2FBNA

Plasmodium falciparum putative fk506-binding protein pfl2275c, c-terminal tpr-containing domain
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
153
structure length
153
Chain Sequence
AKKSIYDYTDEEKVQSAFDIKEEGNEFFKKNEINEAIVKYKEALDFFIHTEEWDDQILLDKKKNIEISCNLNLATCYNKNKDYPKAIDHASKVLKIDKNNVKALYKLGVANMYFGFLEEAKENLYKAASLNPNNLDIRNSYELCVNKLKEARK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords 70 kDa peptidylprolyl isomerase, putative
publication title Crystallographic structure of the tetratricopeptide repeat domain of Plasmodium falciparum FKBP35 and its molecular interaction with Hsp90 C-terminal pentapeptide.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 64
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2fbnA00
1YA0A 2FBNA 4ABNA 5BT1A 3ASGA 3ZGQA 1ZU2A 3NF1A 1IHGA 3QWWA 4KXKB 2VSNA 4N39A 4A1SA 4APOA 3CVPA 2V5FA 5LCWJ 4GZ6A 2KCLA 2I6HA 3PE3A 4N5CA 2UY1A 3AS5A 3Q49B 1OUVA 4BTAA 3QOUA 5LCWC 2KCVA 4JA9A 4XIFA 4J8FA 1QQEA 5EX0A 3N71A 3Q5MA 4GA1A 4G25A 5FTPA 4I9EA 3AS8A 2FO7A 2XCCA 3GW4A 4YNDA 2C0MA 3CVQA 3CK8A 4G23A 5HI7A 1E96B 3URZA 2E2EA 3CEQA 1HH8A 2C2LA 3CKBA 2NC9A 5CCLA 2XEVA 4NQ0A 2MHKA 4KYOB 4U0ZA 3PDNA 3ASDA 3BEEA 2AVPA 2JLBA 3ASFA 3RJVA 2KC7A 2Y4TA 5BW8C 3OXLA 3Q15A 4XI9A 5KJLA 3ZN3A 3CV0A 4N3BA 3GZ2A 3CK7A 4O6FA 4I9CA 2WQHA 3ZHEB 1W3BA 5D0QD 3S7JA 1QZ2A 3KS2A 5EKQD 3Q4AB 4GCOA 3LY7A 2PZIA 2HR2A 2XCBA 5ARFA 3Q47B 4Y6CA 5G04J 4N2QA 2LSVA 4B94A 2GW1A 3ESKA 5FZRA 3UPVA 3TGOA 4HORA 3WXXA 1NA3A 2VGXB 4GA2A 4ME2A 1TJCA 5JJ6A 4JA7A 3SZ7A 1XNFA 3AS4A 4RG9A 4JHRA 5M72A 1FCHA 3LKUA 3QDNA 2Y4UA 5FT9A 4GZ5A 1KT0A 1ZBPA 4U0UA 2XGMA 3MV3B 4N3CA 2Q7FA 4WNEA 4HOQA 2KCKA 4AY5A 5JJTA 2IFUA 4BTBA 3S7DA 4CDRA 3LCAA 2HO1A 4IN3B 2LNIA 3EDTB 4GYOA 5HQ8A 3ASHA 3GYZA 4LEUA 5G05J 5KJKA 3OXGA 4WNGA 2PQNA 4G1TA 3MA5A 2QFCA 3MKRA 2VGYA 2C0LA 4XI0A 2UY1B 4I1AA 3MV2B 2J9QA 1KT1A 3CKCA 3RO2A 4CGWA 4EQFA 3VTYA 4GPKA 4GYYA 5DIZA 2VYIA 4WNFA 3U3WA 5C1DA 3LPZA 3PE4A 4I2WA 3FWVA 4U07A 4UI9K 3RU0A 5A6CA 5CHEE 4HOTA 4H7YA 3KAEA 3FP3A 2VSYA 2L6JA 4H7XA 3U4TA 4GZ3A 4G26A 5FZSA 5FZQA 1HZ4A 2XPIA 2VQ2A 4N2SA 3ULQA 2BUGA 3QKYA 3CK9A 3OXFA 4BT9A 1NZNA 4JL0A 5JJ7A 4G2VA 5G04C 5FJYA 4N3AA 3E4BA 3S7FA 2UWJG 4UI9J 3VTXA 4WNDA 4UQZA 4BWRA 3TG4A 2PQRA 2HYZA 3CVLA 2IF4A 3FFLA 4UI9C 1PC2A 5AYWD 4KBQA 5ARGA 5D0OD 3RKVA 4AM9A 4YVQC 4YVOA 3QWVA 4J0UA 3IEGA 3ZHEA 2P58C 2LSUA 4BT8A 1Y8MA 4WUYA 4UQYA 4J8DA 4HOUA 2XGSA 4W9RA 3S7BA 3HYMB 1A17A 2OOEA 3K9IA 4HOSA 2FF4A 3LY9A 3ZPJA 1KLXA 1NA0A 2KATA 3QWPA 2R5SA 3ZFWA 2FI7A 3TAXA 5KJMA 1WAO1 3LYAA 3R9AB 3LY8A 1P5QA 4U0SA 4AY6A 3KD7A 4GA0A 3GZ1A 1WM5A 4AIFA 2WPVA 4Y6WA 5G05C 5DBKA 1ELWA 4RG6A 1B89A 3RO3A 3RIBA 4I2ZA 2YQ8A 4G24A 3MEKA 2FEZA 2VGXA 5KJNA 4J8EA 4GYWA 5CCMA 1IYGA 4F3VA 5BNWA 4CGVA 3O48A 3TG5A 5EX3A 3JYSA 4NRHB 2YHCA 4I17A 1ELRA 4GCNA 3SF4A 5A7DB 3UQ3A 1HXIA 4UQXA 3UUXA 2PL2A 4U04A 3CVNA 2DBAA 2ONDA 2XGOA
chains in the Genus database with same CATH superfamily
2FBNA 3Q79A 3PZ3A 3FUFA 3FY4A 1O1TA 1ZU2A 1U3CA 2BTDA 4N39A 3UX4A 3KSLA 2V5FA 5LCWJ 2VJ8A 3IBEA 2Y1LE 4FC8A 2AJAA 1UN8A 2OCCE 2F37A 3D9NA 1UW4B 4MBGA 4L7TA 4BTAA 2Y69E 3HVEB 4EECA 3ZUVB 5BV1A 4K0RA 4DI4A 3ZVVA 4GA1A 3ONLA 1MX2A 3GZSA 4FHKA 1BI8B 3AS8A 1HE8A 1HO8A 5HKPA 1N94A 4HRNA 2FO7A 4O1OA 3GW4A 2C0MA 1Z3YA 3FUEA 2P9KG 3ZU7B 1HF8A 3CK8A 1N0RA 3B13A 3OTNA 3CEQA 1HH8A 2C2LA 2R03A 3CKBA 3ENEA 2XEHA 3ULYA 4F1PA 5ANRA 3ASFA 4KZ0A 3KSQA 2Y4TA 3OXLA 5KJLA 3EU5A 4TXRA 3CVXA 3CV0A 4N3BA 4XX5A 1X81A 4G8KA 2WQHA 3ZHEB 3KEZA 3BUAA 1LD8A 1E7UA 1BD8A 1E8YA 3LJNA 4YDEA 1Q2ZA 3FTZA 4TRQA 5C2YA 2OEWA 4YDWA 4LNUD 4AEZC 5KBAA 5EYLA 3NOGD 2XZTG 4RQIA 1DVPA 2VTBB 3C3OA 3AG2E 2AXUA 4N2QA 3SNXA 1Z3XA 1HS6A 4C0EA 1D8EA 2GW1A 3ESKA 4A55A 4CCAA 5FZRA 4IYPA 2ETBA 1TNOA 4GA2A 4XKCA 2P9NG 4ME2A 5HRYA 4L2LA 1S64A 1OCOE 1JCSA 4JA7A 4MKTA 1E8WA 4OVVA 1PAQA 3TL5A 4AV7A 4I43A 2L0TB 4JHJA 5FT9A 3TXMA 4J7WA 4HNAD 3L54A 4BESA 3DPDA 4U0UA 2XGMA 3D9MA 3QC1A 4DUIA 5JJTA 3X2QE 4CDRA 2WMNA 3UKRG 2HO1A 2LNIA 3GYZA 3OXGA 3ZXPA 3SBSA 4WAFA 1BPOA 3W9GA 3L9TA 3MA5A 2QFCA 3MKRA 2VGYA 1IHBA 2BEDA 4TXPA 3DWLG 4XI0A 3VLEA 1RZ4A 1KT1A 3CKCA 4L9PA 3RO2A 2IEJA 4FP7A 4CGWA 2WXJA 4LNGA 4EHMA 4GYYA 2VYIA 4WNFA 3UT7A 3F6QA 4I2WA 4U07A 4PS7A 3QB2A 3AJIA 1S0PA 5A6CA 2BKKB 5B1AE 4XE0A 5CHEE 3V79K 3PZDA 4F1SA 4JC8A 3L6AA 3KAEA 3FP3A 5T4YA 4EZKA 1RW2A 3ABME 2VSYA 4DX2A 3U4TA 3C98A 4GZ3A 5JHAA 5CECB 2EQXA 2RG8A 1NL4A 3PZ1A 5CERB 5FZQA 1MX6A 1IQRA 2J08A 2XPIA 4FU3A 2BUGA 3CK9A 4DRXE 4D10C 5HS0A 3I4RB 2CHZA 3DEOA 4BT9A 4JL0A 5G04C 4UI9J 4U8YD 1MQSA 5AQ9A 4TUUA 1OCCE 4L2YA 3Q7AA 4JXTA 2HYZA 3C72A 3ML8A 1TN7A 3DSXA 4YVOA 3PUJA 1WY6A 3L08A 1N0QA 5AQAA 4FLHA 4UWGA 2NSZA 2ZISA 4OAUC 4R7LA 2P58C 3CLJA 1Y8MA 1ZB1A 4J8DA 3D9IA 3C5RA 2J4DA 1H2VC 3TWTA 4CYMD 3JUEA 3S7BA 5BXUA 2WXHA 2B0OE 2WXNA 3UINC 1KLXA 1A5EA 3QWPA 4G8LA 2IJGX 3B7BA 3TAXA 1QNFA 4HI9A 3R9AB 3LY8A 4U0SA 5FIOA 2PNNA 2Y0BG 1U2VG 4I6GA 3NZUA 4E85A 3GZ1A 4WWPA 4LRZA 3V31A 5DBKA 3CHOA 4FLBA 4K5BA 4RLYA 5AIJA 4G24A 2FEZA 2R02A 3FUIA 2DCPA 2QY7A 2VSOE 3T5XA 2WXFA 2OVBA 5BNWA 4CGVA 1H6PA 3LS8A 4JEUA 1YMPA 5EX3A 3JYSA 4IULA 5JMND 4I17A 1O1SA 3DSTA 3APCA 2XHEA 3SF4A 5A7DB 2WXKA 2X6HA 3UM3A 1MX4A 3ZYMA 1TN8A 1KZOA 1HU3A 3AU5A 3MYVA 3CIAA 3UT4A 4HLLA 3J5PA 3SBTB 2RKKA 2X6IA 2CHXA 3ZIMA 3ASGA 3ZGQA 2X6FA 3QWWA 4KXKB 5FQ8A 4UWHA 1KPSB 4APOA 2ZU6B 4HQDA 5B1BE 3UIOC 2R05A 4B89A 1N4RA 2I6HA 4MLPA 5ENPD 2V0PA 2J07A 2UY1A 4JEHA 5BUZA 4LCTA 4B0ZA 4K03A 1QQEA 3D3MA 5D2MC 3EIQC 3G2TA 5EX0A 4G25A 5FTPA 2KXPC 4I9EA 3DSSA 3HXCA 2XCCA 5BPPA 4DK5A 2WB2A 4G23A 2HE0A 4KZCA 1E96B 3PNLB 2GRQB 4UUCA 3Q9NC 1V54E 1NFIE 2WQ7A 2MHKA 4RVBA 4KYOB 3LXUX 3ABLE 3APFA 3RJVA 4FADA 3Q15A 1UG3A 3HG0D 3L17A 3PRZA 4BX8A 1OT8A 4I9CA 2KZTB 3SI5A 1SZAA 3S7JA 3FUMA 5J08A 4JB8P 3KS2A 4GTMA 5KCMA 2IOLA 5EKQD 2LXMA 4EBAG 1JCRA 3G2WA 2PZIA 2WXMA 3CR3A 2ETAA 4BETA 2E0IA 3C3QA 3Q47B 4GZCA 3FU3A 3NOCD 4Y6CA 5G04J 2J09A 1IXVA 2L9BA 4F53A 4L23A 4B94A 3T9KA 4ZHBA 5FQ4A 3TGOA 4AJWA 1SA5A 1WDYA 5ENRD 3WXXA 1HG2A 2VGXB 3ML9A 2H6FA 5LOZA 3Q78A 4UWKA 3SO8A 3FUDA 1TJFA 4F6RD 1H6OA 5JJ6A 3G2UA 5CRVA 3SZ7A 3RAUA 3TWRA 3AS4A 3TJPA 3IXEA 4A63B 2XEEA 1H19A 3I5PA 3HDXA 3QDNA 4HI8A 5AQBA 4GZ5A 1ZBPA 4BERA 3ESLA 3CGHA 2MYOA 3MV3B 2HM8A 4GTRA 2EIJE 2Q7FA 4I1MA 2KCKA 5ENOD 4TV3A 4PS8A 3SFXA 5AARA 3LCAA 2CHWA 3MKQB 1S70B 2H6IA 5KJKA 4WNGA 2PQNA 3D9HA 3O4ZA 2A5EA 1Z5SC 5CMYA 5AQ7A 5FQ6A 4G11A 2YNQA 4WWNA 4U95D 2KM4A 2OV8A 3VTYA 2XRZA 3ZYLA 5DIZA 3L16A 1LD7A 3LPZA 4CT0A 2J8SD 1K1AA 3FWVA 4LUNU 2AWIA 2LAHA 1KZPA 4GTVA 5KNHD 3HVEA 3QK0A 5E75A 1HZ4A 4CDMA 2XPYA 2XQ0A 4DX1A 2VQ2A 2WQ6A 2IOSA 3OXFA 2XS1A 2J49A 4KMOA 2H6HA 1OWOA 3ZKJA 1NZNA 5JJ7A 3CVVA 4N3AA 3S7FA 3CHRA 1MJ0A 2DYSE 4WNDA 4UWFA 1O1RA 1N4SA 1EDUA 3MKQA 3TG4A 3AG3E 2PQRA 3CQGB 2GRMA 2IF4A 3CQCB 3P2BA 5EN5D 3R7RA 2DVWA 4GAAA 3RKVA 3UTMA 4YVQC 3EUVA 4APFA 4HLEA 3ISMC 5ANLA 1LTXA 2QC9A 2V4LA 3ZHEA 4WUYA 5CBOA 4HOUA 3HIZA 1PY1A 3PREA 5T3RA 2XGSA 4U8HA 4ATZD 1DCQA 2L0IA 4K5CA 4GTPA 2OOEA 2FF4A 3LY9A 3EU9A 2DYRE 2KATA 3FUKA 1SA4A 3TWWA 2MRIA 3LYAA 1OWMA 5EILA 2RD0A 2VTBA 4PS3A 2RFAA 5IY5E 1FVFA 1WM5A 1HFAA 4YDOA 2R59A 3HRAA 4DX7D 3LVQE 1ELWA 4ATGA 5J90A 1G3NB 3RIBA 3W9FA 3FUNA 3MEKA 5KJNA 4GYWA 3DSUA 3HXEA 3EHRA 4F3VA 1TYQG 3UXGA 2P9PG 1FT2A 3PEUB 1H6KA 4KT6B 2YHCA 1NP7A 4GCNA 1N4QA 1HXIA 3UMVA 3FH5A 4UQXA 3UUXA 3TWVA 2NYJA 3CSFA 3E30A 3B7RL 3FTUA 3KEAA 2ONDA 2XGOA 3RRNB 1EPUA 4QQIA 1YYHA 4XEIG 5BT1A 4K5AB 4L1BA 3MGBA 3UM1A 2OEVA 2VSNA 1SZ9A 3PH0C 3U66A 3FH7A 3CVPA 1JWGA 2P2CP 4GZ6A 2KCLA 2EIME 1K8KG 3IKOB 3V2OA 1IQUA 2XRYA 5EIBE 3AS5A 4OAVB 1OUVA 4A1GA 2JEKA 5LCWC 2RFMA 4U7EB 3LJ3A 3DPYA 4JA9A 3N71A 4ZFHA 5ITZF 3NAWA 2LAIA 3Q73A 2OVFA 3B95A 1H2TC 3HXBA 3URZA 2E2EA 2WMOA 3P1UA 3U64A 2NC9A 4A3TA 4AVXA 4NQ0A 2ILRA 4U0ZA 4I6EA 3ASDA 3BEEA 2WXIA 2JLBA 2KC7A 2WXLA 5BW8C 3FDHA 4XI9A 3DBSA 2WXRA 3SHFA 3ZN3A 4XKBA 2CG2A 1AP7A 1N95A 3PUKA 3CK7A 4O6FA 4AP2A 3PNTB 1TR4A 4O1PA 2XS8A 1W3BA 1Y6IA 3TWXA 1QZ2A 2I1JA 5LFAA 3CVYA 2WXQA 3AG4E 3FTWA 4DLOA 4GCOA 3Q7FA 2XCBA 2HR2A 4JPSA 4UWLA 2ZGDA 3ZEFA 3JXJA 4CDNA 2GROB 4RSYA 2QYUA 1EYHA 3ZYKA 2F8XK 1OY3D 5AJDA 2LSVA 4DJAA 2R2LA 3FH8A 1OWPA 3SY2A 5ENTD 4BSZB 1JWFA 3UPVA 3CHSA 4F7AA 4HORA 1NA3A 3FEXA 4ILIA 5BV0A 2IQCA 4MS6A 4HVBA 1TJCA 5AAOA 3NQPA 4GTSA 3DSWA 3JQ1A 2P9LG 1XNFA 3SGHA 2GRLA 5M72A 1FCHA 2A5UA 3OAWA 5FQ7A 1KT0A 2XZDG 1TNYA 3VLFA 4IRUA 1TEZA 2EIKE 4N3CA 4ILGA 4WNEA 4HOQA 4AY5A 2CG3A 5ENSD 3QARA 4HBDA 3SQVA 3BU8A 5JHBA 4U63A 1HX8A 5G2NA 3MX3A 3G2VA 4IN3B 3NZSA 5LX8A 4X8QA 5HQ8A 4LEUA 3ULEG 4C9BB 4BFRA 4GZDA 2JABA 4G1TA 1N52A 2C0LA 2BF0X 3ABKE 1E8ZA 2EILE 2J9QA 1TNBA 4CRWA 3CHPA 2DIWA 3APDA 3EJNA 4GMLA 3U3WA 3TWSA 4LG6A 3PE4A 1N9AA 3RU0A 2DZOA 4TUMA 4HOTA 4H7YA 2V4HC 3ASNE 2I2OA 4G26A 4A3VA 3FTXA 3FU0A 2P9SG 1FT1A 1Z6TA 3FHEA 3SFYA 2GRPB 3QKYA 4WWOA 1X5BA 3G2SA 2X6JA 4GPMA 5AENA 1E8XA 3PEVB 5E76A 3PVLA 2J4BA 1MHQA 4G2VA 1YCSB 4FJZA 5FJYA 3E4BA 3HXDA 2UWJG 5FWQA 4BWRA 2LUHA 3C3RA 1JUQA 4J6IA 1UOHA 1DC2A 3CVLA 3S2AA 2FULA 4HRLA 2R17C 4UI9C 1PC2A 3E32A 2WXOA 4KBQA 2AXZA 3J5QB 5KWDA 1FPPA 4PDXA 2IY0C 2PM6A 3FEYA 4J0UA 1VDYA 5CMWA 1EF1C 1K1BA 2KZTA 3B7UX 3FTYA 4BT8A 3PZ2A 2A4ZA 4XZ4A 3R9MA 4AXHA 3TXNA 5EIDA 3D9OA 4BY6A 1N54A 1TN6A 4DLQA 1A17A 3K9IA 4HOSA 3ZPJA 2WVIA 3CVUA 1H0AA 4ILHB 5KJMA 4HB5A 1P5QA 1E7VA 3DRAA 1TNZA 3KD7A 4DPRA 2LXLA 3DXKG 5G05C 3NBNB 4JZYA 3SD5A 1OCRE 4RG6A 3BG1B 2EINE 3RO3A 2QZAA 2WM9A 4JVSA 2YQ8A 2VGXA 4KVMA 4J8EA 4YDYA 3LVRE 3DXMG 1SVXA 3UT8A 1ELKA 4ACKA 1UN9A 3QAQA 1MZCA 4Q69A 3O48A 2WXPA 3Q9UC 1GW6A 2IONA 4ACLA 4GTTA 3MJWA 4FA6A 3RK6A 3ZNGA 1E90A 3UQ3A 3CVWA 3RRMB 3ZW3A 4OYSA 5AN8A 2PL2A 4JW1A 2F8YA 3JCKC 4GMJA 5D66A 1YA0A 1V55E 3FU6A 2ETCA 4ABNA 4B8AA 2GRNB 3AAAC 3TWQA 3NF1A 1OCZE 4OVUA 1IHGA 5CBNA 4N5QA 3U9WA 4M7CA 4A1SA 2F0YA 4C0MA 4J8YA 3EIJA 4GTOA 2AW6A 3PE3A 4N5CA 5EDSA 3Q49B 1HG5A 3QOUA 1N11A 3ZXSA 2KCVA 3BQOA 2KBXA 4XIFA 4J8FA 3Q5MA 1K3ZD 1JCQA 2WXGA 4P29A 1BU9A 5T8IA 3R7QA 2FO1E 4YNDA 3WG7E 2Y3AA 3CVQA 3MCXA 5HI7A 2IO2C 1OWNA 4CEMA 3FTSA 3JUIA 5CRUA 5CCLA 2XEVA 1UJKA 4Z68A 3PDNA 4JHKA 2AVPA 1QYMA 4GMRA 3T5VA 3JXIA 1O5MA 2VGEA 3T8MA 3GZ2A 4LSZE 4I1OB 2BKGA 3UM0A 5ENQD 5D0QD 3FULA 4ANUA 5CEAA 2XPZA 1JPLA 4LNBA 5B3SE 4EZJA 1INZA 3FTVA 3Q4AB 4DX5D 3LY7A 3NB2A 2ZXWE 5ARFA 2PM7A 3HHMA 1U3DA 2YINA 2X6KA 3D9LA 1WG0A 4HS2A 3QNKA 3PZ4A 1NI1A 3L13A 5A23A 3TWUA 3L22A 2X3MA 4U96D 4KVOA 2LO6A 2CFUA 1AWCB 2DZNA 3ASOE 3LDZA 4BX9A 4ANXA 1SW6A 2I1KA 4RG9A 4CZ2D 4URKA 3EHQA 2DWZA 4JHRA 3I4GA 3LKUA 3I3NA 3IV0A 2Y4UA 2IU1A 2GRRB 4Q96A 2V5QC 4DI3A 4B8CB 1D9SA 5EYPF 4JD2G 3FUHA 3MZLB 3ONKA 5KNGA 4MRUA 2IFUA 4BTBA 3S7DA 4O60A 3FU5A 3RRUA 1XGWA 2CFZA 3EDTB 4GYOA 4AOFA 3ASHA 5G05J 1OXJA 2AXVA 2YHEA 4E6HA 4I6JA 4Q94A 5ENNA 3VLDA 3CHMA 4HRMB 2UY1B 4I1AA 3MV2B 1BI7B 3D9JA 3QJZA 2QYJA 4EQFA 2M63A 5CEDB 4GPKA 3AG1E 1IKND 5C1DA 4BSXA 4UI9K 1OWLA 4B93B 4U8VD 3EHMA 3D9KA 2L6JA 4H7XA 1TNUA 5FZSA 3HXFA 4QFVA 1DNPA 2ZIRA 1UJJA 4PH4B 4V3IA 2L6BA 4ANWA 1QBQA 4N2SA 3ULQA 4EBAA 4NIKA 2ZGGA 3D9PA 3CSTA 2NXPA 1LF8A 3UM2A 3VTXA 4UQZA 3B7TA 4M3OA 3DSVA 4FULA 3IHVA 3FFLA 4ANVA 4GTQA 4GB9A 5AYWD 5ARGA 5JA4D 5D0OD 4NACA 4AM9A 4EZLA 4FJYA 4NURA 3QWVA 1DCEA 2I9CA 2MOWA 3IEGA 3UKUG 3RSEG 4GU5A 1N4PA 2LSUA 1D8DA 4UQYA 3CHQA 5H7PA 3E33A 5AJLA 2VSXE 4W9RA 2H6GA 3HYMB 4FHJA 3UIPC 1NA0A 3IHYA 3L82A 2R5SA 3ZFWA 2FI7A 1WAO1 3V30A 4AY6A 2XENA 4GA0A 4AIFA 1L5JA 2WPVA 4Y6WA 1FVHA 3FUJA 5LP0A 3E37A 2X38A 3LEWA 3UI2A 3E34A 4J8SA 2GGFA 3EHNA 1B89A 3SFZA 3Q75A 2V8SE 3DEPA 4HFGA 2P9UG 4I2ZA 3V2XA 4C48B 5CCMA 3JQ0A 1IYGA 2B6CA 1SQMA 3PS6A 4LERA 1BLXB 4PUCA 2P9IG 3B7SA 4DX6D 3ZRHA 4BEPA 2IO3C 3TG5A 1MYOA 4NRHB 4TXQA 3T8KA 3BG0B 1ELRA 3AU4A 4CT4A 4HXIA 4EPZA 1H2UA 5FINA 3ZYQA 4U04A 5BXOA 3CVNA 2DBAA 5G55A 1S63A
chains in the Genus database with same CATH topology
3SBTB 1YA0A 2FBNA 2X6IA 2CHXA 3ZIMA 3FU6A 4ABNA 4B8AA 3FUFA 5BT1A 3ASGA 3FY4A 4L1BA 3ZGQA 1ZU2A 1U3CA 2X6FA 3MGBA 3NF1A 4OVUA 1IHGA 3QWWA 4KXKB 5FQ8A 2BTDA 2VSNA 4N39A 1SZ9A 4UWHA 3U9WA 4A1SA 3PH0C 3UX4A 3FH7A 2ZU6B 3CVPA 4APOA 3U66A 4JHJA 1JWGA 2V5FA 4C0MA 5LCWJ 2VJ8A 4GZ6A 2KCLA 3IBEA 4B89A 3EIJA 2I6HA 4MLPA 4FC8A 2AW6A 3IKOB 1UN8A 3PE3A 4N5CA 1IQUA 2V0PA 2J07A 2XRYA 2UY1A 5EDSA 3AS5A 4JEHA 5BUZA 3D9NA 3Q49B 4LCTA 1UW4B 1HG5A 1OUVA 4L7TA 4BTAA 3HVEB 3QOUA 4A1GA 2JEKA 5LCWC 4B0ZA 4K03A 3ZXSA 4EECA 2KCVA 3LJ3A 5BV1A 4JA9A 4K0RA 4XIFA 4J8FA 1QQEA 3D3MA 3EIQC 3G2TA 5EX0A 3N71A 4DI4A 3Q5MA 3ZVVA 4GA1A 3ONLA 3GZSA 4G25A 4FHKA 5FTPA 4I9EA 3AS8A 1HE8A 2WXGA 4P29A 1HO8A 5T8IA 2FO7A 3R7QA 2XCCA 3GW4A 5BPPA 2LAIA 4YNDA 2OVFA 2C0MA 1Z3YA 2Y3AA 3FUEA 1H2TC 4DK5A 1HF8A 2WB2A 3CVQA 3CK8A 3MCXA 4G23A 5HI7A 3B13A 4KZCA 3OTNA 1E96B 1OWNA 3URZA 3FTSA 4CEMA 2E2EA 3PNLB 3CEQA 2WMOA 1HH8A 3P1UA 3U64A 2C2LA 3JUIA 3CKBA 3ENEA 2NC9A 5CCLA 2XEVA 4A3TA 4NQ0A 1UJKA 2MHKA 4KYOB 4RVBA 4AVXA 2WQ7A 2ILRA 4U0ZA 3LXUX 3PDNA 4I6EA 3ASDA 3BEEA 4JHKA 2WXIA 3APFA 2AVPA 5ANRA 2JLBA 3ASFA 4KZ0A 3RJVA 2KC7A 2WXLA 2Y4TA 4FADA 5BW8C 3OXLA 3FDHA 3Q15A 4XI9A 3DBSA 5KJLA 1UG3A 2WXRA 3T5VA 3L17A 3SHFA 3CV0A 3ZN3A 3PRZA 4N3BA 3CVXA 4XKBA 2CG2A 3T8MA 4BX8A 3GZ2A 4XX5A 3PUKA 3CK7A 4I1OB 4O6FA 4AP2A 4I9CA 3PNTB 2WQHA 2KZTB 3SI5A 1SZAA 3ZHEB 3KEZA 1W3BA 1Y6IA 5D0QD 3FULA 3S7JA 3FUMA 5J08A 1E7UA 4ANUA 1QZ2A 3KS2A 2XPZA 1JPLA 4EZJA 1E8YA 2I1JA 2IOLA 5KCMA 5LFAA 1INZA 3CVYA 5EKQD 2WXQA 3FTVA 3FTWA 4DLOA 3Q4AB 4EBAG 3FTZA 4GCOA 4TRQA 5C2YA 3LY7A 3G2WA 2PZIA 2HR2A 2XCBA 4JPSA 4UWLA 3ZEFA 4AEZC 4CDNA 2WXMA 3CR3A 5ARFA 2PM7A 2E0IA 3HHMA 1U3DA 2YINA 2X6KA 1DVPA 4RSYA 3D9LA 2VTBB 1EYHA 3Q47B 3ZYKA 4GZCA 4HS2A 3FU3A 3QNKA 2AXUA 4Y6CA 5G04J 2J09A 2L9BA 4N2QA 5AJDA 4F53A 2LSVA 4DJAA 3SNXA 4L23A 1Z3XA 4B94A 3FH8A 3L13A 1OWPA 5A23A 1HS6A 4C0EA 2GW1A 5FQ4A 3ESKA 4A55A 4CCAA 3L22A 1JWFA 2X3MA 5FZRA 3TGOA 3CHSA 4AJWA 4F7AA 3UPVA 4KVOA 4HORA 3WXXA 1NA3A 2LO6A 1HG2A 2VGXB 3ML9A 3FEXA 4IYPA 4ILIA 5LOZA 5BV0A 2CFUA 2IQCA 4GA2A 4MS6A 4UWKA 4XKCA 3FUDA 1TJFA 4HVBA 4ME2A 1TJCA 4L2LA 3NQPA 3LDZA 4BX9A 5JJ6A 3G2UA 4JA7A 3SZ7A 4ANXA 3JQ1A 2I1KA 4MKTA 1XNFA 1E8WA 4OVVA 3AS4A 4RG9A 1PAQA 3TJPA 4URKA 3TL5A 3SGHA 2GRLA 4JHRA 4AV7A 4I43A 5M72A 1FCHA 2A5UA 2L0TB 3I4GA 3LKUA 1H19A 3I5PA 3HDXA 3I3NA 3IV0A 3OAWA 2Y4UA 3QDNA 2IU1A 5FQ7A 5FT9A 3TXMA 4GZ5A 4Q96A 1KT0A 1ZBPA 3L54A 3DPDA 4DI3A 4U0UA 4B8CB 3ESLA 2XGMA 3CGHA 3D9MA 3MV3B 3QC1A 3VLFA 4IRUA 2HM8A 1TEZA 3FUHA 4N3CA 2Q7FA 4ILGA 4WNEA 4HOQA 2KCKA 3MZLB 4I1MA 2CG3A 4AY5A 3ONKA 4TV3A 5JJTA 4MRUA 2IFUA 3QARA 4BTBA 4PS8A 3S7DA 3FU5A 4CDRA 5JHBA 3LCAA 3RRUA 2WMNA 4U63A 1XGWA 2CHWA 1HX8A 2HO1A 3MX3A 3MKQB 5G2NA 3G2VA 4IN3B 3NZSA 5LX8A 2CFZA 2LNIA 3EDTB 4GYOA 5HQ8A 4AOFA 3ASHA 3GYZA 4LEUA 5G05J 5KJKA 3OXGA 4WNGA 3SBSA 2PQNA 4C9BB 3O4ZA 4BFRA 4WAFA 2AXVA 1BPOA 4GZDA 2YHEA 4E6HA 4G1TA 4I6JA 3MA5A 4Q94A 5CMYA 5ENNA 5FQ6A 2QFCA 3MKRA 3VLDA 3CHMA 1N52A 2VGYA 4G11A 2C0LA 4XI0A 2BF0X 1E8ZA 2UY1B 2YNQA 4I1AA 3MV2B 3VLEA 4WWNA 2J9QA 1KT1A 3D9JA 3CKCA 3QJZA 3CHPA 2KM4A 3RO2A 4CRWA 2DIWA 4FP7A 4CGWA 4EQFA 3APDA 2OV8A 2M63A 2WXJA 3VTYA 2XRZA 4GPKA 4GYYA 3ZYLA 5DIZA 2VYIA 3EJNA 3L16A 4GMLA 4WNFA 3U3WA 3UT7A 5C1DA 3LPZA 3PE4A 4CT0A 4BSXA 4I2WA 4LUNU 3FWVA 4U07A 4PS7A 4UI9K 3QB2A 3RU0A 1S0PA 5A6CA 1OWLA 4XE0A 5CHEE 3PZDA 4HOTA 4H7YA 4F1SA 3EHMA 4JC8A 3L6AA 3KAEA 3FP3A 2AWIA 5T4YA 2I2OA 3D9KA 4EZKA 2VSYA 2L6JA 4H7XA 3U4TA 3C98A 2LAHA 4GZ3A 5JHAA 4G26A 4A3VA 2EQXA 2RG8A 3FTXA 3HVEA 5FZSA 3FU0A 5FZQA 3QK0A 4QFVA 1DNPA 5E75A 1HZ4A 1UJJA 1Z6TA 3FHEA 4PH4B 4CDMA 1IQRA 2XPYA 4V3IA 2J08A 2XPIA 4FU3A 4ANWA 2XQ0A 2VQ2A 4N2SA 3ULQA 2BUGA 3QKYA 4WWOA 1X5BA 3G2SA 3CK9A 2IOSA 2X6JA 2WQ6A 3OXFA 4EBAA 5AENA 1E8XA 3PEVB 5E76A 4D10C 2J49A 3I4RB 3PVLA 4KMOA 1OWOA 2J4BA 2CHZA 1MHQA 3D9PA 4BT9A 1NZNA 3CSTA 4JL0A 2NXPA 5JJ7A 1LF8A 4G2VA 5G04C 4FJZA 5FJYA 3CVVA 4N3AA 3E4BA 3S7FA 2UWJG 4UI9J 5FWQA 3CHRA 1MQSA 4TUUA 3VTXA 4WNDA 4UQZA 4UWFA 3B7TA 4M3OA 4BWRA 1EDUA 3MKQA 4L2YA 1JUQA 3TG4A 4J6IA 4JXTA 3CQGB 2PQRA 2HYZA 3CVLA 3IHVA 4FULA 3S2AA 2FULA 3ML8A 2GRMA 2IF4A 2R17C 3FFLA 4UI9C 3CQCB 4ANVA 1PC2A 4GB9A 2WXOA 3P2BA 5AYWD 4KBQA 5ARGA 3R7RA 5D0OD 2AXZA 4NACA 4GAAA 3RKVA 4AM9A 4EZLA 4FJYA 4NURA 4PDXA 4YVQC 4YVOA 3PUJA 1WY6A 4HLEA 3QWVA 4APFA 3L08A 2PM6A 3FEYA 4FLHA 4UWGA 4J0UA 2I9CA 2MOWA 3IEGA 5ANLA 1VDYA 2NSZA 2V4LA 5CMWA 1EF1C 2KZTA 4R7LA 4GU5A 3ZHEA 2P58C 2LSUA 3B7UX 3CLJA 3FTYA 4BT8A 1Y8MA 2A4ZA 4WUYA 4XZ4A 4UQYA 4J8DA 3D9IA 3CHQA 4HOUA 3HIZA 1PY1A 2J4DA 1H2VC 3PREA 5T3RA 2XGSA 4AXHA 5AJLA 4U8HA 2VSXE 4W9RA 3S7BA 3D9OA 3TXNA 4BY6A 2L0IA 1N54A 2WXHA 3HYMB 4FHJA 4DLQA 1A17A 2OOEA 3K9IA 4HOSA 2WXNA 2FF4A 3LY9A 3ZPJA 1KLXA 1NA0A 2KATA 3IHYA 2WVIA 3FUKA 3QWPA 3CVUA 1H0AA 2IJGX 2R5SA 3ZFWA 2FI7A 4ILHB 3TAXA 5KJMA 1WAO1 2MRIA 1QNFA 3LYAA 3R9AB 1OWMA 3LY8A 1P5QA 1E7VA 4U0SA 2RD0A 4AY6A 2VTBA 4PS3A 3KD7A 4GA0A 4I6GA 3NZUA 1FVFA 4E85A 3GZ1A 1WM5A 4AIFA 1L5JA 4DPRA 4WWPA 2WPVA 4Y6WA 1FVHA 1HFAA 3FUJA 4LRZA 5G05C 2R59A 5LP0A 2X38A 5DBKA 3LEWA 4JZYA 3SD5A 3LVQE 4J8SA 2GGFA 1ELWA 3CHOA 4RG6A 3EHNA 1B89A 3SFZA 3BG1B 4FLBA 2V8SE 4ATGA 4HFGA 5J90A 3RO3A 2WM9A 5AIJA 3RIBA 4JVSA 2YQ8A 4G24A 4I2ZA 3FUNA 3MEKA 2FEZA 2VGXA 4KVMA 5KJNA 4J8EA 4GYWA 3LVRE 5CCMA 3JQ0A 3FUIA 2DCPA 2QY7A 2VSOE 3UT8A 1IYGA 1ELKA 3T5XA 4ACKA 1SQMA 1UN9A 2WXFA 2OVBA 3QAQA 4F3VA 3PS6A 5BNWA 4Q69A 4CGVA 4LERA 3LS8A 3O48A 4JEUA 4PUCA 2WXPA 3B7SA 3ZRHA 3PEUB 1H6KA 5EX3A 3TG5A 3JYSA 4KT6B 1GW6A 2IONA 4NRHB 4IULA 4ACLA 2YHCA 4I17A 3MJWA 1NP7A 4FA6A 3BG0B 3RK6A 1ELRA 3APCA 2XHEA 3AU4A 4GCNA 3SF4A 5A7DB 2WXKA 1E90A 4CT4A 3UQ3A 1HXIA 3UMVA 3CVWA 4HXIA 3FH5A 4UQXA 3RRMB 4EPZA 2X6HA 3ZYMA 1H2UA 3UUXA 3CSFA 3ZW3A 4OYSA 2PL2A 1HU3A 3B7RL 4JW1A 3ZYQA 3AU5A 3FTUA 3MYVA 4U04A 3JCKC 3CIAA 3CVNA 3UT4A 2DBAA 5G55A 2ONDA 2XGOA 4GMJA 3RRNB 1EPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YA0 A;  2FBN A;  4ABN A;  5BT1 A;  3ASG A;  3ZGQ A;  1ZU2 A;  3NF1 A;  1IHG A;  3QWW A;  4KXK B;  2VSN A;  4N39 A;  4A1S A;  4APO A;  3CVP A;  2V5F A;  5LCW J;  4GZ6 A;  2KCL A;  2I6H A;  3PE3 A;  4N5C A;  2UY1 A;  3AS5 A;  3Q49 B;  1OUV A;  4BTA A;  3QOU A;  5LCW C;  2KCV A;  4JA9 A;  4XIF A;  4J8F A;  1QQE A;  5EX0 A;  3N71 A;  3Q5M A;  4GA1 A;  4G25 A;  5FTP A;  4I9E A;  3AS8 A;  2FO7 A;  2XCC A;  3GW4 A;  4YND A;  2C0M A;  3CVQ A;  3CK8 A;  4G23 A;  5HI7 A;  1E96 B;  3URZ A;  2E2E A;  3CEQ A;  1HH8 A;  2C2L A;  3CKB A;  2NC9 A;  5CCL A;  2XEV A;  4NQ0 A;  2MHK A;  4KYO B;  4U0Z A;  3PDN A;  3ASD A;  3BEE A;  2AVP A;  2JLB A;  3ASF A;  3RJV A;  2KC7 A;  2Y4T A;  5BW8 C;  3OXL A;  3Q15 A;  4XI9 A;  5KJL A;  3ZN3 A;  3CV0 A;  4N3B A;  3GZ2 A;  3CK7 A;  4O6F A;  4I9C A;  2WQH A;  3ZHE B;  1W3B A;  5D0Q D;  3S7J A;  1QZ2 A;  3KS2 A;  5EKQ D;  3Q4A B;  4GCO A;  3LY7 A;  2PZI A;  2HR2 A;  2XCB A;  5ARF A;  3Q47 B;  4Y6C A;  5G04 J;  4N2Q A;  2LSV A;  4B94 A;  2GW1 A;  3ESK A;  5FZR A;  3UPV A;  3TGO A;  4HOR A;  3WXX A;  1NA3 A;  2VGX B;  4GA2 A;  4ME2 A;  1TJC A;  5JJ6 A;  4JA7 A;  3SZ7 A;  1XNF A;  3AS4 A;  4RG9 A;  4JHR A;  5M72 A;  1FCH A;  3LKU A;  3QDN A;  2Y4U A;  5FT9 A;  4GZ5 A;  1KT0 A;  1ZBP A;  4U0U A;  2XGM A;  3MV3 B;  4N3C A;  2Q7F A;  4WNE A;  4HOQ A;  2KCK A;  4AY5 A;  5JJT A;  2IFU A;  4BTB A;  3S7D A;  4CDR A;  3LCA A;  2HO1 A;  4IN3 B;  2LNI A;  3EDT B;  4GYO A;  5HQ8 A;  3ASH A;  3GYZ A;  4LEU A;  5G05 J;  5KJK A;  3OXG A;  4WNG A;  2PQN A;  4G1T A;  3MA5 A;  2QFC A;  3MKR A;  2VGY A;  2C0L A;  4XI0 A;  2UY1 B;  4I1A A;  3MV2 B;  2J9Q A;  1KT1 A;  3CKC A;  3RO2 A;  4CGW A;  4EQF A;  3VTY A;  4GPK A;  4GYY A;  5DIZ A;  2VYI A;  4WNF A;  3U3W A;  5C1D A;  3LPZ A;  3PE4 A;  4I2W A;  3FWV A;  4U07 A;  4UI9 K;  3RU0 A;  5A6C A;  5CHE E;  4HOT A;  4H7Y A;  3KAE A;  3FP3 A;  2VSY A;  2L6J A;  4H7X A;  3U4T A;  4GZ3 A;  4G26 A;  5FZS A;  5FZQ A;  1HZ4 A;  2XPI A;  2VQ2 A;  4N2S A;  3ULQ A;  2BUG A;  3QKY A;  3CK9 A;  3OXF A;  4BT9 A;  1NZN A;  4JL0 A;  5JJ7 A;  4G2V A;  5G04 C;  5FJY A;  4N3A A;  3E4B A;  3S7F A;  2UWJ G;  4UI9 J;  3VTX A;  4WND A;  4UQZ A;  4BWR A;  3TG4 A;  2PQR A;  2HYZ A;  3CVL A;  2IF4 A;  3FFL A;  4UI9 C;  1PC2 A;  5AYW D;  4KBQ A;  5ARG A;  5D0O D;  3RKV A;  4AM9 A;  4YVQ C;  4YVO A;  3QWV A;  4J0U A;  3IEG A;  3ZHE A;  2P58 C;  2LSU A;  4BT8 A;  1Y8M A;  4WUY A;  4UQY A;  4J8D A;  4HOU A;  2XGS A;  4W9R A;  3S7B A;  3HYM B;  1A17 A;  2OOE A;  3K9I A;  4HOS A;  2FF4 A;  3LY9 A;  3ZPJ A;  1KLX A;  1NA0 A;  2KAT A;  3QWP A;  2R5S A;  3ZFW A;  2FI7 A;  3TAX A;  5KJM A;  1WAO 1;  3LYA A;  3R9A B;  3LY8 A;  1P5Q A;  4U0S A;  4AY6 A;  3KD7 A;  4GA0 A;  3GZ1 A;  1WM5 A;  4AIF A;  2WPV A;  4Y6W A;  5G05 C;  5DBK A;  1ELW A;  4RG6 A;  1B89 A;  3RO3 A;  3RIB A;  4I2Z A;  2YQ8 A;  4G24 A;  3MEK A;  2FEZ A;  2VGX A;  5KJN A;  4J8E A;  4GYW A;  5CCM A;  1IYG A;  4F3V A;  5BNW A;  4CGV A;  3O48 A;  3TG5 A;  5EX3 A;  3JYS A;  4NRH B;  2YHC A;  4I17 A;  1ELR A;  4GCN A;  3SF4 A;  5A7D B;  3UQ3 A;  1HXI A;  4UQX A;  3UUX A;  2PL2 A;  4U04 A;  3CVN A;  2DBA A;  2OND A;  2XGO A; 
#chains in the Genus database with same CATH topology
 2FBN A;  3Q79 A;  3PZ3 A;  3FUF A;  3FY4 A;  1O1T A;  1ZU2 A;  1U3C A;  2BTD A;  4N39 A;  3UX4 A;  3KSL A;  2V5F A;  5LCW J;  2VJ8 A;  3IBE A;  2Y1L E;  4FC8 A;  2AJA A;  1UN8 A;  2OCC E;  2F37 A;  3D9N A;  1UW4 B;  4MBG A;  4L7T A;  4BTA A;  2Y69 E;  3HVE B;  4EEC A;  3ZUV B;  5BV1 A;  4K0R A;  4DI4 A;  3ZVV A;  4GA1 A;  3ONL A;  1MX2 A;  3GZS A;  4FHK A;  1BI8 B;  3AS8 A;  1HE8 A;  1HO8 A;  5HKP A;  1N94 A;  4HRN A;  2FO7 A;  4O1O A;  3GW4 A;  2C0M A;  1Z3Y A;  3FUE A;  2P9K G;  3ZU7 B;  1HF8 A;  3CK8 A;  1N0R A;  3B13 A;  3OTN A;  3CEQ A;  1HH8 A;  2C2L A;  2R03 A;  3CKB A;  3ENE A;  2XEH A;  3ULY A;  4F1P A;  5ANR A;  3ASF A;  4KZ0 A;  3KSQ A;  2Y4T A;  3OXL A;  5KJL A;  3EU5 A;  4TXR A;  3CVX A;  3CV0 A;  4N3B A;  4XX5 A;  1X81 A;  4G8K A;  2WQH A;  3ZHE B;  3KEZ A;  3BUA A;  1LD8 A;  1E7U A;  1BD8 A;  1E8Y A;  3LJN A;  4YDE A;  1Q2Z A;  3FTZ A;  4TRQ A;  5C2Y A;  2OEW A;  4YDW A;  4LNU D;  4AEZ C;  5KBA A;  5EYL A;  3NOG D;  2XZT G;  4RQI A;  1DVP A;  2VTB B;  3C3O A;  3AG2 E;  2AXU A;  4N2Q A;  3SNX A;  1Z3X A;  1HS6 A;  4C0E A;  1D8E A;  2GW1 A;  3ESK A;  4A55 A;  4CCA A;  5FZR A;  4IYP A;  2ETB A;  1TNO A;  4GA2 A;  4XKC A;  2P9N G;  4ME2 A;  5HRY A;  4L2L A;  1S64 A;  1OCO E;  1JCS A;  4JA7 A;  4MKT A;  1E8W A;  4OVV A;  1PAQ A;  3TL5 A;  4AV7 A;  4I43 A;  2L0T B;  4JHJ A;  5FT9 A;  3TXM A;  4J7W A;  4HNA D;  3L54 A;  4BES A;  3DPD A;  4U0U A;  2XGM A;  3D9M A;  3QC1 A;  4DUI A;  5JJT A;  3X2Q E;  4CDR A;  2WMN A;  3UKR G;  2HO1 A;  2LNI A;  3GYZ A;  3OXG A;  3ZXP A;  3SBS A;  4WAF A;  1BPO A;  3W9G A;  3L9T A;  3MA5 A;  2QFC A;  3MKR A;  2VGY A;  1IHB A;  2BED A;  4TXP A;  3DWL G;  4XI0 A;  3VLE A;  1RZ4 A;  1KT1 A;  3CKC A;  4L9P A;  3RO2 A;  2IEJ A;  4FP7 A;  4CGW A;  2WXJ A;  4LNG A;  4EHM A;  4GYY A;  2VYI A;  4WNF A;  3UT7 A;  3F6Q A;  4I2W A;  4U07 A;  4PS7 A;  3QB2 A;  3AJI A;  1S0P A;  5A6C A;  2BKK B;  5B1A E;  4XE0 A;  5CHE E;  3V79 K;  3PZD A;  4F1S A;  4JC8 A;  3L6A A;  3KAE A;  3FP3 A;  5T4Y A;  4EZK A;  1RW2 A;  3ABM E;  2VSY A;  4DX2 A;  3U4T A;  3C98 A;  4GZ3 A;  5JHA A;  5CEC B;  2EQX A;  2RG8 A;  1NL4 A;  3PZ1 A;  5CER B;  5FZQ A;  1MX6 A;  1IQR A;  2J08 A;  2XPI A;  4FU3 A;  2BUG A;  3CK9 A;  4DRX E;  4D10 C;  5HS0 A;  3I4R B;  2CHZ A;  3DEO A;  4BT9 A;  4JL0 A;  5G04 C;  4UI9 J;  4U8Y D;  1MQS A;  5AQ9 A;  4TUU A;  1OCC E;  4L2Y A;  3Q7A A;  4JXT A;  2HYZ A;  3C72 A;  3ML8 A;  1TN7 A;  3DSX A;  4YVO A;  3PUJ A;  1WY6 A;  3L08 A;  1N0Q A;  5AQA A;  4FLH A;  4UWG A;  2NSZ A;  2ZIS A;  4OAU C;  4R7L A;  2P58 C;  3CLJ A;  1Y8M A;  1ZB1 A;  4J8D A;  3D9I A;  3C5R A;  2J4D A;  1H2V C;  3TWT A;  4CYM D;  3JUE A;  3S7B A;  5BXU A;  2WXH A;  2B0O E;  2WXN A;  3UIN C;  1KLX A;  1A5E A;  3QWP A;  4G8L A;  2IJG X;  3B7B A;  3TAX A;  1QNF A;  4HI9 A;  3R9A B;  3LY8 A;  4U0S A;  5FIO A;  2PNN A;  2Y0B G;  1U2V G;  4I6G A;  3NZU A;  4E85 A;  3GZ1 A;  4WWP A;  4LRZ A;  3V31 A;  5DBK A;  3CHO A;  4FLB A;  4K5B A;  4RLY A;  5AIJ A;  4G24 A;  2FEZ A;  2R02 A;  3FUI A;  2DCP A;  2QY7 A;  2VSO E;  3T5X A;  2WXF A;  2OVB A;  5BNW A;  4CGV A;  1H6P A;  3LS8 A;  4JEU A;  1YMP A;  5EX3 A;  3JYS A;  4IUL A;  5JMN D;  4I17 A;  1O1S A;  3DST A;  3APC A;  2XHE A;  3SF4 A;  5A7D B;  2WXK A;  2X6H A;  3UM3 A;  1MX4 A;  3ZYM A;  1TN8 A;  1KZO A;  1HU3 A;  3AU5 A;  3MYV A;  3CIA A;  3UT4 A;  4HLL A;  3J5P A;  3SBT B;  2RKK A;  2X6I A;  2CHX A;  3ZIM A;  3ASG A;  3ZGQ A;  2X6F A;  3QWW A;  4KXK B;  5FQ8 A;  4UWH A;  1KPS B;  4APO A;  2ZU6 B;  4HQD A;  5B1B E;  3UIO C;  2R05 A;  4B89 A;  1N4R A;  2I6H A;  4MLP A;  5ENP D;  2V0P A;  2J07 A;  2UY1 A;  4JEH A;  5BUZ A;  4LCT A;  4B0Z A;  4K03 A;  1QQE A;  3D3M A;  5D2M C;  3EIQ C;  3G2T A;  5EX0 A;  4G25 A;  5FTP A;  2KXP C;  4I9E A;  3DSS A;  3HXC A;  2XCC A;  5BPP A;  4DK5 A;  2WB2 A;  4G23 A;  2HE0 A;  4KZC A;  1E96 B;  3PNL B;  2GRQ B;  4UUC A;  3Q9N C;  1V54 E;  1NFI E;  2WQ7 A;  2MHK A;  4RVB A;  4KYO B;  3LXU X;  3ABL E;  3APF A;  3RJV A;  4FAD A;  3Q15 A;  1UG3 A;  3HG0 D;  3L17 A;  3PRZ A;  4BX8 A;  1OT8 A;  4I9C A;  2KZT B;  3SI5 A;  1SZA A;  3S7J A;  3FUM A;  5J08 A;  4JB8 P;  3KS2 A;  4GTM A;  5KCM A;  2IOL A;  5EKQ D;  2LXM A;  4EBA G;  1JCR A;  3G2W A;  2PZI A;  2WXM A;  3CR3 A;  2ETA A;  4BET A;  2E0I A;  3C3Q A;  3Q47 B;  4GZC A;  3FU3 A;  3NOC D;  4Y6C A;  5G04 J;  2J09 A;  1IXV A;  2L9B A;  4F53 A;  4L23 A;  4B94 A;  3T9K A;  4ZHB A;  5FQ4 A;  3TGO A;  4AJW A;  1SA5 A;  1WDY A;  5ENR D;  3WXX A;  1HG2 A;  2VGX B;  3ML9 A;  2H6F A;  5LOZ A;  3Q78 A;  4UWK A;  3SO8 A;  3FUD A;  1TJF A;  4F6R D;  1H6O A;  5JJ6 A;  3G2U A;  5CRV A;  3SZ7 A;  3RAU A;  3TWR A;  3AS4 A;  3TJP A;  3IXE A;  4A63 B;  2XEE A;  1H19 A;  3I5P A;  3HDX A;  3QDN A;  4HI8 A;  5AQB A;  4GZ5 A;  1ZBP A;  4BER A;  3ESL A;  3CGH A;  2MYO A;  3MV3 B;  2HM8 A;  4GTR A;  2EIJ E;  2Q7F A;  4I1M A;  2KCK A;  5ENO D;  4TV3 A;  4PS8 A;  3SFX A;  5AAR A;  3LCA A;  2CHW A;  3MKQ B;  1S70 B;  2H6I A;  5KJK A;  4WNG A;  2PQN A;  3D9H A;  3O4Z A;  2A5E A;  1Z5S C;  5CMY A;  5AQ7 A;  5FQ6 A;  4G11 A;  2YNQ A;  4WWN A;  4U95 D;  2KM4 A;  2OV8 A;  3VTY A;  2XRZ A;  3ZYL A;  5DIZ A;  3L16 A;  1LD7 A;  3LPZ A;  4CT0 A;  2J8S D;  1K1A A;  3FWV A;  4LUN U;  2AWI A;  2LAH A;  1KZP A;  4GTV A;  5KNH D;  3HVE A;  3QK0 A;  5E75 A;  1HZ4 A;  4CDM A;  2XPY A;  2XQ0 A;  4DX1 A;  2VQ2 A;  2WQ6 A;  2IOS A;  3OXF A;  2XS1 A;  2J49 A;  4KMO A;  2H6H A;  1OWO A;  3ZKJ A;  1NZN A;  5JJ7 A;  3CVV A;  4N3A A;  3S7F A;  3CHR A;  1MJ0 A;  2DYS E;  4WND A;  4UWF A;  1O1R A;  1N4S A;  1EDU A;  3MKQ A;  3TG4 A;  3AG3 E;  2PQR A;  3CQG B;  2GRM A;  2IF4 A;  3CQC B;  3P2B A;  5EN5 D;  3R7R A;  2DVW A;  4GAA A;  3RKV A;  3UTM A;  4YVQ C;  3EUV A;  4APF A;  4HLE A;  3ISM C;  5ANL A;  1LTX A;  2QC9 A;  2V4L A;  3ZHE A;  4WUY A;  5CBO A;  4HOU A;  3HIZ A;  1PY1 A;  3PRE A;  5T3R A;  2XGS A;  4U8H A;  4ATZ D;  1DCQ A;  2L0I A;  4K5C A;  4GTP A;  2OOE A;  2FF4 A;  3LY9 A;  3EU9 A;  2DYR E;  2KAT A;  3FUK A;  1SA4 A;  3TWW A;  2MRI A;  3LYA A;  1OWM A;  5EIL A;  2RD0 A;  2VTB A;  4PS3 A;  2RFA A;  5IY5 E;  1FVF A;  1WM5 A;  1HFA A;  4YDO A;  2R59 A;  3HRA A;  4DX7 D;  3LVQ E;  1ELW A;  4ATG A;  5J90 A;  1G3N B;  3RIB A;  3W9F A;  3FUN A;  3MEK A;  5KJN A;  4GYW A;  3DSU A;  3HXE A;  3EHR A;  4F3V A;  1TYQ G;  3UXG A;  2P9P G;  1FT2 A;  3PEU B;  1H6K A;  4KT6 B;  2YHC A;  1NP7 A;  4GCN A;  1N4Q A;  1HXI A;  3UMV A;  3FH5 A;  4UQX A;  3UUX A;  3TWV A;  2NYJ A;  3CSF A;  3E30 A;  3B7R L;  3FTU A;  3KEA A;  2OND A;  2XGO A;  3RRN B;  1EPU A;  4QQI A;  1YYH A;  4XEI G;  5BT1 A;  4K5A B;  4L1B A;  3MGB A;  3UM1 A;  2OEV A;  2VSN A;  1SZ9 A;  3PH0 C;  3U66 A;  3FH7 A;  3CVP A;  1JWG A;  2P2C P;  4GZ6 A;  2KCL A;  2EIM E;  1K8K G;  3IKO B;  3V2O A;  1IQU A;  2XRY A;  5EIB E;  3AS5 A;  4OAV B;  1OUV A;  4A1G A;  2JEK A;  5LCW C;  2RFM A;  4U7E B;  3LJ3 A;  3DPY A;  4JA9 A;  3N71 A;  4ZFH A;  5ITZ F;  3NAW A;  2LAI A;  3Q73 A;  2OVF A;  3B95 A;  1H2T C;  3HXB A;  3URZ A;  2E2E A;  2WMO A;  3P1U A;  3U64 A;  2NC9 A;  4A3T A;  4AVX A;  4NQ0 A;  2ILR A;  4U0Z A;  4I6E A;  3ASD A;  3BEE A;  2WXI A;  2JLB A;  2KC7 A;  2WXL A;  5BW8 C;  3FDH A;  4XI9 A;  3DBS A;  2WXR A;  3SHF A;  3ZN3 A;  4XKB A;  2CG2 A;  1AP7 A;  1N95 A;  3PUK A;  3CK7 A;  4O6F A;  4AP2 A;  3PNT B;  1TR4 A;  4O1P A;  2XS8 A;  1W3B A;  1Y6I A;  3TWX A;  1QZ2 A;  2I1J A;  5LFA A;  3CVY A;  2WXQ A;  3AG4 E;  3FTW A;  4DLO A;  4GCO A;  3Q7F A;  2XCB A;  2HR2 A;  4JPS A;  4UWL A;  2ZGD A;  3ZEF A;  3JXJ A;  4CDN A;  2GRO B;  4RSY A;  2QYU A;  1EYH A;  3ZYK A;  2F8X K;  1OY3 D;  5AJD A;  2LSV A;  4DJA A;  2R2L A;  3FH8 A;  1OWP A;  3SY2 A;  5ENT D;  4BSZ B;  1JWF A;  3UPV A;  3CHS A;  4F7A A;  4HOR A;  1NA3 A;  3FEX A;  4ILI A;  5BV0 A;  2IQC A;  4MS6 A;  4HVB A;  1TJC A;  5AAO A;  3NQP A;  4GTS A;  3DSW A;  3JQ1 A;  2P9L G;  1XNF A;  3SGH A;  2GRL A;  5M72 A;  1FCH A;  2A5U A;  3OAW A;  5FQ7 A;  1KT0 A;  2XZD G;  1TNY A;  3VLF A;  4IRU A;  1TEZ A;  2EIK E;  4N3C A;  4ILG A;  4WNE A;  4HOQ A;  4AY5 A;  2CG3 A;  5ENS D;  3QAR A;  4HBD A;  3SQV A;  3BU8 A;  5JHB A;  4U63 A;  1HX8 A;  5G2N A;  3MX3 A;  3G2V A;  4IN3 B;  3NZS A;  5LX8 A;  4X8Q A;  5HQ8 A;  4LEU A;  3ULE G;  4C9B B;  4BFR A;  4GZD A;  2JAB A;  4G1T A;  1N52 A;  2C0L A;  2BF0 X;  3ABK E;  1E8Z A;  2EIL E;  2J9Q A;  1TNB A;  4CRW A;  3CHP A;  2DIW A;  3APD A;  3EJN A;  4GML A;  3U3W A;  3TWS A;  4LG6 A;  3PE4 A;  1N9A A;  3RU0 A;  2DZO A;  4TUM A;  4HOT A;  4H7Y A;  2V4H C;  3ASN E;  2I2O A;  4G26 A;  4A3V A;  3FTX A;  3FU0 A;  2P9S G;  1FT1 A;  1Z6T A;  3FHE A;  3SFY A;  2GRP B;  3QKY A;  4WWO A;  1X5B A;  3G2S A;  2X6J A;  4GPM A;  5AEN A;  1E8X A;  3PEV B;  5E76 A;  3PVL A;  2J4B A;  1MHQ A;  4G2V A;  1YCS B;  4FJZ A;  5FJY A;  3E4B A;  3HXD A;  2UWJ G;  5FWQ A;  4BWR A;  2LUH A;  3C3R A;  1JUQ A;  4J6I A;  1UOH A;  1DC2 A;  3CVL A;  3S2A A;  2FUL A;  4HRL A;  2R17 C;  4UI9 C;  1PC2 A;  3E32 A;  2WXO A;  4KBQ A;  2AXZ A;  3J5Q B;  5KWD A;  1FPP A;  4PDX A;  2IY0 C;  2PM6 A;  3FEY A;  4J0U A;  1VDY A;  5CMW A;  1EF1 C;  1K1B A;  2KZT A;  3B7U X;  3FTY A;  4BT8 A;  3PZ2 A;  2A4Z A;  4XZ4 A;  3R9M A;  4AXH A;  3TXN A;  5EID A;  3D9O A;  4BY6 A;  1N54 A;  1TN6 A;  4DLQ A;  1A17 A;  3K9I A;  4HOS A;  3ZPJ A;  2WVI A;  3CVU A;  1H0A A;  4ILH B;  5KJM A;  4HB5 A;  1P5Q A;  1E7V A;  3DRA A;  1TNZ A;  3KD7 A;  4DPR A;  2LXL A;  3DXK G;  5G05 C;  3NBN B;  4JZY A;  3SD5 A;  1OCR E;  4RG6 A;  3BG1 B;  2EIN E;  3RO3 A;  2QZA A;  2WM9 A;  4JVS A;  2YQ8 A;  2VGX A;  4KVM A;  4J8E A;  4YDY A;  3LVR E;  3DXM G;  1SVX A;  3UT8 A;  1ELK A;  4ACK A;  1UN9 A;  3QAQ A;  1MZC A;  4Q69 A;  3O48 A;  2WXP A;  3Q9U C;  1GW6 A;  2ION A;  4ACL A;  4GTT A;  3MJW A;  4FA6 A;  3RK6 A;  3ZNG A;  1E90 A;  3UQ3 A;  3CVW A;  3RRM B;  3ZW3 A;  4OYS A;  5AN8 A;  2PL2 A;  4JW1 A;  2F8Y A;  3JCK C;  4GMJ A;  5D66 A;  1YA0 A;  1V55 E;  3FU6 A;  2ETC A;  4ABN A;  4B8A A;  2GRN B;  3AAA C;  3TWQ A;  3NF1 A;  1OCZ E;  4OVU A;  1IHG A;  5CBN A;  4N5Q A;  3U9W A;  4M7C A;  4A1S A;  2F0Y A;  4C0M A;  4J8Y A;  3EIJ A;  4GTO A;  2AW6 A;  3PE3 A;  4N5C A;  5EDS A;  3Q49 B;  1HG5 A;  3QOU A;  1N11 A;  3ZXS A;  2KCV A;  3BQO A;  2KBX A;  4XIF A;  4J8F A;  3Q5M A;  1K3Z D;  1JCQ A;  2WXG A;  4P29 A;  1BU9 A;  5T8I A;  3R7Q A;  2FO1 E;  4YND A;  3WG7 E;  2Y3A A;  3CVQ A;  3MCX A;  5HI7 A;  2IO2 C;  1OWN A;  4CEM A;  3FTS A;  3JUI A;  5CRU A;  5CCL A;  2XEV A;  1UJK A;  4Z68 A;  3PDN A;  4JHK A;  2AVP A;  1QYM A;  4GMR A;  3T5V A;  3JXI A;  1O5M A;  2VGE A;  3T8M A;  3GZ2 A;  4LSZ E;  4I1O B;  2BKG A;  3UM0 A;  5ENQ D;  5D0Q D;  3FUL A;  4ANU A;  5CEA A;  2XPZ A;  1JPL A;  4LNB A;  5B3S E;  4EZJ A;  1INZ A;  3FTV A;  3Q4A B;  4DX5 D;  3LY7 A;  3NB2 A;  2ZXW E;  5ARF A;  2PM7 A;  3HHM A;  1U3D A;  2YIN A;  2X6K A;  3D9L A;  1WG0 A;  4HS2 A;  3QNK A;  3PZ4 A;  1NI1 A;  3L13 A;  5A23 A;  3TWU A;  3L22 A;  2X3M A;  4U96 D;  4KVO A;  2LO6 A;  2CFU A;  1AWC B;  2DZN A;  3ASO E;  3LDZ A;  4BX9 A;  4ANX A;  1SW6 A;  2I1K A;  4RG9 A;  4CZ2 D;  4URK A;  3EHQ A;  2DWZ A;  4JHR A;  3I4G A;  3LKU A;  3I3N A;  3IV0 A;  2Y4U A;  2IU1 A;  2GRR B;  4Q96 A;  2V5Q C;  4DI3 A;  4B8C B;  1D9S A;  5EYP F;  4JD2 G;  3FUH A;  3MZL B;  3ONK A;  5KNG A;  4MRU A;  2IFU A;  4BTB A;  3S7D A;  4O60 A;  3FU5 A;  3RRU A;  1XGW A;  2CFZ A;  3EDT B;  4GYO A;  4AOF A;  3ASH A;  5G05 J;  1OXJ A;  2AXV A;  2YHE A;  4E6H A;  4I6J A;  4Q94 A;  5ENN A;  3VLD A;  3CHM A;  4HRM B;  2UY1 B;  4I1A A;  3MV2 B;  1BI7 B;  3D9J A;  3QJZ A;  2QYJ A;  4EQF A;  2M63 A;  5CED B;  4GPK A;  3AG1 E;  1IKN D;  5C1D A;  4BSX A;  4UI9 K;  1OWL A;  4B93 B;  4U8V D;  3EHM A;  3D9K A;  2L6J A;  4H7X A;  1TNU A;  5FZS A;  3HXF A;  4QFV A;  1DNP A;  2ZIR A;  1UJJ A;  4PH4 B;  4V3I A;  2L6B A;  4ANW A;  1QBQ A;  4N2S A;  3ULQ A;  4EBA A;  4NIK A;  2ZGG A;  3D9P A;  3CST A;  2NXP A;  1LF8 A;  3UM2 A;  3VTX A;  4UQZ A;  3B7T A;  4M3O A;  3DSV A;  4FUL A;  3IHV A;  3FFL A;  4ANV A;  4GTQ A;  4GB9 A;  5AYW D;  5ARG A;  5JA4 D;  5D0O D;  4NAC A;  4AM9 A;  4EZL A;  4FJY A;  4NUR A;  3QWV A;  1DCE A;  2I9C A;  2MOW A;  3IEG A;  3UKU G;  3RSE G;  4GU5 A;  1N4P A;  2LSU A;  1D8D A;  4UQY A;  3CHQ A;  5H7P A;  3E33 A;  5AJL A;  2VSX E;  4W9R A;  2H6G A;  3HYM B;  4FHJ A;  3UIP C;  1NA0 A;  3IHY A;  3L82 A;  2R5S A;  3ZFW A;  2FI7 A;  1WAO 1;  3V30 A;  4AY6 A;  2XEN A;  4GA0 A;  4AIF A;  1L5J A;  2WPV A;  4Y6W A;  1FVH A;  3FUJ A;  5LP0 A;  3E37 A;  2X38 A;  3LEW A;  3UI2 A;  3E34 A;  4J8S A;  2GGF A;  3EHN A;  1B89 A;  3SFZ A;  3Q75 A;  2V8S E;  3DEP A;  4HFG A;  2P9U G;  4I2Z A;  3V2X A;  4C48 B;  5CCM A;  3JQ0 A;  1IYG A;  2B6C A;  1SQM A;  3PS6 A;  4LER A;  1BLX B;  4PUC A;  2P9I G;  3B7S A;  4DX6 D;  3ZRH A;  4BEP A;  2IO3 C;  3TG5 A;  1MYO A;  4NRH B;  4TXQ A;  3T8K A;  3BG0 B;  1ELR A;  3AU4 A;  4CT4 A;  4HXI A;  4EPZ A;  1H2U A;  5FIN A;  3ZYQ A;  4U04 A;  5BXO A;  3CVN A;  2DBA A;  5G55 A;  1S63 A; 
#chains in the Genus database with same CATH homology
 3SBT B;  1YA0 A;  2FBN A;  2X6I A;  2CHX A;  3ZIM A;  3FU6 A;  4ABN A;  4B8A A;  3FUF A;  5BT1 A;  3ASG A;  3FY4 A;  4L1B A;  3ZGQ A;  1ZU2 A;  1U3C A;  2X6F A;  3MGB A;  3NF1 A;  4OVU A;  1IHG A;  3QWW A;  4KXK B;  5FQ8 A;  2BTD A;  2VSN A;  4N39 A;  1SZ9 A;  4UWH A;  3U9W A;  4A1S A;  3PH0 C;  3UX4 A;  3FH7 A;  2ZU6 B;  3CVP A;  4APO A;  3U66 A;  4JHJ A;  1JWG A;  2V5F A;  4C0M A;  5LCW J;  2VJ8 A;  4GZ6 A;  2KCL A;  3IBE A;  4B89 A;  3EIJ A;  2I6H A;  4MLP A;  4FC8 A;  2AW6 A;  3IKO B;  1UN8 A;  3PE3 A;  4N5C A;  1IQU A;  2V0P A;  2J07 A;  2XRY A;  2UY1 A;  5EDS A;  3AS5 A;  4JEH A;  5BUZ A;  3D9N A;  3Q49 B;  4LCT A;  1UW4 B;  1HG5 A;  1OUV A;  4L7T A;  4BTA A;  3HVE B;  3QOU A;  4A1G A;  2JEK A;  5LCW C;  4B0Z A;  4K03 A;  3ZXS A;  4EEC A;  2KCV A;  3LJ3 A;  5BV1 A;  4JA9 A;  4K0R A;  4XIF A;  4J8F A;  1QQE A;  3D3M A;  3EIQ C;  3G2T A;  5EX0 A;  3N71 A;  4DI4 A;  3Q5M A;  3ZVV A;  4GA1 A;  3ONL A;  3GZS A;  4G25 A;  4FHK A;  5FTP A;  4I9E A;  3AS8 A;  1HE8 A;  2WXG A;  4P29 A;  1HO8 A;  5T8I A;  2FO7 A;  3R7Q A;  2XCC A;  3GW4 A;  5BPP A;  2LAI A;  4YND A;  2OVF A;  2C0M A;  1Z3Y A;  2Y3A A;  3FUE A;  1H2T C;  4DK5 A;  1HF8 A;  2WB2 A;  3CVQ A;  3CK8 A;  3MCX A;  4G23 A;  5HI7 A;  3B13 A;  4KZC A;  3OTN A;  1E96 B;  1OWN A;  3URZ A;  3FTS A;  4CEM A;  2E2E A;  3PNL B;  3CEQ A;  2WMO A;  1HH8 A;  3P1U A;  3U64 A;  2C2L A;  3JUI A;  3CKB A;  3ENE A;  2NC9 A;  5CCL A;  2XEV A;  4A3T A;  4NQ0 A;  1UJK A;  2MHK A;  4KYO B;  4RVB A;  4AVX A;  2WQ7 A;  2ILR A;  4U0Z A;  3LXU X;  3PDN A;  4I6E A;  3ASD A;  3BEE A;  4JHK A;  2WXI A;  3APF A;  2AVP A;  5ANR A;  2JLB A;  3ASF A;  4KZ0 A;  3RJV A;  2KC7 A;  2WXL A;  2Y4T A;  4FAD A;  5BW8 C;  3OXL A;  3FDH A;  3Q15 A;  4XI9 A;  3DBS A;  5KJL A;  1UG3 A;  2WXR A;  3T5V A;  3L17 A;  3SHF A;  3CV0 A;  3ZN3 A;  3PRZ A;  4N3B A;  3CVX A;  4XKB A;  2CG2 A;  3T8M A;  4BX8 A;  3GZ2 A;  4XX5 A;  3PUK A;  3CK7 A;  4I1O B;  4O6F A;  4AP2 A;  4I9C A;  3PNT B;  2WQH A;  2KZT B;  3SI5 A;  1SZA A;  3ZHE B;  3KEZ A;  1W3B A;  1Y6I A;  5D0Q D;  3FUL A;  3S7J A;  3FUM A;  5J08 A;  1E7U A;  4ANU A;  1QZ2 A;  3KS2 A;  2XPZ A;  1JPL A;  4EZJ A;  1E8Y A;  2I1J A;  2IOL A;  5KCM A;  5LFA A;  1INZ A;  3CVY A;  5EKQ D;  2WXQ A;  3FTV A;  3FTW A;  4DLO A;  3Q4A B;  4EBA G;  3FTZ A;  4GCO A;  4TRQ A;  5C2Y A;  3LY7 A;  3G2W A;  2PZI A;  2HR2 A;  2XCB A;  4JPS A;  4UWL A;  3ZEF A;  4AEZ C;  4CDN A;  2WXM A;  3CR3 A;  5ARF A;  2PM7 A;  2E0I A;  3HHM A;  1U3D A;  2YIN A;  2X6K A;  1DVP A;  4RSY A;  3D9L A;  2VTB B;  1EYH A;  3Q47 B;  3ZYK A;  4GZC A;  4HS2 A;  3FU3 A;  3QNK A;  2AXU A;  4Y6C A;  5G04 J;  2J09 A;  2L9B A;  4N2Q A;  5AJD A;  4F53 A;  2LSV A;  4DJA A;  3SNX A;  4L23 A;  1Z3X A;  4B94 A;  3FH8 A;  3L13 A;  1OWP A;  5A23 A;  1HS6 A;  4C0E A;  2GW1 A;  5FQ4 A;  3ESK A;  4A55 A;  4CCA A;  3L22 A;  1JWF A;  2X3M A;  5FZR A;  3TGO A;  3CHS A;  4AJW A;  4F7A A;  3UPV A;  4KVO A;  4HOR A;  3WXX A;  1NA3 A;  2LO6 A;  1HG2 A;  2VGX B;  3ML9 A;  3FEX A;  4IYP A;  4ILI A;  5LOZ A;  5BV0 A;  2CFU A;  2IQC A;  4GA2 A;  4MS6 A;  4UWK A;  4XKC A;  3FUD A;  1TJF A;  4HVB A;  4ME2 A;  1TJC A;  4L2L A;  3NQP A;  3LDZ A;  4BX9 A;  5JJ6 A;  3G2U A;  4JA7 A;  3SZ7 A;  4ANX A;  3JQ1 A;  2I1K A;  4MKT A;  1XNF A;  1E8W A;  4OVV A;  3AS4 A;  4RG9 A;  1PAQ A;  3TJP A;  4URK A;  3TL5 A;  3SGH A;  2GRL A;  4JHR A;  4AV7 A;  4I43 A;  5M72 A;  1FCH A;  2A5U A;  2L0T B;  3I4G A;  3LKU A;  1H19 A;  3I5P A;  3HDX A;  3I3N A;  3IV0 A;  3OAW A;  2Y4U A;  3QDN A;  2IU1 A;  5FQ7 A;  5FT9 A;  3TXM A;  4GZ5 A;  4Q96 A;  1KT0 A;  1ZBP A;  3L54 A;  3DPD A;  4DI3 A;  4U0U A;  4B8C B;  3ESL A;  2XGM A;  3CGH A;  3D9M A;  3MV3 B;  3QC1 A;  3VLF A;  4IRU A;  2HM8 A;  1TEZ A;  3FUH A;  4N3C A;  2Q7F A;  4ILG A;  4WNE A;  4HOQ A;  2KCK A;  3MZL B;  4I1M A;  2CG3 A;  4AY5 A;  3ONK A;  4TV3 A;  5JJT A;  4MRU A;  2IFU A;  3QAR A;  4BTB A;  4PS8 A;  3S7D A;  3FU5 A;  4CDR A;  5JHB A;  3LCA A;  3RRU A;  2WMN A;  4U63 A;  1XGW A;  2CHW A;  1HX8 A;  2HO1 A;  3MX3 A;  3MKQ B;  5G2N A;  3G2V A;  4IN3 B;  3NZS A;  5LX8 A;  2CFZ A;  2LNI A;  3EDT B;  4GYO A;  5HQ8 A;  4AOF A;  3ASH A;  3GYZ A;  4LEU A;  5G05 J;  5KJK A;  3OXG A;  4WNG A;  3SBS A;  2PQN A;  4C9B B;  3O4Z A;  4BFR A;  4WAF A;  2AXV A;  1BPO A;  4GZD A;  2YHE A;  4E6H A;  4G1T A;  4I6J A;  3MA5 A;  4Q94 A;  5CMY A;  5ENN A;  5FQ6 A;  2QFC A;  3MKR A;  3VLD A;  3CHM A;  1N52 A;  2VGY A;  4G11 A;  2C0L A;  4XI0 A;  2BF0 X;  1E8Z A;  2UY1 B;  2YNQ A;  4I1A A;  3MV2 B;  3VLE A;  4WWN A;  2J9Q A;  1KT1 A;  3D9J A;  3CKC A;  3QJZ A;  3CHP A;  2KM4 A;  3RO2 A;  4CRW A;  2DIW A;  4FP7 A;  4CGW A;  4EQF A;  3APD A;  2OV8 A;  2M63 A;  2WXJ A;  3VTY A;  2XRZ A;  4GPK A;  4GYY A;  3ZYL A;  5DIZ A;  2VYI A;  3EJN A;  3L16 A;  4GML A;  4WNF A;  3U3W A;  3UT7 A;  5C1D A;  3LPZ A;  3PE4 A;  4CT0 A;  4BSX A;  4I2W A;  4LUN U;  3FWV A;  4U07 A;  4PS7 A;  4UI9 K;  3QB2 A;  3RU0 A;  1S0P A;  5A6C A;  1OWL A;  4XE0 A;  5CHE E;  3PZD A;  4HOT A;  4H7Y A;  4F1S A;  3EHM A;  4JC8 A;  3L6A A;  3KAE A;  3FP3 A;  2AWI A;  5T4Y A;  2I2O A;  3D9K A;  4EZK A;  2VSY A;  2L6J A;  4H7X A;  3U4T A;  3C98 A;  2LAH A;  4GZ3 A;  5JHA A;  4G26 A;  4A3V A;  2EQX A;  2RG8 A;  3FTX A;  3HVE A;  5FZS A;  3FU0 A;  5FZQ A;  3QK0 A;  4QFV A;  1DNP A;  5E75 A;  1HZ4 A;  1UJJ A;  1Z6T A;  3FHE A;  4PH4 B;  4CDM A;  1IQR A;  2XPY A;  4V3I A;  2J08 A;  2XPI A;  4FU3 A;  4ANW A;  2XQ0 A;  2VQ2 A;  4N2S A;  3ULQ A;  2BUG A;  3QKY A;  4WWO A;  1X5B A;  3G2S A;  3CK9 A;  2IOS A;  2X6J A;  2WQ6 A;  3OXF A;  4EBA A;  5AEN A;  1E8X A;  3PEV B;  5E76 A;  4D10 C;  2J49 A;  3I4R B;  3PVL A;  4KMO A;  1OWO A;  2J4B A;  2CHZ A;  1MHQ A;  3D9P A;  4BT9 A;  1NZN A;  3CST A;  4JL0 A;  2NXP A;  5JJ7 A;  1LF8 A;  4G2V A;  5G04 C;  4FJZ A;  5FJY A;  3CVV A;  4N3A A;  3E4B A;  3S7F A;  2UWJ G;  4UI9 J;  5FWQ A;  3CHR A;  1MQS A;  4TUU A;  3VTX A;  4WND A;  4UQZ A;  4UWF A;  3B7T A;  4M3O A;  4BWR A;  1EDU A;  3MKQ A;  4L2Y A;  1JUQ A;  3TG4 A;  4J6I A;  4JXT A;  3CQG B;  2PQR A;  2HYZ A;  3CVL A;  3IHV A;  4FUL A;  3S2A A;  2FUL A;  3ML8 A;  2GRM A;  2IF4 A;  2R17 C;  3FFL A;  4UI9 C;  3CQC B;  4ANV A;  1PC2 A;  4GB9 A;  2WXO A;  3P2B A;  5AYW D;  4KBQ A;  5ARG A;  3R7R A;  5D0O D;  2AXZ A;  4NAC A;  4GAA A;  3RKV A;  4AM9 A;  4EZL A;  4FJY A;  4NUR A;  4PDX A;  4YVQ C;  4YVO A;  3PUJ A;  1WY6 A;  4HLE A;  3QWV A;  4APF A;  3L08 A;  2PM6 A;  3FEY A;  4FLH A;  4UWG A;  4J0U A;  2I9C A;  2MOW A;  3IEG A;  5ANL A;  1VDY A;  2NSZ A;  2V4L A;  5CMW A;  1EF1 C;  2KZT A;  4R7L A;  4GU5 A;  3ZHE A;  2P58 C;  2LSU A;  3B7U X;  3CLJ A;  3FTY A;  4BT8 A;  1Y8M A;  2A4Z A;  4WUY A;  4XZ4 A;  4UQY A;  4J8D A;  3D9I A;  3CHQ A;  4HOU A;  3HIZ A;  1PY1 A;  2J4D A;  1H2V C;  3PRE A;  5T3R A;  2XGS A;  4AXH A;  5AJL A;  4U8H A;  2VSX E;  4W9R A;  3S7B A;  3D9O A;  3TXN A;  4BY6 A;  2L0I A;  1N54 A;  2WXH A;  3HYM B;  4FHJ A;  4DLQ A;  1A17 A;  2OOE A;  3K9I A;  4HOS A;  2WXN A;  2FF4 A;  3LY9 A;  3ZPJ A;  1KLX A;  1NA0 A;  2KAT A;  3IHY A;  2WVI A;  3FUK A;  3QWP A;  3CVU A;  1H0A A;  2IJG X;  2R5S A;  3ZFW A;  2FI7 A;  4ILH B;  3TAX A;  5KJM A;  1WAO 1;  2MRI A;  1QNF A;  3LYA A;  3R9A B;  1OWM A;  3LY8 A;  1P5Q A;  1E7V A;  4U0S A;  2RD0 A;  4AY6 A;  2VTB A;  4PS3 A;  3KD7 A;  4GA0 A;  4I6G A;  3NZU A;  1FVF A;  4E85 A;  3GZ1 A;  1WM5 A;  4AIF A;  1L5J A;  4DPR A;  4WWP A;  2WPV A;  4Y6W A;  1FVH A;  1HFA A;  3FUJ A;  4LRZ A;  5G05 C;  2R59 A;  5LP0 A;  2X38 A;  5DBK A;  3LEW A;  4JZY A;  3SD5 A;  3LVQ E;  4J8S A;  2GGF A;  1ELW A;  3CHO A;  4RG6 A;  3EHN A;  1B89 A;  3SFZ A;  3BG1 B;  4FLB A;  2V8S E;  4ATG A;  4HFG A;  5J90 A;  3RO3 A;  2WM9 A;  5AIJ A;  3RIB A;  4JVS A;  2YQ8 A;  4G24 A;  4I2Z A;  3FUN A;  3MEK A;  2FEZ A;  2VGX A;  4KVM A;  5KJN A;  4J8E A;  4GYW A;  3LVR E;  5CCM A;  3JQ0 A;  3FUI A;  2DCP A;  2QY7 A;  2VSO E;  3UT8 A;  1IYG A;  1ELK A;  3T5X A;  4ACK A;  1SQM A;  1UN9 A;  2WXF A;  2OVB A;  3QAQ A;  4F3V A;  3PS6 A;  5BNW A;  4Q69 A;  4CGV A;  4LER A;  3LS8 A;  3O48 A;  4JEU A;  4PUC A;  2WXP A;  3B7S A;  3ZRH A;  3PEU B;  1H6K A;  5EX3 A;  3TG5 A;  3JYS A;  4KT6 B;  1GW6 A;  2ION A;  4NRH B;  4IUL A;  4ACL A;  2YHC A;  4I17 A;  3MJW A;  1NP7 A;  4FA6 A;  3BG0 B;  3RK6 A;  1ELR A;  3APC A;  2XHE A;  3AU4 A;  4GCN A;  3SF4 A;  5A7D B;  2WXK A;  1E90 A;  4CT4 A;  3UQ3 A;  1HXI A;  3UMV A;  3CVW A;  4HXI A;  3FH5 A;  4UQX A;  3RRM B;  4EPZ A;  2X6H A;  3ZYM A;  1H2U A;  3UUX A;  3CSF A;  3ZW3 A;  4OYS A;  2PL2 A;  1HU3 A;  3B7R L;  4JW1 A;  3ZYQ A;  3AU5 A;  3FTU A;  3MYV A;  4U04 A;  3JCK C;  3CIA A;  3CVN A;  3UT4 A;  2DBA A;  5G55 A;  2OND A;  2XGO A;  4GMJ A;  3RRN B;  1EPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...