4TXPA

Crystal structure of lip5 n-terminal domain
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
156
structure length
156
Chain Sequence
b'ALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar protein sorting-associated protein VTA1 homolog
publication title A Novel Mechanism of Regulating the ATPase VPS4 by Its Cofactor LIP5 and the Endosomal Sorting Complex Required for Transport (ESCRT)-III Protein CHMP5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 63
structure length 156
sequence length 156
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04652 Vta1 Vta1 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.270 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Vacuolar protein sorting-associated protein vta1 4txpA00
2LXLA 2RKKA 4TXPA 4U7EB 4TXQA 2LUHA 4TXRA 5H7PA 2LXMA
chains in the Genus database with same CATH superfamily
4G11A 2IONA 4DX5D 2WXJA 3P2BA 2QC9A 3FU6A 3CHOA 4AM9A 1OWMA 4FJYA 3APCA 4UWGA 3ENEA 4H7YA 3PVLA 4TXRA 2NXPA 3PREA 1YCSB 3UTMA 3VTXA 1IHGA 1HU3A 2QY7A 1OXJA 1HG5A 1N54A 2ZIRA 3ZXPA 1O5MA 3IHYA 1Y8MA 2X6JA 1UOHA 1H2VC 2XGSA 2Y3AA 3E32A 1H6OA 3PH0C 4K5CA 3APFA 1TYQG 3BU8A 1WY6A 1K8KG 3JXJA 3SY2A 3AJIA 2RD0A 4WNEA 3MZLB 4F3VA 4BFRA 3JQ0A 5CBOA 3UINC 3ESLA 3IV0A 4BSZB 1OUVA 3L82A 5JA4D 2WXMA 3CK9A 4F53A 3GZSA 3V79K 3BUAA 1HFAA 1ELWA 4GMRA 3ZGQA 3U3WA 3RRNB 4EPZA 5AAOA 2VSXE 2J49A 3CVVA 5CCLA 1UN9A 2LNIA 1Z6TA 2AVPA 5ENOD 5EDSA 3HIZA 5A23A 2GRQB 4YDOA 3CIAA 2QZAA 4GAAA 2PZIA 3IBEA 5CRVA 2V0PA 4GYYA 3UM1A 2BKGA 3NZSA 2FULA 2B0OE 1UN8A 3CSFA 3CVQA 2KXPC 4M7CA 4JPSA 3ZXSA 3T5XA 3IXEA 5A7DB 5FTPA 2X6FA 1AP7A 2EINE 4GZCA 3KEAA 5CEDB 4HRMB 2R5SA 5J90A 2H6IA 2PM6A 1FPPA 2I6HA 3EJNA 4DX6D 4U8HA 3L54A 3PNLB 4GB9A 2IY0C 4JL0A 2XS8A 3UT8A 4FLBA 3ZVVA 3IEGA 4GTTA 3CHPA 3B7BA 4XX5A 1ELRA 2NC9A 5G04C 5AARA 4APFA 3EDTB 2LSUA 1N4QA 2DVWA 4J7WA 3JYSA 4U0UA 3SQVA 4RSYA 1LD8A 1SVXA 2XPIA 4EBAG 2BEDA 2XRZA 4BSXA 4AP2A 2DCPA 3V31A 3QWPA 5DIZA 3T8MA 1WDYA 2RFMA 4CCAA 1N52A 3Q7AA 1WM5A 3RU0A 4EQFA 3ESKA 3CEQA 4HOUA 4HORA 2KATA 2KZTA 3LJ3A 5CMYA 5H7PA 4XEIG 5HRYA 4K03A 1TN7A 1EF1C 3SFXA 3MKQB 2J07A 4Y6CA 3FHEA 4G23A 1WG0A 3CSTA 4G26A 2VGXB 5FINA 5ENNA 3PS6A 3FULA 2VTBB 1KT1A 4GTMA 4L23A 4KT6B 4U0ZA 2GRRB 3FTYA 2HR2A 2IO2C 5G2NA 4QQIA 5M72A 2ILRA 4J8DA 3QWWA 4U07A 4FA6A 2BF0X 4LRZA 1Y6IA 1MZCA 5FWQA 3LPZA 4O60A 4I9CA 3RRMB 1PC2A 2Y1LE 2WXNA 3SGHA 1OCOE 3FEYA 3AG3E 5ARFA 1W3BA 4PH4B 1TNOA 1OCRE 3T8KA 3ZPJA 1IKND 5CMWA 2CHXA 5AQBA 2JEKA 4JA7A 3LY7A 3MV2B 1MHQA 2EIME 4N2QA 1N95A 3HHMA 3R7RA 4J8FA 2A5UA 2P9NG 3L6AA 1E90A 3R7QA 3U64A 2ZXWE 3LY8A 3TXMA 5BPPA 3MJWA 4JHRA 4ATZD 5G05C 4ILIA 4CT4A 2GRLA 4HRNA 1NZNA 4RG9A 4LCTA 3BG1B 5BW8C 1N0RA 2P9UG 4HQDA 4BESA 5KNGA 3S7FA 2WXQA 1FVFA 4YNDA 2AXUA 3HXFA 1OWLA 4HOQA 2XQ0A 3C5RA 3UIOC 4YVOA 3TGOA 2YHCA 3FU3A 2YHEA 4FP7A 3FY4A 4CEMA 5LCWC 3FTUA 4GTOA 4L7TA 2XEHA 2QYUA 5AIJA 4JZYA 4GZ6A 4GA1A 4DLQA 5FZSA 1UW4B 4UWLA 1DCQA 3EHQA 4WNGA 3DPYA 5AQAA 4B8CB 3TWTA 3L08A 4IYPA 3FUMA 3ZHEB 4ANVA 3KS2A 2PL2A 4GPMA 4DK5A 3L16A 3C98A 3NOGD 1OY3D 1P5QA 3WXXA 5BT1A 1MJ0A 4AIFA 2ETCA 3NQPA 3SI5A 3B13A 4NQ0A 2P58C 5EN5D 4B0ZA 2J08A 4GTRA 2RG8A 1JCQA 4XKCA 3KEZA 2FF4A 3PEUB 2WMOA 2WQHA 3FTXA 2ZGGA 4JHKA 3LKUA 2GW1A 4PUCA 4HI8A 2XGMA 3VTYA 3HVEB 3DBSA 3CVYA 1HH8A 2XENA 4I6JA 4XKBA 3V30A 2EILE 5BNWA 1SA4A 2F0YA 5G55A 2ETAA 4U95D 5ENQD 4W9RA 3C3RA 4WNDA 3HXDA 2WPVA 3HXBA 4LERA 2MHKA 5JJ7A 1IXVA 1UJJA 2OVBA 3QWVA 4WWNA 1U2VG 3DSSA 3CHRA 3OAWA 3I4RB 3EHMA 5CHEE 4RVBA 2P9LG 4O6FA 3C3QA 3HRAA 3E37A 3S7JA 1X5BA 3FP3A 3K9IA 3B95A 1OCZE 3W9FA 3MA5A 4FULA 3SNXA 3TWSA 3RSEG 3RAUA 3ONLA 1HO8A 3LDZA 1HE8A 1LTXA 2GRMA 4EZJA 4M3OA 3Q5MA 4QFVA 3VLEA 3AU4A 4GTVA 3O4ZA 3CR3A 4XI0A 1HG2A 1O1SA 3AS5A 1INZA 1S70B 4LNUD 5EYLA 3LY9A 4ME2A 4K5BA 4I43A 5CERB 4A63B 3Q9UC 3PUKA 2EIJE 3JQ1A 3UT7A 1N11A 4MBGA 4EHMA 4LG6A 3Q78A 3PUJA 4O1PA 2XHEA 3CGHA 1DC2A 2KCLA 3MV3B 4C48B 4N3BA 4UI9J 1ZBPA 3TWWA 1E96B 4ACKA 2VGXA 2LAIA 2R59A 2HYZA 3GZ2A 4JC8A 5LOZA 2ONDA 4DRXE 1Z3XA 2CHWA 2CG2A 3FTSA 3SFZA 2X38A 3UQ3A 2B6CA 1OWPA 4AXHA 2AJAA 3ZRHA 2J09A 1SZ9A 3URZA 3CVLA 2LSVA 3DEPA 2WXRA 2VGYA 2IQCA 1UG3A 1ZU2A 5KJKA 2V4LA 1H6PA 5JMND 4L1BA 4DJAA 3OXFA 2AXZA 5ANRA 3MGBA 3S7DA 5HKPA 3ONKA 1KZPA 2CFUA 4TRQA 5AQ7A 4CDMA 4PS3A 3UX4A 1IYGA 1KLXA 5FQ7A 2XZDG 3ZN3A 1BU9A 4E6HA 1U3DA 2A5EA 3I4GA 3U9WA 2V5FA 2H6FA 2H6GA 3FTVA 4GYOA 3I5PA 3I3NA 3RIBA 4GPKA 2DYSE 2MRIA 4J8EA 3B7RL 3P1UA 4G2VA 5KWDA 3ASOE 3MX3A 4HS2A 5BV0A 4LEUA 2Q7FA 3DSVA 2KC7A 1NFIE 2VSYA 2LXLA 4HOSA 3OXGA 2V8SE 1FT1A 5LFAA 4Q96A 4DI4A 3FU0A 5B3SE 3RKVA 3G2WA 4L9PA 3UPVA 2MOWA 4FADA 3B7UX 3UUXA 3Q49B 1LF8A 3NF1A 5FZQA 4G25A 5CCMA 2OEVA 4BX9A 2VYIA 4UQXA 2UY1A 3FUEA 2R03A 3CHQA 3TAXA 3MYVA 1PY1A 2L6BA 3Q75A 4Z68A 3FTZA 4GU5A 4JVSA 3UKUG 5KNHD 3B7SA 2R02A 3FUDA 3QAQA 2EQXA 1HX8A 3ZNGA 2WM9A 3E34A 1TN8A 4OVUA 2CHZA 3DXMG 4N5CA 1H6KA 1N9AA 3FFLA 2IEJA 2Y4UA 3KAEA 1SZAA 3LVQE 2LO6A 2OV8A 4U96D 4BTAA 1K1AA 3U4TA 3HDXA 4B8AA 2OCCE 3OTNA 4J8SA 4C0EA 3DRAA 4U7EB 4GCOA 3CK8A 3R9AB 3TG4A 3S2AA 4YDYA 5D66A 5FIOA 1E8WA 2M63A 5EILA 4I6EA 3PE3A 3QK0A 1OWNA 1QNFA 2LXMA 1XGWA 4HXIA 2UWJG 4GTQA 4CYMD 3SD5A 2QYJA 3CVWA 4JEUA 1DVPA 3HVEA 3Q47B 5EKQD 4GMLA 4KVMA 5EX3A 2IFUA 3RJVA 2H6HA 2V4HC 2OOEA 5CECB 2AXVA 3T9KA 3AS8A 1UJKA 2RFAA 3GYZA 2R17C 2IO3C 2KBXA 3ABLE 1OWOA 4K0RA 3F6QA 2X6KA 3V2XA 3CLJA 2YINA 5CBNA 2X6IA 4KZCA 3FH5A 3CVUA 4N3AA 3PZDA 5FJYA 5BV1A 2E0IA 5ANLA 4GCNA 4TUUA 1AWCB 5B1AE 1S63A 4HBDA 1SW6A 4NIKA 1U3CA 3V2OA 3C3OA 3DSWA 2DBAA 5ENSD 5EYPF 3EU5A 1JWGA 3L17A 2F8XK 3QNKA 3IHVA 1S64A 2ZGDA 3PE4A 5JJTA 2OEWA 3RO3A 3JUEA 4OAUC 4GTSA 4BTBA 5AN8A 5FZRA 2IOLA 2LAHA 3W9GA 1DNPA 3S7BA 1N0QA 3ZFWA 4MKTA 4I17A 1DCEA 3G2SA 4DPRA 2C0LA 3EIQC 5AENA 3JCKC 5C1DA 4EECA 2J4DA 3O48A 4IRUA 1A5EA 2HO1A 4HOTA 2PM7A 4MS6A 4ANUA 2XZTG 1HS6A 5AQ9A 4UWHA 3VLFA 3QJZA 3VLDA 2FEZA 3EHRA 1HZ4A 5B1BE 2F8YA 3BG0B 4U04A 2I9CA 2YQ8A 4F6RD 3AU5A 3ZYMA 3ML9A 4DUIA 4ATGA 1X81A 1NL4A 3NB2A 1QYMA 3DSXA 2P9SG 4LNGA 5ARGA 1E8YA 3FWVA 2PNNA 3DEOA 3ASHA 3LEWA 2ZISA 4CT0A 2DZOA 3RK6A 4GZDA 4UI9K 3FDHA 1S0PA 4YDWA 3QARA 5G04J 1Q2ZA 4JEHA 3CK7A 3D9KA 4EZLA 4J8YA 3L22A 4R7LA 3HXEA 3FEXA 2WMNA 3MEKA 5E76A 3PRZA 3BEEA 1D9SA 5CRUA 2XEVA 1JCSA 1TNYA 1TJCA 4N3CA 3Q9NC 2IU1A 5JHAA 1E8ZA 3DPDA 1ELKA 4U8YD 4OVVA 1JWFA 4CDRA 3N71A 5T3RA 4O1OA 4UUCA 5D0OD 4HNAD 5AJDA 2R05A 2AWIA 1OT8A 2JABA 4JD2G 5J08A 3EU9A 4TV3A 1H2UA 3TXNA 1YMPA 3ZIMA 4I1OB 2DZNA 1YA0A 3DXKG 2WXOA 1G3NB 1TJFA 1NP7A 1K3ZD 3LXUX 5FQ4A 2V5QC 3CV0A 5AYWD 4HRLA 5CEAA 5FQ6A 3SF4A 1O1RA 4KZ0A 4HLLA 4XI9A 1E7UA 3ZEFA 4N2SA 3TL5A 3R9MA 2GRPB 1H19A 4ACLA 2WXGA 1VDYA 4A1GA 1Z3YA 4DX7D 2P2CP 2I2OA 3ASNE 4WAFA 5EIDA 5T8IA 2XCCA 4LSZE 4U63A 4BETA 1QZ2A 5KJNA 1FT2A 4AOFA 3KD7A 2NYJA 3CVXA 1KPSB 4TUMA 4B89A 2WXHA 2VSOE 5A6CA 4BERA 3QDNA 3B7TA 2KCVA 4HFGA 2A4ZA 3MKQA 3D9HA 4AY6A 5KJLA 2L9BA 2IF4A 5KJMA 2WXIA 5JHBA 1BI7B 3D9PA 1RZ4A 5G05J 3L9TA 3PZ3A 3TJPA 4RQIA 4RLYA 5LP0A 2VTBA 4LNBA 3SZ7A 4HVBA 3QB2A 4TXQA 3DSTA 4N39A 4JW1A 3DWLG 1OCCE 1XNFA 4XZ4A 2VSNA 2GROB 2C0MA 5EX0A 4JB8P 5HQ8A 2XEEA 4GYWA 4CRWA 3JXIA 5LCWJ 3Q15A 4KXKB 1MQSA 3Q4AB 1D8DA 2I1JA 4A3TA 4KVOA 5AJLA 3SBTB 3UKRG 5BXUA 1O1TA 4KBQA 2R2LA 2HE0A 1EDUA 2P9IG 3NAWA 4C0MA 1NA0A 4I2ZA 1V55E 4WWOA 1D8EA 2X6HA 5HS0A 2QFCA 1Z5SC 1H0AA 3AG1E 3ASDA 3FUJA 5JJ6A 4BT9A 4HB5A 1JPLA 2XCBA 4KMOA 3ZKJA 4WNFA 1IHBA 1TNZA 3LCAA 3ZYLA 4A55A 1L5JA 3QC1A 3KSLA 2Y0BG 3J5PA 2I1KA 3E4BA 1N4SA 3ISMC 3NZUA 4K5AB 2FI7A 3UIPC 4H7XA 2WXPA 1BD8A 3TWXA 3CQGB 2VQ2A 2FO7A 2F37A 4ZHBA 4NRHB 3HXCA 3CHMA 4U0SA 4DI3A 4WWPA 4F7AA 4PS8A 5D2MC 3SBSA 3ULQA 3ASFA 3D3MA 3QKYA 4LUNU 5IY5E 3AG2E 4BX8A 3D9JA 3PZ4A 3UT4A 2KM4A 3G2UA 3J5QB 3CVNA 4ABNA 2GGFA 1PAQA 3ZHEA 4MLPA 4BT8A 1SQMA 4F1SA 4RG6A 1N94A 3FUIA 2YNQA 3LYAA 2Y69E 4J0UA 3OXLA 2XPYA 1QQEA 2BKKB 4BY6A 2CG3A 4CZ2D 2IOSA 4EBAA 2GRNB 1JCRA 3E33A 3UI2A 2FO1E 3FUKA 2WVIA 4A3VA 4U8VD 3UM2A 3ULYA 3ZYQA 4AY5A 3HYMB 2J9QA 3LS8A 4GA2A 4XE0A 1JUQA 4URKA 2VGEA 2XPZA 4IN3B 4UQZA 3TWRA 4AVXA 2MYOA 5LX8A 5KCMA 3LJNA 4GMJA 3ABME 3APDA 4JHJA 3HG0D 3RO2A 3ZYKA 4GA0A 1HXIA 3WG7E 2BTDA 3UXGA 4JA9A 4L2YA 2LUHA 3JUIA 4DX2A 1IQUA 3AAAC 3PZ1A 3AS4A 4GTPA 3GZ1A 1GW6A 4DLOA 1TNUA 4WUYA 3BQOA 1TN6A 2KCKA 1TEZA 4ILGA 4JXTA 2XRYA 1BPOA 5EIBE 3G2VA 1H2TC 5BXOA 3PDNA 4ANXA 3NBNB 3SO8A 3TWQA 4Q69A 3FU5A 2WB2A 3SHFA 1FVHA 3CKBA 3TWVA 2WXLA 4J6IA 2L0IA 5T4YA 5KBAA 1ZB1A 4YVQC 1B89A 3GW4A 2HM8A 5DBKA 4ZFHA 4NURA 3ASGA 2WXKA 4B93B 1SA5A 2DWZA 4V3IA 3C72A 4UI9C 4B94A 4GZ5A 1E7VA 3IKOB 2WQ6A 1MX2A 3FUFA 3D9IA 3CQCB 4IULA 4CDNA 2EIKE 4HI9A 4ILHB 2XS1A 4UWFA 3TWUA 4EZKA 5FT9A 2CFZA 1TR4A 4F1PA 3PEVB 4KYOB 3Q73A 1YYHA 2X3MA 3QOUA 4G8LA 1FCHA 3D9MA 3KSQA 2ZU6B 3FUHA 3MKRA 4FHKA 4FHJA 1BLXB 3D9LA 4C9BB 2UY1B 3EHNA 3PZ2A 5ENTD 4D10C 3T5VA 3UM0A 1EPUA 3D9OA 4Y6WA 4I6GA 3Q79A 4BEPA 3ZU7B 1IQRA 3FH8A 4G1TA 1MX6A 1N4PA 2P9KG 3MCXA 3LVRE 2L0TB 4L2LA 1HF8A 4CGVA 3CVPA 4G24A 4MRUA 1TNBA 4PS7A 2PQRA 1EYHA 5FQ8A 4AV7A 4BWRA 3ML8A 4N5QA 3EUVA 3NOCD 1RW2A 2Y4TA 4OYSA 4TXPA 4FU3A 3FTWA 2KZTB 1E8XA 3EIJA 1MYOA 4Q94A 4UQYA 4HLEA 1LD7A 2J4BA 4P29A 4NACA 3FH7A 3G2TA 3ZUVB 4XIFA 3FUNA 4AJWA 4CGWA 1BI8B 4A1SA 1V54E 3ABKE 4APOA 4I9EA 1MX4A 2WXFA 3CKCA 4E85A 4X8QA 1KT0A 4G8KA 5ENPD 3X2QE 3AG4E 4AEZC 5E75A 3SFYA 2RKKA 5BUZA 2IJGX 4OAVB 2NSZA 4FJZA 4ANWA 3CHSA 4I1MA 3TG5A 2E2EA 2DYRE 3Q7FA 5HI7A 4YDEA 4FLHA 1NI1A 5ITZF 4DX1A 3PNTB 3UMVA 4GZ3A 4UWKA 5ENRD 3RRUA 2L6JA 2VJ8A 1K1BA 4I1AA 4PDXA 2BUGA 2JLBA 5C2YA 2P9PG 2ETBA 2FBNA 5D0QD 2J8SD 3D9NA 2C2LA 4I2WA 3U66A 3L13A 1QBQA 3ULEG 1A17A 2DIWA 3DSUA 2XGOA 3E30A 2AW6A 2OVFA 3ZW3A 1NA3A 1WAO1 2PQNA 1N4RA 2WQ7A 4FC8A 3UM3A 1KZOA
chains in the Genus database with same CATH topology
2LXLA 2RKKA 4TXPA 4U7EB 4TXQA 2LUHA 4TXRA 5H7PA 2LXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LXL A;  2RKK A;  4TXP A;  4U7E B;  4TXQ A;  2LUH A;  4TXR A;  5H7P A;  2LXM A; 
#chains in the Genus database with same CATH topology
 4G11 A;  2ION A;  4DX5 D;  2WXJ A;  3P2B A;  2QC9 A;  3FU6 A;  3CHO A;  4AM9 A;  1OWM A;  4FJY A;  3APC A;  4UWG A;  3ENE A;  4H7Y A;  3PVL A;  4TXR A;  2NXP A;  3PRE A;  1YCS B;  3UTM A;  3VTX A;  1IHG A;  1HU3 A;  2QY7 A;  1OXJ A;  1HG5 A;  1N54 A;  2ZIR A;  3ZXP A;  1O5M A;  3IHY A;  1Y8M A;  2X6J A;  1UOH A;  1H2V C;  2XGS A;  2Y3A A;  3E32 A;  1H6O A;  3PH0 C;  4K5C A;  3APF A;  1TYQ G;  3BU8 A;  1WY6 A;  1K8K G;  3JXJ A;  3SY2 A;  3AJI A;  2RD0 A;  4WNE A;  3MZL B;  4F3V A;  4BFR A;  3JQ0 A;  5CBO A;  3UIN C;  3ESL A;  3IV0 A;  4BSZ B;  1OUV A;  3L82 A;  5JA4 D;  2WXM A;  3CK9 A;  4F53 A;  3GZS A;  3V79 K;  3BUA A;  1HFA A;  1ELW A;  4GMR A;  3ZGQ A;  3U3W A;  3RRN B;  4EPZ A;  5AAO A;  2VSX E;  2J49 A;  3CVV A;  5CCL A;  1UN9 A;  2LNI A;  1Z6T A;  2AVP A;  5ENO D;  5EDS A;  3HIZ A;  5A23 A;  2GRQ B;  4YDO A;  3CIA A;  2QZA A;  4GAA A;  2PZI A;  3IBE A;  5CRV A;  2V0P A;  4GYY A;  3UM1 A;  2BKG A;  3NZS A;  2FUL A;  2B0O E;  1UN8 A;  3CSF A;  3CVQ A;  2KXP C;  4M7C A;  4JPS A;  3ZXS A;  3T5X A;  3IXE A;  5A7D B;  5FTP A;  2X6F A;  1AP7 A;  2EIN E;  4GZC A;  3KEA A;  5CED B;  4HRM B;  2R5S A;  5J90 A;  2H6I A;  2PM6 A;  1FPP A;  2I6H A;  3EJN A;  4DX6 D;  4U8H A;  3L54 A;  3PNL B;  4GB9 A;  2IY0 C;  4JL0 A;  2XS8 A;  3UT8 A;  4FLB A;  3ZVV A;  3IEG A;  4GTT A;  3CHP A;  3B7B A;  4XX5 A;  1ELR A;  2NC9 A;  5G04 C;  5AAR A;  4APF A;  3EDT B;  2LSU A;  1N4Q A;  2DVW A;  4J7W A;  3JYS A;  4U0U A;  3SQV A;  4RSY A;  1LD8 A;  1SVX A;  2XPI A;  4EBA G;  2BED A;  2XRZ A;  4BSX A;  4AP2 A;  2DCP A;  3V31 A;  3QWP A;  5DIZ A;  3T8M A;  1WDY A;  2RFM A;  4CCA A;  1N52 A;  3Q7A A;  1WM5 A;  3RU0 A;  4EQF A;  3ESK A;  3CEQ A;  4HOU A;  4HOR A;  2KAT A;  2KZT A;  3LJ3 A;  5CMY A;  5H7P A;  4XEI G;  5HRY A;  4K03 A;  1TN7 A;  1EF1 C;  3SFX A;  3MKQ B;  2J07 A;  4Y6C A;  3FHE A;  4G23 A;  1WG0 A;  3CST A;  4G26 A;  2VGX B;  5FIN A;  5ENN A;  3PS6 A;  3FUL A;  2VTB B;  1KT1 A;  4GTM A;  4L23 A;  4KT6 B;  4U0Z A;  2GRR B;  3FTY A;  2HR2 A;  2IO2 C;  5G2N A;  4QQI A;  5M72 A;  2ILR A;  4J8D A;  3QWW A;  4U07 A;  4FA6 A;  2BF0 X;  4LRZ A;  1Y6I A;  1MZC A;  5FWQ A;  3LPZ A;  4O60 A;  4I9C A;  3RRM B;  1PC2 A;  2Y1L E;  2WXN A;  3SGH A;  1OCO E;  3FEY A;  3AG3 E;  5ARF A;  1W3B A;  4PH4 B;  1TNO A;  1OCR E;  3T8K A;  3ZPJ A;  1IKN D;  5CMW A;  2CHX A;  5AQB A;  2JEK A;  4JA7 A;  3LY7 A;  3MV2 B;  1MHQ A;  2EIM E;  4N2Q A;  1N95 A;  3HHM A;  3R7R A;  4J8F A;  2A5U A;  2P9N G;  3L6A A;  1E90 A;  3R7Q A;  3U64 A;  2ZXW E;  3LY8 A;  3TXM A;  5BPP A;  3MJW A;  4JHR A;  4ATZ D;  5G05 C;  4ILI A;  4CT4 A;  2GRL A;  4HRN A;  1NZN A;  4RG9 A;  4LCT A;  3BG1 B;  5BW8 C;  1N0R A;  2P9U G;  4HQD A;  4BES A;  5KNG A;  3S7F A;  2WXQ A;  1FVF A;  4YND A;  2AXU A;  3HXF A;  1OWL A;  4HOQ A;  2XQ0 A;  3C5R A;  3UIO C;  4YVO A;  3TGO A;  2YHC A;  3FU3 A;  2YHE A;  4FP7 A;  3FY4 A;  4CEM A;  5LCW C;  3FTU A;  4GTO A;  4L7T A;  2XEH A;  2QYU A;  5AIJ A;  4JZY A;  4GZ6 A;  4GA1 A;  4DLQ A;  5FZS A;  1UW4 B;  4UWL A;  1DCQ A;  3EHQ A;  4WNG A;  3DPY A;  5AQA A;  4B8C B;  3TWT A;  3L08 A;  4IYP A;  3FUM A;  3ZHE B;  4ANV A;  3KS2 A;  2PL2 A;  4GPM A;  4DK5 A;  3L16 A;  3C98 A;  3NOG D;  1OY3 D;  1P5Q A;  3WXX A;  5BT1 A;  1MJ0 A;  4AIF A;  2ETC A;  3NQP A;  3SI5 A;  3B13 A;  4NQ0 A;  2P58 C;  5EN5 D;  4B0Z A;  2J08 A;  4GTR A;  2RG8 A;  1JCQ A;  4XKC A;  3KEZ A;  2FF4 A;  3PEU B;  2WMO A;  2WQH A;  3FTX A;  2ZGG A;  4JHK A;  3LKU A;  2GW1 A;  4PUC A;  4HI8 A;  2XGM A;  3VTY A;  3HVE B;  3DBS A;  3CVY A;  1HH8 A;  2XEN A;  4I6J A;  4XKB A;  3V30 A;  2EIL E;  5BNW A;  1SA4 A;  2F0Y A;  5G55 A;  2ETA A;  4U95 D;  5ENQ D;  4W9R A;  3C3R A;  4WND A;  3HXD A;  2WPV A;  3HXB A;  4LER A;  2MHK A;  5JJ7 A;  1IXV A;  1UJJ A;  2OVB A;  3QWV A;  4WWN A;  1U2V G;  3DSS A;  3CHR A;  3OAW A;  3I4R B;  3EHM A;  5CHE E;  4RVB A;  2P9L G;  4O6F A;  3C3Q A;  3HRA A;  3E37 A;  3S7J A;  1X5B A;  3FP3 A;  3K9I A;  3B95 A;  1OCZ E;  3W9F A;  3MA5 A;  4FUL A;  3SNX A;  3TWS A;  3RSE G;  3RAU A;  3ONL A;  1HO8 A;  3LDZ A;  1HE8 A;  1LTX A;  2GRM A;  4EZJ A;  4M3O A;  3Q5M A;  4QFV A;  3VLE A;  3AU4 A;  4GTV A;  3O4Z A;  3CR3 A;  4XI0 A;  1HG2 A;  1O1S A;  3AS5 A;  1INZ A;  1S70 B;  4LNU D;  5EYL A;  3LY9 A;  4ME2 A;  4K5B A;  4I43 A;  5CER B;  4A63 B;  3Q9U C;  3PUK A;  2EIJ E;  3JQ1 A;  3UT7 A;  1N11 A;  4MBG A;  4EHM A;  4LG6 A;  3Q78 A;  3PUJ A;  4O1P A;  2XHE A;  3CGH A;  1DC2 A;  2KCL A;  3MV3 B;  4C48 B;  4N3B A;  4UI9 J;  1ZBP A;  3TWW A;  1E96 B;  4ACK A;  2VGX A;  2LAI A;  2R59 A;  2HYZ A;  3GZ2 A;  4JC8 A;  5LOZ A;  2OND A;  4DRX E;  1Z3X A;  2CHW A;  2CG2 A;  3FTS A;  3SFZ A;  2X38 A;  3UQ3 A;  2B6C A;  1OWP A;  4AXH A;  2AJA A;  3ZRH A;  2J09 A;  1SZ9 A;  3URZ A;  3CVL A;  2LSV A;  3DEP A;  2WXR A;  2VGY A;  2IQC A;  1UG3 A;  1ZU2 A;  5KJK A;  2V4L A;  1H6P A;  5JMN D;  4L1B A;  4DJA A;  3OXF A;  2AXZ A;  5ANR A;  3MGB A;  3S7D A;  5HKP A;  3ONK A;  1KZP A;  2CFU A;  4TRQ A;  5AQ7 A;  4CDM A;  4PS3 A;  3UX4 A;  1IYG A;  1KLX A;  5FQ7 A;  2XZD G;  3ZN3 A;  1BU9 A;  4E6H A;  1U3D A;  2A5E A;  3I4G A;  3U9W A;  2V5F A;  2H6F A;  2H6G A;  3FTV A;  4GYO A;  3I5P A;  3I3N A;  3RIB A;  4GPK A;  2DYS E;  2MRI A;  4J8E A;  3B7R L;  3P1U A;  4G2V A;  5KWD A;  3ASO E;  3MX3 A;  4HS2 A;  5BV0 A;  4LEU A;  2Q7F A;  3DSV A;  2KC7 A;  1NFI E;  2VSY A;  2LXL A;  4HOS A;  3OXG A;  2V8S E;  1FT1 A;  5LFA A;  4Q96 A;  4DI4 A;  3FU0 A;  5B3S E;  3RKV A;  3G2W A;  4L9P A;  3UPV A;  2MOW A;  4FAD A;  3B7U X;  3UUX A;  3Q49 B;  1LF8 A;  3NF1 A;  5FZQ A;  4G25 A;  5CCM A;  2OEV A;  4BX9 A;  2VYI A;  4UQX A;  2UY1 A;  3FUE A;  2R03 A;  3CHQ A;  3TAX A;  3MYV A;  1PY1 A;  2L6B A;  3Q75 A;  4Z68 A;  3FTZ A;  4GU5 A;  4JVS A;  3UKU G;  5KNH D;  3B7S A;  2R02 A;  3FUD A;  3QAQ A;  2EQX A;  1HX8 A;  3ZNG A;  2WM9 A;  3E34 A;  1TN8 A;  4OVU A;  2CHZ A;  3DXM G;  4N5C A;  1H6K A;  1N9A A;  3FFL A;  2IEJ A;  2Y4U A;  3KAE A;  1SZA A;  3LVQ E;  2LO6 A;  2OV8 A;  4U96 D;  4BTA A;  1K1A A;  3U4T A;  3HDX A;  4B8A A;  2OCC E;  3OTN A;  4J8S A;  4C0E A;  3DRA A;  4U7E B;  4GCO A;  3CK8 A;  3R9A B;  3TG4 A;  3S2A A;  4YDY A;  5D66 A;  5FIO A;  1E8W A;  2M63 A;  5EIL A;  4I6E A;  3PE3 A;  3QK0 A;  1OWN A;  1QNF A;  2LXM A;  1XGW A;  4HXI A;  2UWJ G;  4GTQ A;  4CYM D;  3SD5 A;  2QYJ A;  3CVW A;  4JEU A;  1DVP A;  3HVE A;  3Q47 B;  5EKQ D;  4GML A;  4KVM A;  5EX3 A;  2IFU A;  3RJV A;  2H6H A;  2V4H C;  2OOE A;  5CEC B;  2AXV A;  3T9K A;  3AS8 A;  1UJK A;  2RFA A;  3GYZ A;  2R17 C;  2IO3 C;  2KBX A;  3ABL E;  1OWO A;  4K0R A;  3F6Q A;  2X6K A;  3V2X A;  3CLJ A;  2YIN A;  5CBN A;  2X6I A;  4KZC A;  3FH5 A;  3CVU A;  4N3A A;  3PZD A;  5FJY A;  5BV1 A;  2E0I A;  5ANL A;  4GCN A;  4TUU A;  1AWC B;  5B1A E;  1S63 A;  4HBD A;  1SW6 A;  4NIK A;  1U3C A;  3V2O A;  3C3O A;  3DSW A;  2DBA A;  5ENS D;  5EYP F;  3EU5 A;  1JWG A;  3L17 A;  2F8X K;  3QNK A;  3IHV A;  1S64 A;  2ZGD A;  3PE4 A;  5JJT A;  2OEW A;  3RO3 A;  3JUE A;  4OAU C;  4GTS A;  4BTB A;  5AN8 A;  5FZR A;  2IOL A;  2LAH A;  3W9G A;  1DNP A;  3S7B A;  1N0Q A;  3ZFW A;  4MKT A;  4I17 A;  1DCE A;  3G2S A;  4DPR A;  2C0L A;  3EIQ C;  5AEN A;  3JCK C;  5C1D A;  4EEC A;  2J4D A;  3O48 A;  4IRU A;  1A5E A;  2HO1 A;  4HOT A;  2PM7 A;  4MS6 A;  4ANU A;  2XZT G;  1HS6 A;  5AQ9 A;  4UWH A;  3VLF A;  3QJZ A;  3VLD A;  2FEZ A;  3EHR A;  1HZ4 A;  5B1B E;  2F8Y A;  3BG0 B;  4U04 A;  2I9C A;  2YQ8 A;  4F6R D;  3AU5 A;  3ZYM A;  3ML9 A;  4DUI A;  4ATG A;  1X81 A;  1NL4 A;  3NB2 A;  1QYM A;  3DSX A;  2P9S G;  4LNG A;  5ARG A;  1E8Y A;  3FWV A;  2PNN A;  3DEO A;  3ASH A;  3LEW A;  2ZIS A;  4CT0 A;  2DZO A;  3RK6 A;  4GZD A;  4UI9 K;  3FDH A;  1S0P A;  4YDW A;  3QAR A;  5G04 J;  1Q2Z A;  4JEH A;  3CK7 A;  3D9K A;  4EZL A;  4J8Y A;  3L22 A;  4R7L A;  3HXE A;  3FEX A;  2WMN A;  3MEK A;  5E76 A;  3PRZ A;  3BEE A;  1D9S A;  5CRU A;  2XEV A;  1JCS A;  1TNY A;  1TJC A;  4N3C A;  3Q9N C;  2IU1 A;  5JHA A;  1E8Z A;  3DPD A;  1ELK A;  4U8Y D;  4OVV A;  1JWF A;  4CDR A;  3N71 A;  5T3R A;  4O1O A;  4UUC A;  5D0O D;  4HNA D;  5AJD A;  2R05 A;  2AWI A;  1OT8 A;  2JAB A;  4JD2 G;  5J08 A;  3EU9 A;  4TV3 A;  1H2U A;  3TXN A;  1YMP A;  3ZIM A;  4I1O B;  2DZN A;  1YA0 A;  3DXK G;  2WXO A;  1G3N B;  1TJF A;  1NP7 A;  1K3Z D;  3LXU X;  5FQ4 A;  2V5Q C;  3CV0 A;  5AYW D;  4HRL A;  5CEA A;  5FQ6 A;  3SF4 A;  1O1R A;  4KZ0 A;  4HLL A;  4XI9 A;  1E7U A;  3ZEF A;  4N2S A;  3TL5 A;  3R9M A;  2GRP B;  1H19 A;  4ACL A;  2WXG A;  1VDY A;  4A1G A;  1Z3Y A;  4DX7 D;  2P2C P;  2I2O A;  3ASN E;  4WAF A;  5EID A;  5T8I A;  2XCC A;  4LSZ E;  4U63 A;  4BET A;  1QZ2 A;  5KJN A;  1FT2 A;  4AOF A;  3KD7 A;  2NYJ A;  3CVX A;  1KPS B;  4TUM A;  4B89 A;  2WXH A;  2VSO E;  5A6C A;  4BER A;  3QDN A;  3B7T A;  2KCV A;  4HFG A;  2A4Z A;  3MKQ A;  3D9H A;  4AY6 A;  5KJL A;  2L9B A;  2IF4 A;  5KJM A;  2WXI A;  5JHB A;  1BI7 B;  3D9P A;  1RZ4 A;  5G05 J;  3L9T A;  3PZ3 A;  3TJP A;  4RQI A;  4RLY A;  5LP0 A;  2VTB A;  4LNB A;  3SZ7 A;  4HVB A;  3QB2 A;  4TXQ A;  3DST A;  4N39 A;  4JW1 A;  3DWL G;  1OCC E;  1XNF A;  4XZ4 A;  2VSN A;  2GRO B;  2C0M A;  5EX0 A;  4JB8 P;  5HQ8 A;  2XEE A;  4GYW A;  4CRW A;  3JXI A;  5LCW J;  3Q15 A;  4KXK B;  1MQS A;  3Q4A B;  1D8D A;  2I1J A;  4A3T A;  4KVO A;  5AJL A;  3SBT B;  3UKR G;  5BXU A;  1O1T A;  4KBQ A;  2R2L A;  2HE0 A;  1EDU A;  2P9I G;  3NAW A;  4C0M A;  1NA0 A;  4I2Z A;  1V55 E;  4WWO A;  1D8E A;  2X6H A;  5HS0 A;  2QFC A;  1Z5S C;  1H0A A;  3AG1 E;  3ASD A;  3FUJ A;  5JJ6 A;  4BT9 A;  4HB5 A;  1JPL A;  2XCB A;  4KMO A;  3ZKJ A;  4WNF A;  1IHB A;  1TNZ A;  3LCA A;  3ZYL A;  4A55 A;  1L5J A;  3QC1 A;  3KSL A;  2Y0B G;  3J5P A;  2I1K A;  3E4B A;  1N4S A;  3ISM C;  3NZU A;  4K5A B;  2FI7 A;  3UIP C;  4H7X A;  2WXP A;  1BD8 A;  3TWX A;  3CQG B;  2VQ2 A;  2FO7 A;  2F37 A;  4ZHB A;  4NRH B;  3HXC A;  3CHM A;  4U0S A;  4DI3 A;  4WWP A;  4F7A A;  4PS8 A;  5D2M C;  3SBS A;  3ULQ A;  3ASF A;  3D3M A;  3QKY A;  4LUN U;  5IY5 E;  3AG2 E;  4BX8 A;  3D9J A;  3PZ4 A;  3UT4 A;  2KM4 A;  3G2U A;  3J5Q B;  3CVN A;  4ABN A;  2GGF A;  1PAQ A;  3ZHE A;  4MLP A;  4BT8 A;  1SQM A;  4F1S A;  4RG6 A;  1N94 A;  3FUI A;  2YNQ A;  3LYA A;  2Y69 E;  4J0U A;  3OXL A;  2XPY A;  1QQE A;  2BKK B;  4BY6 A;  2CG3 A;  4CZ2 D;  2IOS A;  4EBA A;  2GRN B;  1JCR A;  3E33 A;  3UI2 A;  2FO1 E;  3FUK A;  2WVI A;  4A3V A;  4U8V D;  3UM2 A;  3ULY A;  3ZYQ A;  4AY5 A;  3HYM B;  2J9Q A;  3LS8 A;  4GA2 A;  4XE0 A;  1JUQ A;  4URK A;  2VGE A;  2XPZ A;  4IN3 B;  4UQZ A;  3TWR A;  4AVX A;  2MYO A;  5LX8 A;  5KCM A;  3LJN A;  4GMJ A;  3ABM E;  3APD A;  4JHJ A;  3HG0 D;  3RO2 A;  3ZYK A;  4GA0 A;  1HXI A;  3WG7 E;  2BTD A;  3UXG A;  4JA9 A;  4L2Y A;  2LUH A;  3JUI A;  4DX2 A;  1IQU A;  3AAA C;  3PZ1 A;  3AS4 A;  4GTP A;  3GZ1 A;  1GW6 A;  4DLO A;  1TNU A;  4WUY A;  3BQO A;  1TN6 A;  2KCK A;  1TEZ A;  4ILG A;  4JXT A;  2XRY A;  1BPO A;  5EIB E;  3G2V A;  1H2T C;  5BXO A;  3PDN A;  4ANX A;  3NBN B;  3SO8 A;  3TWQ A;  4Q69 A;  3FU5 A;  2WB2 A;  3SHF A;  1FVH A;  3CKB A;  3TWV A;  2WXL A;  4J6I A;  2L0I A;  5T4Y A;  5KBA A;  1ZB1 A;  4YVQ C;  1B89 A;  3GW4 A;  2HM8 A;  5DBK A;  4ZFH A;  4NUR A;  3ASG A;  2WXK A;  4B93 B;  1SA5 A;  2DWZ A;  4V3I A;  3C72 A;  4UI9 C;  4B94 A;  4GZ5 A;  1E7V A;  3IKO B;  2WQ6 A;  1MX2 A;  3FUF A;  3D9I A;  3CQC B;  4IUL A;  4CDN A;  2EIK E;  4HI9 A;  4ILH B;  2XS1 A;  4UWF A;  3TWU A;  4EZK A;  5FT9 A;  2CFZ A;  1TR4 A;  4F1P A;  3PEV B;  4KYO B;  3Q73 A;  1YYH A;  2X3M A;  3QOU A;  4G8L A;  1FCH A;  3D9M A;  3KSQ A;  2ZU6 B;  3FUH A;  3MKR A;  4FHK A;  4FHJ A;  1BLX B;  3D9L A;  4C9B B;  2UY1 B;  3EHN A;  3PZ2 A;  5ENT D;  4D10 C;  3T5V A;  3UM0 A;  1EPU A;  3D9O A;  4Y6W A;  4I6G A;  3Q79 A;  4BEP A;  3ZU7 B;  1IQR A;  3FH8 A;  4G1T A;  1MX6 A;  1N4P A;  2P9K G;  3MCX A;  3LVR E;  2L0T B;  4L2L A;  1HF8 A;  4CGV A;  3CVP A;  4G24 A;  4MRU A;  1TNB A;  4PS7 A;  2PQR A;  1EYH A;  5FQ8 A;  4AV7 A;  4BWR A;  3ML8 A;  4N5Q A;  3EUV A;  3NOC D;  1RW2 A;  2Y4T A;  4OYS A;  4TXP A;  4FU3 A;  3FTW A;  2KZT B;  1E8X A;  3EIJ A;  1MYO A;  4Q94 A;  4UQY A;  4HLE A;  1LD7 A;  2J4B A;  4P29 A;  4NAC A;  3FH7 A;  3G2T A;  3ZUV B;  4XIF A;  3FUN A;  4AJW A;  4CGW A;  1BI8 B;  4A1S A;  1V54 E;  3ABK E;  4APO A;  4I9E A;  1MX4 A;  2WXF A;  3CKC A;  4E85 A;  4X8Q A;  1KT0 A;  4G8K A;  5ENP D;  3X2Q E;  3AG4 E;  4AEZ C;  5E75 A;  3SFY A;  2RKK A;  5BUZ A;  2IJG X;  4OAV B;  2NSZ A;  4FJZ A;  4ANW A;  3CHS A;  4I1M A;  3TG5 A;  2E2E A;  2DYR E;  3Q7F A;  5HI7 A;  4YDE A;  4FLH A;  1NI1 A;  5ITZ F;  4DX1 A;  3PNT B;  3UMV A;  4GZ3 A;  4UWK A;  5ENR D;  3RRU A;  2L6J A;  2VJ8 A;  1K1B A;  4I1A A;  4PDX A;  2BUG A;  2JLB A;  5C2Y A;  2P9P G;  2ETB A;  2FBN A;  5D0Q D;  2J8S D;  3D9N A;  2C2L A;  4I2W A;  3U66 A;  3L13 A;  1QBQ A;  3ULE G;  1A17 A;  2DIW A;  3DSU A;  2XGO A;  3E30 A;  2AW6 A;  2OVF A;  3ZW3 A;  1NA3 A;  1WAO 1;  2PQN A;  1N4R A;  2WQ7 A;  4FC8 A;  3UM3 A;  1KZO A; 
#chains in the Genus database with same CATH homology
 2LXL A;  2RKK A;  4TXP A;  4U7E B;  4TXQ A;  2LUH A;  4TXR A;  5H7P A;  2LXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...