2FBNA

Plasmodium falciparum putative fk506-binding protein pfl2275c, c-terminal tpr-containing domain
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
153
structure length
153
Chain Sequence
AKKSIYDYTDEEKVQSAFDIKEEGNEFFKKNEINEAIVKYKEALDFFIHTEEWDDQILLDKKKNIEISCNLNLATCYNKNKDYPKAIDHASKVLKIDKNNVKALYKLGVANMYFGFLEEAKENLYKAASLNPNNLDIRNSYELCVNKLKEARK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 70 kDa peptidylprolyl isomerase, putative
publication title Crystallographic structure of the tetratricopeptide repeat domain of Plasmodium falciparum FKBP35 and its molecular interaction with Hsp90 C-terminal pentapeptide.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Structural genomics, unknown function
total genus 64
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2fbnA00
4JA9A 4JHRA 2L6JA 3K9IA 3SZ7A 2KATA 4J8EA 3U3WA 3IEGA 5FZQA 4BT8A 4N5CA 3Q15A 3RO3A 3CK9A 4WNEA 3JYSA 4N39A 3ULQA 2VGXB 1WAO1 5C1DA 3O48A 5LCWJ 2IFUA 3QKYA 4GA1A 5HQ8A 2YHCA 5JJ6A 5KJNA 1ELRA 4U07A 2KCKA 1KT0A 4I1AA 4LEUA 4B94A 4XI0A 3KD7A 4HOUA 4KYOB 5FTPA 3S7DA 4J8FA 2KCLA 2PQNA 2VYIA 2C0LA 3CKCA 3ASDA 4UI9C 5BNWA 5ARFA 4J0UA 5HI7A 3QOUA 1PC2A 5JJTA 4RG9A 4HOSA 5A7DB 4G2VA 2UY1B 3ZFWA 1TJCA 3GZ2A 2XCCA 4G24A 4U04A 3LY8A 4GA0A 2XGMA 3GZ1A 4N2QA 3AS5A 5KJKA 3CEQA 2YQ8A 4BT9A 3ZHEB 3MV2B 2P58C 2FI7A 4G25A 3ZGQA 2UWJG 4WUYA 3ESKA 3MKRA 3AS4A 3Q49B 2E2EA 3ASGA 2VQ2A 3N71A 1XNFA 2HR2A 3LPZA 2BUGA 2J9QA 4GYWA 3UUXA 5KJMA 1ZBPA 1Y8MA 2PL2A 1NZNA 5DBKA 2I6HA 4GCNA 4HOQA 3TGOA 2Q7FA 3PE4A 2WPVA 3VTXA 2ONDA 3OXFA 1KLXA 4BTAA 4ME2A 1NA3A 4I9EA 5BT1A 2FO7A 4WNGA 3GYZA 4UQYA 2GW1A 4JA7A 3URZA 4O6FA 2HYZA 4J8DA 2OOEA 4AY6A 2C0MA 1KT1A 5D0QD 2IF4A 4YNDA 3PE3A 4AIFA 4CDRA 1IYGA 3MA5A 3RIBA 4NQ0A 3BEEA 3RO2A 4UQZA 4I9CA 4U0UA 5G05J 4H7XA 3QWVA 2Y4TA 4BTBA 2LNIA 4I17A 4IN3B 4G1TA 3FWVA 4N3CA 4EQFA 3OXGA 1OUVA 4G26A 5FZSA 2FF4A 3TG4A 3RU0A 3CK7A 2LSVA 3RJVA 1HXIA 4GCOA 3R9AB 4AY5A 4N3BA 5KJLA 4GA2A 4NRHB 4Y6CA 1YA0A 2JLBA 4ABNA 3QWPA 2FEZA 3Q4AB 5BW8C 2LSUA 4BWRA 2AVPA 2Y4UA 4WNFA 2R5SA 1NA0A 5G04C 2XCBA 5M72A 3CV0A 1QZ2A 3CK8A 3CKBA 4I2ZA 3S7BA 2MHKA 3CVQA 5ARGA 5JJ7A 5A6CA 5FT9A 3TAXA 4UI9J 3ASHA 4G23A 4YVQC 3QWWA 2FBNA 3KAEA 3U4TA 1A17A 3LKUA 5FJYA 5CCLA 4RG6A 3NF1A 4CGVA 2KCVA 4KXKB 2HO1A 1P5QA 2VSNA 3QDNA 1B89A 4UI9K 1E96B 3MV3B 1FCHA 3KS2A 5G04J 3UQ3A 3EDTB 2XEVA 1WM5A 5CCMA 5DIZA 3CVPA 5EX0A 3E4BA 4GYOA 4N2SA 4W9RA 1IHGA 5CHEE 3MEKA 2DBAA 4N3AA 4WNDA 2VGYA 4A1SA 3LY9A 3ZPJA 2NC9A 3S7FA 2VGXA 3PDNA 3ASFA 3VTYA 3CVNA 3FP3A 5EKQD 4F3VA 4XI9A 4UQXA 3Q5MA 1HZ4A 3WXXA 5EX3A 4AM9A 4GZ5A 3SF4A 1HH8A 2PZIA 5LCWC 2XGOA 3UPVA 4XIFA 3GW4A 2WQHA 2KC7A 3AS8A 3LYAA 4CGWA 4APOA 2XPIA 5AYWD 4KBQA 5D0OD 1W3BA 4I2WA 4U0ZA 5FZRA 3OXLA 4JL0A 3CVLA 3RKVA 3HYMB 4Y6WA 2UY1A 2V5FA 4U0SA 5G05C 4HORA 4GYYA 2PQRA 1ZU2A 4YVOA 3FFLA 1QQEA 2C2LA 3TG5A 3LCAA 4H7YA 3ZN3A 4GZ6A 1ELWA 4GZ3A 4GPKA 3LY7A 2XGSA 4HOTA 3S7JA 2VSYA 3ZHEA 3Q47B 2QFCA
chains in the Genus database with same CATH superfamily
4JA9A 2L6JA 2RG8A 5FZQA 4BT8A 3C3RA 3PNLB 1SZAA 4U95D 3NQPA 3CQGB 3DXKG 3QKYA 4GA1A 2YHCA 4RSYA 5KJNA 2DCPA 2GROB 4ACKA 4XKCA 4KYOB 3PEUB 1FT2A 2YNQA 4WWOA 3S7DA 1DCQA 4I1MA 1D9SA 3D9JA 1OXJA 2VSXE 2X6HA 3CKCA 5BNWA 2R17C 2X6IA 2BEDA 3PUJA 5KCMA 3HVEB 5FQ4A 3PZDA 3LXUX 3AU5A 3QAQA 3C98A 2EIME 2XRZA 3ZFWA 3DSUA 3ZIMA 4G24A 3CHMA 3Q9UC 2XGMA 5ENTD 4ANWA 1BI8B 2IEJA 2CG2A 2Y3AA 4BT9A 3IBEA 2RFMA 3CSTA 1E8XA 4CYMD 3S2AA 5CRUA 1MX6A 2FI7A 2ETAA 5ENRD 3ZGQA 5AENA 4K03A 3MKRA 2I1JA 2MYOA 4UWGA 4G8KA 3IXEA 4KZ0A 3ZYKA 2I1KA 4FP7A 1XNFA 5BV1A 3LPZA 4KZCA 1N4QA 4K5BA 3E33A 1WDYA 3ZUVB 4EECA 2PNNA 3EIJA 1NFIE 4AJWA 3U9WA 2XEHA 5AARA 3TWQA 1JWFA 3CHRA 3ZU7B 4XZ4A 5EDSA 4GCNA 4AP2A 3V79K 1A5EA 3PE4A 2OCCE 5FIOA 1IQUA 1UW4B 1LD7A 3VTXA 3OXFA 1KLXA 2ZIRA 4PH4B 4I9EA 3TXNA 5BT1A 1MZCA 2WXKA 4UQYA 2AXZA 1AP7A 4JA7A 3EHQA 1K1AA 3JQ0A 4AOFA 2OOEA 4U96D 3MZLB 3APDA 1KT1A 4APFA 3ZXPA 3E32A 4GAAA 3PE3A 4AIFA 4CDRA 3MGBA 4LCTA 4WWPA 2OEWA 5EIBE 1UN9A 1G3NB 1V54E 4BTBA 2R02A 3JUIA 4GPMA 3L54A 3QK0A 2P9SG 4N3CA 2H6FA 1RZ4A 1IXVA 3OXGA 4EBAG 4G26A 3ULEG 3D9IA 4KT6B 3RU0A 4B93B 3CK7A 1O1TA 4JC8A 4NURA 4GA2A 4NRHB 4ACLA 3SI5A 1YA0A 2JLBA 3FUMA 3QWPA 3PNTB 3FUNA 3Q4AB 1D8DA 3ZKJA 3BG1B 3ZRHA 1NL4A 2KBXA 2R5SA 2XCBA 4UWHA 3UT8A 1H6OA 1E8WA 5AQAA 1MHQA 5JHBA 4PS8A 1PAQA 4JW1A 5J90A 5FT9A 3FH7A 3I5PA 4D10C 3W9FA 3E34A 4YVQC 3QWWA 2FBNA 3G2SA 4BETA 5EYPF 3U4TA 5T4YA 1BI7B 5LX8A 2I9CA 5EYLA 3PZ2A 1E8ZA 4YDWA 2R2LA 1S70B 4GZDA 3IHYA 3RAUA 3NF1A 4BX8A 3AG2E 2KCVA 4DUIA 1KZOA 1H2TC 3KSLA 3MV3B 4K5AB 4DLQA 2JABA 1OCZE 3UQ3A 4TUUA 2XEVA 1MJ0A 1HF8A 1DNPA 2WM9A 5EX0A 1TEZA 3E4BA 5LFAA 2XPYA 2WXPA 1N95A 1IHGA 3EIQC 2AJAA 1SW6A 4CDNA 4HLLA 3B95A 4N3AA 3V2XA 3P1UA 5HKPA 3SFYA 3PEVB 3BU8A 2VGYA 4AV7A 4O1OA 4DX7D 1EPUA 3ZNGA 2NC9A 2WXHA 3S7FA 4EZJA 1DCEA 3CVNA 1K1BA 4XI9A 4XKBA 2DVWA 1OY3D 1HH8A 2WXRA 3EHMA 3Q75A 4AVXA 3FUFA 1UOHA 3FUEA 1X81A 1LD8A 4JD2G 3RRNB 1L5JA 3AS8A 4L1BA 4BESA 1SA4A 3LYAA 4GTVA 4JVSA 2XPIA 5AYWD 5D0OD 4I2WA 3HRAA 1DC2A 2H6IA 2ZU6B 3AG3E 1TNYA 3OXLA 3FTVA 3UM3A 4PUCA 1HU3A 2UY1A 4XEIG 4GYYA 3FH5A 3PVLA 5JHAA 2C2LA 4ATZD 4JZYA 3ONKA 3FDHA 2V4LA 4YDEA 1S63A 4I1OB 3U3WA 3IEGA 3SQVA 2J09A 3KEAA 5KNGA 2J4BA 5CERB 3CK9A 2XS8A 4LRZA 5B3SE 3ULQA 1WAO1 3AG4E 4ANVA 4FJZA 3O48A 3ISMC 5H7PA 4O60A 2IFUA 3C3OA 1KT0A 1NI1A 5ENPD 2V8SE 3T8KA 4B94A 4XI0A 3MKQA 3KD7A 4KMOA 2WB2A 4HOUA 4K5CA 3FUHA 3JUEA 2P2CP 4LERA 2HM8A 1AWCB 2XZTG 4J8FA 2PQNA 2VYIA 3NB2A 3FU5A 4UI9C 4UWFA 2LXMA 4GMJA 5FWQA 4TXRA 1XGWA 3RSEG 3PZ3A 2CG3A 2PM7A 4G2VA 2IONA 3D9MA 2UY1B 4GB9A 1LF8A 3LVQE 1TJCA 4TRQA 3FTSA 1O1SA 3D3MA 3GZ1A 5FQ8A 4N2QA 2NYJA 5KJKA 3D9HA 2ZGGA 1TR4A 3CEQA 3FTYA 1E7VA 2YQ8A 4DRXE 3CHOA 1HG2A 3MV2B 2Y69E 4G8LA 4MLPA 2UWJG 3E30A 4WUYA 3NOGD 3PREA 3CLJA 1MQSA 1TNUA 4DX1A 2VQ2A 3ABKE 2V4HC 3N71A 3ZYMA 2AW6A 5BXUA 1UG3A 3B7TA 1QBQA 4GTTA 2J8SD 2DIWA 3TWWA 2J9QA 3TWUA 3MKQB 5ENOD 2F37A 2VSOE 1OWPA 2B0OE 2PL2A 3DSTA 4GMLA 4KVOA 1WG0A 1Z5SC 3QJZA 1MYOA 4CT0A 1EYHA 4HOQA 2Q7FA 3FU0A 3EU5A 3B7RL 4IRUA 2ONDA 4M3OA 3OTNA 5KWDA 4BSZB 1U2VG 4PDXA 3UM1A 2FO7A 4TXQA 2VJ8A 4WNGA 5D2MC 5ITZF 2GW1A 3URZA 1H6PA 4J6IA 5G55A 2GRLA 2HYZA 4NIKA 1FVFA 4GU5A 3LEWA 4IULA 2C0MA 5D0QD 3G2UA 4YNDA 3L9TA 3FUKA 1IYGA 4L23A 3MA5A 3TJPA 1YMPA 2OV8A 4NQ0A 4XX5A 4OYSA 5AN8A 4U0UA 1HG5A 5G05J 5KNHD 1E90A 4I17A 3HDXA 1OWOA 4EQFA 5D66A 1N4RA 5FZSA 2X6KA 4Q69A 2L0TB 4HI9A 2IOSA 4C48B 3VLEA 4AY5A 3R7QA 4N3BA 4Y6CA 4ABNA 1N0RA 5A23A 4BX9A 4ATGA 5BW8C 2LSUA 1SA5A 4BWRA 4P29A 1OWMA 3CHSA 5E75A 2IO2C 5G04C 5LP0A 3JCKC 1PY1A 1S64A 1TN8A 4HRLA 4M7CA 3S7BA 2WXQA 3CVQA 4L2LA 5G2NA 4TV3A 3ASHA 3IHVA 1FVHA 3DBSA 3V31A 3KEZA 2LO6A 4ANXA 2XRYA 3KAEA 3FU3A 2WXOA 4C9BB 5FQ6A 2DWZA 5CCLA 2H6HA 4CRWA 4CZ2D 4CGVA 3UM0A 4KXKB 5CMYA 1KPSB 3FUIA 5BPPA 3SFXA 1B89A 1N0QA 4UI9K 4TXPA 3GZSA 1E96B 4V3IA 3RRUA 4F53A 1O5MA 5G04J 2QZAA 2WXIA 1H0AA 5CCMA 5DIZA 3ZVVA 2J07A 3CVPA 3JQ1A 4HBDA 5BV0A 1DVPA 3L82A 4E6HA 4MBGA 5CHEE 2VTBA 3MEKA 4OAUC 4O1PA 4C0EA 3HHMA 4JPSA 1MX4A 1EDUA 3VLFA 3PDNA 2PM6A 5EKQD 3Q5MA 2JEKA 4I6JA 3WXXA 3SF4A 4GTMA 4BSXA 2PZIA 2GGFA 1OCCE 4JB8P 3Q9NC 2WXLA 4XIFA 3GW4A 3B13A 4FULA 3T9KA 1TN7A 3EHNA 3P2BA 2MOWA 4APOA 3C3QA 3HXBA 4BERA 4KBQA 4MKTA 1W3BA 3ZYQA 4UWKA 2BF0X 1QYMA 3HG0D 2X6FA 2X6JA 1IHBA 1ELKA 4ZFHA 5CBNA 2V5FA 4HXIA 2GRMA 3CVYA 4B8CB 3FFLA 3UIOC 5AQBA 2I2OA 3TG5A 3L22A 4H7YA 1ELWA 1GW6A 1HE8A 1JCRA 3RK6A 2VSYA 2QFCA 4JHRA 3SZ7A 2VTBB 4J8EA 4L9PA 4FHKA 4N5CA 4A55A 3T5VA 2OVFA 2F8YA 4YDYA 2CHZA 3Q15A 3RO3A 3MYVA 3FHEA 4WNEA 3JYSA 3I4GA 4N39A 3APCA 2RD0A 5C1DA 3HIZA 1OWNA 1ELRA 4U07A 4I1AA 5T8IA 3I3NA 4LEUA 2R03A 4I6GA 1UJKA 1D8EA 4HVBA 4GZCA 2KCLA 4ILIA 3D9OA 3IV0A 2C0LA 5ANLA 2A4ZA 4U8YD 4J0UA 3JXJA 5HI7A 2IU1A 1PC2A 5JJTA 2LUHA 4HOSA 3HXEA 3Q78A 4L2YA 3Q79A 2XEEA 1E7UA 5CBOA 2XCCA 4JEUA 5IY5E 4C0MA 3L6AA 3LY8A 4GA0A 4EPZA 4F1PA 3AS5A 1TYQG 4Q96A 2QC9A 2QYJA 1MX2A 4Z68A 1U3DA 3O4ZA 4MS6A 4EZLA 4EZKA 2ETBA 3ESKA 3DEPA 3Q49B 2E2EA 3G2VA 3G2WA 2J49A 4I6EA 3ENEA 4Q94A 4UUCA 4EBAA 2HR2A 4BY6A 3FUJA 2BUGA 1TNZA 4GYWA 1JWGA 3U66A 1SQMA 1NP7A 2E0IA 1ZBPA 5AIJA 1NZNA 3TWTA 4QFVA 2I6HA 3Q7AA 3AG1E 2LXLA 2GRPB 3TGOA 4PS3A 1Z3XA 2WPVA 3UKRG 3UKUG 4ME2A 4RLYA 4U63A 3ZXSA 1S0PA 1UN8A 2CFZA 5JA4D 2WXFA 1HFAA 3FTWA 3DEOA 3MCXA 3LS8A 4O6FA 5FQ7A 3FEYA 3SFZA 4J8DA 3E37A 4KVMA 3MJWA 1N9AA 3DRAA 4DPRA 2A5UA 3PS6A 2GRRB 3TWXA 2J08A 1N4PA 3BEEA 3RO2A 1N4SA 3DWLG 4I9CA 4BFRA 2Y1LE 2P9IG 4H7XA 3QWVA 1EF1C 1X5BA 2Y4TA 5BUZA 1JPLA 1SZ9A 1UJJA 2LNIA 3JXIA 4G1TA 4F1SA 2M63A 3CHQA 3Q7FA 4HS2A 5HS0A 3DSSA 4B89A 4JEHA 3DXMG 4YDOA 3B7SA 2P9LG 2AWIA 1HXIA 4UWLA 5KJLA 3UTMA 4WAFA 5T3RA 2F8XK 4JHKA 4E85A 2BKGA 3Q73A 5AJLA 3D9LA 2Y4UA 3IKOB 2WXGA 4BEPA 4WNFA 2P9NG 1OCRE 3ASNE 3CV0A 2IQCA 1N94A 3CK8A 3PH0C 3D9PA 5B1AE 3B7UX 1QNFA 4I2ZA 2EINE 5AQ9A 4LG6A 2OEVA 1SVXA 4UI9J 4ZHBA 2AXVA 4OVUA 4DLOA 3J5QB 2WQ6A 4HFGA 3LJ3A 1OCOE 4J8SA 1IQRA 3TWSA 3CSFA 4URKA 3UI2A 2CHWA 3LKUA 3SBSA 3APFA 4RG6A 4PS7A 5AJDA 3FTUA 3NZUA 4U7EB 4HNAD 1TN6A 3FULA 2OVBA 3DSXA 1JCQA 3R7RA 4GTSA 4K0RA 2DYSE 2XQ0A 5JMND 3F6QA 2HO1A 3FEXA 2IY0C 4GTOA 5EILA 2V5QC 1FCHA 2YHEA 4CCAA 3ML9A 4X8QA 3PZ1A 1WM5A 5CEDB 4DJAA 4FA6A 4N2SA 2VGEA 3NAWA 1E8YA 4WNDA 5J08A 1N54A 4A1SA 2ZISA 3ZPJA 2VGXA 1TNBA 1BU9A 2R05A 4DX6D 3ASFA 1Q2ZA 3FP3A 4ILGA 4LUNU 5EX3A 2DZOA 2MRIA 3SNXA 2L0IA 3NBNB 1WY6A 1YYHA 5LCWC 5LOZA 2XPZA 2P9KG 2KC7A 3EU9A 5C2YA 3CHPA 4CGWA 4TUMA 3PUKA 4U0ZA 4JL0A 2WVIA 1H6KA 3CVLA 2WXNA 4A1GA 2GRQB 3G2TA 2F0YA 2GRNB 2PQRA 1ZU2A 3C72A 3MX3A 3DPDA 3LCAA 3ZN3A 3BG0B 4HI8A 4GZ3A 2CHXA 2XGSA 4HOTA 3ZHEA 4ANUA 3EHRA 4U8VD 3K9IA 4LNBA 5CECB 2KATA 4G11A 4CDMA 3UMVA 4DI4A 3EJNA 3BUAA 2ILRA 1LTXA 1TNOA 4GTRA 2VGXB 4DX5D 3CGHA 2BKKB 3HXDA 5KBAA 1H19A 4EHMA 5LCWJ 5HQ8A 5JJ6A 2LAHA 2KCKA 3DSVA 5E76A 3UT4A 1FPPA 1N52A 1Z3YA 1Z6TA 3ZEFA 5HRYA 2X38A 5FTPA 5ANRA 4LSZE 4U8HA 1KZPA 1BD8A 1K3ZD 4XE0A 4AEZC 2EQXA 3QC1A 3SHFA 4L7TA 3AAAC 4B8AA 3ASDA 3FH8A 5ARFA 1U3CA 1JCSA 3QOUA 4FLHA 1HO8A 4RG9A 3UXGA 2IO3C 5A7DB 3T8MA 2V0PA 3W9GA 4IYPA 3GZ2A 1ZB1A 2FULA 4U04A 3TWRA 5CEAA 3C5RA 3PRZA 2AXUA 3CVXA 3L17A 4HQDA 1V55E 2WXMA 5AQ7A 2A5EA 3ZHEB 2P9PG 4NACA 3WG7E 3KSQA 3SD5A 2P58C 4DX2A 5CMWA 4G25A 4A3VA 3CR3A 5ENQD 3AS4A 2EILE 4I43A 3ASGA 3ABLE 3ABME 2WMOA 3L08A 1TJFA 2DYRE 5BXOA 2ETCA 1INZA 3FUDA 3FY4A 2WQ7A 4WWNA 3UUXA 5KJMA 3BQOA 4JXTA 1N11A 1Y8MA 5DBKA 4RVBA 3LDZA 2WMNA 3QNKA 2RKKA 5ENSD 2B6CA 4BTAA 1NA3A 2L9BA 1OT8A 3UT7A 3NOCD 3R9MA 3GYZA 4DK5A 4QQIA 2IOLA 2RFAA 4F7AA 4AY6A 2IF4A 2LAIA 3U64A 2QYUA 1K8KG 3RIBA 3UX4A 4UQZA 3TXMA 2HE0A 4HB5A 4IN3B 3FWVA 3SY2A 3FTXA 3DPYA 4A63B 1OUVA 2XHEA 5EIDA 2FF4A 3TG4A 3D9KA 2LSVA 1YCSB 3RJVA 5AAOA 3V2OA 4GTQA 2Y0BG 4GCOA 3R9AB 4J7WA 4HRNA 2XZDG 1O1RA 4A3TA 2FEZA 2WXJA 2FO1E 3UIPC 2AVPA 3T5XA 1NA0A 3EUVA 3NZSA 5M72A 4FLBA 2L6BA 3LJNA 2KZTA 2P9UG 3DSWA 3UM2A 1QZ2A 5B1BE 3CKBA 3J5PA 4MRUA 2DZNA 4LNGA 2MHKA 3L13A 5ARGA 5JJ7A 5A6CA 3TAXA 3ZYLA 3ESLA 4G23A 3CVWA 1RW2A 3I4RB 3TL5A 2ZGDA 4RQIA 3LVRE 3CQCB 3HXCA 2NSZA 4JHJA 3D9NA 2H6GA 1HS6A 2J4DA 1A17A 3OAWA 5FJYA 4GTPA 5ENNA 4ILHB 3AJIA 3ASOE 3RRMB 3V30A 1P5QA 2VSNA 3QDNA 4CT4A 3CVVA 4FHJA 3KS2A 4HRMB 3SGHA 1FT1A 4OAVB 3EDTB 2R59A 3ZW3A 2BTDA 2XS1A 2ZXWE 5EN5D 4GYOA 3CIAA 2KXPC 4W9RA 2CFUA 1JUQA 2DBAA 2QY7A 3CVUA 2KM4A 2KZTB 2EIKE 4CEMA 4R7LA 4B0ZA 3LY9A 1BLXB 2XENA 3VTYA 3QARA 2YINA 3X2QE 4F3VA 4FJYA 4UQXA 1HZ4A 3TWVA 3FU6A 3PZ4A 4AM9A 1Y6IA 4GZ5A 3AU4A 2NXPA 3ULYA 1BPOA 2X3MA 2XGOA 3UPVA 4FADA 3QB2A 3ML8A 5CRVA 2WQHA 5FINA 1H2VC 4GMRA 4OVVA 1VDYA 4F6RD 2IJGX 3HVEA 3L16A 5FZRA 3SO8A 4FC8A 3RKVA 3HYMB 3VLDA 4Y6WA 3SBTB 1IKND 4HLEA 3B7BA 4AXHA 4U0SA 5G05C 4HORA 3UINC 1H2UA 4FU3A 1HX8A 3ONLA 4YVOA 1OWLA 4DI3A 1QQEA 3HXFA 4GZ6A 4LNUD 4J8YA 4GPKA 3LY7A 3FTZA 3S7JA 4N5QA 2EIJE 3Q47B
chains in the Genus database with same CATH topology
4JA9A 4JHRA 2L6JA 3K9IA 4I1OB 3SZ7A 2KATA 2VTBB 4G11A 4J8EA 2RG8A 4FHKA 3IEGA 5FZQA 4BT8A 4CDMA 3U3WA 3PNLB 4N5CA 4A55A 3T5VA 1SZAA 3UMVA 2OVFA 2J09A 4DI4A 3EJNA 2CHZA 3Q15A 2ILRA 3RO3A 3MYVA 2J4BA 3FHEA 3CK9A 3NQPA 3CQGB 4WNEA 3JYSA 3I4GA 4N39A 3APCA 4LRZA 3ULQA 2VGXB 2RD0A 1WAO1 4ANVA 3CGHA 5C1DA 4FJZA 3O48A 1H19A 5LCWJ 2IFUA 3QKYA 4GA1A 5HQ8A 2YHCA 4RSYA 5JJ6A 3HIZA 1OWNA 2LAHA 1ELRA 4U07A 5KJNA 2KCKA 1KT0A 3UT4A 5E76A 2DCPA 4I1AA 2V8SE 5T8IA 3I3NA 4LEUA 4I6GA 1N52A 1UJKA 4XI0A 3MKQA 3KD7A 1Z3YA 4KMOA 4XKCA 4ACKA 1Z6TA 4HOUA 3ZEFA 2WB2A 4KYOB 2X38A 3PEUB 5FTPA 3FUHA 2YNQA 4LERA 4WWOA 3S7DA 5ANRA 4U8HA 2HM8A 4HVBA 4XE0A 4AEZC 4GZCA 4I1MA 4J8FA 2EQXA 2KCLA 4ILIA 3QC1A 3D9JA 2PQNA 2VYIA 3D9OA 3IV0A 3SHFA 2C0LA 5ANLA 2VSXE 2X6HA 3FU5A 4L7TA 3CKCA 3ASDA 4UI9C 4UWFA 4B8AA 5BNWA 3FH8A 2A4ZA 2R17C 5ARFA 2X6IA 4GMJA 4J0UA 3PUJA 5FWQA 5HI7A 1U3CA 2IU1A 5KCMA 3HVEB 3QOUA 1PC2A 1XGWA 4FLHA 5FQ4A 5JJTA 1HO8A 4RG9A 3PZDA 3LXUX 3AU5A 3QAQA 4HOSA 5A7DB 2CG3A 3C98A 2PM7A 4G2VA 2V0PA 3T8MA 4IYPA 2IONA 2XRZA 3D9MA 2UY1B 3ZFWA 4GB9A 4L2YA 3ZIMA 1LF8A 3LVQE 1TJCA 1E7UA 3GZ2A 4TRQA 2XCCA 4JEUA 4G24A 4C0MA 3CHMA 2FULA 3FTSA 4U04A 3L6AA 3LY8A 4GA0A 2XGMA 4ANWA 4EPZA 3D3MA 3GZ1A 5FQ8A 3PRZA 2AXUA 2CG2A 4N2QA 3CVXA 3L17A 3AS5A 5KJKA 2Y3AA 3CEQA 3FTYA 1E7VA 2YQ8A 2WXMA 3CHOA 4BT9A 3IBEA 3ZHEB 4Q96A 3CSTA 1E8XA 4NACA 1HG2A 3MV2B 3SD5A 3S2AA 2P58C 2FI7A 5CMWA 4G25A 1U3DA 3O4ZA 4MS6A 4A3VA 4MLPA 3CR3A 3ZGQA 4EZLA 2UWJG 4WUYA 4EZKA 5AENA 4K03A 3ESKA 3MKRA 3AS4A 3Q49B 2I1JA 2E2EA 3PREA 3CLJA 1MQSA 3G2VA 4I43A 4UWGA 3ASGA 2VQ2A 3G2WA 4KZ0A 2J49A 3N71A 4I6EA 2WMOA 3ZYKA 3ENEA 2I1KA 3ZYMA 2AW6A 3L08A 4Q94A 4FP7A 1UG3A 1XNFA 4EBAA 5BV1A 3B7TA 2HR2A 3LPZA 4KZCA 4BY6A 3FUJA 1TJFA 2BUGA 2DIWA 2J9QA 1INZA 3FUDA 4GYWA 1JWGA 3FY4A 3MKQB 3U66A 1SQMA 2WQ7A 4WWNA 1NP7A 3UUXA 5KJMA 4JXTA 2E0IA 2VSOE 1ZBPA 4EECA 1OWPA 1Y8MA 2PL2A 1NZNA 3EIJA 4GMLA 4KVOA 4RVBA 5DBKA 3U9WA 4QFVA 4AJWA 3LDZA 2I6HA 3QJZA 2WMNA 1JWFA 3QNKA 3CHRA 4XZ4A 4CT0A 1EYHA 5EDSA 4GCNA 4AP2A 4HOQA 3TGOA 4PS3A 2Q7FA 3PE4A 3FU0A 1Z3XA 1IQUA 1UW4B 2WPVA 3B7RL 3VTXA 4IRUA 2ONDA 3OXFA 1KLXA 4M3OA 3OTNA 4BTAA 4PH4B 4ME2A 1NA3A 2L9BA 4PDXA 3UT7A 4I9EA 3TXNA 4U63A 5BT1A 3ZXSA 1S0PA 2FO7A 2VJ8A 1UN8A 2CFZA 2WXKA 4WNGA 3GYZA 4UQYA 2AXZA 2GW1A 4DK5A 5D0OD 2WXFA 1HFAA 3FTWA 4JA7A 3URZA 3MCXA 3LS8A 4O6FA 5FQ7A 2IOLA 3FEYA 4J6IA 5G55A 2GRLA 2HYZA 3JQ0A 4J8DA 3SFZA 4AOFA 4F7AA 2OOEA 4KVMA 3MJWA 1FVFA 3MZLB 4GU5A 3LEWA 4IULA 4AY6A 2C0MA 4DPRA 2A5UA 3APDA 1KT1A 5D0QD 4APFA 3G2UA 2IF4A 3PS6A 4YNDA 2LAIA 4GAAA 3U64A 3PE3A 4AIFA 2J08A 3FUKA 4CDRA 3MGBA 1IYGA 4L23A 3MA5A 3RIBA 3UX4A 3TJPA 4NQ0A 2OV8A 3BEEA 4XX5A 3RO2A 4LCTA 4UQZA 4WWPA 4OYSA 3TXMA 4I9CA 4U0UA 1HG5A 5G05J 4BFRA 1UN9A 4H7XA 3QWVA 1EF1C 1X5BA 2Y4TA 4BTBA 5BUZA 1JPLA 1SZ9A 1E90A 1UJJA 2LNIA 4I17A 4IN3B 3JUIA 4G1TA 3FWVA 3L54A 3QK0A 4F1SA 2M63A 3HDXA 3CHQA 3FTXA 4N3CA 1OWOA 4EQFA 3OXGA 4EBAG 1OUVA 2XHEA 4G26A 5FZSA 4HS2A 2FF4A 3TG4A 4B89A 3D9IA 2X6KA 3D9KA 4JEHA 4KT6B 3RU0A 3CK7A 4Q69A 2LSVA 3B7SA 2L0TB 3RJVA 2IOSA 2AWIA 1HXIA 3VLEA 4GCOA 4JC8A 3R9AB 3R7QA 4AY5A 4N3BA 4UWLA 5KJLA 4NURA 4GA2A 4NRHB 4Y6CA 4WAFA 5T3RA 3SI5A 1YA0A 4ACLA 2JLBA 4JHKA 4ABNA 5A23A 3FUMA 4BX9A 4E85A 3QWPA 4A3TA 2FEZA 3PNTB 2WXJA 3FUNA 5AJLA 3Q4AB 5BW8C 2LSUA 4ATGA 2AVPA 4BWRA 3D9LA 2Y4UA 4P29A 1OWMA 3CHSA 3IKOB 2WXGA 3BG1B 5E75A 3T5XA 3ZRHA 4WNFA 2R5SA 1NA0A 5G04C 2XCBA 3NZSA 5M72A 4UWHA 3UT8A 4FLBA 3CV0A 1E8WA 2IQCA 5LP0A 3JCKC 2KZTA 1QZ2A 3CK8A 1MHQA 5JHBA 3PH0C 4PS8A 3D9PA 3B7UX 1PAQA 1PY1A 1QNFA 3CKBA 4JW1A 5J90A 4I2ZA 4MRUA 3S7BA 2WXQA 2MHKA 3CVQA 3L13A 4L2LA 5ARGA 5G2NA 5A6CA 5FT9A 3TAXA 5JJ7A 3FH7A 3ZYLA 3CVYA 3I5PA 4D10C 3ESLA 4UI9J 4TV3A 3ASHA 4G23A 4YVQC 3QWWA 3CVWA 2FBNA 1FVHA 3DBSA 2AXVA 3IHVA 4OVUA 3I4RB 3KEZA 3G2SA 2LO6A 4DLOA 4ANXA 3TL5A 2WQ6A 2XRYA 4HFGA 3LVRE 3LJ3A 3CQCB 4J8SA 1IQRA 3KAEA 2NSZA 3FU3A 4JHJA 3U4TA 3D9NA 2WXOA 5T4YA 3CSFA 4C9BB 4URKA 5LX8A 2I9CA 1HS6A 2J4DA 1A17A 2CHWA 1E8ZA 3LKUA 3OAWA 5FJYA 5FQ6A 3SBSA 5CCLA 4CRWA 3APFA 4RG6A 4PS7A 5AJDA 3FTUA 3NZUA 4GZDA 3FULA 5ENNA 4ILHB 2OVBA 3IHYA 3NF1A 4CGVA 4BX8A 3R7RA 2KCVA 4KXKB 4K0RA 3RRMB 2XQ0A 1H2TC 2HO1A 1P5QA 2VSNA 3QDNA 3FEXA 5CMYA 3FUIA 5BPPA 1B89A 4UI9K 3GZSA 4CT4A 3CVVA 1E96B 4V3IA 3MV3B 4FHJA 1FCHA 3RRUA 3KS2A 2YHEA 3SGHA 4F53A 4CCAA 3ML9A 4DLQA 5G04J 3UQ3A 4TUUA 3EDTB 2WXIA 2XEVA 2R59A 3ZW3A 1WM5A 1H0AA 5CCMA 5DIZA 2BTDA 3ZVVA 1HF8A 4DJAA 1DNPA 2J07A 2WM9A 3CVPA 3JQ1A 5EX0A 4FA6A 3E4BA 1TEZA 4GYOA 5LFAA 5BV0A 2XPYA 3CIAA 1DVPA 2WXPA 4N2SA 4W9RA 1IHGA 4E6HA 2CFUA 5CHEE 1E8YA 2VTBA 3EIQC 1JUQA 3MEKA 4CDNA 2DBAA 2QY7A 3CVUA 2KM4A 4N3AA 2KZTB 4C0EA 4WNDA 5J08A 3P1UA 3PEVB 1N54A 2VGYA 4AV7A 3HHMA 4CEMA 4R7LA 1EPUA 4A1SA 4B0ZA 3LY9A 4JPSA 3ZPJA 2NC9A 2WXHA 3S7FA 1EDUA 3VLFA 2VGXA 3PDNA 4EZJA 3ASFA 3VTYA 3QARA 2YINA 2PM6A 3CVNA 3FP3A 5EKQD 4F3VA 4ILGA 4XI9A 4FJYA 4UQXA 3Q5MA 2JEKA 4I6JA 1HZ4A 3WXXA 3FU6A 4LUNU 5EX3A 4AM9A 2MRIA 3SNXA 4XKBA 2L0IA 1Y6IA 4GZ5A 3SF4A 1WY6A 3AU4A 1HH8A 2NXPA 2PZIA 2WXRA 3EHMA 2GGFA 4BSXA 4AVXA 1BPOA 5LCWC 2X3MA 2XGOA 5LOZA 3UPVA 2XPZA 3FUFA 2WXLA 4FADA 3QB2A 3ML8A 4XIFA 3GW4A 3B13A 3FUEA 2WQHA 4FULA 2KC7A 5AIJA 3EHNA 3P2BA 3RRNB 1L5JA 3AS8A 4L1BA 5C2YA 2MOWA 3CHPA 3LYAA 4CGWA 4JVSA 4APOA 2XPIA 5AYWD 1H2VC 4OVVA 4KBQA 3PUKA 4MKTA 1W3BA 1VDYA 4I2WA 2BF0X 2ZU6B 2IJGX 4U0ZA 4UWKA 3HVEA 3L16A 3ZYQA 5FZRA 3OXLA 4JL0A 2WVIA 2X6FA 2X6JA 3FTVA 1H6KA 3CVLA 4FC8A 3RKVA 2WXNA 3HYMB 3VLDA 4A1GA 4PUCA 1HU3A 4Y6WA 1ELKA 3SBTB 4HLEA 2UY1A 3G2TA 4AXHA 2V5FA 4U0SA 5G05C 4HORA 1H2UA 4FU3A 4HXIA 4GYYA 2PQRA 1HX8A 3ONLA 1ZU2A 2GRMA 1OWLA 3FH5A 3PVLA 3FFLA 4YVOA 4B94A 4B8CB 1QQEA 2I2OA 4DI3A 5JHAA 2C2LA 3TG5A 3MX3A 3DPDA 3L22A 3LCAA 4H7YA 3ZN3A 3BG0B 4GZ6A 3ONKA 4JZYA 1ELWA 4GZ3A 1GW6A 1HE8A 2CHXA 3FDHA 4GPKA 3LY7A 2XGSA 4HOTA 2V4LA 3FTZA 3S7JA 3RK6A 2VSYA 3ZHEA 3Q47B 4ANUA 2QFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JA9 A;  4JHR A;  2L6J A;  3K9I A;  3SZ7 A;  2KAT A;  4J8E A;  3U3W A;  3IEG A;  5FZQ A;  4BT8 A;  4N5C A;  3Q15 A;  3RO3 A;  3CK9 A;  4WNE A;  3JYS A;  4N39 A;  3ULQ A;  2VGX B;  1WAO 1;  5C1D A;  3O48 A;  5LCW J;  2IFU A;  3QKY A;  4GA1 A;  5HQ8 A;  2YHC A;  5JJ6 A;  5KJN A;  1ELR A;  4U07 A;  2KCK A;  1KT0 A;  4I1A A;  4LEU A;  4B94 A;  4XI0 A;  3KD7 A;  4HOU A;  4KYO B;  5FTP A;  3S7D A;  4J8F A;  2KCL A;  2PQN A;  2VYI A;  2C0L A;  3CKC A;  3ASD A;  4UI9 C;  5BNW A;  5ARF A;  4J0U A;  5HI7 A;  3QOU A;  1PC2 A;  5JJT A;  4RG9 A;  4HOS A;  5A7D B;  4G2V A;  2UY1 B;  3ZFW A;  1TJC A;  3GZ2 A;  2XCC A;  4G24 A;  4U04 A;  3LY8 A;  4GA0 A;  2XGM A;  3GZ1 A;  4N2Q A;  3AS5 A;  5KJK A;  3CEQ A;  2YQ8 A;  4BT9 A;  3ZHE B;  3MV2 B;  2P58 C;  2FI7 A;  4G25 A;  3ZGQ A;  2UWJ G;  4WUY A;  3ESK A;  3MKR A;  3AS4 A;  3Q49 B;  2E2E A;  3ASG A;  2VQ2 A;  3N71 A;  1XNF A;  2HR2 A;  3LPZ A;  2BUG A;  2J9Q A;  4GYW A;  3UUX A;  5KJM A;  1ZBP A;  1Y8M A;  2PL2 A;  1NZN A;  5DBK A;  2I6H A;  4GCN A;  4HOQ A;  3TGO A;  2Q7F A;  3PE4 A;  2WPV A;  3VTX A;  2OND A;  3OXF A;  1KLX A;  4BTA A;  4ME2 A;  1NA3 A;  4I9E A;  5BT1 A;  2FO7 A;  4WNG A;  3GYZ A;  4UQY A;  2GW1 A;  4JA7 A;  3URZ A;  4O6F A;  2HYZ A;  4J8D A;  2OOE A;  4AY6 A;  2C0M A;  1KT1 A;  5D0Q D;  2IF4 A;  4YND A;  3PE3 A;  4AIF A;  4CDR A;  1IYG A;  3MA5 A;  3RIB A;  4NQ0 A;  3BEE A;  3RO2 A;  4UQZ A;  4I9C A;  4U0U A;  5G05 J;  4H7X A;  3QWV A;  2Y4T A;  4BTB A;  2LNI A;  4I17 A;  4IN3 B;  4G1T A;  3FWV A;  4N3C A;  4EQF A;  3OXG A;  1OUV A;  4G26 A;  5FZS A;  2FF4 A;  3TG4 A;  3RU0 A;  3CK7 A;  2LSV A;  3RJV A;  1HXI A;  4GCO A;  3R9A B;  4AY5 A;  4N3B A;  5KJL A;  4GA2 A;  4NRH B;  4Y6C A;  1YA0 A;  2JLB A;  4ABN A;  3QWP A;  2FEZ A;  3Q4A B;  5BW8 C;  2LSU A;  4BWR A;  2AVP A;  2Y4U A;  4WNF A;  2R5S A;  1NA0 A;  5G04 C;  2XCB A;  5M72 A;  3CV0 A;  1QZ2 A;  3CK8 A;  3CKB A;  4I2Z A;  3S7B A;  2MHK A;  3CVQ A;  5ARG A;  5JJ7 A;  5A6C A;  5FT9 A;  3TAX A;  4UI9 J;  3ASH A;  4G23 A;  4YVQ C;  3QWW A;  2FBN A;  3KAE A;  3U4T A;  1A17 A;  3LKU A;  5FJY A;  5CCL A;  4RG6 A;  3NF1 A;  4CGV A;  2KCV A;  4KXK B;  2HO1 A;  1P5Q A;  2VSN A;  3QDN A;  1B89 A;  4UI9 K;  1E96 B;  3MV3 B;  1FCH A;  3KS2 A;  5G04 J;  3UQ3 A;  3EDT B;  2XEV A;  1WM5 A;  5CCM A;  5DIZ A;  3CVP A;  5EX0 A;  3E4B A;  4GYO A;  4N2S A;  4W9R A;  1IHG A;  5CHE E;  3MEK A;  2DBA A;  4N3A A;  4WND A;  2VGY A;  4A1S A;  3LY9 A;  3ZPJ A;  2NC9 A;  3S7F A;  2VGX A;  3PDN A;  3ASF A;  3VTY A;  3CVN A;  3FP3 A;  5EKQ D;  4F3V A;  4XI9 A;  4UQX A;  3Q5M A;  1HZ4 A;  3WXX A;  5EX3 A;  4AM9 A;  4GZ5 A;  3SF4 A;  1HH8 A;  2PZI A;  5LCW C;  2XGO A;  3UPV A;  4XIF A;  3GW4 A;  2WQH A;  2KC7 A;  3AS8 A;  3LYA A;  4CGW A;  4APO A;  2XPI A;  5AYW D;  4KBQ A;  5D0O D;  1W3B A;  4I2W A;  4U0Z A;  5FZR A;  3OXL A;  4JL0 A;  3CVL A;  3RKV A;  3HYM B;  4Y6W A;  2UY1 A;  2V5F A;  4U0S A;  5G05 C;  4HOR A;  4GYY A;  2PQR A;  1ZU2 A;  4YVO A;  3FFL A;  1QQE A;  2C2L A;  3TG5 A;  3LCA A;  4H7Y A;  3ZN3 A;  4GZ6 A;  1ELW A;  4GZ3 A;  4GPK A;  3LY7 A;  2XGS A;  4HOT A;  3S7J A;  2VSY A;  3ZHE A;  3Q47 B;  2QFC A; 
#chains in the Genus database with same CATH topology
 4JA9 A;  2L6J A;  2RG8 A;  5FZQ A;  4BT8 A;  3C3R A;  3PNL B;  1SZA A;  4U95 D;  3NQP A;  3CQG B;  3DXK G;  3QKY A;  4GA1 A;  2YHC A;  4RSY A;  5KJN A;  2DCP A;  2GRO B;  4ACK A;  4XKC A;  4KYO B;  3PEU B;  1FT2 A;  2YNQ A;  4WWO A;  3S7D A;  1DCQ A;  4I1M A;  1D9S A;  3D9J A;  1OXJ A;  2VSX E;  2X6H A;  3CKC A;  5BNW A;  2R17 C;  2X6I A;  2BED A;  3PUJ A;  5KCM A;  3HVE B;  5FQ4 A;  3PZD A;  3LXU X;  3AU5 A;  3QAQ A;  3C98 A;  2EIM E;  2XRZ A;  3ZFW A;  3DSU A;  3ZIM A;  4G24 A;  3CHM A;  3Q9U C;  2XGM A;  5ENT D;  4ANW A;  1BI8 B;  2IEJ A;  2CG2 A;  2Y3A A;  4BT9 A;  3IBE A;  2RFM A;  3CST A;  1E8X A;  4CYM D;  3S2A A;  5CRU A;  1MX6 A;  2FI7 A;  2ETA A;  5ENR D;  3ZGQ A;  5AEN A;  4K03 A;  3MKR A;  2I1J A;  2MYO A;  4UWG A;  4G8K A;  3IXE A;  4KZ0 A;  3ZYK A;  2I1K A;  4FP7 A;  1XNF A;  5BV1 A;  3LPZ A;  4KZC A;  1N4Q A;  4K5B A;  3E33 A;  1WDY A;  3ZUV B;  4EEC A;  2PNN A;  3EIJ A;  1NFI E;  4AJW A;  3U9W A;  2XEH A;  5AAR A;  3TWQ A;  1JWF A;  3CHR A;  3ZU7 B;  4XZ4 A;  5EDS A;  4GCN A;  4AP2 A;  3V79 K;  1A5E A;  3PE4 A;  2OCC E;  5FIO A;  1IQU A;  1UW4 B;  1LD7 A;  3VTX A;  3OXF A;  1KLX A;  2ZIR A;  4PH4 B;  4I9E A;  3TXN A;  5BT1 A;  1MZC A;  2WXK A;  4UQY A;  2AXZ A;  1AP7 A;  4JA7 A;  3EHQ A;  1K1A A;  3JQ0 A;  4AOF A;  2OOE A;  4U96 D;  3MZL B;  3APD A;  1KT1 A;  4APF A;  3ZXP A;  3E32 A;  4GAA A;  3PE3 A;  4AIF A;  4CDR A;  3MGB A;  4LCT A;  4WWP A;  2OEW A;  5EIB E;  1UN9 A;  1G3N B;  1V54 E;  4BTB A;  2R02 A;  3JUI A;  4GPM A;  3L54 A;  3QK0 A;  2P9S G;  4N3C A;  2H6F A;  1RZ4 A;  1IXV A;  3OXG A;  4EBA G;  4G26 A;  3ULE G;  3D9I A;  4KT6 B;  3RU0 A;  4B93 B;  3CK7 A;  1O1T A;  4JC8 A;  4NUR A;  4GA2 A;  4NRH B;  4ACL A;  3SI5 A;  1YA0 A;  2JLB A;  3FUM A;  3QWP A;  3PNT B;  3FUN A;  3Q4A B;  1D8D A;  3ZKJ A;  3BG1 B;  3ZRH A;  1NL4 A;  2KBX A;  2R5S A;  2XCB A;  4UWH A;  3UT8 A;  1H6O A;  1E8W A;  5AQA A;  1MHQ A;  5JHB A;  4PS8 A;  1PAQ A;  4JW1 A;  5J90 A;  5FT9 A;  3FH7 A;  3I5P A;  4D10 C;  3W9F A;  3E34 A;  4YVQ C;  3QWW A;  2FBN A;  3G2S A;  4BET A;  5EYP F;  3U4T A;  5T4Y A;  1BI7 B;  5LX8 A;  2I9C A;  5EYL A;  3PZ2 A;  1E8Z A;  4YDW A;  2R2L A;  1S70 B;  4GZD A;  3IHY A;  3RAU A;  3NF1 A;  4BX8 A;  3AG2 E;  2KCV A;  4DUI A;  1KZO A;  1H2T C;  3KSL A;  3MV3 B;  4K5A B;  4DLQ A;  2JAB A;  1OCZ E;  3UQ3 A;  4TUU A;  2XEV A;  1MJ0 A;  1HF8 A;  1DNP A;  2WM9 A;  5EX0 A;  1TEZ A;  3E4B A;  5LFA A;  2XPY A;  2WXP A;  1N95 A;  1IHG A;  3EIQ C;  2AJA A;  1SW6 A;  4CDN A;  4HLL A;  3B95 A;  4N3A A;  3V2X A;  3P1U A;  5HKP A;  3SFY A;  3PEV B;  3BU8 A;  2VGY A;  4AV7 A;  4O1O A;  4DX7 D;  1EPU A;  3ZNG A;  2NC9 A;  2WXH A;  3S7F A;  4EZJ A;  1DCE A;  3CVN A;  1K1B A;  4XI9 A;  4XKB A;  2DVW A;  1OY3 D;  1HH8 A;  2WXR A;  3EHM A;  3Q75 A;  4AVX A;  3FUF A;  1UOH A;  3FUE A;  1X81 A;  1LD8 A;  4JD2 G;  3RRN B;  1L5J A;  3AS8 A;  4L1B A;  4BES A;  1SA4 A;  3LYA A;  4GTV A;  4JVS A;  2XPI A;  5AYW D;  5D0O D;  4I2W A;  3HRA A;  1DC2 A;  2H6I A;  2ZU6 B;  3AG3 E;  1TNY A;  3OXL A;  3FTV A;  3UM3 A;  4PUC A;  1HU3 A;  2UY1 A;  4XEI G;  4GYY A;  3FH5 A;  3PVL A;  5JHA A;  2C2L A;  4ATZ D;  4JZY A;  3ONK A;  3FDH A;  2V4L A;  4YDE A;  1S63 A;  4I1O B;  3U3W A;  3IEG A;  3SQV A;  2J09 A;  3KEA A;  5KNG A;  2J4B A;  5CER B;  3CK9 A;  2XS8 A;  4LRZ A;  5B3S E;  3ULQ A;  1WAO 1;  3AG4 E;  4ANV A;  4FJZ A;  3O48 A;  3ISM C;  5H7P A;  4O60 A;  2IFU A;  3C3O A;  1KT0 A;  1NI1 A;  5ENP D;  2V8S E;  3T8K A;  4B94 A;  4XI0 A;  3MKQ A;  3KD7 A;  4KMO A;  2WB2 A;  4HOU A;  4K5C A;  3FUH A;  3JUE A;  2P2C P;  4LER A;  2HM8 A;  1AWC B;  2XZT G;  4J8F A;  2PQN A;  2VYI A;  3NB2 A;  3FU5 A;  4UI9 C;  4UWF A;  2LXM A;  4GMJ A;  5FWQ A;  4TXR A;  1XGW A;  3RSE G;  3PZ3 A;  2CG3 A;  2PM7 A;  4G2V A;  2ION A;  3D9M A;  2UY1 B;  4GB9 A;  1LF8 A;  3LVQ E;  1TJC A;  4TRQ A;  3FTS A;  1O1S A;  3D3M A;  3GZ1 A;  5FQ8 A;  4N2Q A;  2NYJ A;  5KJK A;  3D9H A;  2ZGG A;  1TR4 A;  3CEQ A;  3FTY A;  1E7V A;  2YQ8 A;  4DRX E;  3CHO A;  1HG2 A;  3MV2 B;  2Y69 E;  4G8L A;  4MLP A;  2UWJ G;  3E30 A;  4WUY A;  3NOG D;  3PRE A;  3CLJ A;  1MQS A;  1TNU A;  4DX1 A;  2VQ2 A;  3ABK E;  2V4H C;  3N71 A;  3ZYM A;  2AW6 A;  5BXU A;  1UG3 A;  3B7T A;  1QBQ A;  4GTT A;  2J8S D;  2DIW A;  3TWW A;  2J9Q A;  3TWU A;  3MKQ B;  5ENO D;  2F37 A;  2VSO E;  1OWP A;  2B0O E;  2PL2 A;  3DST A;  4GML A;  4KVO A;  1WG0 A;  1Z5S C;  3QJZ A;  1MYO A;  4CT0 A;  1EYH A;  4HOQ A;  2Q7F A;  3FU0 A;  3EU5 A;  3B7R L;  4IRU A;  2OND A;  4M3O A;  3OTN A;  5KWD A;  4BSZ B;  1U2V G;  4PDX A;  3UM1 A;  2FO7 A;  4TXQ A;  2VJ8 A;  4WNG A;  5D2M C;  5ITZ F;  2GW1 A;  3URZ A;  1H6P A;  4J6I A;  5G55 A;  2GRL A;  2HYZ A;  4NIK A;  1FVF A;  4GU5 A;  3LEW A;  4IUL A;  2C0M A;  5D0Q D;  3G2U A;  4YND A;  3L9T A;  3FUK A;  1IYG A;  4L23 A;  3MA5 A;  3TJP A;  1YMP A;  2OV8 A;  4NQ0 A;  4XX5 A;  4OYS A;  5AN8 A;  4U0U A;  1HG5 A;  5G05 J;  5KNH D;  1E90 A;  4I17 A;  3HDX A;  1OWO A;  4EQF A;  5D66 A;  1N4R A;  5FZS A;  2X6K A;  4Q69 A;  2L0T B;  4HI9 A;  2IOS A;  4C48 B;  3VLE A;  4AY5 A;  3R7Q A;  4N3B A;  4Y6C A;  4ABN A;  1N0R A;  5A23 A;  4BX9 A;  4ATG A;  5BW8 C;  2LSU A;  1SA5 A;  4BWR A;  4P29 A;  1OWM A;  3CHS A;  5E75 A;  2IO2 C;  5G04 C;  5LP0 A;  3JCK C;  1PY1 A;  1S64 A;  1TN8 A;  4HRL A;  4M7C A;  3S7B A;  2WXQ A;  3CVQ A;  4L2L A;  5G2N A;  4TV3 A;  3ASH A;  3IHV A;  1FVH A;  3DBS A;  3V31 A;  3KEZ A;  2LO6 A;  4ANX A;  2XRY A;  3KAE A;  3FU3 A;  2WXO A;  4C9B B;  5FQ6 A;  2DWZ A;  5CCL A;  2H6H A;  4CRW A;  4CZ2 D;  4CGV A;  3UM0 A;  4KXK B;  5CMY A;  1KPS B;  3FUI A;  5BPP A;  3SFX A;  1B89 A;  1N0Q A;  4UI9 K;  4TXP A;  3GZS A;  1E96 B;  4V3I A;  3RRU A;  4F53 A;  1O5M A;  5G04 J;  2QZA A;  2WXI A;  1H0A A;  5CCM A;  5DIZ A;  3ZVV A;  2J07 A;  3CVP A;  3JQ1 A;  4HBD A;  5BV0 A;  1DVP A;  3L82 A;  4E6H A;  4MBG A;  5CHE E;  2VTB A;  3MEK A;  4OAU C;  4O1P A;  4C0E A;  3HHM A;  4JPS A;  1MX4 A;  1EDU A;  3VLF A;  3PDN A;  2PM6 A;  5EKQ D;  3Q5M A;  2JEK A;  4I6J A;  3WXX A;  3SF4 A;  4GTM A;  4BSX A;  2PZI A;  2GGF A;  1OCC E;  4JB8 P;  3Q9N C;  2WXL A;  4XIF A;  3GW4 A;  3B13 A;  4FUL A;  3T9K A;  1TN7 A;  3EHN A;  3P2B A;  2MOW A;  4APO A;  3C3Q A;  3HXB A;  4BER A;  4KBQ A;  4MKT A;  1W3B A;  3ZYQ A;  4UWK A;  2BF0 X;  1QYM A;  3HG0 D;  2X6F A;  2X6J A;  1IHB A;  1ELK A;  4ZFH A;  5CBN A;  2V5F A;  4HXI A;  2GRM A;  3CVY A;  4B8C B;  3FFL A;  3UIO C;  5AQB A;  2I2O A;  3TG5 A;  3L22 A;  4H7Y A;  1ELW A;  1GW6 A;  1HE8 A;  1JCR A;  3RK6 A;  2VSY A;  2QFC A;  4JHR A;  3SZ7 A;  2VTB B;  4J8E A;  4L9P A;  4FHK A;  4N5C A;  4A55 A;  3T5V A;  2OVF A;  2F8Y A;  4YDY A;  2CHZ A;  3Q15 A;  3RO3 A;  3MYV A;  3FHE A;  4WNE A;  3JYS A;  3I4G A;  4N39 A;  3APC A;  2RD0 A;  5C1D A;  3HIZ A;  1OWN A;  1ELR A;  4U07 A;  4I1A A;  5T8I A;  3I3N A;  4LEU A;  2R03 A;  4I6G A;  1UJK A;  1D8E A;  4HVB A;  4GZC A;  2KCL A;  4ILI A;  3D9O A;  3IV0 A;  2C0L A;  5ANL A;  2A4Z A;  4U8Y D;  4J0U A;  3JXJ A;  5HI7 A;  2IU1 A;  1PC2 A;  5JJT A;  2LUH A;  4HOS A;  3HXE A;  3Q78 A;  4L2Y A;  3Q79 A;  2XEE A;  1E7U A;  5CBO A;  2XCC A;  4JEU A;  5IY5 E;  4C0M A;  3L6A A;  3LY8 A;  4GA0 A;  4EPZ A;  4F1P A;  3AS5 A;  1TYQ G;  4Q96 A;  2QC9 A;  2QYJ A;  1MX2 A;  4Z68 A;  1U3D A;  3O4Z A;  4MS6 A;  4EZL A;  4EZK A;  2ETB A;  3ESK A;  3DEP A;  3Q49 B;  2E2E A;  3G2V A;  3G2W A;  2J49 A;  4I6E A;  3ENE A;  4Q94 A;  4UUC A;  4EBA A;  2HR2 A;  4BY6 A;  3FUJ A;  2BUG A;  1TNZ A;  4GYW A;  1JWG A;  3U66 A;  1SQM A;  1NP7 A;  2E0I A;  1ZBP A;  5AIJ A;  1NZN A;  3TWT A;  4QFV A;  2I6H A;  3Q7A A;  3AG1 E;  2LXL A;  2GRP B;  3TGO A;  4PS3 A;  1Z3X A;  2WPV A;  3UKR G;  3UKU G;  4ME2 A;  4RLY A;  4U63 A;  3ZXS A;  1S0P A;  1UN8 A;  2CFZ A;  5JA4 D;  2WXF A;  1HFA A;  3FTW A;  3DEO A;  3MCX A;  3LS8 A;  4O6F A;  5FQ7 A;  3FEY A;  3SFZ A;  4J8D A;  3E37 A;  4KVM A;  3MJW A;  1N9A A;  3DRA A;  4DPR A;  2A5U A;  3PS6 A;  2GRR B;  3TWX A;  2J08 A;  1N4P A;  3BEE A;  3RO2 A;  1N4S A;  3DWL G;  4I9C A;  4BFR A;  2Y1L E;  2P9I G;  4H7X A;  3QWV A;  1EF1 C;  1X5B A;  2Y4T A;  5BUZ A;  1JPL A;  1SZ9 A;  1UJJ A;  2LNI A;  3JXI A;  4G1T A;  4F1S A;  2M63 A;  3CHQ A;  3Q7F A;  4HS2 A;  5HS0 A;  3DSS A;  4B89 A;  4JEH A;  3DXM G;  4YDO A;  3B7S A;  2P9L G;  2AWI A;  1HXI A;  4UWL A;  5KJL A;  3UTM A;  4WAF A;  5T3R A;  2F8X K;  4JHK A;  4E85 A;  2BKG A;  3Q73 A;  5AJL A;  3D9L A;  2Y4U A;  3IKO B;  2WXG A;  4BEP A;  4WNF A;  2P9N G;  1OCR E;  3ASN E;  3CV0 A;  2IQC A;  1N94 A;  3CK8 A;  3PH0 C;  3D9P A;  5B1A E;  3B7U X;  1QNF A;  4I2Z A;  2EIN E;  5AQ9 A;  4LG6 A;  2OEV A;  1SVX A;  4UI9 J;  4ZHB A;  2AXV A;  4OVU A;  4DLO A;  3J5Q B;  2WQ6 A;  4HFG A;  3LJ3 A;  1OCO E;  4J8S A;  1IQR A;  3TWS A;  3CSF A;  4URK A;  3UI2 A;  2CHW A;  3LKU A;  3SBS A;  3APF A;  4RG6 A;  4PS7 A;  5AJD A;  3FTU A;  3NZU A;  4U7E B;  4HNA D;  1TN6 A;  3FUL A;  2OVB A;  3DSX A;  1JCQ A;  3R7R A;  4GTS A;  4K0R A;  2DYS E;  2XQ0 A;  5JMN D;  3F6Q A;  2HO1 A;  3FEX A;  2IY0 C;  4GTO A;  5EIL A;  2V5Q C;  1FCH A;  2YHE A;  4CCA A;  3ML9 A;  4X8Q A;  3PZ1 A;  1WM5 A;  5CED B;  4DJA A;  4FA6 A;  4N2S A;  2VGE A;  3NAW A;  1E8Y A;  4WND A;  5J08 A;  1N54 A;  4A1S A;  2ZIS A;  3ZPJ A;  2VGX A;  1TNB A;  1BU9 A;  2R05 A;  4DX6 D;  3ASF A;  1Q2Z A;  3FP3 A;  4ILG A;  4LUN U;  5EX3 A;  2DZO A;  2MRI A;  3SNX A;  2L0I A;  3NBN B;  1WY6 A;  1YYH A;  5LCW C;  5LOZ A;  2XPZ A;  2P9K G;  2KC7 A;  3EU9 A;  5C2Y A;  3CHP A;  4CGW A;  4TUM A;  3PUK A;  4U0Z A;  4JL0 A;  2WVI A;  1H6K A;  3CVL A;  2WXN A;  4A1G A;  2GRQ B;  3G2T A;  2F0Y A;  2GRN B;  2PQR A;  1ZU2 A;  3C72 A;  3MX3 A;  3DPD A;  3LCA A;  3ZN3 A;  3BG0 B;  4HI8 A;  4GZ3 A;  2CHX A;  2XGS A;  4HOT A;  3ZHE A;  4ANU A;  3EHR A;  4U8V D;  3K9I A;  4LNB A;  5CEC B;  2KAT A;  4G11 A;  4CDM A;  3UMV A;  4DI4 A;  3EJN A;  3BUA A;  2ILR A;  1LTX A;  1TNO A;  4GTR A;  2VGX B;  4DX5 D;  3CGH A;  2BKK B;  3HXD A;  5KBA A;  1H19 A;  4EHM A;  5LCW J;  5HQ8 A;  5JJ6 A;  2LAH A;  2KCK A;  3DSV A;  5E76 A;  3UT4 A;  1FPP A;  1N52 A;  1Z3Y A;  1Z6T A;  3ZEF A;  5HRY A;  2X38 A;  5FTP A;  5ANR A;  4LSZ E;  4U8H A;  1KZP A;  1BD8 A;  1K3Z D;  4XE0 A;  4AEZ C;  2EQX A;  3QC1 A;  3SHF A;  4L7T A;  3AAA C;  4B8A A;  3ASD A;  3FH8 A;  5ARF A;  1U3C A;  1JCS A;  3QOU A;  4FLH A;  1HO8 A;  4RG9 A;  3UXG A;  2IO3 C;  5A7D B;  3T8M A;  2V0P A;  3W9G A;  4IYP A;  3GZ2 A;  1ZB1 A;  2FUL A;  4U04 A;  3TWR A;  5CEA A;  3C5R A;  3PRZ A;  2AXU A;  3CVX A;  3L17 A;  4HQD A;  1V55 E;  2WXM A;  5AQ7 A;  2A5E A;  3ZHE B;  2P9P G;  4NAC A;  3WG7 E;  3KSQ A;  3SD5 A;  2P58 C;  4DX2 A;  5CMW A;  4G25 A;  4A3V A;  3CR3 A;  5ENQ D;  3AS4 A;  2EIL E;  4I43 A;  3ASG A;  3ABL E;  3ABM E;  2WMO A;  3L08 A;  1TJF A;  2DYR E;  5BXO A;  2ETC A;  1INZ A;  3FUD A;  3FY4 A;  2WQ7 A;  4WWN A;  3UUX A;  5KJM A;  3BQO A;  4JXT A;  1N11 A;  1Y8M A;  5DBK A;  4RVB A;  3LDZ A;  2WMN A;  3QNK A;  2RKK A;  5ENS D;  2B6C A;  4BTA A;  1NA3 A;  2L9B A;  1OT8 A;  3UT7 A;  3NOC D;  3R9M A;  3GYZ A;  4DK5 A;  4QQI A;  2IOL A;  2RFA A;  4F7A A;  4AY6 A;  2IF4 A;  2LAI A;  3U64 A;  2QYU A;  1K8K G;  3RIB A;  3UX4 A;  4UQZ A;  3TXM A;  2HE0 A;  4HB5 A;  4IN3 B;  3FWV A;  3SY2 A;  3FTX A;  3DPY A;  4A63 B;  1OUV A;  2XHE A;  5EID A;  2FF4 A;  3TG4 A;  3D9K A;  2LSV A;  1YCS B;  3RJV A;  5AAO A;  3V2O A;  4GTQ A;  2Y0B G;  4GCO A;  3R9A B;  4J7W A;  4HRN A;  2XZD G;  1O1R A;  4A3T A;  2FEZ A;  2WXJ A;  2FO1 E;  3UIP C;  2AVP A;  3T5X A;  1NA0 A;  3EUV A;  3NZS A;  5M72 A;  4FLB A;  2L6B A;  3LJN A;  2KZT A;  2P9U G;  3DSW A;  3UM2 A;  1QZ2 A;  5B1B E;  3CKB A;  3J5P A;  4MRU A;  2DZN A;  4LNG A;  2MHK A;  3L13 A;  5ARG A;  5JJ7 A;  5A6C A;  3TAX A;  3ZYL A;  3ESL A;  4G23 A;  3CVW A;  1RW2 A;  3I4R B;  3TL5 A;  2ZGD A;  4RQI A;  3LVR E;  3CQC B;  3HXC A;  2NSZ A;  4JHJ A;  3D9N A;  2H6G A;  1HS6 A;  2J4D A;  1A17 A;  3OAW A;  5FJY A;  4GTP A;  5ENN A;  4ILH B;  3AJI A;  3ASO E;  3RRM B;  3V30 A;  1P5Q A;  2VSN A;  3QDN A;  4CT4 A;  3CVV A;  4FHJ A;  3KS2 A;  4HRM B;  3SGH A;  1FT1 A;  4OAV B;  3EDT B;  2R59 A;  3ZW3 A;  2BTD A;  2XS1 A;  2ZXW E;  5EN5 D;  4GYO A;  3CIA A;  2KXP C;  4W9R A;  2CFU A;  1JUQ A;  2DBA A;  2QY7 A;  3CVU A;  2KM4 A;  2KZT B;  2EIK E;  4CEM A;  4R7L A;  4B0Z A;  3LY9 A;  1BLX B;  2XEN A;  3VTY A;  3QAR A;  2YIN A;  3X2Q E;  4F3V A;  4FJY A;  4UQX A;  1HZ4 A;  3TWV A;  3FU6 A;  3PZ4 A;  4AM9 A;  1Y6I A;  4GZ5 A;  3AU4 A;  2NXP A;  3ULY A;  1BPO A;  2X3M A;  2XGO A;  3UPV A;  4FAD A;  3QB2 A;  3ML8 A;  5CRV A;  2WQH A;  5FIN A;  1H2V C;  4GMR A;  4OVV A;  1VDY A;  4F6R D;  2IJG X;  3HVE A;  3L16 A;  5FZR A;  3SO8 A;  4FC8 A;  3RKV A;  3HYM B;  3VLD A;  4Y6W A;  3SBT B;  1IKN D;  4HLE A;  3B7B A;  4AXH A;  4U0S A;  5G05 C;  4HOR A;  3UIN C;  1H2U A;  4FU3 A;  1HX8 A;  3ONL A;  4YVO A;  1OWL A;  4DI3 A;  1QQE A;  3HXF A;  4GZ6 A;  4LNU D;  4J8Y A;  4GPK A;  3LY7 A;  3FTZ A;  3S7J A;  4N5Q A;  2EIJ E;  3Q47 B; 
#chains in the Genus database with same CATH homology
 4JA9 A;  4JHR A;  2L6J A;  3K9I A;  4I1O B;  3SZ7 A;  2KAT A;  2VTB B;  4G11 A;  4J8E A;  2RG8 A;  4FHK A;  3IEG A;  5FZQ A;  4BT8 A;  4CDM A;  3U3W A;  3PNL B;  4N5C A;  4A55 A;  3T5V A;  1SZA A;  3UMV A;  2OVF A;  2J09 A;  4DI4 A;  3EJN A;  2CHZ A;  3Q15 A;  2ILR A;  3RO3 A;  3MYV A;  2J4B A;  3FHE A;  3CK9 A;  3NQP A;  3CQG B;  4WNE A;  3JYS A;  3I4G A;  4N39 A;  3APC A;  4LRZ A;  3ULQ A;  2VGX B;  2RD0 A;  1WAO 1;  4ANV A;  3CGH A;  5C1D A;  4FJZ A;  3O48 A;  1H19 A;  5LCW J;  2IFU A;  3QKY A;  4GA1 A;  5HQ8 A;  2YHC A;  4RSY A;  5JJ6 A;  3HIZ A;  1OWN A;  2LAH A;  1ELR A;  4U07 A;  5KJN A;  2KCK A;  1KT0 A;  3UT4 A;  5E76 A;  2DCP A;  4I1A A;  2V8S E;  5T8I A;  3I3N A;  4LEU A;  4I6G A;  1N52 A;  1UJK A;  4XI0 A;  3MKQ A;  3KD7 A;  1Z3Y A;  4KMO A;  4XKC A;  4ACK A;  1Z6T A;  4HOU A;  3ZEF A;  2WB2 A;  4KYO B;  2X38 A;  3PEU B;  5FTP A;  3FUH A;  2YNQ A;  4LER A;  4WWO A;  3S7D A;  5ANR A;  4U8H A;  2HM8 A;  4HVB A;  4XE0 A;  4AEZ C;  4GZC A;  4I1M A;  4J8F A;  2EQX A;  2KCL A;  4ILI A;  3QC1 A;  3D9J A;  2PQN A;  2VYI A;  3D9O A;  3IV0 A;  3SHF A;  2C0L A;  5ANL A;  2VSX E;  2X6H A;  3FU5 A;  4L7T A;  3CKC A;  3ASD A;  4UI9 C;  4UWF A;  4B8A A;  5BNW A;  3FH8 A;  2A4Z A;  2R17 C;  5ARF A;  2X6I A;  4GMJ A;  4J0U A;  3PUJ A;  5FWQ A;  5HI7 A;  1U3C A;  2IU1 A;  5KCM A;  3HVE B;  3QOU A;  1PC2 A;  1XGW A;  4FLH A;  5FQ4 A;  5JJT A;  1HO8 A;  4RG9 A;  3PZD A;  3LXU X;  3AU5 A;  3QAQ A;  4HOS A;  5A7D B;  2CG3 A;  3C98 A;  2PM7 A;  4G2V A;  2V0P A;  3T8M A;  4IYP A;  2ION A;  2XRZ A;  3D9M A;  2UY1 B;  3ZFW A;  4GB9 A;  4L2Y A;  3ZIM A;  1LF8 A;  3LVQ E;  1TJC A;  1E7U A;  3GZ2 A;  4TRQ A;  2XCC A;  4JEU A;  4G24 A;  4C0M A;  3CHM A;  2FUL A;  3FTS A;  4U04 A;  3L6A A;  3LY8 A;  4GA0 A;  2XGM A;  4ANW A;  4EPZ A;  3D3M A;  3GZ1 A;  5FQ8 A;  3PRZ A;  2AXU A;  2CG2 A;  4N2Q A;  3CVX A;  3L17 A;  3AS5 A;  5KJK A;  2Y3A A;  3CEQ A;  3FTY A;  1E7V A;  2YQ8 A;  2WXM A;  3CHO A;  4BT9 A;  3IBE A;  3ZHE B;  4Q96 A;  3CST A;  1E8X A;  4NAC A;  1HG2 A;  3MV2 B;  3SD5 A;  3S2A A;  2P58 C;  2FI7 A;  5CMW A;  4G25 A;  1U3D A;  3O4Z A;  4MS6 A;  4A3V A;  4MLP A;  3CR3 A;  3ZGQ A;  4EZL A;  2UWJ G;  4WUY A;  4EZK A;  5AEN A;  4K03 A;  3ESK A;  3MKR A;  3AS4 A;  3Q49 B;  2I1J A;  2E2E A;  3PRE A;  3CLJ A;  1MQS A;  3G2V A;  4I43 A;  4UWG A;  3ASG A;  2VQ2 A;  3G2W A;  4KZ0 A;  2J49 A;  3N71 A;  4I6E A;  2WMO A;  3ZYK A;  3ENE A;  2I1K A;  3ZYM A;  2AW6 A;  3L08 A;  4Q94 A;  4FP7 A;  1UG3 A;  1XNF A;  4EBA A;  5BV1 A;  3B7T A;  2HR2 A;  3LPZ A;  4KZC A;  4BY6 A;  3FUJ A;  1TJF A;  2BUG A;  2DIW A;  2J9Q A;  1INZ A;  3FUD A;  4GYW A;  1JWG A;  3FY4 A;  3MKQ B;  3U66 A;  1SQM A;  2WQ7 A;  4WWN A;  1NP7 A;  3UUX A;  5KJM A;  4JXT A;  2E0I A;  2VSO E;  1ZBP A;  4EEC A;  1OWP A;  1Y8M A;  2PL2 A;  1NZN A;  3EIJ A;  4GML A;  4KVO A;  4RVB A;  5DBK A;  3U9W A;  4QFV A;  4AJW A;  3LDZ A;  2I6H A;  3QJZ A;  2WMN A;  1JWF A;  3QNK A;  3CHR A;  4XZ4 A;  4CT0 A;  1EYH A;  5EDS A;  4GCN A;  4AP2 A;  4HOQ A;  3TGO A;  4PS3 A;  2Q7F A;  3PE4 A;  3FU0 A;  1Z3X A;  1IQU A;  1UW4 B;  2WPV A;  3B7R L;  3VTX A;  4IRU A;  2OND A;  3OXF A;  1KLX A;  4M3O A;  3OTN A;  4BTA A;  4PH4 B;  4ME2 A;  1NA3 A;  2L9B A;  4PDX A;  3UT7 A;  4I9E A;  3TXN A;  4U63 A;  5BT1 A;  3ZXS A;  1S0P A;  2FO7 A;  2VJ8 A;  1UN8 A;  2CFZ A;  2WXK A;  4WNG A;  3GYZ A;  4UQY A;  2AXZ A;  2GW1 A;  4DK5 A;  5D0O D;  2WXF A;  1HFA A;  3FTW A;  4JA7 A;  3URZ A;  3MCX A;  3LS8 A;  4O6F A;  5FQ7 A;  2IOL A;  3FEY A;  4J6I A;  5G55 A;  2GRL A;  2HYZ A;  3JQ0 A;  4J8D A;  3SFZ A;  4AOF A;  4F7A A;  2OOE A;  4KVM A;  3MJW A;  1FVF A;  3MZL B;  4GU5 A;  3LEW A;  4IUL A;  4AY6 A;  2C0M A;  4DPR A;  2A5U A;  3APD A;  1KT1 A;  5D0Q D;  4APF A;  3G2U A;  2IF4 A;  3PS6 A;  4YND A;  2LAI A;  4GAA A;  3U64 A;  3PE3 A;  4AIF A;  2J08 A;  3FUK A;  4CDR A;  3MGB A;  1IYG A;  4L23 A;  3MA5 A;  3RIB A;  3UX4 A;  3TJP A;  4NQ0 A;  2OV8 A;  3BEE A;  4XX5 A;  3RO2 A;  4LCT A;  4UQZ A;  4WWP A;  4OYS A;  3TXM A;  4I9C A;  4U0U A;  1HG5 A;  5G05 J;  4BFR A;  1UN9 A;  4H7X A;  3QWV A;  1EF1 C;  1X5B A;  2Y4T A;  4BTB A;  5BUZ A;  1JPL A;  1SZ9 A;  1E90 A;  1UJJ A;  2LNI A;  4I17 A;  4IN3 B;  3JUI A;  4G1T A;  3FWV A;  3L54 A;  3QK0 A;  4F1S A;  2M63 A;  3HDX A;  3CHQ A;  3FTX A;  4N3C A;  1OWO A;  4EQF A;  3OXG A;  4EBA G;  1OUV A;  2XHE A;  4G26 A;  5FZS A;  4HS2 A;  2FF4 A;  3TG4 A;  4B89 A;  3D9I A;  2X6K A;  3D9K A;  4JEH A;  4KT6 B;  3RU0 A;  3CK7 A;  4Q69 A;  2LSV A;  3B7S A;  2L0T B;  3RJV A;  2IOS A;  2AWI A;  1HXI A;  3VLE A;  4GCO A;  4JC8 A;  3R9A B;  3R7Q A;  4AY5 A;  4N3B A;  4UWL A;  5KJL A;  4NUR A;  4GA2 A;  4NRH B;  4Y6C A;  4WAF A;  5T3R A;  3SI5 A;  1YA0 A;  4ACL A;  2JLB A;  4JHK A;  4ABN A;  5A23 A;  3FUM A;  4BX9 A;  4E85 A;  3QWP A;  4A3T A;  2FEZ A;  3PNT B;  2WXJ A;  3FUN A;  5AJL A;  3Q4A B;  5BW8 C;  2LSU A;  4ATG A;  2AVP A;  4BWR A;  3D9L A;  2Y4U A;  4P29 A;  1OWM A;  3CHS A;  3IKO B;  2WXG A;  3BG1 B;  5E75 A;  3T5X A;  3ZRH A;  4WNF A;  2R5S A;  1NA0 A;  5G04 C;  2XCB A;  3NZS A;  5M72 A;  4UWH A;  3UT8 A;  4FLB A;  3CV0 A;  1E8W A;  2IQC A;  5LP0 A;  3JCK C;  2KZT A;  1QZ2 A;  3CK8 A;  1MHQ A;  5JHB A;  3PH0 C;  4PS8 A;  3D9P A;  3B7U X;  1PAQ A;  1PY1 A;  1QNF A;  3CKB A;  4JW1 A;  5J90 A;  4I2Z A;  4MRU A;  3S7B A;  2WXQ A;  2MHK A;  3CVQ A;  3L13 A;  4L2L A;  5ARG A;  5G2N A;  5A6C A;  5FT9 A;  3TAX A;  5JJ7 A;  3FH7 A;  3ZYL A;  3CVY A;  3I5P A;  4D10 C;  3ESL A;  4UI9 J;  4TV3 A;  3ASH A;  4G23 A;  4YVQ C;  3QWW A;  3CVW A;  2FBN A;  1FVH A;  3DBS A;  2AXV A;  3IHV A;  4OVU A;  3I4R B;  3KEZ A;  3G2S A;  2LO6 A;  4DLO A;  4ANX A;  3TL5 A;  2WQ6 A;  2XRY A;  4HFG A;  3LVR E;  3LJ3 A;  3CQC B;  4J8S A;  1IQR A;  3KAE A;  2NSZ A;  3FU3 A;  4JHJ A;  3U4T A;  3D9N A;  2WXO A;  5T4Y A;  3CSF A;  4C9B B;  4URK A;  5LX8 A;  2I9C A;  1HS6 A;  2J4D A;  1A17 A;  2CHW A;  1E8Z A;  3LKU A;  3OAW A;  5FJY A;  5FQ6 A;  3SBS A;  5CCL A;  4CRW A;  3APF A;  4RG6 A;  4PS7 A;  5AJD A;  3FTU A;  3NZU A;  4GZD A;  3FUL A;  5ENN A;  4ILH B;  2OVB A;  3IHY A;  3NF1 A;  4CGV A;  4BX8 A;  3R7R A;  2KCV A;  4KXK B;  4K0R A;  3RRM B;  2XQ0 A;  1H2T C;  2HO1 A;  1P5Q A;  2VSN A;  3QDN A;  3FEX A;  5CMY A;  3FUI A;  5BPP A;  1B89 A;  4UI9 K;  3GZS A;  4CT4 A;  3CVV A;  1E96 B;  4V3I A;  3MV3 B;  4FHJ A;  1FCH A;  3RRU A;  3KS2 A;  2YHE A;  3SGH A;  4F53 A;  4CCA A;  3ML9 A;  4DLQ A;  5G04 J;  3UQ3 A;  4TUU A;  3EDT B;  2WXI A;  2XEV A;  2R59 A;  3ZW3 A;  1WM5 A;  1H0A A;  5CCM A;  5DIZ A;  2BTD A;  3ZVV A;  1HF8 A;  4DJA A;  1DNP A;  2J07 A;  2WM9 A;  3CVP A;  3JQ1 A;  5EX0 A;  4FA6 A;  3E4B A;  1TEZ A;  4GYO A;  5LFA A;  5BV0 A;  2XPY A;  3CIA A;  1DVP A;  2WXP A;  4N2S A;  4W9R A;  1IHG A;  4E6H A;  2CFU A;  5CHE E;  1E8Y A;  2VTB A;  3EIQ C;  1JUQ A;  3MEK A;  4CDN A;  2DBA A;  2QY7 A;  3CVU A;  2KM4 A;  4N3A A;  2KZT B;  4C0E A;  4WND A;  5J08 A;  3P1U A;  3PEV B;  1N54 A;  2VGY A;  4AV7 A;  3HHM A;  4CEM A;  4R7L A;  1EPU A;  4A1S A;  4B0Z A;  3LY9 A;  4JPS A;  3ZPJ A;  2NC9 A;  2WXH A;  3S7F A;  1EDU A;  3VLF A;  2VGX A;  3PDN A;  4EZJ A;  3ASF A;  3VTY A;  3QAR A;  2YIN A;  2PM6 A;  3CVN A;  3FP3 A;  5EKQ D;  4F3V A;  4ILG A;  4XI9 A;  4FJY A;  4UQX A;  3Q5M A;  2JEK A;  4I6J A;  1HZ4 A;  3WXX A;  3FU6 A;  4LUN U;  5EX3 A;  4AM9 A;  2MRI A;  3SNX A;  4XKB A;  2L0I A;  1Y6I A;  4GZ5 A;  3SF4 A;  1WY6 A;  3AU4 A;  1HH8 A;  2NXP A;  2PZI A;  2WXR A;  3EHM A;  2GGF A;  4BSX A;  4AVX A;  1BPO A;  5LCW C;  2X3M A;  2XGO A;  5LOZ A;  3UPV A;  2XPZ A;  3FUF A;  2WXL A;  4FAD A;  3QB2 A;  3ML8 A;  4XIF A;  3GW4 A;  3B13 A;  3FUE A;  2WQH A;  4FUL A;  2KC7 A;  5AIJ A;  3EHN A;  3P2B A;  3RRN B;  1L5J A;  3AS8 A;  4L1B A;  5C2Y A;  2MOW A;  3CHP A;  3LYA A;  4CGW A;  4JVS A;  4APO A;  2XPI A;  5AYW D;  1H2V C;  4OVV A;  4KBQ A;  3PUK A;  4MKT A;  1W3B A;  1VDY A;  4I2W A;  2BF0 X;  2ZU6 B;  2IJG X;  4U0Z A;  4UWK A;  3HVE A;  3L16 A;  3ZYQ A;  5FZR A;  3OXL A;  4JL0 A;  2WVI A;  2X6F A;  2X6J A;  3FTV A;  1H6K A;  3CVL A;  4FC8 A;  3RKV A;  2WXN A;  3HYM B;  3VLD A;  4A1G A;  4PUC A;  1HU3 A;  4Y6W A;  1ELK A;  3SBT B;  4HLE A;  2UY1 A;  3G2T A;  4AXH A;  2V5F A;  4U0S A;  5G05 C;  4HOR A;  1H2U A;  4FU3 A;  4HXI A;  4GYY A;  2PQR A;  1HX8 A;  3ONL A;  1ZU2 A;  2GRM A;  1OWL A;  3FH5 A;  3PVL A;  3FFL A;  4YVO A;  4B94 A;  4B8C B;  1QQE A;  2I2O A;  4DI3 A;  5JHA A;  2C2L A;  3TG5 A;  3MX3 A;  3DPD A;  3L22 A;  3LCA A;  4H7Y A;  3ZN3 A;  3BG0 B;  4GZ6 A;  3ONK A;  4JZY A;  1ELW A;  4GZ3 A;  1GW6 A;  1HE8 A;  2CHX A;  3FDH A;  4GPK A;  3LY7 A;  2XGS A;  4HOT A;  2V4L A;  3FTZ A;  3S7J A;  3RK6 A;  2VSY A;  3ZHE A;  3Q47 B;  4ANU A;  2QFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...