4TXPA

Crystal structure of lip5 n-terminal domain
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
156
structure length
156
Chain Sequence
ALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Novel Mechanism of Regulating the ATPase VPS4 by Its Cofactor LIP5 and the Endosomal Sorting Complex Required for Transport (ESCRT)-III Protein CHMP5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Vacuolar protein sorting-associated protein VTA1 homolog
total genus 63
structure length 156
sequence length 156
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04652 Vta1 Vta1 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.270 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Vacuolar protein sorting-associated protein vta1 4txpA00
2LXLA 4TXQA 4TXPA 2RKKA 2LXMA 4TXRA 4U7EB 5H7PA 2LUHA
chains in the Genus database with same CATH superfamily
4KVOA 3HHMA 4DI4A 4GPMA 4KZ0A 3UTMA 2LSVA 4BETA 4F1SA 4OAUC 2J9QA 1NZNA 3CHOA 1LF8A 1QZ2A 4L2YA 3QDNA 3AS8A 1MZCA 4O1OA 3NB2A 2GRNB 1OUVA 3UKRG 3SFZA 3CVXA 4GTTA 4U0ZA 2LNIA 4LNBA 4AY6A 1O1TA 4EPZA 3HIZA 2PQRA 5D0OD 2H6FA 1ZB1A 1O5MA 2BKKB 5HRYA 4HOSA 2I2OA 3ONKA 5AQ9A 2P9KG 3LY8A 2XEHA 3Q9UC 3AG3E 1MHQA 1K1BA 3SGHA 4BT9A 2OVFA 4BSXA 2WMNA 4WNDA 1WDYA 2ILRA 4HS2A 1MX6A 3D9HA 3AG2E 4ZHBA 5G55A 1D8EA 2YNQA 4FLHA 4U63A 4MS6A 4RVBA 2KZTA 5BXOA 1HU3A 3GZ1A 4WWNA 5G04C 4KMOA 1OCRE 4LSZE 3Q9NC 3JUIA 4F3VA 1TYQG 3CSTA 3PE4A 2XGSA 3QKYA 4K5CA 1U2VG 3K9IA 4OAVB 2AWIA 5AN8A 4ANWA 3I4RB 2Y4TA 2V8SE 1MYOA 3LDZA 2ONDA 3OXGA 3IEGA 4HI9A 1K8KG 4E85A 2WXPA 3OXFA 5B1BE 3V2OA 2HE0A 3DSSA 4AY5A 1TN8A 3HXDA 4I9CA 2IONA 5KJLA 2CFZA 5D2MC 4ILIA 2R05A 1E8WA 2GW1A 3SO8A 1QQEA 3GW4A 3BEEA 2IFUA 2IO3C 4WAFA 3WXXA 5FQ8A 3TAXA 2EILE 3UQ3A 5LOZA 5AARA 2A4ZA 2VGXB 3HG0D 2WQ7A 3MV3B 2H6HA 3PUKA 1NL4A 4JEUA 1H2TC 2GRPB 4LEUA 4A3TA 3J5PA 4W9RA 1EYHA 2WXLA 2ETAA 4FHJA 3RAUA 5EX3A 1NA0A 4APOA 3CSFA 2GRQB 3R9AB 3HRAA 5AAOA 3ASDA 3FUEA 1MX4A 3FU0A 4A63B 4G8KA 4JZYA 5CERB 2PM6A 3T8MA 3MX3A 2WXRA 3TWUA 4BESA 3ABKE 3DWLG 3LVQE 2XRZA 2VSYA 4BWRA 2R03A 1W3BA 5FTPA 3NOGD 4XZ4A 4ACKA 3ESLA 2YHEA 1YMPA 4GZ6A 3UXGA 1MJ0A 3SF4A 4GYWA 1Z6TA 1LD7A 3L9TA 4TUUA 4AJWA 2EIJE 4LRZA 3Q75A 2KM4A 3QWWA 3T9KA 3KD7A 2H6IA 3Q78A 5D0QD 4ATGA 1RW2A 2J07A 4C9BB 3VLFA 5G05J 3B7UX 5ENPD 4KZCA 3B7RL 2WXJA 1V55E 3DSWA 4DX6D 1O1RA 1TNUA 1V54E 3Q15A 1ELWA 3G2TA 1N0QA 2WMOA 3BQOA 3D9KA 2ZXWE 3FEXA 2F8YA 4YDYA 3ZXSA 4CDMA 3FEYA 1NFIE 2ZGDA 2AW6A 3ZUVB 1INZA 2QYJA 3AU4A 5KNGA 4BY6A 2WXMA 4FJZA 2GRMA 4U8VD 5FIOA 3DPYA 4HRNA 4U0UA 2IQCA 5ENQD 2XENA 2AVPA 5LP0A 3UT4A 4DUIA 1H2VC 3LYAA 3CQGB 1IHBA 1YCSB 5AQAA 3FTYA 3IV0A 2EIKE 2XGOA 3D9LA 3S7FA 1SA5A 3EHQA 2WQ6A 4HFGA 2B0OE 4FADA 4QQIA 4UWLA 1BI8B 4N5QA 4GTRA 2VGXA 3MJWA 2E0IA 2XPZA 3URZA 3DXMG 4NQ0A 3TWSA 3PNTB 3CHRA 3PVLA 3L16A 3EU5A 5ENSD 2MRIA 4O1PA 5CECB 2CG2A 3B7SA 2WXFA 1D9SA 3UPVA 4RG6A 4CYMD 2JLBA 4FC8A 5CBNA 5KCMA 5LCWC 5HS0A 4RLYA 2XZTG 3HXFA 3ASNE 5ENTD 5E75A 3P2BA 3PE3A 5FZQA 1D8DA 4PUCA 2L0TB 3ML8A 3VTXA 4HQDA 3D9JA 2WXQA 2P9SG 4AEZC 1IKND 4L23A 2QYUA 5FINA 3FDHA 4EBAG 4L2LA 4HRLA 2KBXA 3DBSA 4GU5A 3PREA 1S70B 3MYVA 1DCEA 3RRMB 4GYYA 4JW1A 4JL0A 3ASGA 3RSEG 3L82A 1OWMA 3RKVA 1SZ9A 5D66A 5BT1A 3ZIMA 3UT7A 2JEKA 3APDA 3LVRE 4CRWA 2YHCA 3SFYA 3G2SA 3ML9A 4HBDA 4G23A 3J5QB 3UM2A 4AXHA 3KAEA 1OWNA 2VGEA 4HOQA 5CRUA 1KPSB 2WXOA 2IOLA 3UUXA 3EHNA 4EZJA 1X5BA 3HXCA 1KLXA 2XPYA 3ZU7B 5FZRA 4U96D 4NIKA 5KJKA 4WUYA 3GZ2A 3S7BA 1YA0A 2EINE 3FWVA 3T5XA 1XGWA 4EECA 3Q7AA 4Q94A 2I1JA 5KJMA 3NOCD 1UN9A 1N4RA 4CCAA 4URKA 2WXNA 2P2CP 2R5SA 1FT2A 4D10C 3KSQA 2GRRB 5ANRA 3FP3A 3FTZA 1A5EA 4JPSA 3OAWA 2KCVA 1OXJA 4MBGA 2AXVA 3HDXA 1E8ZA 3D9MA 1IXVA 4DK5A 2FEZA 4AVXA 3C5RA 3G2VA 4YDEA 4Q96A 3CVVA 5JHBA 2KCKA 3W9GA 4GTOA 2DWZA 5M72A 3KS2A 4G24A 4AM9A 3CIAA 1UOHA 5BW8C 4UI9K 3O4ZA 2VYIA 4TV3A 5EKQD 2XCBA 4UWKA 4JB8P 2QY7A 1X81A 1DCQA 3LS8A 1HF8A 5JMND 3TWWA 3CK9A 3D9OA 3UINC 4P29A 4K0RA 3CV0A 2QFCA 4F7AA 5JJTA 3IHYA 1XNFA 4U07A 4J8DA 3UM1A 2FBNA 3L54A 5CEDB 2RG8A 2OVBA 2BKGA 3KEAA 4I1OB 4XKCA 5HKPA 4G2VA 2R2LA 4G25A 3NF1A 2WXGA 3O48A 1N4QA 3I5PA 5AJDA 1NP7A 4A3VA 4HI8A 3Q47B 5EN5D 2P9LG 3TWQA 2FI7A 2KC7A 3KEZA 4DX5D 4Z68A 4C0MA 5BV1A 1FCHA 4BX8A 2PM7A 3APFA 1E8YA 2ETBA 4GTVA 2Q7FA 1JWFA 3MA5A 3EJNA 2F37A 3MGBA 4YVQC 4J8FA 4JA7A 4HOTA 3HYMB 2FULA 2Y69E 3UX4A 4IRUA 4DLQA 3S7JA 2Y1LE 2R59A 5EYPF 3IHVA 2P9NG 3S2AA 3PZ2A 2X38A 4XIFA 4GCNA 1WY6A 3FU3A 3AG4E 3C98A 4L9PA 4BX9A 3TWXA 3TL5A 4UI9C 4JA9A 2X6IA 5JJ6A 4B8CB 3JQ1A 5CBOA 2UY1A 5ITZF 3U3WA 3CHMA 4N2SA 3SBSA 5AENA 5JJ7A 4ABNA 4N5CA 2IO2C 3ZYMA 4M7CA 1E96B 2MHKA 4GZ3A 2E2EA 2HYZA 4NURA 3CK8A 4K5BA 2JABA 3FUMA 2HR2A 4HRMB 2CHZA 3EIQC 4ME2A 4JEHA 5LFAA 3PNLB 4E6HA 2J49A 4BERA 1HE8A 3L13A 3FH8A 3ZXPA 2PL2A 3GZSA 3BG0B 3UI2A 4FU3A 4L1BA 1KT1A 4WWPA 1N94A 5CCLA 4JD2G 3DEPA 1S64A 4CGVA 4CT4A 2B6CA 5BV0A 2MYOA 4CDNA 5ENNA 4I1MA 3LJ3A 3I3NA 3LKUA 1JWGA 5ANLA 4A1SA 3CVWA 1H6PA 1Y6IA 4FLBA 3FFLA 3VTYA 4CEMA 2L9BA 3SZ7A 5C1DA 1OCZE 3ISMC 3UM3A 3CVLA 2M63A 3ZHEA 4GZ5A 2NXPA 1RZ4A 4GA2A 2KATA 1HG2A 3VLDA 1OCOE 4ATZD 3U4TA 3CVYA 3SBTB 1N4PA 4EZKA 1SQMA 4KYOB 1YYHA 3B7TA 4JVSA 2BTDA 4FA6A 2ZISA 4DLOA 3EHRA 4U8YD 4YDOA 3HVEB 5KBAA 3UT8A 1TJCA 1ELRA 1BI7B 3PH0C 3MKRA 1JCQA 3LPZA 2WXHA 5T8IA 1KZOA 3HXEA 3E4BA 3ZFWA 3U9WA 3DSTA 4KBQA 1OY3D 5AJLA 2DZOA 2FF4A 2XPIA 2VSNA 4UQXA 1A17A 5KNHD 5CCMA 2A5EA 4XI9A 1EDUA 2CG3A 2VGYA 1BU9A 2I9CA 2BF0X 4GYOA 2IU1A 5A6CA 4DJAA 1BLXB 2IOSA 4GAAA 3ZYLA 4FP7A 1U3CA 4DPRA 2XEEA 3ZVVA 4X8QA 3ZNGA 3FH7A 4JHKA 3U64A 4CGWA 1K3ZD 3MCXA 3X2QE 5CRVA 2AXUA 2XRYA 5FQ4A 3FULA 4DX2A 1O1SA 2VTBA 3RK6A 4IYPA 4GTPA 1JCRA 2P9IG 4A55A 1WG0A 3TJPA 1HZ4A 1Z3XA 2X6JA 2GGFA 5FWQA 2RD0A 2XEVA 3LJNA 5FJYA 3SFXA 2HM8A 4B93B 5EIDA 4YVOA 3RO3A 1TNYA 5J08A 2VQ2A 1IQUA 4FJYA 4GTSA 1HFAA 2OEVA 1ZBPA 1QNFA 1EPUA 2BUGA 4RQIA 2NYJA 5IY5E 4TXQA 1OWLA 3EIJA 1TJFA 3Q5MA 4JC8A 4EQFA 3LY9A 3BUAA 3QOUA 2NC9A 2IF4A 3JCKC 2X6HA 3RJVA 4BT8A 4PS8A 5HI7A 2LAIA 3PEVB 4RG9A 3QC1A 4G8LA 3C3OA 4NRHB 1KT0A 1VDYA 2XCCA 4F6RD 2Y3AA 4H7YA 4I6GA 3CGHA 3RO2A 4I6EA 2KCLA 3FTSA 2WB2A 1MX2A 3E33A 1U3DA 4PH4B 2R02A 3L6AA 4GMLA 3CLJA 3LEWA 2X6KA 2LXMA 4HNAD 1E90A 2PZIA 1N9AA 4ZFHA 2VTBB 1PY1A 3R7RA 1HH8A 5G2NA 4ANUA 3RIBA 2J08A 3CQCB 1QBQA 3JXJA 3FTWA 4YNDA 3TG4A 1LTXA 2C0MA 4WNGA 3ZRHA 2EQXA 3QARA 3JXIA 3CVPA 3P1UA 2P9PG 5G04J 4B89A 4K5AB 1PC2A 3E37A 2XS1A 2UY1B 4LNGA 3L22A 1OCCE 3RU0A 4BTBA 3Q4AB 3ASHA 1EF1C 4HXIA 1PAQA 3FUDA 4LCTA 3E32A 3D3MA 4IN3B 5EIBE 4U7EB 3Q73A 1TEZA 3PZDA 3D9NA 4I43A 3UM0A 4JXTA 5BPPA 3NZUA 4L7TA 2V5FA 1WM5A 3IBEA 2VJ8A 3C3QA 2GROB 3CVUA 2DBAA 5FT9A 4XI0A 3GYZA 3PZ1A 4N3BA 3L08A 3ZYQA 4HLLA 3AU5A 1S0PA 3DSUA 3FY4A 4GZCA 3CEQA 3FUKA 3N71A 3SNXA 3FUNA 5HQ8A 3ESKA 1UJJA 1SW6A 4V3IA 4UQZA 3FUIA 3C3RA 2IJGX 4AIFA 3PZ4A 1Z5SC 3FTXA 1N54A 5ARFA 2RFAA 2Y0BG 2IY0C 3FUJA 1E8XA 2GRLA 4J7WA 2XHEA 2L6JA 3PZ3A 5DBKA 3QNKA 4MKTA 3PUJA 2F8XK 3C72A 3JQ0A 3T8KA 2V5QC 4WNFA 4C0EA 1BPOA 3HXBA 4FHKA 3ABLE 2P9UG 4TXRA 1NA3A 3QAQA 5G05C 4QFVA 1N0RA 1N95A 1OT8A 2DVWA 2V4HC 2HO1A 3ULEG 3ZHEB 4Y6CA 1HS6A 4J8SA 4XX5A 3L17A 5EX0A 2AJAA 3QK0A 1UW4B 3AAAC 4B8AA 1TNZA 3LY7A 4AP2A 4EHMA 3JYSA 4MLPA 3LXUX 3LCAA 4CT0A 2AXZA 2A5UA 5BNWA 4I2ZA 4H7XA 4AOFA 2RFMA 1E7VA 3TWVA 2LUHA 5ENRD 5KJNA 2H6GA 3SHFA 3SQVA 5AQBA 4BFRA 3Q7FA 3B13A 1AP7A 4EBAA 3PS6A 1SVXA 1G3NB 2DYSE 2ZIRA 4O6FA 2IEJA 2WM9A 3PEUB 2CHWA 2OOEA 4I6JA 4UWFA 3R9MA 3RRUA 2C0LA 3WG7E 5KWDA 1TN6A 2EIME 5LX8A 4XKBA 3ULYA 5C2YA 5B3SE 4NACA 2DIWA 3IKOB 2PQNA 5ARGA 4HVBA 2DZNA 1GW6A 5AQ7A 2RKKA 4YDWA 3KSLA 2XQ0A 4F53A 4WWOA 4G11A 2X3MA 4BTAA 3AS5A 4HB5A 3EHMA 2ZU6B 2CHXA 3FH5A 3CHQA 4I17A 3DPDA 2MOWA 4J6IA 1H0AA 1UN8A 2V0PA 4XE0A 5DIZA 5AYWD 5JA4D 3DXKG 2P58C 3W9FA 5CMWA 2VSOE 3CKBA 3FUHA 3UIOC 2XZDG 5EYLA 1Z3YA 4GTMA 3MEKA 4B94A 1N11A 2BEDA 4MRUA 3FU5A 1UG3A 2I6HA 1S63A 1H6KA 1IYGA 1HX8A 3QJZA 4DRXE 5FQ7A 5JHAA 3SD5A 4DX7D 3ZKJA 3V2XA 2CFUA 3NAWA 2LSUA 1BD8A 3D9IA 1HO8A 4I9EA 5J90A 1OWPA 3V31A 2V4LA 4LG6A 3FHEA 2KXPC 4GA0A 4J8EA 1HXIA 3B7BA 5B1AE 3ZEFA 3UIPC 2J4BA 3AG1E 5BUZA 1FVFA 4GZDA 3ASFA 4UWHA 3TG5A 3MKQB 3ZGQA 2OCCE 3TWRA 4GMRA 3ZYKA 5EDSA 1B89A 4GMJA 5AIJA 4TUMA 1L5JA 3TWTA 4F1PA 3DSXA 1KZPA 2I1KA 2FO7A 3ENEA 2VSXE 2J4DA 4Y6WA 4LERA 4RSYA 3R7QA 4G26A 1SA4A 2YQ8A 4PS7A 3CKCA 3Q49B 4KXKB 3AJIA 4OVUA 2J09A 3CR3A 5FZSA 3ZN3A 1HG5A 4TRQA 3FTVA 4A1GA 2FO1E 3AS4A 3MKQA 2QZAA 3TXNA 1IHGA 1NI1A 2LXLA 3EUVA 3TXMA 5T4YA 4CDRA 4EZLA 1E7UA 2XGMA 4B0ZA 3DRAA 3QWVA 1MQSA 3Q79A 4IULA 4KT6B 4U0SA 1H6OA 3ZW3A 3S7DA 4HORA 4JHRA 1TNOA 1LD8A 1P5QA 1H19A 1WAO1 4N39A 4I1AA 3UMVA 2ETCA 2F0YA 1DVPA 3MV2B 3NZSA 3MZLB 4KVMA 1ELKA 4GB9A 3OXLA 3UKUG 2DYRE 2OV8A 3ONLA 2WXIA 3OTNA 4LNUD 5A23A 2ZGGA 3DEOA 3APCA 3PRZA 5LCWJ 1TN7A 2LO6A 3QWPA 4U8HA 3T5VA 1H2UA 3CVNA 4OVVA 5H7PA 2UWJG 1FPPA 3SY2A 4BSZB 3F6QA 4ACLA 2WPVA 1DC2A 3PDNA 3HVEA 4ILHB 1K1AA 4N3CA 1FVHA 4J8YA 2LAHA 3G2UA 5CHEE 1UJKA 4PS3A 1AWCB 3EU9A 3QB2A 4DI3A 3G2WA 2OEWA 3V79K 3EDTB 2WQHA 2WXKA 3ULQA 1JUQA 4LUNU 3RRNB 4GTQA 3FTUA 4M3OA 4FULA 5FQ6A 1TR4A 4XEIG 5EILA 1QYMA 1SZAA 3ZPJA 4UWGA 1JPLA 4Q69A 2QC9A 4UUCA 5A7DB 1JCSA 2Y4UA 4R7LA 4AV7A 5ENOD 4OYSA 1Y8MA 1OWOA 3TGOA 4I2WA 4WNEA 3CHPA 4N2QA 4GPKA 4UQYA 3U66A 2NSZA 2X6FA 4J0UA 4ANVA 3FUFA 3B95A 3FU6A 1DNPA 2C2LA 4ANXA 1IQRA 3CHSA 3IXEA 3ASOE 1N4SA 1Q2ZA 3SI5A 4GA1A 3BG1B 4JHJA 4C48B 3CVQA 2PNNA 3JUEA 2WVIA 3I4GA 4HOUA 4K03A 2YINA 3DSVA 3CK7A 3ABME 4CZ2D 4DX1A 1ZU2A 2J8SD 3BU8A 3V30A 3VLEA 4U95D 2XS8A 3NBNB 5BXUA 2L0IA 4G1TA 4UI9J 4BEPA 1TNBA 1N52A 4APFA 4U04A 3E34A 5E76A 4O60A 4GCOA 3NQPA 5T3RA 4TXPA 4HLEA 2KZTB 2DCPA 4PDXA 2L6BA 4ILGA 5CEAA 5CMYA 3E30A 1FT1A 4N3AA 3D9PA 2R17C
chains in the Genus database with same CATH topology
2LXLA 4TXQA 4TXPA 2RKKA 2LXMA 4TXRA 4U7EB 5H7PA 2LUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LXL A;  4TXQ A;  4TXP A;  2RKK A;  2LXM A;  4TXR A;  4U7E B;  5H7P A;  2LUH A; 
#chains in the Genus database with same CATH topology
 4KVO A;  3HHM A;  4DI4 A;  4GPM A;  4KZ0 A;  3UTM A;  2LSV A;  4BET A;  4F1S A;  4OAU C;  2J9Q A;  1NZN A;  3CHO A;  1LF8 A;  1QZ2 A;  4L2Y A;  3QDN A;  3AS8 A;  1MZC A;  4O1O A;  3NB2 A;  2GRN B;  1OUV A;  3UKR G;  3SFZ A;  3CVX A;  4GTT A;  4U0Z A;  2LNI A;  4LNB A;  4AY6 A;  1O1T A;  4EPZ A;  3HIZ A;  2PQR A;  5D0O D;  2H6F A;  1ZB1 A;  1O5M A;  2BKK B;  5HRY A;  4HOS A;  2I2O A;  3ONK A;  5AQ9 A;  2P9K G;  3LY8 A;  2XEH A;  3Q9U C;  3AG3 E;  1MHQ A;  1K1B A;  3SGH A;  4BT9 A;  2OVF A;  4BSX A;  2WMN A;  4WND A;  1WDY A;  2ILR A;  4HS2 A;  1MX6 A;  3D9H A;  3AG2 E;  4ZHB A;  5G55 A;  1D8E A;  2YNQ A;  4FLH A;  4U63 A;  4MS6 A;  4RVB A;  2KZT A;  5BXO A;  1HU3 A;  3GZ1 A;  4WWN A;  5G04 C;  4KMO A;  1OCR E;  4LSZ E;  3Q9N C;  3JUI A;  4F3V A;  1TYQ G;  3CST A;  3PE4 A;  2XGS A;  3QKY A;  4K5C A;  1U2V G;  3K9I A;  4OAV B;  2AWI A;  5AN8 A;  4ANW A;  3I4R B;  2Y4T A;  2V8S E;  1MYO A;  3LDZ A;  2OND A;  3OXG A;  3IEG A;  4HI9 A;  1K8K G;  4E85 A;  2WXP A;  3OXF A;  5B1B E;  3V2O A;  2HE0 A;  3DSS A;  4AY5 A;  1TN8 A;  3HXD A;  4I9C A;  2ION A;  5KJL A;  2CFZ A;  5D2M C;  4ILI A;  2R05 A;  1E8W A;  2GW1 A;  3SO8 A;  1QQE A;  3GW4 A;  3BEE A;  2IFU A;  2IO3 C;  4WAF A;  3WXX A;  5FQ8 A;  3TAX A;  2EIL E;  3UQ3 A;  5LOZ A;  5AAR A;  2A4Z A;  2VGX B;  3HG0 D;  2WQ7 A;  3MV3 B;  2H6H A;  3PUK A;  1NL4 A;  4JEU A;  1H2T C;  2GRP B;  4LEU A;  4A3T A;  3J5P A;  4W9R A;  1EYH A;  2WXL A;  2ETA A;  4FHJ A;  3RAU A;  5EX3 A;  1NA0 A;  4APO A;  3CSF A;  2GRQ B;  3R9A B;  3HRA A;  5AAO A;  3ASD A;  3FUE A;  1MX4 A;  3FU0 A;  4A63 B;  4G8K A;  4JZY A;  5CER B;  2PM6 A;  3T8M A;  3MX3 A;  2WXR A;  3TWU A;  4BES A;  3ABK E;  3DWL G;  3LVQ E;  2XRZ A;  2VSY A;  4BWR A;  2R03 A;  1W3B A;  5FTP A;  3NOG D;  4XZ4 A;  4ACK A;  3ESL A;  2YHE A;  1YMP A;  4GZ6 A;  3UXG A;  1MJ0 A;  3SF4 A;  4GYW A;  1Z6T A;  1LD7 A;  3L9T A;  4TUU A;  4AJW A;  2EIJ E;  4LRZ A;  3Q75 A;  2KM4 A;  3QWW A;  3T9K A;  3KD7 A;  2H6I A;  3Q78 A;  5D0Q D;  4ATG A;  1RW2 A;  2J07 A;  4C9B B;  3VLF A;  5G05 J;  3B7U X;  5ENP D;  4KZC A;  3B7R L;  2WXJ A;  1V55 E;  3DSW A;  4DX6 D;  1O1R A;  1TNU A;  1V54 E;  3Q15 A;  1ELW A;  3G2T A;  1N0Q A;  2WMO A;  3BQO A;  3D9K A;  2ZXW E;  3FEX A;  2F8Y A;  4YDY A;  3ZXS A;  4CDM A;  3FEY A;  1NFI E;  2ZGD A;  2AW6 A;  3ZUV B;  1INZ A;  2QYJ A;  3AU4 A;  5KNG A;  4BY6 A;  2WXM A;  4FJZ A;  2GRM A;  4U8V D;  5FIO A;  3DPY A;  4HRN A;  4U0U A;  2IQC A;  5ENQ D;  2XEN A;  2AVP A;  5LP0 A;  3UT4 A;  4DUI A;  1H2V C;  3LYA A;  3CQG B;  1IHB A;  1YCS B;  5AQA A;  3FTY A;  3IV0 A;  2EIK E;  2XGO A;  3D9L A;  3S7F A;  1SA5 A;  3EHQ A;  2WQ6 A;  4HFG A;  2B0O E;  4FAD A;  4QQI A;  4UWL A;  1BI8 B;  4N5Q A;  4GTR A;  2VGX A;  3MJW A;  2E0I A;  2XPZ A;  3URZ A;  3DXM G;  4NQ0 A;  3TWS A;  3PNT B;  3CHR A;  3PVL A;  3L16 A;  3EU5 A;  5ENS D;  2MRI A;  4O1P A;  5CEC B;  2CG2 A;  3B7S A;  2WXF A;  1D9S A;  3UPV A;  4RG6 A;  4CYM D;  2JLB A;  4FC8 A;  5CBN A;  5KCM A;  5LCW C;  5HS0 A;  4RLY A;  2XZT G;  3HXF A;  3ASN E;  5ENT D;  5E75 A;  3P2B A;  3PE3 A;  5FZQ A;  1D8D A;  4PUC A;  2L0T B;  3ML8 A;  3VTX A;  4HQD A;  3D9J A;  2WXQ A;  2P9S G;  4AEZ C;  1IKN D;  4L23 A;  2QYU A;  5FIN A;  3FDH A;  4EBA G;  4L2L A;  4HRL A;  2KBX A;  3DBS A;  4GU5 A;  3PRE A;  1S70 B;  3MYV A;  1DCE A;  3RRM B;  4GYY A;  4JW1 A;  4JL0 A;  3ASG A;  3RSE G;  3L82 A;  1OWM A;  3RKV A;  1SZ9 A;  5D66 A;  5BT1 A;  3ZIM A;  3UT7 A;  2JEK A;  3APD A;  3LVR E;  4CRW A;  2YHC A;  3SFY A;  3G2S A;  3ML9 A;  4HBD A;  4G23 A;  3J5Q B;  3UM2 A;  4AXH A;  3KAE A;  1OWN A;  2VGE A;  4HOQ A;  5CRU A;  1KPS B;  2WXO A;  2IOL A;  3UUX A;  3EHN A;  4EZJ A;  1X5B A;  3HXC A;  1KLX A;  2XPY A;  3ZU7 B;  5FZR A;  4U96 D;  4NIK A;  5KJK A;  4WUY A;  3GZ2 A;  3S7B A;  1YA0 A;  2EIN E;  3FWV A;  3T5X A;  1XGW A;  4EEC A;  3Q7A A;  4Q94 A;  2I1J A;  5KJM A;  3NOC D;  1UN9 A;  1N4R A;  4CCA A;  4URK A;  2WXN A;  2P2C P;  2R5S A;  1FT2 A;  4D10 C;  3KSQ A;  2GRR B;  5ANR A;  3FP3 A;  3FTZ A;  1A5E A;  4JPS A;  3OAW A;  2KCV A;  1OXJ A;  4MBG A;  2AXV A;  3HDX A;  1E8Z A;  3D9M A;  1IXV A;  4DK5 A;  2FEZ A;  4AVX A;  3C5R A;  3G2V A;  4YDE A;  4Q96 A;  3CVV A;  5JHB A;  2KCK A;  3W9G A;  4GTO A;  2DWZ A;  5M72 A;  3KS2 A;  4G24 A;  4AM9 A;  3CIA A;  1UOH A;  5BW8 C;  4UI9 K;  3O4Z A;  2VYI A;  4TV3 A;  5EKQ D;  2XCB A;  4UWK A;  4JB8 P;  2QY7 A;  1X81 A;  1DCQ A;  3LS8 A;  1HF8 A;  5JMN D;  3TWW A;  3CK9 A;  3D9O A;  3UIN C;  4P29 A;  4K0R A;  3CV0 A;  2QFC A;  4F7A A;  5JJT A;  3IHY A;  1XNF A;  4U07 A;  4J8D A;  3UM1 A;  2FBN A;  3L54 A;  5CED B;  2RG8 A;  2OVB A;  2BKG A;  3KEA A;  4I1O B;  4XKC A;  5HKP A;  4G2V A;  2R2L A;  4G25 A;  3NF1 A;  2WXG A;  3O48 A;  1N4Q A;  3I5P A;  5AJD A;  1NP7 A;  4A3V A;  4HI8 A;  3Q47 B;  5EN5 D;  2P9L G;  3TWQ A;  2FI7 A;  2KC7 A;  3KEZ A;  4DX5 D;  4Z68 A;  4C0M A;  5BV1 A;  1FCH A;  4BX8 A;  2PM7 A;  3APF A;  1E8Y A;  2ETB A;  4GTV A;  2Q7F A;  1JWF A;  3MA5 A;  3EJN A;  2F37 A;  3MGB A;  4YVQ C;  4J8F A;  4JA7 A;  4HOT A;  3HYM B;  2FUL A;  2Y69 E;  3UX4 A;  4IRU A;  4DLQ A;  3S7J A;  2Y1L E;  2R59 A;  5EYP F;  3IHV A;  2P9N G;  3S2A A;  3PZ2 A;  2X38 A;  4XIF A;  4GCN A;  1WY6 A;  3FU3 A;  3AG4 E;  3C98 A;  4L9P A;  4BX9 A;  3TWX A;  3TL5 A;  4UI9 C;  4JA9 A;  2X6I A;  5JJ6 A;  4B8C B;  3JQ1 A;  5CBO A;  2UY1 A;  5ITZ F;  3U3W A;  3CHM A;  4N2S A;  3SBS A;  5AEN A;  5JJ7 A;  4ABN A;  4N5C A;  2IO2 C;  3ZYM A;  4M7C A;  1E96 B;  2MHK A;  4GZ3 A;  2E2E A;  2HYZ A;  4NUR A;  3CK8 A;  4K5B A;  2JAB A;  3FUM A;  2HR2 A;  4HRM B;  2CHZ A;  3EIQ C;  4ME2 A;  4JEH A;  5LFA A;  3PNL B;  4E6H A;  2J49 A;  4BER A;  1HE8 A;  3L13 A;  3FH8 A;  3ZXP A;  2PL2 A;  3GZS A;  3BG0 B;  3UI2 A;  4FU3 A;  4L1B A;  1KT1 A;  4WWP A;  1N94 A;  5CCL A;  4JD2 G;  3DEP A;  1S64 A;  4CGV A;  4CT4 A;  2B6C A;  5BV0 A;  2MYO A;  4CDN A;  5ENN A;  4I1M A;  3LJ3 A;  3I3N A;  3LKU A;  1JWG A;  5ANL A;  4A1S A;  3CVW A;  1H6P A;  1Y6I A;  4FLB A;  3FFL A;  3VTY A;  4CEM A;  2L9B A;  3SZ7 A;  5C1D A;  1OCZ E;  3ISM C;  3UM3 A;  3CVL A;  2M63 A;  3ZHE A;  4GZ5 A;  2NXP A;  1RZ4 A;  4GA2 A;  2KAT A;  1HG2 A;  3VLD A;  1OCO E;  4ATZ D;  3U4T A;  3CVY A;  3SBT B;  1N4P A;  4EZK A;  1SQM A;  4KYO B;  1YYH A;  3B7T A;  4JVS A;  2BTD A;  4FA6 A;  2ZIS A;  4DLO A;  3EHR A;  4U8Y D;  4YDO A;  3HVE B;  5KBA A;  3UT8 A;  1TJC A;  1ELR A;  1BI7 B;  3PH0 C;  3MKR A;  1JCQ A;  3LPZ A;  2WXH A;  5T8I A;  1KZO A;  3HXE A;  3E4B A;  3ZFW A;  3U9W A;  3DST A;  4KBQ A;  1OY3 D;  5AJL A;  2DZO A;  2FF4 A;  2XPI A;  2VSN A;  4UQX A;  1A17 A;  5KNH D;  5CCM A;  2A5E A;  4XI9 A;  1EDU A;  2CG3 A;  2VGY A;  1BU9 A;  2I9C A;  2BF0 X;  4GYO A;  2IU1 A;  5A6C A;  4DJA A;  1BLX B;  2IOS A;  4GAA A;  3ZYL A;  4FP7 A;  1U3C A;  4DPR A;  2XEE A;  3ZVV A;  4X8Q A;  3ZNG A;  3FH7 A;  4JHK A;  3U64 A;  4CGW A;  1K3Z D;  3MCX A;  3X2Q E;  5CRV A;  2AXU A;  2XRY A;  5FQ4 A;  3FUL A;  4DX2 A;  1O1S A;  2VTB A;  3RK6 A;  4IYP A;  4GTP A;  1JCR A;  2P9I G;  4A55 A;  1WG0 A;  3TJP A;  1HZ4 A;  1Z3X A;  2X6J A;  2GGF A;  5FWQ A;  2RD0 A;  2XEV A;  3LJN A;  5FJY A;  3SFX A;  2HM8 A;  4B93 B;  5EID A;  4YVO A;  3RO3 A;  1TNY A;  5J08 A;  2VQ2 A;  1IQU A;  4FJY A;  4GTS A;  1HFA A;  2OEV A;  1ZBP A;  1QNF A;  1EPU A;  2BUG A;  4RQI A;  2NYJ A;  5IY5 E;  4TXQ A;  1OWL A;  3EIJ A;  1TJF A;  3Q5M A;  4JC8 A;  4EQF A;  3LY9 A;  3BUA A;  3QOU A;  2NC9 A;  2IF4 A;  3JCK C;  2X6H A;  3RJV A;  4BT8 A;  4PS8 A;  5HI7 A;  2LAI A;  3PEV B;  4RG9 A;  3QC1 A;  4G8L A;  3C3O A;  4NRH B;  1KT0 A;  1VDY A;  2XCC A;  4F6R D;  2Y3A A;  4H7Y A;  4I6G A;  3CGH A;  3RO2 A;  4I6E A;  2KCL A;  3FTS A;  2WB2 A;  1MX2 A;  3E33 A;  1U3D A;  4PH4 B;  2R02 A;  3L6A A;  4GML A;  3CLJ A;  3LEW A;  2X6K A;  2LXM A;  4HNA D;  1E90 A;  2PZI A;  1N9A A;  4ZFH A;  2VTB B;  1PY1 A;  3R7R A;  1HH8 A;  5G2N A;  4ANU A;  3RIB A;  2J08 A;  3CQC B;  1QBQ A;  3JXJ A;  3FTW A;  4YND A;  3TG4 A;  1LTX A;  2C0M A;  4WNG A;  3ZRH A;  2EQX A;  3QAR A;  3JXI A;  3CVP A;  3P1U A;  2P9P G;  5G04 J;  4B89 A;  4K5A B;  1PC2 A;  3E37 A;  2XS1 A;  2UY1 B;  4LNG A;  3L22 A;  1OCC E;  3RU0 A;  4BTB A;  3Q4A B;  3ASH A;  1EF1 C;  4HXI A;  1PAQ A;  3FUD A;  4LCT A;  3E32 A;  3D3M A;  4IN3 B;  5EIB E;  4U7E B;  3Q73 A;  1TEZ A;  3PZD A;  3D9N A;  4I43 A;  3UM0 A;  4JXT A;  5BPP A;  3NZU A;  4L7T A;  2V5F A;  1WM5 A;  3IBE A;  2VJ8 A;  3C3Q A;  2GRO B;  3CVU A;  2DBA A;  5FT9 A;  4XI0 A;  3GYZ A;  3PZ1 A;  4N3B A;  3L08 A;  3ZYQ A;  4HLL A;  3AU5 A;  1S0P A;  3DSU A;  3FY4 A;  4GZC A;  3CEQ A;  3FUK A;  3N71 A;  3SNX A;  3FUN A;  5HQ8 A;  3ESK A;  1UJJ A;  1SW6 A;  4V3I A;  4UQZ A;  3FUI A;  3C3R A;  2IJG X;  4AIF A;  3PZ4 A;  1Z5S C;  3FTX A;  1N54 A;  5ARF A;  2RFA A;  2Y0B G;  2IY0 C;  3FUJ A;  1E8X A;  2GRL A;  4J7W A;  2XHE A;  2L6J A;  3PZ3 A;  5DBK A;  3QNK A;  4MKT A;  3PUJ A;  2F8X K;  3C72 A;  3JQ0 A;  3T8K A;  2V5Q C;  4WNF A;  4C0E A;  1BPO A;  3HXB A;  4FHK A;  3ABL E;  2P9U G;  4TXR A;  1NA3 A;  3QAQ A;  5G05 C;  4QFV A;  1N0R A;  1N95 A;  1OT8 A;  2DVW A;  2V4H C;  2HO1 A;  3ULE G;  3ZHE B;  4Y6C A;  1HS6 A;  4J8S A;  4XX5 A;  3L17 A;  5EX0 A;  2AJA A;  3QK0 A;  1UW4 B;  3AAA C;  4B8A A;  1TNZ A;  3LY7 A;  4AP2 A;  4EHM A;  3JYS A;  4MLP A;  3LXU X;  3LCA A;  4CT0 A;  2AXZ A;  2A5U A;  5BNW A;  4I2Z A;  4H7X A;  4AOF A;  2RFM A;  1E7V A;  3TWV A;  2LUH A;  5ENR D;  5KJN A;  2H6G A;  3SHF A;  3SQV A;  5AQB A;  4BFR A;  3Q7F A;  3B13 A;  1AP7 A;  4EBA A;  3PS6 A;  1SVX A;  1G3N B;  2DYS E;  2ZIR A;  4O6F A;  2IEJ A;  2WM9 A;  3PEU B;  2CHW A;  2OOE A;  4I6J A;  4UWF A;  3R9M A;  3RRU A;  2C0L A;  3WG7 E;  5KWD A;  1TN6 A;  2EIM E;  5LX8 A;  4XKB A;  3ULY A;  5C2Y A;  5B3S E;  4NAC A;  2DIW A;  3IKO B;  2PQN A;  5ARG A;  4HVB A;  2DZN A;  1GW6 A;  5AQ7 A;  2RKK A;  4YDW A;  3KSL A;  2XQ0 A;  4F53 A;  4WWO A;  4G11 A;  2X3M A;  4BTA A;  3AS5 A;  4HB5 A;  3EHM A;  2ZU6 B;  2CHX A;  3FH5 A;  3CHQ A;  4I17 A;  3DPD A;  2MOW A;  4J6I A;  1H0A A;  1UN8 A;  2V0P A;  4XE0 A;  5DIZ A;  5AYW D;  5JA4 D;  3DXK G;  2P58 C;  3W9F A;  5CMW A;  2VSO E;  3CKB A;  3FUH A;  3UIO C;  2XZD G;  5EYL A;  1Z3Y A;  4GTM A;  3MEK A;  4B94 A;  1N11 A;  2BED A;  4MRU A;  3FU5 A;  1UG3 A;  2I6H A;  1S63 A;  1H6K A;  1IYG A;  1HX8 A;  3QJZ A;  4DRX E;  5FQ7 A;  5JHA A;  3SD5 A;  4DX7 D;  3ZKJ A;  3V2X A;  2CFU A;  3NAW A;  2LSU A;  1BD8 A;  3D9I A;  1HO8 A;  4I9E A;  5J90 A;  1OWP A;  3V31 A;  2V4L A;  4LG6 A;  3FHE A;  2KXP C;  4GA0 A;  4J8E A;  1HXI A;  3B7B A;  5B1A E;  3ZEF A;  3UIP C;  2J4B A;  3AG1 E;  5BUZ A;  1FVF A;  4GZD A;  3ASF A;  4UWH A;  3TG5 A;  3MKQ B;  3ZGQ A;  2OCC E;  3TWR A;  4GMR A;  3ZYK A;  5EDS A;  1B89 A;  4GMJ A;  5AIJ A;  4TUM A;  1L5J A;  3TWT A;  4F1P A;  3DSX A;  1KZP A;  2I1K A;  2FO7 A;  3ENE A;  2VSX E;  2J4D A;  4Y6W A;  4LER A;  4RSY A;  3R7Q A;  4G26 A;  1SA4 A;  2YQ8 A;  4PS7 A;  3CKC A;  3Q49 B;  4KXK B;  3AJI A;  4OVU A;  2J09 A;  3CR3 A;  5FZS A;  3ZN3 A;  1HG5 A;  4TRQ A;  3FTV A;  4A1G A;  2FO1 E;  3AS4 A;  3MKQ A;  2QZA A;  3TXN A;  1IHG A;  1NI1 A;  2LXL A;  3EUV A;  3TXM A;  5T4Y A;  4CDR A;  4EZL A;  1E7U A;  2XGM A;  4B0Z A;  3DRA A;  3QWV A;  1MQS A;  3Q79 A;  4IUL A;  4KT6 B;  4U0S A;  1H6O A;  3ZW3 A;  3S7D A;  4HOR A;  4JHR A;  1TNO A;  1LD8 A;  1P5Q A;  1H19 A;  1WAO 1;  4N39 A;  4I1A A;  3UMV A;  2ETC A;  2F0Y A;  1DVP A;  3MV2 B;  3NZS A;  3MZL B;  4KVM A;  1ELK A;  4GB9 A;  3OXL A;  3UKU G;  2DYR E;  2OV8 A;  3ONL A;  2WXI A;  3OTN A;  4LNU D;  5A23 A;  2ZGG A;  3DEO A;  3APC A;  3PRZ A;  5LCW J;  1TN7 A;  2LO6 A;  3QWP A;  4U8H A;  3T5V A;  1H2U A;  3CVN A;  4OVV A;  5H7P A;  2UWJ G;  1FPP A;  3SY2 A;  4BSZ B;  3F6Q A;  4ACL A;  2WPV A;  1DC2 A;  3PDN A;  3HVE A;  4ILH B;  1K1A A;  4N3C A;  1FVH A;  4J8Y A;  2LAH A;  3G2U A;  5CHE E;  1UJK A;  4PS3 A;  1AWC B;  3EU9 A;  3QB2 A;  4DI3 A;  3G2W A;  2OEW A;  3V79 K;  3EDT B;  2WQH A;  2WXK A;  3ULQ A;  1JUQ A;  4LUN U;  3RRN B;  4GTQ A;  3FTU A;  4M3O A;  4FUL A;  5FQ6 A;  1TR4 A;  4XEI G;  5EIL A;  1QYM A;  1SZA A;  3ZPJ A;  4UWG A;  1JPL A;  4Q69 A;  2QC9 A;  4UUC A;  5A7D B;  1JCS A;  2Y4U A;  4R7L A;  4AV7 A;  5ENO D;  4OYS A;  1Y8M A;  1OWO A;  3TGO A;  4I2W A;  4WNE A;  3CHP A;  4N2Q A;  4GPK A;  4UQY A;  3U66 A;  2NSZ A;  2X6F A;  4J0U A;  4ANV A;  3FUF A;  3B95 A;  3FU6 A;  1DNP A;  2C2L A;  4ANX A;  1IQR A;  3CHS A;  3IXE A;  3ASO E;  1N4S A;  1Q2Z A;  3SI5 A;  4GA1 A;  3BG1 B;  4JHJ A;  4C48 B;  3CVQ A;  2PNN A;  3JUE A;  2WVI A;  3I4G A;  4HOU A;  4K03 A;  2YIN A;  3DSV A;  3CK7 A;  3ABM E;  4CZ2 D;  4DX1 A;  1ZU2 A;  2J8S D;  3BU8 A;  3V30 A;  3VLE A;  4U95 D;  2XS8 A;  3NBN B;  5BXU A;  2L0I A;  4G1T A;  4UI9 J;  4BEP A;  1TNB A;  1N52 A;  4APF A;  4U04 A;  3E34 A;  5E76 A;  4O60 A;  4GCO A;  3NQP A;  5T3R A;  4TXP A;  4HLE A;  2KZT B;  2DCP A;  4PDX A;  2L6B A;  4ILG A;  5CEA A;  5CMY A;  3E30 A;  1FT1 A;  4N3A A;  3D9P A;  2R17 C; 
#chains in the Genus database with same CATH homology
 2LXL A;  4TXQ A;  4TXP A;  2RKK A;  2LXM A;  4TXR A;  4U7E B;  5H7P A;  2LUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...