2BEDA

Structure of fpt bound to inhibitor sch207736
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
313
structure length
313
Chain Sequence
GFLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type I
publication title Enhanced FTase activity achieved via piperazine interaction with catalytic zinc.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 119
structure length 313
sequence length 313
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2005-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 2bedA00
1QBQA 1O5MA 1JCRA 1JCQA 4YDOA 1TNZA 1O1RA 2ZIRA 3Q75A 3EU5A 1FT1A 2H6GA 4GTSA 1N4SA 1O1TA 3KSLA 3DSTA 3DSSA 1S64A 1KZOA 4LNBA 4GTOA 1MZCA 4EHMA 3DPYA 3DSXA 1NI1A 3KSQA 3C72A 4L9PA 1FPPA 1N4RA 3HXDA 3PZ3A 1KZPA 3Q73A 1LTXA 4YDEA 3HXCA 3Q79A 3EUVA 4GTPA 1TNOA 3E37A 3HXFA 3E34A 2BEDA 1SA4A 2F0YA 1N4PA 1LD8A 4GTQA 3Q7FA 3PZ2A 2H6IA 2IEJA 2ZISA 1S63A 4GTMA 3DSWA 1TN7A 1TNYA 3PZ1A 1DCEA 1N9AA 1D8DA 1LD7A 1TNUA 3SFYA 3SFXA 1SA5A 3Q7AA 2H6FA 1TN8A 1NL4A 1X81A 3Q78A 4LNGA 1D8EA 1TNBA 3DRAA 3DSVA 1JCSA 3E32A 1TN6A 3E33A 4GTTA 1O1SA 1N94A 1N95A 2R2LA 3HXEA 3HXBA 3PZ4A 4GTRA 4GTVA 2H6HA 1FT2A 1N4QA 3E30A 4MBGA 3DSUA
chains in the Genus database with same CATH superfamily
2GRMA 4B8AA 1X5BA 4XE0A 2LSVA 2L9BA 1MYOA 3Q75A 3GZ1A 4FLHA 4DPRA 4EPZA 4U04A 3EIJA 1MX6A 2P9SG 4NURA 3B95A 3S7JA 1H0AA 4A1SA 4GA2A 2P9LG 3FP3A 5H7PA 3DXMG 1A17A 3MYVA 3RRUA 4J8FA 4CDRA 4DK5A 3FUJA 5ITZF 2WXLA 1KPSB 3BG1B 3TWXA 2OEWA 3ZYLA 4ILIA 2AJAA 4G26A 3Q49B 5ARFA 2LXLA 2J9QA 4L7TA 4H7YA 5EIBE 3C5RA 3RK6A 4QFVA 1TJCA 2XEVA 3Q5MA 3SFYA 4C48B 3U4TA 3CV0A 3V2XA 2A5UA 1MQSA 3QNKA 2I6HA 1E7UA 3FUNA 4ACKA 3QJZA 3ONKA 1QYMA 3IEGA 1ZB1A 4BSXA 4EZKA 1ELWA 3CQCB 5AJLA 2DZNA 2LAIA 4ANUA 1NA3A 3UUXA 2MRIA 3FUEA 5HQ8A 3C3OA 3CVPA 4ANXA 1WG0A 5EKQD 2GRLA 4UWFA 3RIBA 3PDNA 2R05A 3ULQA 1L5JA 4G8KA 3ML9A 4URKA 2J49A 4YNDA 3DPYA 2DYSE 3TXNA 4XX5A 3RO2A 3CVQA 1BPOA 2B6CA 3T8KA 3KEAA 4J0UA 5JHAA 3DBSA 3I5PA 5CEAA 4OAUC 3DPDA 4AY5A 2QC9A 1SQMA 5AN8A 5E76A 2GRNB 3SO8A 3B13A 3UTMA 1UN8A 3VLDA 4ZFHA 2YQ8A 3G2VA 2R17C 1ELKA 2J4DA 4EBAG 2EINE 2LO6A 4PS3A 3E33A 1MHQA 2R2LA 4CCAA 1H2UA 4PH4B 2Y4TA 3SQVA 4HRMB 3CGHA 4LCTA 5ENPD 3CHOA 4JB8P 1OWOA 4TRQA 1U3DA 5BUZA 2CHWA 1PY1A 5JHBA 3LKUA 1P5QA 2RKKA 3EDTB 4BT8A 5B3SE 2FBNA 2C0LA 5CEDB 2PM6A 2FULA 2X6HA 4LUNU 3KD7A 4U0SA 1N11A 4G1TA 2R03A 2WM9A 3PRZA 3ZYMA 2WXNA 2QZAA 4DUIA 2WMNA 4I1MA 1BD8A 2MHKA 1ZU2A 5EYLA 3U9WA 4AJWA 2EIKE 3CSFA 4F1PA 3IV0A 3SY2A 5HS0A 1SZAA 2BEDA 1TEZA 3ASHA 3ASNE 3NOGD 4GPMA 4GZ6A 3OXFA 3G2UA 4MS6A 2WXMA 3UM1A 4GA0A 1G3NB 2Y3AA 4WNEA 1DCEA 3FH8A 1N9AA 5FJYA 2WXIA 4C9BB 2XZTG 2PQRA 3EJNA 3G2WA 1IYGA 3F6QA 4G25A 1QZ2A 1RZ4A 2VGEA 4FHKA 3FTUA 3HIZA 2LUHA 4AY6A 4BX8A 2BKGA 2CHZA 2X6KA 4WNFA 3HXEA 2ILRA 3TXMA 2H6HA 4AV7A 3D9IA 1DC2A 5CMYA 2WQ6A 3WXXA 3VTYA 1JCRA 3V30A 2IO3C 5DBKA 5JA4D 2AXUA 4L2LA 5CHEE 3ZFWA 5HRYA 4AVXA 4KXKB 1NZNA 3R9MA 4YDYA 4W9RA 4B8CB 1UN9A 2Q7FA 4GZ5A 4IN3B 4JZYA 4KMOA 4OAVB 3QWPA 3QC1A 4ZHBA 1E7VA 4ATGA 1NI1A 4CDNA 3FEXA 3VLEA 2X6JA 4AP2A 1K3ZD 2IJGX 3Q73A 3LY8A 3TG4A 4A3TA 5J90A 3UIPC 2KC7A 5FWQA 4J8SA 2IF4A 5FQ7A 4HXIA 3TWTA 2BKKB 3JXIA 2AXZA 3E34A 2YHEA 4A55A 2EILE 3UT4A 1Y6IA 3D9JA 5CCLA 3QB2A 5C2YA 1LD8A 3D9NA 4AEZC 3S2AA 1HG2A 3C3QA 3EIQC 3CEQA 3PZ1A 5ENOD 3SI5A 4DX1A 2YHCA 3U66A 1X81A 2XPYA 3RKVA 4HOSA 1N0RA 1LF8A 3JXJA 2FF4A 4UQYA 2HR2A 4ACLA 5BXUA 5JJTA 2VGXA 3HVEB 3FUHA 3Q47B 2RG8A 4GTRA 2NYJA 2XGSA 4BESA 2DBAA 4I1AA 5JJ7A 4KVMA 1O5MA 4YDOA 4U0UA 1O1RA 4I2WA 1Z3YA 2L0TB 2OEVA 5G05C 3WG7E 3IHYA 2ETAA 3DSTA 3TWRA 4CEMA 5EX3A 3APFA 4CZ2D 3EU9A 3UM3A 5BXOA 1OWPA 3CVXA 5G04C 3FEYA 2YNQA 5BV0A 2JEKA 3AS4A 5C1DA 3CHPA 5KJMA 4L9PA 2WQHA 4LG6A 3LDZA 3L22A 5M72A 5FZQA 5AAOA 2VGYA 2DIWA 4RVBA 2F37A 2RD0A 3O4ZA 1SA4A 2UY1A 1JWGA 1HH8A 2CG3A 3IHVA 4FU3A 1KT0A 1D9SA 1V54E 2A4ZA 2WXGA 3DEPA 3GZSA 5ENNA 2E0IA 3BG0B 1TNUA 3L13A 1FVHA 1NL4A 5FZSA 4A1GA 1HO8A 3CKBA 4K5BA 4FLBA 5AQAA 2OOEA 3ZXSA 1VDYA 3ZUVB 3CK9A 5A7DB 5FT9A 5KJLA 4HRNA 5KNGA 2R5SA 5LFAA 3SBTB 4DLQA 3E30A 3GW4A 4BERA 2WXOA 3U64A 2ZIRA 2X38A 4P29A 4O1OA 3NF1A 2EQXA 2H6GA 3B7BA 3HDXA 5DIZA 4X8QA 4CDMA 4CT4A 3JYSA 5T3RA 5LCWC 3I4RB 4G23A 3NAWA 4QQIA 2CFUA 3FWVA 4N39A 3HRAA 3CSTA 4OVUA 4N2QA 3UIOC 2XEEA 5FZRA 5KCMA 4A3VA 2XPIA 3ZRHA 1N4RA 4TXPA 3PZ3A 4WNDA 5AQBA 1KZPA 5G04J 2F8XK 4ANVA 2AXVA 3ESLA 3V2OA 3EUVA 3MCXA 3EHNA 2IOSA 3T5VA 4GB9A 4J8YA 3LVRE 2LXMA 2IONA 2WVIA 4UWLA 4XI0A 5CECB 2PL2A 3UT7A 3EHQA 1H19A 4LEUA 2WMOA 3B7TA 4HORA 1OT8A 1XNFA 5AARA 1TNBA 3DSVA 4JW1A 3PUJA 1WDYA 1AP7A 2IOLA 3L17A 3LCAA 3UI2A 4O60A 2L6JA 4JPSA 1U2VG 2XS1A 5FQ6A 3LJ3A 3ZXPA 4BY6A 4KVOA 4E85A 3ZYQA 1QBQA 3ZYKA 4JEHA 2ETCA 1TNZA 4HI9A 2VJ8A 3EU5A 3GYZA 2LAHA 4B0ZA 3ZNGA 2P9IG 3GZ2A 2NC9A 4CRWA 1S64A 4APFA 5ENSD 3PE4A 1BU9A 4GTOA 4U95D 3UXGA 1MZCA 2FO7A 4U07A 4YVOA 1S70B 3I4GA 3C72A 3RU0A 2LNIA 2I9CA 4PDXA 1LTXA 3TAXA 2VSYA 2PZIA 4FJYA 4JL0A 1H6KA 3G2SA 2CHXA 4Z68A 1RW2A 3S7DA 2A5EA 2X6IA 3JUIA 2IEJA 3FU0A 4F6RD 4BTAA 4XIFA 4RG9A 1LD7A 1NFIE 3SFXA 1FVFA 1HF8A 2IY0C 4DX5D 4L2YA 4JXTA 1TN8A 4DLOA 1IQUA 2P2CP 3JQ1A 4L23A 1KLXA 3RJVA 4DJAA 3SD5A 1HE8A 5EN5D 1NP7A 2WXHA 5AENA 3ULYA 3PZ4A 2KCVA 1FT2A 3AS8A 3UM2A 2OV8A 2WQ7A 4N2SA 4KZ0A 2XEHA 4FC8A 2F8YA 4K5AB 1DVPA 3DXKG 4J8DA 4RG6A 3SNXA 2C0MA 3L16A 3OXLA 3DSSA 3G2TA 3LS8A 4NQ0A 2C2LA 3VLFA 4LNUD 1OWNA 1BI7B 3AJIA 5CBNA 3CK8A 3V31A 3NQPA 3UQ3A 3KSQA 3HXDA 4I43A 4I1OB 3QWVA 2DCPA 1NA0A 2EIME 4GZ3A 4BSZB 5HKPA 1TNOA 4BETA 3L9TA 3FUMA 3QOUA 3X2QE 4N3BA 4HVBA 5EIDA 5AQ7A 3ABKE 2JLBA 1H6OA 1WM5A 2Y0BG 4GMLA 4UWGA 3LY7A 2IFUA 2H6FA 2ONDA 2CG2A 1D8EA 4N5QA 3DRAA 1TJFA 4Q94A 4V3IA 1WAO1 3J5PA 5AJDA 1U3CA 3B7UX 3FY4A 2P9PG 3SBSA 1OWLA 5BPPA 3FH7A 4G11A 4UI9C 3CHMA 3D9LA 3ESKA 5G55A 2P9UG 1K1AA 3C3RA 2WXJA 2VQ2A 2WXPA 1FT1A 3Q9NC 3BEEA 5CERB 1N4SA 4IULA 4PUCA 2BUGA 4UQZA 3BUAA 4I6EA 3DEOA 3QWWA 1SVXA 4LNBA 2V8SE 2DZOA 3CVUA 1BLXB 3PH0C 4I6JA 1SW6A 2I2OA 5AQ9A 4DI3A 4O6FA 5JMND 4GYWA 4UWKA 3CK7A 4XEIG 3TGOA 4WWOA 2J08A 5IY5E 1JUQA 3E4BA 2J07A 3NBNB 3UX4A 3ZW3A 3TWWA 4TUMA 3E37A 1HU3A 1IKND 3PEVB 1UW4B 3CHQA 3RRMB 3APDA 2VTBA 1Z5SC 5T4YA 3R9AB 4JC8A 4FA6A 4CGWA 2VYIA 3CLJA 2ZXWE 4UI9K 3QK0A 2X3MA 4HFGA 1HXIA 3E32A 2GRRB 3UM0A 1HX8A 3ZKJA 3ZU7B 3SGHA 3CIAA 3D9OA 3TWVA 3W9GA 1OXJA 1N4QA 1HFAA 4WAFA 3CKCA 1XGWA 3MKRA 4JEUA 4GPKA 3B7SA 3OXGA 3FU6A 3PEUB 2WXQA 5LOZA 4HI8A 2DYRE 3ABLE 2XENA 3ENEA 2HM8A 3UINC 3FTZA 1KZOA 1YA0A 3P1UA 3S7BA 1PAQA 2ZU6B 4TXQA 4WNGA 1B89A 2L6BA 5D0QD 4E6HA 4FHJA 2LSUA 2VGXB 2VSXE 4YDEA 3ASGA 5BW8C 5CMWA 2GGFA 3Q15A 2B0OE 3TWUA 2F0YA 3L08A 4HS2A 4AOFA 3CQGB 3MV3B 4F1SA 4G2VA 1ZBPA 4CYMD 3ASDA 4U0ZA 1D8DA 2GRPB 3FFLA 3APCA 1SA5A 4WUYA 3FU5A 2WPVA 3KAEA 5LP0A 4AXHA 4J8EA 4JA9A 3UKUG 5CBOA 2CFZA 4RLYA 3JCKC 1N52A 2PQNA 4Q69A 2MYOA 5B1BE 3C98A 1H2TC 5E75A 3PNLB 4XI9A 4J7WA 4OVVA 2UY1B 4C0MA 2E2EA 1EDUA 2X6FA 2XS8A 4BTBA 1KT1A 3L54A 4I17A 4XZ4A 4O1PA 5JJ6A 2XGMA 3D9HA 3ZHEA 4H7XA 3CVWA 4Y6WA 4K0RA 3ZGQA 2XCCA 3LEWA 5FQ8A 4EECA 4RQIA 3U3WA 1IQRA 4HOTA 3D9KA 4JHJA 2JABA 3FTXA 3LVQE 2OVBA 4JHRA 5G05J 3B7RL 5KJNA 1N4PA 4EBAA 4CGVA 5KWDA 3JUEA 3ZPJA 3MA5A 4HLLA 2H6IA 2ZISA 2GRQB 4I9CA 4OYSA 4L1BA 3BQOA 4GCOA 3Q7AA 2I1KA 4NACA 3HG0D 3TJPA 2BTDA 2V4LA 4LNGA 4TV3A 3UT8A 3FTSA 3AG1E 2VSNA 3D9PA 2J09A 3KEZA 3ONLA 1OCCE 4YVQC 1H2VC 4I6GA 1N94A 5EX0A 3FTYA 3FUIA 4F7AA 5ANRA 4Q96A 2GROB 4JD2G 4J6IA 3TWSA 5AIJA 3OTNA 3FTVA 3VTXA 3T8MA 1EF1C 1O1TA 2XRZA 2ZGDA 2RFMA 1FCHA 3RRNB 4TUUA 4IYPA 3UMVA 4N5CA 2QYUA 5KJKA 2UWJG 4EHMA 2P9NG 2OCCE 3ZVVA 1WY6A 3SHFA 3DSXA 2V0PA 4JA7A 1JPLA 3FHEA 4HLEA 1N0QA 5BT1A 3RSEG 3AAAC 4UWHA 4F3VA 1MX2A 4LSZE 5LCWJ 4R7LA 3IBEA 1HS6A 4UUCA 5FIOA 1E8WA 4EQFA 2NSZA 3Q4AB 2QFCA 4GYYA 3PZ2A 1PC2A 4ME2A 4GTMA 5EYPF 4GZDA 4AM9A 4U8HA 4B89A 2L0IA 4HNAD 3ZIMA 3SF4A 4GCNA 1OWMA 4XKBA 1AWCB 5FINA 3RAUA 4GMRA 5HI7A 1N95A 3ASFA 1E8XA 1OCZE 3NZUA 5B1AE 4ATZD 2XQ0A 4GTVA 4MBGA 1N54A 2YINA 2KZTA 2R59A 4I9EA 1V55E 1E96B 2IU1A 4FULA 3TG5A 3IXEA 2VSOE 3D3MA 3CR3A 1SZ9A 4BWRA 1DNPA 3SFZA 5BV1A 2WXFA 2XRYA 3KSLA 1ELRA 3PREA 3L82A 3S7FA 2FI7A 1HG5A 5T8IA 2IO2C 4WWPA 3AG2E 1H6PA 3CVLA 3UKRG 3AG3E 4FP7A 2KZTB 4I2ZA 2XHEA 1IXVA 5ENTD 4HOUA 5ENQD 1E8YA 3N71A 4BFRA 1S0PA 4AIFA 4KT6B 1YCSB 2AVPA 2ETBA 2FEZA 1UG3A 1BI8B 2M63A 3QDNA 4NIKA 2RFAA 2KATA 3NZSA 1IHBA 3ABME 4TXRA 4GA1A 4U96D 4WWNA 3FUKA 1JWFA 2J4BA 4GTQA 4IRUA 2AWIA 3HYMB 3Q7FA 5KBAA 1TR4A 4M3OA 4JHKA 3FULA 1TN7A 1Y8MA 1E90A 2KM4A 3PE3A 5ARGA 5LX8A 4HQDA 4MLPA 3W9FA 2HYZA 3AU4A 3MEKA 1O1SA 3PS6A 2I1JA 3R7QA 3FH5A 1JCSA 3DSUA 4DX7D 2FO1E 3MKQA 2KBXA 3T9KA 3IKOB 3URZA 3NOCD 5KNHD 4ABNA 4GTSA 2IQCA 2V5FA 1EYHA 2KCKA 2OVFA 3DWLG 2DVWA 1OCOE 4EZJA 4HRLA 4YDWA 3MKQB 1Q2ZA 5CRVA 4A63B 5FQ4A 3LPZA 3TL5A 3QAQA 4FJZA 5A6CA 3ULEG 3I3NA 4BT9A 3L6AA 1INZA 3CVVA 3Q79A 3P2BA 3JQ0A 2WXKA 1EPUA 4APOA 4HB5A 3RO3A 4GU5A 2DWZA 2HO1A 1Z3XA 2GW1A 1MJ0A 2WB2A 3MGBA 5A23A 3MV2B 1TYQG 3AU5A 4U8YD 3V79K 4ILHB 1UOHA 2Y69E 4N3CA 3K9IA 3ISMC 4KZCA 2R02A 4NRHB 4HBDA 4GTTA 4FADA 4N3AA 4D10C 3O48A 3FUFA 3PUKA 1Z6TA 4UQXA 2VTBB 1OY3D 3CVNA 1UJKA 1MX4A 1OCRE 4PS7A 5G2NA 3CHSA 3LYAA 4GAAA 4LRZA 3PZDA 5CCMA 3HVEA 2Y4UA 1FPPA 5EILA 1K8KG 5ENRD 2P58C 3MX3A 5FTPA 4UI9J 3KS2A 2P9KG 4XKCA 3HXCA 5EDSA 4HOQA 4GTPA 2WXRA 5AYWD 3HXFA 1UJJA 2ZGGA 3CVYA 2KCLA 4B93B 3ZN3A 2NXPA 4K03A 3DSWA 3BU8A 1HZ4A 3ML8A 2PM7A 3CHRA 3FU3A 3PVLA 3Q78A 4BX9A 2J8SD 1YMPA 2HE0A 2KXPC 1TN6A 2XZDG 5D66A 3AG4E 4BEPA 2XCBA 4JVSA 1OUVA 4ANWA 5J08A 4Y6CA 4G24A 4KBQA 3QKYA 4GYOA 1JCQA 4DI4A 4U8VD 4DX2A 1GW6A 4U63A 5ANLA 3T5XA 2AW6A 5CRUA 1DCQA 1K1BA 4F53A 3MJWA 1QQEA 1E8ZA 4DX6D 4GZCA 4C0EA 4DRXE 4B94A 4LERA 2XPZA 2Y1LE 3PNTB 4CT0A 3R7RA 1QNFA 3HHMA 3AS5A 4MKTA 2BF0X 4K5CA 4MRUA 3MZLB 4RSYA 2XGOA 3NB2A 4G8LA 4U7EB 3ZEFA 5D2MC 4PS8A 1W3BA 4ILGA 3QARA 2MOWA 4KYOB 2PNNA 3SZ7A 3OAWA 3LJNA 3LXUX 1A5EA 5D0OD 4GMJA 1S63A 1TNYA 3D9MA 2V5QC 3J5QB 2QYJA 3LY9A 1IHGA 4EZLA 3FDHA 5BNWA 3EHRA 3FTWA 3EHMA 3ZHEB 2EIJE 1YYHA 3TWQA 3ASOE 3UPVA 3HXBA 3Q9UC 2V4HC 3FUDA 4M7CA 2QY7A
chains in the Genus database with same CATH topology
1QBQA 1O5MA 1JCRA 1JCQA 4YDOA 1TNZA 1O1RA 2ZIRA 3Q75A 3EU5A 1FT1A 2H6GA 4GTSA 1N4SA 1O1TA 3KSLA 3DSTA 3DSSA 1S64A 1KZOA 4LNBA 4GTOA 1MZCA 4EHMA 3DPYA 3DSXA 1NI1A 3KSQA 3C72A 4L9PA 1FPPA 1N4RA 3HXDA 3PZ3A 1KZPA 3Q73A 1LTXA 4YDEA 3HXCA 3Q79A 3EUVA 4GTPA 1TNOA 3E37A 3HXFA 3E34A 2BEDA 1SA4A 2F0YA 1N4PA 1LD8A 4GTQA 3Q7FA 3PZ2A 2H6IA 2IEJA 2ZISA 1S63A 4GTMA 3DSWA 1TN7A 1TNYA 3PZ1A 1DCEA 1N9AA 1D8DA 1LD7A 1TNUA 3SFYA 3SFXA 1SA5A 3Q7AA 2H6FA 1TN8A 1NL4A 1X81A 3Q78A 4LNGA 1D8EA 1TNBA 3DRAA 3DSVA 1JCSA 3E32A 1TN6A 3E33A 4GTTA 1O1SA 1N94A 1N95A 2R2LA 3HXEA 3HXBA 3PZ4A 4GTRA 4GTVA 2H6HA 1FT2A 1N4QA 3E30A 4MBGA 3DSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QBQ A;  1O5M A;  1JCR A;  1JCQ A;  4YDO A;  1TNZ A;  1O1R A;  2ZIR A;  3Q75 A;  3EU5 A;  1FT1 A;  2H6G A;  4GTS A;  1N4S A;  1O1T A;  3KSL A;  3DST A;  3DSS A;  1S64 A;  1KZO A;  4LNB A;  4GTO A;  1MZC A;  4EHM A;  3DPY A;  3DSX A;  1NI1 A;  3KSQ A;  3C72 A;  4L9P A;  1FPP A;  1N4R A;  3HXD A;  3PZ3 A;  1KZP A;  3Q73 A;  1LTX A;  4YDE A;  3HXC A;  3Q79 A;  3EUV A;  4GTP A;  1TNO A;  3E37 A;  3HXF A;  3E34 A;  2BED A;  1SA4 A;  2F0Y A;  1N4P A;  1LD8 A;  4GTQ A;  3Q7F A;  3PZ2 A;  2H6I A;  2IEJ A;  2ZIS A;  1S63 A;  4GTM A;  3DSW A;  1TN7 A;  1TNY A;  3PZ1 A;  1DCE A;  1N9A A;  1D8D A;  1LD7 A;  1TNU A;  3SFY A;  3SFX A;  1SA5 A;  3Q7A A;  2H6F A;  1TN8 A;  1NL4 A;  1X81 A;  3Q78 A;  4LNG A;  1D8E A;  1TNB A;  3DRA A;  3DSV A;  1JCS A;  3E32 A;  1TN6 A;  3E33 A;  4GTT A;  1O1S A;  1N94 A;  1N95 A;  2R2L A;  3HXE A;  3HXB A;  3PZ4 A;  4GTR A;  4GTV A;  2H6H A;  1FT2 A;  1N4Q A;  3E30 A;  4MBG A;  3DSU A; 
#chains in the Genus database with same CATH topology
 2GRM A;  4B8A A;  1X5B A;  4XE0 A;  2LSV A;  2L9B A;  1MYO A;  3Q75 A;  3GZ1 A;  4FLH A;  4DPR A;  4EPZ A;  4U04 A;  3EIJ A;  1MX6 A;  2P9S G;  4NUR A;  3B95 A;  3S7J A;  1H0A A;  4A1S A;  4GA2 A;  2P9L G;  3FP3 A;  5H7P A;  3DXM G;  1A17 A;  3MYV A;  3RRU A;  4J8F A;  4CDR A;  4DK5 A;  3FUJ A;  5ITZ F;  2WXL A;  1KPS B;  3BG1 B;  3TWX A;  2OEW A;  3ZYL A;  4ILI A;  2AJA A;  4G26 A;  3Q49 B;  5ARF A;  2LXL A;  2J9Q A;  4L7T A;  4H7Y A;  5EIB E;  3C5R A;  3RK6 A;  4QFV A;  1TJC A;  2XEV A;  3Q5M A;  3SFY A;  4C48 B;  3U4T A;  3CV0 A;  3V2X A;  2A5U A;  1MQS A;  3QNK A;  2I6H A;  1E7U A;  3FUN A;  4ACK A;  3QJZ A;  3ONK A;  1QYM A;  3IEG A;  1ZB1 A;  4BSX A;  4EZK A;  1ELW A;  3CQC B;  5AJL A;  2DZN A;  2LAI A;  4ANU A;  1NA3 A;  3UUX A;  2MRI A;  3FUE A;  5HQ8 A;  3C3O A;  3CVP A;  4ANX A;  1WG0 A;  5EKQ D;  2GRL A;  4UWF A;  3RIB A;  3PDN A;  2R05 A;  3ULQ A;  1L5J A;  4G8K A;  3ML9 A;  4URK A;  2J49 A;  4YND A;  3DPY A;  2DYS E;  3TXN A;  4XX5 A;  3RO2 A;  3CVQ A;  1BPO A;  2B6C A;  3T8K A;  3KEA A;  4J0U A;  5JHA A;  3DBS A;  3I5P A;  5CEA A;  4OAU C;  3DPD A;  4AY5 A;  2QC9 A;  1SQM A;  5AN8 A;  5E76 A;  2GRN B;  3SO8 A;  3B13 A;  3UTM A;  1UN8 A;  3VLD A;  4ZFH A;  2YQ8 A;  3G2V A;  2R17 C;  1ELK A;  2J4D A;  4EBA G;  2EIN E;  2LO6 A;  4PS3 A;  3E33 A;  1MHQ A;  2R2L A;  4CCA A;  1H2U A;  4PH4 B;  2Y4T A;  3SQV A;  4HRM B;  3CGH A;  4LCT A;  5ENP D;  3CHO A;  4JB8 P;  1OWO A;  4TRQ A;  1U3D A;  5BUZ A;  2CHW A;  1PY1 A;  5JHB A;  3LKU A;  1P5Q A;  2RKK A;  3EDT B;  4BT8 A;  5B3S E;  2FBN A;  2C0L A;  5CED B;  2PM6 A;  2FUL A;  2X6H A;  4LUN U;  3KD7 A;  4U0S A;  1N11 A;  4G1T A;  2R03 A;  2WM9 A;  3PRZ A;  3ZYM A;  2WXN A;  2QZA A;  4DUI A;  2WMN A;  4I1M A;  1BD8 A;  2MHK A;  1ZU2 A;  5EYL A;  3U9W A;  4AJW A;  2EIK E;  3CSF A;  4F1P A;  3IV0 A;  3SY2 A;  5HS0 A;  1SZA A;  2BED A;  1TEZ A;  3ASH A;  3ASN E;  3NOG D;  4GPM A;  4GZ6 A;  3OXF A;  3G2U A;  4MS6 A;  2WXM A;  3UM1 A;  4GA0 A;  1G3N B;  2Y3A A;  4WNE A;  1DCE A;  3FH8 A;  1N9A A;  5FJY A;  2WXI A;  4C9B B;  2XZT G;  2PQR A;  3EJN A;  3G2W A;  1IYG A;  3F6Q A;  4G25 A;  1QZ2 A;  1RZ4 A;  2VGE A;  4FHK A;  3FTU A;  3HIZ A;  2LUH A;  4AY6 A;  4BX8 A;  2BKG A;  2CHZ A;  2X6K A;  4WNF A;  3HXE A;  2ILR A;  3TXM A;  2H6H A;  4AV7 A;  3D9I A;  1DC2 A;  5CMY A;  2WQ6 A;  3WXX A;  3VTY A;  1JCR A;  3V30 A;  2IO3 C;  5DBK A;  5JA4 D;  2AXU A;  4L2L A;  5CHE E;  3ZFW A;  5HRY A;  4AVX A;  4KXK B;  1NZN A;  3R9M A;  4YDY A;  4W9R A;  4B8C B;  1UN9 A;  2Q7F A;  4GZ5 A;  4IN3 B;  4JZY A;  4KMO A;  4OAV B;  3QWP A;  3QC1 A;  4ZHB A;  1E7V A;  4ATG A;  1NI1 A;  4CDN A;  3FEX A;  3VLE A;  2X6J A;  4AP2 A;  1K3Z D;  2IJG X;  3Q73 A;  3LY8 A;  3TG4 A;  4A3T A;  5J90 A;  3UIP C;  2KC7 A;  5FWQ A;  4J8S A;  2IF4 A;  5FQ7 A;  4HXI A;  3TWT A;  2BKK B;  3JXI A;  2AXZ A;  3E34 A;  2YHE A;  4A55 A;  2EIL E;  3UT4 A;  1Y6I A;  3D9J A;  5CCL A;  3QB2 A;  5C2Y A;  1LD8 A;  3D9N A;  4AEZ C;  3S2A A;  1HG2 A;  3C3Q A;  3EIQ C;  3CEQ A;  3PZ1 A;  5ENO D;  3SI5 A;  4DX1 A;  2YHC A;  3U66 A;  1X81 A;  2XPY A;  3RKV A;  4HOS A;  1N0R A;  1LF8 A;  3JXJ A;  2FF4 A;  4UQY A;  2HR2 A;  4ACL A;  5BXU A;  5JJT A;  2VGX A;  3HVE B;  3FUH A;  3Q47 B;  2RG8 A;  4GTR A;  2NYJ A;  2XGS A;  4BES A;  2DBA A;  4I1A A;  5JJ7 A;  4KVM A;  1O5M A;  4YDO A;  4U0U A;  1O1R A;  4I2W A;  1Z3Y A;  2L0T B;  2OEV A;  5G05 C;  3WG7 E;  3IHY A;  2ETA A;  3DST A;  3TWR A;  4CEM A;  5EX3 A;  3APF A;  4CZ2 D;  3EU9 A;  3UM3 A;  5BXO A;  1OWP A;  3CVX A;  5G04 C;  3FEY A;  2YNQ A;  5BV0 A;  2JEK A;  3AS4 A;  5C1D A;  3CHP A;  5KJM A;  4L9P A;  2WQH A;  4LG6 A;  3LDZ A;  3L22 A;  5M72 A;  5FZQ A;  5AAO A;  2VGY A;  2DIW A;  4RVB A;  2F37 A;  2RD0 A;  3O4Z A;  1SA4 A;  2UY1 A;  1JWG A;  1HH8 A;  2CG3 A;  3IHV A;  4FU3 A;  1KT0 A;  1D9S A;  1V54 E;  2A4Z A;  2WXG A;  3DEP A;  3GZS A;  5ENN A;  2E0I A;  3BG0 B;  1TNU A;  3L13 A;  1FVH A;  1NL4 A;  5FZS A;  4A1G A;  1HO8 A;  3CKB A;  4K5B A;  4FLB A;  5AQA A;  2OOE A;  3ZXS A;  1VDY A;  3ZUV B;  3CK9 A;  5A7D B;  5FT9 A;  5KJL A;  4HRN A;  5KNG A;  2R5S A;  5LFA A;  3SBT B;  4DLQ A;  3E30 A;  3GW4 A;  4BER A;  2WXO A;  3U64 A;  2ZIR A;  2X38 A;  4P29 A;  4O1O A;  3NF1 A;  2EQX A;  2H6G A;  3B7B A;  3HDX A;  5DIZ A;  4X8Q A;  4CDM A;  4CT4 A;  3JYS A;  5T3R A;  5LCW C;  3I4R B;  4G23 A;  3NAW A;  4QQI A;  2CFU A;  3FWV A;  4N39 A;  3HRA A;  3CST A;  4OVU A;  4N2Q A;  3UIO C;  2XEE A;  5FZR A;  5KCM A;  4A3V A;  2XPI A;  3ZRH A;  1N4R A;  4TXP A;  3PZ3 A;  4WND A;  5AQB A;  1KZP A;  5G04 J;  2F8X K;  4ANV A;  2AXV A;  3ESL A;  3V2O A;  3EUV A;  3MCX A;  3EHN A;  2IOS A;  3T5V A;  4GB9 A;  4J8Y A;  3LVR E;  2LXM A;  2ION A;  2WVI A;  4UWL A;  4XI0 A;  5CEC B;  2PL2 A;  3UT7 A;  3EHQ A;  1H19 A;  4LEU A;  2WMO A;  3B7T A;  4HOR A;  1OT8 A;  1XNF A;  5AAR A;  1TNB A;  3DSV A;  4JW1 A;  3PUJ A;  1WDY A;  1AP7 A;  2IOL A;  3L17 A;  3LCA A;  3UI2 A;  4O60 A;  2L6J A;  4JPS A;  1U2V G;  2XS1 A;  5FQ6 A;  3LJ3 A;  3ZXP A;  4BY6 A;  4KVO A;  4E85 A;  3ZYQ A;  1QBQ A;  3ZYK A;  4JEH A;  2ETC A;  1TNZ A;  4HI9 A;  2VJ8 A;  3EU5 A;  3GYZ A;  2LAH A;  4B0Z A;  3ZNG A;  2P9I G;  3GZ2 A;  2NC9 A;  4CRW A;  1S64 A;  4APF A;  5ENS D;  3PE4 A;  1BU9 A;  4GTO A;  4U95 D;  3UXG A;  1MZC A;  2FO7 A;  4U07 A;  4YVO A;  1S70 B;  3I4G A;  3C72 A;  3RU0 A;  2LNI A;  2I9C A;  4PDX A;  1LTX A;  3TAX A;  2VSY A;  2PZI A;  4FJY A;  4JL0 A;  1H6K A;  3G2S A;  2CHX A;  4Z68 A;  1RW2 A;  3S7D A;  2A5E A;  2X6I A;  3JUI A;  2IEJ A;  3FU0 A;  4F6R D;  4BTA A;  4XIF A;  4RG9 A;  1LD7 A;  1NFI E;  3SFX A;  1FVF A;  1HF8 A;  2IY0 C;  4DX5 D;  4L2Y A;  4JXT A;  1TN8 A;  4DLO A;  1IQU A;  2P2C P;  3JQ1 A;  4L23 A;  1KLX A;  3RJV A;  4DJA A;  3SD5 A;  1HE8 A;  5EN5 D;  1NP7 A;  2WXH A;  5AEN A;  3ULY A;  3PZ4 A;  2KCV A;  1FT2 A;  3AS8 A;  3UM2 A;  2OV8 A;  2WQ7 A;  4N2S A;  4KZ0 A;  2XEH A;  4FC8 A;  2F8Y A;  4K5A B;  1DVP A;  3DXK G;  4J8D A;  4RG6 A;  3SNX A;  2C0M A;  3L16 A;  3OXL A;  3DSS A;  3G2T A;  3LS8 A;  4NQ0 A;  2C2L A;  3VLF A;  4LNU D;  1OWN A;  1BI7 B;  3AJI A;  5CBN A;  3CK8 A;  3V31 A;  3NQP A;  3UQ3 A;  3KSQ A;  3HXD A;  4I43 A;  4I1O B;  3QWV A;  2DCP A;  1NA0 A;  2EIM E;  4GZ3 A;  4BSZ B;  5HKP A;  1TNO A;  4BET A;  3L9T A;  3FUM A;  3QOU A;  3X2Q E;  4N3B A;  4HVB A;  5EID A;  5AQ7 A;  3ABK E;  2JLB A;  1H6O A;  1WM5 A;  2Y0B G;  4GML A;  4UWG A;  3LY7 A;  2IFU A;  2H6F A;  2OND A;  2CG2 A;  1D8E A;  4N5Q A;  3DRA A;  1TJF A;  4Q94 A;  4V3I A;  1WAO 1;  3J5P A;  5AJD A;  1U3C A;  3B7U X;  3FY4 A;  2P9P G;  3SBS A;  1OWL A;  5BPP A;  3FH7 A;  4G11 A;  4UI9 C;  3CHM A;  3D9L A;  3ESK A;  5G55 A;  2P9U G;  1K1A A;  3C3R A;  2WXJ A;  2VQ2 A;  2WXP A;  1FT1 A;  3Q9N C;  3BEE A;  5CER B;  1N4S A;  4IUL A;  4PUC A;  2BUG A;  4UQZ A;  3BUA A;  4I6E A;  3DEO A;  3QWW A;  1SVX A;  4LNB A;  2V8S E;  2DZO A;  3CVU A;  1BLX B;  3PH0 C;  4I6J A;  1SW6 A;  2I2O A;  5AQ9 A;  4DI3 A;  4O6F A;  5JMN D;  4GYW A;  4UWK A;  3CK7 A;  4XEI G;  3TGO A;  4WWO A;  2J08 A;  5IY5 E;  1JUQ A;  3E4B A;  2J07 A;  3NBN B;  3UX4 A;  3ZW3 A;  3TWW A;  4TUM A;  3E37 A;  1HU3 A;  1IKN D;  3PEV B;  1UW4 B;  3CHQ A;  3RRM B;  3APD A;  2VTB A;  1Z5S C;  5T4Y A;  3R9A B;  4JC8 A;  4FA6 A;  4CGW A;  2VYI A;  3CLJ A;  2ZXW E;  4UI9 K;  3QK0 A;  2X3M A;  4HFG A;  1HXI A;  3E32 A;  2GRR B;  3UM0 A;  1HX8 A;  3ZKJ A;  3ZU7 B;  3SGH A;  3CIA A;  3D9O A;  3TWV A;  3W9G A;  1OXJ A;  1N4Q A;  1HFA A;  4WAF A;  3CKC A;  1XGW A;  3MKR A;  4JEU A;  4GPK A;  3B7S A;  3OXG A;  3FU6 A;  3PEU B;  2WXQ A;  5LOZ A;  4HI8 A;  2DYR E;  3ABL E;  2XEN A;  3ENE A;  2HM8 A;  3UIN C;  3FTZ A;  1KZO A;  1YA0 A;  3P1U A;  3S7B A;  1PAQ A;  2ZU6 B;  4TXQ A;  4WNG A;  1B89 A;  2L6B A;  5D0Q D;  4E6H A;  4FHJ A;  2LSU A;  2VGX B;  2VSX E;  4YDE A;  3ASG A;  5BW8 C;  5CMW A;  2GGF A;  3Q15 A;  2B0O E;  3TWU A;  2F0Y A;  3L08 A;  4HS2 A;  4AOF A;  3CQG B;  3MV3 B;  4F1S A;  4G2V A;  1ZBP A;  4CYM D;  3ASD A;  4U0Z A;  1D8D A;  2GRP B;  3FFL A;  3APC A;  1SA5 A;  4WUY A;  3FU5 A;  2WPV A;  3KAE A;  5LP0 A;  4AXH A;  4J8E A;  4JA9 A;  3UKU G;  5CBO A;  2CFZ A;  4RLY A;  3JCK C;  1N52 A;  2PQN A;  4Q69 A;  2MYO A;  5B1B E;  3C98 A;  1H2T C;  5E75 A;  3PNL B;  4XI9 A;  4J7W A;  4OVV A;  2UY1 B;  4C0M A;  2E2E A;  1EDU A;  2X6F A;  2XS8 A;  4BTB A;  1KT1 A;  3L54 A;  4I17 A;  4XZ4 A;  4O1P A;  5JJ6 A;  2XGM A;  3D9H A;  3ZHE A;  4H7X A;  3CVW A;  4Y6W A;  4K0R A;  3ZGQ A;  2XCC A;  3LEW A;  5FQ8 A;  4EEC A;  4RQI A;  3U3W A;  1IQR A;  4HOT A;  3D9K A;  4JHJ A;  2JAB A;  3FTX A;  3LVQ E;  2OVB A;  4JHR A;  5G05 J;  3B7R L;  5KJN A;  1N4P A;  4EBA A;  4CGV A;  5KWD A;  3JUE A;  3ZPJ A;  3MA5 A;  4HLL A;  2H6I A;  2ZIS A;  2GRQ B;  4I9C A;  4OYS A;  4L1B A;  3BQO A;  4GCO A;  3Q7A A;  2I1K A;  4NAC A;  3HG0 D;  3TJP A;  2BTD A;  2V4L A;  4LNG A;  4TV3 A;  3UT8 A;  3FTS A;  3AG1 E;  2VSN A;  3D9P A;  2J09 A;  3KEZ A;  3ONL A;  1OCC E;  4YVQ C;  1H2V C;  4I6G A;  1N94 A;  5EX0 A;  3FTY A;  3FUI A;  4F7A A;  5ANR A;  4Q96 A;  2GRO B;  4JD2 G;  4J6I A;  3TWS A;  5AIJ A;  3OTN A;  3FTV A;  3VTX A;  3T8M A;  1EF1 C;  1O1T A;  2XRZ A;  2ZGD A;  2RFM A;  1FCH A;  3RRN B;  4TUU A;  4IYP A;  3UMV A;  4N5C A;  2QYU A;  5KJK A;  2UWJ G;  4EHM A;  2P9N G;  2OCC E;  3ZVV A;  1WY6 A;  3SHF A;  3DSX A;  2V0P A;  4JA7 A;  1JPL A;  3FHE A;  4HLE A;  1N0Q A;  5BT1 A;  3RSE G;  3AAA C;  4UWH A;  4F3V A;  1MX2 A;  4LSZ E;  5LCW J;  4R7L A;  3IBE A;  1HS6 A;  4UUC A;  5FIO A;  1E8W A;  4EQF A;  2NSZ A;  3Q4A B;  2QFC A;  4GYY A;  3PZ2 A;  1PC2 A;  4ME2 A;  4GTM A;  5EYP F;  4GZD A;  4AM9 A;  4U8H A;  4B89 A;  2L0I A;  4HNA D;  3ZIM A;  3SF4 A;  4GCN A;  1OWM A;  4XKB A;  1AWC B;  5FIN A;  3RAU A;  4GMR A;  5HI7 A;  1N95 A;  3ASF A;  1E8X A;  1OCZ E;  3NZU A;  5B1A E;  4ATZ D;  2XQ0 A;  4GTV A;  4MBG A;  1N54 A;  2YIN A;  2KZT A;  2R59 A;  4I9E A;  1V55 E;  1E96 B;  2IU1 A;  4FUL A;  3TG5 A;  3IXE A;  2VSO E;  3D3M A;  3CR3 A;  1SZ9 A;  4BWR A;  1DNP A;  3SFZ A;  5BV1 A;  2WXF A;  2XRY A;  3KSL A;  1ELR A;  3PRE A;  3L82 A;  3S7F A;  2FI7 A;  1HG5 A;  5T8I A;  2IO2 C;  4WWP A;  3AG2 E;  1H6P A;  3CVL A;  3UKR G;  3AG3 E;  4FP7 A;  2KZT B;  4I2Z A;  2XHE A;  1IXV A;  5ENT D;  4HOU A;  5ENQ D;  1E8Y A;  3N71 A;  4BFR A;  1S0P A;  4AIF A;  4KT6 B;  1YCS B;  2AVP A;  2ETB A;  2FEZ A;  1UG3 A;  1BI8 B;  2M63 A;  3QDN A;  4NIK A;  2RFA A;  2KAT A;  3NZS A;  1IHB A;  3ABM E;  4TXR A;  4GA1 A;  4U96 D;  4WWN A;  3FUK A;  1JWF A;  2J4B A;  4GTQ A;  4IRU A;  2AWI A;  3HYM B;  3Q7F A;  5KBA A;  1TR4 A;  4M3O A;  4JHK A;  3FUL A;  1TN7 A;  1Y8M A;  1E90 A;  2KM4 A;  3PE3 A;  5ARG A;  5LX8 A;  4HQD A;  4MLP A;  3W9F A;  2HYZ A;  3AU4 A;  3MEK A;  1O1S A;  3PS6 A;  2I1J A;  3R7Q A;  3FH5 A;  1JCS A;  3DSU A;  4DX7 D;  2FO1 E;  3MKQ A;  2KBX A;  3T9K A;  3IKO B;  3URZ A;  3NOC D;  5KNH D;  4ABN A;  4GTS A;  2IQC A;  2V5F A;  1EYH A;  2KCK A;  2OVF A;  3DWL G;  2DVW A;  1OCO E;  4EZJ A;  4HRL A;  4YDW A;  3MKQ B;  1Q2Z A;  5CRV A;  4A63 B;  5FQ4 A;  3LPZ A;  3TL5 A;  3QAQ A;  4FJZ A;  5A6C A;  3ULE G;  3I3N A;  4BT9 A;  3L6A A;  1INZ A;  3CVV A;  3Q79 A;  3P2B A;  3JQ0 A;  2WXK A;  1EPU A;  4APO A;  4HB5 A;  3RO3 A;  4GU5 A;  2DWZ A;  2HO1 A;  1Z3X A;  2GW1 A;  1MJ0 A;  2WB2 A;  3MGB A;  5A23 A;  3MV2 B;  1TYQ G;  3AU5 A;  4U8Y D;  3V79 K;  4ILH B;  1UOH A;  2Y69 E;  4N3C A;  3K9I A;  3ISM C;  4KZC A;  2R02 A;  4NRH B;  4HBD A;  4GTT A;  4FAD A;  4N3A A;  4D10 C;  3O48 A;  3FUF A;  3PUK A;  1Z6T A;  4UQX A;  2VTB B;  1OY3 D;  3CVN A;  1UJK A;  1MX4 A;  1OCR E;  4PS7 A;  5G2N A;  3CHS A;  3LYA A;  4GAA A;  4LRZ A;  3PZD A;  5CCM A;  3HVE A;  2Y4U A;  1FPP A;  5EIL A;  1K8K G;  5ENR D;  2P58 C;  3MX3 A;  5FTP A;  4UI9 J;  3KS2 A;  2P9K G;  4XKC A;  3HXC A;  5EDS A;  4HOQ A;  4GTP A;  2WXR A;  5AYW D;  3HXF A;  1UJJ A;  2ZGG A;  3CVY A;  2KCL A;  4B93 B;  3ZN3 A;  2NXP A;  4K03 A;  3DSW A;  3BU8 A;  1HZ4 A;  3ML8 A;  2PM7 A;  3CHR A;  3FU3 A;  3PVL A;  3Q78 A;  4BX9 A;  2J8S D;  1YMP A;  2HE0 A;  2KXP C;  1TN6 A;  2XZD G;  5D66 A;  3AG4 E;  4BEP A;  2XCB A;  4JVS A;  1OUV A;  4ANW A;  5J08 A;  4Y6C A;  4G24 A;  4KBQ A;  3QKY A;  4GYO A;  1JCQ A;  4DI4 A;  4U8V D;  4DX2 A;  1GW6 A;  4U63 A;  5ANL A;  3T5X A;  2AW6 A;  5CRU A;  1DCQ A;  1K1B A;  4F53 A;  3MJW A;  1QQE A;  1E8Z A;  4DX6 D;  4GZC A;  4C0E A;  4DRX E;  4B94 A;  4LER A;  2XPZ A;  2Y1L E;  3PNT B;  4CT0 A;  3R7R A;  1QNF A;  3HHM A;  3AS5 A;  4MKT A;  2BF0 X;  4K5C A;  4MRU A;  3MZL B;  4RSY A;  2XGO A;  3NB2 A;  4G8L A;  4U7E B;  3ZEF A;  5D2M C;  4PS8 A;  1W3B A;  4ILG A;  3QAR A;  2MOW A;  4KYO B;  2PNN A;  3SZ7 A;  3OAW A;  3LJN A;  3LXU X;  1A5E A;  5D0O D;  4GMJ A;  1S63 A;  1TNY A;  3D9M A;  2V5Q C;  3J5Q B;  2QYJ A;  3LY9 A;  1IHG A;  4EZL A;  3FDH A;  5BNW A;  3EHR A;  3FTW A;  3EHM A;  3ZHE B;  2EIJ E;  1YYH A;  3TWQ A;  3ASO E;  3UPV A;  3HXB A;  3Q9U C;  2V4H C;  3FUD A;  4M7C A;  2QY7 A; 
#chains in the Genus database with same CATH homology
 1QBQ A;  1O5M A;  1JCR A;  1JCQ A;  4YDO A;  1TNZ A;  1O1R A;  2ZIR A;  3Q75 A;  3EU5 A;  1FT1 A;  2H6G A;  4GTS A;  1N4S A;  1O1T A;  3KSL A;  3DST A;  3DSS A;  1S64 A;  1KZO A;  4LNB A;  4GTO A;  1MZC A;  4EHM A;  3DPY A;  3DSX A;  1NI1 A;  3KSQ A;  3C72 A;  4L9P A;  1FPP A;  1N4R A;  3HXD A;  3PZ3 A;  1KZP A;  3Q73 A;  1LTX A;  4YDE A;  3HXC A;  3Q79 A;  3EUV A;  4GTP A;  1TNO A;  3E37 A;  3HXF A;  3E34 A;  2BED A;  1SA4 A;  2F0Y A;  1N4P A;  1LD8 A;  4GTQ A;  3Q7F A;  3PZ2 A;  2H6I A;  2IEJ A;  2ZIS A;  1S63 A;  4GTM A;  3DSW A;  1TN7 A;  1TNY A;  3PZ1 A;  1DCE A;  1N9A A;  1D8D A;  1LD7 A;  1TNU A;  3SFY A;  3SFX A;  1SA5 A;  3Q7A A;  2H6F A;  1TN8 A;  1NL4 A;  1X81 A;  3Q78 A;  4LNG A;  1D8E A;  1TNB A;  3DRA A;  3DSV A;  1JCS A;  3E32 A;  1TN6 A;  3E33 A;  4GTT A;  1O1S A;  1N94 A;  1N95 A;  2R2L A;  3HXE A;  3HXB A;  3PZ4 A;  4GTR A;  4GTV A;  2H6H A;  1FT2 A;  1N4Q A;  3E30 A;  4MBG A;  3DSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...