1O1SA

Structure of fpt bound to isoprenoid analog 3b
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
315
structure length
315
Chain Sequence
GFLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein farnesyltransferase alpha subunit
publication title Biochemical and Structural Studies with Prenyl Diphosphate Analogues Provide Insights into Isoprenoid Recognition by Protein Farnesyl Transferase
pubmed doi rcsb
source organism Rattus norvegicus
total genus 126
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2003-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1o1sA00
1NL4A 3E34A 2IEJA 1S64A 3E32A 1JCSA 1O1SA 1N4RA 1JCQA 3DSXA 3Q79A 3E37A 3EUVA 1TNUA 1TNOA 3DSTA 1X81A 4GTSA 4GTOA 2ZIRA 3E33A 2H6GA 3PZ1A 1FPPA 1TNBA 4YDEA 2R2LA 3Q7AA 1KZPA 3DSVA 4LNBA 4GTQA 3SFXA 3HXDA 1LTXA 2ZISA 3HXEA 3DSWA 1TNYA 1TNZA 1QBQA 3HXCA 1N4SA 4YDOA 1SA5A 3KSQA 4GTMA 2H6HA 4MBGA 3Q73A 1LD8A 3SFYA 1MZCA 3HXFA 2F0YA 1N4PA 2H6FA 1LD7A 3PZ3A 4L9PA 3DSUA 1D8EA 2H6IA 4GTVA 3Q75A 4GTRA 1D8DA 4GTTA 1O1RA 3DRAA 1N94A 1DCEA 1NI1A 4EHMA 1JCRA 3DSSA 1O1TA 1KZOA 1S63A 1SA4A 3DPYA 3HXBA 1FT1A 1N95A 3PZ2A 3Q78A 1N4QA 1N9AA 1FT2A 4LNGA 3C72A 1TN6A 3EU5A 3KSLA 4GTPA 3Q7FA 3E30A 1TN8A 2BEDA 1TN7A 3PZ4A 1O5MA
chains in the Genus database with same CATH superfamily
2IEJA 4Q96A 5LOZA 4WNDA 5CECB 4XKBA 1N4RA 3E37A 4O1PA 4U0SA 3T9KA 3CQGB 3RO2A 2VSOE 3E33A 2CHZA 4H7XA 2E0IA 4F6RD 3Q7AA 2DYSE 2YHCA 4XEIG 2GW1A 4TV3A 4I1AA 2L9BA 5BT1A 3U66A 4UWKA 1SW6A 1ZB1A 3Q49B 1N4SA 4GTMA 3S7FA 1LD8A 2EIKE 3CVLA 1N4PA 4WWPA 4KXKB 4PS7A 3QK0A 2CG3A 2V5QC 3DEOA 1H2UA 1DCEA 4ACKA 4K5CA 4I1OB 1K3ZD 3JCKC 1UJKA 1KZOA 4L2YA 2UWJG 3HIZA 1QQEA 3MV2B 2CFUA 1N95A 3ASOE 2Y4TA 4WAFA 2CG2A 1SZAA 1DNPA 3CKCA 4L1BA 1FT2A 5ENTD 2NC9A 1TN6A 3G2VA 3FULA 3EU5A 3CVVA 2GROB 2IF4A 3D9HA 3MGBA 4UQYA 1EYHA 1GW6A 4UI9C 3OXLA 3ZXSA 2XZDG 2I6HA 5JJ7A 5CBOA 2R5SA 3D9OA 3JUIA 4U7EB 3V30A 3CHSA 3RRNB 4KVOA 4FLBA 1BI7B 4RLYA 2R2LA 2M63A 3MX3A 3FHEA 3L17A 2KM4A 2GRPB 2YINA 1HF8A 1N54A 1N52A 3FTXA 4D10C 4EZLA 4FP7A 4AV7A 4J8YA 5G04J 1OCZE 3BQOA 4XI0A 4B89A 3DSUA 5JMND 2Y4UA 3RRUA 3MZLB 4U8VD 3D3MA 4FLHA 2DVWA 3W9FA 4I9CA 4I2ZA 3G2WA 1TYQG 3HXBA 2OV8A 3L16A 3EHQA 1KT0A 3TAXA 4DPRA 1IQRA 5E75A 3VLDA 4LEUA 2LNIA 3APDA 3FTUA 2NYJA 2FULA 3CHOA 3U4TA 4GCNA 2QZAA 2WXHA 4HQDA 4G26A 1HXIA 3LKUA 3PVLA 3IBEA 2EIJE 4IULA 2WB2A 1A17A 2DYRE 2P9IG 5BXUA 2BKKB 4L23A 2P2CP 3BU8A 4ANXA 1UJJA 1O5MA 5DBKA 3IHVA 1N0RA 5CBNA 5LCWJ 3PEVB 3TWWA 3FWVA 4ILHB 3PREA 3Q9UC 1NA0A 3FUIA 5EIDA 3ABKE 2DCPA 1TNBA 2HM8A 2ETCA 4GTQA 3HXDA 3UT4A 1TNZA 2WM9A 3CHMA 4DI4A 4JXTA 2XS8A 1EF1C 2H6HA 5ENPD 3D9KA 4GZ3A 1TJCA 3Q73A 3CHPA 3B95A 4PUCA 2VGYA 3PZ3A 4G8KA 1ELWA 1N94A 4U0UA 3QARA 1SVXA 1SA4A 4DUIA 4HBDA 4C9BB 3JQ1A 4L2LA 1V55E 4N2SA 3SHFA 4G1TA 2X38A 2X6IA 4AIFA 4CDRA 2XGMA 3L08A 4C0MA 4E6HA 4XIFA 1D9SA 1OCCE 5E76A 5T4YA 1FCHA 4BETA 4N3CA 3K9IA 2OEWA 2WPVA 2NSZA 1VDYA 4EBAA 2L0TB 2XEHA 2KCKA 3UI2A 5D0QD 3ISMC 2OVBA 3EHNA 5B3SE 4DK5A 3ESLA 2Y3AA 5ANRA 2L6BA 3DSXA 4OVVA 2I1KA 3FUHA 4JEHA 3TWRA 1YA0A 1YCSB 2LUHA 4I6JA 1JPLA 1UN8A 2PM7A 3FEXA 4HRLA 2IOLA 2J8SD 1QBQA 3SD5A 4F7AA 3TWUA 1JUQA 3KSQA 3UINC 1Y8MA 2F8XK 4JB8P 3VTYA 1OT8A 4F1SA 4WWOA 4IN3B 2DIWA 3UT8A 1UN9A 3Q75A 2VGEA 3B7BA 3RJVA 3QWPA 4EHMA 4FADA 4LG6A 2EILE 2J9QA 3AG1E 1HS6A 1K1AA 2RFMA 3MCXA 3ZPJA 2XS1A 3C72A 1MX2A 2OCCE 3UTMA 5KBAA 4A1GA 3ZVVA 2RG8A 1U2VG 4P29A 3KD7A 3ZXPA 4XI9A 2OEVA 2LSUA 4DX2A 3NZSA 2X6HA 5G04C 2WXRA 4N3AA 4U07A 2QYJA 3EIJA 3ZYMA 2IO2C 4I6GA 1X81A 5M72A 2WMNA 5T8IA 3N71A 4J0UA 4GMRA 2H6GA 4PS8A 5AAOA 2IONA 1KZPA 1E8WA 4RG9A 3GZ1A 1INZA 2XCBA 2ZISA 1TNYA 2X6JA 3AS8A 4YDOA 4MBGA 3FDHA 2WXOA 2LO6A 1Z3XA 3P2BA 4RVBA 3UKRG 5FJYA 1W3BA 3V31A 4APFA 2V8SE 1IQUA 2H6IA 1QYMA 2FBNA 3FUEA 3Q5MA 5FZRA 2CHWA 3ZEFA 4GB9A 2V4LA 3TWSA 3CVQA 5BV0A 4GA2A 3FTVA 4TXQA 3RKVA 5CEDB 2ETAA 3QWVA 2VYIA 1KLXA 5CHEE 1IHBA 4G25A 4HOQA 4B0ZA 5LCWC 4CDNA 2AXVA 3ZGQA 2X6KA 1E90A 3L13A 4N3BA 5JJ6A 4OAVB 4O60A 4KZ0A 1PAQA 4H7YA 3IKOB 4FJYA 1MX6A 3ENEA 1A5EA 2PZIA 2R03A 3ONLA 4TXPA 3PZ4A 2XGOA 4YNDA 3E34A 3CR3A 4AOFA 3C3RA 4GTOA 2F37A 4NURA 1TEZA 3QJZA 3FEYA 3R9AB 2J49A 4UQZA 3SFXA 1YYHA 3HXEA 2IFUA 5KJLA 3LYAA 1OWMA 5G05J 3NOCD 5JA4D 3CV0A 1E8YA 3RAUA 4N2QA 3ASGA 4PS3A 3D9LA 4I6EA 4GPKA 4HOTA 2EINE 4GMLA 3JUEA 1OCRE 2WVIA 1MJ0A 1D8DA 4EPZA 1WAO1 3SFZA 3QKYA 4U96D 4WWNA 3FU6A 4GZCA 2ILRA 4JHJA 3HVEA 4C48B 3CVXA 5A7DB 3PZ2A 3HHMA 2FO7A 3AJIA 3CSTA 4JEUA 3RU0A 1N4QA 4EZKA 5ARFA 2LXMA 3I4RB 4CDMA 2PNNA 3R7RA 1HG5A 3ZYKA 3KSLA 4EECA 3AG3E 3ZW3A 4N5QA 2P9UG 2IOSA 4NIKA 4J7WA 2ZU6B 4FHJA 2BTDA 4GZ5A 1IHGA 3UM2A 3UX4A 2PQRA 2VGXA 1ZU2A 5JJTA 4KT6B 3E32A 4JL0A 4HI8A 4BX9A 2HO1A 5G55A 4J6IA 3ZFWA 3DBSA 3ASDA 4ANUA 4UUCA 3TWVA 1LTXA 3I5PA 5CEAA 4AJWA 3FUJA 5HQ8A 1TR4A 5EYPF 4J8EA 4TUUA 5BW8C 5AN8A 5CCMA 1U3CA 4XZ4A 4DX5D 4OYSA 4BT8A 1E7VA 1H19A 3B7UX 4JD2G 4KVMA 1H6PA 1O1TA 3UQ3A 3FFLA 5KWDA 1XNFA 3CK9A 3LXUX 3Q78A 5KNGA 5AQBA 2OVFA 3PS6A 3NF1A 3TGOA 3APCA 4HLLA 2R17C 2V4HC 2P58C 1NP7A 2YHEA 2ONDA 3MJWA 3UT7A 3Q7FA 4JPSA 1TN8A 3RIBA 2XPZA 1RW2A 2WXLA 4TUMA 4DRXE 1HO8A 2P9KG 3FU0A 4XKCA 3EIQC 4WUYA 4G23A 5EIBE 1IXVA 3VTXA 4A1SA 3Q79A 4I1MA 2VJ8A 4Z68A 2I1JA 3P1UA 3UM3A 3RRMB 3PH0C 4AVXA 1E8ZA 2XEEA 5ARGA 4CT0A 2WXNA 2KC7A 2MYOA 3UIOC 5AYWD 3APFA 3EHMA 1JWGA 1S0PA 1OY3D 3SF4A 2LAHA 1EDUA 5B1AE 2FF4A 4HLEA 2YNQA 4LSZE 2ZGDA 4K5AB 5AIJA 4B8CB 5FTPA 1BD8A 4HRNA 4O6FA 3L54A 3AAAC 2H6FA 3V2OA 4DX7D 5JHAA 1LD7A 4A63B 2L0IA 4J8SA 2JABA 3DRAA 3SBTB 2I9CA 1NA3A 3BUAA 4LCTA 3RK6A 3ZYQA 4N39A 2BUGA 3ULEG 4GYWA 4LRZA 2VSXE 1HFAA 2IY0C 3LVRE 2MOWA 4BERA 4GTPA 2IO3C 2ZGGA 4U04A 5D66A 2GRRB 2VQ2A 5C1DA 3HVEB 4K5BA 5G05C 3D9NA 4APOA 3ZNGA 2EQXA 1ELRA 1FVFA 5CCLA 4AY5A 3LVQE 2HE0A 1O1SA 1OWOA 4G8LA 4BTAA 5AENA 3B7SA 3LEWA 3ABLE 4R7LA 1FPPA 4HI9A 4JA9A 3D9MA 2RD0A 2KZTA 2ZXWE 3EJNA 5C2YA 4GZ6A 3VLFA 3CEQA 2VGXB 1BU9A 3D9JA 3L9TA 1HE8A 2E2EA 4DLQA 4Y6CA 2AW6A 3VLEA 4KYOB 3BG0B 3LDZA 4WNFA 5KJMA 2MHKA 1Z3YA 5FQ8A 2GRLA 4AP2A 3CIAA 3UPVA 4F3VA 4HRMB 1Q2ZA 2R02A 2XHEA 3RO3A 1YMPA 3MKQA 3S7JA 3E30A 2IU1A 4HFGA 2BKGA 4ZFHA 3QC1A 3ZU7B 3GW4A 4YVQC 4J8FA 1IYGA 1DC2A 2WXMA 3SY2A 3U64A 1UOHA 4IRUA 4WNEA 2P9NG 5AARA 4F1PA 1JCSA 5EILA 5ENQD 5CERB 2PL2A 3JYSA 2Q7FA 3CGHA 3QB2A 1OUVA 2C0MA 3SO8A 3ABME 5ENRD 3FUMA 4MLPA 2KXPC 3NBNB 1Y6IA 3CSFA 3ZRHA 5BUZA 3U9WA 3OTNA 4TXRA 4DX1A 2QFCA 4EBAG 3PUKA 1Z5SC 3IV0A 4L9PA 2FO1E 2F8YA 5FWQA 1XGWA 5LFAA 4RG6A 3DWLG 2FI7A 1JCRA 3R7QA 2J07A 4ILIA 1S63A 3MV3B 4Q94A 4B94A 2QYUA 4LNGA 1BI8B 1NZNA 2EIME 2X3MA 5ANLA 3J5PA 1RZ4A 3SNXA 1AP7A 3MKRA 1BLXB 3JXIA 3QNKA 1E8XA 3CVPA 3ML9A 1KPSB 1V54E 3EU9A 4QFVA 5CRUA 1EPUA 2WQ7A 1B89A 4JC8A 2WXKA 4G11A 4Y6WA 3URZA 4UWLA 4GA1A 4HOSA 1OWNA 1NL4A 3UM0A 4A3VA 2XPIA 2C2LA 1H2VC 1TNUA 1OXJA 5AJDA 3ASNE 3S7BA 2VSNA 3V79K 4PDXA 2HR2A 3CVNA 3AU5A 3QDNA 3CHRA 4LNUD 1MX4A 4ME2A 4B93B 4KMOA 3AS4A 3T5XA 1HG2A 4HXIA 5DIZA 2F0YA 2JLBA 3EHRA 2XEVA 4UWFA 5CMWA 4GTRA 1MQSA 4FC8A 4OVUA 2A5UA 3DSSA 2KZTB 3FTWA 2R05A 3LY7A 4CZ2D 2GRMA 3FU5A 3QAQA 3KEZA 4DJAA 3PE3A 2R59A 4BX8A 3Q4AB 2XQ0A 3SQVA 4CYMD 2IQCA 4HS2A 5A23A 1TJFA 3FUFA 3CKBA 4GMJA 5ENSD 4EZJA 5FQ6A 4AM9A 1MYOA 4GA0A 3G2TA 5AQ9A 2KCLA 3SI5A 3GZSA 4HVBA 2PQNA 1KT1A 3LCAA 2UY1A 1TNOA 3DSTA 3G2SA 4M3OA 3LJNA 3C98A 3JQ0A 3MKQB 2P9PG 3PZ1A 3FUNA 4CCAA 3DSVA 2JEKA 4FA6A 5FIOA 5HI7A 4XE0A 3FU3A 5KJKA 4ANVA 3ASHA 3I3NA 3CHQA 4AXHA 4BSZB 4HB5A 3UMVA 3ZHEA 5ENOD 1MZCA 4OAUC 1UG3A 3ULQA 3UUXA 3CVWA 3IHYA 2XGSA 3TXMA 1H6OA 2AXZA 4AY6A 3AS5A 3PZDA 3ZUVB 1K1BA 3JXJA 1NFIE 5HKPA 4GU5A 3S2AA 3OXGA 3GZ2A 3C3OA 2P9SG 4E85A 3EDTB 3FH7A 2VSYA 4XX5A 2DZNA 3LPZA 3NAWA 3O48A 3ZYLA 4I43A 3HG0D 5ENNA 3E4BA 4B8AA 2XENA 2LSVA 5D2MC 3T8MA 5LP0A 1S64A 2B6CA 3FH8A 2DBAA 4HOUA 3C3QA 4ACLA 4GTSA 3FTSA 3HYMB 1HU3A 2J4DA 5FQ7A 3B7TA 2LXLA 5AQ7A 1WG0A 2WXGA 3I4GA 3CVUA 3KS2A 2IJGX 4BFRA 2WXJA 2WXPA 3WXXA 4BESA 3LY9A 4CGVA 1UW4B 1S70B 4CRWA 4DI3A 5A6CA 1SA5A 1OWPA 4GYYA 3D9IA 1DVPA 4U0ZA 4GAAA 2XPYA 4UI9K 3DEPA 2CFZA 3MEKA 3C5RA 4A3TA 3CLJA 2A5EA 2J08A 4U8YD 3TL5A 3FH5A 4YDYA 2XCCA 2XRYA 2A4ZA 3DXMG 2I2OA 4BY6A 2CHXA 2FEZA 4HNAD 2B0OE 3G2UA 3D9PA 3BEEA 3Q47B 4K03A 3W9GA 3FP3A 5KCMA 4BT9A 1N11A 4QQIA 4JZYA 2YQ8A 4UQXA 2WXIA 3AG2E 1IKND 4EQFA 3MA5A 2VTBA 3ASFA 3LY8A 1L5JA 3SGHA 3SZ7A 3ZIMA 4FULA 4U8HA 2GRNB 2L6JA 3T8KA 4ILGA 1HH8A 3PEUB 2AWIA 4AEZC 3FTZA 1DCQA 3TWQA 1JCQA 1H6KA 3UIPC 3FUKA 1OWLA 1WM5A 1H0AA 2QC9A 3X2QE 3V2XA 1QNFA 4BEPA 2WXFA 4JA7A 4BWRA 5T3RA 3RSEG 5FZQA 3PNLB 4LNBA 3TG4A 1PC2A 4U95D 4X8QA 1G3NB 4MKTA 3PE4A 2LAIA 3ML8A 4MS6A 4CEMA 4URKA 4ABNA 3HXFA 2UY1B 3NOGD 4LERA 4I17A 1P5QA 5BXOA 1D8EA 3ULYA 1E7UA 1HZ4A 2Y0BG 2PM6A 1OCOE 1MHQA 3HRAA 2OOEA 3O4ZA 2KATA 3DPYA 1FT1A 1LF8A 4ANWA 3PNTB 4I2WA 2NXPA 1SQMA 1WY6A 3MYVA 3J5QB 1N9AA 3ZHEB 2DWZA 4Q69A 4KBQA 4JVSA 1BPOA 3NZUA 3L6AA 4TRQA 1K8KG 3IEGA 5BNWA 3L82A 2BEDA 3GYZA 1TN7A 4UWGA 4ATZD 5FT9A 2WQ6A 3B13A 4JHRA 2Y69E 5BV1A 4RQIA 2XZTG 5HRYA 4BTBA 3FUDA 5LX8A 3LJ3A 3BG1B 3CK7A 4DLOA 2C0LA 5FINA 4F53A 4CGWA 4GPMA 1X5BA 3Q15A 3CQCB 4V3IA 5J08A 5EKQD 4UWHA 1ELKA 3R9MA 3F6QA 3NB2A 3ESKA 3NQPA 5AQAA 2WXQA 4NRHB 4FHKA 4LUNU 3DSWA 3DPDA 2ETBA 4WNGA 4BSXA 4UI9J 3HXCA 2AJAA 2AVPA 3CVYA 3QOUA 2XRZA 3SFYA 2QY7A 4N5CA 1WDYA 3PDNA 4A55A 3UXGA 4GTVA 5EX0A 5IY5E 3ZN3A 1O1RA 5EDSA 1H2TC 5EX3A 4W9RA 1NI1A 3ONKA 5BPPA 5FZSA 5CMYA 5KNHD 3UKUG 5HS0A 1AWCB 4KZCA 5KJNA 1U3DA 2HYZA 3PRZA 4O1OA 2WMOA 1E96B 4MRUA 3KEAA 4IYPA 3IXEA 3LS8A 5AJLA 2KCVA 3AG4E 3TG5A 3HDXA 3U3WA 3OXFA 4GCOA 2V5FA 4NQ0A 4J8DA 4PH4B 3SBSA 4JW1A 3OAWA 3EUVA 4HORA 2GRQB 3L22A 1PY1A 2DZOA 2KBXA 1FVHA 2ZIRA 3WG7E 2VTBB 2GGFA 4I9EA 5ITZF 4YDEA 3TJPA 3PUJA 1Z6TA 2MRIA 4JHKA 4CT4A 4FU3A 4YDWA 3TXNA 5D0OD 5EYLA 4ATGA 4G24A 5CRVA 2Y1LE 1HX8A 5G2NA 2J09A 3S7DA 5J90A 3UM1A 3FTYA 2RKKA 4NACA 3KAEA 4K0RA 4YVOA 4G2VA 1ZBPA 4GTTA 4RSYA 4FJZA 2J4BA 4M7CA 1QZ2A 4U63A 3T5VA 5B1BE 2AXUA 5EN5D 4C0EA 5H7PA 5FQ4A 3Q9NC 3TWXA 3QWWA 3TWTA 2RFAA 4DX6D 3AU4A 1N0QA 3DXKG 4L7TA 2P9LG 1SZ9A 2WQHA 5JHBA 3CK8A 3B7RL 2V0PA 2X6FA 1JWFA 2BF0X 3FY4A 4GZDA 4ZHBA 4GYOA 3ZKJA
chains in the Genus database with same CATH topology
1NL4A 3E34A 2IEJA 1S64A 3E32A 1JCSA 1O1SA 1N4RA 1JCQA 3DSXA 3Q79A 3E37A 3EUVA 1TNUA 1TNOA 3DSTA 1X81A 4GTSA 4GTOA 2ZIRA 3E33A 2H6GA 3PZ1A 1FPPA 1TNBA 4YDEA 2R2LA 3Q7AA 1KZPA 3DSVA 4LNBA 4GTQA 3SFXA 3HXDA 1LTXA 2ZISA 3HXEA 3DSWA 1TNYA 1TNZA 1QBQA 3HXCA 1N4SA 4YDOA 1SA5A 3KSQA 4GTMA 2H6HA 4MBGA 3Q73A 1LD8A 3SFYA 1MZCA 3HXFA 2F0YA 1N4PA 2H6FA 1LD7A 3PZ3A 4L9PA 3DSUA 1D8EA 2H6IA 4GTVA 3Q75A 4GTRA 1D8DA 4GTTA 1O1RA 3DRAA 1N94A 1DCEA 1NI1A 4EHMA 1JCRA 3DSSA 1O1TA 1KZOA 1S63A 1SA4A 3DPYA 3HXBA 1FT1A 1N95A 3PZ2A 3Q78A 1N4QA 1N9AA 1FT2A 4LNGA 3C72A 1TN6A 3EU5A 3KSLA 4GTPA 3Q7FA 3E30A 1TN8A 2BEDA 1TN7A 3PZ4A 1O5MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NL4 A;  3E34 A;  2IEJ A;  1S64 A;  3E32 A;  1JCS A;  1O1S A;  1N4R A;  1JCQ A;  3DSX A;  3Q79 A;  3E37 A;  3EUV A;  1TNU A;  1TNO A;  3DST A;  1X81 A;  4GTS A;  4GTO A;  2ZIR A;  3E33 A;  2H6G A;  3PZ1 A;  1FPP A;  1TNB A;  4YDE A;  2R2L A;  3Q7A A;  1KZP A;  3DSV A;  4LNB A;  4GTQ A;  3SFX A;  3HXD A;  1LTX A;  2ZIS A;  3HXE A;  3DSW A;  1TNY A;  1TNZ A;  1QBQ A;  3HXC A;  1N4S A;  4YDO A;  1SA5 A;  3KSQ A;  4GTM A;  2H6H A;  4MBG A;  3Q73 A;  1LD8 A;  3SFY A;  1MZC A;  3HXF A;  2F0Y A;  1N4P A;  2H6F A;  1LD7 A;  3PZ3 A;  4L9P A;  3DSU A;  1D8E A;  2H6I A;  4GTV A;  3Q75 A;  4GTR A;  1D8D A;  4GTT A;  1O1R A;  3DRA A;  1N94 A;  1DCE A;  1NI1 A;  4EHM A;  1JCR A;  3DSS A;  1O1T A;  1KZO A;  1S63 A;  1SA4 A;  3DPY A;  3HXB A;  1FT1 A;  1N95 A;  3PZ2 A;  3Q78 A;  1N4Q A;  1N9A A;  1FT2 A;  4LNG A;  3C72 A;  1TN6 A;  3EU5 A;  3KSL A;  4GTP A;  3Q7F A;  3E30 A;  1TN8 A;  2BED A;  1TN7 A;  3PZ4 A;  1O5M A; 
#chains in the Genus database with same CATH topology
 2IEJ A;  4Q96 A;  5LOZ A;  4WND A;  5CEC B;  4XKB A;  1N4R A;  3E37 A;  4O1P A;  4U0S A;  3T9K A;  3CQG B;  3RO2 A;  2VSO E;  3E33 A;  2CHZ A;  4H7X A;  2E0I A;  4F6R D;  3Q7A A;  2DYS E;  2YHC A;  4XEI G;  2GW1 A;  4TV3 A;  4I1A A;  2L9B A;  5BT1 A;  3U66 A;  4UWK A;  1SW6 A;  1ZB1 A;  3Q49 B;  1N4S A;  4GTM A;  3S7F A;  1LD8 A;  2EIK E;  3CVL A;  1N4P A;  4WWP A;  4KXK B;  4PS7 A;  3QK0 A;  2CG3 A;  2V5Q C;  3DEO A;  1H2U A;  1DCE A;  4ACK A;  4K5C A;  4I1O B;  1K3Z D;  3JCK C;  1UJK A;  1KZO A;  4L2Y A;  2UWJ G;  3HIZ A;  1QQE A;  3MV2 B;  2CFU A;  1N95 A;  3ASO E;  2Y4T A;  4WAF A;  2CG2 A;  1SZA A;  1DNP A;  3CKC A;  4L1B A;  1FT2 A;  5ENT D;  2NC9 A;  1TN6 A;  3G2V A;  3FUL A;  3EU5 A;  3CVV A;  2GRO B;  2IF4 A;  3D9H A;  3MGB A;  4UQY A;  1EYH A;  1GW6 A;  4UI9 C;  3OXL A;  3ZXS A;  2XZD G;  2I6H A;  5JJ7 A;  5CBO A;  2R5S A;  3D9O A;  3JUI A;  4U7E B;  3V30 A;  3CHS A;  3RRN B;  4KVO A;  4FLB A;  1BI7 B;  4RLY A;  2R2L A;  2M63 A;  3MX3 A;  3FHE A;  3L17 A;  2KM4 A;  2GRP B;  2YIN A;  1HF8 A;  1N54 A;  1N52 A;  3FTX A;  4D10 C;  4EZL A;  4FP7 A;  4AV7 A;  4J8Y A;  5G04 J;  1OCZ E;  3BQO A;  4XI0 A;  4B89 A;  3DSU A;  5JMN D;  2Y4U A;  3RRU A;  3MZL B;  4U8V D;  3D3M A;  4FLH A;  2DVW A;  3W9F A;  4I9C A;  4I2Z A;  3G2W A;  1TYQ G;  3HXB A;  2OV8 A;  3L16 A;  3EHQ A;  1KT0 A;  3TAX A;  4DPR A;  1IQR A;  5E75 A;  3VLD A;  4LEU A;  2LNI A;  3APD A;  3FTU A;  2NYJ A;  2FUL A;  3CHO A;  3U4T A;  4GCN A;  2QZA A;  2WXH A;  4HQD A;  4G26 A;  1HXI A;  3LKU A;  3PVL A;  3IBE A;  2EIJ E;  4IUL A;  2WB2 A;  1A17 A;  2DYR E;  2P9I G;  5BXU A;  2BKK B;  4L23 A;  2P2C P;  3BU8 A;  4ANX A;  1UJJ A;  1O5M A;  5DBK A;  3IHV A;  1N0R A;  5CBN A;  5LCW J;  3PEV B;  3TWW A;  3FWV A;  4ILH B;  3PRE A;  3Q9U C;  1NA0 A;  3FUI A;  5EID A;  3ABK E;  2DCP A;  1TNB A;  2HM8 A;  2ETC A;  4GTQ A;  3HXD A;  3UT4 A;  1TNZ A;  2WM9 A;  3CHM A;  4DI4 A;  4JXT A;  2XS8 A;  1EF1 C;  2H6H A;  5ENP D;  3D9K A;  4GZ3 A;  1TJC A;  3Q73 A;  3CHP A;  3B95 A;  4PUC A;  2VGY A;  3PZ3 A;  4G8K A;  1ELW A;  1N94 A;  4U0U A;  3QAR A;  1SVX A;  1SA4 A;  4DUI A;  4HBD A;  4C9B B;  3JQ1 A;  4L2L A;  1V55 E;  4N2S A;  3SHF A;  4G1T A;  2X38 A;  2X6I A;  4AIF A;  4CDR A;  2XGM A;  3L08 A;  4C0M A;  4E6H A;  4XIF A;  1D9S A;  1OCC E;  5E76 A;  5T4Y A;  1FCH A;  4BET A;  4N3C A;  3K9I A;  2OEW A;  2WPV A;  2NSZ A;  1VDY A;  4EBA A;  2L0T B;  2XEH A;  2KCK A;  3UI2 A;  5D0Q D;  3ISM C;  2OVB A;  3EHN A;  5B3S E;  4DK5 A;  3ESL A;  2Y3A A;  5ANR A;  2L6B A;  3DSX A;  4OVV A;  2I1K A;  3FUH A;  4JEH A;  3TWR A;  1YA0 A;  1YCS B;  2LUH A;  4I6J A;  1JPL A;  1UN8 A;  2PM7 A;  3FEX A;  4HRL A;  2IOL A;  2J8S D;  1QBQ A;  3SD5 A;  4F7A A;  3TWU A;  1JUQ A;  3KSQ A;  3UIN C;  1Y8M A;  2F8X K;  4JB8 P;  3VTY A;  1OT8 A;  4F1S A;  4WWO A;  4IN3 B;  2DIW A;  3UT8 A;  1UN9 A;  3Q75 A;  2VGE A;  3B7B A;  3RJV A;  3QWP A;  4EHM A;  4FAD A;  4LG6 A;  2EIL E;  2J9Q A;  3AG1 E;  1HS6 A;  1K1A A;  2RFM A;  3MCX A;  3ZPJ A;  2XS1 A;  3C72 A;  1MX2 A;  2OCC E;  3UTM A;  5KBA A;  4A1G A;  3ZVV A;  2RG8 A;  1U2V G;  4P29 A;  3KD7 A;  3ZXP A;  4XI9 A;  2OEV A;  2LSU A;  4DX2 A;  3NZS A;  2X6H A;  5G04 C;  2WXR A;  4N3A A;  4U07 A;  2QYJ A;  3EIJ A;  3ZYM A;  2IO2 C;  4I6G A;  1X81 A;  5M72 A;  2WMN A;  5T8I A;  3N71 A;  4J0U A;  4GMR A;  2H6G A;  4PS8 A;  5AAO A;  2ION A;  1KZP A;  1E8W A;  4RG9 A;  3GZ1 A;  1INZ A;  2XCB A;  2ZIS A;  1TNY A;  2X6J A;  3AS8 A;  4YDO A;  4MBG A;  3FDH A;  2WXO A;  2LO6 A;  1Z3X A;  3P2B A;  4RVB A;  3UKR G;  5FJY A;  1W3B A;  3V31 A;  4APF A;  2V8S E;  1IQU A;  2H6I A;  1QYM A;  2FBN A;  3FUE A;  3Q5M A;  5FZR A;  2CHW A;  3ZEF A;  4GB9 A;  2V4L A;  3TWS A;  3CVQ A;  5BV0 A;  4GA2 A;  3FTV A;  4TXQ A;  3RKV A;  5CED B;  2ETA A;  3QWV A;  2VYI A;  1KLX A;  5CHE E;  1IHB A;  4G25 A;  4HOQ A;  4B0Z A;  5LCW C;  4CDN A;  2AXV A;  3ZGQ A;  2X6K A;  1E90 A;  3L13 A;  4N3B A;  5JJ6 A;  4OAV B;  4O60 A;  4KZ0 A;  1PAQ A;  4H7Y A;  3IKO B;  4FJY A;  1MX6 A;  3ENE A;  1A5E A;  2PZI A;  2R03 A;  3ONL A;  4TXP A;  3PZ4 A;  2XGO A;  4YND A;  3E34 A;  3CR3 A;  4AOF A;  3C3R A;  4GTO A;  2F37 A;  4NUR A;  1TEZ A;  3QJZ A;  3FEY A;  3R9A B;  2J49 A;  4UQZ A;  3SFX A;  1YYH A;  3HXE A;  2IFU A;  5KJL A;  3LYA A;  1OWM A;  5G05 J;  3NOC D;  5JA4 D;  3CV0 A;  1E8Y A;  3RAU A;  4N2Q A;  3ASG A;  4PS3 A;  3D9L A;  4I6E A;  4GPK A;  4HOT A;  2EIN E;  4GML A;  3JUE A;  1OCR E;  2WVI A;  1MJ0 A;  1D8D A;  4EPZ A;  1WAO 1;  3SFZ A;  3QKY A;  4U96 D;  4WWN A;  3FU6 A;  4GZC A;  2ILR A;  4JHJ A;  3HVE A;  4C48 B;  3CVX A;  5A7D B;  3PZ2 A;  3HHM A;  2FO7 A;  3AJI A;  3CST A;  4JEU A;  3RU0 A;  1N4Q A;  4EZK A;  5ARF A;  2LXM A;  3I4R B;  4CDM A;  2PNN A;  3R7R A;  1HG5 A;  3ZYK A;  3KSL A;  4EEC A;  3AG3 E;  3ZW3 A;  4N5Q A;  2P9U G;  2IOS A;  4NIK A;  4J7W A;  2ZU6 B;  4FHJ A;  2BTD A;  4GZ5 A;  1IHG A;  3UM2 A;  3UX4 A;  2PQR A;  2VGX A;  1ZU2 A;  5JJT A;  4KT6 B;  3E32 A;  4JL0 A;  4HI8 A;  4BX9 A;  2HO1 A;  5G55 A;  4J6I A;  3ZFW A;  3DBS A;  3ASD A;  4ANU A;  4UUC A;  3TWV A;  1LTX A;  3I5P A;  5CEA A;  4AJW A;  3FUJ A;  5HQ8 A;  1TR4 A;  5EYP F;  4J8E A;  4TUU A;  5BW8 C;  5AN8 A;  5CCM A;  1U3C A;  4XZ4 A;  4DX5 D;  4OYS A;  4BT8 A;  1E7V A;  1H19 A;  3B7U X;  4JD2 G;  4KVM A;  1H6P A;  1O1T A;  3UQ3 A;  3FFL A;  5KWD A;  1XNF A;  3CK9 A;  3LXU X;  3Q78 A;  5KNG A;  5AQB A;  2OVF A;  3PS6 A;  3NF1 A;  3TGO A;  3APC A;  4HLL A;  2R17 C;  2V4H C;  2P58 C;  1NP7 A;  2YHE A;  2OND A;  3MJW A;  3UT7 A;  3Q7F A;  4JPS A;  1TN8 A;  3RIB A;  2XPZ A;  1RW2 A;  2WXL A;  4TUM A;  4DRX E;  1HO8 A;  2P9K G;  3FU0 A;  4XKC A;  3EIQ C;  4WUY A;  4G23 A;  5EIB E;  1IXV A;  3VTX A;  4A1S A;  3Q79 A;  4I1M A;  2VJ8 A;  4Z68 A;  2I1J A;  3P1U A;  3UM3 A;  3RRM B;  3PH0 C;  4AVX A;  1E8Z A;  2XEE A;  5ARG A;  4CT0 A;  2WXN A;  2KC7 A;  2MYO A;  3UIO C;  5AYW D;  3APF A;  3EHM A;  1JWG A;  1S0P A;  1OY3 D;  3SF4 A;  2LAH A;  1EDU A;  5B1A E;  2FF4 A;  4HLE A;  2YNQ A;  4LSZ E;  2ZGD A;  4K5A B;  5AIJ A;  4B8C B;  5FTP A;  1BD8 A;  4HRN A;  4O6F A;  3L54 A;  3AAA C;  2H6F A;  3V2O A;  4DX7 D;  5JHA A;  1LD7 A;  4A63 B;  2L0I A;  4J8S A;  2JAB A;  3DRA A;  3SBT B;  2I9C A;  1NA3 A;  3BUA A;  4LCT A;  3RK6 A;  3ZYQ A;  4N39 A;  2BUG A;  3ULE G;  4GYW A;  4LRZ A;  2VSX E;  1HFA A;  2IY0 C;  3LVR E;  2MOW A;  4BER A;  4GTP A;  2IO3 C;  2ZGG A;  4U04 A;  5D66 A;  2GRR B;  2VQ2 A;  5C1D A;  3HVE B;  4K5B A;  5G05 C;  3D9N A;  4APO A;  3ZNG A;  2EQX A;  1ELR A;  1FVF A;  5CCL A;  4AY5 A;  3LVQ E;  2HE0 A;  1O1S A;  1OWO A;  4G8L A;  4BTA A;  5AEN A;  3B7S A;  3LEW A;  3ABL E;  4R7L A;  1FPP A;  4HI9 A;  4JA9 A;  3D9M A;  2RD0 A;  2KZT A;  2ZXW E;  3EJN A;  5C2Y A;  4GZ6 A;  3VLF A;  3CEQ A;  2VGX B;  1BU9 A;  3D9J A;  3L9T A;  1HE8 A;  2E2E A;  4DLQ A;  4Y6C A;  2AW6 A;  3VLE A;  4KYO B;  3BG0 B;  3LDZ A;  4WNF A;  5KJM A;  2MHK A;  1Z3Y A;  5FQ8 A;  2GRL A;  4AP2 A;  3CIA A;  3UPV A;  4F3V A;  4HRM B;  1Q2Z A;  2R02 A;  2XHE A;  3RO3 A;  1YMP A;  3MKQ A;  3S7J A;  3E30 A;  2IU1 A;  4HFG A;  2BKG A;  4ZFH A;  3QC1 A;  3ZU7 B;  3GW4 A;  4YVQ C;  4J8F A;  1IYG A;  1DC2 A;  2WXM A;  3SY2 A;  3U64 A;  1UOH A;  4IRU A;  4WNE A;  2P9N G;  5AAR A;  4F1P A;  1JCS A;  5EIL A;  5ENQ D;  5CER B;  2PL2 A;  3JYS A;  2Q7F A;  3CGH A;  3QB2 A;  1OUV A;  2C0M A;  3SO8 A;  3ABM E;  5ENR D;  3FUM A;  4MLP A;  2KXP C;  3NBN B;  1Y6I A;  3CSF A;  3ZRH A;  5BUZ A;  3U9W A;  3OTN A;  4TXR A;  4DX1 A;  2QFC A;  4EBA G;  3PUK A;  1Z5S C;  3IV0 A;  4L9P A;  2FO1 E;  2F8Y A;  5FWQ A;  1XGW A;  5LFA A;  4RG6 A;  3DWL G;  2FI7 A;  1JCR A;  3R7Q A;  2J07 A;  4ILI A;  1S63 A;  3MV3 B;  4Q94 A;  4B94 A;  2QYU A;  4LNG A;  1BI8 B;  1NZN A;  2EIM E;  2X3M A;  5ANL A;  3J5P A;  1RZ4 A;  3SNX A;  1AP7 A;  3MKR A;  1BLX B;  3JXI A;  3QNK A;  1E8X A;  3CVP A;  3ML9 A;  1KPS B;  1V54 E;  3EU9 A;  4QFV A;  5CRU A;  1EPU A;  2WQ7 A;  1B89 A;  4JC8 A;  2WXK A;  4G11 A;  4Y6W A;  3URZ A;  4UWL A;  4GA1 A;  4HOS A;  1OWN A;  1NL4 A;  3UM0 A;  4A3V A;  2XPI A;  2C2L A;  1H2V C;  1TNU A;  1OXJ A;  5AJD A;  3ASN E;  3S7B A;  2VSN A;  3V79 K;  4PDX A;  2HR2 A;  3CVN A;  3AU5 A;  3QDN A;  3CHR A;  4LNU D;  1MX4 A;  4ME2 A;  4B93 B;  4KMO A;  3AS4 A;  3T5X A;  1HG2 A;  4HXI A;  5DIZ A;  2F0Y A;  2JLB A;  3EHR A;  2XEV A;  4UWF A;  5CMW A;  4GTR A;  1MQS A;  4FC8 A;  4OVU A;  2A5U A;  3DSS A;  2KZT B;  3FTW A;  2R05 A;  3LY7 A;  4CZ2 D;  2GRM A;  3FU5 A;  3QAQ A;  3KEZ A;  4DJA A;  3PE3 A;  2R59 A;  4BX8 A;  3Q4A B;  2XQ0 A;  3SQV A;  4CYM D;  2IQC A;  4HS2 A;  5A23 A;  1TJF A;  3FUF A;  3CKB A;  4GMJ A;  5ENS D;  4EZJ A;  5FQ6 A;  4AM9 A;  1MYO A;  4GA0 A;  3G2T A;  5AQ9 A;  2KCL A;  3SI5 A;  3GZS A;  4HVB A;  2PQN A;  1KT1 A;  3LCA A;  2UY1 A;  1TNO A;  3DST A;  3G2S A;  4M3O A;  3LJN A;  3C98 A;  3JQ0 A;  3MKQ B;  2P9P G;  3PZ1 A;  3FUN A;  4CCA A;  3DSV A;  2JEK A;  4FA6 A;  5FIO A;  5HI7 A;  4XE0 A;  3FU3 A;  5KJK A;  4ANV A;  3ASH A;  3I3N A;  3CHQ A;  4AXH A;  4BSZ B;  4HB5 A;  3UMV A;  3ZHE A;  5ENO D;  1MZC A;  4OAU C;  1UG3 A;  3ULQ A;  3UUX A;  3CVW A;  3IHY A;  2XGS A;  3TXM A;  1H6O A;  2AXZ A;  4AY6 A;  3AS5 A;  3PZD A;  3ZUV B;  1K1B A;  3JXJ A;  1NFI E;  5HKP A;  4GU5 A;  3S2A A;  3OXG A;  3GZ2 A;  3C3O A;  2P9S G;  4E85 A;  3EDT B;  3FH7 A;  2VSY A;  4XX5 A;  2DZN A;  3LPZ A;  3NAW A;  3O48 A;  3ZYL A;  4I43 A;  3HG0 D;  5ENN A;  3E4B A;  4B8A A;  2XEN A;  2LSV A;  5D2M C;  3T8M A;  5LP0 A;  1S64 A;  2B6C A;  3FH8 A;  2DBA A;  4HOU A;  3C3Q A;  4ACL A;  4GTS A;  3FTS A;  3HYM B;  1HU3 A;  2J4D A;  5FQ7 A;  3B7T A;  2LXL A;  5AQ7 A;  1WG0 A;  2WXG A;  3I4G A;  3CVU A;  3KS2 A;  2IJG X;  4BFR A;  2WXJ A;  2WXP A;  3WXX A;  4BES A;  3LY9 A;  4CGV A;  1UW4 B;  1S70 B;  4CRW A;  4DI3 A;  5A6C A;  1SA5 A;  1OWP A;  4GYY A;  3D9I A;  1DVP A;  4U0Z A;  4GAA A;  2XPY A;  4UI9 K;  3DEP A;  2CFZ A;  3MEK A;  3C5R A;  4A3T A;  3CLJ A;  2A5E A;  2J08 A;  4U8Y D;  3TL5 A;  3FH5 A;  4YDY A;  2XCC A;  2XRY A;  2A4Z A;  3DXM G;  2I2O A;  4BY6 A;  2CHX A;  2FEZ A;  4HNA D;  2B0O E;  3G2U A;  3D9P A;  3BEE A;  3Q47 B;  4K03 A;  3W9G A;  3FP3 A;  5KCM A;  4BT9 A;  1N11 A;  4QQI A;  4JZY A;  2YQ8 A;  4UQX A;  2WXI A;  3AG2 E;  1IKN D;  4EQF A;  3MA5 A;  2VTB A;  3ASF A;  3LY8 A;  1L5J A;  3SGH A;  3SZ7 A;  3ZIM A;  4FUL A;  4U8H A;  2GRN B;  2L6J A;  3T8K A;  4ILG A;  1HH8 A;  3PEU B;  2AWI A;  4AEZ C;  3FTZ A;  1DCQ A;  3TWQ A;  1JCQ A;  1H6K A;  3UIP C;  3FUK A;  1OWL A;  1WM5 A;  1H0A A;  2QC9 A;  3X2Q E;  3V2X A;  1QNF A;  4BEP A;  2WXF A;  4JA7 A;  4BWR A;  5T3R A;  3RSE G;  5FZQ A;  3PNL B;  4LNB A;  3TG4 A;  1PC2 A;  4U95 D;  4X8Q A;  1G3N B;  4MKT A;  3PE4 A;  2LAI A;  3ML8 A;  4MS6 A;  4CEM A;  4URK A;  4ABN A;  3HXF A;  2UY1 B;  3NOG D;  4LER A;  4I17 A;  1P5Q A;  5BXO A;  1D8E A;  3ULY A;  1E7U A;  1HZ4 A;  2Y0B G;  2PM6 A;  1OCO E;  1MHQ A;  3HRA A;  2OOE A;  3O4Z A;  2KAT A;  3DPY A;  1FT1 A;  1LF8 A;  4ANW A;  3PNT B;  4I2W A;  2NXP A;  1SQM A;  1WY6 A;  3MYV A;  3J5Q B;  1N9A A;  3ZHE B;  2DWZ A;  4Q69 A;  4KBQ A;  4JVS A;  1BPO A;  3NZU A;  3L6A A;  4TRQ A;  1K8K G;  3IEG A;  5BNW A;  3L82 A;  2BED A;  3GYZ A;  1TN7 A;  4UWG A;  4ATZ D;  5FT9 A;  2WQ6 A;  3B13 A;  4JHR A;  2Y69 E;  5BV1 A;  4RQI A;  2XZT G;  5HRY A;  4BTB A;  3FUD A;  5LX8 A;  3LJ3 A;  3BG1 B;  3CK7 A;  4DLO A;  2C0L A;  5FIN A;  4F53 A;  4CGW A;  4GPM A;  1X5B A;  3Q15 A;  3CQC B;  4V3I A;  5J08 A;  5EKQ D;  4UWH A;  1ELK A;  3R9M A;  3F6Q A;  3NB2 A;  3ESK A;  3NQP A;  5AQA A;  2WXQ A;  4NRH B;  4FHK A;  4LUN U;  3DSW A;  3DPD A;  2ETB A;  4WNG A;  4BSX A;  4UI9 J;  3HXC A;  2AJA A;  2AVP A;  3CVY A;  3QOU A;  2XRZ A;  3SFY A;  2QY7 A;  4N5C A;  1WDY A;  3PDN A;  4A55 A;  3UXG A;  4GTV A;  5EX0 A;  5IY5 E;  3ZN3 A;  1O1R A;  5EDS A;  1H2T C;  5EX3 A;  4W9R A;  1NI1 A;  3ONK A;  5BPP A;  5FZS A;  5CMY A;  5KNH D;  3UKU G;  5HS0 A;  1AWC B;  4KZC A;  5KJN A;  1U3D A;  2HYZ A;  3PRZ A;  4O1O A;  2WMO A;  1E96 B;  4MRU A;  3KEA A;  4IYP A;  3IXE A;  3LS8 A;  5AJL A;  2KCV A;  3AG4 E;  3TG5 A;  3HDX A;  3U3W A;  3OXF A;  4GCO A;  2V5F A;  4NQ0 A;  4J8D A;  4PH4 B;  3SBS A;  4JW1 A;  3OAW A;  3EUV A;  4HOR A;  2GRQ B;  3L22 A;  1PY1 A;  2DZO A;  2KBX A;  1FVH A;  2ZIR A;  3WG7 E;  2VTB B;  2GGF A;  4I9E A;  5ITZ F;  4YDE A;  3TJP A;  3PUJ A;  1Z6T A;  2MRI A;  4JHK A;  4CT4 A;  4FU3 A;  4YDW A;  3TXN A;  5D0O D;  5EYL A;  4ATG A;  4G24 A;  5CRV A;  2Y1L E;  1HX8 A;  5G2N A;  2J09 A;  3S7D A;  5J90 A;  3UM1 A;  3FTY A;  2RKK A;  4NAC A;  3KAE A;  4K0R A;  4YVO A;  4G2V A;  1ZBP A;  4GTT A;  4RSY A;  4FJZ A;  2J4B A;  4M7C A;  1QZ2 A;  4U63 A;  3T5V A;  5B1B E;  2AXU A;  5EN5 D;  4C0E A;  5H7P A;  5FQ4 A;  3Q9N C;  3TWX A;  3QWW A;  3TWT A;  2RFA A;  4DX6 D;  3AU4 A;  1N0Q A;  3DXK G;  4L7T A;  2P9L G;  1SZ9 A;  2WQH A;  5JHB A;  3CK8 A;  3B7R L;  2V0P A;  2X6F A;  1JWF A;  2BF0 X;  3FY4 A;  4GZD A;  4ZHB A;  4GYO A;  3ZKJ A; 
#chains in the Genus database with same CATH homology
 1NL4 A;  3E34 A;  2IEJ A;  1S64 A;  3E32 A;  1JCS A;  1O1S A;  1N4R A;  1JCQ A;  3DSX A;  3Q79 A;  3E37 A;  3EUV A;  1TNU A;  1TNO A;  3DST A;  1X81 A;  4GTS A;  4GTO A;  2ZIR A;  3E33 A;  2H6G A;  3PZ1 A;  1FPP A;  1TNB A;  4YDE A;  2R2L A;  3Q7A A;  1KZP A;  3DSV A;  4LNB A;  4GTQ A;  3SFX A;  3HXD A;  1LTX A;  2ZIS A;  3HXE A;  3DSW A;  1TNY A;  1TNZ A;  1QBQ A;  3HXC A;  1N4S A;  4YDO A;  1SA5 A;  3KSQ A;  4GTM A;  2H6H A;  4MBG A;  3Q73 A;  1LD8 A;  3SFY A;  1MZC A;  3HXF A;  2F0Y A;  1N4P A;  2H6F A;  1LD7 A;  3PZ3 A;  4L9P A;  3DSU A;  1D8E A;  2H6I A;  4GTV A;  3Q75 A;  4GTR A;  1D8D A;  4GTT A;  1O1R A;  3DRA A;  1N94 A;  1DCE A;  1NI1 A;  4EHM A;  1JCR A;  3DSS A;  1O1T A;  1KZO A;  1S63 A;  1SA4 A;  3DPY A;  3HXB A;  1FT1 A;  1N95 A;  3PZ2 A;  3Q78 A;  1N4Q A;  1N9A A;  1FT2 A;  4LNG A;  3C72 A;  1TN6 A;  3EU5 A;  3KSL A;  4GTP A;  3Q7F A;  3E30 A;  1TN8 A;  2BED A;  1TN7 A;  3PZ4 A;  1O5M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...