2FBNA

Plasmodium falciparum putative fk506-binding protein pfl2275c, c-terminal tpr-containing domain
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
153
structure length
153
Chain Sequence
AKKSIYDYTDEEKVQSAFDIKEEGNEFFKKNEINEAIVKYKEALDFFIHTEEWDDQILLDKKKNIEISCNLNLATCYNKNKDYPKAIDHASKVLKIDKNNVKALYKLGVANMYFGFLEEAKENLYKAASLNPNNLDIRNSYELCVNKLKEARK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic structure of the tetratricopeptide repeat domain of Plasmodium falciparum FKBP35 and its molecular interaction with Hsp90 C-terminal pentapeptide.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Structural genomics, unknown function
molecule keywords 70 kDa peptidylprolyl isomerase, putative
total genus 64
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2fbnA00
3FFLA 2XGOA 4G1TA 3LY9A 2XCBA 1XNFA 4N3CA 4Y6WA 4YNDA 5FZRA 3S7JA 5KJLA 3RJVA 2XCCA 2VGYA 1Y8MA 1ELWA 2UWJG 3OXGA 5HI7A 2XGMA 5LCWC 3ASDA 4GCOA 5FT9A 3AS8A 5G05C 2NC9A 3LY8A 3MA5A 3PDNA 2LSUA 2AVPA 3KD7A 3Q47B 3Q4AB 4IN3B 5G04C 4I17A 3S7BA 3AS5A 3ZPJA 4UI9C 3CKCA 3UPVA 1NZNA 5FZSA 1KT0A 4G26A 4JA7A 2VYIA 2LSVA 2Y4UA 3CEQA 2FEZA 5JJ6A 4G24A 3QWPA 4HOSA 3PE4A 4GCNA 4N5CA 2I6HA 5DIZA 5JJTA 5CCLA 1QQEA 3Q49B 4NQ0A 5EX3A 4Y6CA 3TGOA 4U0SA 2UY1B 3CK9A 2PQNA 3ASHA 4I1AA 4I9CA 3MEKA 4WUYA 4YVOA 4GPKA 1NA0A 4UQZA 3LCAA 3GYZA 3AS4A 2WQHA 4G25A 2PZIA 4RG6A 4CDRA 4KYOB 1A17A 2KCLA 2IFUA 2KATA 3NF1A 3QOUA 4GA0A 3RO2A 3TG4A 2XGSA 3TAXA 4AM9A 3MV3B 4XIFA 1PC2A 4G23A 3UQ3A 4BWRA 3CKBA 3KS2A 4XI0A 3IEGA 2KCVA 4RG9A 4H7XA 3U4TA 4I2WA 2BUGA 2FF4A 3MV2B 4G2VA 3QKYA 2VGXA 4N3BA 2L6JA 4U0ZA 4F3VA 3ZN3A 4KBQA 3QWVA 1B89A 3LPZA 4O6FA 3SF4A 2Q7FA 2J9QA 3URZA 1IHGA 4I2ZA 4LEUA 1ZU2A 2WPVA 1IYGA 4J8EA 2YQ8A 2V5FA 2VQ2A 4JHRA 2LNIA 5AYWD 4A1SA 1KT1A 4U04A 4UI9J 4YVQC 1ZBPA 3E4BA 3OXLA 3OXFA 3QDNA 4GYYA 5FJYA 3RO3A 3SZ7A 5ARFA 1E96B 5KJNA 2C0LA 4UQXA 3LKUA 3FWVA 4JA9A 4J8FA 5BNWA 3CV0A 2DBAA 2XPIA 4GYOA 1QZ2A 1OUVA 4GA2A 3S7DA 4UI9K 2FI7A 3VTXA 3ZGQA 4XI9A 5DBKA 4BT9A 3ZFWA 5G04J 2PQRA 2FBNA 2HYZA 2R5SA 3LYAA 3VTYA 1WM5A 5FTPA 4WNGA 3UUXA 1HH8A 4ME2A 3ZHEA 4APOA 5JJ7A 1NA3A 2MHKA 3O48A 4UQYA 2HR2A 3ZHEB 4WNEA 4BTAA 5ARGA 4ABNA 3EDTB 2KC7A 5A7DB 5M72A 5LCWJ 5HQ8A 3GZ2A 5CCMA 2IF4A 4WNFA 2QFCA 2Y4TA 3CVLA 3MKRA 4W9RA 2PL2A 5D0OD 5BW8C 3RKVA 3S7FA 2JLBA 3BEEA 2E2EA 2VSNA 3FP3A 4CGWA 5A6CA 3GW4A 5KJKA 1P5QA 4EQFA 5FZQA 4I9EA 4HOUA 3TG5A 1HZ4A 3U3WA 3GZ1A 4GYWA 2GW1A 2FO7A 4AY5A 2HO1A 3N71A 4GZ3A 4KXKB 2C2LA 1WAO1 3ASGA 3WXXA 4GA1A 3QWWA 5G05J 2OOEA 4HOQA 4J0UA 4CGVA 4GZ5A 3RIBA 4N2QA 1FCHA 4JL0A 3R9AB 1KLXA 3HYMB 2P58C 1ELRA 2UY1A 3CVPA 2VGXB 2VSYA 4WNDA 4J8DA 5EKQD 3RU0A 4BTBA 3K9IA 5C1DA 5KJMA 4AY6A 3ESKA 3CK8A 3CK7A 3KAEA 2XEVA 3Q15A 5CHEE 4BT8A 5BT1A 4HOTA 1YA0A 3CVQA 3PE3A 4AIFA 4B94A 2KCKA 2ONDA 4GZ6A 4NRHB 4N3AA 1HXIA 4U0UA 2C0MA 5D0QD 4HORA 3LY7A 3CVNA 4N39A 3ULQA 4U07A 3JYSA 4H7YA 1TJCA 3Q5MA 3ASFA 5EX0A 4N2SA 1W3BA 2YHCA
chains in the Genus database with same CATH superfamily
5FZRA 5B3SE 4CT4A 3AS8A 1N11A 3PDNA 5G04C 5AQ7A 3CHOA 3ULYA 2ZU6B 2LSVA 5JJ6A 1O1TA 3AJIA 3LVQE 2AXVA 1IKND 1HX8A 2VSXE 5EX3A 4HI9A 4U0SA 2PZIA 3JCKC 2KATA 3IV0A 4G23A 4CZ2D 3MJWA 3DPDA 1E8WA 3BG0B 4Q69A 4GB9A 2FF4A 4G2VA 4K0RA 4EPZA 1JCSA 3L16A 4I2ZA 3C5RA 1PAQA 1UJJA 5D66A 3RK6A 3QB2A 4A3TA 3D9HA 4RLYA 2VGEA 5AIJA 5EDSA 5JMND 4K03A 4AP2A 2CFUA 3UT4A 4C0EA 4AY5A 1V55E 1N95A 1WAO1 5EYPF 4FP7A 4CGVA 2BF0X 2V4LA 3CHPA 3RIBA 2GRMA 1BLXB 5KJMA 1TYQG 3CK7A 2ETCA 3CVQA 4LSZE 4TUUA 1OT8A 1HG2A 2X6FA 4YNDA 4A63B 3QAQA 2UWJG 4GPMA 3FHEA 5BPPA 1OCRE 1K3ZD 5JA4D 1N9AA 1SZ9A 5HRYA 3ZPJA 3S7BA 5FZSA 1S0PA 4DLQA 3ZXPA 3DRAA 2L9BA 2HE0A 2I6HA 4FC8A 1GW6A 1QQEA 3E37A 4DUIA 3DSSA 4DX6D 4I43A 3CVUA 4GMLA 2GRRB 4P29A 4AM9A 3UM1A 2H6GA 3CKBA 1VDYA 4E6HA 2BKGA 1HFAA 4O6FA 1TNZA 2A5UA 4YDEA 3HG0D 1N54A 5J90A 2YINA 4HLLA 2X6KA 4ILHB 4FU3A 3HRAA 4GTVA 4MS6A 1QZ2A 3UT8A 1TNBA 4L2YA 4Z68A 2R59A 4L1BA 2CG2A 3UUXA 1X81A 4APOA 1NA3A 5AQ9A 2F8XK 5M72A 5JHBA 4WNFA 4HRNA 2VSNA 4DJAA 4I9EA 2RG8A 3N71A 2EIME 3EIQC 3Q7AA 4GMRA 4GZ5A 5E76A 3TWTA 1ELRA 3RU0A 2WXIA 3SFZA 3KSQA 4LUNU 1O1RA 4KZCA 3FEYA 3G2SA 2DZNA 4DK5A 3T5XA 5AN8A 3ZRHA 4ATZD 3FUJA 4ACKA 1S63A 5HI7A 2IOSA 3UKUG 3J5PA 4U63A 3ML8A 3FH7A 3FUIA 4B93B 4BERA 1KT0A 2V4HC 2ZISA 1N0RA 2R03A 3J5QB 4N5CA 2WB2A 4CT0A 5DIZA 3IKOB 5EILA 3KEAA 1BPOA 4CDRA 2ZGDA 5LP0A 3BU8A 1OY3D 2FULA 4ABNA 2Q7FA 1IYGA 4I6GA 2V5FA 3DWLG 1H19A 2BKKB 3BQOA 5CRVA 3FEXA 3VTYA 5IY5E 4L23A 3T9KA 2PNNA 5KBAA 4TXRA 4EZLA 4C0MA 5AAOA 1X5BA 2L0IA 2XPZA 5AQAA 2EINE 1N52A 1YCSB 4BESA 1LF8A 3C3QA 2WXFA 2RKKA 2XEVA 1BI7B 5BT1A 2P9PG 2FO1E 1BU9A 2DWZA 3IHVA 4JZYA 3C3RA 1UG3A 3S7JA 3LY9A 1E8ZA 1UN8A 1MQSA 2EILE 3V2OA 5CBOA 4V3IA 2V5QC 4IULA 4HOSA 3UPVA 1OCZE 5JHAA 2FEZA 2OCCE 3NB2A 4JEHA 4JXTA 4G8LA 1QNFA 5LFAA 3QJZA 3B95A 3TXMA 2R02A 3ZYQA 3PRZA 3DPYA 2H6FA 5E75A 5BXUA 5CMYA 4BX9A 2IJGX 1KT1A 3TXNA 4DX2A 5ENOD 3Q7FA 2DBAA 2XPIA 3MYVA 4GYOA 3AU4A 3ZGQA 2DYSE 5AJLA 5DBKA 3ASNE 2HYZA 2R5SA 2WMOA 4ANXA 4O1OA 4DLOA 5ANLA 3FTUA 4ATGA 4HNAD 3Q9UC 5KNHD 3O4ZA 1RW2A 2C2LA 1DC2A 1WDYA 3CK8A 2J49A 3FTSA 5D0QD 2J4BA 4H7YA 2WMNA 3CHMA 4XE0A 3ZW3A 3V2XA 1S64A 3TWXA 3PZ1A 2LXLA 4I17A 2PM7A 1HE8A 4JHJA 3U9WA 3TGOA 3EU5A 5BV0A 2M63A 3CK9A 4FLBA 4WUYA 3MEKA 1KZOA 1NA0A 1N4SA 3GYZA 4Q96A 3MV3B 4N5QA 1N4QA 5CMWA 4K5CA 2HM8A 2J07A 4FHKA 3LPZA 2WM9A 4KT6B 3OXLA 4J8YA 2EIJE 1KPSB 1HG5A 2P9NG 1FVFA 4KZ0A 1SVXA 3NZSA 3ESLA 4L2LA 3FUHA 3NOCD 5ANRA 2ETAA 1H6OA 3ASOE 3CVLA 4ZFHA 1E7VA 4HOUA 4GZDA 1U2VG 2HO1A 4FULA 2H6IA 2IU1A 3QWWA 4ILIA 4I1OB 4HB5A 3HYMB 3ZU7B 4TUMA 3JUIA 4BT8A 4HOTA 3L17A 3E32A 3TWUA 4N3AA 2XENA 2VTBB 4U07A 1RZ4A 2XQ0A 2KZTB 5EX0A 2L6BA 3PZ3A 3HHMA 4JC8A 3OXGA 3KEZA 2NSZA 5ENTD 1TJFA 3Q4AB 1WG0A 4NURA 2P9LG 4GTQA 4DPRA 4G24A 3CQCB 3TWVA 2ILRA 5ENSD 4EECA 5FWQA 3W9FA 4I1AA 4DRXE 2YHEA 3LVRE 3FUDA 1AP7A 3CHRA 2F0YA 1HU3A 4XIFA 1WY6A 4FADA 2VGXA 4KMOA 5FQ6A 4IYPA 2MYOA 3SF4A 2LAHA 3LXUX 1NI1A 3SGHA 3RO3A 2X6JA 5KJNA 2R17C 4UWFA 4HBDA 4F7AA 3ZHEA 4F1SA 3HDXA 2DVWA 2WXPA 3CSFA 4WNEA 3ULEG 4GMJA 3D9JA 3E33A 1Q2ZA 3UM0A 3B7RL 5BW8C 3UT7A 4J6IA 2QC9A 3HXCA 3DEOA 1HZ4A 4GYWA 3G2WA 4WWOA 5KCMA 4GAAA 4U95D 3TJPA 4HOQA 4URKA 2VGXB 5EKQD 4FLHA 4R7LA 5CECB 1U3DA 1TR4A 2XCBA 2CFZA 1N4RA 4Q94A 1Y8MA 3ZYKA 2NC9A 1V54E 4OAUC 1DNPA 4OVVA 4M7CA 4HXIA 4JA7A 3QWPA 4JPSA 1U3CA 1NP7A 4LNBA 3ZNGA 4UQZA 1XGWA 3DSWA 4AEZC 3ABME 4XI0A 3U4TA 4H7XA 4I2WA 3MV2B 2V8SE 4XKCA 1B89A 3WXXA 1NL4A 3DXKG 1ZB1A 3L22A 5FQ4A 2VQ2A 1HS6A 2I9CA 2F37A 4GA2A 1OUVA 3S7DA 4UI9K 2FI7A 2FBNA 2XEHA 1IQRA 1WM5A 3JQ1A 3CLJA 1E7UA 5AJDA 2LO6A 1SA5A 4NACA 2EQXA 3FP3A 2IO3C 4C48B 4CDMA 3UTMA 2GW1A 4AV7A 3P1UA 4QFVA 2OOEA 3ML9A 2QYUA 1FCHA 2JABA 1KLXA 2IEJA 2R05A 3EHQA 4XX5A 1INZA 3U66A 3B13A 4N3CA 3FUNA 3AG4E 2WXQA 4JEUA 3OTNA 3TWWA 2IY0C 4GCOA 5FT9A 4GU5A 2L0TB 5AQBA 3RRNB 3W9GA 2DCPA 2P9IG 4LG6A 3Q75A 2CHXA 2XZTG 4GCNA 3FTVA 4YDYA 3UMVA 4A3VA 3Q49B 4NQ0A 3Q79A 2PQNA 3CIAA 3QC1A 1Y6IA 3NAWA 2WQHA 3FULA 2IFUA 3RO2A 5ENNA 1BD8A 2WXMA 4UWKA 4U0ZA 2L6JA 4MRUA 3VLFA 2J9QA 3NBNB 4C9BB 4J8EA 4YDWA 1UOHA 2LNIA 3UM3A 2GRQB 4UUCA 5FJYA 3FH8A 1E96B 2P9KG 4XKBA 4JA9A 5HS0A 4I1MA 2CG3A 1O1SA 2HR2A 3ZKJA 3ZXSA 3I4GA 5D0OD 4MKTA 1JWFA 3BEEA 3F6QA 1SQMA 3GZ1A 4HRMB 5FQ8A 4GZ3A 4ANWA 4HQDA 4PDXA 4GA1A 2WXLA 4J0UA 4BEPA 4AOFA 4ZHBA 4DI3A 2VSYA 4J8DA 2GRNB 4UWHA 3PE3A 3IXEA 3R9MA 2ONDA 1K8KG 3T8KA 4N2SA 2XGOA 2ZIRA 1MX6A 5KJLA 1H0AA 5ENQD 4O1PA 5LCWC 4XEIG 3EUVA 3MA5A 4DX1A 4IN3B 3FY4A 5BXOA 3CKCA 3TWSA 2J4DA 1N94A 3ASHA 2LAIA 3FH5A 4GTRA 2WQ6A 3LCAA 5C2YA 3NF1A 2OV8A 2XGSA 4APFA 2GRPB 2P9UG 3T5VA 5B1BE 2WVIA 1TNUA 2I1KA 5LX8A 2WXJA 4A1SA 1N0QA 4UI9J 3QDNA 3ZUVB 3ONLA 4BY6A 2OEWA 2C0LA 4J8FA 3SBTB 2MOWA 4XI9A 2XRZA 3FU6A 1KZPA 3O48A 3CHQA 4BTAA 4F53A 4BSXA 5CCMA 3AG2E 2QFCA 3MKRA 4G8KA 3Q9NC 4CGWA 5A6CA 4EQFA 4HRLA 5FZQA 3LS8A 3QARA 2B6CA 4OYSA 5EN5D 4N2QA 4MBGA 2UY1A 3L9TA 4BTBA 3ESKA 2QYJA 4GZ6A 3VLEA 3JUEA 1W3BA 2YHCA 2XS8A 1NFIE 4U8YD 4AJWA 3RJVA 2IONA 3FTWA 4ILGA 1TN7A 2P2CP 4FJZA 1H6KA 3L6AA 4JD2G 2AW6A 3APFA 3KD7A 4LNUD 3RRUA 1MYOA 3PE4A 4U7EB 4B8CB 5H7PA 1QYMA 2WXNA 1MJ0A 1JUQA 2KBXA 4GPKA 3PUKA 4GTOA 4RG6A 2WXOA 2AJAA 2X3MA 3ABKE 4JVSA 1SZAA 3Q73A 2Y3AA 1IHGA 4L7TA 4JHRA 3UXGA 2VTBA 4PS7A 3FWVA 4J8SA 3I3NA 3HXFA 4GTSA 4EHMA 5A23A 1D8DA 5FTPA 3UIPC 1Z5SC 2PL2A 1BI8B 4UWLA 3FUEA 2ZXWE 3TG5A 4J7WA 4WWPA 3PEVB 3ABLE 1G3NB 2WXRA 2PM6A 1FT2A 5J08A 5T3RA 4WNDA 3DSXA 3PREA 5C1DA 4AY6A 3SHFA 4AIFA 4WWNA 4U96D 3ULQA 3ONKA 3L54A 4Y6WA 3L13A 2AXUA 3PH0C 1ELWA 1MZCA 1A5EA 3RRMB 3LDZA 4EZKA 3IBEA 2JEKA 3FU5A 3ISMC 3I5PA 1TEZA 2KXPC 4TRQA 3CGHA 3CVVA 1UW4B 3UX4A 1TN6A 4QQIA 4GTTA 2ZGGA 2NYJA 1A17A 1IQUA 3UQ3A 2I2OA 5T8IA 3DSTA 3KS2A 3PUJA 2VSOE 4M3OA 2GROB 2X6IA 3B7TA 3TL5A 5BV1A 3B7SA 4JHKA 2E0IA 3UKRG 4DX5D 3ZFWA 1EPUA 3HXDA 4HORA 5JJ7A 2XHEA 5EYLA 1DVPA 5LCWJ 5HKPA 2H6HA 4ANVA 5CERB 3FUFA 3UINC 3JQ0A 4F1PA 4ACLA 3G2VA 3MGBA 4KXKB 1OWNA 3X2QE 2Y69E 5D2MC 2ETBA 5BUZA 4OVUA 3PEUB 1FPPA 3APCA 1YA0A 1JCQA 2WQ7A 3AG3E 1HO8A 4HLEA 3EU9A 3JYSA 3Q5MA 4EBAG 3U64A 4LRZA 4XZ4A 3HIZA 3DSVA 3P2BA 3CR3A 2VGYA 2I1JA 5CEAA 3ASDA 3PS6A 4TV3A 5G05C 3UI2A 3R7QA 3Q47B 2KM4A 3AS5A 3HXEA 1OWOA 3WG7E 4G26A 1DCQA 3SFXA 2DYRE 1LD8A 2VJ8A 4I9CA 3EHMA 2KCLA 2OVBA 4CRWA 1O5MA 4CEMA 1PC2A 3D3MA 4HS2A 2LXMA 3SFYA 3IEGA 2KCVA 1OXJA 4UWGA 4N3BA 2CHZA 4F3VA 3APDA 4U8VD 1LD7A 3FUKA 3D9NA 4LEUA 1ZU2A 3V79K 3MKQB 3T8MA 3ZEFA 4B8AA 3KSLA 2YQ8A 5AYWD 1H2TC 4GYYA 1FVHA 1YMPA 1K1AA 4RVBA 2BTDA 3PNTB 3MCXA 3CV0A 3D9MA 3RSEG 1HF8A 5FINA 3FU0A 2XZDG 3LYAA 4D10C 3L08A 2IQCA 5ARGA 3LEWA 3EDTB 2J08A 4HVBA 3MKQA 2Y4TA 3S7FA 3D9IA 4E85A 3ASGA 3HXBA 4O60A 5AENA 1TNYA 1EYHA 3S2AA 3K9IA 5G55A 3Q15A 2XS1A 4K5AB 4CCAA 4B94A 4NRHB 4TXQA 2A5EA 1LTXA 4BX8A 3C98A 1UN9A 2XCCA 3AAAC 2XGMA 3SD5A 2YNQA 3LY8A 2LSUA 2AVPA 3PNLB 1UJKA 3CQGB 4G11A 5CBNA 2R2LA 4KVMA 4GTPA 3E34A 4LCTA 4DI4A 1IHBA 3AS4A 4WAFA 3QOUA 4GA0A 4PH4B 3OAWA 1FT1A 4HFGA 3FUMA 3ZN3A 1QBQA 3CVYA 2WPVA 4RSYA 3TWRA 2XEEA 4BFRA 3C72A 1N4PA 3LKUA 1Z3YA 1H2UA 1E90A 3MZLB 5G2NA 2AXZA 1HH8A 5BNWA 4UQYA 5KNGA 4FJYA 2IF4A 1IXVA 1YYHA 4RQIA 4W9RA 3RKVA 4A1GA 3ZYLA 4GZCA 4B89A 3EHRA 4I6EA 3CVWA 3FDHA 4F6RD 3I4RB 3ZIMA 2RD0A 1H6PA 5CEDB 3FTZA 1PY1A 3LY7A 1MX2A 1TNOA 3ENEA 3ASFA 2WXHA 5CRUA 1MHQA 4G1TA 2P9SG 1AWCB 3HVEB 3V30A 1SW6A 2AWIA 2LUHA 4KVOA 3TWQA 4PUCA 4U8HA 4UI9C 4JB8P 1NZNA 3PVLA 3CVXA 3DXMG 2BEDA 2J09A 3C3OA 3NOGD 3TAXA 3V31A 3UM2A 4GTMA 3QKYA 2V0PA 4AVXA 1L5JA 4ANUA 2B0OE 5ENRD 5T4YA 4K5BA 1K1BA 1ZBPA 3OXFA 4CYMD 4UQXA 3G2UA 3VTXA 5G04J 4ME2A 5EIBE 3VLDA 5B1AE 4MLPA 4LNGA 3D9LA 3QK0A 3U3WA 3MX3A 2QY7A 2OEVA 2IOLA 4JL0A 3B7BA 4PS8A 1D9SA 3KAEA 2J8SD 2OVFA 3SQVA 2KCKA 3JXIA 1HXIA 3PZ2A 3SI5A 1Z3XA 1TJCA 4NIKA 3SNXA 1H2VC 3Q78A 2EIKE 4BSZB 4CDNA 2F8YA 4EBAA 2X38A 2VYIA 2Y4UA 3CEQA 1JPLA 2A4ZA 4Y6CA 3D9KA 3EJNA 2UY1B 4G25A 3LJ3A 4KYOB 1JWGA 2XRYA 4BWRA 1E8YA 2KZTA 2BUGA 4KBQA 3QWVA 3URZA 2WXGA 5ITZF 2DIWA 3UIOC 5FQ7A 4PS3A 3SZ7A 1D8EA 3DEPA 4BT9A 3FTXA 2MRIA 2PQRA 1SA4A 2XPYA 4WNGA 4B0ZA 3NQPA 4OAVB 2QZAA 5FIOA 2JLBA 2E2EA 1EDUA 1P5QA 3E30A 2IO2C 3NZUA 3FTYA 3RAUA 3PZDA 3ZVVA 5G05J 3L82A 3R9AB 5KWDA 2P58C 4X8QA 3EIJA 5CHEE 2Y1LE 3PZ4A 3SO8A 2Y0BG 2GRLA 3HVEA 3FFLA 1XNFA 1ELKA 3FU3A 4LERA 1MX4A 3DSUA 3BUAA 3ZYMA 1OCCE 5JJTA 5CCLA 2GGFA 4YVOA 3B7UX 3CHSA 2DZOA 3DBSA 3AG1E 1S70B 3TG4A 1OWPA 5LOZA 3SY2A 4L9PA 4EZJA 2RFMA 4RG9A 3CSTA 2CHWA 4FA6A 2WXKA 1OWMA 3JXJA 1DCEA 4U04A 4YVQC 3D9OA 3E4BA 3BG1B 4YDOA 5ARFA 3D9PA 4I6JA 5ENPD 4AXHA 3R7RA 2X6HA 4JW1A 1Z6TA 3QNKA 2MHKA 3ZHEB 3LJNA 4DX7D 3G2TA 2KC7A 5A7DB 5HQ8A 3GZ2A 3GW4A 4FHJA 1EF1C 1E8XA 2RFAA 1JCRA 2FO7A 3IHYA 4HI8A 5KJKA 3CVPA 5AARA 4A55A 4BETA 2NXPA 3GZSA 3SBSA 4IRUA 3AU5A 2C0MA 1OCOE 4U0UA 1TN8A 3CVNA 4N39A 3EHNA 4TXPA 5EIDA 1OWLA
chains in the Genus database with same CATH topology
2XGOA 5FZRA 5KJLA 2XCCA 1H0AA 2WMNA 3CHMA 4XE0A 3ZW3A 2XGMA 5LCWC 4CT4A 3AS8A 3SD5A 2YNQA 3LY8A 3MA5A 3PDNA 2LSUA 2AVPA 3PNLB 4IN3B 5G04C 4I17A 1UJKA 3CQGB 3FY4A 3CKCA 3CHOA 4G11A 2PM7A 1HE8A 2LSVA 2ZU6B 2J4DA 5JJ6A 4JHJA 3LVQE 2AXVA 4KVMA 2VSXE 1HX8A 3U9WA 5EX3A 4LCTA 3TGOA 4U0SA 5BV0A 2M63A 3CK9A 3ASHA 4FLBA 4WUYA 3MEKA 2LAIA 4DI4A 3FH5A 1NA0A 2WQ6A 3LCAA 3GYZA 3AS4A 4WAFA 2PZIA 3JCKC 4Q96A 3QOUA 2KATA 4GA0A 3NF1A 4PH4B 3IV0A 5C2YA 3OAWA 2OV8A 2XGSA 3MV3B 4G23A 4APFA 3MJWA 3DPDA 5CMWA 4HFGA 1E8WA 3BG0B 4Q69A 4GB9A 2HM8A 2FF4A 3FUMA 4G2VA 4K0RA 3T5VA 4EPZA 2WVIA 3ZN3A 2J07A 4FHKA 2I1KA 3LPZA 2WM9A 4KT6B 3L16A 4I2ZA 5LX8A 3CVYA 2WPVA 4RSYA 4BFRA 2WXJA 4A1SA 1PAQA 4UI9J 3OXLA 3QDNA 1UJJA 3ONLA 3RK6A 4BY6A 2C0LA 3LKUA 1Z3YA 1H2UA 1HG5A 3QB2A 4J8FA 3SBTB 4A3TA 1E90A 1FVFA 2MOWA 4KZ0A 4XI9A 3NZSA 3MZLB 5G2NA 2XRZA 3FU6A 2AXZA 3ESLA 4L2LA 1HH8A 3O48A 3FUHA 3CHQA 4UQYA 5BNWA 4BTAA 5ANRA 4F53A 4BSXA 5AIJA 4FJYA 5CCMA 5EDSA 2IF4A 2QFCA 3CVLA 3MKRA 4W9RA 3RKVA 4K03A 1E7VA 4CGWA 4A1GA 5A6CA 4EQFA 5FZQA 3ZYLA 4AP2A 4HOUA 2CFUA 3UT4A 4GZDA 4C0EA 4AY5A 4GZCA 2HO1A 3LS8A 4FULA 1WAO1 4B89A 2IU1A 3QARA 3QWWA 4FP7A 4I6EA 4ILIA 4OYSA 4I1OB 2BF0X 4CGVA 2V4LA 3CHPA 3RIBA 3CVWA 4N2QA 2GRMA 3FDHA 3HYMB 2UY1A 4BTBA 5KJMA 3I4RB 3ESKA 3CK7A 3JUIA 4BT8A 4HOTA 3L17A 3ZIMA 3CVQA 4GZ6A 4N3AA 2RD0A 3FTZA 1PY1A 3VLEA 3LY7A 4TUUA 4U07A 2XQ0A 2VTBB 2KZTB 3ENEA 3ASFA 5EX0A 2WXHA 1HG2A 1W3BA 2YHCA 1MHQA 2X6FA 4G1TA 4YNDA 3HVEB 4AJWA 3QAQA 2IONA 3RJVA 2AWIA 3FTWA 4ILGA 3HHMA 4JC8A 2UWJG 4FJZA 3OXGA 3FHEA 2NSZA 3KEZA 1H6KA 5BPPA 3L6AA 1SZ9A 4KVOA 2AW6A 1TJFA 3APFA 3KD7A 3Q4AB 4PUCA 3S7BA 4U8HA 3ZPJA 4NURA 4UI9C 1NZNA 5FZSA 1S0PA 4DPRA 3RRUA 4DLQA 4G24A 2L9BA 3PE4A 3PVLA 3CQCB 4B8CB 2I6HA 3CVXA 2ILRA 2WXNA 1GW6A 4FC8A 1QQEA 4EECA 1JUQA 5FWQA 4GPKA 4I1AA 2YHEA 3LVRE 3PUKA 3FUDA 4I43A 3CVUA 4GMLA 2J09A 3CHRA 4RG6A 4P29A 2WXOA 3TAXA 4AM9A 2X3MA 1HU3A 4XIFA 3CKBA 1WY6A 4JVSA 1VDYA 1SZAA 4E6HA 4FADA 3QKYA 2VGXA 2Y3AA 2V0PA 4KMOA 5FQ6A 4IYPA 1HFAA 4AVXA 3SF4A 4O6FA 1L5JA 1IHGA 4ANUA 4L7TA 5T4YA 2A5UA 2LAHA 3LXUX 4JHRA 2VTBA 4PS7A 1ZBPA 1N54A 3SGHA 3OXFA 5J90A 3RO3A 2X6JA 2YINA 5KJNA 2R17C 2X6KA 4UWFA 4ILHB 4UQXA 3FWVA 4FU3A 4J8SA 3G2UA 3I3NA 4MS6A 1QZ2A 3UT8A 4L2YA 3VTXA 2R59A 5G04J 5A23A 4F7AA 4L1BA 2CG2A 5FTPA 3UUXA 3ZHEA 4ME2A 4F1SA 4APOA 1NA3A 3HDXA 2WXPA 3CSFA 4WNEA 4GMJA 5M72A 5JHBA 3D9JA 4WNFA 3B7RL 2PL2A 5BW8C 4UWLA 3FUEA 3UT7A 3VLDA 4J6IA 2VSNA 4MLPA 4DJAA 3D9LA 4I9EA 3QK0A 3TG5A 1HZ4A 3U3WA 4GYWA 3G2WA 4WWPA 3PEVB 4WWOA 2RG8A 3N71A 5KCMA 2WXRA 2PM6A 3EIQC 4GAAA 3MX3A 2QY7A 3TJPA 4HOQA 2IOLA 4GZ5A 5J08A 4JL0A 5E76A 5T3RA 4URKA 4WNDA 1ELRA 3RU0A 2VGXB 2WXIA 4PS8A 4FLHA 5EKQD 3PREA 5C1DA 4AY6A 4R7LA 3SHFA 3SFZA 1U3DA 3KAEA 4LUNU 4KZCA 2OVFA 4AIFA 2KCKA 1HXIA 4WWNA 3SI5A 3FEYA 3ULQA 1Z3XA 3G2SA 1TJCA 4DK5A 3ONKA 3L54A 2XCBA 4Y6WA 3T5XA 3L13A 3ZRHA 2CFZA 3FUJA 4ACKA 2AXUA 3PH0C 4Q94A 1Y8MA 1ELWA 3SNXA 5HI7A 1H2VC 3RRMB 2IOSA 3ZYKA 2NC9A 3LDZA 4EZKA 4U63A 3IBEA 3ML8A 1DNPA 4CDNA 3FH7A 3FUIA 4OVVA 2JEKA 4EBAA 2X38A 4HXIA 1KT0A 4JA7A 2VYIA 2Y4UA 3CEQA 3FU5A 1JPLA 3QWPA 2A4ZA 3I5PA 4N5CA 4JPSA 2WB2A 1TEZA 4CT0A 5DIZA 1U3CA 3IKOB 4TRQA 1NP7A 3CGHA 3CVVA 1UW4B 4Y6CA 3UX4A 3D9KA 3EJNA 2UY1B 4UQZA 1BPOA 4G25A 4CDRA 3LJ3A 1A17A 4KYOB 1XGWA 1JWGA 2XRYA 1IQUA 4AEZC 3UQ3A 2I2OA 5T8IA 5LP0A 4BWRA 3KS2A 4XI0A 3U4TA 1E8YA 3PUJA 2VSOE 4H7XA 4M3OA 2KZTA 4I2WA 2BUGA 2X6IA 3MV2B 2V8SE 3B7TA 2FULA 4KBQA 3QWVA 1B89A 2WXGA 4XKCA 3URZA 2Q7FA 3WXXA 4ABNA 1IYGA 2DIWA 3TL5A 5BV1A 4I6GA 3L22A 5FQ4A 2V5FA 2VQ2A 3B7SA 1HS6A 2I9CA 5FQ7A 4PS3A 3SZ7A 4JHKA 1H19A 2E0IA 4GA2A 1OUVA 3S7DA 4UI9K 2FI7A 3FEXA 4BT9A 3ZFWA 3FTXA 2MRIA 2FBNA 2PQRA 4L23A 3VTYA 1EPUA 2XPYA 1IQRA 1WM5A 4WNGA 3JQ1A 4HORA 3CLJA 5JJ7A 2XHEA 4B0ZA 3NQPA 1DVPA 1E7UA 5LCWJ 5AJDA 4ANVA 2LO6A 4EZLA 3FUFA 2EQXA 4NACA 2JLBA 2E2EA 3FP3A 3JQ0A 4C0MA 3R7RA 1EDUA 1P5QA 4ACLA 4CDMA 1X5BA 2L0IA 3G2VA 3NZUA 2GW1A 3FTYA 2XPZA 3MGBA 4KXKB 4AV7A 3PZDA 3ZVVA 1N52A 1OWNA 3P1UA 4QFVA 5G05J 2OOEA 3ML9A 1LF8A 1FCHA 3R9AB 1KLXA 5BUZA 2P58C 4OVUA 2WXFA 3PEUB 3EIJA 5CHEE 2XEVA 5BT1A 3APCA 1YA0A 2WQ7A 4XX5A 1INZA 3U66A 1HO8A 3IHVA 4HLEA 3JYSA 4JZYA 1UG3A 2GRLA 3B13A 3Q5MA 4EBAG 3U64A 4LRZA 3HVEA 3FFLA 3HIZA 4N3CA 3LY9A 4XZ4A 1E8ZA 1XNFA 1UN8A 3FUNA 1MQSA 3S7JA 1ELKA 3P2BA 3FU3A 3CR3A 2VGYA 2I1JA 2WXQA 4JEUA 4LERA 3OTNA 3ASDA 4GCOA 5FT9A 4V3IA 4GU5A 2L0TB 3PS6A 4IULA 4TV3A 5G05C 3R7QA 4HOSA 3Q47B 3RRNB 2KM4A 3AS5A 3UPVA 1OWOA 2DCPA 4G26A 5JHAA 2FEZA 2CHXA 3ZYMA 4GCNA 3FTVA 3UMVA 4A3VA 4JEHA 4JXTA 5JJTA 5CCLA 3Q49B 1QNFA 4NQ0A 5LFAA 2GGFA 2PQNA 2VJ8A 3B7UX 3CIAA 3CHSA 3QC1A 3EHMA 4I9CA 4YVOA 1Y6IA 3DBSA 3QJZA 2WQHA 3TXMA 3FULA 3TG4A 1OWPA 2IFUA 2KCLA 2OVBA 5LOZA 5ENNA 3RO2A 4CRWA 4CEMA 1PC2A 3ZYQA 3D3MA 4HS2A 4EZJA 2WXMA 3IEGA 2KCVA 4RG9A 3CSTA 2CHWA 3PRZA 4UWKA 4UWGA 4FA6A 4U0ZA 4N3BA 2L6JA 5E75A 2CHZA 4F3VA 3APDA 4MRUA 3VLFA 5CMYA 2J9QA 3FUKA 3D9NA 4LEUA 1ZU2A 3MKQB 2WXKA 3T8MA 3ZEFA 4J8EA 4B8AA 4BX9A 4C9BB 2IJGX 1OWMA 2YQ8A 2LNIA 5AYWD 1KT1A 4U04A 3TXNA 4YVQC 1H2TC 3D9OA 3E4BA 4GYYA 1FVHA 3FH8A 5FJYA 3BG1B 5ARFA 1E96B 4XKBA 3D9PA 4RVBA 4I6JA 4JA9A 2BTDA 3PNTB 3MCXA 2X6HA 3D9MA 2DBAA 2XPIA 1HF8A 3CV0A 3MYVA 3AU4A 4GYOA 4I1MA 4AXHA 3ZGQA 4JW1A 5AJLA 5DBKA 2CG3A 1Z6TA 3QNKA 3FU0A 2HYZA 2R5SA 2WMOA 3LYAA 4D10C 4ANXA 3L08A 2MHKA 2IQCA 5ANLA 3ZHEB 2HR2A 4DLOA 3G2TA 3LEWA 5ARGA 3EDTB 2J08A 2KC7A 3FTUA 5A7DB 4ATGA 3ZXSA 5HQ8A 3GZ2A 4HVBA 3MKQA 3I4GA 2Y4TA 4MKTA 5D0OD 3S7FA 3D9IA 1JWFA 3BEEA 4E85A 3GW4A 4FHJA 1EF1C 1E8XA 3O4ZA 1SQMA 3GZ1A 5FQ8A 2FO7A 4GZ3A 2C2LA 4ANWA 3ASGA 3IHYA 4PDXA 4GA1A 2WXLA 5AENA 4J0UA 5KJKA 4AOFA 3CVPA 4DI3A 2VSYA 1EYHA 4J8DA 3S2AA 3K9IA 3CK8A 2J49A 3Q15A 5G55A 4UWHA 4A55A 3FTSA 2NXPA 4CCAA 3PE3A 4B94A 3GZSA 2ONDA 3SBSA 4IRUA 4NRHB 3AU5A 2C0MA 4U0UA 5D0QD 3CVNA 4N39A 2J4BA 3EHNA 4BX8A 4H7YA 3C98A 1OWLA 4N2SA 1UN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FFL A;  2XGO A;  4G1T A;  3LY9 A;  2XCB A;  1XNF A;  4N3C A;  4Y6W A;  4YND A;  5FZR A;  3S7J A;  5KJL A;  3RJV A;  2XCC A;  2VGY A;  1Y8M A;  1ELW A;  2UWJ G;  3OXG A;  5HI7 A;  2XGM A;  5LCW C;  3ASD A;  4GCO A;  5FT9 A;  3AS8 A;  5G05 C;  2NC9 A;  3LY8 A;  3MA5 A;  3PDN A;  2LSU A;  2AVP A;  3KD7 A;  3Q47 B;  3Q4A B;  4IN3 B;  5G04 C;  4I17 A;  3S7B A;  3AS5 A;  3ZPJ A;  4UI9 C;  3CKC A;  3UPV A;  1NZN A;  5FZS A;  1KT0 A;  4G26 A;  4JA7 A;  2VYI A;  2LSV A;  2Y4U A;  3CEQ A;  2FEZ A;  5JJ6 A;  4G24 A;  3QWP A;  4HOS A;  3PE4 A;  4GCN A;  4N5C A;  2I6H A;  5DIZ A;  5JJT A;  5CCL A;  1QQE A;  3Q49 B;  4NQ0 A;  5EX3 A;  4Y6C A;  3TGO A;  4U0S A;  2UY1 B;  3CK9 A;  2PQN A;  3ASH A;  4I1A A;  4I9C A;  3MEK A;  4WUY A;  4YVO A;  4GPK A;  1NA0 A;  4UQZ A;  3LCA A;  3GYZ A;  3AS4 A;  2WQH A;  4G25 A;  2PZI A;  4RG6 A;  4CDR A;  4KYO B;  1A17 A;  2KCL A;  2IFU A;  2KAT A;  3NF1 A;  3QOU A;  4GA0 A;  3RO2 A;  3TG4 A;  2XGS A;  3TAX A;  4AM9 A;  3MV3 B;  4XIF A;  1PC2 A;  4G23 A;  3UQ3 A;  4BWR A;  3CKB A;  3KS2 A;  4XI0 A;  3IEG A;  2KCV A;  4RG9 A;  4H7X A;  3U4T A;  4I2W A;  2BUG A;  2FF4 A;  3MV2 B;  4G2V A;  3QKY A;  2VGX A;  4N3B A;  2L6J A;  4U0Z A;  4F3V A;  3ZN3 A;  4KBQ A;  3QWV A;  1B89 A;  3LPZ A;  4O6F A;  3SF4 A;  2Q7F A;  2J9Q A;  3URZ A;  1IHG A;  4I2Z A;  4LEU A;  1ZU2 A;  2WPV A;  1IYG A;  4J8E A;  2YQ8 A;  2V5F A;  2VQ2 A;  4JHR A;  2LNI A;  5AYW D;  4A1S A;  1KT1 A;  4U04 A;  4UI9 J;  4YVQ C;  1ZBP A;  3E4B A;  3OXL A;  3OXF A;  3QDN A;  4GYY A;  5FJY A;  3RO3 A;  3SZ7 A;  5ARF A;  1E96 B;  5KJN A;  2C0L A;  4UQX A;  3LKU A;  3FWV A;  4JA9 A;  4J8F A;  5BNW A;  3CV0 A;  2DBA A;  2XPI A;  4GYO A;  1QZ2 A;  1OUV A;  4GA2 A;  3S7D A;  4UI9 K;  2FI7 A;  3VTX A;  3ZGQ A;  4XI9 A;  5DBK A;  4BT9 A;  3ZFW A;  5G04 J;  2PQR A;  2FBN A;  2HYZ A;  2R5S A;  3LYA A;  3VTY A;  1WM5 A;  5FTP A;  4WNG A;  3UUX A;  1HH8 A;  4ME2 A;  3ZHE A;  4APO A;  5JJ7 A;  1NA3 A;  2MHK A;  3O48 A;  4UQY A;  2HR2 A;  3ZHE B;  4WNE A;  4BTA A;  5ARG A;  4ABN A;  3EDT B;  2KC7 A;  5A7D B;  5M72 A;  5LCW J;  5HQ8 A;  3GZ2 A;  5CCM A;  2IF4 A;  4WNF A;  2QFC A;  2Y4T A;  3CVL A;  3MKR A;  4W9R A;  2PL2 A;  5D0O D;  5BW8 C;  3RKV A;  3S7F A;  2JLB A;  3BEE A;  2E2E A;  2VSN A;  3FP3 A;  4CGW A;  5A6C A;  3GW4 A;  5KJK A;  1P5Q A;  4EQF A;  5FZQ A;  4I9E A;  4HOU A;  3TG5 A;  1HZ4 A;  3U3W A;  3GZ1 A;  4GYW A;  2GW1 A;  2FO7 A;  4AY5 A;  2HO1 A;  3N71 A;  4GZ3 A;  4KXK B;  2C2L A;  1WAO 1;  3ASG A;  3WXX A;  4GA1 A;  3QWW A;  5G05 J;  2OOE A;  4HOQ A;  4J0U A;  4CGV A;  4GZ5 A;  3RIB A;  4N2Q A;  1FCH A;  4JL0 A;  3R9A B;  1KLX A;  3HYM B;  2P58 C;  1ELR A;  2UY1 A;  3CVP A;  2VGX B;  2VSY A;  4WND A;  4J8D A;  5EKQ D;  3RU0 A;  4BTB A;  3K9I A;  5C1D A;  5KJM A;  4AY6 A;  3ESK A;  3CK8 A;  3CK7 A;  3KAE A;  2XEV A;  3Q15 A;  5CHE E;  4BT8 A;  5BT1 A;  4HOT A;  1YA0 A;  3CVQ A;  3PE3 A;  4AIF A;  4B94 A;  2KCK A;  2OND A;  4GZ6 A;  4NRH B;  4N3A A;  1HXI A;  4U0U A;  2C0M A;  5D0Q D;  4HOR A;  3LY7 A;  3CVN A;  4N39 A;  3ULQ A;  4U07 A;  3JYS A;  4H7Y A;  1TJC A;  3Q5M A;  3ASF A;  5EX0 A;  4N2S A;  1W3B A;  2YHC A; 
#chains in the Genus database with same CATH topology
 5FZR A;  5B3S E;  4CT4 A;  3AS8 A;  1N11 A;  3PDN A;  5G04 C;  5AQ7 A;  3CHO A;  3ULY A;  2ZU6 B;  2LSV A;  5JJ6 A;  1O1T A;  3AJI A;  3LVQ E;  2AXV A;  1IKN D;  1HX8 A;  2VSX E;  5EX3 A;  4HI9 A;  4U0S A;  2PZI A;  3JCK C;  2KAT A;  3IV0 A;  4G23 A;  4CZ2 D;  3MJW A;  3DPD A;  1E8W A;  3BG0 B;  4Q69 A;  4GB9 A;  2FF4 A;  4G2V A;  4K0R A;  4EPZ A;  1JCS A;  3L16 A;  4I2Z A;  3C5R A;  1PAQ A;  1UJJ A;  5D66 A;  3RK6 A;  3QB2 A;  4A3T A;  3D9H A;  4RLY A;  2VGE A;  5AIJ A;  5EDS A;  5JMN D;  4K03 A;  4AP2 A;  2CFU A;  3UT4 A;  4C0E A;  4AY5 A;  1V55 E;  1N95 A;  1WAO 1;  5EYP F;  4FP7 A;  4CGV A;  2BF0 X;  2V4L A;  3CHP A;  3RIB A;  2GRM A;  1BLX B;  5KJM A;  1TYQ G;  3CK7 A;  2ETC A;  3CVQ A;  4LSZ E;  4TUU A;  1OT8 A;  1HG2 A;  2X6F A;  4YND A;  4A63 B;  3QAQ A;  2UWJ G;  4GPM A;  3FHE A;  5BPP A;  1OCR E;  1K3Z D;  5JA4 D;  1N9A A;  1SZ9 A;  5HRY A;  3ZPJ A;  3S7B A;  5FZS A;  1S0P A;  4DLQ A;  3ZXP A;  3DRA A;  2L9B A;  2HE0 A;  2I6H A;  4FC8 A;  1GW6 A;  1QQE A;  3E37 A;  4DUI A;  3DSS A;  4DX6 D;  4I43 A;  3CVU A;  4GML A;  2GRR B;  4P29 A;  4AM9 A;  3UM1 A;  2H6G A;  3CKB A;  1VDY A;  4E6H A;  2BKG A;  1HFA A;  4O6F A;  1TNZ A;  2A5U A;  4YDE A;  3HG0 D;  1N54 A;  5J90 A;  2YIN A;  4HLL A;  2X6K A;  4ILH B;  4FU3 A;  3HRA A;  4GTV A;  4MS6 A;  1QZ2 A;  3UT8 A;  1TNB A;  4L2Y A;  4Z68 A;  2R59 A;  4L1B A;  2CG2 A;  3UUX A;  1X81 A;  4APO A;  1NA3 A;  5AQ9 A;  2F8X K;  5M72 A;  5JHB A;  4WNF A;  4HRN A;  2VSN A;  4DJA A;  4I9E A;  2RG8 A;  3N71 A;  2EIM E;  3EIQ C;  3Q7A A;  4GMR A;  4GZ5 A;  5E76 A;  3TWT A;  1ELR A;  3RU0 A;  2WXI A;  3SFZ A;  3KSQ A;  4LUN U;  1O1R A;  4KZC A;  3FEY A;  3G2S A;  2DZN A;  4DK5 A;  3T5X A;  5AN8 A;  3ZRH A;  4ATZ D;  3FUJ A;  4ACK A;  1S63 A;  5HI7 A;  2IOS A;  3UKU G;  3J5P A;  4U63 A;  3ML8 A;  3FH7 A;  3FUI A;  4B93 B;  4BER A;  1KT0 A;  2V4H C;  2ZIS A;  1N0R A;  2R03 A;  3J5Q B;  4N5C A;  2WB2 A;  4CT0 A;  5DIZ A;  3IKO B;  5EIL A;  3KEA A;  1BPO A;  4CDR A;  2ZGD A;  5LP0 A;  3BU8 A;  1OY3 D;  2FUL A;  4ABN A;  2Q7F A;  1IYG A;  4I6G A;  2V5F A;  3DWL G;  1H19 A;  2BKK B;  3BQO A;  5CRV A;  3FEX A;  3VTY A;  5IY5 E;  4L23 A;  3T9K A;  2PNN A;  5KBA A;  4TXR A;  4EZL A;  4C0M A;  5AAO A;  1X5B A;  2L0I A;  2XPZ A;  5AQA A;  2EIN E;  1N52 A;  1YCS B;  4BES A;  1LF8 A;  3C3Q A;  2WXF A;  2RKK A;  2XEV A;  1BI7 B;  5BT1 A;  2P9P G;  2FO1 E;  1BU9 A;  2DWZ A;  3IHV A;  4JZY A;  3C3R A;  1UG3 A;  3S7J A;  3LY9 A;  1E8Z A;  1UN8 A;  1MQS A;  2EIL E;  3V2O A;  5CBO A;  4V3I A;  2V5Q C;  4IUL A;  4HOS A;  3UPV A;  1OCZ E;  5JHA A;  2FEZ A;  2OCC E;  3NB2 A;  4JEH A;  4JXT A;  4G8L A;  1QNF A;  5LFA A;  3QJZ A;  3B95 A;  3TXM A;  2R02 A;  3ZYQ A;  3PRZ A;  3DPY A;  2H6F A;  5E75 A;  5BXU A;  5CMY A;  4BX9 A;  2IJG X;  1KT1 A;  3TXN A;  4DX2 A;  5ENO D;  3Q7F A;  2DBA A;  2XPI A;  3MYV A;  4GYO A;  3AU4 A;  3ZGQ A;  2DYS E;  5AJL A;  5DBK A;  3ASN E;  2HYZ A;  2R5S A;  2WMO A;  4ANX A;  4O1O A;  4DLO A;  5ANL A;  3FTU A;  4ATG A;  4HNA D;  3Q9U C;  5KNH D;  3O4Z A;  1RW2 A;  2C2L A;  1DC2 A;  1WDY A;  3CK8 A;  2J49 A;  3FTS A;  5D0Q D;  2J4B A;  4H7Y A;  2WMN A;  3CHM A;  4XE0 A;  3ZW3 A;  3V2X A;  1S64 A;  3TWX A;  3PZ1 A;  2LXL A;  4I17 A;  2PM7 A;  1HE8 A;  4JHJ A;  3U9W A;  3TGO A;  3EU5 A;  5BV0 A;  2M63 A;  3CK9 A;  4FLB A;  4WUY A;  3MEK A;  1KZO A;  1NA0 A;  1N4S A;  3GYZ A;  4Q96 A;  3MV3 B;  4N5Q A;  1N4Q A;  5CMW A;  4K5C A;  2HM8 A;  2J07 A;  4FHK A;  3LPZ A;  2WM9 A;  4KT6 B;  3OXL A;  4J8Y A;  2EIJ E;  1KPS B;  1HG5 A;  2P9N G;  1FVF A;  4KZ0 A;  1SVX A;  3NZS A;  3ESL A;  4L2L A;  3FUH A;  3NOC D;  5ANR A;  2ETA A;  1H6O A;  3ASO E;  3CVL A;  4ZFH A;  1E7V A;  4HOU A;  4GZD A;  1U2V G;  2HO1 A;  4FUL A;  2H6I A;  2IU1 A;  3QWW A;  4ILI A;  4I1O B;  4HB5 A;  3HYM B;  3ZU7 B;  4TUM A;  3JUI A;  4BT8 A;  4HOT A;  3L17 A;  3E32 A;  3TWU A;  4N3A A;  2XEN A;  2VTB B;  4U07 A;  1RZ4 A;  2XQ0 A;  2KZT B;  5EX0 A;  2L6B A;  3PZ3 A;  3HHM A;  4JC8 A;  3OXG A;  3KEZ A;  2NSZ A;  5ENT D;  1TJF A;  3Q4A B;  1WG0 A;  4NUR A;  2P9L G;  4GTQ A;  4DPR A;  4G24 A;  3CQC B;  3TWV A;  2ILR A;  5ENS D;  4EEC A;  5FWQ A;  3W9F A;  4I1A A;  4DRX E;  2YHE A;  3LVR E;  3FUD A;  1AP7 A;  3CHR A;  2F0Y A;  1HU3 A;  4XIF A;  1WY6 A;  4FAD A;  2VGX A;  4KMO A;  5FQ6 A;  4IYP A;  2MYO A;  3SF4 A;  2LAH A;  3LXU X;  1NI1 A;  3SGH A;  3RO3 A;  2X6J A;  5KJN A;  2R17 C;  4UWF A;  4HBD A;  4F7A A;  3ZHE A;  4F1S A;  3HDX A;  2DVW A;  2WXP A;  3CSF A;  4WNE A;  3ULE G;  4GMJ A;  3D9J A;  3E33 A;  1Q2Z A;  3UM0 A;  3B7R L;  5BW8 C;  3UT7 A;  4J6I A;  2QC9 A;  3HXC A;  3DEO A;  1HZ4 A;  4GYW A;  3G2W A;  4WWO A;  5KCM A;  4GAA A;  4U95 D;  3TJP A;  4HOQ A;  4URK A;  2VGX B;  5EKQ D;  4FLH A;  4R7L A;  5CEC B;  1U3D A;  1TR4 A;  2XCB A;  2CFZ A;  1N4R A;  4Q94 A;  1Y8M A;  3ZYK A;  2NC9 A;  1V54 E;  4OAU C;  1DNP A;  4OVV A;  4M7C A;  4HXI A;  4JA7 A;  3QWP A;  4JPS A;  1U3C A;  1NP7 A;  4LNB A;  3ZNG A;  4UQZ A;  1XGW A;  3DSW A;  4AEZ C;  3ABM E;  4XI0 A;  3U4T A;  4H7X A;  4I2W A;  3MV2 B;  2V8S E;  4XKC A;  1B89 A;  3WXX A;  1NL4 A;  3DXK G;  1ZB1 A;  3L22 A;  5FQ4 A;  2VQ2 A;  1HS6 A;  2I9C A;  2F37 A;  4GA2 A;  1OUV A;  3S7D A;  4UI9 K;  2FI7 A;  2FBN A;  2XEH A;  1IQR A;  1WM5 A;  3JQ1 A;  3CLJ A;  1E7U A;  5AJD A;  2LO6 A;  1SA5 A;  4NAC A;  2EQX A;  3FP3 A;  2IO3 C;  4C48 B;  4CDM A;  3UTM A;  2GW1 A;  4AV7 A;  3P1U A;  4QFV A;  2OOE A;  3ML9 A;  2QYU A;  1FCH A;  2JAB A;  1KLX A;  2IEJ A;  2R05 A;  3EHQ A;  4XX5 A;  1INZ A;  3U66 A;  3B13 A;  4N3C A;  3FUN A;  3AG4 E;  2WXQ A;  4JEU A;  3OTN A;  3TWW A;  2IY0 C;  4GCO A;  5FT9 A;  4GU5 A;  2L0T B;  5AQB A;  3RRN B;  3W9G A;  2DCP A;  2P9I G;  4LG6 A;  3Q75 A;  2CHX A;  2XZT G;  4GCN A;  3FTV A;  4YDY A;  3UMV A;  4A3V A;  3Q49 B;  4NQ0 A;  3Q79 A;  2PQN A;  3CIA A;  3QC1 A;  1Y6I A;  3NAW A;  2WQH A;  3FUL A;  2IFU A;  3RO2 A;  5ENN A;  1BD8 A;  2WXM A;  4UWK A;  4U0Z A;  2L6J A;  4MRU A;  3VLF A;  2J9Q A;  3NBN B;  4C9B B;  4J8E A;  4YDW A;  1UOH A;  2LNI A;  3UM3 A;  2GRQ B;  4UUC A;  5FJY A;  3FH8 A;  1E96 B;  2P9K G;  4XKB A;  4JA9 A;  5HS0 A;  4I1M A;  2CG3 A;  1O1S A;  2HR2 A;  3ZKJ A;  3ZXS A;  3I4G A;  5D0O D;  4MKT A;  1JWF A;  3BEE A;  3F6Q A;  1SQM A;  3GZ1 A;  4HRM B;  5FQ8 A;  4GZ3 A;  4ANW A;  4HQD A;  4PDX A;  4GA1 A;  2WXL A;  4J0U A;  4BEP A;  4AOF A;  4ZHB A;  4DI3 A;  2VSY A;  4J8D A;  2GRN B;  4UWH A;  3PE3 A;  3IXE A;  3R9M A;  2OND A;  1K8K G;  3T8K A;  4N2S A;  2XGO A;  2ZIR A;  1MX6 A;  5KJL A;  1H0A A;  5ENQ D;  4O1P A;  5LCW C;  4XEI G;  3EUV A;  3MA5 A;  4DX1 A;  4IN3 B;  3FY4 A;  5BXO A;  3CKC A;  3TWS A;  2J4D A;  1N94 A;  3ASH A;  2LAI A;  3FH5 A;  4GTR A;  2WQ6 A;  3LCA A;  5C2Y A;  3NF1 A;  2OV8 A;  2XGS A;  4APF A;  2GRP B;  2P9U G;  3T5V A;  5B1B E;  2WVI A;  1TNU A;  2I1K A;  5LX8 A;  2WXJ A;  4A1S A;  1N0Q A;  4UI9 J;  3QDN A;  3ZUV B;  3ONL A;  4BY6 A;  2OEW A;  2C0L A;  4J8F A;  3SBT B;  2MOW A;  4XI9 A;  2XRZ A;  3FU6 A;  1KZP A;  3O48 A;  3CHQ A;  4BTA A;  4F53 A;  4BSX A;  5CCM A;  3AG2 E;  2QFC A;  3MKR A;  4G8K A;  3Q9N C;  4CGW A;  5A6C A;  4EQF A;  4HRL A;  5FZQ A;  3LS8 A;  3QAR A;  2B6C A;  4OYS A;  5EN5 D;  4N2Q A;  4MBG A;  2UY1 A;  3L9T A;  4BTB A;  3ESK A;  2QYJ A;  4GZ6 A;  3VLE A;  3JUE A;  1W3B A;  2YHC A;  2XS8 A;  1NFI E;  4U8Y D;  4AJW A;  3RJV A;  2ION A;  3FTW A;  4ILG A;  1TN7 A;  2P2C P;  4FJZ A;  1H6K A;  3L6A A;  4JD2 G;  2AW6 A;  3APF A;  3KD7 A;  4LNU D;  3RRU A;  1MYO A;  3PE4 A;  4U7E B;  4B8C B;  5H7P A;  1QYM A;  2WXN A;  1MJ0 A;  1JUQ A;  2KBX A;  4GPK A;  3PUK A;  4GTO A;  4RG6 A;  2WXO A;  2AJA A;  2X3M A;  3ABK E;  4JVS A;  1SZA A;  3Q73 A;  2Y3A A;  1IHG A;  4L7T A;  4JHR A;  3UXG A;  2VTB A;  4PS7 A;  3FWV A;  4J8S A;  3I3N A;  3HXF A;  4GTS A;  4EHM A;  5A23 A;  1D8D A;  5FTP A;  3UIP C;  1Z5S C;  2PL2 A;  1BI8 B;  4UWL A;  3FUE A;  2ZXW E;  3TG5 A;  4J7W A;  4WWP A;  3PEV B;  3ABL E;  1G3N B;  2WXR A;  2PM6 A;  1FT2 A;  5J08 A;  5T3R A;  4WND A;  3DSX A;  3PRE A;  5C1D A;  4AY6 A;  3SHF A;  4AIF A;  4WWN A;  4U96 D;  3ULQ A;  3ONK A;  3L54 A;  4Y6W A;  3L13 A;  2AXU A;  3PH0 C;  1ELW A;  1MZC A;  1A5E A;  3RRM B;  3LDZ A;  4EZK A;  3IBE A;  2JEK A;  3FU5 A;  3ISM C;  3I5P A;  1TEZ A;  2KXP C;  4TRQ A;  3CGH A;  3CVV A;  1UW4 B;  3UX4 A;  1TN6 A;  4QQI A;  4GTT A;  2ZGG A;  2NYJ A;  1A17 A;  1IQU A;  3UQ3 A;  2I2O A;  5T8I A;  3DST A;  3KS2 A;  3PUJ A;  2VSO E;  4M3O A;  2GRO B;  2X6I A;  3B7T A;  3TL5 A;  5BV1 A;  3B7S A;  4JHK A;  2E0I A;  3UKR G;  4DX5 D;  3ZFW A;  1EPU A;  3HXD A;  4HOR A;  5JJ7 A;  2XHE A;  5EYL A;  1DVP A;  5LCW J;  5HKP A;  2H6H A;  4ANV A;  5CER B;  3FUF A;  3UIN C;  3JQ0 A;  4F1P A;  4ACL A;  3G2V A;  3MGB A;  4KXK B;  1OWN A;  3X2Q E;  2Y69 E;  5D2M C;  2ETB A;  5BUZ A;  4OVU A;  3PEU B;  1FPP A;  3APC A;  1YA0 A;  1JCQ A;  2WQ7 A;  3AG3 E;  1HO8 A;  4HLE A;  3EU9 A;  3JYS A;  3Q5M A;  4EBA G;  3U64 A;  4LRZ A;  4XZ4 A;  3HIZ A;  3DSV A;  3P2B A;  3CR3 A;  2VGY A;  2I1J A;  5CEA A;  3ASD A;  3PS6 A;  4TV3 A;  5G05 C;  3UI2 A;  3R7Q A;  3Q47 B;  2KM4 A;  3AS5 A;  3HXE A;  1OWO A;  3WG7 E;  4G26 A;  1DCQ A;  3SFX A;  2DYR E;  1LD8 A;  2VJ8 A;  4I9C A;  3EHM A;  2KCL A;  2OVB A;  4CRW A;  1O5M A;  4CEM A;  1PC2 A;  3D3M A;  4HS2 A;  2LXM A;  3SFY A;  3IEG A;  2KCV A;  1OXJ A;  4UWG A;  4N3B A;  2CHZ A;  4F3V A;  3APD A;  4U8V D;  1LD7 A;  3FUK A;  3D9N A;  4LEU A;  1ZU2 A;  3V79 K;  3MKQ B;  3T8M A;  3ZEF A;  4B8A A;  3KSL A;  2YQ8 A;  5AYW D;  1H2T C;  4GYY A;  1FVH A;  1YMP A;  1K1A A;  4RVB A;  2BTD A;  3PNT B;  3MCX A;  3CV0 A;  3D9M A;  3RSE G;  1HF8 A;  5FIN A;  3FU0 A;  2XZD G;  3LYA A;  4D10 C;  3L08 A;  2IQC A;  5ARG A;  3LEW A;  3EDT B;  2J08 A;  4HVB A;  3MKQ A;  2Y4T A;  3S7F A;  3D9I A;  4E85 A;  3ASG A;  3HXB A;  4O60 A;  5AEN A;  1TNY A;  1EYH A;  3S2A A;  3K9I A;  5G55 A;  3Q15 A;  2XS1 A;  4K5A B;  4CCA A;  4B94 A;  4NRH B;  4TXQ A;  2A5E A;  1LTX A;  4BX8 A;  3C98 A;  1UN9 A;  2XCC A;  3AAA C;  2XGM A;  3SD5 A;  2YNQ A;  3LY8 A;  2LSU A;  2AVP A;  3PNL B;  1UJK A;  3CQG B;  4G11 A;  5CBN A;  2R2L A;  4KVM A;  4GTP A;  3E34 A;  4LCT A;  4DI4 A;  1IHB A;  3AS4 A;  4WAF A;  3QOU A;  4GA0 A;  4PH4 B;  3OAW A;  1FT1 A;  4HFG A;  3FUM A;  3ZN3 A;  1QBQ A;  3CVY A;  2WPV A;  4RSY A;  3TWR A;  2XEE A;  4BFR A;  3C72 A;  1N4P A;  3LKU A;  1Z3Y A;  1H2U A;  1E90 A;  3MZL B;  5G2N A;  2AXZ A;  1HH8 A;  5BNW A;  4UQY A;  5KNG A;  4FJY A;  2IF4 A;  1IXV A;  1YYH A;  4RQI A;  4W9R A;  3RKV A;  4A1G A;  3ZYL A;  4GZC A;  4B89 A;  3EHR A;  4I6E A;  3CVW A;  3FDH A;  4F6R D;  3I4R B;  3ZIM A;  2RD0 A;  1H6P A;  5CED B;  3FTZ A;  1PY1 A;  3LY7 A;  1MX2 A;  1TNO A;  3ENE A;  3ASF A;  2WXH A;  5CRU A;  1MHQ A;  4G1T A;  2P9S G;  1AWC B;  3HVE B;  3V30 A;  1SW6 A;  2AWI A;  2LUH A;  4KVO A;  3TWQ A;  4PUC A;  4U8H A;  4UI9 C;  4JB8 P;  1NZN A;  3PVL A;  3CVX A;  3DXM G;  2BED A;  2J09 A;  3C3O A;  3NOG D;  3TAX A;  3V31 A;  3UM2 A;  4GTM A;  3QKY A;  2V0P A;  4AVX A;  1L5J A;  4ANU A;  2B0O E;  5ENR D;  5T4Y A;  4K5B A;  1K1B A;  1ZBP A;  3OXF A;  4CYM D;  4UQX A;  3G2U A;  3VTX A;  5G04 J;  4ME2 A;  5EIB E;  3VLD A;  5B1A E;  4MLP A;  4LNG A;  3D9L A;  3QK0 A;  3U3W A;  3MX3 A;  2QY7 A;  2OEV A;  2IOL A;  4JL0 A;  3B7B A;  4PS8 A;  1D9S A;  3KAE A;  2J8S D;  2OVF A;  3SQV A;  2KCK A;  3JXI A;  1HXI A;  3PZ2 A;  3SI5 A;  1Z3X A;  1TJC A;  4NIK A;  3SNX A;  1H2V C;  3Q78 A;  2EIK E;  4BSZ B;  4CDN A;  2F8Y A;  4EBA A;  2X38 A;  2VYI A;  2Y4U A;  3CEQ A;  1JPL A;  2A4Z A;  4Y6C A;  3D9K A;  3EJN A;  2UY1 B;  4G25 A;  3LJ3 A;  4KYO B;  1JWG A;  2XRY A;  4BWR A;  1E8Y A;  2KZT A;  2BUG A;  4KBQ A;  3QWV A;  3URZ A;  2WXG A;  5ITZ F;  2DIW A;  3UIO C;  5FQ7 A;  4PS3 A;  3SZ7 A;  1D8E A;  3DEP A;  4BT9 A;  3FTX A;  2MRI A;  2PQR A;  1SA4 A;  2XPY A;  4WNG A;  4B0Z A;  3NQP A;  4OAV B;  2QZA A;  5FIO A;  2JLB A;  2E2E A;  1EDU A;  1P5Q A;  3E30 A;  2IO2 C;  3NZU A;  3FTY A;  3RAU A;  3PZD A;  3ZVV A;  5G05 J;  3L82 A;  3R9A B;  5KWD A;  2P58 C;  4X8Q A;  3EIJ A;  5CHE E;  2Y1L E;  3PZ4 A;  3SO8 A;  2Y0B G;  2GRL A;  3HVE A;  3FFL A;  1XNF A;  1ELK A;  3FU3 A;  4LER A;  1MX4 A;  3DSU A;  3BUA A;  3ZYM A;  1OCC E;  5JJT A;  5CCL A;  2GGF A;  4YVO A;  3B7U X;  3CHS A;  2DZO A;  3DBS A;  3AG1 E;  1S70 B;  3TG4 A;  1OWP A;  5LOZ A;  3SY2 A;  4L9P A;  4EZJ A;  2RFM A;  4RG9 A;  3CST A;  2CHW A;  4FA6 A;  2WXK A;  1OWM A;  3JXJ A;  1DCE A;  4U04 A;  4YVQ C;  3D9O A;  3E4B A;  3BG1 B;  4YDO A;  5ARF A;  3D9P A;  4I6J A;  5ENP D;  4AXH A;  3R7R A;  2X6H A;  4JW1 A;  1Z6T A;  3QNK A;  2MHK A;  3ZHE B;  3LJN A;  4DX7 D;  3G2T A;  2KC7 A;  5A7D B;  5HQ8 A;  3GZ2 A;  3GW4 A;  4FHJ A;  1EF1 C;  1E8X A;  2RFA A;  1JCR A;  2FO7 A;  3IHY A;  4HI8 A;  5KJK A;  3CVP A;  5AAR A;  4A55 A;  4BET A;  2NXP A;  3GZS A;  3SBS A;  4IRU A;  3AU5 A;  2C0M A;  1OCO E;  4U0U A;  1TN8 A;  3CVN A;  4N39 A;  3EHN A;  4TXP A;  5EID A;  1OWL A; 
#chains in the Genus database with same CATH homology
 2XGO A;  5FZR A;  5KJL A;  2XCC A;  1H0A A;  2WMN A;  3CHM A;  4XE0 A;  3ZW3 A;  2XGM A;  5LCW C;  4CT4 A;  3AS8 A;  3SD5 A;  2YNQ A;  3LY8 A;  3MA5 A;  3PDN A;  2LSU A;  2AVP A;  3PNL B;  4IN3 B;  5G04 C;  4I17 A;  1UJK A;  3CQG B;  3FY4 A;  3CKC A;  3CHO A;  4G11 A;  2PM7 A;  1HE8 A;  2LSV A;  2ZU6 B;  2J4D A;  5JJ6 A;  4JHJ A;  3LVQ E;  2AXV A;  4KVM A;  2VSX E;  1HX8 A;  3U9W A;  5EX3 A;  4LCT A;  3TGO A;  4U0S A;  5BV0 A;  2M63 A;  3CK9 A;  3ASH A;  4FLB A;  4WUY A;  3MEK A;  2LAI A;  4DI4 A;  3FH5 A;  1NA0 A;  2WQ6 A;  3LCA A;  3GYZ A;  3AS4 A;  4WAF A;  2PZI A;  3JCK C;  4Q96 A;  3QOU A;  2KAT A;  4GA0 A;  3NF1 A;  4PH4 B;  3IV0 A;  5C2Y A;  3OAW A;  2OV8 A;  2XGS A;  3MV3 B;  4G23 A;  4APF A;  3MJW A;  3DPD A;  5CMW A;  4HFG A;  1E8W A;  3BG0 B;  4Q69 A;  4GB9 A;  2HM8 A;  2FF4 A;  3FUM A;  4G2V A;  4K0R A;  3T5V A;  4EPZ A;  2WVI A;  3ZN3 A;  2J07 A;  4FHK A;  2I1K A;  3LPZ A;  2WM9 A;  4KT6 B;  3L16 A;  4I2Z A;  5LX8 A;  3CVY A;  2WPV A;  4RSY A;  4BFR A;  2WXJ A;  4A1S A;  1PAQ A;  4UI9 J;  3OXL A;  3QDN A;  1UJJ A;  3ONL A;  3RK6 A;  4BY6 A;  2C0L A;  3LKU A;  1Z3Y A;  1H2U A;  1HG5 A;  3QB2 A;  4J8F A;  3SBT B;  4A3T A;  1E90 A;  1FVF A;  2MOW A;  4KZ0 A;  4XI9 A;  3NZS A;  3MZL B;  5G2N A;  2XRZ A;  3FU6 A;  2AXZ A;  3ESL A;  4L2L A;  1HH8 A;  3O48 A;  3FUH A;  3CHQ A;  4UQY A;  5BNW A;  4BTA A;  5ANR A;  4F53 A;  4BSX A;  5AIJ A;  4FJY A;  5CCM A;  5EDS A;  2IF4 A;  2QFC A;  3CVL A;  3MKR A;  4W9R A;  3RKV A;  4K03 A;  1E7V A;  4CGW A;  4A1G A;  5A6C A;  4EQF A;  5FZQ A;  3ZYL A;  4AP2 A;  4HOU A;  2CFU A;  3UT4 A;  4GZD A;  4C0E A;  4AY5 A;  4GZC A;  2HO1 A;  3LS8 A;  4FUL A;  1WAO 1;  4B89 A;  2IU1 A;  3QAR A;  3QWW A;  4FP7 A;  4I6E A;  4ILI A;  4OYS A;  4I1O B;  2BF0 X;  4CGV A;  2V4L A;  3CHP A;  3RIB A;  3CVW A;  4N2Q A;  2GRM A;  3FDH A;  3HYM B;  2UY1 A;  4BTB A;  5KJM A;  3I4R B;  3ESK A;  3CK7 A;  3JUI A;  4BT8 A;  4HOT A;  3L17 A;  3ZIM A;  3CVQ A;  4GZ6 A;  4N3A A;  2RD0 A;  3FTZ A;  1PY1 A;  3VLE A;  3LY7 A;  4TUU A;  4U07 A;  2XQ0 A;  2VTB B;  2KZT B;  3ENE A;  3ASF A;  5EX0 A;  2WXH A;  1HG2 A;  1W3B A;  2YHC A;  1MHQ A;  2X6F A;  4G1T A;  4YND A;  3HVE B;  4AJW A;  3QAQ A;  2ION A;  3RJV A;  2AWI A;  3FTW A;  4ILG A;  3HHM A;  4JC8 A;  2UWJ G;  4FJZ A;  3OXG A;  3FHE A;  2NSZ A;  3KEZ A;  1H6K A;  5BPP A;  3L6A A;  1SZ9 A;  4KVO A;  2AW6 A;  1TJF A;  3APF A;  3KD7 A;  3Q4A B;  4PUC A;  3S7B A;  4U8H A;  3ZPJ A;  4NUR A;  4UI9 C;  1NZN A;  5FZS A;  1S0P A;  4DPR A;  3RRU A;  4DLQ A;  4G24 A;  2L9B A;  3PE4 A;  3PVL A;  3CQC B;  4B8C B;  2I6H A;  3CVX A;  2ILR A;  2WXN A;  1GW6 A;  4FC8 A;  1QQE A;  4EEC A;  1JUQ A;  5FWQ A;  4GPK A;  4I1A A;  2YHE A;  3LVR E;  3PUK A;  3FUD A;  4I43 A;  3CVU A;  4GML A;  2J09 A;  3CHR A;  4RG6 A;  4P29 A;  2WXO A;  3TAX A;  4AM9 A;  2X3M A;  1HU3 A;  4XIF A;  3CKB A;  1WY6 A;  4JVS A;  1VDY A;  1SZA A;  4E6H A;  4FAD A;  3QKY A;  2VGX A;  2Y3A A;  2V0P A;  4KMO A;  5FQ6 A;  4IYP A;  1HFA A;  4AVX A;  3SF4 A;  4O6F A;  1L5J A;  1IHG A;  4ANU A;  4L7T A;  5T4Y A;  2A5U A;  2LAH A;  3LXU X;  4JHR A;  2VTB A;  4PS7 A;  1ZBP A;  1N54 A;  3SGH A;  3OXF A;  5J90 A;  3RO3 A;  2X6J A;  2YIN A;  5KJN A;  2R17 C;  2X6K A;  4UWF A;  4ILH B;  4UQX A;  3FWV A;  4FU3 A;  4J8S A;  3G2U A;  3I3N A;  4MS6 A;  1QZ2 A;  3UT8 A;  4L2Y A;  3VTX A;  2R59 A;  5G04 J;  5A23 A;  4F7A A;  4L1B A;  2CG2 A;  5FTP A;  3UUX A;  3ZHE A;  4ME2 A;  4F1S A;  4APO A;  1NA3 A;  3HDX A;  2WXP A;  3CSF A;  4WNE A;  4GMJ A;  5M72 A;  5JHB A;  3D9J A;  4WNF A;  3B7R L;  2PL2 A;  5BW8 C;  4UWL A;  3FUE A;  3UT7 A;  3VLD A;  4J6I A;  2VSN A;  4MLP A;  4DJA A;  3D9L A;  4I9E A;  3QK0 A;  3TG5 A;  1HZ4 A;  3U3W A;  4GYW A;  3G2W A;  4WWP A;  3PEV B;  4WWO A;  2RG8 A;  3N71 A;  5KCM A;  2WXR A;  2PM6 A;  3EIQ C;  4GAA A;  3MX3 A;  2QY7 A;  3TJP A;  4HOQ A;  2IOL A;  4GZ5 A;  5J08 A;  4JL0 A;  5E76 A;  5T3R A;  4URK A;  4WND A;  1ELR A;  3RU0 A;  2VGX B;  2WXI A;  4PS8 A;  4FLH A;  5EKQ D;  3PRE A;  5C1D A;  4AY6 A;  4R7L A;  3SHF A;  3SFZ A;  1U3D A;  3KAE A;  4LUN U;  4KZC A;  2OVF A;  4AIF A;  2KCK A;  1HXI A;  4WWN A;  3SI5 A;  3FEY A;  3ULQ A;  1Z3X A;  3G2S A;  1TJC A;  4DK5 A;  3ONK A;  3L54 A;  2XCB A;  4Y6W A;  3T5X A;  3L13 A;  3ZRH A;  2CFZ A;  3FUJ A;  4ACK A;  2AXU A;  3PH0 C;  4Q94 A;  1Y8M A;  1ELW A;  3SNX A;  5HI7 A;  1H2V C;  3RRM B;  2IOS A;  3ZYK A;  2NC9 A;  3LDZ A;  4EZK A;  4U63 A;  3IBE A;  3ML8 A;  1DNP A;  4CDN A;  3FH7 A;  3FUI A;  4OVV A;  2JEK A;  4EBA A;  2X38 A;  4HXI A;  1KT0 A;  4JA7 A;  2VYI A;  2Y4U A;  3CEQ A;  3FU5 A;  1JPL A;  3QWP A;  2A4Z A;  3I5P A;  4N5C A;  4JPS A;  2WB2 A;  1TEZ A;  4CT0 A;  5DIZ A;  1U3C A;  3IKO B;  4TRQ A;  1NP7 A;  3CGH A;  3CVV A;  1UW4 B;  4Y6C A;  3UX4 A;  3D9K A;  3EJN A;  2UY1 B;  4UQZ A;  1BPO A;  4G25 A;  4CDR A;  3LJ3 A;  1A17 A;  4KYO B;  1XGW A;  1JWG A;  2XRY A;  1IQU A;  4AEZ C;  3UQ3 A;  2I2O A;  5T8I A;  5LP0 A;  4BWR A;  3KS2 A;  4XI0 A;  3U4T A;  1E8Y A;  3PUJ A;  2VSO E;  4H7X A;  4M3O A;  2KZT A;  4I2W A;  2BUG A;  2X6I A;  3MV2 B;  2V8S E;  3B7T A;  2FUL A;  4KBQ A;  3QWV A;  1B89 A;  2WXG A;  4XKC A;  3URZ A;  2Q7F A;  3WXX A;  4ABN A;  1IYG A;  2DIW A;  3TL5 A;  5BV1 A;  4I6G A;  3L22 A;  5FQ4 A;  2V5F A;  2VQ2 A;  3B7S A;  1HS6 A;  2I9C A;  5FQ7 A;  4PS3 A;  3SZ7 A;  4JHK A;  1H19 A;  2E0I A;  4GA2 A;  1OUV A;  3S7D A;  4UI9 K;  2FI7 A;  3FEX A;  4BT9 A;  3ZFW A;  3FTX A;  2MRI A;  2FBN A;  2PQR A;  4L23 A;  3VTY A;  1EPU A;  2XPY A;  1IQR A;  1WM5 A;  4WNG A;  3JQ1 A;  4HOR A;  3CLJ A;  5JJ7 A;  2XHE A;  4B0Z A;  3NQP A;  1DVP A;  1E7U A;  5LCW J;  5AJD A;  4ANV A;  2LO6 A;  4EZL A;  3FUF A;  2EQX A;  4NAC A;  2JLB A;  2E2E A;  3FP3 A;  3JQ0 A;  4C0M A;  3R7R A;  1EDU A;  1P5Q A;  4ACL A;  4CDM A;  1X5B A;  2L0I A;  3G2V A;  3NZU A;  2GW1 A;  3FTY A;  2XPZ A;  3MGB A;  4KXK B;  4AV7 A;  3PZD A;  3ZVV A;  1N52 A;  1OWN A;  3P1U A;  4QFV A;  5G05 J;  2OOE A;  3ML9 A;  1LF8 A;  1FCH A;  3R9A B;  1KLX A;  5BUZ A;  2P58 C;  4OVU A;  2WXF A;  3PEU B;  3EIJ A;  5CHE E;  2XEV A;  5BT1 A;  3APC A;  1YA0 A;  2WQ7 A;  4XX5 A;  1INZ A;  3U66 A;  1HO8 A;  3IHV A;  4HLE A;  3JYS A;  4JZY A;  1UG3 A;  2GRL A;  3B13 A;  3Q5M A;  4EBA G;  3U64 A;  4LRZ A;  3HVE A;  3FFL A;  3HIZ A;  4N3C A;  3LY9 A;  4XZ4 A;  1E8Z A;  1XNF A;  1UN8 A;  3FUN A;  1MQS A;  3S7J A;  1ELK A;  3P2B A;  3FU3 A;  3CR3 A;  2VGY A;  2I1J A;  2WXQ A;  4JEU A;  4LER A;  3OTN A;  3ASD A;  4GCO A;  5FT9 A;  4V3I A;  4GU5 A;  2L0T B;  3PS6 A;  4IUL A;  4TV3 A;  5G05 C;  3R7Q A;  4HOS A;  3Q47 B;  3RRN B;  2KM4 A;  3AS5 A;  3UPV A;  1OWO A;  2DCP A;  4G26 A;  5JHA A;  2FEZ A;  2CHX A;  3ZYM A;  4GCN A;  3FTV A;  3UMV A;  4A3V A;  4JEH A;  4JXT A;  5JJT A;  5CCL A;  3Q49 B;  1QNF A;  4NQ0 A;  5LFA A;  2GGF A;  2PQN A;  2VJ8 A;  3B7U X;  3CIA A;  3CHS A;  3QC1 A;  3EHM A;  4I9C A;  4YVO A;  1Y6I A;  3DBS A;  3QJZ A;  2WQH A;  3TXM A;  3FUL A;  3TG4 A;  1OWP A;  2IFU A;  2KCL A;  2OVB A;  5LOZ A;  5ENN A;  3RO2 A;  4CRW A;  4CEM A;  1PC2 A;  3ZYQ A;  3D3M A;  4HS2 A;  4EZJ A;  2WXM A;  3IEG A;  2KCV A;  4RG9 A;  3CST A;  2CHW A;  3PRZ A;  4UWK A;  4UWG A;  4FA6 A;  4U0Z A;  4N3B A;  2L6J A;  5E75 A;  2CHZ A;  4F3V A;  3APD A;  4MRU A;  3VLF A;  5CMY A;  2J9Q A;  3FUK A;  3D9N A;  4LEU A;  1ZU2 A;  3MKQ B;  2WXK A;  3T8M A;  3ZEF A;  4J8E A;  4B8A A;  4BX9 A;  4C9B B;  2IJG X;  1OWM A;  2YQ8 A;  2LNI A;  5AYW D;  1KT1 A;  4U04 A;  3TXN A;  4YVQ C;  1H2T C;  3D9O A;  3E4B A;  4GYY A;  1FVH A;  3FH8 A;  5FJY A;  3BG1 B;  5ARF A;  1E96 B;  4XKB A;  3D9P A;  4RVB A;  4I6J A;  4JA9 A;  2BTD A;  3PNT B;  3MCX A;  2X6H A;  3D9M A;  2DBA A;  2XPI A;  1HF8 A;  3CV0 A;  3MYV A;  3AU4 A;  4GYO A;  4I1M A;  4AXH A;  3ZGQ A;  4JW1 A;  5AJL A;  5DBK A;  2CG3 A;  1Z6T A;  3QNK A;  3FU0 A;  2HYZ A;  2R5S A;  2WMO A;  3LYA A;  4D10 C;  4ANX A;  3L08 A;  2MHK A;  2IQC A;  5ANL A;  3ZHE B;  2HR2 A;  4DLO A;  3G2T A;  3LEW A;  5ARG A;  3EDT B;  2J08 A;  2KC7 A;  3FTU A;  5A7D B;  4ATG A;  3ZXS A;  5HQ8 A;  3GZ2 A;  4HVB A;  3MKQ A;  3I4G A;  2Y4T A;  4MKT A;  5D0O D;  3S7F A;  3D9I A;  1JWF A;  3BEE A;  4E85 A;  3GW4 A;  4FHJ A;  1EF1 C;  1E8X A;  3O4Z A;  1SQM A;  3GZ1 A;  5FQ8 A;  2FO7 A;  4GZ3 A;  2C2L A;  4ANW A;  3ASG A;  3IHY A;  4PDX A;  4GA1 A;  2WXL A;  5AEN A;  4J0U A;  5KJK A;  4AOF A;  3CVP A;  4DI3 A;  2VSY A;  1EYH A;  4J8D A;  3S2A A;  3K9I A;  3CK8 A;  2J49 A;  3Q15 A;  5G55 A;  4UWH A;  4A55 A;  3FTS A;  2NXP A;  4CCA A;  3PE3 A;  4B94 A;  3GZS A;  2OND A;  3SBS A;  4IRU A;  4NRH B;  3AU5 A;  2C0M A;  4U0U A;  5D0Q D;  3CVN A;  4N39 A;  2J4B A;  3EHN A;  4BX8 A;  4H7Y A;  3C98 A;  1OWL A;  4N2S A;  1UN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...