1AP7A

P19-ink4d from mouse, nmr, 20 structures
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
168
structure length
168
Chain Sequence
GSMLLEEVCVGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSPAVALELLKQGASPNVQDASGTSPVHDAARTGFLDTLKVLVEHGADVNALDSTGSLPIHLAIREGHSSVVSFLAPESDLHHRDASGLTPLELARQRGAQNLMDILQGHMMIPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle inhibitor
molecule keywords P19-INK4D
publication title Structure of the cyclin-dependent kinase inhibitor p19Ink4d.
pubmed doi rcsb
source organism Mus musculus
total genus 31
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 1997-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1ap7A00
1MX2A 2Y1LE 1IXVA 2DVWA 5EYPF 1BI8B 3B7BA 2HE0A 3HRAA 4LG6A 1BD8A 1YYHA 3T9KA 5ENTD 4OAVB 1SVXA 1QYMA 3ZUVB 3V2XA 5CEAA 4U8YD 3ZKJA 3IXEA 2MYOA 4BETA 5BXOA 4G8KA 3EU9A 3NOCD 3TWXA 4GMRA 4O1PA 2ZGGA 1DCQA 5FIOA 2P2CP 3JXIA 4HB5A 4K5BA 2AJAA 5AQ7A 4DX2A 3TWUA 4NIKA 3UI2A 5CECB 4HBDA 2Y0BG 2PNNA 2XEHA 3W9FA 4CZ2D 4DX1A 3TWQA 5ITZF 4QFVA 2ZGDA 3DEPA 3JXJA 4U96D 1BLXB 1N0RA 4YDWA 3D9HA 3J5PA 4HRMB 5AQBA 1OY3D 3T8KA 1S70B 2XZDG 3UXGA 3NBNB 4BEPA 2J8SD 5ENRD 4U95D 2ETBA 5KNHD 4G8LA 3W9GA 2QC9A 4K5CA 4N5QA 2KXPC 1WG0A 3V31A 3EHQA 3TWWA 5AARA 4HRLA 3SO8A 5CEDB 1IKND 2F8YA 4OAUC 2V4HC 3V79K 3V30A 4HQDA 5EIDA 3J5QB 5JA4D 2RFAA 4TUMA 3B95A 4YDYA 5EIBE 2XENA 5HS0A 5CBOA 1UOHA 1K3ZD 4HRNA 4F1PA 1YMPA 2F8XK 4C48B 5EN5D 2XEEA 2RFMA 2B0OE 4LSZE 3HG0D 4DUIA 2QYJA 2JABA 1MX6A 2BKGA 5ENSD 5FINA 3TWTA 2L6BA 4BSZB 3AAAC 4HI8A 3JUEA 5CERB 1AWCB 3AJIA 4JB8P 4J7WA 4B93B 5EYLA 2DWZA 2ETCA 2DZOA 2NYJA 3V2OA 1NFIE 3TWSA 4QQIA 4DX5D 4HLLA 5BXUA 1TR4A 1SW6A 2FO1E 1BU9A 5AAOA 5AQ9A 4BERA 3C5RA 4ZFHA 4Z68A 5ENOD 4DX6D 5D66A 3ZNGA 5AQAA 1DC2A 5HKPA 5KNGA 3EHRA 4U8VD 4CYMD 2BKKB 1K1BA 1IHBA 3LJNA 3NOGD 4UUCA 5ENQD 4DX7D 3KEAA 5ENPD 3DEOA 2F37A 3ZU7B 2KBXA 2A5EA 1YCSB 3Q9UC 1AP7A 2ETAA 4F6RD 4GPMA 5KWDA 1BI7B 5AN8A 4O1OA 1MJ0A 2V5QC 1D9SA 3UTMA 1K1AA 3Q9NC 1MX4A 2XZTG 3TWVA 4DRXE 4J8YA 4HNAD 4A63B 1A5EA 4HI9A 1MYOA 5EILA 5HRYA 4RLYA 5JMND 2VGEA 3TWRA 1WDYA 5KBAA 1G3NB 5CBNA 4ZHBA 4ATZD 1N0QA 4K5AB 1OT8A 4O60A 1N11A 2DZNA 4LNUD 3F6QA 4BESA
chains in the Genus database with same CATH superfamily
4N39A 1YYHA 1LD7A 4IULA 3UM0A 3ZUVB 3QAQA 2CFZA 3PZ4A 3MKQA 3AS5A 1OWMA 3PUKA 1ZU2A 5BV0A 2X6FA 1O1TA 3S7FA 2XEHA 4GAAA 2WMOA 5DBKA 5ITZF 1HX8A 2ZGDA 3OXLA 4J0UA 3QWVA 3MA5A 5KJLA 3W9GA 3NF1A 3CVUA 5AARA 3FWVA 1HXIA 1SQMA 1QNFA 2WXQA 4TUMA 3ZXSA 4FP7A 3QOUA 1UOHA 2F8XK 2V0PA 4LSZE 2YNQA 5FINA 1D8DA 4B93B 3EHNA 5HI7A 1HZ4A 2P9LG 2NYJA 4UI9J 4DLOA 5EDSA 3G2SA 4HLEA 4JPSA 4OVUA 1D9SA 4BTBA 4F7AA 2XHEA 4A63B 1A5EA 2LXLA 5HRYA 4ZHBA 4IN3B 4D10C 3PEUB 3CQCB 1Z6TA 5KCMA 3GZ2A 3CHSA 2C0MA 4RQIA 4FHKA 1QBQA 1D8EA 2GRRB 2KATA 4DX2A 2FBNA 2IU1A 3G2VA 4I1AA 4CDRA 4K0RA 3TGOA 1HS6A 2J8SD 2OCCE 3ZYKA 4TXRA 4F53A 4UWKA 2LNIA 1S63A 4HRLA 3TG5A 4HQDA 2DBAA 2WQHA 3VTXA 3L08A 5CRUA 4XKBA 1OWPA 2I6HA 1E90A 2L6BA 1TN8A 3L13A 3PE3A 5G04J 3MV2B 1UJKA 3R9MA 4GTTA 5G05C 3L17A 5HKPA 2CG3A 2XCBA 3RK6A 4GU5A 2XGOA 5C1DA 1XGWA 2H6HA 1X5BA 3UT8A 4F6RD 4GPMA 4AIFA 2P9NG 3ABLE 2IOLA 3KEZA 4LRZA 2KZTA 4HOUA 2J07A 3RJVA 2IY0C 3ZFWA 3FUMA 3P2BA 4UWGA 1BI8B 4GA2A 3EIJA 4KVOA 3SFZA 1JWFA 3LDZA 5CEAA 3Q5MA 2P9PG 3U66A 3FTSA 3Q7AA 3LVRE 4GMRA 4GZDA 2ZGGA 2WB2A 2DCPA 3SF4A 1S0PA 2IO3C 4CZ2D 3MX3A 3TAXA 3SBSA 3U64A 2ZIRA 3PZ3A 3VLFA 4MLPA 3UXGA 2Y69E 3ZHEA 4TRQA 4U95D 2WXJA 3CVLA 4ANUA 2R5SA 3SGHA 4Q69A 3ZYMA 4J8FA 5HS0A 1K3ZD 4ANWA 1IQRA 2R59A 5EN5D 1GW6A 2CFUA 4JZYA 4J7WA 3ML8A 1QQEA 3ASDA 3FUDA 3WG7E 1MZCA 5ENOD 2HO1A 5ANLA 1A17A 4G2VA 4JVSA 5JHAA 2F37A 3ZU7B 2ETAA 1TNBA 3CIAA 2XZTG 4WWOA 2M63A 3FUKA 4N2QA 5T3RA 4U0ZA 1TJCA 4GCNA 4HXIA 3FUIA 4FHJA 1WM5A 2L0IA 3FY4A 2WPVA 3S7JA 1SVXA 3V2XA 2WXOA 1HG5A 1O5MA 1H0AA 1QZ2A 3VLEA 3BG1B 2FF4A 2AJAA 4UQZA 2Y3AA 1JPLA 4HVBA 1U2VG 3TWQA 4RSYA 3E37A 3D9PA 1YA0A 3OTNA 4WNDA 1S70B 4BEPA 1BPOA 4Y6CA 3N71A 4BX9A 4B0ZA 4OAUC 5FZSA 1Z3XA 4A1GA 5EIDA 4F3VA 3GZSA 3RRMB 4U04A 3R9AB 4JA7A 3AU4A 4WNEA 3AJIA 4L2YA 1EPUA 2E2EA 3FTYA 3RO2A 1N95A 3I5PA 1SW6A 1BU9A 1FT1A 3IV0A 2CG2A 2J09A 2VSYA 3PNTB 5KNGA 3UINC 3EHRA 2ONDA 2L9BA 3NOGD 3DEOA 1X81A 4LERA 4XEIG 3C3RA 2V5QC 4JL0A 4GZ6A 3HYMB 3ISMC 1N4SA 3MGBA 4AM9A 4XI0A 4I1OB 2WXIA 3AG2E 4BFRA 2ILRA 2A4ZA 2OOEA 2BF0X 3U4TA 3I3NA 1DCEA 3PE4A 1MX2A 1E8WA 1UG3A 5FQ6A 3PS6A 3FFLA 3ZXPA 2OV8A 5AJLA 4AY6A 4CGVA 4BETA 4KZ0A 2WXNA 2J49A 2QY7A 5DIZA 2LSUA 1OXJA 4OYSA 4DX1A 2A5UA 3CGHA 3CVQA 1OY3D 3DSWA 2XZDG 1OWOA 4KXKB 2ZU6B 3ABKE 2WQ6A 3QWPA 2VQ2A 5FZRA 3V31A 1JWGA 3CKCA 2F8YA 2AVPA 2RFAA 5EIBE 4CEMA 1K8KG 2WXRA 3T5XA 2H6IA 2YHCA 1Y8MA 3C3OA 3HDXA 5JJTA 4HFGA 4QQIA 4KBQA 3FEYA 4XX5A 2R2LA 4GB9A 4J8EA 4EHMA 3KEAA 4AOFA 2R05A 4I6EA 5A7DB 2LXMA 4GTRA 4TXPA 4FJYA 4HOQA 3CSTA 2GW1A 2LUHA 1OT8A 3T8MA 4EECA 2VTBA 4A3TA 4GMLA 1OCZE 2NSZA 4A1SA 2IQCA 3LCAA 1N52A 1HH8A 4YNDA 2YINA 4URKA 1INZA 3Q47B 1E7VA 4UQXA 3U3WA 2IOSA 4G11A 4YDOA 2QZAA 1KZOA 2WVIA 4XKCA 5ARFA 5CRVA 4RG6A 4G8LA 3KAEA 4B8CB 2X3MA 2V4HC 4AP2A 2XRZA 4YDYA 1H2UA 4M3OA 3E34A 3ENEA 4RVBA 2QYJA 1AWCB 1H6PA 5ARGA 2DYSE 2IO2C 2OVBA 4EZJA 4E6HA 2WXMA 2WMNA 5CHEE 1RZ4A 2Y4UA 2EINE 4Z68A 3ZNGA 5KJNA 1RW2A 3WXXA 3PDNA 5BV1A 1NA3A 3PVLA 4FLHA 3ZYLA 1NI1A 4JC8A 4A3VA 4UQYA 4U7EB 4LNGA 4BWRA 1V55E 1TYQG 2DYRE 3HRAA 5C2YA 3CHRA 3UKRG 2P9UG 3ASGA 4G26A 4TUUA 3R7QA 1KLXA 3TWXA 3FUFA 3L22A 4O1PA 4HOSA 1DCQA 5FIOA 3D9KA 4FULA 4K5BA 3D9JA 2KC7A 2Y0BG 3O4ZA 5JJ6A 3FULA 3UM1A 3SQVA 3IHVA 3OXGA 2XPZA 2HM8A 5BT1A 2EIKE 1W3BA 5LCWC 3RU0A 2CHZA 5LFAA 3CHOA 3SO8A 3FH7A 3TXMA 3AS8A 2IONA 3SFXA 2KCLA 1JUQA 2VGYA 4JHJA 3LKUA 3SNXA 5ENSD 2C0LA 2NC9A 4H7XA 3LXUX 2VSXE 1TEZA 1NL4A 2ETCA 2KZTB 3SD5A 3PNLB 5AAOA 4KZCA 4DX6D 3HXEA 4J6IA 3E32A 4PS3A 1IHBA 4N3BA 1Z5SC 1TJFA 4CDNA 3T5VA 4F1SA 4C0MA 3L6AA 1UN9A 2QYUA 2VGEA 2MRIA 1S64A 5JJ7A 1DNPA 1O1SA 4NRHB 2Y1LE 2VSNA 3DSTA 5FWQA 3MEKA 3B7BA 1H2VC 5FT9A 4PDXA 1HO8A 5G2NA 2ZXWE 1OUVA 4LNBA 4C0EA 2V8SE 4WWNA 3KSQA 5D0QD 2YHEA 1JCSA 4WAFA 3UMVA 3PREA 3ZGQA 3UI2A 4PS8A 2X6JA 1HF8A 1BLXB 5AQBA 4XE0A 3PEVB 4ILHB 2KXPC 3C72A 1ELKA 2WXKA 2I9CA 1LTXA 3BG0B 4UWHA 3Q79A 3Q73A 1WY6A 3LYAA 4JD2G 4HRNA 3MZLB 4W9RA 1MX6A 5CERB 3HIZA 3JUEA 3AG4E 3DSUA 5T4YA 1Q2ZA 2DWZA 3DPDA 2B6CA 2DZOA 3QB2A 4WWPA 5KJMA 1U3CA 3TL5A 3C5RA 4ZFHA 2IF4A 1NZNA 3MYVA 5G05J 1SA5A 1N94A 3CQGB 4L23A 1SA4A 4AY5A 4HS2A 1MJ0A 4JEUA 3Q9NC 1MQSA 3KD7A 1UW4B 3Q49B 5CMYA 1N0QA 3L54A 4LNUD 3VLDA 2X38A 3FTZA 4B94A 1Y6IA 5AENA 3QKYA 1H6KA 3MCXA 2X6IA 3TG4A 4K03A 4C9BB 1OWLA 3RRNB 3EHMA 3DXMG 2AWIA 3JXIA 2J4DA 4XZ4A 2C2LA 5CECB 1NP7A 4GMJA 3W9FA 5ENNA 4JW1A 4I9CA 4HRMB 4GTPA 3UPVA 1KZPA 1WG0A 3UUXA 3JCKC 3FEXA 4I6GA 4L1BA 2ZISA 4XI9A 1O1RA 3B7UX 3FHEA 1IQUA 5T8IA 3QC1A 4N5CA 3FU6A 5IY5E 3B7SA 1E96B 5BXUA 1E8XA 3QWWA 4AEZC 5D66A 1DC2A 4EPZA 3D9MA 4U8VD 1E8ZA 4ILIA 4GTVA 4Q96A 2FEZA 4APFA 1E8YA 3EJNA 3RAUA 3Q15A 3CVWA 2MOWA 3FH8A 5KBAA 5FQ7A 4HORA 2YQ8A 2LAIA 2VYIA 3AG3E 4WNGA 4ACLA 4O60A 5D2MC 2BTDA 4GTMA 3SFYA 2I2OA 4Y6WA 4OAVB 3NB2A 5EX3A 4ACKA 2PZIA 2AXUA 3ULYA 4APOA 4U0SA 1ZB1A 4TV3A 2NXPA 3CVNA 2P2CP 2XGSA 5ANRA 2FO7A 2BUGA 3D3MA 3ZPJA 2J9QA 3JXJA 3RSEG 5E75A 1HG2A 4EZKA 1KPSB 4YDEA 5H7PA 4AVXA 1EDUA 4U63A 4BSXA 3L16A 3VTYA 2UY1B 4GYYA 2VGXB 3HXDA 1YMPA 1N4RA 2BEDA 1EYHA 3EUVA 4DUIA 1XNFA 3AAAC 4I1MA 3DSVA 1PAQA 5FQ8A 1IYGA 3ABME 4N3AA 4CDMA 1N54A 2R17C 3HXCA 4O1OA 3ZIMA 4Q94A 2R03A 2I1KA 4PS7A 5LP0A 4ATGA 1MYOA 3D9OA 1OCRE 5EKQD 3FP3A 3O48A 4JEHA 3F6QA 3GW4A 3HVEB 4YVOA 1JCQA 3ASFA 4DPRA 5EYPF 3CK8A 4BY6A 2KM4A 3B13A 5BXOA 4FU3A 4R7LA 3KSLA 1TNZA 3BQOA 3MKQB 4KMOA 2HR2A 4U0UA 4KYOB 4CCAA 3E4BA 3DPYA 2AW6A 4AV7A 4ANXA 1E7UA 3D9HA 3J5PA 3K9IA 3FUHA 2P9SG 2QC9A 3TWWA 3G2UA 5JA4D 2JLBA 4I6JA 3GYZA 3FTWA 4AXHA 4MRUA 4HI8A 3B7TA 4UI9C 5EYLA 5E76A 4NQ0A 1OCOE 5FQ4A 2KCVA 2GROB 2FO1E 4V3IA 5EX0A 3X2QE 2X6KA 3BEEA 4GYWA 2EIME 4CYMD 1K1BA 1UJJA 4N2SA 3Q4AB 1HFAA 2KBXA 3EU5A 1YCSB 3D9IA 1TNOA 1K1AA 4DRXE 4DI4A 3QJZA 4ME2A 2H6GA 1V54E 4BESA 1IXVA 3HXBA 5BW8C 2RG8A 1H19A 4LG6A 4ILGA 2P9IG 4I43A 4FADA 1EF1C 3ONKA 3JQ0A 1OCCE 4NURA 1L5JA 3APCA 2Q7FA 3EU9A 3UM3A 3TJPA 3FH5A 4P29A 2EILE 3CR3A 3UT7A 3CVYA 4U07A 4FC8A 4QFVA 5AJDA 4BT8A 3DEPA 4BTAA 1UN8A 3QNKA 1KT1A 4I9EA 4BX8A 2ETBA 2XCCA 5KNHD 4EBAA 5J08A 3ULQA 3ASOE 1VDYA 3EHQA 5KJKA 1H6OA 3Q7FA 1IKND 4U8HA 2P58C 5BUZA 3DWLG 2OEVA 5D0OD 1Z3YA 3FUEA 4I17A 3PRZA 2XEEA 2RFMA 4X8QA 5AIJA 4CT0A 4J8SA 2GRLA 1FVFA 3UX4A 2JABA 3QK0A 2HYZA 3UIPC 5G04C 4JB8P 4L7TA 1NFIE 5A6CA 3ASNE 3Q78A 5B1AE 3CK9A 3LY8A 3LJNA 2XRYA 3FTVA 2XPIA 3FUJA 5KWDA 3DSXA 3EDTB 2MHKA 3LS8A 3ESKA 1MX4A 1PC2A 3DRAA 4K5AB 3U9WA 3MJWA 4L9PA 2DZNA 2IJGX 3SY2A 2OVFA 4B89A 3CLJA 3R7RA 3UKUG 5B3SE 3L9TA 1BD8A 2R02A 4GZCA 4JA9A 4AJWA 3D9NA 4U8YD 2MYOA 4G8KA 4OVVA 2L6JA 1WAO1 5B1BE 5HQ8A 4G1TA 4CRWA 3BUAA 3C98A 2GGFA 4I2WA 2DIWA 1N0RA 3CK7A 3ULEG 4K5CA 4N5QA 2IFUA 3ZHEB 3BU8A 2AXVA 3IBEA 5LCWJ 3RIBA 2QFCA 3HXFA 4GA0A 3CVPA 3NZSA 3JQ1A 3G2WA 3ZN3A 2J08A 1HU3A 2BKGA 3NBNB 3B7RL 3DXKG 4ANVA 4EZLA 1KT0A 1FCHA 3TWSA 4DX5D 3RO3A 3UM2A 3NAWA 2X6HA 3FU0A 3CHQA 3MKRA 4UUCA 4DX7D 2WM9A 1AP7A 2XS1A 3IKOB 3ML9A 4J8YA 2PQNA 3TWRA 3FU5A 2CHWA 2LO6A 5CBNA 4ATZD 3ESLA 3APFA 4YDWA 1LD8A 1TNUA 3ASHA 3L82A 5CMWA 2DVWA 3FDHA 4UWFA 3SZ7A 3PZ1A 3DSSA 4G25A 4LCTA 4XIFA 4G24A 5CCMA 1JCRA 4A55A 3D9LA 3SI5A 3ZYQA 3HHMA 4WNFA 3LY7A 5AQ7A 3OAWA 2PNNA 2WXLA 1NA0A 2F0YA 4U96D 2WXHA 4GTSA 3T8KA 3ZRHA 5A23A 2XPYA 1ZBPA 1TN7A 3PUJA 5G55A 1N4QA 3J5QB 3Q75A 5CCLA 5CBOA 2WQ7A 4F1PA 3IHYA 4C48B 2B0OE 4UI9K 3ONLA 4CT4A 3LY9A 4J8DA 1SZAA 2V4LA 4EBAG 4JXTA 4DLQA 3FTUA 4HLLA 2KCKA 4BT9A 3NQPA 5AQ9A 4G23A 4ABNA 1OWNA 4YVQC 4FLBA 2GRNB 3UT4A 5ENQD 3EIQC 5ENPD 3ZVVA 4FJZA 3Q9UC 3ZW3A 2L0TB 5LOZA 3MV3B 4MBGA 3S7BA 5BNWA 5M72A 1B89A 3OXFA 2I1JA 2E0IA 1G3NB 1N11A 1ELWA 5AYWD 3CSFA 5J90A 1TNYA 4IYPA 2HE0A 5FZQA 2WXGA 3FUNA 2XGMA 1N4PA 2GRMA 3ZKJA 4GCOA 3C3QA 2CHXA 4GZ5A 4O6FA 3PH0C 2WXFA 4HB5A 3TXNA 4UWLA 2J4BA 4PH4B 3I4GA 3FU3A 2RKKA 3NZUA 2OEWA 3JYSA 4I2ZA 2IEJA 5ENRD 3CV0A 4KVMA 1ELRA 2JEKA 3KS2A 4KT6B 3AS4A 5CEDB 2PM6A 3I4RB 3V30A 2FI7A 3CVXA 3CHMA 2VJ8A 2GRPB 4GA1A 3CVVA 1MHQA 3TWTA 3LEWA 1U3DA 1FPPA 2P9KG 2FULA 4PUCA 2XS8A 3V2OA 3RRUA 3E33A 3P1UA 4GPKA 5AQAA 3APDA 3QDNA 1P5QA 2H6FA 2V5FA 4L2LA 1BI7B 5AN8A 1DVPA 5JHBA 2UWJG 4HI9A 1TN6A 5LX8A 4GZ3A 4RLYA 5JMND 4NACA 3SHFA 5FJYA 4GTOA 3LJ3A 5BPPA 1HE8A 3IEGA 2XQ0A 4JHRA 4N3CA 4H7YA 2LSVA 4TXQA 2VTBB 3T9KA 5ENTD 1QYMA 3AG1E 4B8AA 1LF8A 4GYOA 4HOTA 3IXEA 1FT2A 3JUIA 4LUNU 3NOCD 2EQXA 2PL2A 3DBSA 3G2TA 3TWUA 4NIKA 2Y4TA 4HBDA 4IRUA 3UIOC 2EIJE 3PZ2A 3LPZA 4LEUA 4M7CA 1PY1A 2LAHA 4DK5A 1H2TC 4MKTA 4WUYA 3CKBA 3S7DA 2RD0A 2GRQB 4RG9A 1SZ9A 3PZDA 2UY1A 3V79K 2VGXA 3B95A 2XENA 4E85A 2WXPA 3QARA 4MS6A 2AXZA 3URZA 3CEQA 2XEVA 3HG0D 4BSZB 3GZ1A 4EQFA 3AU5A 2PM7A 1TR4A 3ZEFA 4BERA 4CGWA 1N9AA 3UQ3A 4DJAA 2VSOE 2BKKB 2PQRA 5FTPA 1FVHA 1IHGA 3S2AA 2A5EA 3LVQE 4DI3A 3RKVA 3CHPA 3UTMA 3TWVA 3E30A 4HNAD 4JHKA 4FA6A 3SBTB 5EILA 3FTXA 3HVEA 1WDYA 4GTQA
chains in the Genus database with same CATH topology
1MX2A 2Y1LE 1IXVA 2DVWA 5EYPF 1BI8B 3B7BA 2HE0A 3HRAA 4LG6A 1BD8A 1YYHA 3T9KA 5ENTD 4OAVB 1SVXA 1QYMA 3ZUVB 3V2XA 5CEAA 4U8YD 3ZKJA 3IXEA 2MYOA 4BETA 5BXOA 4G8KA 3EU9A 3NOCD 3TWXA 4GMRA 4O1PA 2ZGGA 1DCQA 5FIOA 2P2CP 3JXIA 4HB5A 4K5BA 2AJAA 5AQ7A 4DX2A 3TWUA 4NIKA 3UI2A 5CECB 4HBDA 2Y0BG 2PNNA 2XEHA 3W9FA 4CZ2D 4DX1A 3TWQA 5ITZF 4QFVA 2ZGDA 3DEPA 3JXJA 4U96D 1BLXB 1N0RA 4YDWA 3D9HA 3J5PA 4HRMB 5AQBA 1OY3D 3T8KA 1S70B 2XZDG 3UXGA 3NBNB 4BEPA 2J8SD 5ENRD 4U95D 2ETBA 5KNHD 4G8LA 3W9GA 2QC9A 4K5CA 4N5QA 2KXPC 1WG0A 3V31A 3EHQA 3TWWA 5AARA 4HRLA 3SO8A 5CEDB 1IKND 2F8YA 4OAUC 2V4HC 3V79K 3V30A 4HQDA 5EIDA 3J5QB 5JA4D 2RFAA 4TUMA 3B95A 4YDYA 5EIBE 2XENA 5HS0A 5CBOA 1UOHA 1K3ZD 4HRNA 4F1PA 1YMPA 2F8XK 4C48B 5EN5D 2XEEA 2RFMA 2B0OE 4LSZE 3HG0D 4DUIA 2QYJA 2JABA 1MX6A 2BKGA 5ENSD 5FINA 3TWTA 2L6BA 4BSZB 3AAAC 4HI8A 3JUEA 5CERB 1AWCB 3AJIA 4JB8P 4J7WA 4B93B 5EYLA 2DWZA 2ETCA 2DZOA 2NYJA 3V2OA 1NFIE 3TWSA 4QQIA 4DX5D 4HLLA 5BXUA 1TR4A 1SW6A 2FO1E 1BU9A 5AAOA 5AQ9A 4BERA 3C5RA 4ZFHA 4Z68A 5ENOD 4DX6D 5D66A 3ZNGA 5AQAA 1DC2A 5HKPA 5KNGA 3EHRA 4U8VD 4CYMD 2BKKB 1K1BA 1IHBA 3LJNA 3NOGD 4UUCA 5ENQD 4DX7D 3KEAA 5ENPD 3DEOA 2F37A 3ZU7B 2KBXA 2A5EA 1YCSB 3Q9UC 1AP7A 2ETAA 4F6RD 4GPMA 5KWDA 1BI7B 5AN8A 4O1OA 1MJ0A 2V5QC 1D9SA 3UTMA 1K1AA 3Q9NC 1MX4A 2XZTG 3TWVA 4DRXE 4J8YA 4HNAD 4A63B 1A5EA 4HI9A 1MYOA 5EILA 5HRYA 4RLYA 5JMND 2VGEA 3TWRA 1WDYA 5KBAA 1G3NB 5CBNA 4ZHBA 4ATZD 1N0QA 4K5AB 1OT8A 4O60A 1N11A 2DZNA 4LNUD 3F6QA 4BESA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MX2 A;  2Y1L E;  1IXV A;  2DVW A;  5EYP F;  1BI8 B;  3B7B A;  2HE0 A;  3HRA A;  4LG6 A;  1BD8 A;  1YYH A;  3T9K A;  5ENT D;  4OAV B;  1SVX A;  1QYM A;  3ZUV B;  3V2X A;  5CEA A;  4U8Y D;  3ZKJ A;  3IXE A;  2MYO A;  4BET A;  5BXO A;  4G8K A;  3EU9 A;  3NOC D;  3TWX A;  4GMR A;  4O1P A;  2ZGG A;  1DCQ A;  5FIO A;  2P2C P;  3JXI A;  4HB5 A;  4K5B A;  2AJA A;  5AQ7 A;  4DX2 A;  3TWU A;  4NIK A;  3UI2 A;  5CEC B;  4HBD A;  2Y0B G;  2PNN A;  2XEH A;  3W9F A;  4CZ2 D;  4DX1 A;  3TWQ A;  5ITZ F;  4QFV A;  2ZGD A;  3DEP A;  3JXJ A;  4U96 D;  1BLX B;  1N0R A;  4YDW A;  3D9H A;  3J5P A;  4HRM B;  5AQB A;  1OY3 D;  3T8K A;  1S70 B;  2XZD G;  3UXG A;  3NBN B;  4BEP A;  2J8S D;  5ENR D;  4U95 D;  2ETB A;  5KNH D;  4G8L A;  3W9G A;  2QC9 A;  4K5C A;  4N5Q A;  2KXP C;  1WG0 A;  3V31 A;  3EHQ A;  3TWW A;  5AAR A;  4HRL A;  3SO8 A;  5CED B;  1IKN D;  2F8Y A;  4OAU C;  2V4H C;  3V79 K;  3V30 A;  4HQD A;  5EID A;  3J5Q B;  5JA4 D;  2RFA A;  4TUM A;  3B95 A;  4YDY A;  5EIB E;  2XEN A;  5HS0 A;  5CBO A;  1UOH A;  1K3Z D;  4HRN A;  4F1P A;  1YMP A;  2F8X K;  4C48 B;  5EN5 D;  2XEE A;  2RFM A;  2B0O E;  4LSZ E;  3HG0 D;  4DUI A;  2QYJ A;  2JAB A;  1MX6 A;  2BKG A;  5ENS D;  5FIN A;  3TWT A;  2L6B A;  4BSZ B;  3AAA C;  4HI8 A;  3JUE A;  5CER B;  1AWC B;  3AJI A;  4JB8 P;  4J7W A;  4B93 B;  5EYL A;  2DWZ A;  2ETC A;  2DZO A;  2NYJ A;  3V2O A;  1NFI E;  3TWS A;  4QQI A;  4DX5 D;  4HLL A;  5BXU A;  1TR4 A;  1SW6 A;  2FO1 E;  1BU9 A;  5AAO A;  5AQ9 A;  4BER A;  3C5R A;  4ZFH A;  4Z68 A;  5ENO D;  4DX6 D;  5D66 A;  3ZNG A;  5AQA A;  1DC2 A;  5HKP A;  5KNG A;  3EHR A;  4U8V D;  4CYM D;  2BKK B;  1K1B A;  1IHB A;  3LJN A;  3NOG D;  4UUC A;  5ENQ D;  4DX7 D;  3KEA A;  5ENP D;  3DEO A;  2F37 A;  3ZU7 B;  2KBX A;  2A5E A;  1YCS B;  3Q9U C;  1AP7 A;  2ETA A;  4F6R D;  4GPM A;  5KWD A;  1BI7 B;  5AN8 A;  4O1O A;  1MJ0 A;  2V5Q C;  1D9S A;  3UTM A;  1K1A A;  3Q9N C;  1MX4 A;  2XZT G;  3TWV A;  4DRX E;  4J8Y A;  4HNA D;  4A63 B;  1A5E A;  4HI9 A;  1MYO A;  5EIL A;  5HRY A;  4RLY A;  5JMN D;  2VGE A;  3TWR A;  1WDY A;  5KBA A;  1G3N B;  5CBN A;  4ZHB A;  4ATZ D;  1N0Q A;  4K5A B;  1OT8 A;  4O60 A;  1N11 A;  2DZN A;  4LNU D;  3F6Q A;  4BES A; 
#chains in the Genus database with same CATH topology
 4N39 A;  1YYH A;  1LD7 A;  4IUL A;  3UM0 A;  3ZUV B;  3QAQ A;  2CFZ A;  3PZ4 A;  3MKQ A;  3AS5 A;  1OWM A;  3PUK A;  1ZU2 A;  5BV0 A;  2X6F A;  1O1T A;  3S7F A;  2XEH A;  4GAA A;  2WMO A;  5DBK A;  5ITZ F;  1HX8 A;  2ZGD A;  3OXL A;  4J0U A;  3QWV A;  3MA5 A;  5KJL A;  3W9G A;  3NF1 A;  3CVU A;  5AAR A;  3FWV A;  1HXI A;  1SQM A;  1QNF A;  2WXQ A;  4TUM A;  3ZXS A;  4FP7 A;  3QOU A;  1UOH A;  2F8X K;  2V0P A;  4LSZ E;  2YNQ A;  5FIN A;  1D8D A;  4B93 B;  3EHN A;  5HI7 A;  1HZ4 A;  2P9L G;  2NYJ A;  4UI9 J;  4DLO A;  5EDS A;  3G2S A;  4HLE A;  4JPS A;  4OVU A;  1D9S A;  4BTB A;  4F7A A;  2XHE A;  4A63 B;  1A5E A;  2LXL A;  5HRY A;  4ZHB A;  4IN3 B;  4D10 C;  3PEU B;  3CQC B;  1Z6T A;  5KCM A;  3GZ2 A;  3CHS A;  2C0M A;  4RQI A;  4FHK A;  1QBQ A;  1D8E A;  2GRR B;  2KAT A;  4DX2 A;  2FBN A;  2IU1 A;  3G2V A;  4I1A A;  4CDR A;  4K0R A;  3TGO A;  1HS6 A;  2J8S D;  2OCC E;  3ZYK A;  4TXR A;  4F53 A;  4UWK A;  2LNI A;  1S63 A;  4HRL A;  3TG5 A;  4HQD A;  2DBA A;  2WQH A;  3VTX A;  3L08 A;  5CRU A;  4XKB A;  1OWP A;  2I6H A;  1E90 A;  2L6B A;  1TN8 A;  3L13 A;  3PE3 A;  5G04 J;  3MV2 B;  1UJK A;  3R9M A;  4GTT A;  5G05 C;  3L17 A;  5HKP A;  2CG3 A;  2XCB A;  3RK6 A;  4GU5 A;  2XGO A;  5C1D A;  1XGW A;  2H6H A;  1X5B A;  3UT8 A;  4F6R D;  4GPM A;  4AIF A;  2P9N G;  3ABL E;  2IOL A;  3KEZ A;  4LRZ A;  2KZT A;  4HOU A;  2J07 A;  3RJV A;  2IY0 C;  3ZFW A;  3FUM A;  3P2B A;  4UWG A;  1BI8 B;  4GA2 A;  3EIJ A;  4KVO A;  3SFZ A;  1JWF A;  3LDZ A;  5CEA A;  3Q5M A;  2P9P G;  3U66 A;  3FTS A;  3Q7A A;  3LVR E;  4GMR A;  4GZD A;  2ZGG A;  2WB2 A;  2DCP A;  3SF4 A;  1S0P A;  2IO3 C;  4CZ2 D;  3MX3 A;  3TAX A;  3SBS A;  3U64 A;  2ZIR A;  3PZ3 A;  3VLF A;  4MLP A;  3UXG A;  2Y69 E;  3ZHE A;  4TRQ A;  4U95 D;  2WXJ A;  3CVL A;  4ANU A;  2R5S A;  3SGH A;  4Q69 A;  3ZYM A;  4J8F A;  5HS0 A;  1K3Z D;  4ANW A;  1IQR A;  2R59 A;  5EN5 D;  1GW6 A;  2CFU A;  4JZY A;  4J7W A;  3ML8 A;  1QQE A;  3ASD A;  3FUD A;  3WG7 E;  1MZC A;  5ENO D;  2HO1 A;  5ANL A;  1A17 A;  4G2V A;  4JVS A;  5JHA A;  2F37 A;  3ZU7 B;  2ETA A;  1TNB A;  3CIA A;  2XZT G;  4WWO A;  2M63 A;  3FUK A;  4N2Q A;  5T3R A;  4U0Z A;  1TJC A;  4GCN A;  4HXI A;  3FUI A;  4FHJ A;  1WM5 A;  2L0I A;  3FY4 A;  2WPV A;  3S7J A;  1SVX A;  3V2X A;  2WXO A;  1HG5 A;  1O5M A;  1H0A A;  1QZ2 A;  3VLE A;  3BG1 B;  2FF4 A;  2AJA A;  4UQZ A;  2Y3A A;  1JPL A;  4HVB A;  1U2V G;  3TWQ A;  4RSY A;  3E37 A;  3D9P A;  1YA0 A;  3OTN A;  4WND A;  1S70 B;  4BEP A;  1BPO A;  4Y6C A;  3N71 A;  4BX9 A;  4B0Z A;  4OAU C;  5FZS A;  1Z3X A;  4A1G A;  5EID A;  4F3V A;  3GZS A;  3RRM B;  4U04 A;  3R9A B;  4JA7 A;  3AU4 A;  4WNE A;  3AJI A;  4L2Y A;  1EPU A;  2E2E A;  3FTY A;  3RO2 A;  1N95 A;  3I5P A;  1SW6 A;  1BU9 A;  1FT1 A;  3IV0 A;  2CG2 A;  2J09 A;  2VSY A;  3PNT B;  5KNG A;  3UIN C;  3EHR A;  2OND A;  2L9B A;  3NOG D;  3DEO A;  1X81 A;  4LER A;  4XEI G;  3C3R A;  2V5Q C;  4JL0 A;  4GZ6 A;  3HYM B;  3ISM C;  1N4S A;  3MGB A;  4AM9 A;  4XI0 A;  4I1O B;  2WXI A;  3AG2 E;  4BFR A;  2ILR A;  2A4Z A;  2OOE A;  2BF0 X;  3U4T A;  3I3N A;  1DCE A;  3PE4 A;  1MX2 A;  1E8W A;  1UG3 A;  5FQ6 A;  3PS6 A;  3FFL A;  3ZXP A;  2OV8 A;  5AJL A;  4AY6 A;  4CGV A;  4BET A;  4KZ0 A;  2WXN A;  2J49 A;  2QY7 A;  5DIZ A;  2LSU A;  1OXJ A;  4OYS A;  4DX1 A;  2A5U A;  3CGH A;  3CVQ A;  1OY3 D;  3DSW A;  2XZD G;  1OWO A;  4KXK B;  2ZU6 B;  3ABK E;  2WQ6 A;  3QWP A;  2VQ2 A;  5FZR A;  3V31 A;  1JWG A;  3CKC A;  2F8Y A;  2AVP A;  2RFA A;  5EIB E;  4CEM A;  1K8K G;  2WXR A;  3T5X A;  2H6I A;  2YHC A;  1Y8M A;  3C3O A;  3HDX A;  5JJT A;  4HFG A;  4QQI A;  4KBQ A;  3FEY A;  4XX5 A;  2R2L A;  4GB9 A;  4J8E A;  4EHM A;  3KEA A;  4AOF A;  2R05 A;  4I6E A;  5A7D B;  2LXM A;  4GTR A;  4TXP A;  4FJY A;  4HOQ A;  3CST A;  2GW1 A;  2LUH A;  1OT8 A;  3T8M A;  4EEC A;  2VTB A;  4A3T A;  4GML A;  1OCZ E;  2NSZ A;  4A1S A;  2IQC A;  3LCA A;  1N52 A;  1HH8 A;  4YND A;  2YIN A;  4URK A;  1INZ A;  3Q47 B;  1E7V A;  4UQX A;  3U3W A;  2IOS A;  4G11 A;  4YDO A;  2QZA A;  1KZO A;  2WVI A;  4XKC A;  5ARF A;  5CRV A;  4RG6 A;  4G8L A;  3KAE A;  4B8C B;  2X3M A;  2V4H C;  4AP2 A;  2XRZ A;  4YDY A;  1H2U A;  4M3O A;  3E34 A;  3ENE A;  4RVB A;  2QYJ A;  1AWC B;  1H6P A;  5ARG A;  2DYS E;  2IO2 C;  2OVB A;  4EZJ A;  4E6H A;  2WXM A;  2WMN A;  5CHE E;  1RZ4 A;  2Y4U A;  2EIN E;  4Z68 A;  3ZNG A;  5KJN A;  1RW2 A;  3WXX A;  3PDN A;  5BV1 A;  1NA3 A;  3PVL A;  4FLH A;  3ZYL A;  1NI1 A;  4JC8 A;  4A3V A;  4UQY A;  4U7E B;  4LNG A;  4BWR A;  1V55 E;  1TYQ G;  2DYR E;  3HRA A;  5C2Y A;  3CHR A;  3UKR G;  2P9U G;  3ASG A;  4G26 A;  4TUU A;  3R7Q A;  1KLX A;  3TWX A;  3FUF A;  3L22 A;  4O1P A;  4HOS A;  1DCQ A;  5FIO A;  3D9K A;  4FUL A;  4K5B A;  3D9J A;  2KC7 A;  2Y0B G;  3O4Z A;  5JJ6 A;  3FUL A;  3UM1 A;  3SQV A;  3IHV A;  3OXG A;  2XPZ A;  2HM8 A;  5BT1 A;  2EIK E;  1W3B A;  5LCW C;  3RU0 A;  2CHZ A;  5LFA A;  3CHO A;  3SO8 A;  3FH7 A;  3TXM A;  3AS8 A;  2ION A;  3SFX A;  2KCL A;  1JUQ A;  2VGY A;  4JHJ A;  3LKU A;  3SNX A;  5ENS D;  2C0L A;  2NC9 A;  4H7X A;  3LXU X;  2VSX E;  1TEZ A;  1NL4 A;  2ETC A;  2KZT B;  3SD5 A;  3PNL B;  5AAO A;  4KZC A;  4DX6 D;  3HXE A;  4J6I A;  3E32 A;  4PS3 A;  1IHB A;  4N3B A;  1Z5S C;  1TJF A;  4CDN A;  3T5V A;  4F1S A;  4C0M A;  3L6A A;  1UN9 A;  2QYU A;  2VGE A;  2MRI A;  1S64 A;  5JJ7 A;  1DNP A;  1O1S A;  4NRH B;  2Y1L E;  2VSN A;  3DST A;  5FWQ A;  3MEK A;  3B7B A;  1H2V C;  5FT9 A;  4PDX A;  1HO8 A;  5G2N A;  2ZXW E;  1OUV A;  4LNB A;  4C0E A;  2V8S E;  4WWN A;  3KSQ A;  5D0Q D;  2YHE A;  1JCS A;  4WAF A;  3UMV A;  3PRE A;  3ZGQ A;  3UI2 A;  4PS8 A;  2X6J A;  1HF8 A;  1BLX B;  5AQB A;  4XE0 A;  3PEV B;  4ILH B;  2KXP C;  3C72 A;  1ELK A;  2WXK A;  2I9C A;  1LTX A;  3BG0 B;  4UWH A;  3Q79 A;  3Q73 A;  1WY6 A;  3LYA A;  4JD2 G;  4HRN A;  3MZL B;  4W9R A;  1MX6 A;  5CER B;  3HIZ A;  3JUE A;  3AG4 E;  3DSU A;  5T4Y A;  1Q2Z A;  2DWZ A;  3DPD A;  2B6C A;  2DZO A;  3QB2 A;  4WWP A;  5KJM A;  1U3C A;  3TL5 A;  3C5R A;  4ZFH A;  2IF4 A;  1NZN A;  3MYV A;  5G05 J;  1SA5 A;  1N94 A;  3CQG B;  4L23 A;  1SA4 A;  4AY5 A;  4HS2 A;  1MJ0 A;  4JEU A;  3Q9N C;  1MQS A;  3KD7 A;  1UW4 B;  3Q49 B;  5CMY A;  1N0Q A;  3L54 A;  4LNU D;  3VLD A;  2X38 A;  3FTZ A;  4B94 A;  1Y6I A;  5AEN A;  3QKY A;  1H6K A;  3MCX A;  2X6I A;  3TG4 A;  4K03 A;  4C9B B;  1OWL A;  3RRN B;  3EHM A;  3DXM G;  2AWI A;  3JXI A;  2J4D A;  4XZ4 A;  2C2L A;  5CEC B;  1NP7 A;  4GMJ A;  3W9F A;  5ENN A;  4JW1 A;  4I9C A;  4HRM B;  4GTP A;  3UPV A;  1KZP A;  1WG0 A;  3UUX A;  3JCK C;  3FEX A;  4I6G A;  4L1B A;  2ZIS A;  4XI9 A;  1O1R A;  3B7U X;  3FHE A;  1IQU A;  5T8I A;  3QC1 A;  4N5C A;  3FU6 A;  5IY5 E;  3B7S A;  1E96 B;  5BXU A;  1E8X A;  3QWW A;  4AEZ C;  5D66 A;  1DC2 A;  4EPZ A;  3D9M A;  4U8V D;  1E8Z A;  4ILI A;  4GTV A;  4Q96 A;  2FEZ A;  4APF A;  1E8Y A;  3EJN A;  3RAU A;  3Q15 A;  3CVW A;  2MOW A;  3FH8 A;  5KBA A;  5FQ7 A;  4HOR A;  2YQ8 A;  2LAI A;  2VYI A;  3AG3 E;  4WNG A;  4ACL A;  4O60 A;  5D2M C;  2BTD A;  4GTM A;  3SFY A;  2I2O A;  4Y6W A;  4OAV B;  3NB2 A;  5EX3 A;  4ACK A;  2PZI A;  2AXU A;  3ULY A;  4APO A;  4U0S A;  1ZB1 A;  4TV3 A;  2NXP A;  3CVN A;  2P2C P;  2XGS A;  5ANR A;  2FO7 A;  2BUG A;  3D3M A;  3ZPJ A;  2J9Q A;  3JXJ A;  3RSE G;  5E75 A;  1HG2 A;  4EZK A;  1KPS B;  4YDE A;  5H7P A;  4AVX A;  1EDU A;  4U63 A;  4BSX A;  3L16 A;  3VTY A;  2UY1 B;  4GYY A;  2VGX B;  3HXD A;  1YMP A;  1N4R A;  2BED A;  1EYH A;  3EUV A;  4DUI A;  1XNF A;  3AAA C;  4I1M A;  3DSV A;  1PAQ A;  5FQ8 A;  1IYG A;  3ABM E;  4N3A A;  4CDM A;  1N54 A;  2R17 C;  3HXC A;  4O1O A;  3ZIM A;  4Q94 A;  2R03 A;  2I1K A;  4PS7 A;  5LP0 A;  4ATG A;  1MYO A;  3D9O A;  1OCR E;  5EKQ D;  3FP3 A;  3O48 A;  4JEH A;  3F6Q A;  3GW4 A;  3HVE B;  4YVO A;  1JCQ A;  3ASF A;  4DPR A;  5EYP F;  3CK8 A;  4BY6 A;  2KM4 A;  3B13 A;  5BXO A;  4FU3 A;  4R7L A;  3KSL A;  1TNZ A;  3BQO A;  3MKQ B;  4KMO A;  2HR2 A;  4U0U A;  4KYO B;  4CCA A;  3E4B A;  3DPY A;  2AW6 A;  4AV7 A;  4ANX A;  1E7U A;  3D9H A;  3J5P A;  3K9I A;  3FUH A;  2P9S G;  2QC9 A;  3TWW A;  3G2U A;  5JA4 D;  2JLB A;  4I6J A;  3GYZ A;  3FTW A;  4AXH A;  4MRU A;  4HI8 A;  3B7T A;  4UI9 C;  5EYL A;  5E76 A;  4NQ0 A;  1OCO E;  5FQ4 A;  2KCV A;  2GRO B;  2FO1 E;  4V3I A;  5EX0 A;  3X2Q E;  2X6K A;  3BEE A;  4GYW A;  2EIM E;  4CYM D;  1K1B A;  1UJJ A;  4N2S A;  3Q4A B;  1HFA A;  2KBX A;  3EU5 A;  1YCS B;  3D9I A;  1TNO A;  1K1A A;  4DRX E;  4DI4 A;  3QJZ A;  4ME2 A;  2H6G A;  1V54 E;  4BES A;  1IXV A;  3HXB A;  5BW8 C;  2RG8 A;  1H19 A;  4LG6 A;  4ILG A;  2P9I G;  4I43 A;  4FAD A;  1EF1 C;  3ONK A;  3JQ0 A;  1OCC E;  4NUR A;  1L5J A;  3APC A;  2Q7F A;  3EU9 A;  3UM3 A;  3TJP A;  3FH5 A;  4P29 A;  2EIL E;  3CR3 A;  3UT7 A;  3CVY A;  4U07 A;  4FC8 A;  4QFV A;  5AJD A;  4BT8 A;  3DEP A;  4BTA A;  1UN8 A;  3QNK A;  1KT1 A;  4I9E A;  4BX8 A;  2ETB A;  2XCC A;  5KNH D;  4EBA A;  5J08 A;  3ULQ A;  3ASO E;  1VDY A;  3EHQ A;  5KJK A;  1H6O A;  3Q7F A;  1IKN D;  4U8H A;  2P58 C;  5BUZ A;  3DWL G;  2OEV A;  5D0O D;  1Z3Y A;  3FUE A;  4I17 A;  3PRZ A;  2XEE A;  2RFM A;  4X8Q A;  5AIJ A;  4CT0 A;  4J8S A;  2GRL A;  1FVF A;  3UX4 A;  2JAB A;  3QK0 A;  2HYZ A;  3UIP C;  5G04 C;  4JB8 P;  4L7T A;  1NFI E;  5A6C A;  3ASN E;  3Q78 A;  5B1A E;  3CK9 A;  3LY8 A;  3LJN A;  2XRY A;  3FTV A;  2XPI A;  3FUJ A;  5KWD A;  3DSX A;  3EDT B;  2MHK A;  3LS8 A;  3ESK A;  1MX4 A;  1PC2 A;  3DRA A;  4K5A B;  3U9W A;  3MJW A;  4L9P A;  2DZN A;  2IJG X;  3SY2 A;  2OVF A;  4B89 A;  3CLJ A;  3R7R A;  3UKU G;  5B3S E;  3L9T A;  1BD8 A;  2R02 A;  4GZC A;  4JA9 A;  4AJW A;  3D9N A;  4U8Y D;  2MYO A;  4G8K A;  4OVV A;  2L6J A;  1WAO 1;  5B1B E;  5HQ8 A;  4G1T A;  4CRW A;  3BUA A;  3C98 A;  2GGF A;  4I2W A;  2DIW A;  1N0R A;  3CK7 A;  3ULE G;  4K5C A;  4N5Q A;  2IFU A;  3ZHE B;  3BU8 A;  2AXV A;  3IBE A;  5LCW J;  3RIB A;  2QFC A;  3HXF A;  4GA0 A;  3CVP A;  3NZS A;  3JQ1 A;  3G2W A;  3ZN3 A;  2J08 A;  1HU3 A;  2BKG A;  3NBN B;  3B7R L;  3DXK G;  4ANV A;  4EZL A;  1KT0 A;  1FCH A;  3TWS A;  4DX5 D;  3RO3 A;  3UM2 A;  3NAW A;  2X6H A;  3FU0 A;  3CHQ A;  3MKR A;  4UUC A;  4DX7 D;  2WM9 A;  1AP7 A;  2XS1 A;  3IKO B;  3ML9 A;  4J8Y A;  2PQN A;  3TWR A;  3FU5 A;  2CHW A;  2LO6 A;  5CBN A;  4ATZ D;  3ESL A;  3APF A;  4YDW A;  1LD8 A;  1TNU A;  3ASH A;  3L82 A;  5CMW A;  2DVW A;  3FDH A;  4UWF A;  3SZ7 A;  3PZ1 A;  3DSS A;  4G25 A;  4LCT A;  4XIF A;  4G24 A;  5CCM A;  1JCR A;  4A55 A;  3D9L A;  3SI5 A;  3ZYQ A;  3HHM A;  4WNF A;  3LY7 A;  5AQ7 A;  3OAW A;  2PNN A;  2WXL A;  1NA0 A;  2F0Y A;  4U96 D;  2WXH A;  4GTS A;  3T8K A;  3ZRH A;  5A23 A;  2XPY A;  1ZBP A;  1TN7 A;  3PUJ A;  5G55 A;  1N4Q A;  3J5Q B;  3Q75 A;  5CCL A;  5CBO A;  2WQ7 A;  4F1P A;  3IHY A;  4C48 B;  2B0O E;  4UI9 K;  3ONL A;  4CT4 A;  3LY9 A;  4J8D A;  1SZA A;  2V4L A;  4EBA G;  4JXT A;  4DLQ A;  3FTU A;  4HLL A;  2KCK A;  4BT9 A;  3NQP A;  5AQ9 A;  4G23 A;  4ABN A;  1OWN A;  4YVQ C;  4FLB A;  2GRN B;  3UT4 A;  5ENQ D;  3EIQ C;  5ENP D;  3ZVV A;  4FJZ A;  3Q9U C;  3ZW3 A;  2L0T B;  5LOZ A;  3MV3 B;  4MBG A;  3S7B A;  5BNW A;  5M72 A;  1B89 A;  3OXF A;  2I1J A;  2E0I A;  1G3N B;  1N11 A;  1ELW A;  5AYW D;  3CSF A;  5J90 A;  1TNY A;  4IYP A;  2HE0 A;  5FZQ A;  2WXG A;  3FUN A;  2XGM A;  1N4P A;  2GRM A;  3ZKJ A;  4GCO A;  3C3Q A;  2CHX A;  4GZ5 A;  4O6F A;  3PH0 C;  2WXF A;  4HB5 A;  3TXN A;  4UWL A;  2J4B A;  4PH4 B;  3I4G A;  3FU3 A;  2RKK A;  3NZU A;  2OEW A;  3JYS A;  4I2Z A;  2IEJ A;  5ENR D;  3CV0 A;  4KVM A;  1ELR A;  2JEK A;  3KS2 A;  4KT6 B;  3AS4 A;  5CED B;  2PM6 A;  3I4R B;  3V30 A;  2FI7 A;  3CVX A;  3CHM A;  2VJ8 A;  2GRP B;  4GA1 A;  3CVV A;  1MHQ A;  3TWT A;  3LEW A;  1U3D A;  1FPP A;  2P9K G;  2FUL A;  4PUC A;  2XS8 A;  3V2O A;  3RRU A;  3E33 A;  3P1U A;  4GPK A;  5AQA A;  3APD A;  3QDN A;  1P5Q A;  2H6F A;  2V5F A;  4L2L A;  1BI7 B;  5AN8 A;  1DVP A;  5JHB A;  2UWJ G;  4HI9 A;  1TN6 A;  5LX8 A;  4GZ3 A;  4RLY A;  5JMN D;  4NAC A;  3SHF A;  5FJY A;  4GTO A;  3LJ3 A;  5BPP A;  1HE8 A;  3IEG A;  2XQ0 A;  4JHR A;  4N3C A;  4H7Y A;  2LSV A;  4TXQ A;  2VTB B;  3T9K A;  5ENT D;  1QYM A;  3AG1 E;  4B8A A;  1LF8 A;  4GYO A;  4HOT A;  3IXE A;  1FT2 A;  3JUI A;  4LUN U;  3NOC D;  2EQX A;  2PL2 A;  3DBS A;  3G2T A;  3TWU A;  4NIK A;  2Y4T A;  4HBD A;  4IRU A;  3UIO C;  2EIJ E;  3PZ2 A;  3LPZ A;  4LEU A;  4M7C A;  1PY1 A;  2LAH A;  4DK5 A;  1H2T C;  4MKT A;  4WUY A;  3CKB A;  3S7D A;  2RD0 A;  2GRQ B;  4RG9 A;  1SZ9 A;  3PZD A;  2UY1 A;  3V79 K;  2VGX A;  3B95 A;  2XEN A;  4E85 A;  2WXP A;  3QAR A;  4MS6 A;  2AXZ A;  3URZ A;  3CEQ A;  2XEV A;  3HG0 D;  4BSZ B;  3GZ1 A;  4EQF A;  3AU5 A;  2PM7 A;  1TR4 A;  3ZEF A;  4BER A;  4CGW A;  1N9A A;  3UQ3 A;  4DJA A;  2VSO E;  2BKK B;  2PQR A;  5FTP A;  1FVH A;  1IHG A;  3S2A A;  2A5E A;  3LVQ E;  4DI3 A;  3RKV A;  3CHP A;  3UTM A;  3TWV A;  3E30 A;  4HNA D;  4JHK A;  4FA6 A;  3SBT B;  5EIL A;  3FTX A;  3HVE A;  1WDY A;  4GTQ A; 
#chains in the Genus database with same CATH homology
 1MX2 A;  2Y1L E;  1IXV A;  2DVW A;  5EYP F;  1BI8 B;  3B7B A;  2HE0 A;  3HRA A;  4LG6 A;  1BD8 A;  1YYH A;  3T9K A;  5ENT D;  4OAV B;  1SVX A;  1QYM A;  3ZUV B;  3V2X A;  5CEA A;  4U8Y D;  3ZKJ A;  3IXE A;  2MYO A;  4BET A;  5BXO A;  4G8K A;  3EU9 A;  3NOC D;  3TWX A;  4GMR A;  4O1P A;  2ZGG A;  1DCQ A;  5FIO A;  2P2C P;  3JXI A;  4HB5 A;  4K5B A;  2AJA A;  5AQ7 A;  4DX2 A;  3TWU A;  4NIK A;  3UI2 A;  5CEC B;  4HBD A;  2Y0B G;  2PNN A;  2XEH A;  3W9F A;  4CZ2 D;  4DX1 A;  3TWQ A;  5ITZ F;  4QFV A;  2ZGD A;  3DEP A;  3JXJ A;  4U96 D;  1BLX B;  1N0R A;  4YDW A;  3D9H A;  3J5P A;  4HRM B;  5AQB A;  1OY3 D;  3T8K A;  1S70 B;  2XZD G;  3UXG A;  3NBN B;  4BEP A;  2J8S D;  5ENR D;  4U95 D;  2ETB A;  5KNH D;  4G8L A;  3W9G A;  2QC9 A;  4K5C A;  4N5Q A;  2KXP C;  1WG0 A;  3V31 A;  3EHQ A;  3TWW A;  5AAR A;  4HRL A;  3SO8 A;  5CED B;  1IKN D;  2F8Y A;  4OAU C;  2V4H C;  3V79 K;  3V30 A;  4HQD A;  5EID A;  3J5Q B;  5JA4 D;  2RFA A;  4TUM A;  3B95 A;  4YDY A;  5EIB E;  2XEN A;  5HS0 A;  5CBO A;  1UOH A;  1K3Z D;  4HRN A;  4F1P A;  1YMP A;  2F8X K;  4C48 B;  5EN5 D;  2XEE A;  2RFM A;  2B0O E;  4LSZ E;  3HG0 D;  4DUI A;  2QYJ A;  2JAB A;  1MX6 A;  2BKG A;  5ENS D;  5FIN A;  3TWT A;  2L6B A;  4BSZ B;  3AAA C;  4HI8 A;  3JUE A;  5CER B;  1AWC B;  3AJI A;  4JB8 P;  4J7W A;  4B93 B;  5EYL A;  2DWZ A;  2ETC A;  2DZO A;  2NYJ A;  3V2O A;  1NFI E;  3TWS A;  4QQI A;  4DX5 D;  4HLL A;  5BXU A;  1TR4 A;  1SW6 A;  2FO1 E;  1BU9 A;  5AAO A;  5AQ9 A;  4BER A;  3C5R A;  4ZFH A;  4Z68 A;  5ENO D;  4DX6 D;  5D66 A;  3ZNG A;  5AQA A;  1DC2 A;  5HKP A;  5KNG A;  3EHR A;  4U8V D;  4CYM D;  2BKK B;  1K1B A;  1IHB A;  3LJN A;  3NOG D;  4UUC A;  5ENQ D;  4DX7 D;  3KEA A;  5ENP D;  3DEO A;  2F37 A;  3ZU7 B;  2KBX A;  2A5E A;  1YCS B;  3Q9U C;  1AP7 A;  2ETA A;  4F6R D;  4GPM A;  5KWD A;  1BI7 B;  5AN8 A;  4O1O A;  1MJ0 A;  2V5Q C;  1D9S A;  3UTM A;  1K1A A;  3Q9N C;  1MX4 A;  2XZT G;  3TWV A;  4DRX E;  4J8Y A;  4HNA D;  4A63 B;  1A5E A;  4HI9 A;  1MYO A;  5EIL A;  5HRY A;  4RLY A;  5JMN D;  2VGE A;  3TWR A;  1WDY A;  5KBA A;  1G3N B;  5CBN A;  4ZHB A;  4ATZ D;  1N0Q A;  4K5A B;  1OT8 A;  4O60 A;  1N11 A;  2DZN A;  4LNU D;  3F6Q A;  4BES A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...