1AP7A

P19-ink4d from mouse, nmr, 20 structures
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
168
structure length
168
Chain Sequence
GSMLLEEVCVGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSPAVALELLKQGASPNVQDASGTSPVHDAARTGFLDTLKVLVEHGADVNALDSTGSLPIHLAIREGHSSVVSFLAPESDLHHRDASGLTPLELARQRGAQNLMDILQGHMMIPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the cyclin-dependent kinase inhibitor p19Ink4d.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell cycle inhibitor
molecule keywords P19-INK4D
total genus 31
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 1997-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1ap7A00
5BXUA 3JUEA 4TUMA 5ITZF 3DEOA 1IHBA 2VGEA 2FO1E 4OAVB 3D9HA 2Y0BG 2XEHA 4LNUD 3UTMA 3TWRA 2Y1LE 1YYHA 2F8YA 3KEAA 2F8XK 5AQBA 1MX6A 3UXGA 2DVWA 2F37A 1G3NB 1MX2A 2XEEA 2XZTG 4CZ2D 4DRXE 4DX7D 3TWVA 4HQDA 3NOCD 2ETBA 2DZOA 4O60A 1WDYA 4YDWA 4HRNA 5EIDA 4JB8P 1MX4A 5HKPA 4U96D 4GPMA 3W9FA 2ETCA 2JABA 4U95D 5ENTD 2MYOA 3ZU7B 1K1BA 4CYMD 5KBAA 1BD8A 4A63B 1N0RA 5D66A 2P2CP 5EYPF 4B93B 2PNNA 5ENRD 3V31A 5CEAA 3ZNGA 2AJAA 2KXPC 2XZDG 3J5PA 4LSZE 3F6QA 5EN5D 3W9GA 5JA4D 3IXEA 4O1PA 5FINA 4DX6D 5KWDA 1D9SA 1YMPA 4HBDA 4N5QA 3HG0D 5AQ9A 2XENA 3T8KA 4HI9A 1WG0A 1AP7A 3AJIA 1MJ0A 1S70B 2V5QC 5KNHD 3V30A 1DCQA 3EHRA 3TWUA 5EYLA 4UUCA 5AQ7A 3C5RA 4BERA 4HB5A 5CBNA 4BESA 4HNAD 3TWTA 3ZKJA 3ZUVB 4HI8A 3V2XA 1DC2A 4HRMB 5ENPD 2B0OE 4DUIA 3B95A 4C48B 1QYMA 3TWQA 4GMRA 5ENSD 5CEDB 2BKGA 3JXJA 1K1AA 1A5EA 2ETAA 1IXVA 1OT8A 2RFMA 4G8LA 3UI2A 4J7WA 1YCSB 5CBOA 3EHQA 1SW6A 4DX1A 1MYOA 4NIKA 4BEPA 3NOGD 4F1PA 3LJNA 3V2OA 1UOHA 2V4HC 2DWZA 3NBNB 3V79K 4DX5D 4J8YA 5HS0A 1N11A 2RFAA 4K5CA 5CERB 2ZGGA 5ENQD 5FIOA 5KNGA 4LG6A 4K5AB 4RLYA 4QFVA 4ZFHA 4Z68A 4U8VD 3TWSA 5EILA 4ATZD 2DZNA 3J5QB 5AQAA 1TR4A 4QQIA 1BI7B 3EU9A 2A5EA 2L6BA 3TWWA 5CECB 1OY3D 2KBXA 3Q9UC 4U8YD 3Q9NC 4HLLA 1SVXA 3SO8A 5ENOD 5BXOA 1IKND 1NFIE 4HRLA 4ZHBA 1AWCB 3JXIA 3HRAA 2QC9A 3B7BA 4BETA 1BLXB 1BU9A 5HRYA 2HE0A 5JMND 4YDYA 3T9KA 5AAOA 4DX2A 3AAAC 4K5BA 1BI8B 2QYJA 4F6RD 5AARA 2NYJA 2J8SD 4G8KA 4OAUC 3DEPA 5EIBE 5AN8A 1N0QA 1K3ZD 4O1OA 4BSZB 2ZGDA 2BKKB 3TWXA
chains in the Genus database with same CATH superfamily
1HZ4A 5ITZF 3DRAA 2WXRA 4JA9A 3FUJA 1U3DA 3UTMA 4TXQA 3CSFA 1FPPA 4G1TA 4Q96A 2XEEA 5B3SE 4C0MA 3FTVA 4CYMD 5KBAA 1NP7A 4G24A 2EINE 3QOUA 3MJWA 3LY8A 4AVXA 4CDRA 1YMPA 2XENA 2Y69E 4TUUA 3QK0A 5EYLA 4NQ0A 2LNIA 5A6CA 3D9KA 2KCLA 1N4PA 5G2NA 3JQ1A 5ARGA 3MKRA 3BEEA 3FUEA 3CR3A 4I17A 4W9RA 1UN9A 3V2OA 2V4HC 2HYZA 5HS0A 4GAAA 3VLFA 3PS6A 2P9IG 3UINC 4GTPA 3TG4A 3MEKA 3DBSA 2KBXA 2IO2C 3KSLA 4J8FA 2E0IA 4ZHBA 4ME2A 3HRAA 2QC9A 2KZTA 4AP2A 3DSXA 4CT0A 1INZA 4JXTA 2B6CA 2VGXA 3SF4A 1IQUA 4EPZA 1YYHA 4UWKA 3FUHA 5JHAA 3FUFA 3FTWA 3SHFA 1E7VA 2J49A 3CVPA 3O4ZA 2OEVA 1JCQA 1TNZA 1BD8A 5ENRD 1IHGA 1TN8A 1OWLA 1NL4A 4BWRA 3LJ3A 5AJLA 4JW1A 3RK6A 4UI9C 3ABME 3ZKJA 1QYMA 3LVQE 3PH0C 2CHWA 1E8ZA 1UJJA 4I9EA 4GTQA 4Z68A 5EILA 5A23A 5B1BE 1EPUA 1IKND 3JUIA 2EIME 3E32A 3T9KA 4DX2A 2OVFA 4EZKA 4GTRA 4LUNU 5ENPD 1NA0A 3MKQA 4HOSA 5LX8A 3PZDA 3FY4A 3HIZA 3FTSA 3SBTB 4PH4B 2F8YA 5FZSA 4DX7D 3SFXA 4WNGA 4DJAA 4B94A 4APFA 3TJPA 4IULA 5AENA 4LCTA 4BX9A 4CDMA 1TNUA 5T3RA 5EDSA 3ZXSA 3IXEA 2C2LA 2EILE 2VSXE 3Q79A 5AQ9A 5AJDA 2WXKA 1LF8A 4CT4A 3Q7FA 3ENEA 3EHRA 3UM0A 4UUCA 1JCSA 3ZIMA 3Q15A 4M7CA 3S2AA 3FH5A 3RIBA 4XKBA 4DX1A 1MYOA 4NIKA 3Q49B 3APFA 4WAFA 3LJNA 4KT6B 2L6JA 1H2TC 1O1RA 1DNPA 3IV0A 4UI9K 5CERB 4EECA 1H2VC 4WWNA 5FQ4A 4AY6A 4J8EA 2OVBA 4N5CA 1N95A 2AXUA 5BUZA 1E8YA 3OXLA 3FTYA 3K9IA 5BV0A 4ANVA 4ILGA 3BQOA 4URKA 3S7JA 3I5PA 4ILIA 4U0ZA 1SA5A 4I6JA 4DLOA 1LD7A 3PE3A 3QB2A 4G25A 4V3IA 3Q47B 3T5XA 4DI3A 2IU1A 2I1JA 2H6IA 4Q69A 2DVWA 2KCKA 1KT1A 2XQ0A 2XS8A 4ANXA 1G3NB 4A55A 3RJVA 1TEZA 1MX4A 4KZ0A 1UW4B 2JABA 4YDEA 5D0QD 1Z3XA 5BNWA 2V4LA 2A4ZA 2EIJE 1Y6IA 4FADA 5EKQD 2Y4UA 4MS6A 3ZRHA 3F6QA 5FT9A 4TV3A 3KEZA 4B89A 5FQ6A 4GTSA 4FJZA 5IY5E 3TGOA 4L1BA 4P29A 3QAQA 5G04C 3AU4A 1EYHA 4B8AA 5BT1A 3ZUVB 2NXPA 2EIKE 5EX0A 4FULA 3SFYA 1K1AA 2XRYA 2J08A 1A5EA 3CVXA 2UY1A 4G23A 4UWHA 1MZCA 3SZ7A 2YINA 4I1OB 4I2ZA 4Y6WA 2ZGGA 3BG1B 3I4RB 5KNGA 1O1SA 3B7TA 1TR4A 1BI7B 3UKUG 4AEZC 5BXOA 1QZ2A 3LXUX 3LY9A 3RSEG 3B7BA 3MX3A 4BETA 3CQCB 4U63A 2X6JA 4GCOA 3CVLA 4A3TA 3CK9A 4O1OA 2ZGDA 1JWFA 2XHEA 2IQCA 3UMVA 4B0ZA 3CVWA 4UWFA 3KEAA 3ONKA 3CSTA 2C0MA 1FVHA 1MHQA 4CZ2D 4IYPA 3UUXA 4N3AA 4ACKA 3W9FA 3IEGA 4GTOA 1MQSA 2V8SE 2OOEA 5CHEE 4FP7A 4LSZE 3ZFWA 3QC1A 1HX8A 3HG0D 3LKUA 4AY5A 3L13A 2FI7A 1S70B 3FTUA 3ASDA 4JD2G 5AQ7A 4XEIG 2WVIA 4AIFA 2L0TB 3E34A 4KYOB 3ASFA 2XCBA 4BEPA 2PM6A 3CGHA 5J08A 3ML8A 4FC8A 5BV1A 4DX5D 3I3NA 2WXIA 3EHNA 5T8IA 4GB9A 4K5AB 3CVQA 3RO3A 2WMOA 3N71A 2DZNA 5G55A 5CRUA 2L6BA 3HXDA 5EX3A 5FZRA 3ZGQA 5ANLA 2UY1B 1BU9A 3FU5A 3PEUB 4YDYA 3APDA 3CHPA 3OXGA 3DEPA 2FEZA 3ULYA 3ISMC 5J90A 1OCOE 4AV7A 3P2BA 4XI0A 2J4BA 3BG0B 3PNLB 4JHKA 5HI7A 3R7RA 3CHSA 3D3MA 3R7QA 3FUNA 2IY0C 3NOCD 2Q7FA 2YQ8A 4HLEA 3IKOB 4GYOA 2R2LA 2J09A 4OVUA 4U0UA 3ULQA 2RG8A 5EYPF 3G2VA 3V31A 5H7PA 4LERA 4H7YA 1VDYA 2AJAA 2KXPC 3DXMG 4HXIA 4HI9A 2XGMA 3FTXA 5CCMA 4BERA 3NQPA 4HB5A 4L2LA 4HNAD 3TWTA 2GROB 4HI8A 3V2XA 1H0AA 1HO8A 1TJCA 2WQHA 3HVEB 3JXJA 3KSQA 3T5VA 2NC9A 2RFMA 3SY2A 2CFZA 3D9LA 5DIZA 4K03A 2J4DA 3SBSA 2LSVA 3FEYA 5B1AE 2H6HA 2RFAA 5KJKA 4FLBA 4GZ3A 4J8DA 4ATGA 3RRUA 2IOLA 4HS2A 2ZIRA 3CKCA 4Y6CA 3MGBA 3FEXA 3L22A 2MRIA 2VGXB 4WNDA 2WXOA 3GZ2A 1OCZE 3UQ3A 2DIWA 4XZ4A 3S7BA 1TNBA 2R05A 1JWGA 3ONLA 1GW6A 3D9HA 4F1SA 1E8WA 1O1TA 2XEHA 1W3BA 2Y1LE 1O5MA 5AQBA 3OXFA 4HOUA 1FT2A 4CEMA 1SA4A 5ENTD 2WM9A 2A5UA 2GRRB 3QWVA 4GU5A 4JA7A 3UX4A 1Y8MA 4WWPA 3CHRA 2KM4A 2VSNA 1HS6A 3L6AA 4BTAA 2X6KA 2FF4A 4N5QA 3HXBA 3FHEA 3PREA 3UM3A 3PZ2A 3V30A 1DCQA 1N54A 2WQ7A 4PS3A 4AJWA 3PUJA 4GPKA 3CVNA 4LNGA 2BKGA 1HXIA 3FU0A 1V55E 3AS5A 3OAWA 1SQMA 4JL0A 4F3VA 3NBNB 4J8YA 2LXLA 3CVVA 4RLYA 3LYAA 1L5JA 1AWCB 4I6GA 1NI1A 5FQ8A 2HE0A 5JMND 3AAAC 2VGYA 3GZSA 2HM8A 2HO1A 4DK5A 4BX8A 2LAHA 2QZAA 5AN8A 3LY7A 3B13A 2VGEA 3LS8A 3I4GA 2WXJA 1SZ9A 1OWPA 4RQIA 1Z6TA 1H2UA 4GA0A 2DBAA 5ENNA 3CHQA 4BFRA 3TWVA 3HDXA 4I1AA 4HRNA 2AW6A 3ASGA 5CMYA 2ZISA 4JZYA 5JHBA 4KXKB 3SI5A 1XNFA 2I1KA 3CHMA 4XE0A 3UIPC 4HBDA 3NF1A 3ZPJA 3B7RL 3AJIA 3ZYQA 5T4YA 1JPLA 3BUAA 4MLPA 4HRMB 4NACA 3ZW3A 4KVMA 3ML9A 3FFLA 1HG2A 4N3BA 4DPRA 2P9KG 5FTPA 2V0PA 1FT1A 2ZU6B 4UQZA 4M3OA 4KBQA 3FUDA 2AXZA 3CEQA 2P9NG 3E30A 3Q7AA 4BY6A 2OCCE 3Q9UC 4U8YD 2OV8A 4HRLA 5HRYA 4N2SA 4A3VA 4GMJA 3ZN3A 1TNYA 4N3CA 2QYJA 2NYJA 4G8KA 3FUIA 1S64A 4IN3B 2BKKB 3TWXA 4GYWA 4XI9A 2WXHA 3TWRA 1ELKA 1Z3YA 4U8HA 4UQXA 1MX6A 2F37A 3L9TA 3PUKA 1MX2A 4WNEA 3X2QE 4DRXE 4XIFA 3ZHEA 3LPZA 3FWVA 3HVEA 1OCCE 4GZ6A 2V5FA 4EZJA 2BEDA 4JEHA 5KWDA 2VTBA 1JCRA 4YDOA 1EF1C 2VSOE 2WXMA 3EHMA 1LD8A 1HFAA 1ZU2A 4L2YA 4KMOA 4PS7A 3RRNB 3CLJA 2IJGX 3TL5A 4G8LA 4J7WA 2WXNA 3EHQA 5KJNA 3G2UA 3NAWA 5CCLA 3L82A 2XPZA 1UJKA 3HYMB 3NZSA 4LG6A 4F53A 4WUYA 3WG7E 3G2TA 3B7UX 3J5QB 4EZLA 3EU9A 3L54A 3D9NA 2XPYA 4WWOA 4FHJA 3D9OA 1H6KA 2X6IA 3JCKC 5AARA 2WXFA 3EU5A 3E33A 1HG5A 3JUEA 1IHBA 3FU6A 3MYVA 2IFUA 3DSUA 4ANWA 2FO7A 3GYZA 2XCCA 1FCHA 3RU0A 4GYYA 4ANUA 2MHKA 2I9CA 4OYSA 2R5SA 4GPMA 2CHXA 2ETCA 4I1MA 4BSXA 2FBNA 4YVQC 4B8CB 2R03A 2AXVA 3Q75A 3U9WA 3MV3B 2P58C 3ZHEB 1AP7A 4J8SA 5KNHD 3EJNA 5DBKA 4HVBA 2GRQB 3LDZA 4DUIA 2RD0A 3SFZA 3U3WA 5ENSD 4CCAA 4BT8A 1YCSB 1SW6A 3CK8A 1IYGA 4CRWA 2UWJG 4OVVA 3UM1A 2PQRA 3V79K 3AG3E 1N11A 1FVFA 4E85A 4K0RA 3GW4A 4ZFHA 1N4RA 4U8VD 1HU3A 4GA1A 1UN8A 1E7UA 4MBGA 2EQXA 3AU5A 3SO8A 1H19A 4Q94A 3EIQC 3FULA 5C2YA 4TXPA 2OEWA 1KZOA 1TN6A 4L9PA 4BSZB 1K3ZD 3UKRG 2PM7A 3AG2E 3PVLA 4JVSA 3FP3A 3ASOE 1K8KG 3MCXA 2KC7A 3ULEG 3PZ3A 1U2VG 2ETBA 2XGOA 1WDYA 3L16A 4UQYA 4FA6A 4U96D 3FTZA 1K1BA 4A63B 3U4TA 2PQNA 2X3MA 4B93B 4L7TA 5LCWC 4HFGA 3SNXA 3PNTB 2P9PG 3RAUA 4NURA 3PEVB 1LTXA 5JJTA 1E8XA 4X8QA 3T8KA 1WY6A 2XGSA 3U66A 4FHKA 5LOZA 4EQFA 4BESA 3DPYA 2B0OE 1E96B 4GMRA 3ZEFA 3JQ0A 2WPVA 2ETAA 1IXVA 1OT8A 4H7XA 3RO2A 3C98A 4LNBA 1WM5A 2I6HA 2BUGA 3D9PA 3IHYA 3SGHA 4C9BB 2E2EA 4JC8A 2I2OA 4GMLA 3TAXA 1QNFA 2J9QA 4KZCA 4XX5A 2GGFA 2DYRE 4NRHB 1PC2A 3UIOC 1N0QA 3ABKE 4TUMA 4UWGA 1UG3A 3U64A 3TXNA 5KCMA 2WXQA 5D0OD 3URZA 2CG2A 3FH8A 3KS2A 1PY1A 4GTVA 4HQDA 4GZCA 5EIDA 5HKPA 1TN7A 2MYOA 3ZU7B 2Y4TA 1OUVA 3LCAA 2WXGA 3CQGB 2GW1A 4U0SA 3MA5A 2VQ2A 4D10C 2XZDG 1Z5SC 3R9AB 2YNQA 1S63A 1KZPA 1ZB1A 1WG0A 2XPIA 3APCA 5LFAA 3FH7A 3S7FA 3C5RA 5CBNA 4XKCA 5G05J 3P1UA 3IBEA 3DXKG 3CVYA 3ASHA 3MKQB 3EIJA 3VTYA 3NOGD 2RKKA 3OTNA 4WNFA 3DSWA 4UWLA 3PZ1A 1OWOA 5M72A 2NSZA 4QFVA 3ZYLA 4HLLA 2ONDA 2P9SG 4JEUA 5JJ6A 2WXLA 3B7SA 3JYSA 1SZAA 2QY7A 2CFUA 3KAEA 4F6RD 3AS4A 3Q78A 5CRVA 1N4QA 2KZTB 1P5QA 5JJ7A 4PS8A 2WQ6A 3ZXPA 4I2WA 3AS8A 2F8XK 2HR2A 2VYIA 5C1DA 4L23A 2P9UG 2H6GA 2AVPA 4JB8P 3EUVA 4TRQA 3D9JA 4ILHB 2M63A 5E76A 4AM9A 3DSTA 5CEAA 5CMWA 3ZNGA 3SD5A 1KPSB 3J5PA 3G2SA 1E90A 4RSYA 5FQ7A 4DX6D 1WAO1 3CV0A 2VSYA 2QFCA 2V5QC 3HXEA 3PRZA 3MV2B 4G26A 2MOWA 3DPDA 2ILRA 1QBQA 3DSSA 3GZ1A 2GRPB 4C48B 2CHZA 3DWLG 5AYWD 2GRLA 4RG6A 4CGVA 2PL2A 3UI2A 5CBOA 1UOHA 2XS1A 1RW2A 4MRUA 4K5CA 3ZVVA 3C3OA 4F7AA 4U7EB 1TYQG 3UPVA 5G04J 3AG1E 4GTMA 2WXPA 4G11A 3D9MA 4AXHA 1OY3D 4FJYA 4A1GA 2Y3AA 2C0LA 2IEJA 4OAUC 2IOSA 3QARA 3VLEA 5ENOD 1HF8A 3MZLB 5E75A 4GZDA 1IQRA 2BTDA 3ZYKA 2GRMA 2X6HA 4IRUA 1JUQA 3ZYMA 4ACLA 1YA0A 1Q2ZA 4R7LA 1V54E 4YVOA 3G2WA 4U95D 3QWWA 3EDTB 3BU8A 4YNDA 2VTBB 1ELWA 3FUKA 1QQEA 3KD7A 3W9GA 5JA4D 4O1PA 4APOA 5FINA 3HHMA 5BPPA 1RZ4A 1MJ0A 3TWUA 4HORA 2L9BA 2WB2A 3S7DA 5ARFA 4F1PA 3AG4E 3FDHA 1XGWA 4U04A 2R17C 2AWIA 3PDNA 5D2MC 4FU3A 2LUHA 4RVBA 1PAQA 2JLBA 1KT0A 3TWSA 5AQAA 2VJ8A 5CECB 3UT7A 5FJYA 4A1SA 2LSUA 3HXCA 2F0YA 5AAOA 3UT4A 2KATA 1HH8A 3WXXA 3ASNE 1DVPA 1ZBPA 5BXUA 1OXJA 3DEOA 3D9IA 1H6OA 4OAVB 4MKTA 2Y0BG 4I9CA 2WMNA 4JPSA 3O48A 3UXGA 4JHJA 3DSVA 2XZTG 2DCPA 1X81A 2IF4A 2DZOA 4O60A 4DI4A 1TJFA 1X5BA 3L17A 1N0RA 2P2CP 1D8EA 3VTXA 3NB2A 4I43A 4E6HA 2FULA 4O6FA 1NA3A 2J07A 1OWNA 3E4BA 3SQVA 4BTBA 4BT9A 3CVUA 2R59A 5LP0A 4GCNA 1DC2A 1OCRE 1ELRA 4GA2A 2YHCA 3ABLE 5CEDB 3QKYA 3QJZA 4FLHA 2JEKA 3UT8A 2DWZA 3CKBA 4J6IA 2R02A 2L0IA 3Q5MA 5FIOA 4UI9J 2BF0X 2GRNB 4RG9A 5BW8C 4ATZD 3TG5A 1U3CA 3CK7A 3E37A 1KLXA 1NFIE 3T8MA 4DLQA 3JXIA 4EBAG 5A7DB 3QWPA 3TXMA 4LEUA 5HQ8A 2LO6A 3VLDA 3QDNA 4K5BA 3FU3A 2XRZA 4ABNA 3LVRE 1S0PA 3Q73A 2J8SD 2YHEA 4GZ5A 3RRMB 5KJLA 4PUCA 2FO1E 3NZUA 4TXRA 3RKVA 4LNUD 2ZXWE 4CDNA 5ANRA 1TNOA 3IHVA 4EHMA 4N39A 1NZNA 4YDWA 4CGWA 4U07A 4N2QA 3L08A 4I6EA 4C0EA 5D66A 2PNNA 2H6FA 2PZIA 2DYSE 5EN5D 3C3RA 2LXMA 3LEWA 1D9SA 3ESKA 4EBAA 2IO3C 4AOFA 4PDXA 1BPOA 4KVOA 3ESLA 2LAIA 4JHRA 4GTTA 1HE8A 3B95A 3C72A 1H6PA 4LRZA 3R9MA 3TWQA 3Q4AB 5FWQA 2XEVA 2QYUA 1N4SA 4HOQA 3HXFA 1EDUA 5LCWJ 5ENQD 2P9LG 2X38A 3CIAA 1OWMA 4QQIA 2A5EA 5G05C 2CG3A 3TWWA 1B89A 3Q9NC 3QNKA 1SVXA 3C3QA 2IONA 4J0UA 1A17A 1N52A 1BLXB 5AIJA 1DCEA 2KCVA 3UM2A 1N94A 3CHOA 3PZ4A 3FUMA 5KJMA 1N9AA 1BI8B 5FZQA 1D8DA 4HOTA 5EIBE 4G2VA 2X6FA 3PE4A
chains in the Genus database with same CATH topology
5BXUA 3JUEA 4TUMA 5ITZF 3DEOA 1IHBA 2VGEA 2FO1E 4OAVB 3D9HA 2Y0BG 2XEHA 4LNUD 3UTMA 3TWRA 2Y1LE 1YYHA 2F8YA 3KEAA 2F8XK 5AQBA 1MX6A 3UXGA 2DVWA 2F37A 1G3NB 1MX2A 2XEEA 2XZTG 4CZ2D 4DRXE 4DX7D 3TWVA 4HQDA 3NOCD 2ETBA 2DZOA 4O60A 1WDYA 4YDWA 4HRNA 5EIDA 4JB8P 1MX4A 5HKPA 4U96D 4GPMA 3W9FA 2ETCA 2JABA 4U95D 5ENTD 2MYOA 3ZU7B 1K1BA 4CYMD 5KBAA 1BD8A 4A63B 1N0RA 5D66A 2P2CP 5EYPF 4B93B 2PNNA 5ENRD 3V31A 5CEAA 3ZNGA 2AJAA 2KXPC 2XZDG 3J5PA 4LSZE 3F6QA 5EN5D 3W9GA 5JA4D 3IXEA 4O1PA 5FINA 4DX6D 5KWDA 1D9SA 1YMPA 4HBDA 4N5QA 3HG0D 5AQ9A 2XENA 3T8KA 4HI9A 1WG0A 1AP7A 3AJIA 1MJ0A 1S70B 2V5QC 5KNHD 3V30A 1DCQA 3EHRA 3TWUA 5EYLA 4UUCA 5AQ7A 3C5RA 4BERA 4HB5A 5CBNA 4BESA 4HNAD 3TWTA 3ZKJA 3ZUVB 4HI8A 3V2XA 1DC2A 4HRMB 5ENPD 2B0OE 4DUIA 3B95A 4C48B 1QYMA 3TWQA 4GMRA 5ENSD 5CEDB 2BKGA 3JXJA 1K1AA 1A5EA 2ETAA 1IXVA 1OT8A 2RFMA 4G8LA 3UI2A 4J7WA 1YCSB 5CBOA 3EHQA 1SW6A 4DX1A 1MYOA 4NIKA 4BEPA 3NOGD 4F1PA 3LJNA 3V2OA 1UOHA 2V4HC 2DWZA 3NBNB 3V79K 4DX5D 4J8YA 5HS0A 1N11A 2RFAA 4K5CA 5CERB 2ZGGA 5ENQD 5FIOA 5KNGA 4LG6A 4K5AB 4RLYA 4QFVA 4ZFHA 4Z68A 4U8VD 3TWSA 5EILA 4ATZD 2DZNA 3J5QB 5AQAA 1TR4A 4QQIA 1BI7B 3EU9A 2A5EA 2L6BA 3TWWA 5CECB 1OY3D 2KBXA 3Q9UC 4U8YD 3Q9NC 4HLLA 1SVXA 3SO8A 5ENOD 5BXOA 1IKND 1NFIE 4HRLA 4ZHBA 1AWCB 3JXIA 3HRAA 2QC9A 3B7BA 4BETA 1BLXB 1BU9A 5HRYA 2HE0A 5JMND 4YDYA 3T9KA 5AAOA 4DX2A 3AAAC 4K5BA 1BI8B 2QYJA 4F6RD 5AARA 2NYJA 2J8SD 4G8KA 4OAUC 3DEPA 5EIBE 5AN8A 1N0QA 1K3ZD 4O1OA 4BSZB 2ZGDA 2BKKB 3TWXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BXU A;  3JUE A;  4TUM A;  5ITZ F;  3DEO A;  1IHB A;  2VGE A;  2FO1 E;  4OAV B;  3D9H A;  2Y0B G;  2XEH A;  4LNU D;  3UTM A;  3TWR A;  2Y1L E;  1YYH A;  2F8Y A;  3KEA A;  2F8X K;  5AQB A;  1MX6 A;  3UXG A;  2DVW A;  2F37 A;  1G3N B;  1MX2 A;  2XEE A;  2XZT G;  4CZ2 D;  4DRX E;  4DX7 D;  3TWV A;  4HQD A;  3NOC D;  2ETB A;  2DZO A;  4O60 A;  1WDY A;  4YDW A;  4HRN A;  5EID A;  4JB8 P;  1MX4 A;  5HKP A;  4U96 D;  4GPM A;  3W9F A;  2ETC A;  2JAB A;  4U95 D;  5ENT D;  2MYO A;  3ZU7 B;  1K1B A;  4CYM D;  5KBA A;  1BD8 A;  4A63 B;  1N0R A;  5D66 A;  2P2C P;  5EYP F;  4B93 B;  2PNN A;  5ENR D;  3V31 A;  5CEA A;  3ZNG A;  2AJA A;  2KXP C;  2XZD G;  3J5P A;  4LSZ E;  3F6Q A;  5EN5 D;  3W9G A;  5JA4 D;  3IXE A;  4O1P A;  5FIN A;  4DX6 D;  5KWD A;  1D9S A;  1YMP A;  4HBD A;  4N5Q A;  3HG0 D;  5AQ9 A;  2XEN A;  3T8K A;  4HI9 A;  1WG0 A;  1AP7 A;  3AJI A;  1MJ0 A;  1S70 B;  2V5Q C;  5KNH D;  3V30 A;  1DCQ A;  3EHR A;  3TWU A;  5EYL A;  4UUC A;  5AQ7 A;  3C5R A;  4BER A;  4HB5 A;  5CBN A;  4BES A;  4HNA D;  3TWT A;  3ZKJ A;  3ZUV B;  4HI8 A;  3V2X A;  1DC2 A;  4HRM B;  5ENP D;  2B0O E;  4DUI A;  3B95 A;  4C48 B;  1QYM A;  3TWQ A;  4GMR A;  5ENS D;  5CED B;  2BKG A;  3JXJ A;  1K1A A;  1A5E A;  2ETA A;  1IXV A;  1OT8 A;  2RFM A;  4G8L A;  3UI2 A;  4J7W A;  1YCS B;  5CBO A;  3EHQ A;  1SW6 A;  4DX1 A;  1MYO A;  4NIK A;  4BEP A;  3NOG D;  4F1P A;  3LJN A;  3V2O A;  1UOH A;  2V4H C;  2DWZ A;  3NBN B;  3V79 K;  4DX5 D;  4J8Y A;  5HS0 A;  1N11 A;  2RFA A;  4K5C A;  5CER B;  2ZGG A;  5ENQ D;  5FIO A;  5KNG A;  4LG6 A;  4K5A B;  4RLY A;  4QFV A;  4ZFH A;  4Z68 A;  4U8V D;  3TWS A;  5EIL A;  4ATZ D;  2DZN A;  3J5Q B;  5AQA A;  1TR4 A;  4QQI A;  1BI7 B;  3EU9 A;  2A5E A;  2L6B A;  3TWW A;  5CEC B;  1OY3 D;  2KBX A;  3Q9U C;  4U8Y D;  3Q9N C;  4HLL A;  1SVX A;  3SO8 A;  5ENO D;  5BXO A;  1IKN D;  1NFI E;  4HRL A;  4ZHB A;  1AWC B;  3JXI A;  3HRA A;  2QC9 A;  3B7B A;  4BET A;  1BLX B;  1BU9 A;  5HRY A;  2HE0 A;  5JMN D;  4YDY A;  3T9K A;  5AAO A;  4DX2 A;  3AAA C;  4K5B A;  1BI8 B;  2QYJ A;  4F6R D;  5AAR A;  2NYJ A;  2J8S D;  4G8K A;  4OAU C;  3DEP A;  5EIB E;  5AN8 A;  1N0Q A;  1K3Z D;  4O1O A;  4BSZ B;  2ZGD A;  2BKK B;  3TWX A; 
#chains in the Genus database with same CATH topology
 1HZ4 A;  5ITZ F;  3DRA A;  2WXR A;  4JA9 A;  3FUJ A;  1U3D A;  3UTM A;  4TXQ A;  3CSF A;  1FPP A;  4G1T A;  4Q96 A;  2XEE A;  5B3S E;  4C0M A;  3FTV A;  4CYM D;  5KBA A;  1NP7 A;  4G24 A;  2EIN E;  3QOU A;  3MJW A;  3LY8 A;  4AVX A;  4CDR A;  1YMP A;  2XEN A;  2Y69 E;  4TUU A;  3QK0 A;  5EYL A;  4NQ0 A;  2LNI A;  5A6C A;  3D9K A;  2KCL A;  1N4P A;  5G2N A;  3JQ1 A;  5ARG A;  3MKR A;  3BEE A;  3FUE A;  3CR3 A;  4I17 A;  4W9R A;  1UN9 A;  3V2O A;  2V4H C;  2HYZ A;  5HS0 A;  4GAA A;  3VLF A;  3PS6 A;  2P9I G;  3UIN C;  4GTP A;  3TG4 A;  3MEK A;  3DBS A;  2KBX A;  2IO2 C;  3KSL A;  4J8F A;  2E0I A;  4ZHB A;  4ME2 A;  3HRA A;  2QC9 A;  2KZT A;  4AP2 A;  3DSX A;  4CT0 A;  1INZ A;  4JXT A;  2B6C A;  2VGX A;  3SF4 A;  1IQU A;  4EPZ A;  1YYH A;  4UWK A;  3FUH A;  5JHA A;  3FUF A;  3FTW A;  3SHF A;  1E7V A;  2J49 A;  3CVP A;  3O4Z A;  2OEV A;  1JCQ A;  1TNZ A;  1BD8 A;  5ENR D;  1IHG A;  1TN8 A;  1OWL A;  1NL4 A;  4BWR A;  3LJ3 A;  5AJL A;  4JW1 A;  3RK6 A;  4UI9 C;  3ABM E;  3ZKJ A;  1QYM A;  3LVQ E;  3PH0 C;  2CHW A;  1E8Z A;  1UJJ A;  4I9E A;  4GTQ A;  4Z68 A;  5EIL A;  5A23 A;  5B1B E;  1EPU A;  1IKN D;  3JUI A;  2EIM E;  3E32 A;  3T9K A;  4DX2 A;  2OVF A;  4EZK A;  4GTR A;  4LUN U;  5ENP D;  1NA0 A;  3MKQ A;  4HOS A;  5LX8 A;  3PZD A;  3FY4 A;  3HIZ A;  3FTS A;  3SBT B;  4PH4 B;  2F8Y A;  5FZS A;  4DX7 D;  3SFX A;  4WNG A;  4DJA A;  4B94 A;  4APF A;  3TJP A;  4IUL A;  5AEN A;  4LCT A;  4BX9 A;  4CDM A;  1TNU A;  5T3R A;  5EDS A;  3ZXS A;  3IXE A;  2C2L A;  2EIL E;  2VSX E;  3Q79 A;  5AQ9 A;  5AJD A;  2WXK A;  1LF8 A;  4CT4 A;  3Q7F A;  3ENE A;  3EHR A;  3UM0 A;  4UUC A;  1JCS A;  3ZIM A;  3Q15 A;  4M7C A;  3S2A A;  3FH5 A;  3RIB A;  4XKB A;  4DX1 A;  1MYO A;  4NIK A;  3Q49 B;  3APF A;  4WAF A;  3LJN A;  4KT6 B;  2L6J A;  1H2T C;  1O1R A;  1DNP A;  3IV0 A;  4UI9 K;  5CER B;  4EEC A;  1H2V C;  4WWN A;  5FQ4 A;  4AY6 A;  4J8E A;  2OVB A;  4N5C A;  1N95 A;  2AXU A;  5BUZ A;  1E8Y A;  3OXL A;  3FTY A;  3K9I A;  5BV0 A;  4ANV A;  4ILG A;  3BQO A;  4URK A;  3S7J A;  3I5P A;  4ILI A;  4U0Z A;  1SA5 A;  4I6J A;  4DLO A;  1LD7 A;  3PE3 A;  3QB2 A;  4G25 A;  4V3I A;  3Q47 B;  3T5X A;  4DI3 A;  2IU1 A;  2I1J A;  2H6I A;  4Q69 A;  2DVW A;  2KCK A;  1KT1 A;  2XQ0 A;  2XS8 A;  4ANX A;  1G3N B;  4A55 A;  3RJV A;  1TEZ A;  1MX4 A;  4KZ0 A;  1UW4 B;  2JAB A;  4YDE A;  5D0Q D;  1Z3X A;  5BNW A;  2V4L A;  2A4Z A;  2EIJ E;  1Y6I A;  4FAD A;  5EKQ D;  2Y4U A;  4MS6 A;  3ZRH A;  3F6Q A;  5FT9 A;  4TV3 A;  3KEZ A;  4B89 A;  5FQ6 A;  4GTS A;  4FJZ A;  5IY5 E;  3TGO A;  4L1B A;  4P29 A;  3QAQ A;  5G04 C;  3AU4 A;  1EYH A;  4B8A A;  5BT1 A;  3ZUV B;  2NXP A;  2EIK E;  5EX0 A;  4FUL A;  3SFY A;  1K1A A;  2XRY A;  2J08 A;  1A5E A;  3CVX A;  2UY1 A;  4G23 A;  4UWH A;  1MZC A;  3SZ7 A;  2YIN A;  4I1O B;  4I2Z A;  4Y6W A;  2ZGG A;  3BG1 B;  3I4R B;  5KNG A;  1O1S A;  3B7T A;  1TR4 A;  1BI7 B;  3UKU G;  4AEZ C;  5BXO A;  1QZ2 A;  3LXU X;  3LY9 A;  3RSE G;  3B7B A;  3MX3 A;  4BET A;  3CQC B;  4U63 A;  2X6J A;  4GCO A;  3CVL A;  4A3T A;  3CK9 A;  4O1O A;  2ZGD A;  1JWF A;  2XHE A;  2IQC A;  3UMV A;  4B0Z A;  3CVW A;  4UWF A;  3KEA A;  3ONK A;  3CST A;  2C0M A;  1FVH A;  1MHQ A;  4CZ2 D;  4IYP A;  3UUX A;  4N3A A;  4ACK A;  3W9F A;  3IEG A;  4GTO A;  1MQS A;  2V8S E;  2OOE A;  5CHE E;  4FP7 A;  4LSZ E;  3ZFW A;  3QC1 A;  1HX8 A;  3HG0 D;  3LKU A;  4AY5 A;  3L13 A;  2FI7 A;  1S70 B;  3FTU A;  3ASD A;  4JD2 G;  5AQ7 A;  4XEI G;  2WVI A;  4AIF A;  2L0T B;  3E34 A;  4KYO B;  3ASF A;  2XCB A;  4BEP A;  2PM6 A;  3CGH A;  5J08 A;  3ML8 A;  4FC8 A;  5BV1 A;  4DX5 D;  3I3N A;  2WXI A;  3EHN A;  5T8I A;  4GB9 A;  4K5A B;  3CVQ A;  3RO3 A;  2WMO A;  3N71 A;  2DZN A;  5G55 A;  5CRU A;  2L6B A;  3HXD A;  5EX3 A;  5FZR A;  3ZGQ A;  5ANL A;  2UY1 B;  1BU9 A;  3FU5 A;  3PEU B;  4YDY A;  3APD A;  3CHP A;  3OXG A;  3DEP A;  2FEZ A;  3ULY A;  3ISM C;  5J90 A;  1OCO E;  4AV7 A;  3P2B A;  4XI0 A;  2J4B A;  3BG0 B;  3PNL B;  4JHK A;  5HI7 A;  3R7R A;  3CHS A;  3D3M A;  3R7Q A;  3FUN A;  2IY0 C;  3NOC D;  2Q7F A;  2YQ8 A;  4HLE A;  3IKO B;  4GYO A;  2R2L A;  2J09 A;  4OVU A;  4U0U A;  3ULQ A;  2RG8 A;  5EYP F;  3G2V A;  3V31 A;  5H7P A;  4LER A;  4H7Y A;  1VDY A;  2AJA A;  2KXP C;  3DXM G;  4HXI A;  4HI9 A;  2XGM A;  3FTX A;  5CCM A;  4BER A;  3NQP A;  4HB5 A;  4L2L A;  4HNA D;  3TWT A;  2GRO B;  4HI8 A;  3V2X A;  1H0A A;  1HO8 A;  1TJC A;  2WQH A;  3HVE B;  3JXJ A;  3KSQ A;  3T5V A;  2NC9 A;  2RFM A;  3SY2 A;  2CFZ A;  3D9L A;  5DIZ A;  4K03 A;  2J4D A;  3SBS A;  2LSV A;  3FEY A;  5B1A E;  2H6H A;  2RFA A;  5KJK A;  4FLB A;  4GZ3 A;  4J8D A;  4ATG A;  3RRU A;  2IOL A;  4HS2 A;  2ZIR A;  3CKC A;  4Y6C A;  3MGB A;  3FEX A;  3L22 A;  2MRI A;  2VGX B;  4WND A;  2WXO A;  3GZ2 A;  1OCZ E;  3UQ3 A;  2DIW A;  4XZ4 A;  3S7B A;  1TNB A;  2R05 A;  1JWG A;  3ONL A;  1GW6 A;  3D9H A;  4F1S A;  1E8W A;  1O1T A;  2XEH A;  1W3B A;  2Y1L E;  1O5M A;  5AQB A;  3OXF A;  4HOU A;  1FT2 A;  4CEM A;  1SA4 A;  5ENT D;  2WM9 A;  2A5U A;  2GRR B;  3QWV A;  4GU5 A;  4JA7 A;  3UX4 A;  1Y8M A;  4WWP A;  3CHR A;  2KM4 A;  2VSN A;  1HS6 A;  3L6A A;  4BTA A;  2X6K A;  2FF4 A;  4N5Q A;  3HXB A;  3FHE A;  3PRE A;  3UM3 A;  3PZ2 A;  3V30 A;  1DCQ A;  1N54 A;  2WQ7 A;  4PS3 A;  4AJW A;  3PUJ A;  4GPK A;  3CVN A;  4LNG A;  2BKG A;  1HXI A;  3FU0 A;  1V55 E;  3AS5 A;  3OAW A;  1SQM A;  4JL0 A;  4F3V A;  3NBN B;  4J8Y A;  2LXL A;  3CVV A;  4RLY A;  3LYA A;  1L5J A;  1AWC B;  4I6G A;  1NI1 A;  5FQ8 A;  2HE0 A;  5JMN D;  3AAA C;  2VGY A;  3GZS A;  2HM8 A;  2HO1 A;  4DK5 A;  4BX8 A;  2LAH A;  2QZA A;  5AN8 A;  3LY7 A;  3B13 A;  2VGE A;  3LS8 A;  3I4G A;  2WXJ A;  1SZ9 A;  1OWP A;  4RQI A;  1Z6T A;  1H2U A;  4GA0 A;  2DBA A;  5ENN A;  3CHQ A;  4BFR A;  3TWV A;  3HDX A;  4I1A A;  4HRN A;  2AW6 A;  3ASG A;  5CMY A;  2ZIS A;  4JZY A;  5JHB A;  4KXK B;  3SI5 A;  1XNF A;  2I1K A;  3CHM A;  4XE0 A;  3UIP C;  4HBD A;  3NF1 A;  3ZPJ A;  3B7R L;  3AJI A;  3ZYQ A;  5T4Y A;  1JPL A;  3BUA A;  4MLP A;  4HRM B;  4NAC A;  3ZW3 A;  4KVM A;  3ML9 A;  3FFL A;  1HG2 A;  4N3B A;  4DPR A;  2P9K G;  5FTP A;  2V0P A;  1FT1 A;  2ZU6 B;  4UQZ A;  4M3O A;  4KBQ A;  3FUD A;  2AXZ A;  3CEQ A;  2P9N G;  3E30 A;  3Q7A A;  4BY6 A;  2OCC E;  3Q9U C;  4U8Y D;  2OV8 A;  4HRL A;  5HRY A;  4N2S A;  4A3V A;  4GMJ A;  3ZN3 A;  1TNY A;  4N3C A;  2QYJ A;  2NYJ A;  4G8K A;  3FUI A;  1S64 A;  4IN3 B;  2BKK B;  3TWX A;  4GYW A;  4XI9 A;  2WXH A;  3TWR A;  1ELK A;  1Z3Y A;  4U8H A;  4UQX A;  1MX6 A;  2F37 A;  3L9T A;  3PUK A;  1MX2 A;  4WNE A;  3X2Q E;  4DRX E;  4XIF A;  3ZHE A;  3LPZ A;  3FWV A;  3HVE A;  1OCC E;  4GZ6 A;  2V5F A;  4EZJ A;  2BED A;  4JEH A;  5KWD A;  2VTB A;  1JCR A;  4YDO A;  1EF1 C;  2VSO E;  2WXM A;  3EHM A;  1LD8 A;  1HFA A;  1ZU2 A;  4L2Y A;  4KMO A;  4PS7 A;  3RRN B;  3CLJ A;  2IJG X;  3TL5 A;  4G8L A;  4J7W A;  2WXN A;  3EHQ A;  5KJN A;  3G2U A;  3NAW A;  5CCL A;  3L82 A;  2XPZ A;  1UJK A;  3HYM B;  3NZS A;  4LG6 A;  4F53 A;  4WUY A;  3WG7 E;  3G2T A;  3B7U X;  3J5Q B;  4EZL A;  3EU9 A;  3L54 A;  3D9N A;  2XPY A;  4WWO A;  4FHJ A;  3D9O A;  1H6K A;  2X6I A;  3JCK C;  5AAR A;  2WXF A;  3EU5 A;  3E33 A;  1HG5 A;  3JUE A;  1IHB A;  3FU6 A;  3MYV A;  2IFU A;  3DSU A;  4ANW A;  2FO7 A;  3GYZ A;  2XCC A;  1FCH A;  3RU0 A;  4GYY A;  4ANU A;  2MHK A;  2I9C A;  4OYS A;  2R5S A;  4GPM A;  2CHX A;  2ETC A;  4I1M A;  4BSX A;  2FBN A;  4YVQ C;  4B8C B;  2R03 A;  2AXV A;  3Q75 A;  3U9W A;  3MV3 B;  2P58 C;  3ZHE B;  1AP7 A;  4J8S A;  5KNH D;  3EJN A;  5DBK A;  4HVB A;  2GRQ B;  3LDZ A;  4DUI A;  2RD0 A;  3SFZ A;  3U3W A;  5ENS D;  4CCA A;  4BT8 A;  1YCS B;  1SW6 A;  3CK8 A;  1IYG A;  4CRW A;  2UWJ G;  4OVV A;  3UM1 A;  2PQR A;  3V79 K;  3AG3 E;  1N11 A;  1FVF A;  4E85 A;  4K0R A;  3GW4 A;  4ZFH A;  1N4R A;  4U8V D;  1HU3 A;  4GA1 A;  1UN8 A;  1E7U A;  4MBG A;  2EQX A;  3AU5 A;  3SO8 A;  1H19 A;  4Q94 A;  3EIQ C;  3FUL A;  5C2Y A;  4TXP A;  2OEW A;  1KZO A;  1TN6 A;  4L9P A;  4BSZ B;  1K3Z D;  3UKR G;  2PM7 A;  3AG2 E;  3PVL A;  4JVS A;  3FP3 A;  3ASO E;  1K8K G;  3MCX A;  2KC7 A;  3ULE G;  3PZ3 A;  1U2V G;  2ETB A;  2XGO A;  1WDY A;  3L16 A;  4UQY A;  4FA6 A;  4U96 D;  3FTZ A;  1K1B A;  4A63 B;  3U4T A;  2PQN A;  2X3M A;  4B93 B;  4L7T A;  5LCW C;  4HFG A;  3SNX A;  3PNT B;  2P9P G;  3RAU A;  4NUR A;  3PEV B;  1LTX A;  5JJT A;  1E8X A;  4X8Q A;  3T8K A;  1WY6 A;  2XGS A;  3U66 A;  4FHK A;  5LOZ A;  4EQF A;  4BES A;  3DPY A;  2B0O E;  1E96 B;  4GMR A;  3ZEF A;  3JQ0 A;  2WPV A;  2ETA A;  1IXV A;  1OT8 A;  4H7X A;  3RO2 A;  3C98 A;  4LNB A;  1WM5 A;  2I6H A;  2BUG A;  3D9P A;  3IHY A;  3SGH A;  4C9B B;  2E2E A;  4JC8 A;  2I2O A;  4GML A;  3TAX A;  1QNF A;  2J9Q A;  4KZC A;  4XX5 A;  2GGF A;  2DYR E;  4NRH B;  1PC2 A;  3UIO C;  1N0Q A;  3ABK E;  4TUM A;  4UWG A;  1UG3 A;  3U64 A;  3TXN A;  5KCM A;  2WXQ A;  5D0O D;  3URZ A;  2CG2 A;  3FH8 A;  3KS2 A;  1PY1 A;  4GTV A;  4HQD A;  4GZC A;  5EID A;  5HKP A;  1TN7 A;  2MYO A;  3ZU7 B;  2Y4T A;  1OUV A;  3LCA A;  2WXG A;  3CQG B;  2GW1 A;  4U0S A;  3MA5 A;  2VQ2 A;  4D10 C;  2XZD G;  1Z5S C;  3R9A B;  2YNQ A;  1S63 A;  1KZP A;  1ZB1 A;  1WG0 A;  2XPI A;  3APC A;  5LFA A;  3FH7 A;  3S7F A;  3C5R A;  5CBN A;  4XKC A;  5G05 J;  3P1U A;  3IBE A;  3DXK G;  3CVY A;  3ASH A;  3MKQ B;  3EIJ A;  3VTY A;  3NOG D;  2RKK A;  3OTN A;  4WNF A;  3DSW A;  4UWL A;  3PZ1 A;  1OWO A;  5M72 A;  2NSZ A;  4QFV A;  3ZYL A;  4HLL A;  2OND A;  2P9S G;  4JEU A;  5JJ6 A;  2WXL A;  3B7S A;  3JYS A;  1SZA A;  2QY7 A;  2CFU A;  3KAE A;  4F6R D;  3AS4 A;  3Q78 A;  5CRV A;  1N4Q A;  2KZT B;  1P5Q A;  5JJ7 A;  4PS8 A;  2WQ6 A;  3ZXP A;  4I2W A;  3AS8 A;  2F8X K;  2HR2 A;  2VYI A;  5C1D A;  4L23 A;  2P9U G;  2H6G A;  2AVP A;  4JB8 P;  3EUV A;  4TRQ A;  3D9J A;  4ILH B;  2M63 A;  5E76 A;  4AM9 A;  3DST A;  5CEA A;  5CMW A;  3ZNG A;  3SD5 A;  1KPS B;  3J5P A;  3G2S A;  1E90 A;  4RSY A;  5FQ7 A;  4DX6 D;  1WAO 1;  3CV0 A;  2VSY A;  2QFC A;  2V5Q C;  3HXE A;  3PRZ A;  3MV2 B;  4G26 A;  2MOW A;  3DPD A;  2ILR A;  1QBQ A;  3DSS A;  3GZ1 A;  2GRP B;  4C48 B;  2CHZ A;  3DWL G;  5AYW D;  2GRL A;  4RG6 A;  4CGV A;  2PL2 A;  3UI2 A;  5CBO A;  1UOH A;  2XS1 A;  1RW2 A;  4MRU A;  4K5C A;  3ZVV A;  3C3O A;  4F7A A;  4U7E B;  1TYQ G;  3UPV A;  5G04 J;  3AG1 E;  4GTM A;  2WXP A;  4G11 A;  3D9M A;  4AXH A;  1OY3 D;  4FJY A;  4A1G A;  2Y3A A;  2C0L A;  2IEJ A;  4OAU C;  2IOS A;  3QAR A;  3VLE A;  5ENO D;  1HF8 A;  3MZL B;  5E75 A;  4GZD A;  1IQR A;  2BTD A;  3ZYK A;  2GRM A;  2X6H A;  4IRU A;  1JUQ A;  3ZYM A;  4ACL A;  1YA0 A;  1Q2Z A;  4R7L A;  1V54 E;  4YVO A;  3G2W A;  4U95 D;  3QWW A;  3EDT B;  3BU8 A;  4YND A;  2VTB B;  1ELW A;  3FUK A;  1QQE A;  3KD7 A;  3W9G A;  5JA4 D;  4O1P A;  4APO A;  5FIN A;  3HHM A;  5BPP A;  1RZ4 A;  1MJ0 A;  3TWU A;  4HOR A;  2L9B A;  2WB2 A;  3S7D A;  5ARF A;  4F1P A;  3AG4 E;  3FDH A;  1XGW A;  4U04 A;  2R17 C;  2AWI A;  3PDN A;  5D2M C;  4FU3 A;  2LUH A;  4RVB A;  1PAQ A;  2JLB A;  1KT0 A;  3TWS A;  5AQA A;  2VJ8 A;  5CEC B;  3UT7 A;  5FJY A;  4A1S A;  2LSU A;  3HXC A;  2F0Y A;  5AAO A;  3UT4 A;  2KAT A;  1HH8 A;  3WXX A;  3ASN E;  1DVP A;  1ZBP A;  5BXU A;  1OXJ A;  3DEO A;  3D9I A;  1H6O A;  4OAV B;  4MKT A;  2Y0B G;  4I9C A;  2WMN A;  4JPS A;  3O48 A;  3UXG A;  4JHJ A;  3DSV A;  2XZT G;  2DCP A;  1X81 A;  2IF4 A;  2DZO A;  4O60 A;  4DI4 A;  1TJF A;  1X5B A;  3L17 A;  1N0R A;  2P2C P;  1D8E A;  3VTX A;  3NB2 A;  4I43 A;  4E6H A;  2FUL A;  4O6F A;  1NA3 A;  2J07 A;  1OWN A;  3E4B A;  3SQV A;  4BTB A;  4BT9 A;  3CVU A;  2R59 A;  5LP0 A;  4GCN A;  1DC2 A;  1OCR E;  1ELR A;  4GA2 A;  2YHC A;  3ABL E;  5CED B;  3QKY A;  3QJZ A;  4FLH A;  2JEK A;  3UT8 A;  2DWZ A;  3CKB A;  4J6I A;  2R02 A;  2L0I A;  3Q5M A;  5FIO A;  4UI9 J;  2BF0 X;  2GRN B;  4RG9 A;  5BW8 C;  4ATZ D;  3TG5 A;  1U3C A;  3CK7 A;  3E37 A;  1KLX A;  1NFI E;  3T8M A;  4DLQ A;  3JXI A;  4EBA G;  5A7D B;  3QWP A;  3TXM A;  4LEU A;  5HQ8 A;  2LO6 A;  3VLD A;  3QDN A;  4K5B A;  3FU3 A;  2XRZ A;  4ABN A;  3LVR E;  1S0P A;  3Q73 A;  2J8S D;  2YHE A;  4GZ5 A;  3RRM B;  5KJL A;  4PUC A;  2FO1 E;  3NZU A;  4TXR A;  3RKV A;  4LNU D;  2ZXW E;  4CDN A;  5ANR A;  1TNO A;  3IHV A;  4EHM A;  4N39 A;  1NZN A;  4YDW A;  4CGW A;  4U07 A;  4N2Q A;  3L08 A;  4I6E A;  4C0E A;  5D66 A;  2PNN A;  2H6F A;  2PZI A;  2DYS E;  5EN5 D;  3C3R A;  2LXM A;  3LEW A;  1D9S A;  3ESK A;  4EBA A;  2IO3 C;  4AOF A;  4PDX A;  1BPO A;  4KVO A;  3ESL A;  2LAI A;  4JHR A;  4GTT A;  1HE8 A;  3B95 A;  3C72 A;  1H6P A;  4LRZ A;  3R9M A;  3TWQ A;  3Q4A B;  5FWQ A;  2XEV A;  2QYU A;  1N4S A;  4HOQ A;  3HXF A;  1EDU A;  5LCW J;  5ENQ D;  2P9L G;  2X38 A;  3CIA A;  1OWM A;  4QQI A;  2A5E A;  5G05 C;  2CG3 A;  3TWW A;  1B89 A;  3Q9N C;  3QNK A;  1SVX A;  3C3Q A;  2ION A;  4J0U A;  1A17 A;  1N52 A;  1BLX B;  5AIJ A;  1DCE A;  2KCV A;  3UM2 A;  1N94 A;  3CHO A;  3PZ4 A;  3FUM A;  5KJM A;  1N9A A;  1BI8 B;  5FZQ A;  1D8D A;  4HOT A;  5EIB E;  4G2V A;  2X6F A;  3PE4 A; 
#chains in the Genus database with same CATH homology
 5BXU A;  3JUE A;  4TUM A;  5ITZ F;  3DEO A;  1IHB A;  2VGE A;  2FO1 E;  4OAV B;  3D9H A;  2Y0B G;  2XEH A;  4LNU D;  3UTM A;  3TWR A;  2Y1L E;  1YYH A;  2F8Y A;  3KEA A;  2F8X K;  5AQB A;  1MX6 A;  3UXG A;  2DVW A;  2F37 A;  1G3N B;  1MX2 A;  2XEE A;  2XZT G;  4CZ2 D;  4DRX E;  4DX7 D;  3TWV A;  4HQD A;  3NOC D;  2ETB A;  2DZO A;  4O60 A;  1WDY A;  4YDW A;  4HRN A;  5EID A;  4JB8 P;  1MX4 A;  5HKP A;  4U96 D;  4GPM A;  3W9F A;  2ETC A;  2JAB A;  4U95 D;  5ENT D;  2MYO A;  3ZU7 B;  1K1B A;  4CYM D;  5KBA A;  1BD8 A;  4A63 B;  1N0R A;  5D66 A;  2P2C P;  5EYP F;  4B93 B;  2PNN A;  5ENR D;  3V31 A;  5CEA A;  3ZNG A;  2AJA A;  2KXP C;  2XZD G;  3J5P A;  4LSZ E;  3F6Q A;  5EN5 D;  3W9G A;  5JA4 D;  3IXE A;  4O1P A;  5FIN A;  4DX6 D;  5KWD A;  1D9S A;  1YMP A;  4HBD A;  4N5Q A;  3HG0 D;  5AQ9 A;  2XEN A;  3T8K A;  4HI9 A;  1WG0 A;  1AP7 A;  3AJI A;  1MJ0 A;  1S70 B;  2V5Q C;  5KNH D;  3V30 A;  1DCQ A;  3EHR A;  3TWU A;  5EYL A;  4UUC A;  5AQ7 A;  3C5R A;  4BER A;  4HB5 A;  5CBN A;  4BES A;  4HNA D;  3TWT A;  3ZKJ A;  3ZUV B;  4HI8 A;  3V2X A;  1DC2 A;  4HRM B;  5ENP D;  2B0O E;  4DUI A;  3B95 A;  4C48 B;  1QYM A;  3TWQ A;  4GMR A;  5ENS D;  5CED B;  2BKG A;  3JXJ A;  1K1A A;  1A5E A;  2ETA A;  1IXV A;  1OT8 A;  2RFM A;  4G8L A;  3UI2 A;  4J7W A;  1YCS B;  5CBO A;  3EHQ A;  1SW6 A;  4DX1 A;  1MYO A;  4NIK A;  4BEP A;  3NOG D;  4F1P A;  3LJN A;  3V2O A;  1UOH A;  2V4H C;  2DWZ A;  3NBN B;  3V79 K;  4DX5 D;  4J8Y A;  5HS0 A;  1N11 A;  2RFA A;  4K5C A;  5CER B;  2ZGG A;  5ENQ D;  5FIO A;  5KNG A;  4LG6 A;  4K5A B;  4RLY A;  4QFV A;  4ZFH A;  4Z68 A;  4U8V D;  3TWS A;  5EIL A;  4ATZ D;  2DZN A;  3J5Q B;  5AQA A;  1TR4 A;  4QQI A;  1BI7 B;  3EU9 A;  2A5E A;  2L6B A;  3TWW A;  5CEC B;  1OY3 D;  2KBX A;  3Q9U C;  4U8Y D;  3Q9N C;  4HLL A;  1SVX A;  3SO8 A;  5ENO D;  5BXO A;  1IKN D;  1NFI E;  4HRL A;  4ZHB A;  1AWC B;  3JXI A;  3HRA A;  2QC9 A;  3B7B A;  4BET A;  1BLX B;  1BU9 A;  5HRY A;  2HE0 A;  5JMN D;  4YDY A;  3T9K A;  5AAO A;  4DX2 A;  3AAA C;  4K5B A;  1BI8 B;  2QYJ A;  4F6R D;  5AAR A;  2NYJ A;  2J8S D;  4G8K A;  4OAU C;  3DEP A;  5EIB E;  5AN8 A;  1N0Q A;  1K3Z D;  4O1O A;  4BSZ B;  2ZGD A;  2BKK B;  3TWX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...