3NOCD

Designed ankyrin repeat protein (darpin) binders to acrb: plasticity of the interface
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
154
structure length
154
Chain Sequence
DLGKKLLEAARAGQDDEVRILMANGADVNARDFTGWTPLHLAAHFGHLEIVEVLLKNGADVNAKDSLGVTPLHLAARRGHLEIVEVLLKNGADVNASDSHGFTPLHLAAKRGHLEIVEVLLKNGADVNAQDKFGKTAFDISIDNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Designed ankyrin repeat protein binders for the crystallization of AcrB: Plasticity of the dominant interface
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein/protein binding
molecule keywords Acriflavine resistance protein B
total genus 41
structure length 154
sequence length 154
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3nocD00
3IXEA 4HB5A 1NFIE 4ZFHA 4HNAD 2FO1E 3NBNB 4B93B 4NIKA 3TWVA 1A5EA 4F1PA 5D66A 2MYOA 3EHRA 3B95A 4ZHBA 3JXIA 2QYJA 3V30A 3V2XA 5JA4D 5KNHD 2XZTG 4U95D 4YDYA 3TWSA 2ZGGA 5FINA 5ITZF 1AWCB 4DX2A 4JB8P 3UXGA 4QQIA 3UTMA 3TWTA 2B0OE 1BU9A 5EN5D 4O1OA 1MYOA 1N11A 4N5QA 1SVXA 2HE0A 3TWQA 3ZU7B 1AP7A 1D9SA 2DWZA 2F37A 2Y1LE 4DX7D 1SW6A 4G8KA 4UUCA 5AQAA 2J8SD 4Z68A 1YCSB 5KNGA 4F6RD 2XENA 2ETCA 4U8VD 4RLYA 5AN8A 4K5BA 4K5AB 1N0RA 1WDYA 2BKKB 2F8YA 3C5RA 4J7WA 4GPMA 2DZOA 5AQ9A 5FIOA 3F6QA 4DRXE 1S70B 4BETA 4YDWA 4BSZB 1OT8A 1BLXB 5AAOA 4HI9A 2PNNA 3NOCD 4G8LA 1MX2A 2AJAA 4BERA 5ENSD 5HS0A 1K1AA 3T9KA 5AQBA 5EYPF 4BESA 3D9HA 2NYJA 3DEOA 4GMRA 3ZUVB 5KBAA 3SO8A 4OAUC 3B7BA 5CBNA 2ETAA 3W9FA 2JABA 4U96D 1IKND 3TWXA 5KWDA 5ENRD 1TR4A 3V2OA 5ENPD 5CERB 2KXPC 1YYHA 1BI8B 1OY3D 1UOHA 3TWUA 3AAAC 3W9GA 3ZKJA 5CBOA 4C48B 5EIBE 4HLLA 2KBXA 4HRMB 2VGEA 1BI7B 2L6BA 5EYLA 2F8XK 1DC2A 4K5CA 4O60A 4DUIA 5BXUA 5CECB 2ETBA 3JUEA 5JMND 2XEHA 1MJ0A 5ENTD 1IXVA 4DX6D 1MX6A 4HRLA 4TUMA 5EIDA 1MX4A 1YMPA 3HG0D 4ATZD 3ZNGA 3HRAA 2QC9A 3EHQA 1K3ZD 4HRNA 2A5EA 5AARA 4HBDA 2P2CP 2XZDG 3LJNA 2DZNA 1IHBA 4O1PA 4CZ2D 4OAVB 5ENQD 2V5QC 1QYMA 3Q9UC 3V79K 3TWRA 3JXJA 3T8KA 4LG6A 2XEEA 3TWWA 3NOGD 3J5QB 3V31A 5BXOA 3UI2A 5HRYA 3AJIA 3Q9NC 2Y0BG 2ZGDA 1WG0A 1DCQA 2DVWA 3DEPA 1N0QA 4QFVA 5ENOD 4LSZE 4DX5D 1BD8A 5CEDB 4U8YD 4HI8A 4HQDA 2BKGA 5HKPA 5CEAA 4A63B 2V4HC 3EU9A 3J5PA 4CYMD 1G3NB 2RFMA 2RFAA 4J8YA 4BEPA 4DX1A 5EILA 3KEAA 1K1BA 4LNUD 5AQ7A
chains in the Genus database with same CATH superfamily
3KS2A 2FO1E 2IF4A 1KZPA 4NIKA 2QY7A 4ZHBA 3V30A 5KNHD 2XCCA 1KPSB 2WXQA 5T3RA 2WQ6A 1QBQA 1FT1A 4GPKA 2B0OE 3D9MA 3L54A 3MA5A 4BX8A 4N5CA 4G8KA 3VTXA 3C3QA 2WXFA 4GB9A 3NF1A 2VTBA 1E8ZA 2WB2A 4A3TA 1NA3A 3TWXA 1IKND 5ENRD 2R02A 4DK5A 4AOFA 3PE3A 5KJNA 3UINC 3TWUA 2BF0X 3B7SA 3B7RL 3BUAA 5ENNA 4LNBA 3ASFA 5CHEE 4E6HA 1IQRA 3CQGB 3FTYA 3D9OA 3CVLA 4GYWA 1LTXA 4A3VA 3CVPA 4AJWA 4U0SA 1IHBA 1UJKA 2IJGX 2Q7FA 3IBEA 3CVUA 1E96B 3V31A 3PUJA 1O1RA 3CK9A 3AU5A 4N2QA 2XHEA 4AY6A 1JCRA 3JCKC 5IY5E 3AG4E 4I2WA 3CHRA 4GZ3A 1G3NB 5BPPA 2J9QA 1DNPA 2KZTB 3SNXA 1FCHA 4I9EA 5JA4D 2XGMA 3TAXA 4CRWA 5KJLA 4IN3B 2R59A 4AV7A 3HIZA 2PL2A 4Y6CA 2KZTA 2LO6A 2RKKA 1YCSB 3RRUA 3FWVA 4BTBA 4K5AB 1N0RA 1FT2A 4LNGA 5AQ9A 5J90A 4JVSA 1O1TA 4MKTA 1N4PA 2NYJA 4LEUA 2QYUA 4GZCA 5LX8A 3CVWA 3TXMA 4I43A 3AU4A 1OCZE 2EIJE 3QWVA 5CCMA 4ACKA 2QFCA 2XPZA 4CCAA 2BUGA 4PH4B 3Q4AB 3FUNA 2HYZA 3L16A 4GTOA 2KBXA 4KXKB 4AXHA 4O60A 3QK0A 5JMND 2CG3A 3D3MA 2XEVA 5E76A 4FLBA 1SQMA 5EX3A 1TNUA 3U4TA 4EBAG 3ULYA 3HXCA 4HVBA 5JJ6A 1TJCA 2GROB 3MJWA 4YNDA 3DXMG 5ENQD 3FHEA 2XRYA 2ZIRA 2UWJG 2EIME 4GTSA 2ZGDA 2P58C 1JWFA 4BY6A 4OYSA 4M7CA 2XCBA 3ZN3A 3EU9A 4BEPA 4WUYA 3UIPC 2ZXWE 3TL5A 1JWGA 2ONDA 3LY7A 1KT0A 1S0PA 2AW6A 2WPVA 5ITZF 1TEZA 1TNYA 3I4RB 2YHEA 2J4DA 3Q5MA 1OCCE 1NA0A 3MCXA 1S64A 4MS6A 4UWFA 4GPMA 4J8EA 4Q96A 2AJAA 5KBAA 4OAUC 2LSUA 2GRNB 2PQRA 3CIAA 3DWLG 3CEQA 2H6FA 5J08A 4G2VA 3CKCA 1N4RA 4PS8A 2WVIA 1B89A 3PEVB 3T5XA 1UOHA 3AG3E 5CBOA 5LOZA 3LY8A 3I3NA 2F8XK 4DX6D 3Q15A 1MX6A 4UWKA 3NB2A 3P2BA 5CMYA 2E0IA 1EF1C 3HVEA 3JYSA 1INZA 4U0ZA 5LCWC 3Q47B 4H7XA 1K8KG 3FTXA 3PEUB 1IHGA 2CHZA 5CRVA 3MKQB 2WXGA 1UN8A 4J8SA 4EZJA 3CVVA 1LD8A 1D8EA 2IU1A 3L6AA 3SF4A 4FJYA 4PUCA 4ANUA 2P9LG 2E2EA 4GTQA 3CHQA 4J0UA 4YDYA 3TWSA 2V5FA 5JJ7A 4JZYA 1N4QA 4BX9A 4L2LA 3L9TA 3CV0A 3QARA 3S7BA 2HE0A 3C3OA 5DIZA 1QNFA 3FUJA 4C0MA 1AP7A 4XI9A 2WXOA 4URKA 5ARFA 4RLYA 3SGHA 5ARGA 4NRHB 4OVVA 1Z3YA 4JXTA 4XE0A 3LS8A 4BSZB 5BUZA 5HS0A 3IHYA 3LDZA 3ZPJA 3KAEA 3Q49B 3D9JA 3SFZA 3D9IA 4IULA 3RJVA 5KWDA 4I1OB 3E4BA 4JA9A 1H6KA 3JQ0A 2WXRA 2EILE 1IYGA 4GMLA 1MHQA 3EIQC 3LEWA 2MHKA 3PZ4A 5B3SE 3HRAA 2R5SA 3FUKA 4JHKA 1K3ZD 1TN8A 2XS1A 1FVFA 5JJTA 2V5QC 2H6IA 3JUIA 4J8FA 3NOGD 5FQ8A 2DVWA 1NL4A 4FHJA 2LNIA 2VSXE 4LSZE 1BD8A 2CG2A 1H6PA 1TYQG 4JHRA 1HXIA 4ILGA 5HKPA 3DSWA 3FTSA 2RFAA 2X6HA 3QDNA 2XPIA 1ZBPA 4U04A 2I9CA 4EZKA 1FVHA 1PC2A 3QKYA 1HG5A 4APOA 4MRUA 4E85A 4JL0A 5A7DB 1N11A 3ZU7B 2Y1LE 3CR3A 4Z68A 3EDTB 1ZB1A 5AN8A 3MKQA 1EPUA 2L6JA 3C5RA 3ESKA 5AAOA 3DSTA 1JUQA 3ESLA 1N54A 3HXEA 2WXMA 4B89A 3D9NA 4ACLA 4B0ZA 3E37A 2JABA 5H7PA 3QC1A 5LP0A 1H19A 4JD2G 2VQ2A 4I6EA 1LF8A 3AAAC 3W9GA 4C48B 3MV3B 4YVQC 3FFLA 4YDOA 1HO8A 4KZCA 2OVFA 4DUIA 5BXUA 3FEXA 3BG1B 2X6FA 3DBSA 2C0LA 2FULA 2V0PA 4LUNU 1S63A 3TG4A 3EHQA 3EUVA 4K0RA 3D9KA 3O48A 3FTWA 1HU3A 4N3AA 4GCNA 3TWRA 3DPYA 3LYAA 4QFVA 2GRQB 4F1PA 1N4SA 3EHRA 2PZIA 4RSYA 1GW6A 3LKUA 4U95D 5FZSA 5FINA 4QQIA 4YDEA 3AS4A 2R17C 1TJFA 4HS2A 5G05J 1ZU2A 3FY4A 4CGWA 3B7TA 4G26A 3ML9A 2CFZA 1QZ2A 4JC8A 3SBTB 2XENA 4U8VD 4WWPA 2MRIA 4ILHB 4AY5A 4DRXE 3B7UX 3NOCD 4I9CA 3D9HA 2WXPA 3B7BA 3UX4A 3UT7A 4OVUA 4TXRA 5LFAA 3C98A 4GTPA 3UIOC 2WMNA 5ENPD 5G04J 2PM7A 1BI8B 3UM1A 1TN7A 2L9BA 4EQFA 4UQYA 2OVBA 3BQOA 2FO7A 4CT4A 3SI5A 2I1JA 2VSNA 2ETBA 2IOSA 1TNZA 3MX3A 1KLXA 2QC9A 5DBKA 3L13A 1E7UA 3G2VA 4ANVA 3OTNA 2H6GA 2DBAA 2J49A 2EINE 3RO3A 2XEEA 3DSUA 2LAIA 1E8WA 3AJIA 5CCLA 3PE4A 3DEPA 4TRQA 2RD0A 2WXNA 3C3RA 3Q73A 4TV3A 3J5PA 3RAUA 4CYMD 4TXQA 5EILA 2AXUA 5FZQA 4B93B 1A5EA 2LAHA 5LCWJ 3APDA 4GU5A 3UXGA 2PM6A 2X6KA 4AP2A 3FEYA 4H7YA 4W9RA 2IO3C 2WXJA 1D9SA 3AG1E 5CMWA 4CDRA 3CVYA 4ABNA 3LJ3A 2WQHA 4DLQA 1HS6A 1WDYA 4XI0A 3CLJA 1OT8A 3ZIMA 3VLFA 4GZDA 4BFRA 1HX8A 1Y6IA 3DEOA 3PUKA 1NP7A 5CBNA 2R2LA 2P9SG 1UG3A 3ASNE 3ISMC 3UT4A 3RKVA 5B1BE 3LVRE 3SQVA 4B8CB 5CECB 3HYMB 4TUMA 4XKCA 3HHMA 1HH8A 5G2NA 2GW1A 4J6IA 1OWNA 4KT6B 5AARA 3QJZA 4BT8A 2DZNA 2IO2C 5KJMA 3G2UA 4A1SA 5HRYA 3CVQA 1YA0A 2LXMA 3QWPA 2AWIA 4UQZA 4BT9A 2WXLA 2A5UA 2ZGGA 4I1AA 2KCKA 3PH0C 3G2SA 4JB8P 3CHMA 1U3CA 4I6JA 1BU9A 5EKQD 5EN5D 3NQPA 2OOEA 4UUCA 4JEUA 4EBAA 4K5BA 4J7WA 3D9LA 3UM0A 2J4BA 3ULQA 1TN6A 1KZOA 2CHWA 2J09A 3ZYQA 4L7TA 2P9UG 2GRPB 2AVPA 3ZXSA 1OUVA 3QNKA 4Q69A 3FUIA 4DPRA 4I17A 4NACA 4CGVA 2YNQA 2Y4TA 4GYOA 5EIDA 1U2VG 3S7JA 3MGBA 4BTAA 3S2AA 4I1MA 1TNOA 5M72A 3RIBA 2AXZA 3J5QB 3ONKA 1U3DA 2I6HA 1H2UA 3TXNA 4NQ0A 4A1GA 2KC7A 2IEJA 4DX1A 4JPSA 1OCRE 3NAWA 1OWOA 2YQ8A 5AQ7A 4HB5A 3UPVA 4HLEA 4LERA 4TUUA 1OWLA 4R7LA 3CK7A 2WQ7A 3ZVVA 4WWOA 3UTMA 5KJKA 1X5BA 3PRZA 5KNGA 3X2QE 3OXLA 4XEIG 3VTYA 5FIOA 3ABLE 3WXXA 3SHFA 4HI9A 3SFYA 2JEKA 5C1DA 3DXKG 4GMRA 4FHKA 2WMOA 1N9AA 5EDSA 2L0TB 3PS6A 2WXHA 5D0QD 2EQXA 1OY3D 1Q2ZA 3QAQA 4CEMA 2VGEA 2DIWA 5EYLA 4ILIA 3UMVA 1O1SA 3GZSA 4HXIA 1MX4A 3LCAA 3PDNA 1HE8A 2KM4A 3JQ1A 3G2TA 2C0MA 4RG9A 5C2YA 2J07A 2R05A 1E90A 3Q7FA 4KZ0A 4U07A 3V79K 4L9PA 4N2SA 3CKBA 2RG8A 2QZAA 4N3BA 4XIFA 3UM2A 1HZ4A 2IOLA 1JCQA 3IXEA 3RRNB 5D66A 1Z6TA 4GTMA 3CHPA 3APFA 3U64A 5A23A 1HG2A 1SZ9A 3UUXA 3ZW3A 4FC8A 4HFGA 4N5QA 3UM3A 5AJLA 3KD7A 4HOSA 3IKOB 2J8SD 4GZ5A 3RO2A 5FTPA 3IV0A 4GA2A 4UWGA 4UWLA 4AVXA 5EYPF 2HO1A 4LRZA 2HM8A 2P9PG 4G23A 4GTRA 4U96D 1TR4A 2VTBB 3V2OA 1YYHA 3ZKJA 3LY9A 2L6BA 2OCCE 1IXVA 4GA0A 4C9BB 4HRLA 3OXGA 1VDYA 3ZNGA 4ME2A 5HI7A 3HVEB 2A5EA 2IQCA 4DI4A 4WNFA 2X6IA 4HOUA 3MZLB 5BXOA 2FBNA 3CHSA 3FU6A 2Y0BG 4HI8A 3HXBA 3L22A 2V4HC 1O5MA 1E8XA 1A17A 4HNAD 3FU5A 1Z3XA 3V2XA 1RW2A 3SBSA 3L08A 4BSXA 3E33A 3FUFA 4O1OA 4KVOA 1SVXA 5AYWD 3Q75A 3ENEA 4DX7D 3FUMA 4F6RD 3OAWA 3APCA 2F8YA 4BETA 1H2TC 3L82A 3Q7AA 1K1AA 2UY1B 3LPZA 4I2ZA 3VLEA 2X6JA 2V8SE 3G2WA 5E75A 3ZYMA 4CDMA 4GZ6A 1RZ4A 4FA6A 2UY1A 4XZ4A 3ZYLA 1DC2A 1BI7B 4B94A 2R03A 3FP3A 3CK8A 3EU5A 4ATZD 3ASOE 3ONLA 3LJNA 4OAVB 3TG5A 4FJZA 3RSEG 4N39A 2A4ZA 2NC9A 4V3IA 2VGXB 3PREA 4U8YD 3CVXA 3UT8A 4A63B 2IY0C 4J8YA 3EJNA 3HXFA 3GW4A 4LNUD 3OXFA 4YVOA 3NBNB 2MYOA 3JXIA 3T5VA 2KCVA 2F0YA 3ZHEB 2PQNA 4FULA 5EX0A 5AIJA 4HOQA 4G1TA 3SD5A 2XQ0A 3ASDA 2Y3AA 1N94A 3CGHA 4J8DA 3K9IA 2V4LA 4FP7A 1NZNA 3EHMA 3QB2A 1OWMA 2I2OA 4KYOB 3ZFWA 2VSYA 1MX2A 2LUHA 3ZEFA 3SO8A 5G05C 4ANXA 3W9FA 3ULEG 4IYPA 4EHMA 4JA7A 3U9WA 5G04C 1WAO1 2GRRB 4DLOA 3E32A 2KCLA 4Q94A 4PS7A 2H6HA 4GTVA 3ASGA 3FULA 4HRNA 3AS8A 1JPLA 4EPZA 4O1PA 2C2LA 3Q9UC 3ZXPA 3T8KA 1H6OA 3CQCB 1NI1A 2FEZA 3Q9NC 2J08A 3Q78A 1XGWA 4JW1A 2OEWA 3RRMB 4BWRA 2BKGA 2BTDA 4EZLA 2BEDA 1H2VC 4M3OA 5FQ6A 1LD7A 1D8DA 3SZ7A 5FQ4A 2LSVA 3FUDA 3PZ2A 5BT1A 3U3WA 3GZ1A 4JEHA 5HQ8A 3BU8A 1HF8A 5ANLA 4CDNA 3LVQE 4AEZC 4L1BA 3ZGQA 1E7VA 2YHCA 4U8HA 3Q79A 2ETCA 4GA1A 2EIKE 2KATA 3T8MA 3HDXA 3KSLA 5FJYA 3PVLA 2DZOA 1S70B 3FTZA 4G8LA 3AS5A 2FF4A 4U7EB 3S7DA 5AQBA 3DRAA 3I5PA 4AM9A 3TJPA 3DPDA 3P1UA 2ETAA 4U63A 4WWNA 4F7AA 1BPOA 2NSZA 3IHVA 2X38A 2CFUA 2Y69E 1DCEA 2IONA 4UI9C 5ANRA 3S7FA 4RVBA 3AG2E 1OXJA 4NURA 4CT0A 4RG6A 3JUEA 5BV0A 3R7QA 4KVMA 2OV8A 5T4YA 2XGOA 3EHNA 4HBDA 2XZDG 3U66A 3RK6A 4AIFA 4F1SA 1QYMA 3FU3A 4P29A 3DSVA 4FLHA 4LG6A 2HR2A 4GMJA 5CEDB 4UQXA 1H0AA 2WXIA 5CEAA 4WAFA 1XNFA 3GZ2A 3FTVA 4UI9K 3FU0A 3B13A 4Y6WA 4DJAA 3R9AB 1ELWA 3WG7E 2XZTG 3ZRHA 1QQEA 3CVNA 5FT9A 5G55A 3NZSA 3E34A 4D10C 1DVPA 5A6CA 4ATGA 3UKRG 3E30A 4I6GA 3FH5A 4N3CA 3FTUA 2DCPA 2CHXA 2PNNA 3T9KA 2ZU6B 4XKBA 2P9NG 3MEKA 1UJJA 1EDUA 4FU3A 3ZYKA 2ZISA 1V54E 5BNWA 5B1AE 4F3VA 1PY1A 4PS3A 4HLLA 5D0OD 1OCOE 4KMOA 3QWWA 1E8YA 4U0UA 3TGOA 3HG0D 4GAAA 3FH7A 4IRUA 2P2CP 3BG0B 3VLDA 4DI3A 3QOUA 4CZ2D 3UQ3A 1X81A 3JXJA 3C72A 4UI9J 3DSXA 1N0QA 2B6CA 4APFA 4HQDA 3PNTB 1K1BA 3ABME 5BV1A 1P5QA 2P9IG 4ZFHA 3RU0A 2LXLA 3TWVA 3PZ3A 1MZCA 2QYJA 2X3MA 5FZRA 4MLPA 1SA4A 1UW4B 1AWCB 3PNLB 2MOWA 2VGXA 2WM9A 1MYOA 4WNDA 1N95A 2P9KG 2F37A 4G24A 4KBQA 5KCMA 3FUHA 2DYRE 3UKUG 3FUEA 4B8AA 1EYHA 2BKKB 3SY2A 3F6QA 4TXPA 1WM5A 4ANWA 4G11A 5ENSD 3FDHA 3ZUVB 1KT1A 4WNEA 4HOTA 2WXKA 3MYVA 2VSOE 5JHBA 1V55E 3MV2B 4XX5A 4UWHA 3L17A 4JHJA 1SA5A 5EIBE 3D9PA 1ELRA 1MJ0A 2Y4UA 3PZDA 1WY6A 3CSFA 5AENA 5BW8C 1YMPA 1Y8MA 2XGSA 2M63A 5AJDA 4GCOA 2YINA 3N71A 2AXVA 3BEEA 3CSTA 3ABKE 2XRZA 5JHAA 4HORA 4O6FA 3UI2A 3O4ZA 2OEVA 1WG0A 1DCQA 2VJ8A 3KEZA 3PZ1A 1IQUA 2VGYA 3ZHEA 2RFMA 3URZA 2I1KA 1JCSA 3KEAA 1HFAA 1NFIE 2NXPA 3MKRA 1PAQA 3B95A 1W3BA 1SZAA 4GTTA 1UN9A 4L23A 4DX2A 1ELKA 3CHOA 3TWTA 4FADA 2JLBA 3TWQA 2FI7A 2DWZA 2L0IA 1SW6A 5AQAA 3FH8A 4X8QA 4A55A 3LXUX 2ILRA 1FPPA 2GGFA 4GYYA 5CRUA 4F53A 4YDWA 1BLXB 3NZUA 5FQ7A 2XPYA 4L2YA 4BERA 2VYIA 4LCTA 2GRMA 4BESA 3KSQA 2GRLA 2XS8A 3SFXA 2DYSE 3ML8A 5FWQA 3R9MA 1MQSA 5CERB 2IFUA 2KXPC 3GYZA 1N52A 3R7RA 1L5JA 3EIJA 4EECA 3IEGA 4HRMB 4K5CA 1OWPA 2XEHA 5ENTD 4K03A 1TNBA 3I4GA 4PDXA 5T8IA 4RQIA 4WNGA 3HXDA 4MBGA 3TWWA 4G25A 5ENOD 4DX5D 4C0EA 1Z5SC 3ASHA 5D2MC 3DSSA
chains in the Genus database with same CATH topology
3IXEA 4HB5A 1NFIE 4ZFHA 4HNAD 2FO1E 3NBNB 4B93B 4NIKA 3TWVA 1A5EA 4F1PA 5D66A 2MYOA 3EHRA 3B95A 4ZHBA 3JXIA 2QYJA 3V30A 3V2XA 5JA4D 5KNHD 2XZTG 4U95D 4YDYA 3TWSA 2ZGGA 5FINA 5ITZF 1AWCB 4DX2A 4JB8P 3UXGA 4QQIA 3UTMA 3TWTA 2B0OE 1BU9A 5EN5D 4O1OA 1MYOA 1N11A 4N5QA 1SVXA 2HE0A 3TWQA 3ZU7B 1AP7A 1D9SA 2DWZA 2F37A 2Y1LE 4DX7D 1SW6A 4G8KA 4UUCA 5AQAA 2J8SD 4Z68A 1YCSB 5KNGA 4F6RD 2XENA 2ETCA 4U8VD 4RLYA 5AN8A 4K5BA 4K5AB 1N0RA 1WDYA 2BKKB 2F8YA 3C5RA 4J7WA 4GPMA 2DZOA 5AQ9A 5FIOA 3F6QA 4DRXE 1S70B 4BETA 4YDWA 4BSZB 1OT8A 1BLXB 5AAOA 4HI9A 2PNNA 3NOCD 4G8LA 1MX2A 2AJAA 4BERA 5ENSD 5HS0A 1K1AA 3T9KA 5AQBA 5EYPF 4BESA 3D9HA 2NYJA 3DEOA 4GMRA 3ZUVB 5KBAA 3SO8A 4OAUC 3B7BA 5CBNA 2ETAA 3W9FA 2JABA 4U96D 1IKND 3TWXA 5KWDA 5ENRD 1TR4A 3V2OA 5ENPD 5CERB 2KXPC 1YYHA 1BI8B 1OY3D 1UOHA 3TWUA 3AAAC 3W9GA 3ZKJA 5CBOA 4C48B 5EIBE 4HLLA 2KBXA 4HRMB 2VGEA 1BI7B 2L6BA 5EYLA 2F8XK 1DC2A 4K5CA 4O60A 4DUIA 5BXUA 5CECB 2ETBA 3JUEA 5JMND 2XEHA 1MJ0A 5ENTD 1IXVA 4DX6D 1MX6A 4HRLA 4TUMA 5EIDA 1MX4A 1YMPA 3HG0D 4ATZD 3ZNGA 3HRAA 2QC9A 3EHQA 1K3ZD 4HRNA 2A5EA 5AARA 4HBDA 2P2CP 2XZDG 3LJNA 2DZNA 1IHBA 4O1PA 4CZ2D 4OAVB 5ENQD 2V5QC 1QYMA 3Q9UC 3V79K 3TWRA 3JXJA 3T8KA 4LG6A 2XEEA 3TWWA 3NOGD 3J5QB 3V31A 5BXOA 3UI2A 5HRYA 3AJIA 3Q9NC 2Y0BG 2ZGDA 1WG0A 1DCQA 2DVWA 3DEPA 1N0QA 4QFVA 5ENOD 4LSZE 4DX5D 1BD8A 5CEDB 4U8YD 4HI8A 4HQDA 2BKGA 5HKPA 5CEAA 4A63B 2V4HC 3EU9A 3J5PA 4CYMD 1G3NB 2RFMA 2RFAA 4J8YA 4BEPA 4DX1A 5EILA 3KEAA 1K1BA 4LNUD 5AQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IXE A;  4HB5 A;  1NFI E;  4ZFH A;  4HNA D;  2FO1 E;  3NBN B;  4B93 B;  4NIK A;  3TWV A;  1A5E A;  4F1P A;  5D66 A;  2MYO A;  3EHR A;  3B95 A;  4ZHB A;  3JXI A;  2QYJ A;  3V30 A;  3V2X A;  5JA4 D;  5KNH D;  2XZT G;  4U95 D;  4YDY A;  3TWS A;  2ZGG A;  5FIN A;  5ITZ F;  1AWC B;  4DX2 A;  4JB8 P;  3UXG A;  4QQI A;  3UTM A;  3TWT A;  2B0O E;  1BU9 A;  5EN5 D;  4O1O A;  1MYO A;  1N11 A;  4N5Q A;  1SVX A;  2HE0 A;  3TWQ A;  3ZU7 B;  1AP7 A;  1D9S A;  2DWZ A;  2F37 A;  2Y1L E;  4DX7 D;  1SW6 A;  4G8K A;  4UUC A;  5AQA A;  2J8S D;  4Z68 A;  1YCS B;  5KNG A;  4F6R D;  2XEN A;  2ETC A;  4U8V D;  4RLY A;  5AN8 A;  4K5B A;  4K5A B;  1N0R A;  1WDY A;  2BKK B;  2F8Y A;  3C5R A;  4J7W A;  4GPM A;  2DZO A;  5AQ9 A;  5FIO A;  3F6Q A;  4DRX E;  1S70 B;  4BET A;  4YDW A;  4BSZ B;  1OT8 A;  1BLX B;  5AAO A;  4HI9 A;  2PNN A;  3NOC D;  4G8L A;  1MX2 A;  2AJA A;  4BER A;  5ENS D;  5HS0 A;  1K1A A;  3T9K A;  5AQB A;  5EYP F;  4BES A;  3D9H A;  2NYJ A;  3DEO A;  4GMR A;  3ZUV B;  5KBA A;  3SO8 A;  4OAU C;  3B7B A;  5CBN A;  2ETA A;  3W9F A;  2JAB A;  4U96 D;  1IKN D;  3TWX A;  5KWD A;  5ENR D;  1TR4 A;  3V2O A;  5ENP D;  5CER B;  2KXP C;  1YYH A;  1BI8 B;  1OY3 D;  1UOH A;  3TWU A;  3AAA C;  3W9G A;  3ZKJ A;  5CBO A;  4C48 B;  5EIB E;  4HLL A;  2KBX A;  4HRM B;  2VGE A;  1BI7 B;  2L6B A;  5EYL A;  2F8X K;  1DC2 A;  4K5C A;  4O60 A;  4DUI A;  5BXU A;  5CEC B;  2ETB A;  3JUE A;  5JMN D;  2XEH A;  1MJ0 A;  5ENT D;  1IXV A;  4DX6 D;  1MX6 A;  4HRL A;  4TUM A;  5EID A;  1MX4 A;  1YMP A;  3HG0 D;  4ATZ D;  3ZNG A;  3HRA A;  2QC9 A;  3EHQ A;  1K3Z D;  4HRN A;  2A5E A;  5AAR A;  4HBD A;  2P2C P;  2XZD G;  3LJN A;  2DZN A;  1IHB A;  4O1P A;  4CZ2 D;  4OAV B;  5ENQ D;  2V5Q C;  1QYM A;  3Q9U C;  3V79 K;  3TWR A;  3JXJ A;  3T8K A;  4LG6 A;  2XEE A;  3TWW A;  3NOG D;  3J5Q B;  3V31 A;  5BXO A;  3UI2 A;  5HRY A;  3AJI A;  3Q9N C;  2Y0B G;  2ZGD A;  1WG0 A;  1DCQ A;  2DVW A;  3DEP A;  1N0Q A;  4QFV A;  5ENO D;  4LSZ E;  4DX5 D;  1BD8 A;  5CED B;  4U8Y D;  4HI8 A;  4HQD A;  2BKG A;  5HKP A;  5CEA A;  4A63 B;  2V4H C;  3EU9 A;  3J5P A;  4CYM D;  1G3N B;  2RFM A;  2RFA A;  4J8Y A;  4BEP A;  4DX1 A;  5EIL A;  3KEA A;  1K1B A;  4LNU D;  5AQ7 A; 
#chains in the Genus database with same CATH topology
 3KS2 A;  2FO1 E;  2IF4 A;  1KZP A;  4NIK A;  2QY7 A;  4ZHB A;  3V30 A;  5KNH D;  2XCC A;  1KPS B;  2WXQ A;  5T3R A;  2WQ6 A;  1QBQ A;  1FT1 A;  4GPK A;  2B0O E;  3D9M A;  3L54 A;  3MA5 A;  4BX8 A;  4N5C A;  4G8K A;  3VTX A;  3C3Q A;  2WXF A;  4GB9 A;  3NF1 A;  2VTB A;  1E8Z A;  2WB2 A;  4A3T A;  1NA3 A;  3TWX A;  1IKN D;  5ENR D;  2R02 A;  4DK5 A;  4AOF A;  3PE3 A;  5KJN A;  3UIN C;  3TWU A;  2BF0 X;  3B7S A;  3B7R L;  3BUA A;  5ENN A;  4LNB A;  3ASF A;  5CHE E;  4E6H A;  1IQR A;  3CQG B;  3FTY A;  3D9O A;  3CVL A;  4GYW A;  1LTX A;  4A3V A;  3CVP A;  4AJW A;  4U0S A;  1IHB A;  1UJK A;  2IJG X;  2Q7F A;  3IBE A;  3CVU A;  1E96 B;  3V31 A;  3PUJ A;  1O1R A;  3CK9 A;  3AU5 A;  4N2Q A;  2XHE A;  4AY6 A;  1JCR A;  3JCK C;  5IY5 E;  3AG4 E;  4I2W A;  3CHR A;  4GZ3 A;  1G3N B;  5BPP A;  2J9Q A;  1DNP A;  2KZT B;  3SNX A;  1FCH A;  4I9E A;  5JA4 D;  2XGM A;  3TAX A;  4CRW A;  5KJL A;  4IN3 B;  2R59 A;  4AV7 A;  3HIZ A;  2PL2 A;  4Y6C A;  2KZT A;  2LO6 A;  2RKK A;  1YCS B;  3RRU A;  3FWV A;  4BTB A;  4K5A B;  1N0R A;  1FT2 A;  4LNG A;  5AQ9 A;  5J90 A;  4JVS A;  1O1T A;  4MKT A;  1N4P A;  2NYJ A;  4LEU A;  2QYU A;  4GZC A;  5LX8 A;  3CVW A;  3TXM A;  4I43 A;  3AU4 A;  1OCZ E;  2EIJ E;  3QWV A;  5CCM A;  4ACK A;  2QFC A;  2XPZ A;  4CCA A;  2BUG A;  4PH4 B;  3Q4A B;  3FUN A;  2HYZ A;  3L16 A;  4GTO A;  2KBX A;  4KXK B;  4AXH A;  4O60 A;  3QK0 A;  5JMN D;  2CG3 A;  3D3M A;  2XEV A;  5E76 A;  4FLB A;  1SQM A;  5EX3 A;  1TNU A;  3U4T A;  4EBA G;  3ULY A;  3HXC A;  4HVB A;  5JJ6 A;  1TJC A;  2GRO B;  3MJW A;  4YND A;  3DXM G;  5ENQ D;  3FHE A;  2XRY A;  2ZIR A;  2UWJ G;  2EIM E;  4GTS A;  2ZGD A;  2P58 C;  1JWF A;  4BY6 A;  4OYS A;  4M7C A;  2XCB A;  3ZN3 A;  3EU9 A;  4BEP A;  4WUY A;  3UIP C;  2ZXW E;  3TL5 A;  1JWG A;  2OND A;  3LY7 A;  1KT0 A;  1S0P A;  2AW6 A;  2WPV A;  5ITZ F;  1TEZ A;  1TNY A;  3I4R B;  2YHE A;  2J4D A;  3Q5M A;  1OCC E;  1NA0 A;  3MCX A;  1S64 A;  4MS6 A;  4UWF A;  4GPM A;  4J8E A;  4Q96 A;  2AJA A;  5KBA A;  4OAU C;  2LSU A;  2GRN B;  2PQR A;  3CIA A;  3DWL G;  3CEQ A;  2H6F A;  5J08 A;  4G2V A;  3CKC A;  1N4R A;  4PS8 A;  2WVI A;  1B89 A;  3PEV B;  3T5X A;  1UOH A;  3AG3 E;  5CBO A;  5LOZ A;  3LY8 A;  3I3N A;  2F8X K;  4DX6 D;  3Q15 A;  1MX6 A;  4UWK A;  3NB2 A;  3P2B A;  5CMY A;  2E0I A;  1EF1 C;  3HVE A;  3JYS A;  1INZ A;  4U0Z A;  5LCW C;  3Q47 B;  4H7X A;  1K8K G;  3FTX A;  3PEU B;  1IHG A;  2CHZ A;  5CRV A;  3MKQ B;  2WXG A;  1UN8 A;  4J8S A;  4EZJ A;  3CVV A;  1LD8 A;  1D8E A;  2IU1 A;  3L6A A;  3SF4 A;  4FJY A;  4PUC A;  4ANU A;  2P9L G;  2E2E A;  4GTQ A;  3CHQ A;  4J0U A;  4YDY A;  3TWS A;  2V5F A;  5JJ7 A;  4JZY A;  1N4Q A;  4BX9 A;  4L2L A;  3L9T A;  3CV0 A;  3QAR A;  3S7B A;  2HE0 A;  3C3O A;  5DIZ A;  1QNF A;  3FUJ A;  4C0M A;  1AP7 A;  4XI9 A;  2WXO A;  4URK A;  5ARF A;  4RLY A;  3SGH A;  5ARG A;  4NRH B;  4OVV A;  1Z3Y A;  4JXT A;  4XE0 A;  3LS8 A;  4BSZ B;  5BUZ A;  5HS0 A;  3IHY A;  3LDZ A;  3ZPJ A;  3KAE A;  3Q49 B;  3D9J A;  3SFZ A;  3D9I A;  4IUL A;  3RJV A;  5KWD A;  4I1O B;  3E4B A;  4JA9 A;  1H6K A;  3JQ0 A;  2WXR A;  2EIL E;  1IYG A;  4GML A;  1MHQ A;  3EIQ C;  3LEW A;  2MHK A;  3PZ4 A;  5B3S E;  3HRA A;  2R5S A;  3FUK A;  4JHK A;  1K3Z D;  1TN8 A;  2XS1 A;  1FVF A;  5JJT A;  2V5Q C;  2H6I A;  3JUI A;  4J8F A;  3NOG D;  5FQ8 A;  2DVW A;  1NL4 A;  4FHJ A;  2LNI A;  2VSX E;  4LSZ E;  1BD8 A;  2CG2 A;  1H6P A;  1TYQ G;  4JHR A;  1HXI A;  4ILG A;  5HKP A;  3DSW A;  3FTS A;  2RFA A;  2X6H A;  3QDN A;  2XPI A;  1ZBP A;  4U04 A;  2I9C A;  4EZK A;  1FVH A;  1PC2 A;  3QKY A;  1HG5 A;  4APO A;  4MRU A;  4E85 A;  4JL0 A;  5A7D B;  1N11 A;  3ZU7 B;  2Y1L E;  3CR3 A;  4Z68 A;  3EDT B;  1ZB1 A;  5AN8 A;  3MKQ A;  1EPU A;  2L6J A;  3C5R A;  3ESK A;  5AAO A;  3DST A;  1JUQ A;  3ESL A;  1N54 A;  3HXE A;  2WXM A;  4B89 A;  3D9N A;  4ACL A;  4B0Z A;  3E37 A;  2JAB A;  5H7P A;  3QC1 A;  5LP0 A;  1H19 A;  4JD2 G;  2VQ2 A;  4I6E A;  1LF8 A;  3AAA C;  3W9G A;  4C48 B;  3MV3 B;  4YVQ C;  3FFL A;  4YDO A;  1HO8 A;  4KZC A;  2OVF A;  4DUI A;  5BXU A;  3FEX A;  3BG1 B;  2X6F A;  3DBS A;  2C0L A;  2FUL A;  2V0P A;  4LUN U;  1S63 A;  3TG4 A;  3EHQ A;  3EUV A;  4K0R A;  3D9K A;  3O48 A;  3FTW A;  1HU3 A;  4N3A A;  4GCN A;  3TWR A;  3DPY A;  3LYA A;  4QFV A;  2GRQ B;  4F1P A;  1N4S A;  3EHR A;  2PZI A;  4RSY A;  1GW6 A;  3LKU A;  4U95 D;  5FZS A;  5FIN A;  4QQI A;  4YDE A;  3AS4 A;  2R17 C;  1TJF A;  4HS2 A;  5G05 J;  1ZU2 A;  3FY4 A;  4CGW A;  3B7T A;  4G26 A;  3ML9 A;  2CFZ A;  1QZ2 A;  4JC8 A;  3SBT B;  2XEN A;  4U8V D;  4WWP A;  2MRI A;  4ILH B;  4AY5 A;  4DRX E;  3B7U X;  3NOC D;  4I9C A;  3D9H A;  2WXP A;  3B7B A;  3UX4 A;  3UT7 A;  4OVU A;  4TXR A;  5LFA A;  3C98 A;  4GTP A;  3UIO C;  2WMN A;  5ENP D;  5G04 J;  2PM7 A;  1BI8 B;  3UM1 A;  1TN7 A;  2L9B A;  4EQF A;  4UQY A;  2OVB A;  3BQO A;  2FO7 A;  4CT4 A;  3SI5 A;  2I1J A;  2VSN A;  2ETB A;  2IOS A;  1TNZ A;  3MX3 A;  1KLX A;  2QC9 A;  5DBK A;  3L13 A;  1E7U A;  3G2V A;  4ANV A;  3OTN A;  2H6G A;  2DBA A;  2J49 A;  2EIN E;  3RO3 A;  2XEE A;  3DSU A;  2LAI A;  1E8W A;  3AJI A;  5CCL A;  3PE4 A;  3DEP A;  4TRQ A;  2RD0 A;  2WXN A;  3C3R A;  3Q73 A;  4TV3 A;  3J5P A;  3RAU A;  4CYM D;  4TXQ A;  5EIL A;  2AXU A;  5FZQ A;  4B93 B;  1A5E A;  2LAH A;  5LCW J;  3APD A;  4GU5 A;  3UXG A;  2PM6 A;  2X6K A;  4AP2 A;  3FEY A;  4H7Y A;  4W9R A;  2IO3 C;  2WXJ A;  1D9S A;  3AG1 E;  5CMW A;  4CDR A;  3CVY A;  4ABN A;  3LJ3 A;  2WQH A;  4DLQ A;  1HS6 A;  1WDY A;  4XI0 A;  3CLJ A;  1OT8 A;  3ZIM A;  3VLF A;  4GZD A;  4BFR A;  1HX8 A;  1Y6I A;  3DEO A;  3PUK A;  1NP7 A;  5CBN A;  2R2L A;  2P9S G;  1UG3 A;  3ASN E;  3ISM C;  3UT4 A;  3RKV A;  5B1B E;  3LVR E;  3SQV A;  4B8C B;  5CEC B;  3HYM B;  4TUM A;  4XKC A;  3HHM A;  1HH8 A;  5G2N A;  2GW1 A;  4J6I A;  1OWN A;  4KT6 B;  5AAR A;  3QJZ A;  4BT8 A;  2DZN A;  2IO2 C;  5KJM A;  3G2U A;  4A1S A;  5HRY A;  3CVQ A;  1YA0 A;  2LXM A;  3QWP A;  2AWI A;  4UQZ A;  4BT9 A;  2WXL A;  2A5U A;  2ZGG A;  4I1A A;  2KCK A;  3PH0 C;  3G2S A;  4JB8 P;  3CHM A;  1U3C A;  4I6J A;  1BU9 A;  5EKQ D;  5EN5 D;  3NQP A;  2OOE A;  4UUC A;  4JEU A;  4EBA A;  4K5B A;  4J7W A;  3D9L A;  3UM0 A;  2J4B A;  3ULQ A;  1TN6 A;  1KZO A;  2CHW A;  2J09 A;  3ZYQ A;  4L7T A;  2P9U G;  2GRP B;  2AVP A;  3ZXS A;  1OUV A;  3QNK A;  4Q69 A;  3FUI A;  4DPR A;  4I17 A;  4NAC A;  4CGV A;  2YNQ A;  2Y4T A;  4GYO A;  5EID A;  1U2V G;  3S7J A;  3MGB A;  4BTA A;  3S2A A;  4I1M A;  1TNO A;  5M72 A;  3RIB A;  2AXZ A;  3J5Q B;  3ONK A;  1U3D A;  2I6H A;  1H2U A;  3TXN A;  4NQ0 A;  4A1G A;  2KC7 A;  2IEJ A;  4DX1 A;  4JPS A;  1OCR E;  3NAW A;  1OWO A;  2YQ8 A;  5AQ7 A;  4HB5 A;  3UPV A;  4HLE A;  4LER A;  4TUU A;  1OWL A;  4R7L A;  3CK7 A;  2WQ7 A;  3ZVV A;  4WWO A;  3UTM A;  5KJK A;  1X5B A;  3PRZ A;  5KNG A;  3X2Q E;  3OXL A;  4XEI G;  3VTY A;  5FIO A;  3ABL E;  3WXX A;  3SHF A;  4HI9 A;  3SFY A;  2JEK A;  5C1D A;  3DXK G;  4GMR A;  4FHK A;  2WMO A;  1N9A A;  5EDS A;  2L0T B;  3PS6 A;  2WXH A;  5D0Q D;  2EQX A;  1OY3 D;  1Q2Z A;  3QAQ A;  4CEM A;  2VGE A;  2DIW A;  5EYL A;  4ILI A;  3UMV A;  1O1S A;  3GZS A;  4HXI A;  1MX4 A;  3LCA A;  3PDN A;  1HE8 A;  2KM4 A;  3JQ1 A;  3G2T A;  2C0M A;  4RG9 A;  5C2Y A;  2J07 A;  2R05 A;  1E90 A;  3Q7F A;  4KZ0 A;  4U07 A;  3V79 K;  4L9P A;  4N2S A;  3CKB A;  2RG8 A;  2QZA A;  4N3B A;  4XIF A;  3UM2 A;  1HZ4 A;  2IOL A;  1JCQ A;  3IXE A;  3RRN B;  5D66 A;  1Z6T A;  4GTM A;  3CHP A;  3APF A;  3U64 A;  5A23 A;  1HG2 A;  1SZ9 A;  3UUX A;  3ZW3 A;  4FC8 A;  4HFG A;  4N5Q A;  3UM3 A;  5AJL A;  3KD7 A;  4HOS A;  3IKO B;  2J8S D;  4GZ5 A;  3RO2 A;  5FTP A;  3IV0 A;  4GA2 A;  4UWG A;  4UWL A;  4AVX A;  5EYP F;  2HO1 A;  4LRZ A;  2HM8 A;  2P9P G;  4G23 A;  4GTR A;  4U96 D;  1TR4 A;  2VTB B;  3V2O A;  1YYH A;  3ZKJ A;  3LY9 A;  2L6B A;  2OCC E;  1IXV A;  4GA0 A;  4C9B B;  4HRL A;  3OXG A;  1VDY A;  3ZNG A;  4ME2 A;  5HI7 A;  3HVE B;  2A5E A;  2IQC A;  4DI4 A;  4WNF A;  2X6I A;  4HOU A;  3MZL B;  5BXO A;  2FBN A;  3CHS A;  3FU6 A;  2Y0B G;  4HI8 A;  3HXB A;  3L22 A;  2V4H C;  1O5M A;  1E8X A;  1A17 A;  4HNA D;  3FU5 A;  1Z3X A;  3V2X A;  1RW2 A;  3SBS A;  3L08 A;  4BSX A;  3E33 A;  3FUF A;  4O1O A;  4KVO A;  1SVX A;  5AYW D;  3Q75 A;  3ENE A;  4DX7 D;  3FUM A;  4F6R D;  3OAW A;  3APC A;  2F8Y A;  4BET A;  1H2T C;  3L82 A;  3Q7A A;  1K1A A;  2UY1 B;  3LPZ A;  4I2Z A;  3VLE A;  2X6J A;  2V8S E;  3G2W A;  5E75 A;  3ZYM A;  4CDM A;  4GZ6 A;  1RZ4 A;  4FA6 A;  2UY1 A;  4XZ4 A;  3ZYL A;  1DC2 A;  1BI7 B;  4B94 A;  2R03 A;  3FP3 A;  3CK8 A;  3EU5 A;  4ATZ D;  3ASO E;  3ONL A;  3LJN A;  4OAV B;  3TG5 A;  4FJZ A;  3RSE G;  4N39 A;  2A4Z A;  2NC9 A;  4V3I A;  2VGX B;  3PRE A;  4U8Y D;  3CVX A;  3UT8 A;  4A63 B;  2IY0 C;  4J8Y A;  3EJN A;  3HXF A;  3GW4 A;  4LNU D;  3OXF A;  4YVO A;  3NBN B;  2MYO A;  3JXI A;  3T5V A;  2KCV A;  2F0Y A;  3ZHE B;  2PQN A;  4FUL A;  5EX0 A;  5AIJ A;  4HOQ A;  4G1T A;  3SD5 A;  2XQ0 A;  3ASD A;  2Y3A A;  1N94 A;  3CGH A;  4J8D A;  3K9I A;  2V4L A;  4FP7 A;  1NZN A;  3EHM A;  3QB2 A;  1OWM A;  2I2O A;  4KYO B;  3ZFW A;  2VSY A;  1MX2 A;  2LUH A;  3ZEF A;  3SO8 A;  5G05 C;  4ANX A;  3W9F A;  3ULE G;  4IYP A;  4EHM A;  4JA7 A;  3U9W A;  5G04 C;  1WAO 1;  2GRR B;  4DLO A;  3E32 A;  2KCL A;  4Q94 A;  4PS7 A;  2H6H A;  4GTV A;  3ASG A;  3FUL A;  4HRN A;  3AS8 A;  1JPL A;  4EPZ A;  4O1P A;  2C2L A;  3Q9U C;  3ZXP A;  3T8K A;  1H6O A;  3CQC B;  1NI1 A;  2FEZ A;  3Q9N C;  2J08 A;  3Q78 A;  1XGW A;  4JW1 A;  2OEW A;  3RRM B;  4BWR A;  2BKG A;  2BTD A;  4EZL A;  2BED A;  1H2V C;  4M3O A;  5FQ6 A;  1LD7 A;  1D8D A;  3SZ7 A;  5FQ4 A;  2LSV A;  3FUD A;  3PZ2 A;  5BT1 A;  3U3W A;  3GZ1 A;  4JEH A;  5HQ8 A;  3BU8 A;  1HF8 A;  5ANL A;  4CDN A;  3LVQ E;  4AEZ C;  4L1B A;  3ZGQ A;  1E7V A;  2YHC A;  4U8H A;  3Q79 A;  2ETC A;  4GA1 A;  2EIK E;  2KAT A;  3T8M A;  3HDX A;  3KSL A;  5FJY A;  3PVL A;  2DZO A;  1S70 B;  3FTZ A;  4G8L A;  3AS5 A;  2FF4 A;  4U7E B;  3S7D A;  5AQB A;  3DRA A;  3I5P A;  4AM9 A;  3TJP A;  3DPD A;  3P1U A;  2ETA A;  4U63 A;  4WWN A;  4F7A A;  1BPO A;  2NSZ A;  3IHV A;  2X38 A;  2CFU A;  2Y69 E;  1DCE A;  2ION A;  4UI9 C;  5ANR A;  3S7F A;  4RVB A;  3AG2 E;  1OXJ A;  4NUR A;  4CT0 A;  4RG6 A;  3JUE A;  5BV0 A;  3R7Q A;  4KVM A;  2OV8 A;  5T4Y A;  2XGO A;  3EHN A;  4HBD A;  2XZD G;  3U66 A;  3RK6 A;  4AIF A;  4F1S A;  1QYM A;  3FU3 A;  4P29 A;  3DSV A;  4FLH A;  4LG6 A;  2HR2 A;  4GMJ A;  5CED B;  4UQX A;  1H0A A;  2WXI A;  5CEA A;  4WAF A;  1XNF A;  3GZ2 A;  3FTV A;  4UI9 K;  3FU0 A;  3B13 A;  4Y6W A;  4DJA A;  3R9A B;  1ELW A;  3WG7 E;  2XZT G;  3ZRH A;  1QQE A;  3CVN A;  5FT9 A;  5G55 A;  3NZS A;  3E34 A;  4D10 C;  1DVP A;  5A6C A;  4ATG A;  3UKR G;  3E30 A;  4I6G A;  3FH5 A;  4N3C A;  3FTU A;  2DCP A;  2CHX A;  2PNN A;  3T9K A;  2ZU6 B;  4XKB A;  2P9N G;  3MEK A;  1UJJ A;  1EDU A;  4FU3 A;  3ZYK A;  2ZIS A;  1V54 E;  5BNW A;  5B1A E;  4F3V A;  1PY1 A;  4PS3 A;  4HLL A;  5D0O D;  1OCO E;  4KMO A;  3QWW A;  1E8Y A;  4U0U A;  3TGO A;  3HG0 D;  4GAA A;  3FH7 A;  4IRU A;  2P2C P;  3BG0 B;  3VLD A;  4DI3 A;  3QOU A;  4CZ2 D;  3UQ3 A;  1X81 A;  3JXJ A;  3C72 A;  4UI9 J;  3DSX A;  1N0Q A;  2B6C A;  4APF A;  4HQD A;  3PNT B;  1K1B A;  3ABM E;  5BV1 A;  1P5Q A;  2P9I G;  4ZFH A;  3RU0 A;  2LXL A;  3TWV A;  3PZ3 A;  1MZC A;  2QYJ A;  2X3M A;  5FZR A;  4MLP A;  1SA4 A;  1UW4 B;  1AWC B;  3PNL B;  2MOW A;  2VGX A;  2WM9 A;  1MYO A;  4WND A;  1N95 A;  2P9K G;  2F37 A;  4G24 A;  4KBQ A;  5KCM A;  3FUH A;  2DYR E;  3UKU G;  3FUE A;  4B8A A;  1EYH A;  2BKK B;  3SY2 A;  3F6Q A;  4TXP A;  1WM5 A;  4ANW A;  4G11 A;  5ENS D;  3FDH A;  3ZUV B;  1KT1 A;  4WNE A;  4HOT A;  2WXK A;  3MYV A;  2VSO E;  5JHB A;  1V55 E;  3MV2 B;  4XX5 A;  4UWH A;  3L17 A;  4JHJ A;  1SA5 A;  5EIB E;  3D9P A;  1ELR A;  1MJ0 A;  2Y4U A;  3PZD A;  1WY6 A;  3CSF A;  5AEN A;  5BW8 C;  1YMP A;  1Y8M A;  2XGS A;  2M63 A;  5AJD A;  4GCO A;  2YIN A;  3N71 A;  2AXV A;  3BEE A;  3CST A;  3ABK E;  2XRZ A;  5JHA A;  4HOR A;  4O6F A;  3UI2 A;  3O4Z A;  2OEV A;  1WG0 A;  1DCQ A;  2VJ8 A;  3KEZ A;  3PZ1 A;  1IQU A;  2VGY A;  3ZHE A;  2RFM A;  3URZ A;  2I1K A;  1JCS A;  3KEA A;  1HFA A;  1NFI E;  2NXP A;  3MKR A;  1PAQ A;  3B95 A;  1W3B A;  1SZA A;  4GTT A;  1UN9 A;  4L23 A;  4DX2 A;  1ELK A;  3CHO A;  3TWT A;  4FAD A;  2JLB A;  3TWQ A;  2FI7 A;  2DWZ A;  2L0I A;  1SW6 A;  5AQA A;  3FH8 A;  4X8Q A;  4A55 A;  3LXU X;  2ILR A;  1FPP A;  2GGF A;  4GYY A;  5CRU A;  4F53 A;  4YDW A;  1BLX B;  3NZU A;  5FQ7 A;  2XPY A;  4L2Y A;  4BER A;  2VYI A;  4LCT A;  2GRM A;  4BES A;  3KSQ A;  2GRL A;  2XS8 A;  3SFX A;  2DYS E;  3ML8 A;  5FWQ A;  3R9M A;  1MQS A;  5CER B;  2IFU A;  2KXP C;  3GYZ A;  1N52 A;  3R7R A;  1L5J A;  3EIJ A;  4EEC A;  3IEG A;  4HRM B;  4K5C A;  1OWP A;  2XEH A;  5ENT D;  4K03 A;  1TNB A;  3I4G A;  4PDX A;  5T8I A;  4RQI A;  4WNG A;  3HXD A;  4MBG A;  3TWW A;  4G25 A;  5ENO D;  4DX5 D;  4C0E A;  1Z5S C;  3ASH A;  5D2M C;  3DSS A; 
#chains in the Genus database with same CATH homology
 3IXE A;  4HB5 A;  1NFI E;  4ZFH A;  4HNA D;  2FO1 E;  3NBN B;  4B93 B;  4NIK A;  3TWV A;  1A5E A;  4F1P A;  5D66 A;  2MYO A;  3EHR A;  3B95 A;  4ZHB A;  3JXI A;  2QYJ A;  3V30 A;  3V2X A;  5JA4 D;  5KNH D;  2XZT G;  4U95 D;  4YDY A;  3TWS A;  2ZGG A;  5FIN A;  5ITZ F;  1AWC B;  4DX2 A;  4JB8 P;  3UXG A;  4QQI A;  3UTM A;  3TWT A;  2B0O E;  1BU9 A;  5EN5 D;  4O1O A;  1MYO A;  1N11 A;  4N5Q A;  1SVX A;  2HE0 A;  3TWQ A;  3ZU7 B;  1AP7 A;  1D9S A;  2DWZ A;  2F37 A;  2Y1L E;  4DX7 D;  1SW6 A;  4G8K A;  4UUC A;  5AQA A;  2J8S D;  4Z68 A;  1YCS B;  5KNG A;  4F6R D;  2XEN A;  2ETC A;  4U8V D;  4RLY A;  5AN8 A;  4K5B A;  4K5A B;  1N0R A;  1WDY A;  2BKK B;  2F8Y A;  3C5R A;  4J7W A;  4GPM A;  2DZO A;  5AQ9 A;  5FIO A;  3F6Q A;  4DRX E;  1S70 B;  4BET A;  4YDW A;  4BSZ B;  1OT8 A;  1BLX B;  5AAO A;  4HI9 A;  2PNN A;  3NOC D;  4G8L A;  1MX2 A;  2AJA A;  4BER A;  5ENS D;  5HS0 A;  1K1A A;  3T9K A;  5AQB A;  5EYP F;  4BES A;  3D9H A;  2NYJ A;  3DEO A;  4GMR A;  3ZUV B;  5KBA A;  3SO8 A;  4OAU C;  3B7B A;  5CBN A;  2ETA A;  3W9F A;  2JAB A;  4U96 D;  1IKN D;  3TWX A;  5KWD A;  5ENR D;  1TR4 A;  3V2O A;  5ENP D;  5CER B;  2KXP C;  1YYH A;  1BI8 B;  1OY3 D;  1UOH A;  3TWU A;  3AAA C;  3W9G A;  3ZKJ A;  5CBO A;  4C48 B;  5EIB E;  4HLL A;  2KBX A;  4HRM B;  2VGE A;  1BI7 B;  2L6B A;  5EYL A;  2F8X K;  1DC2 A;  4K5C A;  4O60 A;  4DUI A;  5BXU A;  5CEC B;  2ETB A;  3JUE A;  5JMN D;  2XEH A;  1MJ0 A;  5ENT D;  1IXV A;  4DX6 D;  1MX6 A;  4HRL A;  4TUM A;  5EID A;  1MX4 A;  1YMP A;  3HG0 D;  4ATZ D;  3ZNG A;  3HRA A;  2QC9 A;  3EHQ A;  1K3Z D;  4HRN A;  2A5E A;  5AAR A;  4HBD A;  2P2C P;  2XZD G;  3LJN A;  2DZN A;  1IHB A;  4O1P A;  4CZ2 D;  4OAV B;  5ENQ D;  2V5Q C;  1QYM A;  3Q9U C;  3V79 K;  3TWR A;  3JXJ A;  3T8K A;  4LG6 A;  2XEE A;  3TWW A;  3NOG D;  3J5Q B;  3V31 A;  5BXO A;  3UI2 A;  5HRY A;  3AJI A;  3Q9N C;  2Y0B G;  2ZGD A;  1WG0 A;  1DCQ A;  2DVW A;  3DEP A;  1N0Q A;  4QFV A;  5ENO D;  4LSZ E;  4DX5 D;  1BD8 A;  5CED B;  4U8Y D;  4HI8 A;  4HQD A;  2BKG A;  5HKP A;  5CEA A;  4A63 B;  2V4H C;  3EU9 A;  3J5P A;  4CYM D;  1G3N B;  2RFM A;  2RFA A;  4J8Y A;  4BEP A;  4DX1 A;  5EIL A;  3KEA A;  1K1B A;  4LNU D;  5AQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...