3NOCD

Designed ankyrin repeat protein (darpin) binders to acrb: plasticity of the interface
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
154
structure length
154
Chain Sequence
DLGKKLLEAARAGQDDEVRILMANGADVNARDFTGWTPLHLAAHFGHLEIVEVLLKNGADVNAKDSLGVTPLHLAARRGHLEIVEVLLKNGADVNASDSHGFTPLHLAAKRGHLEIVEVLLKNGADVNAQDKFGKTAFDISIDNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acriflavine resistance protein B
publication title Designed ankyrin repeat protein binders for the crystallization of AcrB: Plasticity of the dominant interface
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein/protein binding
total genus 41
structure length 154
sequence length 154
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3nocD00
2F8YA 1BI8B 5AAOA 4O1OA 2ETAA 2F37A 1BD8A 4HI9A 4U8YD 1SVXA 1WG0A 4OAUC 2ZGDA 4UUCA 4BERA 1SW6A 3Q9UC 5ENRD 3NOGD 4ATZD 4K5CA 4F6RD 1AWCB 1DCQA 4DX5D 3TWVA 5AQAA 4QFVA 4BESA 5HRYA 4HBDA 2B0OE 1MX6A 4RLYA 4CYMD 3DEOA 5CERB 2Y0BG 5ENSD 2FO1E 2VGEA 2XEEA 3V2XA 4DX2A 4HNAD 3V31A 1IHBA 2DZOA 2J8SD 4DX7D 2Y1LE 4HB5A 4TUMA 5EYLA 1K1BA 3DEPA 4G8KA 5AQBA 3W9GA 3ZUVB 5BXUA 1OY3D 2V5QC 4GMRA 1D9SA 3TWXA 5KBAA 3LJNA 2DZNA 3UI2A 1A5EA 5D66A 2XZDG 5HS0A 4U95D 1BU9A 4JB8P 1NFIE 4HLLA 2KBXA 5ENPD 1BI7B 5KNHD 4HRMB 4BEPA 4C48B 1QYMA 2A5EA 3J5PA 3TWSA 5BXOA 2ETBA 3TWWA 1MYOA 5EIBE 4N5QA 5ENQD 3B7BA 5AARA 3JXJA 1N11A 2P2CP 3NOCD 5ENTD 3HG0D 4O1PA 3IXEA 4G8LA 4J7WA 1S70B 5KNGA 2BKGA 3TWTA 4BETA 4DX6D 2NYJA 4YDWA 1WDYA 2F8XK 5CBNA 4DX1A 4DUIA 4NIKA 1IKND 5FINA 4GPMA 3ZNGA 3NBNB 5EN5D 1DC2A 3JUEA 5EILA 2V4HC 3TWUA 5JMND 4DRXE 1MX2A 4OAVB 1AP7A 5EYPF 4LNUD 3TWRA 1N0RA 3UXGA 5AQ7A 3F6QA 4Z68A 2DWZA 1TR4A 2QYJA 3HRAA 4LG6A 1YCSB 4CZ2D 5AQ9A 1OT8A 3TWQA 1K3ZD 3D9HA 5CECB 5CEAA 1BLXB 1IXVA 2BKKB 2ZGGA 4LSZE 5EIDA 5AN8A 5HKPA 3UTMA 4F1PA 5ITZF 2AJAA 3SO8A 5JA4D 1YMPA 4ZHBA 3AAAC 2MYOA 1MJ0A 4HQDA 2RFMA 3AJIA 3C5RA 2XENA 4J8YA 3ZKJA 3ZU7B 4B93B 3JXIA 2XZTG 3J5QB 4QQIA 4O60A 2PNNA 4HRNA 4U96D 3V79K 4A63B 3KEAA 3V30A 4K5AB 1UOHA 2HE0A 3EHQA 3W9FA 5ENOD 4ZFHA 4BSZB 2XEHA 2DVWA 2QC9A 4HI8A 4HRLA 2KXPC 3T9KA 2RFAA 4YDYA 1G3NB 1YYHA 3EU9A 2L6BA 4K5BA 2ETCA 1MX4A 5KWDA 4U8VD 3V2OA 5CBOA 1N0QA 3Q9NC 3T8KA 5CEDB 2JABA 1K1AA 3EHRA 5FIOA 3B95A
chains in the Genus database with same CATH superfamily
3NQPA 4O1OA 2GW1A 5KJKA 2RD0A 1NA0A 3CGHA 3FUMA 3CQCB 2VJ8A 2UY1A 4NURA 2FULA 3PZ1A 4DPRA 3SFXA 2Y0BG 2FO1E 4HORA 3UT4A 4KT6B 1TNUA 4PUCA 5FZSA 3FTYA 1D9SA 3SGHA 3SNXA 3ABLE 4JHKA 4DLOA 1BPOA 1LD8A 1DNPA 4FC8A 5T4YA 4PS8A 4N5QA 3UIOC 4TXRA 3JXJA 5ENTD 3E34A 4O1PA 1WDYA 3FULA 5AJLA 3Q7FA 4NIKA 1O1TA 2WXJA 2V4HC 1Z3XA 4F3VA 4OAVB 3CK8A 5EYPF 2EIJE 4GZDA 2ONDA 3QOUA 3WXXA 4U0UA 1K3ZD 1KT0A 4XI0A 1TNOA 4XIFA 2AJAA 3ULYA 2ILRA 3SI5A 4CGWA 3ISMC 1B89A 2PQNA 4BSXA 3ESLA 3FWVA 1EYHA 4UI9K 3MJWA 3DRAA 4ZFHA 3NB2A 2GRMA 2KXPC 3G2SA 1WAO1 2L6BA 3Q73A 1N0QA 5ARGA 3T8KA 3EHRA 5FIOA 3VLFA 4K0RA 4FJZA 1WG0A 4B8CB 1LTXA 4I17A 3FTXA 5ENRD 4FJYA 2I6HA 4FLBA 4EBAA 5D2MC 2Y4TA 3AU5A 2J4DA 2C0LA 3LY8A 2NC9A 3G2UA 1U3DA 1IHBA 3MV3B 4HB5A 4HXIA 3D9IA 3ZUVB 1EF1C 1N94A 1E90A 3ZN3A 1H6OA 5HI7A 3RSEG 4N5CA 1HG2A 2R2LA 1S0PA 1X5BA 4GMLA 1HU3A 3PUJA 1TN8A 3Q75A 3DSWA 3TWSA 5LFAA 3UKUG 3BU8A 3EHNA 4G24A 3S7JA 3QWPA 5B1AE 1N4PA 1Z5SC 4G2VA 3IKOB 4R7LA 2ZXWE 4JHRA 2QYUA 3MX3A 2VSOE 3FUHA 2WVIA 4U8HA 4ANVA 4ATGA 4OVUA 3LJ3A 2KCKA 1OT8A 3FY4A 4UQYA 3R7RA 3UTMA 2GGFA 4LSZE 5JHAA 5KJMA 3UM0A 2P9UG 4YVOA 3MKRA 1JCRA 3SZ7A 2XENA 4YNDA 1SZ9A 2R17C 4J8EA 3FTVA 3CHRA 4ACLA 3HXCA 2HE0A 4M7CA 1NP7A 4HOUA 4HRLA 3T9KA 4I2WA 4C0MA 4ANWA 4K5BA 2E2EA 4BFRA 3ML8A 3L08A 3ASOE 3PS6A 3HDXA 3PEVB 4H7YA 4K5CA 3TWVA 5HRYA 3DXKG 5DBKA 1H6KA 4A1SA 3FUNA 1EDUA 3ABKE 2VGEA 4LNGA 4B8AA 3V31A 3U4TA 5JHBA 1X81A 4ABNA 4ACKA 2WXNA 3QC1A 4N2SA 2V5QC 3T5XA 4J6IA 3CHMA 2P9KG 4N39A 3O4ZA 3ULQA 4L7TA 1O1SA 2IQCA 4CDNA 2WQ6A 1H6PA 4JHJA 3EUVA 3SHFA 2QY7A 4AV7A 4AEZC 3ZEFA 1UJKA 2Y4UA 3PUKA 2XGMA 2P58C 2ZIRA 4WUYA 4MKTA 3F6QA 2DWZA 4FP7A 3SQVA 5KJNA 3GZSA 4XZ4A 5AN8A 2PZIA 5HQ8A 2I2OA 4I43A 1MJ0A 4A3VA 3AJIA 3UM2A 3DSXA 3EDTB 3KS2A 3RRNB 4Y6CA 5CCMA 3KEAA 4BTBA 3EHQA 2PQRA 3W9FA 4F53A 1L5JA 1YYHA 4UQXA 2XS1A 2XQ0A 2DYRE 2MHKA 3UINC 3ZPJA 5IY5E 2F8YA 4TXQA 2X6HA 2GROB 5G05J 3PRZA 5BUZA 3RRUA 2VGXA 5AQAA 3LPZA 2JEKA 1P5QA 4CDMA 4URKA 3DSTA 1A17A 4RG6A 3PH0C 3AG3E 4JEHA 4I6GA 2PL2A 1K1BA 3NZUA 4U0SA 2CFZA 3JUIA 4GMRA 3TWXA 5KBAA 2KC7A 3GYZA 3TG4A 3KEZA 1HO8A 4UWLA 5HS0A 1UJJA 1V55E 3RO3A 4ME2A 4GZ5A 3L16A 2CFUA 3QNKA 4JL0A 4DK5A 1FT2A 1KT1A 1WY6A 2UY1B 3NOCD 3FUEA 2H6HA 4BETA 2BKGA 4U63A 3ZHEB 4G11A 1JCSA 1N4RA 4LUNU 4PS7A 3ZNGA 2LSVA 4DRXE 2Y3AA 4LNUD 3LVRE 3C98A 3FP3A 3TWQA 4AIFA 4A55A 1IHGA 5CECB 1HFAA 4G23A 4JA9A 4HQDA 2XGSA 4JA7A 4M3OA 3RJVA 4OVVA 1D8EA 3J5QB 4X8QA 2CG2A 4WNDA 4N3CA 2JLBA 2OVFA 1MQSA 4GTMA 1DVPA 4ANUA 4AVXA 4GTVA 5ARFA 4HOSA 5FT9A 3CHSA 5FINA 3D9LA 3ML9A 5AAOA 4IYPA 3Q15A 4U04A 4L2LA 3I5PA 2FEZA 4MS6A 3Q9UC 4RSYA 2V8SE 3CSTA 2VTBB 5T3RA 1DCQA 1SA5A 3ESKA 2RG8A 3FUDA 5G04J 1H0AA 3FH5A 2DZOA 4ILHB 4L1BA 3UM3A 1FVFA 1MZCA 3FU3A 3ASDA 1EPUA 4UWFA 3MYVA 4I9CA 4EPZA 2I1JA 3IEGA 1OWLA 3VLDA 4GYYA 1SA4A 2L6JA 5AARA 3TG5A 4FA6A 3TWTA 4G8LA 1W3BA 3S7FA 4D10C 5EN5D 3JUEA 5EILA 3FU5A 3C3QA 5E75A 3D9HA 2OV8A 3FEYA 4NACA 3D3MA 3B7SA 4XX5A 3LCAA 3RU0A 2R02A 3FHEA 1TN6A 4I6JA 4GZCA 4HI8A 2RFAA 4CGVA 5G05C 2L0IA 5LP0A 2WQHA 4Y6WA 1IQUA 4CYMD 5BNWA 2YINA 1BD8A 2CHZA 2X3MA 3AS5A 4BERA 2E0IA 2PM6A 2V4LA 1AWCB 4RVBA 3D9PA 1HF8A 4GA1A 3Q49B 1UG3A 2AWIA 3ABME 3OTNA 3PREA 3PNTB 4Q69A 1HH8A 4HVBA 4WNFA 4GTTA 5D66A 2I9CA 4HLLA 2WXLA 2DCPA 1FT1A 3AS8A 5FTPA 4TXPA 5FQ8A 1N11A 5KNGA 2OEWA 3K9IA 4G25A 4DX1A 3AU4A 4GYWA 4KYOB 4OYSA 4JC8A 3T5VA 4MBGA 5EIDA 5ITZF 4GMJA 2MYOA 3ZU7B 2XZTG 3R9AB 2J09A 2VSYA 4U96D 1OCOE 2BEDA 1TNBA 3ONLA 2XRZA 3G2WA 3Q5MA 4JZYA 2R05A 5ANRA 2MRIA 1V54E 5G04C 5T8IA 2Q7FA 4RG9A 3DWLG 3CIAA 4I2ZA 5JJTA 3RK6A 4DI3A 5G2NA 2VGYA 3LVQE 4UQZA 4G8KA 3LKUA 1U2VG 1OWNA 3DPDA 4XE0A 3UI2A 3LY9A 3OXGA 5BT1A 3TXNA 4GYOA 2ETBA 1E96B 3JQ1A 1H2VC 1TJCA 4CT0A 3CVQA 1TNZA 5JJ7A 2VGXB 3CHQA 4TRQA 3ZXSA 1IKND 5JMND 3HXBA 4N3BA 2EILE 1O5MA 4I6EA 1U3CA 5ENNA 2X6KA 2WXRA 1OCZE 3ZRHA 4MRUA 5LOZA 1SQMA 4A63B 5ENOD 4XKCA 2QC9A 2J07A 2R03A 2V0PA 4F7AA 2WXPA 5KWDA 1TNYA 3AG4E 1OWOA 3UM1A 2LXMA 2V5FA 3APFA 4KZ0A 5FQ6A 3BEEA 2YHCA 2GRLA 3CKCA 3FU0A 3ASHA 3AG1E 5EX0A 2KCLA 2IONA 3KAEA 5ENSD 3CVVA 1QZ2A 3FH8A 4DX7D 3EJNA 4PDXA 1JPLA 3LEWA 2VSXE 5AQBA 4L23A 1HS6A 4WAFA 3EIQC 4HRMB 3J5PA 1MHQA 5EKQD 2WB2A 3EU5A 3B7BA 4TUUA 3HHMA 3MCXA 4HFGA 4A3TA 2RKKA 2F8XK 3DSVA 1E8ZA 4DUIA 3FH7A 3CVUA 2OCCE 1OXJA 4C9BB 3NBNB 1H19A 5AQ7A 4LG6A 3QARA 1NZNA 5CEAA 2BKKB 2ZGGA 5CRVA 1VDYA 5D0OD 2RFMA 3C5RA 2LNIA 1ELWA 1Q2ZA 3MZLB 1Y8MA 4WWPA 2XCCA 3FTWA 4J0UA 2DVWA 2C2LA 3IHYA 1G3NB 1KZPA 1UW4B 3QB2A 1MX4A 5CBOA 4TV3A 4GCOA 3S2AA 2HR2A 3HVEA 3Q4AB 4RQIA 1SVXA 2WXHA 3CEQA 4GTSA 3PE4A 2YQ8A 4DX5D 4DLQA 4HS2A 4E6HA 2XEEA 2WXQA 4DX2A 4FU3A 3FUIA 3GZ1A 4EQFA 2J8SD 4LERA 3PZDA 2AVPA 3TGOA 4U95D 2XHEA 4BEPA 4BT8A 3IHVA 5CCLA 1MYOA 3HXFA 2BF0X 3UXGA 3IXEA 2DYSE 1XNFA 4I9EA 2C0MA 5G55A 3FEXA 4ANXA 5ANLA 2IO3C 1TR4A 2QYJA 1N9AA 4BX9A 3CVPA 2WXOA 1N4QA 3UKRG 1UN9A 3E32A 3RO2A 4FLHA 4ZHBA 3AAAC 3JXIA 2HM8A 2XGOA 1Y6IA 5BV1A 2PNNA 4HRNA 4EBAG 4APOA 3AG2E 2F0YA 4K5AB 3LY7A 1H2TC 3S7BA 2XEHA 2FBNA 3IV0A 4WWOA 1HE8A 4HLEA 1E8XA 4DJAA 3QKYA 4DI4A 3UT8A 2JABA 4JD2G 2L0TB 3ULEG 4GZ3A 3Q78A 2F37A 5CMWA 3N71A 3ZYQA 1SW6A 2X38A 4CCAA 3PVLA 4G1TA 4RLYA 2IF4A 4GZ6A 1OCRE 3V2XA 3UMVA 2MOWA 3UUXA 1N54A 4YVQC 3KSLA 2WXKA 4TUMA 1ZU2A 2LSUA 2LO6A 3W9GA 5A6CA 5D0QD 4AXHA 1HX8A 1GW6A 2X6IA 5FZRA 2KBXA 2VSNA 5KNHD 2ZISA 1KLXA 4C48B 4JPSA 2KM4A 2ZU6B 5BXOA 4IN3B 1NL4A 2KZTA 5B1BE 3MKQA 3CHOA 4GPMA 3ASFA 3O48A 5C1DA 5AIJA 1YA0A 4AY5A 2XRYA 2P9LG 3OAWA 1Z6TA 5BPPA 3L6AA 3JQ0A 4XI9A 4GTOA 3MA5A 2H6IA 3CK7A 3HIZA 2H6GA 3NAWA 5CHEE 4BT9A 1S64A 3I3NA 4YDEA 1K1AA 3JCKC 2IEJA 2ETAA 4W9RA 2XCBA 5EDSA 4U8YD 2ZGDA 4GTRA 2I1KA 4YDOA 3BUAA 3DSUA 2B0OE 1D8DA 2EIKE 4G26A 4FADA 4XEIG 4HNAD 4EZJA 2GRQB 3BG1B 5LCWJ 2QFCA 3TJPA 1JWFA 3NZSA 5BXUA 2WXIA 3S7DA 4K03A 3CLJA 3DPYA 3I4GA 2KATA 4CEMA 3B13A 2IU1A 5ENQD 3G2TA 2P2CP 3L54A 3BQOA 2WMNA 3QWVA 3VLEA 1FCHA 2XPIA 3BG0B 3SBTB 4H7XA 3SD5A 4PH4B 2CHWA 3C3RA 5A23A 1IXVA 3MEKA 3G2VA 5KJLA 4KMOA 3C3OA 4B93B 4QQIA 1TEZA 3ZW3A 3CVYA 4LRZA 4B0ZA 2IOSA 3ZHEA 3LYAA 3D9KA 2P9IG 3OXFA 4CRWA 3CK9A 4C0EA 1ELRA 4KXKB 3CR3A 3EHMA 2GRNB 4BX8A 3ZYLA 1RW2A 3KSQA 1E8YA 1N4SA 2X6FA 2BUGA 5LX8A 5JJ6A 2CHXA 2YNQA 3QAQA 4WNGA 5J90A 1MX6A 1JCQA 3PE3A 3L17A 3CSFA 3FUKA 3FUJA 2HO1A 5B3SE 2HYZA 4GCNA 3KD7A 1ZBPA 4KBQA 2P9PG 3UX4A 4J8FA 3ZVVA 2A4ZA 3HVEB 2VTBA 1KZOA 3U3WA 1NI1A 1K8KG 4EZKA 2H6FA 3SFZA 5CBNA 4L2YA 3TWUA 2FI7A 3DBSA 3ZYKA 3GW4A 3QWWA 3ZYMA 1OWPA 2OEVA 5AQ9A 5H7PA 3R9MA 1NA3A 4EZLA 3CKBA 3VTXA 2AXVA 3HYMB 3Q7AA 1TYQG 3ZFWA 4JEUA 2L9BA 4WWNA 4CDRA 3UQ3A 2NSZA 2ETCA 3R7QA 1LF8A 2IJGX 3CVWA 4GU5A 3ASGA 1INZA 4U7EB 5FJYA 3Q47B 3D9JA 3PZ4A 3E33A 1LD7A 2WXGA 4GTQA 3NF1A 3NOGD 4ATZD 4JVSA 4F6RD 5LCWC 4QFVA 4N3AA 1PC2A 4GTPA 3DEOA 3ZIMA 2DIWA 4V3IA 2WXMA 5BV0A 1QNFA 2IO2C 5CMYA 2R59A 2X6JA 4AM9A 3SY2A 3DEPA 4NRHB 3TL5A 2QZAA 4A1GA 2J49A 3FDHA 2LXLA 1NFIE 4NQ0A 1BI7B 1QYMA 2XEVA 4UWKA 3TWWA 2J9QA 5M72A 3ZXPA 3D9NA 4J7WA 3HXEA 3Q79A 1IQRA 1JUQA 2VQ2A 4P29A 4AY6A 3B7TA 2BTDA 4GB9A 4HOTA 2WQ7A 2AXZA 3E37A 2PM7A 4O6FA 2LAHA 3TAXA 1HZ4A 3ONKA 3GZ2A 1YMPA 3UIPC 3RRMB 1UN8A 1FVHA 5FZQA 5BW8C 4KZCA 1UOHA 3LDZA 3E4BA 4IRUA 4BSZB 1E7UA 2KZTB 4BY6A 1E7VA 3MKQB 4U8VD 1ZB1A 1QBQA 3I4RB 3V30A 1A5EA 5AYWD 3B95A 1BI8B 3CHPA 4HI9A 4OAUC 3PDNA 1IYGA 3FU6A 3FTZA 1Z3YA 3B7UX 4BESA 4KVMA 3UPVA 2GRRB 5A7DB 3URZA 4LNBA 4LEUA 3APCA 3CV0A 5CRUA 3EIJA 2Y1LE 5EYLA 3DXMG 4L9PA 3TXMA 1OY3D 3U64A 3LJNA 1OCCE 2DZNA 3PZ2A 4GPKA 1N95A 1N52A 5ENPD 4UWHA 5AJDA 4AJWA 3AS4A 3PNLB 4U0ZA 4MLPA 5EIBE 3QK0A 1PAQA 2WXFA 3PZ3A 4DX6D 4APFA 4GA0A 3OXLA 4EECA 2IOLA 3RAUA 1TN7A 4B94A 1DC2A 1AP7A 3TWRA 1N0RA 4F1SA 2A5UA 4CZ2D 3B7RL 3IBEA 2GRPB 1H2UA 4WNEA 3SFYA 4F1PA 5JA4D 4J8YA 4FHKA 3U66A 4O60A 5AENA 3CVNA 2EINE 3V79K 3LS8A 5C2YA 3JYSA 5E76A 4AP2A 5J08A 3APDA 4EHMA 2WM9A 1SZAA 4YDYA 3MV2B 4XKBA 1HXIA 3P2BA 2LUHA 3Q9NC 2J4BA 3X2QE 5EX3A 3ENEA 4UI9J 2NXPA 4J8SA 4HBDA 2B6CA 2M63A 3P1UA 5CERB 2OVBA 3WG7E 3FFLA 4I1OB 3U9WA 3LXUX 2OOEA 5FQ7A 2FF4A 2AW6A 2DBAA 2A5EA 4ILGA 4PS3A 3SBSA 2IY0C 3E30A 2WMOA 3HG0D 4YDWA 1QQEA 3VTYA 4I1AA 2XPZA 4UWGA 1MX2A 3D9MA 3PEUB 2WPVA 4Z68A 3D9OA 3HRAA 4GA2A 4Q94A 1KPSB 1OWMA 1BLXB 2R5SA 3CQGB 2UWJG 1O1RA 3QJZA 5DIZA 2P9NG 3ZKJA 1JWGA 3CVLA 5FQ4A 2LAIA 3SF4A 4ILIA 3CVXA 1S63A 4I1MA 4LCTA 4BWRA 3RIBA 4CT4A 3HXDA 5CEDB 4AOFA 4B89A 2EQXA 4UUCA 3L9TA 1DCEA 1TJFA 1WM5A 1XGWA 3ASNE 1HG5A 2CG3A 4N2QA 3L13A 4JXTA 4U07A 4E85A 1ELKA 2XZDG 2FO7A 1BU9A 4JB8P 5FWQA 1FPPA 3RKVA 3L22A 3ZGQA 3T8MA 1S70B 2NYJA 2XS8A 3L82A 3FTUA 3FTSA 3FUFA 2XPYA 2Y69E 4HOQA 4FULA 1YCSB 1PY1A 2P9SG 5KCMA 5HKPA 2J08A 4KVOA 2AXUA 2VYIA 3SO8A 4JW1A 2EIME 1RZ4A 4GAAA 4IULA 1OUVA 4J8DA 2KCVA 4FHJA 3C72A 3QDNA 4BTAA 3EU9A 2IFUA 3V2OA 4UI9C 3MGBA 4Q96A 2YHEA 1E8WA 3UT7A 3DSSA
chains in the Genus database with same CATH topology
2F8YA 1BI8B 5AAOA 4O1OA 2ETAA 2F37A 1BD8A 4HI9A 4U8YD 1SVXA 1WG0A 4OAUC 2ZGDA 4UUCA 4BERA 1SW6A 3Q9UC 5ENRD 3NOGD 4ATZD 4K5CA 4F6RD 1AWCB 1DCQA 4DX5D 3TWVA 5AQAA 4QFVA 4BESA 5HRYA 4HBDA 2B0OE 1MX6A 4RLYA 4CYMD 3DEOA 5CERB 2Y0BG 5ENSD 2FO1E 2VGEA 2XEEA 3V2XA 4DX2A 4HNAD 3V31A 1IHBA 2DZOA 2J8SD 4DX7D 2Y1LE 4HB5A 4TUMA 5EYLA 1K1BA 3DEPA 4G8KA 5AQBA 3W9GA 3ZUVB 5BXUA 1OY3D 2V5QC 4GMRA 1D9SA 3TWXA 5KBAA 3LJNA 2DZNA 3UI2A 1A5EA 5D66A 2XZDG 5HS0A 4U95D 1BU9A 4JB8P 1NFIE 4HLLA 2KBXA 5ENPD 1BI7B 5KNHD 4HRMB 4BEPA 4C48B 1QYMA 2A5EA 3J5PA 3TWSA 5BXOA 2ETBA 3TWWA 1MYOA 5EIBE 4N5QA 5ENQD 3B7BA 5AARA 3JXJA 1N11A 2P2CP 3NOCD 5ENTD 3HG0D 4O1PA 3IXEA 4G8LA 4J7WA 1S70B 5KNGA 2BKGA 3TWTA 4BETA 4DX6D 2NYJA 4YDWA 1WDYA 2F8XK 5CBNA 4DX1A 4DUIA 4NIKA 1IKND 5FINA 4GPMA 3ZNGA 3NBNB 5EN5D 1DC2A 3JUEA 5EILA 2V4HC 3TWUA 5JMND 4DRXE 1MX2A 4OAVB 1AP7A 5EYPF 4LNUD 3TWRA 1N0RA 3UXGA 5AQ7A 3F6QA 4Z68A 2DWZA 1TR4A 2QYJA 3HRAA 4LG6A 1YCSB 4CZ2D 5AQ9A 1OT8A 3TWQA 1K3ZD 3D9HA 5CECB 5CEAA 1BLXB 1IXVA 2BKKB 2ZGGA 4LSZE 5EIDA 5AN8A 5HKPA 3UTMA 4F1PA 5ITZF 2AJAA 3SO8A 5JA4D 1YMPA 4ZHBA 3AAAC 2MYOA 1MJ0A 4HQDA 2RFMA 3AJIA 3C5RA 2XENA 4J8YA 3ZKJA 3ZU7B 4B93B 3JXIA 2XZTG 3J5QB 4QQIA 4O60A 2PNNA 4HRNA 4U96D 3V79K 4A63B 3KEAA 3V30A 4K5AB 1UOHA 2HE0A 3EHQA 3W9FA 5ENOD 4ZFHA 4BSZB 2XEHA 2DVWA 2QC9A 4HI8A 4HRLA 2KXPC 3T9KA 2RFAA 4YDYA 1G3NB 1YYHA 3EU9A 2L6BA 4K5BA 2ETCA 1MX4A 5KWDA 4U8VD 3V2OA 5CBOA 1N0QA 3Q9NC 3T8KA 5CEDB 2JABA 1K1AA 3EHRA 5FIOA 3B95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F8Y A;  1BI8 B;  5AAO A;  4O1O A;  2ETA A;  2F37 A;  1BD8 A;  4HI9 A;  4U8Y D;  1SVX A;  1WG0 A;  4OAU C;  2ZGD A;  4UUC A;  4BER A;  1SW6 A;  3Q9U C;  5ENR D;  3NOG D;  4ATZ D;  4K5C A;  4F6R D;  1AWC B;  1DCQ A;  4DX5 D;  3TWV A;  5AQA A;  4QFV A;  4BES A;  5HRY A;  4HBD A;  2B0O E;  1MX6 A;  4RLY A;  4CYM D;  3DEO A;  5CER B;  2Y0B G;  5ENS D;  2FO1 E;  2VGE A;  2XEE A;  3V2X A;  4DX2 A;  4HNA D;  3V31 A;  1IHB A;  2DZO A;  2J8S D;  4DX7 D;  2Y1L E;  4HB5 A;  4TUM A;  5EYL A;  1K1B A;  3DEP A;  4G8K A;  5AQB A;  3W9G A;  3ZUV B;  5BXU A;  1OY3 D;  2V5Q C;  4GMR A;  1D9S A;  3TWX A;  5KBA A;  3LJN A;  2DZN A;  3UI2 A;  1A5E A;  5D66 A;  2XZD G;  5HS0 A;  4U95 D;  1BU9 A;  4JB8 P;  1NFI E;  4HLL A;  2KBX A;  5ENP D;  1BI7 B;  5KNH D;  4HRM B;  4BEP A;  4C48 B;  1QYM A;  2A5E A;  3J5P A;  3TWS A;  5BXO A;  2ETB A;  3TWW A;  1MYO A;  5EIB E;  4N5Q A;  5ENQ D;  3B7B A;  5AAR A;  3JXJ A;  1N11 A;  2P2C P;  3NOC D;  5ENT D;  3HG0 D;  4O1P A;  3IXE A;  4G8L A;  4J7W A;  1S70 B;  5KNG A;  2BKG A;  3TWT A;  4BET A;  4DX6 D;  2NYJ A;  4YDW A;  1WDY A;  2F8X K;  5CBN A;  4DX1 A;  4DUI A;  4NIK A;  1IKN D;  5FIN A;  4GPM A;  3ZNG A;  3NBN B;  5EN5 D;  1DC2 A;  3JUE A;  5EIL A;  2V4H C;  3TWU A;  5JMN D;  4DRX E;  1MX2 A;  4OAV B;  1AP7 A;  5EYP F;  4LNU D;  3TWR A;  1N0R A;  3UXG A;  5AQ7 A;  3F6Q A;  4Z68 A;  2DWZ A;  1TR4 A;  2QYJ A;  3HRA A;  4LG6 A;  1YCS B;  4CZ2 D;  5AQ9 A;  1OT8 A;  3TWQ A;  1K3Z D;  3D9H A;  5CEC B;  5CEA A;  1BLX B;  1IXV A;  2BKK B;  2ZGG A;  4LSZ E;  5EID A;  5AN8 A;  5HKP A;  3UTM A;  4F1P A;  5ITZ F;  2AJA A;  3SO8 A;  5JA4 D;  1YMP A;  4ZHB A;  3AAA C;  2MYO A;  1MJ0 A;  4HQD A;  2RFM A;  3AJI A;  3C5R A;  2XEN A;  4J8Y A;  3ZKJ A;  3ZU7 B;  4B93 B;  3JXI A;  2XZT G;  3J5Q B;  4QQI A;  4O60 A;  2PNN A;  4HRN A;  4U96 D;  3V79 K;  4A63 B;  3KEA A;  3V30 A;  4K5A B;  1UOH A;  2HE0 A;  3EHQ A;  3W9F A;  5ENO D;  4ZFH A;  4BSZ B;  2XEH A;  2DVW A;  2QC9 A;  4HI8 A;  4HRL A;  2KXP C;  3T9K A;  2RFA A;  4YDY A;  1G3N B;  1YYH A;  3EU9 A;  2L6B A;  4K5B A;  2ETC A;  1MX4 A;  5KWD A;  4U8V D;  3V2O A;  5CBO A;  1N0Q A;  3Q9N C;  3T8K A;  5CED B;  2JAB A;  1K1A A;  3EHR A;  5FIO A;  3B95 A; 
#chains in the Genus database with same CATH topology
 3NQP A;  4O1O A;  2GW1 A;  5KJK A;  2RD0 A;  1NA0 A;  3CGH A;  3FUM A;  3CQC B;  2VJ8 A;  2UY1 A;  4NUR A;  2FUL A;  3PZ1 A;  4DPR A;  3SFX A;  2Y0B G;  2FO1 E;  4HOR A;  3UT4 A;  4KT6 B;  1TNU A;  4PUC A;  5FZS A;  3FTY A;  1D9S A;  3SGH A;  3SNX A;  3ABL E;  4JHK A;  4DLO A;  1BPO A;  1LD8 A;  1DNP A;  4FC8 A;  5T4Y A;  4PS8 A;  4N5Q A;  3UIO C;  4TXR A;  3JXJ A;  5ENT D;  3E34 A;  4O1P A;  1WDY A;  3FUL A;  5AJL A;  3Q7F A;  4NIK A;  1O1T A;  2WXJ A;  2V4H C;  1Z3X A;  4F3V A;  4OAV B;  3CK8 A;  5EYP F;  2EIJ E;  4GZD A;  2OND A;  3QOU A;  3WXX A;  4U0U A;  1K3Z D;  1KT0 A;  4XI0 A;  1TNO A;  4XIF A;  2AJA A;  3ULY A;  2ILR A;  3SI5 A;  4CGW A;  3ISM C;  1B89 A;  2PQN A;  4BSX A;  3ESL A;  3FWV A;  1EYH A;  4UI9 K;  3MJW A;  3DRA A;  4ZFH A;  3NB2 A;  2GRM A;  2KXP C;  3G2S A;  1WAO 1;  2L6B A;  3Q73 A;  1N0Q A;  5ARG A;  3T8K A;  3EHR A;  5FIO A;  3VLF A;  4K0R A;  4FJZ A;  1WG0 A;  4B8C B;  1LTX A;  4I17 A;  3FTX A;  5ENR D;  4FJY A;  2I6H A;  4FLB A;  4EBA A;  5D2M C;  2Y4T A;  3AU5 A;  2J4D A;  2C0L A;  3LY8 A;  2NC9 A;  3G2U A;  1U3D A;  1IHB A;  3MV3 B;  4HB5 A;  4HXI A;  3D9I A;  3ZUV B;  1EF1 C;  1N94 A;  1E90 A;  3ZN3 A;  1H6O A;  5HI7 A;  3RSE G;  4N5C A;  1HG2 A;  2R2L A;  1S0P A;  1X5B A;  4GML A;  1HU3 A;  3PUJ A;  1TN8 A;  3Q75 A;  3DSW A;  3TWS A;  5LFA A;  3UKU G;  3BU8 A;  3EHN A;  4G24 A;  3S7J A;  3QWP A;  5B1A E;  1N4P A;  1Z5S C;  4G2V A;  3IKO B;  4R7L A;  2ZXW E;  4JHR A;  2QYU A;  3MX3 A;  2VSO E;  3FUH A;  2WVI A;  4U8H A;  4ANV A;  4ATG A;  4OVU A;  3LJ3 A;  2KCK A;  1OT8 A;  3FY4 A;  4UQY A;  3R7R A;  3UTM A;  2GGF A;  4LSZ E;  5JHA A;  5KJM A;  3UM0 A;  2P9U G;  4YVO A;  3MKR A;  1JCR A;  3SZ7 A;  2XEN A;  4YND A;  1SZ9 A;  2R17 C;  4J8E A;  3FTV A;  3CHR A;  4ACL A;  3HXC A;  2HE0 A;  4M7C A;  1NP7 A;  4HOU A;  4HRL A;  3T9K A;  4I2W A;  4C0M A;  4ANW A;  4K5B A;  2E2E A;  4BFR A;  3ML8 A;  3L08 A;  3ASO E;  3PS6 A;  3HDX A;  3PEV B;  4H7Y A;  4K5C A;  3TWV A;  5HRY A;  3DXK G;  5DBK A;  1H6K A;  4A1S A;  3FUN A;  1EDU A;  3ABK E;  2VGE A;  4LNG A;  4B8A A;  3V31 A;  3U4T A;  5JHB A;  1X81 A;  4ABN A;  4ACK A;  2WXN A;  3QC1 A;  4N2S A;  2V5Q C;  3T5X A;  4J6I A;  3CHM A;  2P9K G;  4N39 A;  3O4Z A;  3ULQ A;  4L7T A;  1O1S A;  2IQC A;  4CDN A;  2WQ6 A;  1H6P A;  4JHJ A;  3EUV A;  3SHF A;  2QY7 A;  4AV7 A;  4AEZ C;  3ZEF A;  1UJK A;  2Y4U A;  3PUK A;  2XGM A;  2P58 C;  2ZIR A;  4WUY A;  4MKT A;  3F6Q A;  2DWZ A;  4FP7 A;  3SQV A;  5KJN A;  3GZS A;  4XZ4 A;  5AN8 A;  2PZI A;  5HQ8 A;  2I2O A;  4I43 A;  1MJ0 A;  4A3V A;  3AJI A;  3UM2 A;  3DSX A;  3EDT B;  3KS2 A;  3RRN B;  4Y6C A;  5CCM A;  3KEA A;  4BTB A;  3EHQ A;  2PQR A;  3W9F A;  4F53 A;  1L5J A;  1YYH A;  4UQX A;  2XS1 A;  2XQ0 A;  2DYR E;  2MHK A;  3UIN C;  3ZPJ A;  5IY5 E;  2F8Y A;  4TXQ A;  2X6H A;  2GRO B;  5G05 J;  3PRZ A;  5BUZ A;  3RRU A;  2VGX A;  5AQA A;  3LPZ A;  2JEK A;  1P5Q A;  4CDM A;  4URK A;  3DST A;  1A17 A;  4RG6 A;  3PH0 C;  3AG3 E;  4JEH A;  4I6G A;  2PL2 A;  1K1B A;  3NZU A;  4U0S A;  2CFZ A;  3JUI A;  4GMR A;  3TWX A;  5KBA A;  2KC7 A;  3GYZ A;  3TG4 A;  3KEZ A;  1HO8 A;  4UWL A;  5HS0 A;  1UJJ A;  1V55 E;  3RO3 A;  4ME2 A;  4GZ5 A;  3L16 A;  2CFU A;  3QNK A;  4JL0 A;  4DK5 A;  1FT2 A;  1KT1 A;  1WY6 A;  2UY1 B;  3NOC D;  3FUE A;  2H6H A;  4BET A;  2BKG A;  4U63 A;  3ZHE B;  4G11 A;  1JCS A;  1N4R A;  4LUN U;  4PS7 A;  3ZNG A;  2LSV A;  4DRX E;  2Y3A A;  4LNU D;  3LVR E;  3C98 A;  3FP3 A;  3TWQ A;  4AIF A;  4A55 A;  1IHG A;  5CEC B;  1HFA A;  4G23 A;  4JA9 A;  4HQD A;  2XGS A;  4JA7 A;  4M3O A;  3RJV A;  4OVV A;  1D8E A;  3J5Q B;  4X8Q A;  2CG2 A;  4WND A;  4N3C A;  2JLB A;  2OVF A;  1MQS A;  4GTM A;  1DVP A;  4ANU A;  4AVX A;  4GTV A;  5ARF A;  4HOS A;  5FT9 A;  3CHS A;  5FIN A;  3D9L A;  3ML9 A;  5AAO A;  4IYP A;  3Q15 A;  4U04 A;  4L2L A;  3I5P A;  2FEZ A;  4MS6 A;  3Q9U C;  4RSY A;  2V8S E;  3CST A;  2VTB B;  5T3R A;  1DCQ A;  1SA5 A;  3ESK A;  2RG8 A;  3FUD A;  5G04 J;  1H0A A;  3FH5 A;  2DZO A;  4ILH B;  4L1B A;  3UM3 A;  1FVF A;  1MZC A;  3FU3 A;  3ASD A;  1EPU A;  4UWF A;  3MYV A;  4I9C A;  4EPZ A;  2I1J A;  3IEG A;  1OWL A;  3VLD A;  4GYY A;  1SA4 A;  2L6J A;  5AAR A;  3TG5 A;  4FA6 A;  3TWT A;  4G8L A;  1W3B A;  3S7F A;  4D10 C;  5EN5 D;  3JUE A;  5EIL A;  3FU5 A;  3C3Q A;  5E75 A;  3D9H A;  2OV8 A;  3FEY A;  4NAC A;  3D3M A;  3B7S A;  4XX5 A;  3LCA A;  3RU0 A;  2R02 A;  3FHE A;  1TN6 A;  4I6J A;  4GZC A;  4HI8 A;  2RFA A;  4CGV A;  5G05 C;  2L0I A;  5LP0 A;  2WQH A;  4Y6W A;  1IQU A;  4CYM D;  5BNW A;  2YIN A;  1BD8 A;  2CHZ A;  2X3M A;  3AS5 A;  4BER A;  2E0I A;  2PM6 A;  2V4L A;  1AWC B;  4RVB A;  3D9P A;  1HF8 A;  4GA1 A;  3Q49 B;  1UG3 A;  2AWI A;  3ABM E;  3OTN A;  3PRE A;  3PNT B;  4Q69 A;  1HH8 A;  4HVB A;  4WNF A;  4GTT A;  5D66 A;  2I9C A;  4HLL A;  2WXL A;  2DCP A;  1FT1 A;  3AS8 A;  5FTP A;  4TXP A;  5FQ8 A;  1N11 A;  5KNG A;  2OEW A;  3K9I A;  4G25 A;  4DX1 A;  3AU4 A;  4GYW A;  4KYO B;  4OYS A;  4JC8 A;  3T5V A;  4MBG A;  5EID A;  5ITZ F;  4GMJ A;  2MYO A;  3ZU7 B;  2XZT G;  3R9A B;  2J09 A;  2VSY A;  4U96 D;  1OCO E;  2BED A;  1TNB A;  3ONL A;  2XRZ A;  3G2W A;  3Q5M A;  4JZY A;  2R05 A;  5ANR A;  2MRI A;  1V54 E;  5G04 C;  5T8I A;  2Q7F A;  4RG9 A;  3DWL G;  3CIA A;  4I2Z A;  5JJT A;  3RK6 A;  4DI3 A;  5G2N A;  2VGY A;  3LVQ E;  4UQZ A;  4G8K A;  3LKU A;  1U2V G;  1OWN A;  3DPD A;  4XE0 A;  3UI2 A;  3LY9 A;  3OXG A;  5BT1 A;  3TXN A;  4GYO A;  2ETB A;  1E96 B;  3JQ1 A;  1H2V C;  1TJC A;  4CT0 A;  3CVQ A;  1TNZ A;  5JJ7 A;  2VGX B;  3CHQ A;  4TRQ A;  3ZXS A;  1IKN D;  5JMN D;  3HXB A;  4N3B A;  2EIL E;  1O5M A;  4I6E A;  1U3C A;  5ENN A;  2X6K A;  2WXR A;  1OCZ E;  3ZRH A;  4MRU A;  5LOZ A;  1SQM A;  4A63 B;  5ENO D;  4XKC A;  2QC9 A;  2J07 A;  2R03 A;  2V0P A;  4F7A A;  2WXP A;  5KWD A;  1TNY A;  3AG4 E;  1OWO A;  3UM1 A;  2LXM A;  2V5F A;  3APF A;  4KZ0 A;  5FQ6 A;  3BEE A;  2YHC A;  2GRL A;  3CKC A;  3FU0 A;  3ASH A;  3AG1 E;  5EX0 A;  2KCL A;  2ION A;  3KAE A;  5ENS D;  3CVV A;  1QZ2 A;  3FH8 A;  4DX7 D;  3EJN A;  4PDX A;  1JPL A;  3LEW A;  2VSX E;  5AQB A;  4L23 A;  1HS6 A;  4WAF A;  3EIQ C;  4HRM B;  3J5P A;  1MHQ A;  5EKQ D;  2WB2 A;  3EU5 A;  3B7B A;  4TUU A;  3HHM A;  3MCX A;  4HFG A;  4A3T A;  2RKK A;  2F8X K;  3DSV A;  1E8Z A;  4DUI A;  3FH7 A;  3CVU A;  2OCC E;  1OXJ A;  4C9B B;  3NBN B;  1H19 A;  5AQ7 A;  4LG6 A;  3QAR A;  1NZN A;  5CEA A;  2BKK B;  2ZGG A;  5CRV A;  1VDY A;  5D0O D;  2RFM A;  3C5R A;  2LNI A;  1ELW A;  1Q2Z A;  3MZL B;  1Y8M A;  4WWP A;  2XCC A;  3FTW A;  4J0U A;  2DVW A;  2C2L A;  3IHY A;  1G3N B;  1KZP A;  1UW4 B;  3QB2 A;  1MX4 A;  5CBO A;  4TV3 A;  4GCO A;  3S2A A;  2HR2 A;  3HVE A;  3Q4A B;  4RQI A;  1SVX A;  2WXH A;  3CEQ A;  4GTS A;  3PE4 A;  2YQ8 A;  4DX5 D;  4DLQ A;  4HS2 A;  4E6H A;  2XEE A;  2WXQ A;  4DX2 A;  4FU3 A;  3FUI A;  3GZ1 A;  4EQF A;  2J8S D;  4LER A;  3PZD A;  2AVP A;  3TGO A;  4U95 D;  2XHE A;  4BEP A;  4BT8 A;  3IHV A;  5CCL A;  1MYO A;  3HXF A;  2BF0 X;  3UXG A;  3IXE A;  2DYS E;  1XNF A;  4I9E A;  2C0M A;  5G55 A;  3FEX A;  4ANX A;  5ANL A;  2IO3 C;  1TR4 A;  2QYJ A;  1N9A A;  4BX9 A;  3CVP A;  2WXO A;  1N4Q A;  3UKR G;  1UN9 A;  3E32 A;  3RO2 A;  4FLH A;  4ZHB A;  3AAA C;  3JXI A;  2HM8 A;  2XGO A;  1Y6I A;  5BV1 A;  2PNN A;  4HRN A;  4EBA G;  4APO A;  3AG2 E;  2F0Y A;  4K5A B;  3LY7 A;  1H2T C;  3S7B A;  2XEH A;  2FBN A;  3IV0 A;  4WWO A;  1HE8 A;  4HLE A;  1E8X A;  4DJA A;  3QKY A;  4DI4 A;  3UT8 A;  2JAB A;  4JD2 G;  2L0T B;  3ULE G;  4GZ3 A;  3Q78 A;  2F37 A;  5CMW A;  3N71 A;  3ZYQ A;  1SW6 A;  2X38 A;  4CCA A;  3PVL A;  4G1T A;  4RLY A;  2IF4 A;  4GZ6 A;  1OCR E;  3V2X A;  3UMV A;  2MOW A;  3UUX A;  1N54 A;  4YVQ C;  3KSL A;  2WXK A;  4TUM A;  1ZU2 A;  2LSU A;  2LO6 A;  3W9G A;  5A6C A;  5D0Q D;  4AXH A;  1HX8 A;  1GW6 A;  2X6I A;  5FZR A;  2KBX A;  2VSN A;  5KNH D;  2ZIS A;  1KLX A;  4C48 B;  4JPS A;  2KM4 A;  2ZU6 B;  5BXO A;  4IN3 B;  1NL4 A;  2KZT A;  5B1B E;  3MKQ A;  3CHO A;  4GPM A;  3ASF A;  3O48 A;  5C1D A;  5AIJ A;  1YA0 A;  4AY5 A;  2XRY A;  2P9L G;  3OAW A;  1Z6T A;  5BPP A;  3L6A A;  3JQ0 A;  4XI9 A;  4GTO A;  3MA5 A;  2H6I A;  3CK7 A;  3HIZ A;  2H6G A;  3NAW A;  5CHE E;  4BT9 A;  1S64 A;  3I3N A;  4YDE A;  1K1A A;  3JCK C;  2IEJ A;  2ETA A;  4W9R A;  2XCB A;  5EDS A;  4U8Y D;  2ZGD A;  4GTR A;  2I1K A;  4YDO A;  3BUA A;  3DSU A;  2B0O E;  1D8D A;  2EIK E;  4G26 A;  4FAD A;  4XEI G;  4HNA D;  4EZJ A;  2GRQ B;  3BG1 B;  5LCW J;  2QFC A;  3TJP A;  1JWF A;  3NZS A;  5BXU A;  2WXI A;  3S7D A;  4K03 A;  3CLJ A;  3DPY A;  3I4G A;  2KAT A;  4CEM A;  3B13 A;  2IU1 A;  5ENQ D;  3G2T A;  2P2C P;  3L54 A;  3BQO A;  2WMN A;  3QWV A;  3VLE A;  1FCH A;  2XPI A;  3BG0 B;  3SBT B;  4H7X A;  3SD5 A;  4PH4 B;  2CHW A;  3C3R A;  5A23 A;  1IXV A;  3MEK A;  3G2V A;  5KJL A;  4KMO A;  3C3O A;  4B93 B;  4QQI A;  1TEZ A;  3ZW3 A;  3CVY A;  4LRZ A;  4B0Z A;  2IOS A;  3ZHE A;  3LYA A;  3D9K A;  2P9I G;  3OXF A;  4CRW A;  3CK9 A;  4C0E A;  1ELR A;  4KXK B;  3CR3 A;  3EHM A;  2GRN B;  4BX8 A;  3ZYL A;  1RW2 A;  3KSQ A;  1E8Y A;  1N4S A;  2X6F A;  2BUG A;  5LX8 A;  5JJ6 A;  2CHX A;  2YNQ A;  3QAQ A;  4WNG A;  5J90 A;  1MX6 A;  1JCQ A;  3PE3 A;  3L17 A;  3CSF A;  3FUK A;  3FUJ A;  2HO1 A;  5B3S E;  2HYZ A;  4GCN A;  3KD7 A;  1ZBP A;  4KBQ A;  2P9P G;  3UX4 A;  4J8F A;  3ZVV A;  2A4Z A;  3HVE B;  2VTB A;  1KZO A;  3U3W A;  1NI1 A;  1K8K G;  4EZK A;  2H6F A;  3SFZ A;  5CBN A;  4L2Y A;  3TWU A;  2FI7 A;  3DBS A;  3ZYK A;  3GW4 A;  3QWW A;  3ZYM A;  1OWP A;  2OEV A;  5AQ9 A;  5H7P A;  3R9M A;  1NA3 A;  4EZL A;  3CKB A;  3VTX A;  2AXV A;  3HYM B;  3Q7A A;  1TYQ G;  3ZFW A;  4JEU A;  2L9B A;  4WWN A;  4CDR A;  3UQ3 A;  2NSZ A;  2ETC A;  3R7Q A;  1LF8 A;  2IJG X;  3CVW A;  4GU5 A;  3ASG A;  1INZ A;  4U7E B;  5FJY A;  3Q47 B;  3D9J A;  3PZ4 A;  3E33 A;  1LD7 A;  2WXG A;  4GTQ A;  3NF1 A;  3NOG D;  4ATZ D;  4JVS A;  4F6R D;  5LCW C;  4QFV A;  4N3A A;  1PC2 A;  4GTP A;  3DEO A;  3ZIM A;  2DIW A;  4V3I A;  2WXM A;  5BV0 A;  1QNF A;  2IO2 C;  5CMY A;  2R59 A;  2X6J A;  4AM9 A;  3SY2 A;  3DEP A;  4NRH B;  3TL5 A;  2QZA A;  4A1G A;  2J49 A;  3FDH A;  2LXL A;  1NFI E;  4NQ0 A;  1BI7 B;  1QYM A;  2XEV A;  4UWK A;  3TWW A;  2J9Q A;  5M72 A;  3ZXP A;  3D9N A;  4J7W A;  3HXE A;  3Q79 A;  1IQR A;  1JUQ A;  2VQ2 A;  4P29 A;  4AY6 A;  3B7T A;  2BTD A;  4GB9 A;  4HOT A;  2WQ7 A;  2AXZ A;  3E37 A;  2PM7 A;  4O6F A;  2LAH A;  3TAX A;  1HZ4 A;  3ONK A;  3GZ2 A;  1YMP A;  3UIP C;  3RRM B;  1UN8 A;  1FVH A;  5FZQ A;  5BW8 C;  4KZC A;  1UOH A;  3LDZ A;  3E4B A;  4IRU A;  4BSZ B;  1E7U A;  2KZT B;  4BY6 A;  1E7V A;  3MKQ B;  4U8V D;  1ZB1 A;  1QBQ A;  3I4R B;  3V30 A;  1A5E A;  5AYW D;  3B95 A;  1BI8 B;  3CHP A;  4HI9 A;  4OAU C;  3PDN A;  1IYG A;  3FU6 A;  3FTZ A;  1Z3Y A;  3B7U X;  4BES A;  4KVM A;  3UPV A;  2GRR B;  5A7D B;  3URZ A;  4LNB A;  4LEU A;  3APC A;  3CV0 A;  5CRU A;  3EIJ A;  2Y1L E;  5EYL A;  3DXM G;  4L9P A;  3TXM A;  1OY3 D;  3U64 A;  3LJN A;  1OCC E;  2DZN A;  3PZ2 A;  4GPK A;  1N95 A;  1N52 A;  5ENP D;  4UWH A;  5AJD A;  4AJW A;  3AS4 A;  3PNL B;  4U0Z A;  4MLP A;  5EIB E;  3QK0 A;  1PAQ A;  2WXF A;  3PZ3 A;  4DX6 D;  4APF A;  4GA0 A;  3OXL A;  4EEC A;  2IOL A;  3RAU A;  1TN7 A;  4B94 A;  1DC2 A;  1AP7 A;  3TWR A;  1N0R A;  4F1S A;  2A5U A;  4CZ2 D;  3B7R L;  3IBE A;  2GRP B;  1H2U A;  4WNE A;  3SFY A;  4F1P A;  5JA4 D;  4J8Y A;  4FHK A;  3U66 A;  4O60 A;  5AEN A;  3CVN A;  2EIN E;  3V79 K;  3LS8 A;  5C2Y A;  3JYS A;  5E76 A;  4AP2 A;  5J08 A;  3APD A;  4EHM A;  2WM9 A;  1SZA A;  4YDY A;  3MV2 B;  4XKB A;  1HXI A;  3P2B A;  2LUH A;  3Q9N C;  2J4B A;  3X2Q E;  5EX3 A;  3ENE A;  4UI9 J;  2NXP A;  4J8S A;  4HBD A;  2B6C A;  2M63 A;  3P1U A;  5CER B;  2OVB A;  3WG7 E;  3FFL A;  4I1O B;  3U9W A;  3LXU X;  2OOE A;  5FQ7 A;  2FF4 A;  2AW6 A;  2DBA A;  2A5E A;  4ILG A;  4PS3 A;  3SBS A;  2IY0 C;  3E30 A;  2WMO A;  3HG0 D;  4YDW A;  1QQE A;  3VTY A;  4I1A A;  2XPZ A;  4UWG A;  1MX2 A;  3D9M A;  3PEU B;  2WPV A;  4Z68 A;  3D9O A;  3HRA A;  4GA2 A;  4Q94 A;  1KPS B;  1OWM A;  1BLX B;  2R5S A;  3CQG B;  2UWJ G;  1O1R A;  3QJZ A;  5DIZ A;  2P9N G;  3ZKJ A;  1JWG A;  3CVL A;  5FQ4 A;  2LAI A;  3SF4 A;  4ILI A;  3CVX A;  1S63 A;  4I1M A;  4LCT A;  4BWR A;  3RIB A;  4CT4 A;  3HXD A;  5CED B;  4AOF A;  4B89 A;  2EQX A;  4UUC A;  3L9T A;  1DCE A;  1TJF A;  1WM5 A;  1XGW A;  3ASN E;  1HG5 A;  2CG3 A;  4N2Q A;  3L13 A;  4JXT A;  4U07 A;  4E85 A;  1ELK A;  2XZD G;  2FO7 A;  1BU9 A;  4JB8 P;  5FWQ A;  1FPP A;  3RKV A;  3L22 A;  3ZGQ A;  3T8M A;  1S70 B;  2NYJ A;  2XS8 A;  3L82 A;  3FTU A;  3FTS A;  3FUF A;  2XPY A;  2Y69 E;  4HOQ A;  4FUL A;  1YCS B;  1PY1 A;  2P9S G;  5KCM A;  5HKP A;  2J08 A;  4KVO A;  2AXU A;  2VYI A;  3SO8 A;  4JW1 A;  2EIM E;  1RZ4 A;  4GAA A;  4IUL A;  1OUV A;  4J8D A;  2KCV A;  4FHJ A;  3C72 A;  3QDN A;  4BTA A;  3EU9 A;  2IFU A;  3V2O A;  4UI9 C;  3MGB A;  4Q96 A;  2YHE A;  1E8W A;  3UT7 A;  3DSS A; 
#chains in the Genus database with same CATH homology
 2F8Y A;  1BI8 B;  5AAO A;  4O1O A;  2ETA A;  2F37 A;  1BD8 A;  4HI9 A;  4U8Y D;  1SVX A;  1WG0 A;  4OAU C;  2ZGD A;  4UUC A;  4BER A;  1SW6 A;  3Q9U C;  5ENR D;  3NOG D;  4ATZ D;  4K5C A;  4F6R D;  1AWC B;  1DCQ A;  4DX5 D;  3TWV A;  5AQA A;  4QFV A;  4BES A;  5HRY A;  4HBD A;  2B0O E;  1MX6 A;  4RLY A;  4CYM D;  3DEO A;  5CER B;  2Y0B G;  5ENS D;  2FO1 E;  2VGE A;  2XEE A;  3V2X A;  4DX2 A;  4HNA D;  3V31 A;  1IHB A;  2DZO A;  2J8S D;  4DX7 D;  2Y1L E;  4HB5 A;  4TUM A;  5EYL A;  1K1B A;  3DEP A;  4G8K A;  5AQB A;  3W9G A;  3ZUV B;  5BXU A;  1OY3 D;  2V5Q C;  4GMR A;  1D9S A;  3TWX A;  5KBA A;  3LJN A;  2DZN A;  3UI2 A;  1A5E A;  5D66 A;  2XZD G;  5HS0 A;  4U95 D;  1BU9 A;  4JB8 P;  1NFI E;  4HLL A;  2KBX A;  5ENP D;  1BI7 B;  5KNH D;  4HRM B;  4BEP A;  4C48 B;  1QYM A;  2A5E A;  3J5P A;  3TWS A;  5BXO A;  2ETB A;  3TWW A;  1MYO A;  5EIB E;  4N5Q A;  5ENQ D;  3B7B A;  5AAR A;  3JXJ A;  1N11 A;  2P2C P;  3NOC D;  5ENT D;  3HG0 D;  4O1P A;  3IXE A;  4G8L A;  4J7W A;  1S70 B;  5KNG A;  2BKG A;  3TWT A;  4BET A;  4DX6 D;  2NYJ A;  4YDW A;  1WDY A;  2F8X K;  5CBN A;  4DX1 A;  4DUI A;  4NIK A;  1IKN D;  5FIN A;  4GPM A;  3ZNG A;  3NBN B;  5EN5 D;  1DC2 A;  3JUE A;  5EIL A;  2V4H C;  3TWU A;  5JMN D;  4DRX E;  1MX2 A;  4OAV B;  1AP7 A;  5EYP F;  4LNU D;  3TWR A;  1N0R A;  3UXG A;  5AQ7 A;  3F6Q A;  4Z68 A;  2DWZ A;  1TR4 A;  2QYJ A;  3HRA A;  4LG6 A;  1YCS B;  4CZ2 D;  5AQ9 A;  1OT8 A;  3TWQ A;  1K3Z D;  3D9H A;  5CEC B;  5CEA A;  1BLX B;  1IXV A;  2BKK B;  2ZGG A;  4LSZ E;  5EID A;  5AN8 A;  5HKP A;  3UTM A;  4F1P A;  5ITZ F;  2AJA A;  3SO8 A;  5JA4 D;  1YMP A;  4ZHB A;  3AAA C;  2MYO A;  1MJ0 A;  4HQD A;  2RFM A;  3AJI A;  3C5R A;  2XEN A;  4J8Y A;  3ZKJ A;  3ZU7 B;  4B93 B;  3JXI A;  2XZT G;  3J5Q B;  4QQI A;  4O60 A;  2PNN A;  4HRN A;  4U96 D;  3V79 K;  4A63 B;  3KEA A;  3V30 A;  4K5A B;  1UOH A;  2HE0 A;  3EHQ A;  3W9F A;  5ENO D;  4ZFH A;  4BSZ B;  2XEH A;  2DVW A;  2QC9 A;  4HI8 A;  4HRL A;  2KXP C;  3T9K A;  2RFA A;  4YDY A;  1G3N B;  1YYH A;  3EU9 A;  2L6B A;  4K5B A;  2ETC A;  1MX4 A;  5KWD A;  4U8V D;  3V2O A;  5CBO A;  1N0Q A;  3Q9N C;  3T8K A;  5CED B;  2JAB A;  1K1A A;  3EHR A;  5FIO A;  3B95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...