3NOCD

Designed ankyrin repeat protein (darpin) binders to acrb: plasticity of the interface
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
154
structure length
154
Chain Sequence
DLGKKLLEAARAGQDDEVRILMANGADVNARDFTGWTPLHLAAHFGHLEIVEVLLKNGADVNAKDSLGVTPLHLAARRGHLEIVEVLLKNGADVNASDSHGFTPLHLAAKRGHLEIVEVLLKNGADVNAQDKFGKTAFDISIDNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein/protein binding
molecule keywords Acriflavine resistance protein B
publication title Designed ankyrin repeat protein binders for the crystallization of AcrB: Plasticity of the dominant interface
pubmed doi rcsb
source organism Escherichia coli
total genus 41
structure length 154
sequence length 154
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3nocD00
3ZUVB 4DUIA 4ZFHA 4CZ2D 2MYOA 5CEDB 3F6QA 1UOHA 4G8KA 4LSZE 5AARA 5CEAA 2RFMA 1D9SA 2KXPC 1MX2A 2VGEA 3W9FA 5AQ9A 5CECB 2XZTG 3HG0D 5BXUA 4CYMD 5KBAA 5KNGA 4U8YD 4HRNA 1IXVA 4OAVB 2KBXA 3ZNGA 3AJIA 5FINA 2NYJA 3V2XA 2BKGA 4TUMA 4B93B 4F6RD 5ENQD 5CBOA 2PNNA 4J8YA 2RFAA 1A5EA 1IHBA 4LG6A 5ENTD 1BU9A 2ETBA 3D9HA 4BERA 3KEAA 1WG0A 2F37A 4U95D 5EN5D 4J7WA 5AAOA 4HI8A 3NBNB 2Y1LE 3LJNA 5ENSD 2P2CP 1DC2A 2DVWA 1OY3D 3Q9NC 5AQAA 5AN8A 1WDYA 4OAUC 5ITZF 3DEPA 2BKKB 3B7BA 4U96D 3NOGD 3TWWA 2QYJA 1IKND 1BD8A 5ENOD 1YMPA 4U8VD 4ATZD 4BSZB 4DX1A 4DX6D 3TWTA 1K3ZD 2V4HC 3TWSA 1NFIE 3NOCD 1DCQA 4DX7D 4GPMA 5FIOA 3SO8A 4K5CA 1MYOA 4HLLA 5CERB 5EYPF 5EIDA 2F8YA 3JXIA 5KNHD 4DRXE 2A5EA 5D66A 3V2OA 4NIKA 1YCSB 4UUCA 4K5BA 4HRMB 3T9KA 4G8LA 3JUEA 1AWCB 3EU9A 4N5QA 3EHRA 1BLXB 2V5QC 3UTMA 1S70B 4Z68A 4BESA 3ZKJA 1TR4A 1SW6A 2Y0BG 3UI2A 1YYHA 1AP7A 3TWVA 3T8KA 5EYLA 3V30A 2XZDG 2FO1E 4JB8P 5BXOA 4DX5D 2DZOA 4O60A 1OT8A 5KWDA 1BI8B 4BEPA 3EHQA 4HB5A 4K5AB 3UXGA 4BETA 3Q9UC 1MX4A 4YDWA 3JXJA 5CBNA 1QYMA 2XEHA 4YDYA 5JA4D 4O1PA 4F1PA 2J8SD 4ZHBA 5HS0A 2QC9A 3AAAC 5EIBE 3ZU7B 2ZGGA 1N11A 1MJ0A 4GMRA 2XENA 5HRYA 2F8XK 3J5QB 2AJAA 2DWZA 2XEEA 5AQ7A 3TWUA 2JABA 4A63B 4HI9A 2HE0A 1N0RA 4O1OA 1BI7B 1G3NB 1K1BA 1SVXA 3J5PA 4QQIA 5ENRD 1N0QA 3TWXA 3TWRA 4HRLA 3V79K 2L6BA 2ETCA 2ZGDA 3HRAA 5ENPD 4C48B 3C5RA 2DZNA 3TWQA 4HNAD 5JMND 4HBDA 4DX2A 3W9GA 1MX6A 3IXEA 2ETAA 4HQDA 4RLYA 1K1AA 3DEOA 5AQBA 2B0OE 5EILA 5HKPA 3B95A 3V31A 4LNUD 4QFVA
chains in the Genus database with same CATH superfamily
4KZCA 1KT0A 2MRIA 1LTXA 1Z5SC 2MYOA 4LSZE 4DI3A 3ZPJA 3HXBA 5AQ9A 2YINA 5KBAA 2XS8A 1EPUA 4U8YD 4HRNA 4UQYA 4GTQA 2L9BA 3PS6A 2FF4A 3ZFWA 5KJKA 2XS1A 5AENA 2WXJA 4BWRA 2WXRA 1JCRA 3TL5A 4F1SA 2XPIA 3SZ7A 3RRUA 5AN8A 5G2NA 2WXMA 4CRWA 3EIQC 2L0TB 3CEQA 4N39A 3QWWA 2ZISA 3ASNE 2WXLA 2Y69E 4I6JA 5FQ6A 4CDMA 4FA6A 3Q4AB 5KJMA 1YYHA 5BXOA 4L2YA 4FULA 1Y8MA 2NC9A 3GW4A 2P9LG 2Y4UA 4GTOA 4YDWA 1DNPA 3G2TA 3CV0A 4Q69A 3AAAC 1TNOA 3G2WA 3APFA 5B1BE 3JCKC 3EUVA 2ETCA 3APCA 1N4RA 2WMNA 4OYSA 3BG1B 3HIZA 3IXEA 2KCVA 4BT8A 3ULEG 2YHEA 3QB2A 3MV2B 4I6GA 4HXIA 3JQ1A 2H6FA 1UW4B 3QDNA 3PE3A 2DCPA 5A6CA 4M7CA 2IF4A 3AS8A 2RFMA 3QOUA 3D9KA 3CVWA 4GCOA 5D0QD 1IXVA 3L22A 3HVEA 3R7RA 2XRYA 2NYJA 5FQ8A 3ZRHA 4J8YA 1A5EA 1IHBA 3KS2A 1DCEA 4WAFA 3ONLA 3CHSA 2ZU6B 2PM7A 4BTAA 2KC7A 4HI8A 3ML8A 4XIFA 2AWIA 3Q7FA 5ANLA 4CT0A 3UKUG 4I2WA 4XI9A 5FIOA 2EIJE 4I1AA 3SHFA 1PAQA 4HOQA 4HVBA 3B7TA 4E85A 4LUNU 1BLXB 2IY0C 3KEZA 4K0RA 5KJNA 5AIJA 5BNWA 3DXMG 5FQ4A 5HRYA 2DYSE 3NQPA 4FJYA 3CK8A 4BT9A 2MHKA 3ZEFA 2I6HA 3L6AA 4O6FA 3TWUA 3J5PA 2Q7FA 3FUNA 4GMJA 2V5FA 2ETAA 2GGFA 2V8SE 3ASFA 2PQNA 2UY1B 4LERA 5CEAA 1D9SA 2H6IA 1MX2A 2A4ZA 4HLEA 1GW6A 5T4YA 3SFYA 2P9PG 3V2XA 3D9PA 2BKGA 3CVNA 3QWPA 1BU9A 1SA5A 1X5BA 2R02A 2AXZA 3DSUA 3KEAA 1N54A 1UJJA 4LCTA 1S0PA 3CQGB 1D8DA 1HU3A 4BSZB 4U0SA 3PDNA 1PY1A 1UG3A 1Z6TA 5EIDA 5EYPF 4AJWA 4XE0A 4G8LA 2CG2A 2RKKA 2IEJA 3KSQA 1IHGA 3T8KA 5EYLA 3V30A 3FUHA 2QY7A 3QNKA 3ML9A 5LX8A 4U04A 5EX0A 2XHEA 2P58C 2XEHA 2WXFA 2J8SD 1KZPA 3FUIA 3FULA 3RRNB 4GTMA 4J8DA 2IOSA 2WPVA 3ZXSA 3MYVA 3TWQA 4FLBA 4HBDA 1H2TC 3L16A 1K1AA 1IQUA 5AQBA 2B0OE 1HF8A 3FTXA 3FUEA 5JJ6A 1UOHA 4G8KA 5AARA 2KXPC 3L82A 3FTYA 4CYMD 2IO2C 3OXGA 3LDZA 4FU3A 5DIZA 3MA5A 4FLHA 5ENTD 4ANWA 5CRUA 2BF0X 2AW6A 3U66A 3LJNA 2X6IA 4HORA 3DEPA 1JPLA 5BW8C 2R05A 4HOUA 4BTBA 4W9RA 1NFIE 2E0IA 4GPMA 3T8MA 4ILGA 3KD7A 1MYOA 3I5PA 1Y6IA 3BU8A 4JD2G 2VTBA 3IHYA 4HRMB 3T9KA 1P5QA 1IYGA 2XPZA 2R5SA 4AY6A 4U0UA 3CSTA 5H7PA 3LS8A 1U2VG 4B0ZA 3DSTA 5D0OD 1S64A 2XEVA 3GYZA 3MKRA 1MQSA 4GZDA 4GYOA 4CDRA 4RVBA 3DXKG 3S2AA 3B7RL 1RZ4A 4I2ZA 1N95A 3L08A 5ENPD 3VTYA 2C2LA 3E32A 4GB9A 1MX6A 3SY2A 5BT1A 3VTXA 5BV0A 1HE8A 3AS4A 3CK7A 3TXMA 5CEDB 3PEVB 4XI0A 4AP2A 5B3SE 3DSVA 1KLXA 2UY1A 3PE4A 3PUJA 1NL4A 1O5MA 3AJIA 2VQ2A 1ELRA 3SBTB 4B93B 3RSEG 2RFAA 1WG0A 4Y6CA 4AIFA 4J7WA 3ZYLA 2DVWA 4JA9A 4TXQA 4CCAA 3SI5A 4XKBA 4L9PA 3HVEB 3B7BA 3FH5A 4U96D 3LEWA 4YDEA 3JYSA 4G26A 3ABME 1YMPA 3QJZA 1E8WA 3FU0A 3NOCD 4AM9A 1HS6A 4R7LA 3UPVA 3SGHA 4H7YA 4DRXE 1JUQA 4EPZA 1UN9A 4GCNA 4N5QA 3TJPA 2P9IG 4WNGA 3ZYMA 3D3MA 4UWLA 3ZW3A 2XGSA 3LY9A 4U0ZA 2VSXE 4JHRA 4JL0A 3MEKA 4O1PA 1H2VC 3ZU7B 3SQVA 4CGVA 2EQXA 2GW1A 3EHMA 2GROB 2XQ0A 2GRPB 4APFA 1K1BA 1H2UA 4HRLA 1TNZA 2C0LA 3PZ4A 3PRZA 3D9LA 3SNXA 4ILIA 4DUIA 4ZFHA 3RAUA 3S7FA 4PS7A 3F6QA 5T8IA 1QZ2A 5ANRA 5CECB 3ZXPA 5B1AE 1FVFA 3UM3A 4AY5A 3UT7A 4KT6B 3FTSA 3CHMA 4F6RD 3SFZA 3CVYA 4WNDA 3E34A 4U7EB 1E8YA 4EBAA 2J4BA 4B8CB 1S63A 3G2VA 4GTSA 4AEZC 3FUFA 3ESLA 3VLDA 1K3ZD 1DCQA 1Z3YA 5BUZA 4PUCA 3HHMA 5EKQD 3CHPA 3D9NA 3Q7AA 4LEUA 3UM2A 5J90A 3MCXA 2WXNA 2RD0A 2UWJG 2FO1E 4AOFA 3U9WA 2IFUA 4GTTA 4BEPA 2WXPA 2CHWA 3IKOB 1L5JA 3C3RA 5JA4D 5JJTA 1K8KG 2M63A 3OXLA 2XEEA 3L13A 4DLOA 1N0RA 4O1OA 1N0QA 4GZ5A 2I1JA 3JUIA 1V54E 1XGWA 2X3MA 3AG4E 4Q96A 1FT2A 4B94A 3RIBA 1H6KA 3QC1A 3W9FA 4GA2A 4ANUA 5BXUA 2WQHA 2J09A 2KBXA 2GRMA 4H7XA 3LXUX 5CBOA 2FULA 4UQXA 4LG6A 3ZIMA 4J0UA 5AAOA 4G23A 1N9AA 3PH0C 3FDHA 2OCCE 1E90A 1IKND 2QYJA 3HXDA 1TJFA 3G2SA 2BEDA 3E4BA 3PZ3A 2VSYA 3CKBA 1Q2ZA 4I1OB 1EF1C 1NA3A 2XPYA 3E37A 1AWCB 4UI9C 2VGXB 4FADA 2WM9A 3ZKJA 1TR4A 3BEEA 4I6EA 3MV3B 2J4DA 4EECA 3ABKE 2WMOA 2VTBB 3ZVVA 4HB5A 2I9CA 5EDSA 1QYMA 2QYUA 4ZHBA 4L1BA 2XENA 2JEKA 4U07A 3RJVA 3NAWA 3MKQB 3JQ0A 4QQIA 3DPYA 3FUDA 1E7UA 3L9TA 3QAQA 1WY6A 2WQ7A 3DEOA 2H6GA 3ZUVB 4LRZA 3SD5A 4GYWA 2GRNB 4UWKA 1HH8A 4G25A 3RRMB 2LXMA 3UUXA 3QKYA 4GTPA 1SZ9A 1TNYA 2PNNA 2OV8A 4GU5A 5LOZA 3I4GA 3CVXA 3R9MA 3SBSA 3D9HA 3S7DA 2X6FA 2J08A 5CCLA 3TG5A 1FVHA 1HFAA 4JVSA 3PREA 4GZ3A 3UM1A 4JZYA 2H6HA 5CERB 3OXFA 3LVRE 3VLEA 1TJCA 3HDXA 1HO8A 4Z68A 4MKTA 2GRRB 4UWFA 5LFAA 2LAIA 1B89A 1N4PA 3ZYKA 3UX4A 1X81A 4M3OA 1E7VA 4UQZA 2EINE 3Q9UC 2V0PA 3BUAA 4GAAA 4F1PA 2AXUA 1OCOE 1A17A 5LCWC 4FHJA 4UI9K 3PUKA 3K9IA 1QNFA 2VGYA 3OAWA 2IJGX 4YVOA 2J9QA 5FTPA 4UWHA 5HKPA 2WXQA 1H19A 3Q15A 1TNUA 4FJZA 4IN3B 1OXJA 3NB2A 4KBQA 2HO1A 3FTVA 1JWFA 2LNIA 2RG8A 3ASOE 2KM4A 4TUMA 2CHZA 1NP7A 4F53A 3O48A 3UT4A 1HG2A 3DRAA 5EN5D 2F37A 5JHAA 5ENSD 5FT9A 3EJNA 1WDYA 3D9MA 4N3AA 2X6HA 4HLLA 4XZ4A 1O1RA 2AVPA 4BSXA 4NIKA 4PH4B 4LNGA 4UUCA 4B8AA 4IULA 2MOWA 3EU9A 4U8HA 2YHCA 4DK5A 3D9JA 3NZSA 3CVUA 1S70B 3PEUB 4GMLA 2VGXA 1FCHA 3L54A 4MBGA 2DZOA 4O60A 3S7BA 4J8FA 5HI7A 3LVQE 3FEXA 4I9CA 1HG5A 5HS0A 2DWZA 1BI7B 3TWXA 3L17A 4ABNA 3D9IA 3UT8A 3MKQA 2L6BA 3FEYA 4FP7A 4C48B 2YQ8A 1ELWA 4MLPA 4HNAD 4DX2A 2EILE 4HQDA 2BUGA 4HOSA 1W3BA 4BX9A 4GYYA 3ZN3A 2F0YA 3EIJA 3AG1E 4KXKB 5EILA 2XCCA 3UKRG 1JWGA 2A5UA 1QBQA 3PNTB 5KNGA 2EIKE 3ZNGA 1OCZE 4C0EA 2L0IA 4TXPA 1N94A 1OWOA 3SF4A 5FWQA 1INZA 4U63A 2P9NG 3FUMA 4JEHA 2C0MA 1XNFA 4DX6D 4DX7D 1ZBPA 2YNQA 3QWVA 3QARA 3OTNA 5KNHD 1OWPA 3V2OA 4RG6A 4Y6WA 4N3BA 3HXFA 3URZA 3CQCB 1N4SA 4DX5D 4F7AA 5CRVA 3CVQA 1SZAA 3X2QE 4K5AB 4GA1A 3BG0B 3FU3A 3WXXA 4I17A 5FQ7A 1Z3XA 5M72A 2QC9A 2ZGGA 1N11A 1MJ0A 4P29A 4WNFA 2IU1A 4DI4A 1JCSA 5EX3A 4HI9A 4CDNA 4ACKA 5ARFA 3CR3A 1DVPA 3FP3A 5CMWA 1NZNA 4RLYA 5ARGA 2ZIRA 1VDYA 2OOEA 3ULQA 3C98A 2I2OA 2ILRA 5A23A 3LKUA 3CIAA 2KCKA 3R9AB 2VGEA 1H6PA 3CHQA 2CHXA 4JPSA 4A55A 1OWNA 2R2LA 3PVLA 4JHJA 4L2LA 4YNDA 4G2VA 4I43A 3R7QA 4A1SA 4DLQA 1OWLA 4J8SA 4BERA 4HFGA 4U95D 3C3QA 1NI1A 3Q9NC 4F3VA 2X38A 1U3CA 1WAO1 3MX3A 1BD8A 2EIME 5ENOD 1HX8A 3FU6A 2OEVA 5G55A 1TYQG 4C9BB 3FTWA 1HXIA 3Q5MA 4GTVA 1QQEA 3ZGQA 2QZAA 3EHRA 1SW6A 3UI2A 4ANXA 2OEWA 2WB2A 1O1SA 3FFLA 2PQRA 5KWDA 3EHQA 3LYAA 3CHOA 4CEMA 4GMRA 2F8XK 2AJAA 1LF8A 3WG7E 3I4RB 5C1DA 3ZHEA 2JABA 1BPOA 2Y4TA 4LNBA 1G3NB 1SVXA 2DIWA 3RO2A 2DZNA 3FWVA 4QFVA 3PNLB 2P9SG 1FPPA 2P9UG 4E6HA 1EYHA 4I9EA 3AG3E 4OVUA 4BY6A 1N4QA 2NXPA 4OAVB 4DJAA 3UQ3A 1D8EA 3CVLA 3BQOA 5T3RA 3FY4A 1MHQA 2IQCA 1DC2A 4RG9A 1WM5A 2L6JA 4ATGA 1TN6A 2HR2A 5ITZF 2BKKB 4NQ0A 4ATZD 4DX1A 3UINC 4KMOA 4GA0A 5HQ8A 4EBAG 1O1TA 4X8QA 3G2UA 1YCSB 3JUEA 3UM0A 3I3NA 3FTZA 5ENNA 3FTUA 3NF1A 3ASGA 2WXIA 3E33A 3TWVA 4MS6A 2PL2A 3RKVA 1OT8A 1EDUA 4TRQA 4ILHB 3S7JA 3U4TA 3EHNA 3N71A 4WWPA 4EQFA 4XX5A 2QFCA 4AVXA 4IRUA 5G04C 5BPPA 3KAEA 4RSYA 3ABLE 4XKCA 2IO3C 2WXOA 3U3WA 3V31A 3B95A 4LNUD 5LP0A 4G11A 5FZSA 1E8ZA 4N3CA 2KZTB 1E8XA 3T5XA 2LSVA 2X6JA 4PS8A 1OCRE 4V3IA 2XZTG 5J08A 4WNEA 4TXRA 1RW2A 2J07A 3GZ2A 3FUJA 1IQRA 2HM8A 2P2CP 4EZLA 3UIPC 5AQAA 2FBNA 4N2QA 3TXNA 5C2YA 5IY5E 4TUUA 3UMVA 4GTRA 2LUHA 4AXHA 5CHEE 4L23A 3T5VA 4PDXA 2F8YA 3DSXA 4A1GA 3ULYA 2R03A 4N5CA 2FI7A 4APOA 1KT1A 1E96B 3Q79A 1SQMA 2VJ8A 3ASDA 1UJKA 1BI8B 3Q75A 1V55E 3UXGA 4BETA 5CBNA 3J5QB 3HYMB 4FHKA 5G05C 3DBSA 1ZU2A 5KCMA 5E76A 5ENRD 3V79K 4JXTA 1U3DA 3RU0A 4BFRA 4EZKA 2XRZA 4A3TA 3CSFA 2R59A 5AYWD 4CZ2D 5JJ7A 4YDOA 2NSZA 3HG0D 3DSSA 3CK9A 4A3VA 4D10C 4ME2A 4GZCA 3GZSA 4CGWA 2LO6A 4KZ0A 5ENQD 4I1MA 2ETBA 3P2BA 4JC8A 2Y1LE 2LSUA 4WWOA 2CG3A 4OAUC 3PZ1A 3NOGD 4KYOB 4JA7A 4U8VD 2P9KG 1H6OA 3RO3A 2V4HC 4CT4A 4GPKA 1TNBA 3CGHA 1SA4A 4NACA 3JXIA 1UN8A 5D66A 2WQ6A 3FH7A 1TEZA 3FH8A 3IHVA 1LD7A 3UTMA 4BESA 1KPSB 2ZXWE 2XZDG 2WXGA 3APDA 4IYPA 1KZOA 3IEGA 2PM6A 2GRLA 2CFZA 1MX4A 4OVVA 3JXJA 4UI9J 3FHEA 3CKCA 4JEUA 5G04J 5EIBE 4K03A 5AJDA 3UIOC 3CVVA 3ZYQA 4NURA 4WWNA 3CHRA 2JLBA 2HE0A 4DPRA 3MZLB 3TWRA 3U64A 1PC2A 3W9GA 3Q78A 4TV3A 3PZ2A 4B89A 4GZ6A 3Q73A 1MZCA 2XGMA 3O4ZA 3ZHEB 3LY8A 2KZTA 1OWMA 2LXLA 5BV1A 5FINA 3ESKA 2CFUA 3ENEA 1H0AA 3ASHA 2WXHA 1JCQA 2I1KA 5A7DB 4HOTA 2WXKA 3NBNB 2WVIA 3CLJA 1LD8A 2XCBA 5E75A 3B7SA 3MGBA 3MJWA 2Y3AA 5D2MC 3TWSA 2HYZA 4K5CA 3AU4A 3DPDA 3E30A 1NA0A 4JW1A 2LAHA 4J8EA 3IV0A 4XEIG 2OVFA 3C72A 4L7TA 1YA0A 1FT1A 3AG2E 1AP7A 4JB8P 2VYIA 2FO7A 3P1UA 4KVOA 4PS3A 2XGOA 5G05J 4G24A 4YDYA 3IBEA 4RQIA 3LPZA 5DBKA 5FZRA 5AQ7A 4ACLA 3D9OA 2ZGDA 3HRAA 3C5RA 2VSOE 5KJLA 4G1TA 5LCWJ 4BX8A 2IONA 1OCCE 2DBAA 1ZB1A 4Q94A 2B6CA 3GZ1A 2X6KA 3RK6A 3NZUA 3EU5A 5FJYA 5CCMA 4NRHB 3B13A 4KVMA 4YVQC 4JHKA 3PZDA 5CMYA 1TN8A 2PZIA 3ISMC 2KCLA 5AJLA 3TG4A 1OY3D 2V4LA 3Q49B 2IOLA 4ANVA 4WUYA 3TWWA 4MRUA 5FZQA 3C3OA 2J49A 3CVPA 3LCAA 3TWTA 3B7UX 3Q47B 3FUKA 3SO8A 4EHMA 1N52A 1ELKA 3EDTB 2A5EA 3ONKA 2KATA 4EZJA 1OUVA 4K5BA 3LJ3A 2ONDA 4J6IA 2R17C 2V5QC 2AXVA 4URKA 2Y0BG 3DSWA 3AU5A 4FC8A 3LY7A 2BTDA 2VSNA 3TAXA 3DWLG 2E2EA 3HXEA 3VLFA 1HZ4A 3HXCA 3KSLA 2OVBA 3AS5A 4C0MA 2FEZA 4A63B 3TGOA 4UWGA 4AV7A 2GRQB 3SFXA 5JHBA 3FU5A 4N2SA 5JMND 3QK0A 2DYRE 1TN7A 4HS2A
chains in the Genus database with same CATH topology
3ZUVB 4DUIA 4ZFHA 4CZ2D 2MYOA 5CEDB 3F6QA 1UOHA 4G8KA 4LSZE 5AARA 5CEAA 2RFMA 1D9SA 2KXPC 1MX2A 2VGEA 3W9FA 5AQ9A 5CECB 2XZTG 3HG0D 5BXUA 4CYMD 5KBAA 5KNGA 4U8YD 4HRNA 1IXVA 4OAVB 2KBXA 3ZNGA 3AJIA 5FINA 2NYJA 3V2XA 2BKGA 4TUMA 4B93B 4F6RD 5ENQD 5CBOA 2PNNA 4J8YA 2RFAA 1A5EA 1IHBA 4LG6A 5ENTD 1BU9A 2ETBA 3D9HA 4BERA 3KEAA 1WG0A 2F37A 4U95D 5EN5D 4J7WA 5AAOA 4HI8A 3NBNB 2Y1LE 3LJNA 5ENSD 2P2CP 1DC2A 2DVWA 1OY3D 3Q9NC 5AQAA 5AN8A 1WDYA 4OAUC 5ITZF 3DEPA 2BKKB 3B7BA 4U96D 3NOGD 3TWWA 2QYJA 1IKND 1BD8A 5ENOD 1YMPA 4U8VD 4ATZD 4BSZB 4DX1A 4DX6D 3TWTA 1K3ZD 2V4HC 3TWSA 1NFIE 3NOCD 1DCQA 4DX7D 4GPMA 5FIOA 3SO8A 4K5CA 1MYOA 4HLLA 5CERB 5EYPF 5EIDA 2F8YA 3JXIA 5KNHD 4DRXE 2A5EA 5D66A 3V2OA 4NIKA 1YCSB 4UUCA 4K5BA 4HRMB 3T9KA 4G8LA 3JUEA 1AWCB 3EU9A 4N5QA 3EHRA 1BLXB 2V5QC 3UTMA 1S70B 4Z68A 4BESA 3ZKJA 1TR4A 1SW6A 2Y0BG 3UI2A 1YYHA 1AP7A 3TWVA 3T8KA 5EYLA 3V30A 2XZDG 2FO1E 4JB8P 5BXOA 4DX5D 2DZOA 4O60A 1OT8A 5KWDA 1BI8B 4BEPA 3EHQA 4HB5A 4K5AB 3UXGA 4BETA 3Q9UC 1MX4A 4YDWA 3JXJA 5CBNA 1QYMA 2XEHA 4YDYA 5JA4D 4O1PA 4F1PA 2J8SD 4ZHBA 5HS0A 2QC9A 3AAAC 5EIBE 3ZU7B 2ZGGA 1N11A 1MJ0A 4GMRA 2XENA 5HRYA 2F8XK 3J5QB 2AJAA 2DWZA 2XEEA 5AQ7A 3TWUA 2JABA 4A63B 4HI9A 2HE0A 1N0RA 4O1OA 1BI7B 1G3NB 1K1BA 1SVXA 3J5PA 4QQIA 5ENRD 1N0QA 3TWXA 3TWRA 4HRLA 3V79K 2L6BA 2ETCA 2ZGDA 3HRAA 5ENPD 4C48B 3C5RA 2DZNA 3TWQA 4HNAD 5JMND 4HBDA 4DX2A 3W9GA 1MX6A 3IXEA 2ETAA 4HQDA 4RLYA 1K1AA 3DEOA 5AQBA 2B0OE 5EILA 5HKPA 3B95A 3V31A 4LNUD 4QFVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZUV B;  4DUI A;  4ZFH A;  4CZ2 D;  2MYO A;  5CED B;  3F6Q A;  1UOH A;  4G8K A;  4LSZ E;  5AAR A;  5CEA A;  2RFM A;  1D9S A;  2KXP C;  1MX2 A;  2VGE A;  3W9F A;  5AQ9 A;  5CEC B;  2XZT G;  3HG0 D;  5BXU A;  4CYM D;  5KBA A;  5KNG A;  4U8Y D;  4HRN A;  1IXV A;  4OAV B;  2KBX A;  3ZNG A;  3AJI A;  5FIN A;  2NYJ A;  3V2X A;  2BKG A;  4TUM A;  4B93 B;  4F6R D;  5ENQ D;  5CBO A;  2PNN A;  4J8Y A;  2RFA A;  1A5E A;  1IHB A;  4LG6 A;  5ENT D;  1BU9 A;  2ETB A;  3D9H A;  4BER A;  3KEA A;  1WG0 A;  2F37 A;  4U95 D;  5EN5 D;  4J7W A;  5AAO A;  4HI8 A;  3NBN B;  2Y1L E;  3LJN A;  5ENS D;  2P2C P;  1DC2 A;  2DVW A;  1OY3 D;  3Q9N C;  5AQA A;  5AN8 A;  1WDY A;  4OAU C;  5ITZ F;  3DEP A;  2BKK B;  3B7B A;  4U96 D;  3NOG D;  3TWW A;  2QYJ A;  1IKN D;  1BD8 A;  5ENO D;  1YMP A;  4U8V D;  4ATZ D;  4BSZ B;  4DX1 A;  4DX6 D;  3TWT A;  1K3Z D;  2V4H C;  3TWS A;  1NFI E;  3NOC D;  1DCQ A;  4DX7 D;  4GPM A;  5FIO A;  3SO8 A;  4K5C A;  1MYO A;  4HLL A;  5CER B;  5EYP F;  5EID A;  2F8Y A;  3JXI A;  5KNH D;  4DRX E;  2A5E A;  5D66 A;  3V2O A;  4NIK A;  1YCS B;  4UUC A;  4K5B A;  4HRM B;  3T9K A;  4G8L A;  3JUE A;  1AWC B;  3EU9 A;  4N5Q A;  3EHR A;  1BLX B;  2V5Q C;  3UTM A;  1S70 B;  4Z68 A;  4BES A;  3ZKJ A;  1TR4 A;  1SW6 A;  2Y0B G;  3UI2 A;  1YYH A;  1AP7 A;  3TWV A;  3T8K A;  5EYL A;  3V30 A;  2XZD G;  2FO1 E;  4JB8 P;  5BXO A;  4DX5 D;  2DZO A;  4O60 A;  1OT8 A;  5KWD A;  1BI8 B;  4BEP A;  3EHQ A;  4HB5 A;  4K5A B;  3UXG A;  4BET A;  3Q9U C;  1MX4 A;  4YDW A;  3JXJ A;  5CBN A;  1QYM A;  2XEH A;  4YDY A;  5JA4 D;  4O1P A;  4F1P A;  2J8S D;  4ZHB A;  5HS0 A;  2QC9 A;  3AAA C;  5EIB E;  3ZU7 B;  2ZGG A;  1N11 A;  1MJ0 A;  4GMR A;  2XEN A;  5HRY A;  2F8X K;  3J5Q B;  2AJA A;  2DWZ A;  2XEE A;  5AQ7 A;  3TWU A;  2JAB A;  4A63 B;  4HI9 A;  2HE0 A;  1N0R A;  4O1O A;  1BI7 B;  1G3N B;  1K1B A;  1SVX A;  3J5P A;  4QQI A;  5ENR D;  1N0Q A;  3TWX A;  3TWR A;  4HRL A;  3V79 K;  2L6B A;  2ETC A;  2ZGD A;  3HRA A;  5ENP D;  4C48 B;  3C5R A;  2DZN A;  3TWQ A;  4HNA D;  5JMN D;  4HBD A;  4DX2 A;  3W9G A;  1MX6 A;  3IXE A;  2ETA A;  4HQD A;  4RLY A;  1K1A A;  3DEO A;  5AQB A;  2B0O E;  5EIL A;  5HKP A;  3B95 A;  3V31 A;  4LNU D;  4QFV A; 
#chains in the Genus database with same CATH topology
 4KZC A;  1KT0 A;  2MRI A;  1LTX A;  1Z5S C;  2MYO A;  4LSZ E;  4DI3 A;  3ZPJ A;  3HXB A;  5AQ9 A;  2YIN A;  5KBA A;  2XS8 A;  1EPU A;  4U8Y D;  4HRN A;  4UQY A;  4GTQ A;  2L9B A;  3PS6 A;  2FF4 A;  3ZFW A;  5KJK A;  2XS1 A;  5AEN A;  2WXJ A;  4BWR A;  2WXR A;  1JCR A;  3TL5 A;  4F1S A;  2XPI A;  3SZ7 A;  3RRU A;  5AN8 A;  5G2N A;  2WXM A;  4CRW A;  3EIQ C;  2L0T B;  3CEQ A;  4N39 A;  3QWW A;  2ZIS A;  3ASN E;  2WXL A;  2Y69 E;  4I6J A;  5FQ6 A;  4CDM A;  4FA6 A;  3Q4A B;  5KJM A;  1YYH A;  5BXO A;  4L2Y A;  4FUL A;  1Y8M A;  2NC9 A;  3GW4 A;  2P9L G;  2Y4U A;  4GTO A;  4YDW A;  1DNP A;  3G2T A;  3CV0 A;  4Q69 A;  3AAA C;  1TNO A;  3G2W A;  3APF A;  5B1B E;  3JCK C;  3EUV A;  2ETC A;  3APC A;  1N4R A;  2WMN A;  4OYS A;  3BG1 B;  3HIZ A;  3IXE A;  2KCV A;  4BT8 A;  3ULE G;  2YHE A;  3QB2 A;  3MV2 B;  4I6G A;  4HXI A;  3JQ1 A;  2H6F A;  1UW4 B;  3QDN A;  3PE3 A;  2DCP A;  5A6C A;  4M7C A;  2IF4 A;  3AS8 A;  2RFM A;  3QOU A;  3D9K A;  3CVW A;  4GCO A;  5D0Q D;  1IXV A;  3L22 A;  3HVE A;  3R7R A;  2XRY A;  2NYJ A;  5FQ8 A;  3ZRH A;  4J8Y A;  1A5E A;  1IHB A;  3KS2 A;  1DCE A;  4WAF A;  3ONL A;  3CHS A;  2ZU6 B;  2PM7 A;  4BTA A;  2KC7 A;  4HI8 A;  3ML8 A;  4XIF A;  2AWI A;  3Q7F A;  5ANL A;  4CT0 A;  3UKU G;  4I2W A;  4XI9 A;  5FIO A;  2EIJ E;  4I1A A;  3SHF A;  1PAQ A;  4HOQ A;  4HVB A;  3B7T A;  4E85 A;  4LUN U;  1BLX B;  2IY0 C;  3KEZ A;  4K0R A;  5KJN A;  5AIJ A;  5BNW A;  3DXM G;  5FQ4 A;  5HRY A;  2DYS E;  3NQP A;  4FJY A;  3CK8 A;  4BT9 A;  2MHK A;  3ZEF A;  2I6H A;  3L6A A;  4O6F A;  3TWU A;  3J5P A;  2Q7F A;  3FUN A;  4GMJ A;  2V5F A;  2ETA A;  2GGF A;  2V8S E;  3ASF A;  2PQN A;  2UY1 B;  4LER A;  5CEA A;  1D9S A;  2H6I A;  1MX2 A;  2A4Z A;  4HLE A;  1GW6 A;  5T4Y A;  3SFY A;  2P9P G;  3V2X A;  3D9P A;  2BKG A;  3CVN A;  3QWP A;  1BU9 A;  1SA5 A;  1X5B A;  2R02 A;  2AXZ A;  3DSU A;  3KEA A;  1N54 A;  1UJJ A;  4LCT A;  1S0P A;  3CQG B;  1D8D A;  1HU3 A;  4BSZ B;  4U0S A;  3PDN A;  1PY1 A;  1UG3 A;  1Z6T A;  5EID A;  5EYP F;  4AJW A;  4XE0 A;  4G8L A;  2CG2 A;  2RKK A;  2IEJ A;  3KSQ A;  1IHG A;  3T8K A;  5EYL A;  3V30 A;  3FUH A;  2QY7 A;  3QNK A;  3ML9 A;  5LX8 A;  4U04 A;  5EX0 A;  2XHE A;  2P58 C;  2XEH A;  2WXF A;  2J8S D;  1KZP A;  3FUI A;  3FUL A;  3RRN B;  4GTM A;  4J8D A;  2IOS A;  2WPV A;  3ZXS A;  3MYV A;  3TWQ A;  4FLB A;  4HBD A;  1H2T C;  3L16 A;  1K1A A;  1IQU A;  5AQB A;  2B0O E;  1HF8 A;  3FTX A;  3FUE A;  5JJ6 A;  1UOH A;  4G8K A;  5AAR A;  2KXP C;  3L82 A;  3FTY A;  4CYM D;  2IO2 C;  3OXG A;  3LDZ A;  4FU3 A;  5DIZ A;  3MA5 A;  4FLH A;  5ENT D;  4ANW A;  5CRU A;  2BF0 X;  2AW6 A;  3U66 A;  3LJN A;  2X6I A;  4HOR A;  3DEP A;  1JPL A;  5BW8 C;  2R05 A;  4HOU A;  4BTB A;  4W9R A;  1NFI E;  2E0I A;  4GPM A;  3T8M A;  4ILG A;  3KD7 A;  1MYO A;  3I5P A;  1Y6I A;  3BU8 A;  4JD2 G;  2VTB A;  3IHY A;  4HRM B;  3T9K A;  1P5Q A;  1IYG A;  2XPZ A;  2R5S A;  4AY6 A;  4U0U A;  3CST A;  5H7P A;  3LS8 A;  1U2V G;  4B0Z A;  3DST A;  5D0O D;  1S64 A;  2XEV A;  3GYZ A;  3MKR A;  1MQS A;  4GZD A;  4GYO A;  4CDR A;  4RVB A;  3DXK G;  3S2A A;  3B7R L;  1RZ4 A;  4I2Z A;  1N95 A;  3L08 A;  5ENP D;  3VTY A;  2C2L A;  3E32 A;  4GB9 A;  1MX6 A;  3SY2 A;  5BT1 A;  3VTX A;  5BV0 A;  1HE8 A;  3AS4 A;  3CK7 A;  3TXM A;  5CED B;  3PEV B;  4XI0 A;  4AP2 A;  5B3S E;  3DSV A;  1KLX A;  2UY1 A;  3PE4 A;  3PUJ A;  1NL4 A;  1O5M A;  3AJI A;  2VQ2 A;  1ELR A;  3SBT B;  4B93 B;  3RSE G;  2RFA A;  1WG0 A;  4Y6C A;  4AIF A;  4J7W A;  3ZYL A;  2DVW A;  4JA9 A;  4TXQ A;  4CCA A;  3SI5 A;  4XKB A;  4L9P A;  3HVE B;  3B7B A;  3FH5 A;  4U96 D;  3LEW A;  4YDE A;  3JYS A;  4G26 A;  3ABM E;  1YMP A;  3QJZ A;  1E8W A;  3FU0 A;  3NOC D;  4AM9 A;  1HS6 A;  4R7L A;  3UPV A;  3SGH A;  4H7Y A;  4DRX E;  1JUQ A;  4EPZ A;  1UN9 A;  4GCN A;  4N5Q A;  3TJP A;  2P9I G;  4WNG A;  3ZYM A;  3D3M A;  4UWL A;  3ZW3 A;  2XGS A;  3LY9 A;  4U0Z A;  2VSX E;  4JHR A;  4JL0 A;  3MEK A;  4O1P A;  1H2V C;  3ZU7 B;  3SQV A;  4CGV A;  2EQX A;  2GW1 A;  3EHM A;  2GRO B;  2XQ0 A;  2GRP B;  4APF A;  1K1B A;  1H2U A;  4HRL A;  1TNZ A;  2C0L A;  3PZ4 A;  3PRZ A;  3D9L A;  3SNX A;  4ILI A;  4DUI A;  4ZFH A;  3RAU A;  3S7F A;  4PS7 A;  3F6Q A;  5T8I A;  1QZ2 A;  5ANR A;  5CEC B;  3ZXP A;  5B1A E;  1FVF A;  3UM3 A;  4AY5 A;  3UT7 A;  4KT6 B;  3FTS A;  3CHM A;  4F6R D;  3SFZ A;  3CVY A;  4WND A;  3E34 A;  4U7E B;  1E8Y A;  4EBA A;  2J4B A;  4B8C B;  1S63 A;  3G2V A;  4GTS A;  4AEZ C;  3FUF A;  3ESL A;  3VLD A;  1K3Z D;  1DCQ A;  1Z3Y A;  5BUZ A;  4PUC A;  3HHM A;  5EKQ D;  3CHP A;  3D9N A;  3Q7A A;  4LEU A;  3UM2 A;  5J90 A;  3MCX A;  2WXN A;  2RD0 A;  2UWJ G;  2FO1 E;  4AOF A;  3U9W A;  2IFU A;  4GTT A;  4BEP A;  2WXP A;  2CHW A;  3IKO B;  1L5J A;  3C3R A;  5JA4 D;  5JJT A;  1K8K G;  2M63 A;  3OXL A;  2XEE A;  3L13 A;  4DLO A;  1N0R A;  4O1O A;  1N0Q A;  4GZ5 A;  2I1J A;  3JUI A;  1V54 E;  1XGW A;  2X3M A;  3AG4 E;  4Q96 A;  1FT2 A;  4B94 A;  3RIB A;  1H6K A;  3QC1 A;  3W9F A;  4GA2 A;  4ANU A;  5BXU A;  2WQH A;  2J09 A;  2KBX A;  2GRM A;  4H7X A;  3LXU X;  5CBO A;  2FUL A;  4UQX A;  4LG6 A;  3ZIM A;  4J0U A;  5AAO A;  4G23 A;  1N9A A;  3PH0 C;  3FDH A;  2OCC E;  1E90 A;  1IKN D;  2QYJ A;  3HXD A;  1TJF A;  3G2S A;  2BED A;  3E4B A;  3PZ3 A;  2VSY A;  3CKB A;  1Q2Z A;  4I1O B;  1EF1 C;  1NA3 A;  2XPY A;  3E37 A;  1AWC B;  4UI9 C;  2VGX B;  4FAD A;  2WM9 A;  3ZKJ A;  1TR4 A;  3BEE A;  4I6E A;  3MV3 B;  2J4D A;  4EEC A;  3ABK E;  2WMO A;  2VTB B;  3ZVV A;  4HB5 A;  2I9C A;  5EDS A;  1QYM A;  2QYU A;  4ZHB A;  4L1B A;  2XEN A;  2JEK A;  4U07 A;  3RJV A;  3NAW A;  3MKQ B;  3JQ0 A;  4QQI A;  3DPY A;  3FUD A;  1E7U A;  3L9T A;  3QAQ A;  1WY6 A;  2WQ7 A;  3DEO A;  2H6G A;  3ZUV B;  4LRZ A;  3SD5 A;  4GYW A;  2GRN B;  4UWK A;  1HH8 A;  4G25 A;  3RRM B;  2LXM A;  3UUX A;  3QKY A;  4GTP A;  1SZ9 A;  1TNY A;  2PNN A;  2OV8 A;  4GU5 A;  5LOZ A;  3I4G A;  3CVX A;  3R9M A;  3SBS A;  3D9H A;  3S7D A;  2X6F A;  2J08 A;  5CCL A;  3TG5 A;  1FVH A;  1HFA A;  4JVS A;  3PRE A;  4GZ3 A;  3UM1 A;  4JZY A;  2H6H A;  5CER B;  3OXF A;  3LVR E;  3VLE A;  1TJC A;  3HDX A;  1HO8 A;  4Z68 A;  4MKT A;  2GRR B;  4UWF A;  5LFA A;  2LAI A;  1B89 A;  1N4P A;  3ZYK A;  3UX4 A;  1X81 A;  4M3O A;  1E7V A;  4UQZ A;  2EIN E;  3Q9U C;  2V0P A;  3BUA A;  4GAA A;  4F1P A;  2AXU A;  1OCO E;  1A17 A;  5LCW C;  4FHJ A;  4UI9 K;  3PUK A;  3K9I A;  1QNF A;  2VGY A;  3OAW A;  2IJG X;  4YVO A;  2J9Q A;  5FTP A;  4UWH A;  5HKP A;  2WXQ A;  1H19 A;  3Q15 A;  1TNU A;  4FJZ A;  4IN3 B;  1OXJ A;  3NB2 A;  4KBQ A;  2HO1 A;  3FTV A;  1JWF A;  2LNI A;  2RG8 A;  3ASO E;  2KM4 A;  4TUM A;  2CHZ A;  1NP7 A;  4F53 A;  3O48 A;  3UT4 A;  1HG2 A;  3DRA A;  5EN5 D;  2F37 A;  5JHA A;  5ENS D;  5FT9 A;  3EJN A;  1WDY A;  3D9M A;  4N3A A;  2X6H A;  4HLL A;  4XZ4 A;  1O1R A;  2AVP A;  4BSX A;  4NIK A;  4PH4 B;  4LNG A;  4UUC A;  4B8A A;  4IUL A;  2MOW A;  3EU9 A;  4U8H A;  2YHC A;  4DK5 A;  3D9J A;  3NZS A;  3CVU A;  1S70 B;  3PEU B;  4GML A;  2VGX A;  1FCH A;  3L54 A;  4MBG A;  2DZO A;  4O60 A;  3S7B A;  4J8F A;  5HI7 A;  3LVQ E;  3FEX A;  4I9C A;  1HG5 A;  5HS0 A;  2DWZ A;  1BI7 B;  3TWX A;  3L17 A;  4ABN A;  3D9I A;  3UT8 A;  3MKQ A;  2L6B A;  3FEY A;  4FP7 A;  4C48 B;  2YQ8 A;  1ELW A;  4MLP A;  4HNA D;  4DX2 A;  2EIL E;  4HQD A;  2BUG A;  4HOS A;  1W3B A;  4BX9 A;  4GYY A;  3ZN3 A;  2F0Y A;  3EIJ A;  3AG1 E;  4KXK B;  5EIL A;  2XCC A;  3UKR G;  1JWG A;  2A5U A;  1QBQ A;  3PNT B;  5KNG A;  2EIK E;  3ZNG A;  1OCZ E;  4C0E A;  2L0I A;  4TXP A;  1N94 A;  1OWO A;  3SF4 A;  5FWQ A;  1INZ A;  4U63 A;  2P9N G;  3FUM A;  4JEH A;  2C0M A;  1XNF A;  4DX6 D;  4DX7 D;  1ZBP A;  2YNQ A;  3QWV A;  3QAR A;  3OTN A;  5KNH D;  1OWP A;  3V2O A;  4RG6 A;  4Y6W A;  4N3B A;  3HXF A;  3URZ A;  3CQC B;  1N4S A;  4DX5 D;  4F7A A;  5CRV A;  3CVQ A;  1SZA A;  3X2Q E;  4K5A B;  4GA1 A;  3BG0 B;  3FU3 A;  3WXX A;  4I17 A;  5FQ7 A;  1Z3X A;  5M72 A;  2QC9 A;  2ZGG A;  1N11 A;  1MJ0 A;  4P29 A;  4WNF A;  2IU1 A;  4DI4 A;  1JCS A;  5EX3 A;  4HI9 A;  4CDN A;  4ACK A;  5ARF A;  3CR3 A;  1DVP A;  3FP3 A;  5CMW A;  1NZN A;  4RLY A;  5ARG A;  2ZIR A;  1VDY A;  2OOE A;  3ULQ A;  3C98 A;  2I2O A;  2ILR A;  5A23 A;  3LKU A;  3CIA A;  2KCK A;  3R9A B;  2VGE A;  1H6P A;  3CHQ A;  2CHX A;  4JPS A;  4A55 A;  1OWN A;  2R2L A;  3PVL A;  4JHJ A;  4L2L A;  4YND A;  4G2V A;  4I43 A;  3R7Q A;  4A1S A;  4DLQ A;  1OWL A;  4J8S A;  4BER A;  4HFG A;  4U95 D;  3C3Q A;  1NI1 A;  3Q9N C;  4F3V A;  2X38 A;  1U3C A;  1WAO 1;  3MX3 A;  1BD8 A;  2EIM E;  5ENO D;  1HX8 A;  3FU6 A;  2OEV A;  5G55 A;  1TYQ G;  4C9B B;  3FTW A;  1HXI A;  3Q5M A;  4GTV A;  1QQE A;  3ZGQ A;  2QZA A;  3EHR A;  1SW6 A;  3UI2 A;  4ANX A;  2OEW A;  2WB2 A;  1O1S A;  3FFL A;  2PQR A;  5KWD A;  3EHQ A;  3LYA A;  3CHO A;  4CEM A;  4GMR A;  2F8X K;  2AJA A;  1LF8 A;  3WG7 E;  3I4R B;  5C1D A;  3ZHE A;  2JAB A;  1BPO A;  2Y4T A;  4LNB A;  1G3N B;  1SVX A;  2DIW A;  3RO2 A;  2DZN A;  3FWV A;  4QFV A;  3PNL B;  2P9S G;  1FPP A;  2P9U G;  4E6H A;  1EYH A;  4I9E A;  3AG3 E;  4OVU A;  4BY6 A;  1N4Q A;  2NXP A;  4OAV B;  4DJA A;  3UQ3 A;  1D8E A;  3CVL A;  3BQO A;  5T3R A;  3FY4 A;  1MHQ A;  2IQC A;  1DC2 A;  4RG9 A;  1WM5 A;  2L6J A;  4ATG A;  1TN6 A;  2HR2 A;  5ITZ F;  2BKK B;  4NQ0 A;  4ATZ D;  4DX1 A;  3UIN C;  4KMO A;  4GA0 A;  5HQ8 A;  4EBA G;  1O1T A;  4X8Q A;  3G2U A;  1YCS B;  3JUE A;  3UM0 A;  3I3N A;  3FTZ A;  5ENN A;  3FTU A;  3NF1 A;  3ASG A;  2WXI A;  3E33 A;  3TWV A;  4MS6 A;  2PL2 A;  3RKV A;  1OT8 A;  1EDU A;  4TRQ A;  4ILH B;  3S7J A;  3U4T A;  3EHN A;  3N71 A;  4WWP A;  4EQF A;  4XX5 A;  2QFC A;  4AVX A;  4IRU A;  5G04 C;  5BPP A;  3KAE A;  4RSY A;  3ABL E;  4XKC A;  2IO3 C;  2WXO A;  3U3W A;  3V31 A;  3B95 A;  4LNU D;  5LP0 A;  4G11 A;  5FZS A;  1E8Z A;  4N3C A;  2KZT B;  1E8X A;  3T5X A;  2LSV A;  2X6J A;  4PS8 A;  1OCR E;  4V3I A;  2XZT G;  5J08 A;  4WNE A;  4TXR A;  1RW2 A;  2J07 A;  3GZ2 A;  3FUJ A;  1IQR A;  2HM8 A;  2P2C P;  4EZL A;  3UIP C;  5AQA A;  2FBN A;  4N2Q A;  3TXN A;  5C2Y A;  5IY5 E;  4TUU A;  3UMV A;  4GTR A;  2LUH A;  4AXH A;  5CHE E;  4L23 A;  3T5V A;  4PDX A;  2F8Y A;  3DSX A;  4A1G A;  3ULY A;  2R03 A;  4N5C A;  2FI7 A;  4APO A;  1KT1 A;  1E96 B;  3Q79 A;  1SQM A;  2VJ8 A;  3ASD A;  1UJK A;  1BI8 B;  3Q75 A;  1V55 E;  3UXG A;  4BET A;  5CBN A;  3J5Q B;  3HYM B;  4FHK A;  5G05 C;  3DBS A;  1ZU2 A;  5KCM A;  5E76 A;  5ENR D;  3V79 K;  4JXT A;  1U3D A;  3RU0 A;  4BFR A;  4EZK A;  2XRZ A;  4A3T A;  3CSF A;  2R59 A;  5AYW D;  4CZ2 D;  5JJ7 A;  4YDO A;  2NSZ A;  3HG0 D;  3DSS A;  3CK9 A;  4A3V A;  4D10 C;  4ME2 A;  4GZC A;  3GZS A;  4CGW A;  2LO6 A;  4KZ0 A;  5ENQ D;  4I1M A;  2ETB A;  3P2B A;  4JC8 A;  2Y1L E;  2LSU A;  4WWO A;  2CG3 A;  4OAU C;  3PZ1 A;  3NOG D;  4KYO B;  4JA7 A;  4U8V D;  2P9K G;  1H6O A;  3RO3 A;  2V4H C;  4CT4 A;  4GPK A;  1TNB A;  3CGH A;  1SA4 A;  4NAC A;  3JXI A;  1UN8 A;  5D66 A;  2WQ6 A;  3FH7 A;  1TEZ A;  3FH8 A;  3IHV A;  1LD7 A;  3UTM A;  4BES A;  1KPS B;  2ZXW E;  2XZD G;  2WXG A;  3APD A;  4IYP A;  1KZO A;  3IEG A;  2PM6 A;  2GRL A;  2CFZ A;  1MX4 A;  4OVV A;  3JXJ A;  4UI9 J;  3FHE A;  3CKC A;  4JEU A;  5G04 J;  5EIB E;  4K03 A;  5AJD A;  3UIO C;  3CVV A;  3ZYQ A;  4NUR A;  4WWN A;  3CHR A;  2JLB A;  2HE0 A;  4DPR A;  3MZL B;  3TWR A;  3U64 A;  1PC2 A;  3W9G A;  3Q78 A;  4TV3 A;  3PZ2 A;  4B89 A;  4GZ6 A;  3Q73 A;  1MZC A;  2XGM A;  3O4Z A;  3ZHE B;  3LY8 A;  2KZT A;  1OWM A;  2LXL A;  5BV1 A;  5FIN A;  3ESK A;  2CFU A;  3ENE A;  1H0A A;  3ASH A;  2WXH A;  1JCQ A;  2I1K A;  5A7D B;  4HOT A;  2WXK A;  3NBN B;  2WVI A;  3CLJ A;  1LD8 A;  2XCB A;  5E75 A;  3B7S A;  3MGB A;  3MJW A;  2Y3A A;  5D2M C;  3TWS A;  2HYZ A;  4K5C A;  3AU4 A;  3DPD A;  3E30 A;  1NA0 A;  4JW1 A;  2LAH A;  4J8E A;  3IV0 A;  4XEI G;  2OVF A;  3C72 A;  4L7T A;  1YA0 A;  1FT1 A;  3AG2 E;  1AP7 A;  4JB8 P;  2VYI A;  2FO7 A;  3P1U A;  4KVO A;  4PS3 A;  2XGO A;  5G05 J;  4G24 A;  4YDY A;  3IBE A;  4RQI A;  3LPZ A;  5DBK A;  5FZR A;  5AQ7 A;  4ACL A;  3D9O A;  2ZGD A;  3HRA A;  3C5R A;  2VSO E;  5KJL A;  4G1T A;  5LCW J;  4BX8 A;  2ION A;  1OCC E;  2DBA A;  1ZB1 A;  4Q94 A;  2B6C A;  3GZ1 A;  2X6K A;  3RK6 A;  3NZU A;  3EU5 A;  5FJY A;  5CCM A;  4NRH B;  3B13 A;  4KVM A;  4YVQ C;  4JHK A;  3PZD A;  5CMY A;  1TN8 A;  2PZI A;  3ISM C;  2KCL A;  5AJL A;  3TG4 A;  1OY3 D;  2V4L A;  3Q49 B;  2IOL A;  4ANV A;  4WUY A;  3TWW A;  4MRU A;  5FZQ A;  3C3O A;  2J49 A;  3CVP A;  3LCA A;  3TWT A;  3B7U X;  3Q47 B;  3FUK A;  3SO8 A;  4EHM A;  1N52 A;  1ELK A;  3EDT B;  2A5E A;  3ONK A;  2KAT A;  4EZJ A;  1OUV A;  4K5B A;  3LJ3 A;  2OND A;  4J6I A;  2R17 C;  2V5Q C;  2AXV A;  4URK A;  2Y0B G;  3DSW A;  3AU5 A;  4FC8 A;  3LY7 A;  2BTD A;  2VSN A;  3TAX A;  3DWL G;  2E2E A;  3HXE A;  3VLF A;  1HZ4 A;  3HXC A;  3KSL A;  2OVB A;  3AS5 A;  4C0M A;  2FEZ A;  4A63 B;  3TGO A;  4UWG A;  4AV7 A;  2GRQ B;  3SFX A;  5JHB A;  3FU5 A;  4N2S A;  5JMN D;  3QK0 A;  2DYR E;  1TN7 A;  4HS2 A; 
#chains in the Genus database with same CATH homology
 3ZUV B;  4DUI A;  4ZFH A;  4CZ2 D;  2MYO A;  5CED B;  3F6Q A;  1UOH A;  4G8K A;  4LSZ E;  5AAR A;  5CEA A;  2RFM A;  1D9S A;  2KXP C;  1MX2 A;  2VGE A;  3W9F A;  5AQ9 A;  5CEC B;  2XZT G;  3HG0 D;  5BXU A;  4CYM D;  5KBA A;  5KNG A;  4U8Y D;  4HRN A;  1IXV A;  4OAV B;  2KBX A;  3ZNG A;  3AJI A;  5FIN A;  2NYJ A;  3V2X A;  2BKG A;  4TUM A;  4B93 B;  4F6R D;  5ENQ D;  5CBO A;  2PNN A;  4J8Y A;  2RFA A;  1A5E A;  1IHB A;  4LG6 A;  5ENT D;  1BU9 A;  2ETB A;  3D9H A;  4BER A;  3KEA A;  1WG0 A;  2F37 A;  4U95 D;  5EN5 D;  4J7W A;  5AAO A;  4HI8 A;  3NBN B;  2Y1L E;  3LJN A;  5ENS D;  2P2C P;  1DC2 A;  2DVW A;  1OY3 D;  3Q9N C;  5AQA A;  5AN8 A;  1WDY A;  4OAU C;  5ITZ F;  3DEP A;  2BKK B;  3B7B A;  4U96 D;  3NOG D;  3TWW A;  2QYJ A;  1IKN D;  1BD8 A;  5ENO D;  1YMP A;  4U8V D;  4ATZ D;  4BSZ B;  4DX1 A;  4DX6 D;  3TWT A;  1K3Z D;  2V4H C;  3TWS A;  1NFI E;  3NOC D;  1DCQ A;  4DX7 D;  4GPM A;  5FIO A;  3SO8 A;  4K5C A;  1MYO A;  4HLL A;  5CER B;  5EYP F;  5EID A;  2F8Y A;  3JXI A;  5KNH D;  4DRX E;  2A5E A;  5D66 A;  3V2O A;  4NIK A;  1YCS B;  4UUC A;  4K5B A;  4HRM B;  3T9K A;  4G8L A;  3JUE A;  1AWC B;  3EU9 A;  4N5Q A;  3EHR A;  1BLX B;  2V5Q C;  3UTM A;  1S70 B;  4Z68 A;  4BES A;  3ZKJ A;  1TR4 A;  1SW6 A;  2Y0B G;  3UI2 A;  1YYH A;  1AP7 A;  3TWV A;  3T8K A;  5EYL A;  3V30 A;  2XZD G;  2FO1 E;  4JB8 P;  5BXO A;  4DX5 D;  2DZO A;  4O60 A;  1OT8 A;  5KWD A;  1BI8 B;  4BEP A;  3EHQ A;  4HB5 A;  4K5A B;  3UXG A;  4BET A;  3Q9U C;  1MX4 A;  4YDW A;  3JXJ A;  5CBN A;  1QYM A;  2XEH A;  4YDY A;  5JA4 D;  4O1P A;  4F1P A;  2J8S D;  4ZHB A;  5HS0 A;  2QC9 A;  3AAA C;  5EIB E;  3ZU7 B;  2ZGG A;  1N11 A;  1MJ0 A;  4GMR A;  2XEN A;  5HRY A;  2F8X K;  3J5Q B;  2AJA A;  2DWZ A;  2XEE A;  5AQ7 A;  3TWU A;  2JAB A;  4A63 B;  4HI9 A;  2HE0 A;  1N0R A;  4O1O A;  1BI7 B;  1G3N B;  1K1B A;  1SVX A;  3J5P A;  4QQI A;  5ENR D;  1N0Q A;  3TWX A;  3TWR A;  4HRL A;  3V79 K;  2L6B A;  2ETC A;  2ZGD A;  3HRA A;  5ENP D;  4C48 B;  3C5R A;  2DZN A;  3TWQ A;  4HNA D;  5JMN D;  4HBD A;  4DX2 A;  3W9G A;  1MX6 A;  3IXE A;  2ETA A;  4HQD A;  4RLY A;  1K1A A;  3DEO A;  5AQB A;  2B0O E;  5EIL A;  5HKP A;  3B95 A;  3V31 A;  4LNU D;  4QFV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...