3NOCD

Designed ankyrin repeat protein (darpin) binders to acrb: plasticity of the interface
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
154
structure length
154
Chain Sequence
DLGKKLLEAARAGQDDEVRILMANGADVNARDFTGWTPLHLAAHFGHLEIVEVLLKNGADVNAKDSLGVTPLHLAARRGHLEIVEVLLKNGADVNASDSHGFTPLHLAAKRGHLEIVEVLLKNGADVNAQDKFGKTAFDISIDNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Designed ankyrin repeat protein binders for the crystallization of AcrB: Plasticity of the dominant interface
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein/protein binding
molecule keywords Acriflavine resistance protein B
total genus 41
structure length 154
sequence length 154
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3nocD00
5ENOD 3TWXA 4F6RD 1G3NB 5KNGA 1DC2A 5FIOA 1BI8B 2A5EA 5HKPA 4DX5D 4HRMB 1BLXB 4LSZE 4O1PA 2DZNA 1NFIE 4U8VD 5EYPF 2ETBA 4DX7D 5ENQD 1N11A 4ZFHA 1AWCB 1BD8A 2QYJA 5HRYA 5ITZF 1IHBA 3TWRA 3ZUVB 2V4HC 3AAAC 5EIDA 3V2XA 1A5EA 1S70B 4HB5A 4Z68A 4TUMA 3B95A 3J5QB 3TWVA 4BESA 4DX1A 3Q9NC 1MYOA 5CBOA 3UXGA 3EHRA 1WDYA 3DEPA 3NOGD 5JMND 3JUEA 3TWQA 3KEAA 4NIKA 4QFVA 5AQBA 4K5CA 4ZHBA 4B93B 3NOCD 4HBDA 4QQIA 5CERB 5AQ7A 4K5BA 4G8LA 3IXEA 2MYOA 1YCSB 4U8YD 1DCQA 1WG0A 5AQ9A 3UI2A 1IXVA 5AQAA 2Y0BG 3Q9UC 5ENTD 4U95D 3SO8A 4G8KA 2DVWA 3V79K 2KXPC 4LG6A 5AARA 3T8KA 3HRAA 1K1BA 4F1PA 4HRLA 5BXOA 1N0RA 4BEPA 1AP7A 1MX4A 2F8YA 2JABA 4BETA 5CEDB 1SVXA 4GPMA 2J8SD 4HQDA 4ATZD 1MJ0A 2F8XK 1K1AA 4J8YA 5AAOA 3F6QA 5EYLA 2ZGDA 1BI7B 1OT8A 5CEAA 4CYMD 4U96D 3ZNGA 2P2CP 1TR4A 4BSZB 3EU9A 4HI9A 3EHQA 4C48B 5KWDA 2ETCA 1YMPA 5AN8A 1YYHA 1IKND 2XENA 3HG0D 4BERA 2ETAA 5BXUA 4OAUC 3DEOA 2HE0A 3LJNA 2RFMA 3TWUA 5FINA 3D9HA 1BU9A 3JXIA 2ZGGA 2RFAA 3AJIA 2BKGA 3V31A 1N0QA 4RLYA 4YDYA 3TWSA 3ZKJA 3W9FA 2B0OE 4DUIA 5CBNA 3V2OA 3W9GA 5EN5D 1SW6A 2DZOA 4HNAD 2KBXA 5D66A 5ENRD 4GMRA 3B7BA 4J7WA 5KNHD 3T9KA 4O1OA 2VGEA 2AJAA 3TWTA 3TWWA 4O60A 4DX2A 2FO1E 5EILA 5HS0A 3UTMA 5CECB 5EIBE 1MX2A 4HI8A 2QC9A 1OY3D 4CZ2D 4UUCA 4JB8P 4OAVB 1QYMA 2F37A 5ENPD 4DX6D 4HLLA 2XEHA 4A63B 2NYJA 4LNUD 2L6BA 1UOHA 2XZDG 4HRNA 2XZTG 3C5RA 3ZU7B 1D9SA 4K5AB 5ENSD 4DRXE 2V5QC 3JXJA 5KBAA 1MX6A 2PNNA 4N5QA 3V30A 3J5PA 1K3ZD 3NBNB 4YDWA 2XEEA 5JA4D 2BKKB 2Y1LE 2DWZA
chains in the Genus database with same CATH superfamily
1SZAA 4G23A 4CDRA 4F1SA 4N2SA 2DZNA 4IYPA 3KAEA 2I1JA 3CVNA 1AWCB 5HRYA 3FUFA 3SFXA 3ZUVB 3Q79A 4FA6A 3FTZA 3C3RA 4IULA 4DX1A 1NI1A 3UX4A 2KZTB 5CBOA 3CEQA 3UMVA 5G04C 4Y6CA 5T4YA 3UM1A 4TXPA 2XS8A 3DSVA 3EJNA 4PS3A 2WXOA 3LKUA 5AQ9A 4U0ZA 2XS1A 3ZRHA 4C9BB 4N2QA 3T8KA 4U63A 1Q2ZA 1N9AA 1OWMA 4GPMA 2J8SD 4DK5A 3Q15A 1WAO1 4TV3A 3DPDA 2KCVA 1TR4A 3CK8A 2H6HA 3EHQA 5D0QD 1YYHA 3FH8A 3CGHA 2A4ZA 2HE0A 2Y4TA 3AJIA 5AJLA 2WMNA 2XRZA 4U7EB 4DX2A 4O60A 5CECB 4AEZC 4HI8A 2IQCA 3PZ4A 4A1SA 3PREA 4HLLA 4EBAA 3ABLE 2KCKA 4B0ZA 2R05A 2L6JA 3JXJA 4W9RA 1HZ4A 3U64A 3QARA 5T3RA 2WXHA 3E4BA 3L17A 3AG4E 2NC9A 1ZB1A 3ZYMA 1S63A 1OCOE 4O1PA 2P9NG 2XCCA 3TWRA 1HXIA 3Q5MA 4Z68A 5J90A 4EZJA 2WXFA 3JUEA 5G55A 5AQBA 4CGWA 4HBDA 2Y4UA 2P9KG 4G8LA 2R03A 3Q73A 5JHBA 3TJPA 4AM9A 5LFAA 1RZ4A 4WWNA 4M3OA 3ML8A 4F1PA 5DIZA 1AP7A 2F8YA 3EUVA 1TN6A 1H6KA 5EYLA 3L13A 3AU5A 5E75A 1NL4A 3ZIMA 5DBKA 4HI9A 4GTVA 1YMPA 1Y6IA 2CG3A 4N3BA 1BPOA 2YINA 3MKQA 4TRQA 1SW6A 5LCWC 2H6GA 2XGSA 1OXJA 1H2VC 3TWWA 1E90A 4EPZA 2GGFA 3FUHA 1UOHA 5H7PA 2WXGA 3FUJA 2VSNA 3RJVA 4J8DA 5JJ7A 4L2LA 5BT1A 4DX5D 1BLXB 4A3VA 1NFIE 1FVHA 1TN7A 2ZXWE 4GYWA 3HHMA 3V2XA 4I2ZA 3UINC 2OEVA 3B95A 2WXQA 2GRPB 1OWLA 4MKTA 4XE0A 3TG4A 2X3MA 5CRVA 4KT6B 3CKCA 5A6CA 1E7VA 2FULA 3HRAA 1QZ2A 2RD0A 4DPRA 1H6OA 2IF4A 2ZGDA 4OYSA 4J8FA 3EU9A 4C48B 3CV0A 4DI3A 3ASNE 3FH7A 3DEOA 2LSUA 3D9HA 4JXTA 2F0YA 3LS8A 1UN8A 2IU1A 2HM8A 3V2OA 3LPZA 5EN5D 3UM3A 3N71A 1FT1A 3AG2E 3DPYA 4GTSA 4AY6A 2EILE 4UUCA 3FTVA 1P5QA 2VTBA 2PL2A 3FDHA 4LNUD 2L6BA 2L9BA 4CT4A 4GTRA 2LXMA 1SZ9A 3D9OA 1DCEA 2V4LA 4HS2A 5CCMA 1TYQG 2V8SE 4WWOA 3I4GA 5FWQA 3FH5A 3EHNA 1TNOA 2WQHA 1DVPA 3LYAA 4HORA 1MQSA 2WXPA 5CMWA 3DEPA 3NF1A 3FTUA 3SBSA 3RKVA 4K5BA 4X8QA 4MLPA 1S0PA 5B3SE 3Q9UC 4G8KA 4EECA 4LG6A 3PVLA 3PE3A 4H7YA 3FTXA 3B7RL 4A1GA 3FFLA 4UWLA 4HOUA 4ANUA 4BTAA 2VGXA 3NZSA 4ANXA 2P2CP 3UQ3A 5AYWD 3HXCA 5AJDA 1BU9A 5KJKA 3E30A 4U0SA 2AVPA 2FF4A 3JQ1A 4APFA 4O1OA 3FU0A 5HS0A 3D9NA 2X6KA 3KSQA 4GTTA 4JPSA 2J08A 4K0RA 1PC2A 2PNNA 3UM0A 3HYMB 1IQRA 3J5PA 3NBNB 3UIOC 3MGBA 3EIJA 3CQCB 5T8IA 2GRLA 4AXHA 2I2OA 2A5EA 4FJYA 4YVQC 2IY0C 1XNFA 4LSZE 2R59A 5M72A 3FUNA 4EHMA 4DX7D 3E34A 4GZDA 2VJ8A 4I17A 2DCPA 4I1OB 2LNIA 5FTPA 2BF0X 3SGHA 4BY6A 4ZHBA 4Y6WA 2J4BA 3IKOB 4NURA 3Q78A 5AQAA 4AJWA 5ENTD 5KJLA 2DVWA 3JUIA 2RKKA 1KPSB 2XRYA 2Y3AA 1EPUA 2X38A 4I9EA 4JZYA 3KS2A 4GA1A 3NZUA 4BFRA 4GA0A 1BI7B 1OT8A 2CHZA 1L5JA 4GB9A 3AS5A 2LSVA 3FUIA 5ENNA 4J6IA 4U0UA 3PNTB 2RG8A 5D66A 2L0IA 5KNHD 4KBQA 3QWPA 5BV1A 3TWTA 4L1BA 5EILA 5C2YA 5BUZA 3SZ7A 2QC9A 1Z6TA 5B1AE 3ZXSA 4XX5A 3CVWA 4DRXE 2V5QC 2I1KA 2DIWA 2XEEA 3EU5A 2BKKB 1DC2A 5FIOA 2ZIRA 3UKRG 3S2AA 3UM2A 5ENQD 1BD8A 2KATA 2V5FA 4GZ3A 4FP7A 5EIDA 4KMOA 3JQ0A 2HR2A 3T8MA 3ZW3A 3PZ2A 3P1UA 3PZDA 3U9WA 1RW2A 5CERB 1KZPA 3IXEA 1MHQA 4FU3A 3AG1E 4J8SA 1QQEA 4FJZA 3FTYA 3NAWA 3ASHA 2VTBB 2GRNB 4OVUA 4JW1A 5BXOA 3ESLA 5G05J 4UI9C 3PEUB 3TGOA 4J0UA 2KCLA 3S7DA 4D10C 5BW8C 4CDMA 3ASDA 3MX3A 2VSXE 1KT0A 1NP7A 2MOWA 1TNYA 4HVBA 2WXRA 2PZIA 1EF1C 3ABME 4HOQA 1N0QA 5LOZA 3ZKJA 3MV3B 4RG6A 4DUIA 3LEWA 2DBAA 2BUGA 2KBXA 1Z5SC 5D2MC 1OY3D 4UQZA 1JCQA 4MBGA 1V55E 4A63B 3FULA 2XZTG 2QZAA 4KVOA 1ZBPA 4N5QA 4GYYA 4I1AA 4LERA 1YA0A 1JWFA 3CHSA 2WXJA 4IRUA 5LCWJ 1NA3A 5EYPF 3TG5A 1HG5A 4ZFHA 3ISMC 3DSXA 4HXIA 2J4DA 1H0AA 3Q9NC 2I9CA 2ZU6B 3ABKE 3T5VA 4JC8A 2EIKE 2XPYA 4KYOB 5LP0A 4XKBA 4Q69A 3BQOA 3DSUA 3PS6A 1TEZA 4UI9J 4U95D 2R02A 3LVQE 2KXPC 3UT4A 3TAXA 2UY1A 4TXRA 4XI0A 4ATZD 2WM9A 3AS8A 4CYMD 2XHEA 3X2QE 3SHFA 2WXMA 3I3NA 4B94A 5AN8A 2IONA 3QNKA 1D8DA 2GRQB 4GMLA 1FPPA 3KEZA 3VLDA 4FULA 1HFAA 2OCCE 1N4RA 3IHVA 4HOSA 3R9MA 1HH8A 3L16A 4DX6D 2IOLA 3D9JA 3ML9A 3RK6A 4CT0A 1JPLA 3C5RA 4AIFA 3CLJA 4GYOA 4FC8A 1FVFA 5KNGA 3SF4A 3BEEA 3EIQC 2QYJA 3QK0A 2XGOA 3P2BA 3LJ3A 4ABNA 1PY1A 1H2UA 4DLQA 3SQVA 3TWVA 2E0IA 4GCOA 3ESKA 3EHRA 5JMND 3R9AB 2WMOA 4B93B 2I6HA 4UQXA 4FHJA 4K03A 3GZSA 3L82A 3Q7AA 4U8YD 5A23A 4ANVA 3FUMA 1OCZE 4PH4B 3RO3A 2HYZA 1OWNA 4MS6A 4HFGA 3ZHEA 1Z3XA 2GRRB 3DRAA 2BTDA 3G2UA 2P9SG 1E7UA 4I6GA 4ACKA 4AV7A 1IKND 4WAFA 4YDOA 2C0LA 2RFMA 2HO1A 5FINA 3O48A 4YDYA 1NZNA 3CVYA 2FBNA 3W9FA 2Y69E 5EX0A 3DBSA 5ENRD 1MZCA 1OCCE 3B7BA 4N5CA 4FLBA 3TXNA 3JYSA 3D9LA 2BEDA 3BUAA 3IHYA 1W3BA 4JHJA 4ME2A 4NQ0A 2LAHA 3SBTB 2WXLA 4DI4A 3FU6A 3MJWA 4AP2A 3MEKA 3DXKG 2PQRA 4UWGA 2MHKA 2WXKA 1E8WA 1OUVA 2GROB 2A5UA 4AY5A 5FQ6A 4WUYA 5LX8A 3AU4A 4GPKA 4BTBA 2VSOE 2YNQA 4ILGA 2Q7FA 3QDNA 1TN8A 4L23A 4BWRA 3BG1B 4PS8A 3D9KA 3QAQA 1UJJA 2LXLA 5B1BE 4EQFA 1H2TC 4KVMA 1K1BA 3E32A 3Q49B 4CDNA 5ANLA 1N0RA 4EZKA 1QBQA 3OXLA 3CHQA 3IBEA 5BV0A 4UWKA 3APFA 3ASGA 1LF8A 4J8YA 3OAWA 3DSSA 3PUKA 4U96D 1O1SA 5D0OD 5C1DA 5FZRA 4BERA 3HG0D 5BXUA 4OAUC 2RFAA 2YQ8A 2E2EA 3HXDA 2B0OE 2X6JA 3FY4A 4I9CA 1U3DA 4HNAD 4GMRA 4J7WA 4F3VA 5FQ7A 3MZLB 1MX2A 3LXUX 1WY6A 2ONDA 2R17C 4OAVB 1X81A 2NYJA 4GZCA 1H6PA 4G2VA 4GTPA 4YDWA 3ZFWA 3CK7A 5ENOD 3TWXA 4CRWA 1X5BA 5HKPA 4FADA 4RVBA 3ULEG 2FI7A 5EKQD 2ETBA 3C72A 2AW6A 3G2SA 5JJ6A 5G04J 3FU5A 3NQPA 2NSZA 2OVBA 3HXFA 3MA5A 3KEAA 3UT7A 1SA5A 4WNDA 2LO6A 4JEHA 3UKUG 2JEKA 3UI2A 2Y0BG 5IY5E 3FP3A 4UWHA 4HRLA 4BEPA 1MX4A 2JABA 3QJZA 3RAUA 4BX8A 1HF8A 3ZPJA 4JHKA 3FU3A 3RU0A 3FUDA 3PRZA 4F53A 4KXKB 4LUNU 3O4ZA 3CHMA 4I1MA 3HXEA 5A7DB 1N94A 2IOSA 3MCXA 5CCLA 2P9PG 3ENEA 4XEIG 4CZ2D 3RSEG 3IV0A 4B8AA 2F37A 4U04A 3PE4A 2WB2A 3MYVA 4HRNA 3QB2A 5KBAA 5KCMA 5ENSD 1EYHA 1HO8A 4LNBA 1H19A 3ZHEB 5JJTA 2DWZA 3FTWA 4H7XA 3CVXA 3ONKA 4CEMA 3ZN3A 3VTYA 1LD7A 5FJYA 1N11A 2PM6A 3OTNA 3CSFA 5ITZF 2WXIA 3BG0B 1S70B 1TJCA 3CHPA 1JUQA 3U66A 4GZ6A 3VLEA 4NIKA 3S7FA 5KJMA 5AQ7A 4C0EA 3PEVB 1UG3A 2CFUA 2DYSE 3DWLG 3PDNA 3ASOE 3Q4AB 3T5XA 3IEGA 1UN9A 2GW1A 5JHAA 4E6HA 2X6FA 2IFUA 4WWPA 4FLHA 2WXNA 4E85A 3CSTA 3F6QA 1E8XA 3GW4A 4BSZB 3DSTA 3SFYA 2XGMA 2VSYA 1HU3A 3Q75A 3R7QA 2VGYA 4AOFA 1OCRE 4GZ5A 2L0TB 4I43A 2VGEA 3HVEA 4LCTA 3DXMG 3ZYLA 4UI9K 4KZCA 2CHXA 2VGXB 4XIFA 1TNZA 4JB8P 4Q94A 3ZGQA 2ILRA 2XEHA 3NB2A 5CRUA 1K3ZD 2KM4A 5HI7A 3I5PA 3GYZA 4F6RD 2EIJE 1BI8B 2P9IG 2OEWA 4GU5A 4U8VD 3ZXPA 4Q96A 2XCBA 2P9LG 1IHBA 3UUXA 4BESA 3G2TA 1MYOA 3S7JA 2EQXA 2GRMA 1JCSA 4XZ4A 1KLXA 4JL0A 3B7SA 4EBAG 2R5SA 4QFVA 4K5CA 2EIME 3URZA 3NOCD 3U3WA 3L08A 4CCAA 4M7CA 4ANWA 1O1RA 3KD7A 3TXMA 4KZ0A 2J07A 1ZU2A 3L54A 3CHRA 3CKBA 1E8ZA 3MV2B 5J08A 3CVUA 1SVXA 3E33A 1O5MA 4HQDA 3UIPC 2OV8A 2J49A 1HX8A 4RQIA 3Q7FA 3G2VA 5FQ8A 1N52A 2CFZA 2DYRE 1KT1A 2ETAA 3QWVA 3LJNA 3JXIA 4JA7A 4DLOA 2OOEA 3RRMB 2VYIA 1FCHA 3CIAA 3GZ2A 3CR3A 3ZYQA 4B8CB 3HVEB 1N4SA 3LY8A 2XZDG 4J8EA 4K5AB 1N95A 4MRUA 2QY7A 3D9MA 5JA4D 3RO2A 5BPPA 2WQ7A 4L2YA 5ANRA 4ACLA 4GCNA 1KZOA 3R7RA 2IO2C 3AAAC 2H6IA 4TUMA 3J5QB 1QNFA 3CVPA 1SA4A 4GTOA 3HIZA 2H6FA 3NOGD 4YDEA 1JWGA 1DNPA 2WVIA 4EZLA 3RRNB 3VLFA 2KC7A 1IXVA 2LUHA 3SO8A 1HE8A 4YVOA 3FUEA 3CQGB 2AXUA 2CHWA 2XQ0A 3FHEA 3OXGA 4WNFA 2F8XK 2LAIA 4GMJA 1ELRA 4G11A 1VDYA 3QOUA 2XPIA 5ARGA 2AXVA 4JA9A 1S64A 2R2LA 3DSWA 2J09A 3GZ1A 1UJKA 3TWUA 2BKGA 4LRZA 3CVQA 3B7TA 5ARFA 5FT9A 2XPZA 1SQMA 4G1TA 3L6AA 3L22A 3T9KA 3BU8A 4GTQA 5FZQA 4NACA 2M63A 4GTMA 3FTSA 4ILHB 2C0MA 1D9SA 3HDXA 4BSXA 3PNLB 2FO7A 1ELKA 3K9IA 3AG3E 1TNUA 3D9IA 4PDXA 2MRIA 4HRMB 4A3TA 3SY2A 3U4TA 4DJAA 3EHMA 3UXGA 4RG9A 1WDYA 2VQ2A 3CVVA 2IEJA 4YNDA 3L9TA 5KJNA 1HS6A 3TL5A 4XKCA 1FT2A 4GAAA 1YCSB 3PH0C 2WPVA 4JD2G 4G26A 4TXQA 3SNXA 2UWJG 1EDUA 4PS7A 3JCKC 1V54E 3LVRE 1O1TA 3ULQA 4BETA 5FQ4A 4G24A 5CEAA 5EX3A 4LEUA 1XGWA 3QKYA 5KWDA 1Z3YA 3HXBA 4ATGA 2JLBA 3ASFA 4HOTA 4XI9A 3Q47B 4F7AA 4I6JA 3LY9A 4I6EA 3RRUA 4N39A 4TUUA 4WNGA 2AWIA 3I4RB 5CMYA 2PM7A 4R7LA 4CGVA 3MKRA 4NRHB 1N4QA 4PUCA 1HG2A 4JEUA 3CVLA 1G3NB 3FWVA 5AIJA 4AVXA 3WG7E 4UQYA 4HLEA 1Y8MA 2YHEA 3CHOA 2IJGX 1TNBA 3RIBA 3UPVA 4JHRA 2WQ6A 4LNGA 3FUKA 1UW4B 1IQUA 3CK9A 3PZ3A 3EDTB 1E8YA 3C3QA 5EDSA 1OWPA 2MYOA 3SFZA 5G05C 2IO3C 3LY7A 5AARA 3KSLA 1A17A 3LCAA 2X6IA 1INZA 4BX9A 1MJ0A 1K1AA 5AAOA 2P9UG 3ZNGA 2C2LA 1E96B 2ETCA 3E37A 2XENA 5G2NA 1GW6A 4L9PA 3V31A 4G25A 5E76A 1D8EA 5CBNA 2KZTA 4N3CA 3B7UX 2FO1E 2XEVA 3FEYA 2UY1B 3PZ1A 4O6FA 2YHCA 5HQ8A 1OWOA 5BNWA 3VTXA 1QYMA 3APDA 4WNEA 3PUJA 1LD8A 1MX6A 2PQNA 1IHGA 4C0MA 2Y1LE 3D3MA 3APCA 4N3AA 4U07A 2QFCA 3ONLA 3AS4A 1WM5A 3SD5A 4BT8A 3OXFA 1NA0A 4I2WA 1K8KG 1U2VG 2V4HC 3MKQB 1A5EA 4HB5A 4URKA 4V3IA 3C3OA 1TJFA 2V0PA 3TWQA 2B6CA 3WXXA 4QQIA 2AXZA 2X6HA 2CG2A 1DCQA 1WG0A 1B89A 4BT9A 3UT8A 4APOA 4A55A 2P58C 3V79K 3ZEFA 4L7TA 4GA2A 4P29A 1IYGA 1ELWA 3G2WA 4U8HA 5CEDB 4JVSA 1PAQA 2NXPA 2ZISA 3ZYKA 3ULYA 3C98A 3LDZA 2ZGGA 4OVVA 4RLYA 3TWSA 4B89A 4IN3B 3ZVVA 2FEZA 3W9GA 4ILIA 2DZOA 3SI5A 2AJAA 3UTMA 2J9QA 5CHEE 2OVFA 3D9PA 1U3CA 5EIBE 3S7BA 1JCRA 3QWWA 4FHKA 1N54A 5ENPD 5FZSA 2EINE 3QC1A 3FEXA 3ZU7B 3B13A 4UWFA 5AENA 3V30A 1N4PA 1LTXA 4RSYA 2QYUA
chains in the Genus database with same CATH topology
5ENOD 3TWXA 4F6RD 1G3NB 5KNGA 1DC2A 5FIOA 1BI8B 2A5EA 5HKPA 4DX5D 4HRMB 1BLXB 4LSZE 4O1PA 2DZNA 1NFIE 4U8VD 5EYPF 2ETBA 4DX7D 5ENQD 1N11A 4ZFHA 1AWCB 1BD8A 2QYJA 5HRYA 5ITZF 1IHBA 3TWRA 3ZUVB 2V4HC 3AAAC 5EIDA 3V2XA 1A5EA 1S70B 4HB5A 4Z68A 4TUMA 3B95A 3J5QB 3TWVA 4BESA 4DX1A 3Q9NC 1MYOA 5CBOA 3UXGA 3EHRA 1WDYA 3DEPA 3NOGD 5JMND 3JUEA 3TWQA 3KEAA 4NIKA 4QFVA 5AQBA 4K5CA 4ZHBA 4B93B 3NOCD 4HBDA 4QQIA 5CERB 5AQ7A 4K5BA 4G8LA 3IXEA 2MYOA 1YCSB 4U8YD 1DCQA 1WG0A 5AQ9A 3UI2A 1IXVA 5AQAA 2Y0BG 3Q9UC 5ENTD 4U95D 3SO8A 4G8KA 2DVWA 3V79K 2KXPC 4LG6A 5AARA 3T8KA 3HRAA 1K1BA 4F1PA 4HRLA 5BXOA 1N0RA 4BEPA 1AP7A 1MX4A 2F8YA 2JABA 4BETA 5CEDB 1SVXA 4GPMA 2J8SD 4HQDA 4ATZD 1MJ0A 2F8XK 1K1AA 4J8YA 5AAOA 3F6QA 5EYLA 2ZGDA 1BI7B 1OT8A 5CEAA 4CYMD 4U96D 3ZNGA 2P2CP 1TR4A 4BSZB 3EU9A 4HI9A 3EHQA 4C48B 5KWDA 2ETCA 1YMPA 5AN8A 1YYHA 1IKND 2XENA 3HG0D 4BERA 2ETAA 5BXUA 4OAUC 3DEOA 2HE0A 3LJNA 2RFMA 3TWUA 5FINA 3D9HA 1BU9A 3JXIA 2ZGGA 2RFAA 3AJIA 2BKGA 3V31A 1N0QA 4RLYA 4YDYA 3TWSA 3ZKJA 3W9FA 2B0OE 4DUIA 5CBNA 3V2OA 3W9GA 5EN5D 1SW6A 2DZOA 4HNAD 2KBXA 5D66A 5ENRD 4GMRA 3B7BA 4J7WA 5KNHD 3T9KA 4O1OA 2VGEA 2AJAA 3TWTA 3TWWA 4O60A 4DX2A 2FO1E 5EILA 5HS0A 3UTMA 5CECB 5EIBE 1MX2A 4HI8A 2QC9A 1OY3D 4CZ2D 4UUCA 4JB8P 4OAVB 1QYMA 2F37A 5ENPD 4DX6D 4HLLA 2XEHA 4A63B 2NYJA 4LNUD 2L6BA 1UOHA 2XZDG 4HRNA 2XZTG 3C5RA 3ZU7B 1D9SA 4K5AB 5ENSD 4DRXE 2V5QC 3JXJA 5KBAA 1MX6A 2PNNA 4N5QA 3V30A 3J5PA 1K3ZD 3NBNB 4YDWA 2XEEA 5JA4D 2BKKB 2Y1LE 2DWZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ENO D;  3TWX A;  4F6R D;  1G3N B;  5KNG A;  1DC2 A;  5FIO A;  1BI8 B;  2A5E A;  5HKP A;  4DX5 D;  4HRM B;  1BLX B;  4LSZ E;  4O1P A;  2DZN A;  1NFI E;  4U8V D;  5EYP F;  2ETB A;  4DX7 D;  5ENQ D;  1N11 A;  4ZFH A;  1AWC B;  1BD8 A;  2QYJ A;  5HRY A;  5ITZ F;  1IHB A;  3TWR A;  3ZUV B;  2V4H C;  3AAA C;  5EID A;  3V2X A;  1A5E A;  1S70 B;  4HB5 A;  4Z68 A;  4TUM A;  3B95 A;  3J5Q B;  3TWV A;  4BES A;  4DX1 A;  3Q9N C;  1MYO A;  5CBO A;  3UXG A;  3EHR A;  1WDY A;  3DEP A;  3NOG D;  5JMN D;  3JUE A;  3TWQ A;  3KEA A;  4NIK A;  4QFV A;  5AQB A;  4K5C A;  4ZHB A;  4B93 B;  3NOC D;  4HBD A;  4QQI A;  5CER B;  5AQ7 A;  4K5B A;  4G8L A;  3IXE A;  2MYO A;  1YCS B;  4U8Y D;  1DCQ A;  1WG0 A;  5AQ9 A;  3UI2 A;  1IXV A;  5AQA A;  2Y0B G;  3Q9U C;  5ENT D;  4U95 D;  3SO8 A;  4G8K A;  2DVW A;  3V79 K;  2KXP C;  4LG6 A;  5AAR A;  3T8K A;  3HRA A;  1K1B A;  4F1P A;  4HRL A;  5BXO A;  1N0R A;  4BEP A;  1AP7 A;  1MX4 A;  2F8Y A;  2JAB A;  4BET A;  5CED B;  1SVX A;  4GPM A;  2J8S D;  4HQD A;  4ATZ D;  1MJ0 A;  2F8X K;  1K1A A;  4J8Y A;  5AAO A;  3F6Q A;  5EYL A;  2ZGD A;  1BI7 B;  1OT8 A;  5CEA A;  4CYM D;  4U96 D;  3ZNG A;  2P2C P;  1TR4 A;  4BSZ B;  3EU9 A;  4HI9 A;  3EHQ A;  4C48 B;  5KWD A;  2ETC A;  1YMP A;  5AN8 A;  1YYH A;  1IKN D;  2XEN A;  3HG0 D;  4BER A;  2ETA A;  5BXU A;  4OAU C;  3DEO A;  2HE0 A;  3LJN A;  2RFM A;  3TWU A;  5FIN A;  3D9H A;  1BU9 A;  3JXI A;  2ZGG A;  2RFA A;  3AJI A;  2BKG A;  3V31 A;  1N0Q A;  4RLY A;  4YDY A;  3TWS A;  3ZKJ A;  3W9F A;  2B0O E;  4DUI A;  5CBN A;  3V2O A;  3W9G A;  5EN5 D;  1SW6 A;  2DZO A;  4HNA D;  2KBX A;  5D66 A;  5ENR D;  4GMR A;  3B7B A;  4J7W A;  5KNH D;  3T9K A;  4O1O A;  2VGE A;  2AJA A;  3TWT A;  3TWW A;  4O60 A;  4DX2 A;  2FO1 E;  5EIL A;  5HS0 A;  3UTM A;  5CEC B;  5EIB E;  1MX2 A;  4HI8 A;  2QC9 A;  1OY3 D;  4CZ2 D;  4UUC A;  4JB8 P;  4OAV B;  1QYM A;  2F37 A;  5ENP D;  4DX6 D;  4HLL A;  2XEH A;  4A63 B;  2NYJ A;  4LNU D;  2L6B A;  1UOH A;  2XZD G;  4HRN A;  2XZT G;  3C5R A;  3ZU7 B;  1D9S A;  4K5A B;  5ENS D;  4DRX E;  2V5Q C;  3JXJ A;  5KBA A;  1MX6 A;  2PNN A;  4N5Q A;  3V30 A;  3J5P A;  1K3Z D;  3NBN B;  4YDW A;  2XEE A;  5JA4 D;  2BKK B;  2Y1L E;  2DWZ A; 
#chains in the Genus database with same CATH topology
 1SZA A;  4G23 A;  4CDR A;  4F1S A;  4N2S A;  2DZN A;  4IYP A;  3KAE A;  2I1J A;  3CVN A;  1AWC B;  5HRY A;  3FUF A;  3SFX A;  3ZUV B;  3Q79 A;  4FA6 A;  3FTZ A;  3C3R A;  4IUL A;  4DX1 A;  1NI1 A;  3UX4 A;  2KZT B;  5CBO A;  3CEQ A;  3UMV A;  5G04 C;  4Y6C A;  5T4Y A;  3UM1 A;  4TXP A;  2XS8 A;  3DSV A;  3EJN A;  4PS3 A;  2WXO A;  3LKU A;  5AQ9 A;  4U0Z A;  2XS1 A;  3ZRH A;  4C9B B;  4N2Q A;  3T8K A;  4U63 A;  1Q2Z A;  1N9A A;  1OWM A;  4GPM A;  2J8S D;  4DK5 A;  3Q15 A;  1WAO 1;  4TV3 A;  3DPD A;  2KCV A;  1TR4 A;  3CK8 A;  2H6H A;  3EHQ A;  5D0Q D;  1YYH A;  3FH8 A;  3CGH A;  2A4Z A;  2HE0 A;  2Y4T A;  3AJI A;  5AJL A;  2WMN A;  2XRZ A;  4U7E B;  4DX2 A;  4O60 A;  5CEC B;  4AEZ C;  4HI8 A;  2IQC A;  3PZ4 A;  4A1S A;  3PRE A;  4HLL A;  4EBA A;  3ABL E;  2KCK A;  4B0Z A;  2R05 A;  2L6J A;  3JXJ A;  4W9R A;  1HZ4 A;  3U64 A;  3QAR A;  5T3R A;  2WXH A;  3E4B A;  3L17 A;  3AG4 E;  2NC9 A;  1ZB1 A;  3ZYM A;  1S63 A;  1OCO E;  4O1P A;  2P9N G;  2XCC A;  3TWR A;  1HXI A;  3Q5M A;  4Z68 A;  5J90 A;  4EZJ A;  2WXF A;  3JUE A;  5G55 A;  5AQB A;  4CGW A;  4HBD A;  2Y4U A;  2P9K G;  4G8L A;  2R03 A;  3Q73 A;  5JHB A;  3TJP A;  4AM9 A;  5LFA A;  1RZ4 A;  4WWN A;  4M3O A;  3ML8 A;  4F1P A;  5DIZ A;  1AP7 A;  2F8Y A;  3EUV A;  1TN6 A;  1H6K A;  5EYL A;  3L13 A;  3AU5 A;  5E75 A;  1NL4 A;  3ZIM A;  5DBK A;  4HI9 A;  4GTV A;  1YMP A;  1Y6I A;  2CG3 A;  4N3B A;  1BPO A;  2YIN A;  3MKQ A;  4TRQ A;  1SW6 A;  5LCW C;  2H6G A;  2XGS A;  1OXJ A;  1H2V C;  3TWW A;  1E90 A;  4EPZ A;  2GGF A;  3FUH A;  1UOH A;  5H7P A;  2WXG A;  3FUJ A;  2VSN A;  3RJV A;  4J8D A;  5JJ7 A;  4L2L A;  5BT1 A;  4DX5 D;  1BLX B;  4A3V A;  1NFI E;  1FVH A;  1TN7 A;  2ZXW E;  4GYW A;  3HHM A;  3V2X A;  4I2Z A;  3UIN C;  2OEV A;  3B95 A;  2WXQ A;  2GRP B;  1OWL A;  4MKT A;  4XE0 A;  3TG4 A;  2X3M A;  5CRV A;  4KT6 B;  3CKC A;  5A6C A;  1E7V A;  2FUL A;  3HRA A;  1QZ2 A;  2RD0 A;  4DPR A;  1H6O A;  2IF4 A;  2ZGD A;  4OYS A;  4J8F A;  3EU9 A;  4C48 B;  3CV0 A;  4DI3 A;  3ASN E;  3FH7 A;  3DEO A;  2LSU A;  3D9H A;  4JXT A;  2F0Y A;  3LS8 A;  1UN8 A;  2IU1 A;  2HM8 A;  3V2O A;  3LPZ A;  5EN5 D;  3UM3 A;  3N71 A;  1FT1 A;  3AG2 E;  3DPY A;  4GTS A;  4AY6 A;  2EIL E;  4UUC A;  3FTV A;  1P5Q A;  2VTB A;  2PL2 A;  3FDH A;  4LNU D;  2L6B A;  2L9B A;  4CT4 A;  4GTR A;  2LXM A;  1SZ9 A;  3D9O A;  1DCE A;  2V4L A;  4HS2 A;  5CCM A;  1TYQ G;  2V8S E;  4WWO A;  3I4G A;  5FWQ A;  3FH5 A;  3EHN A;  1TNO A;  2WQH A;  1DVP A;  3LYA A;  4HOR A;  1MQS A;  2WXP A;  5CMW A;  3DEP A;  3NF1 A;  3FTU A;  3SBS A;  3RKV A;  4K5B A;  4X8Q A;  4MLP A;  1S0P A;  5B3S E;  3Q9U C;  4G8K A;  4EEC A;  4LG6 A;  3PVL A;  3PE3 A;  4H7Y A;  3FTX A;  3B7R L;  4A1G A;  3FFL A;  4UWL A;  4HOU A;  4ANU A;  4BTA A;  2VGX A;  3NZS A;  4ANX A;  2P2C P;  3UQ3 A;  5AYW D;  3HXC A;  5AJD A;  1BU9 A;  5KJK A;  3E30 A;  4U0S A;  2AVP A;  2FF4 A;  3JQ1 A;  4APF A;  4O1O A;  3FU0 A;  5HS0 A;  3D9N A;  2X6K A;  3KSQ A;  4GTT A;  4JPS A;  2J08 A;  4K0R A;  1PC2 A;  2PNN A;  3UM0 A;  3HYM B;  1IQR A;  3J5P A;  3NBN B;  3UIO C;  3MGB A;  3EIJ A;  3CQC B;  5T8I A;  2GRL A;  4AXH A;  2I2O A;  2A5E A;  4FJY A;  4YVQ C;  2IY0 C;  1XNF A;  4LSZ E;  2R59 A;  5M72 A;  3FUN A;  4EHM A;  4DX7 D;  3E34 A;  4GZD A;  2VJ8 A;  4I17 A;  2DCP A;  4I1O B;  2LNI A;  5FTP A;  2BF0 X;  3SGH A;  4BY6 A;  4ZHB A;  4Y6W A;  2J4B A;  3IKO B;  4NUR A;  3Q78 A;  5AQA A;  4AJW A;  5ENT D;  5KJL A;  2DVW A;  3JUI A;  2RKK A;  1KPS B;  2XRY A;  2Y3A A;  1EPU A;  2X38 A;  4I9E A;  4JZY A;  3KS2 A;  4GA1 A;  3NZU A;  4BFR A;  4GA0 A;  1BI7 B;  1OT8 A;  2CHZ A;  1L5J A;  4GB9 A;  3AS5 A;  2LSV A;  3FUI A;  5ENN A;  4J6I A;  4U0U A;  3PNT B;  2RG8 A;  5D66 A;  2L0I A;  5KNH D;  4KBQ A;  3QWP A;  5BV1 A;  3TWT A;  4L1B A;  5EIL A;  5C2Y A;  5BUZ A;  3SZ7 A;  2QC9 A;  1Z6T A;  5B1A E;  3ZXS A;  4XX5 A;  3CVW A;  4DRX E;  2V5Q C;  2I1K A;  2DIW A;  2XEE A;  3EU5 A;  2BKK B;  1DC2 A;  5FIO A;  2ZIR A;  3UKR G;  3S2A A;  3UM2 A;  5ENQ D;  1BD8 A;  2KAT A;  2V5F A;  4GZ3 A;  4FP7 A;  5EID A;  4KMO A;  3JQ0 A;  2HR2 A;  3T8M A;  3ZW3 A;  3PZ2 A;  3P1U A;  3PZD A;  3U9W A;  1RW2 A;  5CER B;  1KZP A;  3IXE A;  1MHQ A;  4FU3 A;  3AG1 E;  4J8S A;  1QQE A;  4FJZ A;  3FTY A;  3NAW A;  3ASH A;  2VTB B;  2GRN B;  4OVU A;  4JW1 A;  5BXO A;  3ESL A;  5G05 J;  4UI9 C;  3PEU B;  3TGO A;  4J0U A;  2KCL A;  3S7D A;  4D10 C;  5BW8 C;  4CDM A;  3ASD A;  3MX3 A;  2VSX E;  1KT0 A;  1NP7 A;  2MOW A;  1TNY A;  4HVB A;  2WXR A;  2PZI A;  1EF1 C;  3ABM E;  4HOQ A;  1N0Q A;  5LOZ A;  3ZKJ A;  3MV3 B;  4RG6 A;  4DUI A;  3LEW A;  2DBA A;  2BUG A;  2KBX A;  1Z5S C;  5D2M C;  1OY3 D;  4UQZ A;  1JCQ A;  4MBG A;  1V55 E;  4A63 B;  3FUL A;  2XZT G;  2QZA A;  4KVO A;  1ZBP A;  4N5Q A;  4GYY A;  4I1A A;  4LER A;  1YA0 A;  1JWF A;  3CHS A;  2WXJ A;  4IRU A;  5LCW J;  1NA3 A;  5EYP F;  3TG5 A;  1HG5 A;  4ZFH A;  3ISM C;  3DSX A;  4HXI A;  2J4D A;  1H0A A;  3Q9N C;  2I9C A;  2ZU6 B;  3ABK E;  3T5V A;  4JC8 A;  2EIK E;  2XPY A;  4KYO B;  5LP0 A;  4XKB A;  4Q69 A;  3BQO A;  3DSU A;  3PS6 A;  1TEZ A;  4UI9 J;  4U95 D;  2R02 A;  3LVQ E;  2KXP C;  3UT4 A;  3TAX A;  2UY1 A;  4TXR A;  4XI0 A;  4ATZ D;  2WM9 A;  3AS8 A;  4CYM D;  2XHE A;  3X2Q E;  3SHF A;  2WXM A;  3I3N A;  4B94 A;  5AN8 A;  2ION A;  3QNK A;  1D8D A;  2GRQ B;  4GML A;  1FPP A;  3KEZ A;  3VLD A;  4FUL A;  1HFA A;  2OCC E;  1N4R A;  3IHV A;  4HOS A;  3R9M A;  1HH8 A;  3L16 A;  4DX6 D;  2IOL A;  3D9J A;  3ML9 A;  3RK6 A;  4CT0 A;  1JPL A;  3C5R A;  4AIF A;  3CLJ A;  4GYO A;  4FC8 A;  1FVF A;  5KNG A;  3SF4 A;  3BEE A;  3EIQ C;  2QYJ A;  3QK0 A;  2XGO A;  3P2B A;  3LJ3 A;  4ABN A;  1PY1 A;  1H2U A;  4DLQ A;  3SQV A;  3TWV A;  2E0I A;  4GCO A;  3ESK A;  3EHR A;  5JMN D;  3R9A B;  2WMO A;  4B93 B;  2I6H A;  4UQX A;  4FHJ A;  4K03 A;  3GZS A;  3L82 A;  3Q7A A;  4U8Y D;  5A23 A;  4ANV A;  3FUM A;  1OCZ E;  4PH4 B;  3RO3 A;  2HYZ A;  1OWN A;  4MS6 A;  4HFG A;  3ZHE A;  1Z3X A;  2GRR B;  3DRA A;  2BTD A;  3G2U A;  2P9S G;  1E7U A;  4I6G A;  4ACK A;  4AV7 A;  1IKN D;  4WAF A;  4YDO A;  2C0L A;  2RFM A;  2HO1 A;  5FIN A;  3O48 A;  4YDY A;  1NZN A;  3CVY A;  2FBN A;  3W9F A;  2Y69 E;  5EX0 A;  3DBS A;  5ENR D;  1MZC A;  1OCC E;  3B7B A;  4N5C A;  4FLB A;  3TXN A;  3JYS A;  3D9L A;  2BED A;  3BUA A;  3IHY A;  1W3B A;  4JHJ A;  4ME2 A;  4NQ0 A;  2LAH A;  3SBT B;  2WXL A;  4DI4 A;  3FU6 A;  3MJW A;  4AP2 A;  3MEK A;  3DXK G;  2PQR A;  4UWG A;  2MHK A;  2WXK A;  1E8W A;  1OUV A;  2GRO B;  2A5U A;  4AY5 A;  5FQ6 A;  4WUY A;  5LX8 A;  3AU4 A;  4GPK A;  4BTB A;  2VSO E;  2YNQ A;  4ILG A;  2Q7F A;  3QDN A;  1TN8 A;  4L23 A;  4BWR A;  3BG1 B;  4PS8 A;  3D9K A;  3QAQ A;  1UJJ A;  2LXL A;  5B1B E;  4EQF A;  1H2T C;  4KVM A;  1K1B A;  3E32 A;  3Q49 B;  4CDN A;  5ANL A;  1N0R A;  4EZK A;  1QBQ A;  3OXL A;  3CHQ A;  3IBE A;  5BV0 A;  4UWK A;  3APF A;  3ASG A;  1LF8 A;  4J8Y A;  3OAW A;  3DSS A;  3PUK A;  4U96 D;  1O1S A;  5D0O D;  5C1D A;  5FZR A;  4BER A;  3HG0 D;  5BXU A;  4OAU C;  2RFA A;  2YQ8 A;  2E2E A;  3HXD A;  2B0O E;  2X6J A;  3FY4 A;  4I9C A;  1U3D A;  4HNA D;  4GMR A;  4J7W A;  4F3V A;  5FQ7 A;  3MZL B;  1MX2 A;  3LXU X;  1WY6 A;  2OND A;  2R17 C;  4OAV B;  1X81 A;  2NYJ A;  4GZC A;  1H6P A;  4G2V A;  4GTP A;  4YDW A;  3ZFW A;  3CK7 A;  5ENO D;  3TWX A;  4CRW A;  1X5B A;  5HKP A;  4FAD A;  4RVB A;  3ULE G;  2FI7 A;  5EKQ D;  2ETB A;  3C72 A;  2AW6 A;  3G2S A;  5JJ6 A;  5G04 J;  3FU5 A;  3NQP A;  2NSZ A;  2OVB A;  3HXF A;  3MA5 A;  3KEA A;  3UT7 A;  1SA5 A;  4WND A;  2LO6 A;  4JEH A;  3UKU G;  2JEK A;  3UI2 A;  2Y0B G;  5IY5 E;  3FP3 A;  4UWH A;  4HRL A;  4BEP A;  1MX4 A;  2JAB A;  3QJZ A;  3RAU A;  4BX8 A;  1HF8 A;  3ZPJ A;  4JHK A;  3FU3 A;  3RU0 A;  3FUD A;  3PRZ A;  4F53 A;  4KXK B;  4LUN U;  3O4Z A;  3CHM A;  4I1M A;  3HXE A;  5A7D B;  1N94 A;  2IOS A;  3MCX A;  5CCL A;  2P9P G;  3ENE A;  4XEI G;  4CZ2 D;  3RSE G;  3IV0 A;  4B8A A;  2F37 A;  4U04 A;  3PE4 A;  2WB2 A;  3MYV A;  4HRN A;  3QB2 A;  5KBA A;  5KCM A;  5ENS D;  1EYH A;  1HO8 A;  4LNB A;  1H19 A;  3ZHE B;  5JJT A;  2DWZ A;  3FTW A;  4H7X A;  3CVX A;  3ONK A;  4CEM A;  3ZN3 A;  3VTY A;  1LD7 A;  5FJY A;  1N11 A;  2PM6 A;  3OTN A;  3CSF A;  5ITZ F;  2WXI A;  3BG0 B;  1S70 B;  1TJC A;  3CHP A;  1JUQ A;  3U66 A;  4GZ6 A;  3VLE A;  4NIK A;  3S7F A;  5KJM A;  5AQ7 A;  4C0E A;  3PEV B;  1UG3 A;  2CFU A;  2DYS E;  3DWL G;  3PDN A;  3ASO E;  3Q4A B;  3T5X A;  3IEG A;  1UN9 A;  2GW1 A;  5JHA A;  4E6H A;  2X6F A;  2IFU A;  4WWP A;  4FLH A;  2WXN A;  4E85 A;  3CST A;  3F6Q A;  1E8X A;  3GW4 A;  4BSZ B;  3DST A;  3SFY A;  2XGM A;  2VSY A;  1HU3 A;  3Q75 A;  3R7Q A;  2VGY A;  4AOF A;  1OCR E;  4GZ5 A;  2L0T B;  4I43 A;  2VGE A;  3HVE A;  4LCT A;  3DXM G;  3ZYL A;  4UI9 K;  4KZC A;  2CHX A;  2VGX B;  4XIF A;  1TNZ A;  4JB8 P;  4Q94 A;  3ZGQ A;  2ILR A;  2XEH A;  3NB2 A;  5CRU A;  1K3Z D;  2KM4 A;  5HI7 A;  3I5P A;  3GYZ A;  4F6R D;  2EIJ E;  1BI8 B;  2P9I G;  2OEW A;  4GU5 A;  4U8V D;  3ZXP A;  4Q96 A;  2XCB A;  2P9L G;  1IHB A;  3UUX A;  4BES A;  3G2T A;  1MYO A;  3S7J A;  2EQX A;  2GRM A;  1JCS A;  4XZ4 A;  1KLX A;  4JL0 A;  3B7S A;  4EBA G;  2R5S A;  4QFV A;  4K5C A;  2EIM E;  3URZ A;  3NOC D;  3U3W A;  3L08 A;  4CCA A;  4M7C A;  4ANW A;  1O1R A;  3KD7 A;  3TXM A;  4KZ0 A;  2J07 A;  1ZU2 A;  3L54 A;  3CHR A;  3CKB A;  1E8Z A;  3MV2 B;  5J08 A;  3CVU A;  1SVX A;  3E33 A;  1O5M A;  4HQD A;  3UIP C;  2OV8 A;  2J49 A;  1HX8 A;  4RQI A;  3Q7F A;  3G2V A;  5FQ8 A;  1N52 A;  2CFZ A;  2DYR E;  1KT1 A;  2ETA A;  3QWV A;  3LJN A;  3JXI A;  4JA7 A;  4DLO A;  2OOE A;  3RRM B;  2VYI A;  1FCH A;  3CIA A;  3GZ2 A;  3CR3 A;  3ZYQ A;  4B8C B;  3HVE B;  1N4S A;  3LY8 A;  2XZD G;  4J8E A;  4K5A B;  1N95 A;  4MRU A;  2QY7 A;  3D9M A;  5JA4 D;  3RO2 A;  5BPP A;  2WQ7 A;  4L2Y A;  5ANR A;  4ACL A;  4GCN A;  1KZO A;  3R7R A;  2IO2 C;  3AAA C;  2H6I A;  4TUM A;  3J5Q B;  1QNF A;  3CVP A;  1SA4 A;  4GTO A;  3HIZ A;  2H6F A;  3NOG D;  4YDE A;  1JWG A;  1DNP A;  2WVI A;  4EZL A;  3RRN B;  3VLF A;  2KC7 A;  1IXV A;  2LUH A;  3SO8 A;  1HE8 A;  4YVO A;  3FUE A;  3CQG B;  2AXU A;  2CHW A;  2XQ0 A;  3FHE A;  3OXG A;  4WNF A;  2F8X K;  2LAI A;  4GMJ A;  1ELR A;  4G11 A;  1VDY A;  3QOU A;  2XPI A;  5ARG A;  2AXV A;  4JA9 A;  1S64 A;  2R2L A;  3DSW A;  2J09 A;  3GZ1 A;  1UJK A;  3TWU A;  2BKG A;  4LRZ A;  3CVQ A;  3B7T A;  5ARF A;  5FT9 A;  2XPZ A;  1SQM A;  4G1T A;  3L6A A;  3L22 A;  3T9K A;  3BU8 A;  4GTQ A;  5FZQ A;  4NAC A;  2M63 A;  4GTM A;  3FTS A;  4ILH B;  2C0M A;  1D9S A;  3HDX A;  4BSX A;  3PNL B;  2FO7 A;  1ELK A;  3K9I A;  3AG3 E;  1TNU A;  3D9I A;  4PDX A;  2MRI A;  4HRM B;  4A3T A;  3SY2 A;  3U4T A;  4DJA A;  3EHM A;  3UXG A;  4RG9 A;  1WDY A;  2VQ2 A;  3CVV A;  2IEJ A;  4YND A;  3L9T A;  5KJN A;  1HS6 A;  3TL5 A;  4XKC A;  1FT2 A;  4GAA A;  1YCS B;  3PH0 C;  2WPV A;  4JD2 G;  4G26 A;  4TXQ A;  3SNX A;  2UWJ G;  1EDU A;  4PS7 A;  3JCK C;  1V54 E;  3LVR E;  1O1T A;  3ULQ A;  4BET A;  5FQ4 A;  4G24 A;  5CEA A;  5EX3 A;  4LEU A;  1XGW A;  3QKY A;  5KWD A;  1Z3Y A;  3HXB A;  4ATG A;  2JLB A;  3ASF A;  4HOT A;  4XI9 A;  3Q47 B;  4F7A A;  4I6J A;  3LY9 A;  4I6E A;  3RRU A;  4N39 A;  4TUU A;  4WNG A;  2AWI A;  3I4R B;  5CMY A;  2PM7 A;  4R7L A;  4CGV A;  3MKR A;  4NRH B;  1N4Q A;  4PUC A;  1HG2 A;  4JEU A;  3CVL A;  1G3N B;  3FWV A;  5AIJ A;  4AVX A;  3WG7 E;  4UQY A;  4HLE A;  1Y8M A;  2YHE A;  3CHO A;  2IJG X;  1TNB A;  3RIB A;  3UPV A;  4JHR A;  2WQ6 A;  4LNG A;  3FUK A;  1UW4 B;  1IQU A;  3CK9 A;  3PZ3 A;  3EDT B;  1E8Y A;  3C3Q A;  5EDS A;  1OWP A;  2MYO A;  3SFZ A;  5G05 C;  2IO3 C;  3LY7 A;  5AAR A;  3KSL A;  1A17 A;  3LCA A;  2X6I A;  1INZ A;  4BX9 A;  1MJ0 A;  1K1A A;  5AAO A;  2P9U G;  3ZNG A;  2C2L A;  1E96 B;  2ETC A;  3E37 A;  2XEN A;  5G2N A;  1GW6 A;  4L9P A;  3V31 A;  4G25 A;  5E76 A;  1D8E A;  5CBN A;  2KZT A;  4N3C A;  3B7U X;  2FO1 E;  2XEV A;  3FEY A;  2UY1 B;  3PZ1 A;  4O6F A;  2YHC A;  5HQ8 A;  1OWO A;  5BNW A;  3VTX A;  1QYM A;  3APD A;  4WNE A;  3PUJ A;  1LD8 A;  1MX6 A;  2PQN A;  1IHG A;  4C0M A;  2Y1L E;  3D3M A;  3APC A;  4N3A A;  4U07 A;  2QFC A;  3ONL A;  3AS4 A;  1WM5 A;  3SD5 A;  4BT8 A;  3OXF A;  1NA0 A;  4I2W A;  1K8K G;  1U2V G;  2V4H C;  3MKQ B;  1A5E A;  4HB5 A;  4URK A;  4V3I A;  3C3O A;  1TJF A;  2V0P A;  3TWQ A;  2B6C A;  3WXX A;  4QQI A;  2AXZ A;  2X6H A;  2CG2 A;  1DCQ A;  1WG0 A;  1B89 A;  4BT9 A;  3UT8 A;  4APO A;  4A55 A;  2P58 C;  3V79 K;  3ZEF A;  4L7T A;  4GA2 A;  4P29 A;  1IYG A;  1ELW A;  3G2W A;  4U8H A;  5CED B;  4JVS A;  1PAQ A;  2NXP A;  2ZIS A;  3ZYK A;  3ULY A;  3C98 A;  3LDZ A;  2ZGG A;  4OVV A;  4RLY A;  3TWS A;  4B89 A;  4IN3 B;  3ZVV A;  2FEZ A;  3W9G A;  4ILI A;  2DZO A;  3SI5 A;  2AJA A;  3UTM A;  2J9Q A;  5CHE E;  2OVF A;  3D9P A;  1U3C A;  5EIB E;  3S7B A;  1JCR A;  3QWW A;  4FHK A;  1N54 A;  5ENP D;  5FZS A;  2EIN E;  3QC1 A;  3FEX A;  3ZU7 B;  3B13 A;  4UWF A;  5AEN A;  3V30 A;  1N4P A;  1LTX A;  4RSY A;  2QYU A; 
#chains in the Genus database with same CATH homology
 5ENO D;  3TWX A;  4F6R D;  1G3N B;  5KNG A;  1DC2 A;  5FIO A;  1BI8 B;  2A5E A;  5HKP A;  4DX5 D;  4HRM B;  1BLX B;  4LSZ E;  4O1P A;  2DZN A;  1NFI E;  4U8V D;  5EYP F;  2ETB A;  4DX7 D;  5ENQ D;  1N11 A;  4ZFH A;  1AWC B;  1BD8 A;  2QYJ A;  5HRY A;  5ITZ F;  1IHB A;  3TWR A;  3ZUV B;  2V4H C;  3AAA C;  5EID A;  3V2X A;  1A5E A;  1S70 B;  4HB5 A;  4Z68 A;  4TUM A;  3B95 A;  3J5Q B;  3TWV A;  4BES A;  4DX1 A;  3Q9N C;  1MYO A;  5CBO A;  3UXG A;  3EHR A;  1WDY A;  3DEP A;  3NOG D;  5JMN D;  3JUE A;  3TWQ A;  3KEA A;  4NIK A;  4QFV A;  5AQB A;  4K5C A;  4ZHB A;  4B93 B;  3NOC D;  4HBD A;  4QQI A;  5CER B;  5AQ7 A;  4K5B A;  4G8L A;  3IXE A;  2MYO A;  1YCS B;  4U8Y D;  1DCQ A;  1WG0 A;  5AQ9 A;  3UI2 A;  1IXV A;  5AQA A;  2Y0B G;  3Q9U C;  5ENT D;  4U95 D;  3SO8 A;  4G8K A;  2DVW A;  3V79 K;  2KXP C;  4LG6 A;  5AAR A;  3T8K A;  3HRA A;  1K1B A;  4F1P A;  4HRL A;  5BXO A;  1N0R A;  4BEP A;  1AP7 A;  1MX4 A;  2F8Y A;  2JAB A;  4BET A;  5CED B;  1SVX A;  4GPM A;  2J8S D;  4HQD A;  4ATZ D;  1MJ0 A;  2F8X K;  1K1A A;  4J8Y A;  5AAO A;  3F6Q A;  5EYL A;  2ZGD A;  1BI7 B;  1OT8 A;  5CEA A;  4CYM D;  4U96 D;  3ZNG A;  2P2C P;  1TR4 A;  4BSZ B;  3EU9 A;  4HI9 A;  3EHQ A;  4C48 B;  5KWD A;  2ETC A;  1YMP A;  5AN8 A;  1YYH A;  1IKN D;  2XEN A;  3HG0 D;  4BER A;  2ETA A;  5BXU A;  4OAU C;  3DEO A;  2HE0 A;  3LJN A;  2RFM A;  3TWU A;  5FIN A;  3D9H A;  1BU9 A;  3JXI A;  2ZGG A;  2RFA A;  3AJI A;  2BKG A;  3V31 A;  1N0Q A;  4RLY A;  4YDY A;  3TWS A;  3ZKJ A;  3W9F A;  2B0O E;  4DUI A;  5CBN A;  3V2O A;  3W9G A;  5EN5 D;  1SW6 A;  2DZO A;  4HNA D;  2KBX A;  5D66 A;  5ENR D;  4GMR A;  3B7B A;  4J7W A;  5KNH D;  3T9K A;  4O1O A;  2VGE A;  2AJA A;  3TWT A;  3TWW A;  4O60 A;  4DX2 A;  2FO1 E;  5EIL A;  5HS0 A;  3UTM A;  5CEC B;  5EIB E;  1MX2 A;  4HI8 A;  2QC9 A;  1OY3 D;  4CZ2 D;  4UUC A;  4JB8 P;  4OAV B;  1QYM A;  2F37 A;  5ENP D;  4DX6 D;  4HLL A;  2XEH A;  4A63 B;  2NYJ A;  4LNU D;  2L6B A;  1UOH A;  2XZD G;  4HRN A;  2XZT G;  3C5R A;  3ZU7 B;  1D9S A;  4K5A B;  5ENS D;  4DRX E;  2V5Q C;  3JXJ A;  5KBA A;  1MX6 A;  2PNN A;  4N5Q A;  3V30 A;  3J5P A;  1K3Z D;  3NBN B;  4YDW A;  2XEE A;  5JA4 D;  2BKK B;  2Y1L E;  2DWZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...