7 A;  4KVM A;  4OAV B;  2BED A;  2DYR E;  2A5E A;  2NSZ A;  3PRZ A;  2H6G A;  3EIQ C;  3T5X A;  2DCP A;  4WWO A;  3ZNG A;  3ZIM A;  1TNZ A;  3UQ3 A;  4L2Y A;  2KC7 A;  5AEN A;  4ZFH A;  5KJL A;  2IO2 C;  3OXL A;  3MV2 B;  4GA0 A;  3C98 A;  3T9K A;  4B8C B;  3RAU A;  3UKR G;  2XQ0 A;  5JMN D;  2WXM A;  2AVP A;  3LY8 A;  1ELW A;  1N4P A;  3AS4 A;  3R9A B;  1RZ4 A;  1TNB A;  2ZXW E;  5ANR A;  1N0Q A;  1JCS A;  3D9N A;  2FUL A;  4MS6 A;  5KJK A;  3ZGQ A;  3SD5 A;  3C3O A;  1Z6T A;  1SQM A;  3U4T A;  2CHW A;  2WXK A;  2WQ6 A;  3HG0 D;  4EZL A;  4DUI A;  4NUR A;  4EBA A;  3OXF A;  1UN8 A;  3DST A;  2HYZ A;  2RFA A;  2LXL A;  1OY3 D;  1MHQ A;  5KNG A;  3RU0 A;  3V30 A;  4CT4 A;  1YA0 A;  3R7R A;  3B7S A;  2ZGD A;  2RFM A;  4PS3 A;  5KBA A;  4AM9 A;  3ZYQ A;  4ANX A;  1OCC E;  1OCR E;  1DCE A;  5CBN A;  3FEY A;  4R7L A;  1TN8 A;  2PL2 A;  3EJN A;  3UM0 A;  4BT9 A;  2PQR A;  2CG2 A;  5DBK A;  3QJZ A;  2OND A;  4ATZ D;  2KZT B;  2XS8 A;  1XNF A;  3Q78 A;  4WAF A;  5AQA A;  3JXJ A;  3QKY A;  2P9P G;  2L0I A;  3C5R A;  3X2Q E;  3MX3 A;  3PEU B;  3ASN E;  2WXI A;  2MOW A;  3RRN B;  1K1B A;  3CST A;  4JA7 A;  5E75 A;  3GW4 A;  2NYJ A;  3V79 K;  4C0M A;  2YHE A;  1H6P A;  2VQ2 A;  5T3R A;  3TGO A;  5T8I A;  4ILG A;  4KXK B;  2FEZ A;  4HS2 A;  2BF0 X;  2PNN A;  3FFL A;  4KZC A;  4BES A;  4I1M A;  2P9K G;  4LG6 A;  4CGV A;  4U96 D;  4F3V A;  4XE0 A;  3CVV A;  5G04 J;  5AJL A;  5AYW D;  4U0U A;  3B7R L;  3TXM A;  3NAW A;  1MJ0 A;  1LD7 A;  3PNT B;  3DXK G;  3HXE A;  4IN3 B;  4JL0 A;  4GTO A;  4AJW A;  3CQC B;  3ULQ A;  2I6H A;  4HRM B;  2OV8 A;  1BI7 B;  4I2Z A;  4JPS A;  1O1T A;  4F53 A;  2XRZ A;  2V4L A;  2XPI A;  3VLF A;  2PM7 A;  3I5P A;  3KD7 A;  1IQU A;  2H6I A;  3LCA A;  3KEA A;  4G24 A;  3FUN A;  4EEC A;  4Q69 A;  2J9Q A;  4Q96 A;  3QDN A;  3J5Q B;  3U3W A;  3I4R B;  1OXJ A;  4WNG A;  3C72 A;  5G05 C;  1WAO 1;  3URZ A;  4GA2 A;  3CVP A;  3AG1 E;  3ZRH A;  4F1S A;  3L08 A;  3IV0 A;  4TUU A;  2B0O E;  4B89 A;  5ARG A;  4BEP A;  4KZ0 A;  2IF4 A;  1YYH A;  4G26 A;  4Y6W A;  4XI9 A;  4N3A A;  5D2M C;  1Z5S C;  2KCV A;  4D10 C;  1JCQ A;  1OWO A;  2R5S A;  4HVB A;  1SW6 A;  4CEM A;  2HM8 A;  2EIJ E;  4HOQ A;  4UI9 K;  3PE4 A;  3E4B A;  4AY5 A;  3ABM E;  5IY5 E;  4YDW A;  3FU0 A;  3E34 A;  3CK8 A;  5EKQ D;  4J8S A;  1WG0 A;  3FTU A;  3WXX A;  1E7V A;  4F7A A;  1JWF A;  3SFX A;  3UT7 A;  3AS8 A;  4UWL A;  4OYS A;  2KCL A;  5EIL A;  4G25 A;  3DWL G;  4HXI A;  5AQ9 A;  4HBD A;  3ZXS A;  3RO2 A;  2UY1 A;  3SBT B;  1HS6 A;  2QFC A;  5FZR A;  3HXF A;  4AXH A;  4G23 A;  4X8Q A;  1RW2 A;  4N3C A;  4TXP A;  1DC2 A;  1TJC A;  2R59 A;  3Q7A A;  4N5C A;  1FPP A;  1KPS B;  2KAT A;  3G2U A;  2R02 A;  4OVV A;  5T4Y A;  2XEH A;  4FLB A;  3OXG A;  3ASO E;  4DI4 A;  3E32 A;  5ENQ D;  3IBE A;  3D9P A;  1KZP A;  4JEU A;  4C9B B;  1S70 B;  3TWT A;  3LS8 A;  4XX5 A;  3FUE A;  2DZN A;  4TXQ A;  2CHX A;  4KVO A;  5BPP A;  5A7D B;  3RKV A;  1N54 A;  2AJA A;  2LUH A;  3DEP A;  3CVX A;  4JXT A;  2JAB A;  1MX2 A;  5ENR D;  2X6I A;  1OWN A;  4ILI A;  3CHQ A;  5HS0 A;  4L2L A;  3JUE A;  2ETC A;  1OCZ E;  2P9U G;  3D9L A;  4IRU A;  4O60 A;  4WNE A;  2FF4 A;  1X81 A;  3LJ3 A;  3MCX A;  3CV0 A;  1BD8 A;  4UWG A;  5FJY A;  1U2V G;  1E7U A;  3CSF A;  5BUZ A;  2EIL E;  4O6F A;  1O1S A;  3VLD A;  2B6C A;  3LVR E;  3Q73 A;  2XCB A;  4N2Q A;  4EZJ A;  2QYJ A;  2VGX A;  2E0I A;  3FU5 A;  4RVB A;  3LJN A;  5BXO A;  3MKQ B;  3ZUV B;  5AN8 A;  4B94 A;  1A17 A;  5KJN A;  2DZO A;  2XGM A;  4IYP A;  2LAI A;  5LCW J;  3B7U X;  3L16 A;  2J07 A;  2YIN A;  3NQP A;  2X6F A;  3KS2 A;  2WXJ A;  5EDS A;  2KXP C;  4GML A;  2IJG X;  5JHA A;  5JA4 D;  3TWR A;  4CGW A;  5FQ6 A;  1TYQ G;  2GRL A;  4GTQ A;  3R9M A;  4YVQ C;  3UX4 A;  3EU9 A;  4Y6C A;  1E90 A;  2LO6 A;  4OAU C;  4YVO A;  3FDH A;  5KWD A;  3CVY A;  2P9S G;  1K3Z D;  5AQ7 A;  1SA4 A;  2UY1 B;  4PS8 A;  3KAE A;  4I6J A;  3G2S A;  3ENE A;  1IQR A;  2IOL A;  3UTM A;  2XPZ A;  3L9T A;  4KT6 B;  2J8S D;  2GGF A;  2RG8 A;  3QAR A;  4FJY A;  3NB2 A;  3I3N A;  1EDU A;  5JHB A;  1V54 E;  4APF A;  3NZU A;  3VTY A;  3ZW3 A;  2C0M A;  4MBG A;  1A5E A;  5ENO D;  2VSY A;  2IFU A;  3U9W A;  5BXU A;  3AAA C;  4ANU A;  4HRL A;  4UUC A;  3QB2 A;  1NZN A;  2XGS A;  5CED B;  5FT9 A;  4I9C A;  3G2V A;  4DJA A;  4V3I A;  2VSX E;  3QWP A;  5LCW C;  4RSY A;  3APF A;  2MRI A;  4B93 B;  5CEA A;  3LYA A;  5EYL A;  3NZS A;  2L0T B;  2DIW A;  3Q75 A;  2P2C P;  2EIM E;  2GW1 A;  5AIJ A;  2IEJ A;  3FUL A;  2AXU A;  4JW1 A;  4FA6 A;  1QNF A;  4FUL A;  1IKN D;  3U64 A;  1K1A A;  2Q7F A;  2GRQ B;  3PRE A;  3FY4 A;  1OWP A;  4GPM A;  1QZ2 A;  4AIF A;  3B7T A;  4J0U A;  3G2W A;  4ME2 A;  4JB8 P;  4HNA D;  2VGX B;  4I2W A;  1N94 A;  1IYG A;  1FCH A;  1INZ A;  3D3M A;  4GZ3 A;  4DX2 A;  1KT0 A;  1MQS A;  3PUJ A;  2MHK A;  5E76 A;  3UM2 A;  4DI3 A;  3EUV A;  3S2A A;  3U66 A;  4HI9 A;  3O48 A;  5FWQ A;  4U8Y D;  4HB5 A;  2XZT G;  2XCC A;  2C2L A;  1LD8 A;  2XEV A;  5BV1 A;  3UM1 A;  5BV0 A;  1H2T C;  3DSV A;  5A23 A;  2ION A;  1H0A A;  5JJT A;  2WXN A;  3UIP C;  3L13 A;  4EZK A;  2A5U A;  2Y69 E;  2P9N G;  5AJD A;  2P9L G;  4OVU A;  4A55 A;  3FU6 A;  2EQX A;  5CBO A;  3EHQ A;  3E30 A;  2R17 C;  1WM5 A;  3FP3 A;  1NFI E;  3BU8 A;  4UI9 C;  5BT1 A;  3SNX A;  2LNI A;  4XEI G;  3JUI A;  3OTN A;  3JCK C;  4NRH B;  4EBA G;  3QAQ A;  2X3M A;  4YDY A;  1AWC B;  4EPZ A;  3PEV B;  4I6E A;  1WDY A;  3FUF A;  4GZ5 A;  3ZYL A;  4AV7 A;  3PNL B;  2AXZ A;  2L6B A;  4GZC A;  2WXL A;  4FHJ A;  1ELK A;  1DVP A;  1X5B A;  5J90 A;  3B7B A;  2Y1L E;  4WWN A;  4GYW A;  4Z68 A;  1TR4 A;  1L5J A;  1AP7 A;  3CVW A;  2DVW A;  3ML9 A;  3NBN B;  2QYU A;  5KCM A;  1S64 A;  4AVX A;  4BER A;  2GRN B;  2GRM A;  1H6K A;  1S63 A;  1TN7 A;  2J09 A;  3AG3 E;  3QK0 A;  3EHR A;  2VTB B;  3AU4 A;  3C3Q A;  5LP0 A;  3QNK A;  1KZO A;  3ABK E;  3E37 A;  4KYO B;  3FUH A;  1MX4 A;  3ZVV A;  2J4B A;  4LNU D;  5CMW A;  3UIN C;  1HZ4 A;  5ANL A;  2X6J A;  4N39 A;  4HOS A;  3KSQ A;  2FO7 A;  3FTZ A;  4FP7 A;  2A4Z A;  3ML8 A;  1S0P A;  2Y4U A;  3TWU A;  4AY6 A;  4MRU A;  2VSO E;  2E2E A;  3TWW A;  1BLX B;  3LY9 A;  2I1J A;  2I9C A;  4UQY A;  3ZYM A;  3DSU A;  2PQN A;  3PZ3 A;  4WND A;  2AXV A;  3AJI A;  1Z3X A;  3CVL A;  3HHM A;  4URK A;  3SO8 A;  4MLP A;  5ENP D;  2CFU A;  1UOH A;  1IXV A;  1ELR A;  2WMO A;  4L23 A;  4UI9 J;  4G2V A;  2QY7 A;  2VYI A;  3HRA A;  4PH4 B;  3K9I A;  1K8K G;  4JZY A;  4KMO A;  2XRY A;  2CFZ A;  2ZIR A;  3MGB A;  4E6H A;  2EIN E;  4J8E A;  4J8Y A;  1N9A A;  2RKK A;  3ZKJ A;  4GYY A;  1LF8 A;  4JHK A;  4BSX A;  2BTD A;  1ZU2 A;  4BT8 A;  4XIF A;  2J49 A;  4A1S A;  4BTA A; 
#chains in the Genus database with same CATH homology
 4LG6 A;  1MX4 A;  2AJA A;  4DUI A;  4OAU C;  4YDW A;  4DX5 D;  3DEP A;  4U96 D;  5EYL A;  4LNU D;  2ETA A;  2RFA A;  5AAO A;  1NFI E;  5FIN A;  2F8Y A;  1BI8 B;  5KWD A;  2BKK B;  1WG0 A;  2JAB A;  4F6R D;  4BET A;  2P2C P;  1MX2 A;  1OY3 D;  5AQB A;  5KNG A;  3W9F A;  4BSZ B;  1MJ0 A;  1K3Z D;  2XEN A;  5ENR D;  5AQ7 A;  4G8L A;  3V30 A;  3UXG A;  1OT8 A;  2QC9 A;  1SVX A;  4U8V D;  1IKN D;  5EN5 D;  5HS0 A;  1K1A A;  1YMP A;  4DRX E;  5D66 A;  2ZGD A;  4YDY A;  2RFM A;  1AWC B;  3JUE A;  2ETC A;  4HRM B;  4GPM A;  2V5Q C;  4QFV A;  5EIL A;  5HKP A;  3TWV A;  3TWU A;  1BI7 B;  4G8K A;  5ENT D;  2F37 A;  4TUM A;  1WDY A;  4ZHB A;  5KBA A;  5BXO A;  4O60 A;  3TWW A;  5AQ9 A;  1BLX B;  3UTM A;  4HRN A;  4HBD A;  2MYO A;  3B95 A;  3IXE A;  4HI8 A;  4CYM D;  5CBN A;  1MX6 A;  5FIO A;  3NOG D;  4JB8 P;  2J8S D;  2XEE A;  4HNA D;  3V31 A;  1BD8 A;  2L6B A;  4K5B A;  4LSZ E;  3KEA A;  4C48 B;  4O1O A;  4HQD A;  2ZGG A;  4DX2 A;  4DX6 D;  4ATZ D;  4OAV B;  3AJI A;  1D9S A;  2BKG A;  3B7B A;  2A5E A;  3V2O A;  2VGE A;  2Y1L E;  4RLY A;  1DC2 A;  5EYP F;  5AQA A;  3JXJ A;  3J5Q B;  3SO8 A;  3TWQ A;  5ENP D;  1TR4 A;  2KBX A;  3C5R A;  3JXI A;  5EID A;  4Z68 A;  4HI9 A;  4A63 B;  2F8X K;  2QYJ A;  4U8Y D;  1AP7 A;  3TWS A;  4HB5 A;  4GMR A;  3LJN A;  2XZT G;  3Q9U C;  4QQI A;  1UOH A;  2DVW A;  5AN8 A;  1N11 A;  3ZNG A;  1IXV A;  3ZUV B;  2FO1 E;  1BU9 A;  3NOC D;  4ZFH A;  1A5E A;  2DZO A;  5ENO D;  1K1B A;  3NBN B;  3HRA A;  4K5A B;  2XZD G;  2XEH A;  3T9K A;  2Y0B G;  3D9H A;  3W9G A;  5BXU A;  5KNH D;  3AAA C;  2NYJ A;  3V79 K;  2B0O E;  3F6Q A;  5ITZ F;  5JMN D;  4HRL A;  5ENQ D;  4BEP A;  4BER A;  1DCQ A;  1IHB A;  1N0R A;  2HE0 A;  5EIB E;  4J8Y A;  3Q9N C;  4N5Q A;  4UUC A;  4CZ2 D;  1YYH A;  3J5P A;  2ETB A;  3ZKJ A;  1S70 B;  4O1P A;  1QYM A;  3TWX A;  3ZU7 B;  1N0Q A;  4F1P A;  3TWT A;  2KXP C;  1MYO A;  2DWZ A;  5AAR A;  5CED B;  3T8K A;  3DEO A;  5ENS D;  4DX1 A;  1SW6 A;  2DZN A;  4NIK A;  4U95 D;  2PNN A;  5HRY A;  3EHR A;  3V2X A;  5JA4 D;  4DX7 D;  4K5C A;  3TWR A;  1YCS B;  5CER B;  4HLL A;  4BES A;  1G3N B;  5CEC B;  3UI2 A;  5CBO A;  2V4H C;  4B93 B;  3EHQ A;  3EU9 A;  4J7W A;  3HG0 D;  5CEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...