4TXPA

Crystal structure of lip5 n-terminal domain
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
156
structure length
156
Chain Sequence
ALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar protein sorting-associated protein VTA1 homolog
publication title A Novel Mechanism of Regulating the ATPase VPS4 by Its Cofactor LIP5 and the Endosomal Sorting Complex Required for Transport (ESCRT)-III Protein CHMP5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 63
structure length 156
sequence length 156
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04652 Vta1 Vta1 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.270 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Vacuolar protein sorting-associated protein vta1 4txpA00
2LXMA 2RKKA 4TXRA 4TXQA 2LUHA 4TXPA 4U7EB 5H7PA 2LXLA
chains in the Genus database with same CATH superfamily
4ANXA 3CVPA 3CVUA 3P1UA 3IHYA 3CEQA 3UI2A 5AQAA 4XIFA 4V3IA 1FVFA 3PNLB 4N3CA 4UWGA 3ZN3A 4I2ZA 1HE8A 3I5PA 4AIFA 3SBSA 3DPDA 5B1BE 5G55A 2VJ8A 3ZIMA 3Q9NC 5G2NA 3D9MA 4BTAA 4FU3A 4HOUA 2L0TB 3UX4A 3Q47B 3FTVA 2I1KA 3VTXA 3ASHA 3IBEA 4A3VA 3NZUA 5D0QD 1BI7B 4LNGA 3P2BA 2YHEA 3FUNA 3T5VA 2GGFA 3FH8A 5A23A 3TG4A 5B1AE 3DSXA 4FP7A 4UI9C 2EIKE 4GA1A 4MKTA 3BEEA 3MZLB 3JXIA 4I9CA 5DBKA 1Z3XA 2IO2C 2FEZA 3FTYA 5T4YA 2M63A 3ASGA 4WNEA 3T5XA 4GU5A 1BI8B 2FF4A 2P2CP 1OCOE 1KT0A 3ZFWA 5LOZA 4N5QA 3CVQA 1K8KG 4CCAA 3GYZA 1MX2A 2A5EA 1FCHA 4APFA 4GYYA 3ZYLA 1HU3A 4GTRA 1TN7A 2I9CA 3T9KA 4B94A 3CKBA 1HX8A 3MA5A 5AYWD 2XGSA 4WAFA 3X2QE 1IQUA 4JVSA 4KZCA 2B0OE 2FI7A 3DSSA 3TWXA 4ACLA 2ETBA 4KYOB 1TNOA 2ZXWE 3EHQA 4ACKA 3NBNB 3L17A 3CR3A 1QBQA 3AU5A 2J4DA 4EZLA 3LVRE 1N54A 3CHMA 2OVBA 1JCSA 5CCMA 3D9OA 2IQCA 3UPVA 2BF0X 2VTBB 1ZBPA 4I6JA 5CRUA 1UW4B 4HVBA 4C48B 3UKUG 2KC7A 1Z5SC 4CYMD 1OCCE 4C0EA 3PE4A 2F0YA 4B8AA 4HLLA 2XEEA 4B93B 4GTTA 4LRZA 2P9PG 5FT9A 2FULA 2GRQB 3Q7AA 2CHWA 3ZYMA 5KBAA 2VGXB 5CHEE 2KZTA 3PUKA 1NFIE 2LXMA 1NL4A 3V31A 3CVLA 3APFA 3V2OA 4L23A 3L54A 1U3DA 3TXMA 1O1RA 4N3BA 4CDNA 2LAIA 2WXFA 4BERA 2WXHA 3G2UA 2OV8A 1S0PA 2I6HA 4XI0A 2WXLA 4I1OB 3MEKA 4UWLA 1DCQA 1N95A 4IRUA 1YMPA 3MYVA 2EQXA 4U96D 3UM2A 5AAOA 4GTPA 4JC8A 1LD8A 4XEIG 4GZ6A 2PQNA 3CK8A 4U8HA 5ENPD 1KT1A 3D9IA 3DEPA 2PM7A 4U0SA 4DPRA 2KATA 4YVQC 2X6JA 5FQ8A 2DCPA 2X6IA 4XZ4A 3G2VA 3IKOB 3FU6A 4ILGA 4MBGA 3RRNB 2R59A 1IYGA 3ZU7B 2EILE 2EINE 4GTOA 2L6JA 2F37A 4L2YA 3FUDA 4LEUA 3QARA 3DEOA 5ANRA 2C2LA 3ABLE 5AJDA 1N4PA 2J8SD 2V5QC 2XHEA 4RLYA 5E75A 1OCZE 4LNUD 5LP0A 3MKRA 3TWTA 3TG5A 4DUIA 2WB2A 2PQRA 4FHKA 4O60A 1U3CA 4H7YA 2WQ6A 2LNIA 2MRIA 4BT8A 3CHQA 4YNDA 1HG2A 4GCOA 3B7TA 3FY4A 2WXNA 4M7CA 4LUNU 3IXEA 1N52A 4HRNA 2AJAA 1E8XA 3FH5A 4NURA 1YCSB 4K5BA 3EHNA 4RQIA 3MV3B 3T8MA 3DXMG 4DX5D 2MHKA 4EPZA 3SI5A 3Q49B 4H7XA 2AW6A 3RRMB 3CHPA 3L9TA 4B8CB 4CT0A 4Q69A 3PEVB 4I6EA 2VSOE 4AP2A 2J07A 4EQFA 2YHCA 3ZXSA 4GZCA 1O1TA 2NYJA 5LCWC 2EIME 4GMLA 3LEWA 2J9QA 3LPZA 1OWMA 3FUJA 2XZTG 5CEAA 2WXOA 4HOSA 3L08A 2VYIA 3VLFA 4ILIA 2NSZA 5JJTA 1AWCB 4FJYA 1Y6IA 3GZ1A 5ARGA 3U4TA 4RVBA 1DNPA 3SGHA 2XPYA 4P29A 3PZ4A 1JWGA 3U66A 3SFZA 4MS6A 4PS8A 4UWKA 1IKND 5HKPA 4BSZB 1V54E 4KZ0A 1TNUA 3PREA 2IF4A 4WWOA 4HOQA 4DX2A 3IHVA 4FA6A 3ASOE 3FULA 4L9PA 3SD5A 1FT1A 5ENSD 3B7UX 3MJWA 4I1MA 3CGHA 3UM1A 1TYQG 2Y4TA 4U7EB 3ZHEB 1Y8MA 4I6GA 4A1GA 1TNYA 1U2VG 1E8ZA 4U95D 3DSWA 3BQOA 2QFCA 3HXBA 3OAWA 3ENEA 3E32A 5KJKA 1OT8A 3MKQB 4QFVA 3T8KA 5BXUA 1MZCA 1SA5A 2JLBA 3B7BA 1X5BA 1P5QA 2FBNA 4I2WA 2XEVA 3I4GA 3WG7E 1H2UA 3AU4A 4ME2A 3AJIA 1INZA 1UJKA 3CSTA 2J09A 3HXDA 2Y3AA 4G8KA 2VGEA 4NACA 3FUEA 2WMNA 1NI1A 3LCAA 1SQMA 4AVXA 3S7JA 1OXJA 4UQZA 2OOEA 2R05A 1L5JA 3NF1A 4JHKA 3KEZA 3SBTB 4ATGA 1D8DA 2RKKA 4JEHA 1NZNA 1EF1C 4HI8A 2IONA 5HQ8A 4BFRA 3IEGA 4HBDA 2WQHA 2WPVA 3DBSA 4TXPA 4KXKB 3RSEG 5JMND 2H6FA 3HXCA 4CRWA 1QQEA 2R02A 1TN6A 3OXGA 2WM9A 5AIJA 1JUQA 2MYOA 3HXEA 4AV7A 3FEYA 2X3MA 4GMJA 2P9UG 4KBQA 3VTYA 3ASNE 3U64A 1UOHA 3CHRA 2P9KG 5J08A 4HLEA 4CGWA 2EIJE 2XCBA 4AXHA 2R5SA 2RFAA 2GROB 1QZ2A 1UG3A 4GA0A 3LY9A 1ELRA 1OCRE 2CHZA 4EBAA 3HVEB 3PZ1A 3TXNA 2WXPA 3DXKG 4GTSA 4HB5A 1AP7A 2Y1LE 4HI9A 3LDZA 4AM9A 2UY1A 4B89A 3E33A 3JQ1A 3KS2A 2WXMA 5BW8C 4JEUA 3AG2E 1K1AA 5CMWA 3HG0D 1E96B 3PDNA 4YVOA 3PRZA 1WAO1 1HO8A 3CQCB 4JHJA 3U3WA 3FFLA 3UKRG 1TEZA 1ZU2A 1ELWA 2F8XK 4NRHB 1WDYA 5FQ7A 4LERA 2DVWA 3EUVA 2KM4A 4IYPA 3HIZA 3NB2A 4UI9K 5T8IA 4G11A 2Y0BG 3AG1E 2HO1A 5JJ7A 4AEZC 2OEVA 4ANWA 3D9KA 2YINA 4XKBA 4DLQA 4B0ZA 2V4LA 3EU5A 5AQ7A 4JZYA 1E8WA 3D3MA 4FLBA 4APOA 2QZAA 2BTDA 2ZGGA 1O5MA 3D9NA 4JA7A 4C9BB 2AVPA 3LYAA 2P9LG 5FIOA 2YQ8A 1N0RA 2R03A 1MQSA 5H7PA 3CV0A 2DZNA 4ANUA 3C3RA 1Q2ZA 2J08A 2GRPB 1PY1A 2AXVA 3FUFA 3FU5A 3FTWA 3SNXA 4U0UA 5D2MC 1SZ9A 4J8SA 3S7BA 3FH7A 4Y6CA 3Q5MA 4IULA 5KJLA 1O1SA 4AY5A 2P58C 4FLHA 2WQ7A 3SFXA 1UJJA 3S7FA 5AENA 2OVFA 4PS7A 3G2WA 1E7VA 3SO8A 2CHXA 3AS4A 3CIAA 3GZSA 4BESA 2H6HA 3QAQA 5BV1A 2XZDG 4RG6A 3CVVA 3R9AB 2KCVA 3DSTA 2XS8A 3RJVA 2DZOA 3PEUB 3S2AA 1HH8A 2AWIA 3CVXA 1HS6A 2C0LA 2ZGDA 4GTVA 1HF8A 4TXQA 4YDEA 2HYZA 3V2XA 2C0MA 2DIWA 1K1BA 3K9IA 3LKUA 5JHAA 2XRZA 5FZRA 2PZIA 2CFUA 4J8YA 2DBAA 3RKVA 3RAUA 3ULYA 3VLDA 3FTXA 4GZ5A 4WNFA 2VGYA 4LCTA 4NIKA 2L6BA 4JPSA 3UINC 4F3VA 4U63A 4G1TA 4U07A 5B3SE 2XQ0A 4DX6D 3JCKC 5LX8A 3CSFA 3PUJA 3EDTB 4HFGA 1W3BA 4O1PA 2HR2A 5ENQD 4WNGA 1TNBA 1OWOA 2A5UA 4TV3A 1BLXB 4JA9A 3EHRA 5BUZA 5DIZA 5ENOD 2LXLA 2LUHA 4FULA 5ARFA 5AN8A 3E30A 3J5QB 3HYMB 2IJGX 5KWDA 4GTQA 3TWQA 5JHBA 3OXLA 3FP3A 3D9PA 3ISMC 4LNBA 2UY1B 1BPOA 1IHBA 2X38A 2UWJG 3EIQC 1NP7A 1WG0A 3UT7A 3MX3A 1DCEA 2WXJA 4AY6A 2DYRE 2J49A 3J5PA 1XGWA 4WWNA 3JYSA 4E6HA 3FUIA 2ETCA 2Y69E 1HZ4A 1NA3A 3ML9A 2XPZA 5D0OD 2DWZA 2BKKB 3UT4A 1FT2A 5CERB 2WXIA 3FUHA 4F53A 3O4ZA 4LG6A 3UT8A 4EBAG 4CDMA 1V55E 3KSQA 3SZ7A 3TWSA 2WXRA 1N4SA 5FQ6A 4E85A 4EECA 4PS3A 5CRVA 3B13A 4D10C 5CEDB 2V5FA 3LXUX 4BY6A 5ENTD 3NQPA 3QWVA 3PH0C 2XGOA 4I1AA 4GTMA 3AS8A 2AXUA 1NA0A 4BTBA 5C1DA 5KJMA 3C98A 3QWPA 3PVLA 3FU3A 4DI4A 3FUKA 4JW1A 5ENRD 3V79K 3EHMA 1WM5A 1OWLA 2NC9A 2IO3C 2LO6A 5CCLA 4G24A 2GW1A 2AXZA 2KZTB 3O48A 5BV0A 4N39A 4K5AB 3NZSA 5EN5D 4Z68A 5FZQA 1PAQA 3BG1B 4HNAD 3W9FA 4BX8A 1X81A 4OVVA 3QOUA 1OWNA 3DSUA 5D66A 2DYSE 2YNQA 1H19A 2VSXE 2XCCA 4U04A 3L6AA 4G23A 4N5CA 2BUGA 4WUYA 4GPKA 4Y6WA 2KCLA 1FVHA 4L7TA 1DC2A 3PE3A 2QY7A 1LTXA 4UQYA 3UMVA 2PM6A 3ABME 4ANVA 1MJ0A 4FJZA 2R2LA 5ENNA 2BKGA 1TJFA 4JD2G 1ELKA 4AJWA 3FWVA 3AG4E 3BG0B 4JXTA 1QYMA 3QWWA 4NQ0A 4DRXE 4CDRA 4FC8A 5M72A 1GW6A 5EIBE 3JUEA 3CLJA 4DI3A 3URZA 1IXVA 2VGXA 2P9NG 4HORA 1EYHA 3ULQA 4GZDA 2IU1A 2OEWA 4CT4A 3EJNA 2E0IA 3PNTB 1B89A 1JCQA 3DPYA 3ONLA 1JCRA 2RFMA 3S7DA 3RU0A 5BPPA 4J7WA 4RSYA 4ABNA 5FQ4A 3E37A 4GPMA 3RO2A 4BSXA 3R7RA 4GB9A 3PZDA 1BD8A 2WXKA 4HQDA 3APCA 3AS5A 5E76A 3Q78A 2XPIA 3ONKA 2VQ2A 2VSNA 2GRMA 2XEHA 3CQGB 1H6OA 1N0QA 3LVQE 1UN9A 3SQVA 3D9JA 4I17A 1SA4A 1A5EA 1IHGA 5AQBA 4A1SA 4Q96A 3HHMA 3F6QA 3RK6A 3BU8A 4JB8P 3CKCA 3TAXA 4JHRA 4HRMB 3C72A 3ZVVA 3NOGD 3ZEFA 5CBOA 4G25A 3ZNGA 1VDYA 3EU9A 2JEKA 3DRAA 1H0AA 5AQ9A 3SY2A 5G04J 3JQ0A 4HS2A 4QQIA 4UQXA 2HM8A 4CEMA 2A4ZA 5EX0A 1E7UA 1Z3YA 5A6CA 4DK5A 3SFYA 3R7QA 4PH4B 2QYJA 3LS8A 3D9LA 1UN8A 3CVYA 5KNHD 3CVWA 3AAAC 3CK7A 4I43A 4UWFA 2FO7A 4X8QA 2KBXA 3L22A 3DWLG 4BX9A 3TWUA 3LJNA 4J8FA 4N2SA 3B7SA 2H6IA 1D9SA 3KAEA 1QNFA 3U9WA 2GRLA 1N11A 4G2VA 4HRLA 4M3OA 5CBNA 3B95A 5G05J 1S64A 2XS1A 4ILHB 4U0ZA 1S63A 2PL2A 4F1PA 4DJAA 4N2QA 2RG8A 2MOWA 3FTZA 2J4BA 4IN3B 2WMOA 4I9EA 3LJ3A 4DX7D 2PNNA 3UIOC 3HRAA 5EILA 4CGVA 3QKYA 3ZW3A 4RG9A 4TUUA 5EKQD 4KVOA 1TN8A 3ZUVB 1RZ4A 1H6KA 1HFAA 3CK9A 1OUVA 4CZ2D 2LSUA 3GW4A 1OWPA 5LCWJ 4GYWA 4AOFA 2X6HA 4U8VD 1WY6A 3JXJA 3Q4AB 2LSVA 2B6CA 3V30A 4ZFHA 4XE0A 3VLEA 2I2OA 3Q7FA 1SZAA 3ZRHA 3OXFA 1HXIA 2ETAA 4JL0A 5IY5E 4BWRA 2IEJA 3LY8A 3UQ3A 2F8YA 3I3NA 2BEDA 1TJCA 2GRRB 4UWHA 5BXOA 4BETA 3QNKA 3QJZA 1OY3D 3KEAA 3TL5A 3Q79A 2KXPC 3TJPA 1H2TC 1H2VC 3R9MA 2WXQA 2CFZA 4MRUA 3ASDA 4BEPA 2L0IA 4URKA 2V8SE 2OCCE 5AARA 3ABKE 2IOSA 1MHQA 2IFUA 4G8LA 3UM3A 2P9SG 2KCKA 3E4BA 3AG3E 3ZHEA 3L13A 2VSYA 2L9BA 4N3AA 5ITZF 3ZGQA 1D8EA 1FPPA 1TNZA 2WXGA 3G2TA 3PZ3A 5EIDA 2ONDA 4TRQA 1N9AA 3SHFA 3SF4A 1LD7A 2IY0C 1E90A 2GRNB 2E2EA 5FZSA 3MKQA 3RIBA 2XRYA 4A63B 2R17C 3UTMA 4OVUA 4FADA 1BU9A 3FTUA 4EHMA 3CVNA 4K0RA 5CECB 3ASFA 3N71A 1G3NB 3ESLA 3JUIA 4F6RD 1KZOA 4EZKA 4ATZD 3Q15A 3D9HA 4DLOA 3BUAA 5G04C 3MCXA 4GCNA 4U8YD 4J8EA 3UUXA 2H6GA 5KCMA 1ZB1A 2JABA 3C3QA 3RRUA 4J8DA 1DVPA 4DX1A 1RW2A 4EZJA 1SVXA 5EDSA 4PUCA 4OAUC 1EDUA 1KPSB 4O6FA 1MX6A 5KNGA 3MGBA 3APDA 4GA2A 2P9IG 4GMRA 3TWRA 4XI9A 1JWFA 3Q9UC 2V0PA 3E34A 3UM0A 2WVIA 4HXIA 2XGMA 3QB2A 3Q73A 1HG5A 3LY7A 1YYHA 1N4QA 4J6IA 4XKCA 4KVMA 5G05C 5ANLA 5HRYA 3B7RL 3EIJA 1YA0A 3FTSA 4GYOA 1A17A 4L1BA 4LSZE 4O1OA 2Y4UA 3L82A 2XENA 3HVEA 5FJYA 1XNFA 4ZHBA 4YDOA 5AJLA 4UI9J 3UXGA 2CG3A 5FWQA 2I1JA 4YDYA 3QDNA 4TUMA 4A3TA 3CHOA 4BT9A 3NOCD 4W9RA 5JA4D 4TXRA 4PDXA 2Q7FA 3Q75A 4OYSA 1Z6TA 4WWPA 1KLXA 5FTPA 3L16A 3WXXA 4R7LA 3HXFA 4K03A 3ZXPA 5LFAA 4GAAA 2ZIRA 5JJ6A 2ZU6B 4J0UA 1N4RA 1LF8A 3FHEA 3FEXA 2X6KA 2V4HC 1E8YA 5EX3A 1TR4A 1PC2A 1N94A 2IOLA 5T3RA 2X6FA 1MYOA 3ZKJA 2VTBA 2CG2A 4HOTA 5A7DB 4XX5A 2NXPA 4KMOA 4F7AA 1IQRA 5C2YA 5J90A 3TWVA 3GZ2A 3NAWA 4A55A 4KT6B 4OAVB 3ZYKA 4UUCA 3IV0A 4F1SA 1S70B 3PS6A 3ZPJA 4G26A 2ILRA 2RD0A 3CHSA 2QYUA 3G2SA 2FO1E 3KSLA 3W9GA 4YDWA 3MV2B 4K5CA 5FINA 3UIPC 1K3ZD 1H6PA 3QK0A 4FHJA 5BT1A 3OTNA 4GZ3A 1SW6A 3FU0A 3RO3A 1EPUA 1KZPA 1MX4A 4L2LA 5HS0A 2QC9A 4C0MA 5HI7A 3C5RA 3PZ2A 3ZYQA 3ULEG 4WNDA 3FDHA 5CMYA 4Q94A 5KJNA 3QC1A 5BNWA 3KD7A 3ESKA 2HE0A 3TWWA 1JPLA 4MLPA 5EYLA 3HDXA 3ML8A 3TGOA 5EYPF 3C3OA 3FUMA 2ZISA 3I4RB 3DSVA 2LAHA
chains in the Genus database with same CATH topology
2LXMA 2RKKA 4TXRA 4TXQA 2LUHA 4TXPA 4U7EB 5H7PA 2LXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LXM A;  2RKK A;  4TXR A;  4TXQ A;  2LUH A;  4TXP A;  4U7E B;  5H7P A;  2LXL A; 
#chains in the Genus database with same CATH topology
 4ANX A;  3CVP A;  3CVU A;  3P1U A;  3IHY A;  3CEQ A;  3UI2 A;  5AQA A;  4XIF A;  4V3I A;  1FVF A;  3PNL B;  4N3C A;  4UWG A;  3ZN3 A;  4I2Z A;  1HE8 A;  3I5P A;  4AIF A;  3SBS A;  3DPD A;  5B1B E;  5G55 A;  2VJ8 A;  3ZIM A;  3Q9N C;  5G2N A;  3D9M A;  4BTA A;  4FU3 A;  4HOU A;  2L0T B;  3UX4 A;  3Q47 B;  3FTV A;  2I1K A;  3VTX A;  3ASH A;  3IBE A;  4A3V A;  3NZU A;  5D0Q D;  1BI7 B;  4LNG A;  3P2B A;  2YHE A;  3FUN A;  3T5V A;  2GGF A;  3FH8 A;  5A23 A;  3TG4 A;  5B1A E;  3DSX A;  4FP7 A;  4UI9 C;  2EIK E;  4GA1 A;  4MKT A;  3BEE A;  3MZL B;  3JXI A;  4I9C A;  5DBK A;  1Z3X A;  2IO2 C;  2FEZ A;  3FTY A;  5T4Y A;  2M63 A;  3ASG A;  4WNE A;  3T5X A;  4GU5 A;  1BI8 B;  2FF4 A;  2P2C P;  1OCO E;  1KT0 A;  3ZFW A;  5LOZ A;  4N5Q A;  3CVQ A;  1K8K G;  4CCA A;  3GYZ A;  1MX2 A;  2A5E A;  1FCH A;  4APF A;  4GYY A;  3ZYL A;  1HU3 A;  4GTR A;  1TN7 A;  2I9C A;  3T9K A;  4B94 A;  3CKB A;  1HX8 A;  3MA5 A;  5AYW D;  2XGS A;  4WAF A;  3X2Q E;  1IQU A;  4JVS A;  4KZC A;  2B0O E;  2FI7 A;  3DSS A;  3TWX A;  4ACL A;  2ETB A;  4KYO B;  1TNO A;  2ZXW E;  3EHQ A;  4ACK A;  3NBN B;  3L17 A;  3CR3 A;  1QBQ A;  3AU5 A;  2J4D A;  4EZL A;  3LVR E;  1N54 A;  3CHM A;  2OVB A;  1JCS A;  5CCM A;  3D9O A;  2IQC A;  3UPV A;  2BF0 X;  2VTB B;  1ZBP A;  4I6J A;  5CRU A;  1UW4 B;  4HVB A;  4C48 B;  3UKU G;  2KC7 A;  1Z5S C;  4CYM D;  1OCC E;  4C0E A;  3PE4 A;  2F0Y A;  4B8A A;  4HLL A;  2XEE A;  4B93 B;  4GTT A;  4LRZ A;  2P9P G;  5FT9 A;  2FUL A;  2GRQ B;  3Q7A A;  2CHW A;  3ZYM A;  5KBA A;  2VGX B;  5CHE E;  2KZT A;  3PUK A;  1NFI E;  2LXM A;  1NL4 A;  3V31 A;  3CVL A;  3APF A;  3V2O A;  4L23 A;  3L54 A;  1U3D A;  3TXM A;  1O1R A;  4N3B A;  4CDN A;  2LAI A;  2WXF A;  4BER A;  2WXH A;  3G2U A;  2OV8 A;  1S0P A;  2I6H A;  4XI0 A;  2WXL A;  4I1O B;  3MEK A;  4UWL A;  1DCQ A;  1N95 A;  4IRU A;  1YMP A;  3MYV A;  2EQX A;  4U96 D;  3UM2 A;  5AAO A;  4GTP A;  4JC8 A;  1LD8 A;  4XEI G;  4GZ6 A;  2PQN A;  3CK8 A;  4U8H A;  5ENP D;  1KT1 A;  3D9I A;  3DEP A;  2PM7 A;  4U0S A;  4DPR A;  2KAT A;  4YVQ C;  2X6J A;  5FQ8 A;  2DCP A;  2X6I A;  4XZ4 A;  3G2V A;  3IKO B;  3FU6 A;  4ILG A;  4MBG A;  3RRN B;  2R59 A;  1IYG A;  3ZU7 B;  2EIL E;  2EIN E;  4GTO A;  2L6J A;  2F37 A;  4L2Y A;  3FUD A;  4LEU A;  3QAR A;  3DEO A;  5ANR A;  2C2L A;  3ABL E;  5AJD A;  1N4P A;  2J8S D;  2V5Q C;  2XHE A;  4RLY A;  5E75 A;  1OCZ E;  4LNU D;  5LP0 A;  3MKR A;  3TWT A;  3TG5 A;  4DUI A;  2WB2 A;  2PQR A;  4FHK A;  4O60 A;  1U3C A;  4H7Y A;  2WQ6 A;  2LNI A;  2MRI A;  4BT8 A;  3CHQ A;  4YND A;  1HG2 A;  4GCO A;  3B7T A;  3FY4 A;  2WXN A;  4M7C A;  4LUN U;  3IXE A;  1N52 A;  4HRN A;  2AJA A;  1E8X A;  3FH5 A;  4NUR A;  1YCS B;  4K5B A;  3EHN A;  4RQI A;  3MV3 B;  3T8M A;  3DXM G;  4DX5 D;  2MHK A;  4EPZ A;  3SI5 A;  3Q49 B;  4H7X A;  2AW6 A;  3RRM B;  3CHP A;  3L9T A;  4B8C B;  4CT0 A;  4Q69 A;  3PEV B;  4I6E A;  2VSO E;  4AP2 A;  2J07 A;  4EQF A;  2YHC A;  3ZXS A;  4GZC A;  1O1T A;  2NYJ A;  5LCW C;  2EIM E;  4GML A;  3LEW A;  2J9Q A;  3LPZ A;  1OWM A;  3FUJ A;  2XZT G;  5CEA A;  2WXO A;  4HOS A;  3L08 A;  2VYI A;  3VLF A;  4ILI A;  2NSZ A;  5JJT A;  1AWC B;  4FJY A;  1Y6I A;  3GZ1 A;  5ARG A;  3U4T A;  4RVB A;  1DNP A;  3SGH A;  2XPY A;  4P29 A;  3PZ4 A;  1JWG A;  3U66 A;  3SFZ A;  4MS6 A;  4PS8 A;  4UWK A;  1IKN D;  5HKP A;  4BSZ B;  1V54 E;  4KZ0 A;  1TNU A;  3PRE A;  2IF4 A;  4WWO A;  4HOQ A;  4DX2 A;  3IHV A;  4FA6 A;  3ASO E;  3FUL A;  4L9P A;  3SD5 A;  1FT1 A;  5ENS D;  3B7U X;  3MJW A;  4I1M A;  3CGH A;  3UM1 A;  1TYQ G;  2Y4T A;  4U7E B;  3ZHE B;  1Y8M A;  4I6G A;  4A1G A;  1TNY A;  1U2V G;  1E8Z A;  4U95 D;  3DSW A;  3BQO A;  2QFC A;  3HXB A;  3OAW A;  3ENE A;  3E32 A;  5KJK A;  1OT8 A;  3MKQ B;  4QFV A;  3T8K A;  5BXU A;  1MZC A;  1SA5 A;  2JLB A;  3B7B A;  1X5B A;  1P5Q A;  2FBN A;  4I2W A;  2XEV A;  3I4G A;  3WG7 E;  1H2U A;  3AU4 A;  4ME2 A;  3AJI A;  1INZ A;  1UJK A;  3CST A;  2J09 A;  3HXD A;  2Y3A A;  4G8K A;  2VGE A;  4NAC A;  3FUE A;  2WMN A;  1NI1 A;  3LCA A;  1SQM A;  4AVX A;  3S7J A;  1OXJ A;  4UQZ A;  2OOE A;  2R05 A;  1L5J A;  3NF1 A;  4JHK A;  3KEZ A;  3SBT B;  4ATG A;  1D8D A;  2RKK A;  4JEH A;  1NZN A;  1EF1 C;  4HI8 A;  2ION A;  5HQ8 A;  4BFR A;  3IEG A;  4HBD A;  2WQH A;  2WPV A;  3DBS A;  4TXP A;  4KXK B;  3RSE G;  5JMN D;  2H6F A;  3HXC A;  4CRW A;  1QQE A;  2R02 A;  1TN6 A;  3OXG A;  2WM9 A;  5AIJ A;  1JUQ A;  2MYO A;  3HXE A;  4AV7 A;  3FEY A;  2X3M A;  4GMJ A;  2P9U G;  4KBQ A;  3VTY A;  3ASN E;  3U64 A;  1UOH A;  3CHR A;  2P9K G;  5J08 A;  4HLE A;  4CGW A;  2EIJ E;  2XCB A;  4AXH A;  2R5S A;  2RFA A;  2GRO B;  1QZ2 A;  1UG3 A;  4GA0 A;  3LY9 A;  1ELR A;  1OCR E;  2CHZ A;  4EBA A;  3HVE B;  3PZ1 A;  3TXN A;  2WXP A;  3DXK G;  4GTS A;  4HB5 A;  1AP7 A;  2Y1L E;  4HI9 A;  3LDZ A;  4AM9 A;  2UY1 A;  4B89 A;  3E33 A;  3JQ1 A;  3KS2 A;  2WXM A;  5BW8 C;  4JEU A;  3AG2 E;  1K1A A;  5CMW A;  3HG0 D;  1E96 B;  3PDN A;  4YVO A;  3PRZ A;  1WAO 1;  1HO8 A;  3CQC B;  4JHJ A;  3U3W A;  3FFL A;  3UKR G;  1TEZ A;  1ZU2 A;  1ELW A;  2F8X K;  4NRH B;  1WDY A;  5FQ7 A;  4LER A;  2DVW A;  3EUV A;  2KM4 A;  4IYP A;  3HIZ A;  3NB2 A;  4UI9 K;  5T8I A;  4G11 A;  2Y0B G;  3AG1 E;  2HO1 A;  5JJ7 A;  4AEZ C;  2OEV A;  4ANW A;  3D9K A;  2YIN A;  4XKB A;  4DLQ A;  4B0Z A;  2V4L A;  3EU5 A;  5AQ7 A;  4JZY A;  1E8W A;  3D3M A;  4FLB A;  4APO A;  2QZA A;  2BTD A;  2ZGG A;  1O5M A;  3D9N A;  4JA7 A;  4C9B B;  2AVP A;  3LYA A;  2P9L G;  5FIO A;  2YQ8 A;  1N0R A;  2R03 A;  1MQS A;  5H7P A;  3CV0 A;  2DZN A;  4ANU A;  3C3R A;  1Q2Z A;  2J08 A;  2GRP B;  1PY1 A;  2AXV A;  3FUF A;  3FU5 A;  3FTW A;  3SNX A;  4U0U A;  5D2M C;  1SZ9 A;  4J8S A;  3S7B A;  3FH7 A;  4Y6C A;  3Q5M A;  4IUL A;  5KJL A;  1O1S A;  4AY5 A;  2P58 C;  4FLH A;  2WQ7 A;  3SFX A;  1UJJ A;  3S7F A;  5AEN A;  2OVF A;  4PS7 A;  3G2W A;  1E7V A;  3SO8 A;  2CHX A;  3AS4 A;  3CIA A;  3GZS A;  4BES A;  2H6H A;  3QAQ A;  5BV1 A;  2XZD G;  4RG6 A;  3CVV A;  3R9A B;  2KCV A;  3DST A;  2XS8 A;  3RJV A;  2DZO A;  3PEU B;  3S2A A;  1HH8 A;  2AWI A;  3CVX A;  1HS6 A;  2C0L A;  2ZGD A;  4GTV A;  1HF8 A;  4TXQ A;  4YDE A;  2HYZ A;  3V2X A;  2C0M A;  2DIW A;  1K1B A;  3K9I A;  3LKU A;  5JHA A;  2XRZ A;  5FZR A;  2PZI A;  2CFU A;  4J8Y A;  2DBA A;  3RKV A;  3RAU A;  3ULY A;  3VLD A;  3FTX A;  4GZ5 A;  4WNF A;  2VGY A;  4LCT A;  4NIK A;  2L6B A;  4JPS A;  3UIN C;  4F3V A;  4U63 A;  4G1T A;  4U07 A;  5B3S E;  2XQ0 A;  4DX6 D;  3JCK C;  5LX8 A;  3CSF A;  3PUJ A;  3EDT B;  4HFG A;  1W3B A;  4O1P A;  2HR2 A;  5ENQ D;  4WNG A;  1TNB A;  1OWO A;  2A5U A;  4TV3 A;  1BLX B;  4JA9 A;  3EHR A;  5BUZ A;  5DIZ A;  5ENO D;  2LXL A;  2LUH A;  4FUL A;  5ARF A;  5AN8 A;  3E30 A;  3J5Q B;  3HYM B;  2IJG X;  5KWD A;  4GTQ A;  3TWQ A;  5JHB A;  3OXL A;  3FP3 A;  3D9P A;  3ISM C;  4LNB A;  2UY1 B;  1BPO A;  1IHB A;  2X38 A;  2UWJ G;  3EIQ C;  1NP7 A;  1WG0 A;  3UT7 A;  3MX3 A;  1DCE A;  2WXJ A;  4AY6 A;  2DYR E;  2J49 A;  3J5P A;  1XGW A;  4WWN A;  3JYS A;  4E6H A;  3FUI A;  2ETC A;  2Y69 E;  1HZ4 A;  1NA3 A;  3ML9 A;  2XPZ A;  5D0O D;  2DWZ A;  2BKK B;  3UT4 A;  1FT2 A;  5CER B;  2WXI A;  3FUH A;  4F53 A;  3O4Z A;  4LG6 A;  3UT8 A;  4EBA G;  4CDM A;  1V55 E;  3KSQ A;  3SZ7 A;  3TWS A;  2WXR A;  1N4S A;  5FQ6 A;  4E85 A;  4EEC A;  4PS3 A;  5CRV A;  3B13 A;  4D10 C;  5CED B;  2V5F A;  3LXU X;  4BY6 A;  5ENT D;  3NQP A;  3QWV A;  3PH0 C;  2XGO A;  4I1A A;  4GTM A;  3AS8 A;  2AXU A;  1NA0 A;  4BTB A;  5C1D A;  5KJM A;  3C98 A;  3QWP A;  3PVL A;  3FU3 A;  4DI4 A;  3FUK A;  4JW1 A;  5ENR D;  3V79 K;  3EHM A;  1WM5 A;  1OWL A;  2NC9 A;  2IO3 C;  2LO6 A;  5CCL A;  4G24 A;  2GW1 A;  2AXZ A;  2KZT B;  3O48 A;  5BV0 A;  4N39 A;  4K5A B;  3NZS A;  5EN5 D;  4Z68 A;  5FZQ A;  1PAQ A;  3BG1 B;  4HNA D;  3W9F A;  4BX8 A;  1X81 A;  4OVV A;  3QOU A;  1OWN A;  3DSU A;  5D66 A;  2DYS E;  2YNQ A;  1H19 A;  2VSX E;  2XCC A;  4U04 A;  3L6A A;  4G23 A;  4N5C A;  2BUG A;  4WUY A;  4GPK A;  4Y6W A;  2KCL A;  1FVH A;  4L7T A;  1DC2 A;  3PE3 A;  2QY7 A;  1LTX A;  4UQY A;  3UMV A;  2PM6 A;  3ABM E;  4ANV A;  1MJ0 A;  4FJZ A;  2R2L A;  5ENN A;  2BKG A;  1TJF A;  4JD2 G;  1ELK A;  4AJW A;  3FWV A;  3AG4 E;  3BG0 B;  4JXT A;  1QYM A;  3QWW A;  4NQ0 A;  4DRX E;  4CDR A;  4FC8 A;  5M72 A;  1GW6 A;  5EIB E;  3JUE A;  3CLJ A;  4DI3 A;  3URZ A;  1IXV A;  2VGX A;  2P9N G;  4HOR A;  1EYH A;  3ULQ A;  4GZD A;  2IU1 A;  2OEW A;  4CT4 A;  3EJN A;  2E0I A;  3PNT B;  1B89 A;  1JCQ A;  3DPY A;  3ONL A;  1JCR A;  2RFM A;  3S7D A;  3RU0 A;  5BPP A;  4J7W A;  4RSY A;  4ABN A;  5FQ4 A;  3E37 A;  4GPM A;  3RO2 A;  4BSX A;  3R7R A;  4GB9 A;  3PZD A;  1BD8 A;  2WXK A;  4HQD A;  3APC A;  3AS5 A;  5E76 A;  3Q78 A;  2XPI A;  3ONK A;  2VQ2 A;  2VSN A;  2GRM A;  2XEH A;  3CQG B;  1H6O A;  1N0Q A;  3LVQ E;  1UN9 A;  3SQV A;  3D9J A;  4I17 A;  1SA4 A;  1A5E A;  1IHG A;  5AQB A;  4A1S A;  4Q96 A;  3HHM A;  3F6Q A;  3RK6 A;  3BU8 A;  4JB8 P;  3CKC A;  3TAX A;  4JHR A;  4HRM B;  3C72 A;  3ZVV A;  3NOG D;  3ZEF A;  5CBO A;  4G25 A;  3ZNG A;  1VDY A;  3EU9 A;  2JEK A;  3DRA A;  1H0A A;  5AQ9 A;  3SY2 A;  5G04 J;  3JQ0 A;  4HS2 A;  4QQI A;  4UQX A;  2HM8 A;  4CEM A;  2A4Z A;  5EX0 A;  1E7U A;  1Z3Y A;  5A6C A;  4DK5 A;  3SFY A;  3R7Q A;  4PH4 B;  2QYJ A;  3LS8 A;  3D9L A;  1UN8 A;  3CVY A;  5KNH D;  3CVW A;  3AAA C;  3CK7 A;  4I43 A;  4UWF A;  2FO7 A;  4X8Q A;  2KBX A;  3L22 A;  3DWL G;  4BX9 A;  3TWU A;  3LJN A;  4J8F A;  4N2S A;  3B7S A;  2H6I A;  1D9S A;  3KAE A;  1QNF A;  3U9W A;  2GRL A;  1N11 A;  4G2V A;  4HRL A;  4M3O A;  5CBN A;  3B95 A;  5G05 J;  1S64 A;  2XS1 A;  4ILH B;  4U0Z A;  1S63 A;  2PL2 A;  4F1P A;  4DJA A;  4N2Q A;  2RG8 A;  2MOW A;  3FTZ A;  2J4B A;  4IN3 B;  2WMO A;  4I9E A;  3LJ3 A;  4DX7 D;  2PNN A;  3UIO C;  3HRA A;  5EIL A;  4CGV A;  3QKY A;  3ZW3 A;  4RG9 A;  4TUU A;  5EKQ D;  4KVO A;  1TN8 A;  3ZUV B;  1RZ4 A;  1H6K A;  1HFA A;  3CK9 A;  1OUV A;  4CZ2 D;  2LSU A;  3GW4 A;  1OWP A;  5LCW J;  4GYW A;  4AOF A;  2X6H A;  4U8V D;  1WY6 A;  3JXJ A;  3Q4A B;  2LSV A;  2B6C A;  3V30 A;  4ZFH A;  4XE0 A;  3VLE A;  2I2O A;  3Q7F A;  1SZA A;  3ZRH A;  3OXF A;  1HXI A;  2ETA A;  4JL0 A;  5IY5 E;  4BWR A;  2IEJ A;  3LY8 A;  3UQ3 A;  2F8Y A;  3I3N A;  2BED A;  1TJC A;  2GRR B;  4UWH A;  5BXO A;  4BET A;  3QNK A;  3QJZ A;  1OY3 D;  3KEA A;  3TL5 A;  3Q79 A;  2KXP C;  3TJP A;  1H2T C;  1H2V C;  3R9M A;  2WXQ A;  2CFZ A;  4MRU A;  3ASD A;  4BEP A;  2L0I A;  4URK A;  2V8S E;  2OCC E;  5AAR A;  3ABK E;  2IOS A;  1MHQ A;  2IFU A;  4G8L A;  3UM3 A;  2P9S G;  2KCK A;  3E4B A;  3AG3 E;  3ZHE A;  3L13 A;  2VSY A;  2L9B A;  4N3A A;  5ITZ F;  3ZGQ A;  1D8E A;  1FPP A;  1TNZ A;  2WXG A;  3G2T A;  3PZ3 A;  5EID A;  2OND A;  4TRQ A;  1N9A A;  3SHF A;  3SF4 A;  1LD7 A;  2IY0 C;  1E90 A;  2GRN B;  2E2E A;  5FZS A;  3MKQ A;  3RIB A;  2XRY A;  4A63 B;  2R17 C;  3UTM A;  4OVU A;  4FAD A;  1BU9 A;  3FTU A;  4EHM A;  3CVN A;  4K0R A;  5CEC B;  3ASF A;  3N71 A;  1G3N B;  3ESL A;  3JUI A;  4F6R D;  1KZO A;  4EZK A;  4ATZ D;  3Q15 A;  3D9H A;  4DLO A;  3BUA A;  5G04 C;  3MCX A;  4GCN A;  4U8Y D;  4J8E A;  3UUX A;  2H6G A;  5KCM A;  1ZB1 A;  2JAB A;  3C3Q A;  3RRU A;  4J8D A;  1DVP A;  4DX1 A;  1RW2 A;  4EZJ A;  1SVX A;  5EDS A;  4PUC A;  4OAU C;  1EDU A;  1KPS B;  4O6F A;  1MX6 A;  5KNG A;  3MGB A;  3APD A;  4GA2 A;  2P9I G;  4GMR A;  3TWR A;  4XI9 A;  1JWF A;  3Q9U C;  2V0P A;  3E34 A;  3UM0 A;  2WVI A;  4HXI A;  2XGM A;  3QB2 A;  3Q73 A;  1HG5 A;  3LY7 A;  1YYH A;  1N4Q A;  4J6I A;  4XKC A;  4KVM A;  5G05 C;  5ANL A;  5HRY A;  3B7R L;  3EIJ A;  1YA0 A;  3FTS A;  4GYO A;  1A17 A;  4L1B A;  4LSZ E;  4O1O A;  2Y4U A;  3L82 A;  2XEN A;  3HVE A;  5FJY A;  1XNF A;  4ZHB A;  4YDO A;  5AJL A;  4UI9 J;  3UXG A;  2CG3 A;  5FWQ A;  2I1J A;  4YDY A;  3QDN A;  4TUM A;  4A3T A;  3CHO A;  4BT9 A;  3NOC D;  4W9R A;  5JA4 D;  4TXR A;  4PDX A;  2Q7F A;  3Q75 A;  4OYS A;  1Z6T A;  4WWP A;  1KLX A;  5FTP A;  3L16 A;  3WXX A;  4R7L A;  3HXF A;  4K03 A;  3ZXP A;  5LFA A;  4GAA A;  2ZIR A;  5JJ6 A;  2ZU6 B;  4J0U A;  1N4R A;  1LF8 A;  3FHE A;  3FEX A;  2X6K A;  2V4H C;  1E8Y A;  5EX3 A;  1TR4 A;  1PC2 A;  1N94 A;  2IOL A;  5T3R A;  2X6F A;  1MYO A;  3ZKJ A;  2VTB A;  2CG2 A;  4HOT A;  5A7D B;  4XX5 A;  2NXP A;  4KMO A;  4F7A A;  1IQR A;  5C2Y A;  5J90 A;  3TWV A;  3GZ2 A;  3NAW A;  4A55 A;  4KT6 B;  4OAV B;  3ZYK A;  4UUC A;  3IV0 A;  4F1S A;  1S70 B;  3PS6 A;  3ZPJ A;  4G26 A;  2ILR A;  2RD0 A;  3CHS A;  2QYU A;  3G2S A;  2FO1 E;  3KSL A;  3W9G A;  4YDW A;  3MV2 B;  4K5C A;  5FIN A;  3UIP C;  1K3Z D;  1H6P A;  3QK0 A;  4FHJ A;  5BT1 A;  3OTN A;  4GZ3 A;  1SW6 A;  3FU0 A;  3RO3 A;  1EPU A;  1KZP A;  1MX4 A;  4L2L A;  5HS0 A;  2QC9 A;  4C0M A;  5HI7 A;  3C5R A;  3PZ2 A;  3ZYQ A;  3ULE G;  4WND A;  3FDH A;  5CMY A;  4Q94 A;  5KJN A;  3QC1 A;  5BNW A;  3KD7 A;  3ESK A;  2HE0 A;  3TWW A;  1JPL A;  4MLP A;  5EYL A;  3HDX A;  3ML8 A;  3TGO A;  5EYP F;  3C3O A;  3FUM A;  2ZIS A;  3I4R B;  3DSV A;  2LAH A; 
#chains in the Genus database with same CATH homology
 2LXM A;  2RKK A;  4TXR A;  4TXQ A;  2LUH A;  4TXP A;  4U7E B;  5H7P A;  2LXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...