3NOCD

Designed ankyrin repeat protein (darpin) binders to acrb: plasticity of the interface
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
154
structure length
154
Chain Sequence
b'DLGKKLLEAARAGQDDEVRILMANGADVNARDFTGWTPLHLAAHFGHLEIVEVLLKNGADVNAKDSLGVTPLHLAARRGHLEIVEVLLKNGADVNASDSHGFTPLHLAAKRGHLEIVEVLLKNGADVNAQDKFGKTAFDISIDNGNEDLAEILQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acriflavine resistance protein B
publication title Designed ankyrin repeat protein binders for the crystallization of AcrB: Plasticity of the dominant interface
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein/protein binding
total genus 41
structure length 154
sequence length 154
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3nocD00
1N0QA 1IHBA 2P2CP 3D9HA 5ENQD 1IXVA 2V5QC 1UOHA 5AN8A 4HI8A 1YCSB 3C5RA 5AQBA 4GPMA 3HG0D 4BESA 2DZNA 2XZTG 3T9KA 4Z68A 4U8YD 5AARA 3UI2A 3ZU7B 4J8YA 3DEOA 4B93B 2F8XK 3KEAA 4DRXE 4DX2A 1OY3D 1K1AA 4F6RD 2JABA 2RFAA 4U95D 4DX5D 5EIBE 4J7WA 2L6BA 3TWTA 4HBDA 2QC9A 5AQ7A 2RFMA 3IXEA 4RLYA 5HRYA 3V2XA 1G3NB 3ZKJA 4K5CA 2F37A 4O1PA 3B7BA 2XENA 3J5QB 3JUEA 1WG0A 4BSZB 4BETA 5AAOA 5CEAA 1DCQA 2J8SD 4LG6A 5BXOA 2PNNA 3B95A 1DC2A 2A5EA 5ENOD 5ENSD 1WDYA 1OT8A 3V79K 2NYJA 4HNAD 2BKGA 4JB8P 5EYPF 1NFIE 3TWUA 2F8YA 4ZHBA 3V31A 5KNHD 4C48B 4DUIA 4DX1A 3V30A 1K1BA 3Q9UC 2ETCA 3TWSA 3JXJA 5CBOA 4O1OA 1BD8A 3ZNGA 2XZDG 1N0RA 3W9FA 3SO8A 1SW6A 2ETBA 1MX6A 4LNUD 4O60A 5FIOA 5HS0A 4F1PA 4HRNA 3LJNA 1QYMA 1TR4A 5HKPA 4DX7D 5CBNA 2FO1E 3EHRA 4HLLA 4HRMB 2AJAA 5ENPD 2BKKB 4CYMD 4K5BA 4OAVB 3AAAC 4HB5A 5EILA 5KBAA 2KXPC 2ZGGA 5EYLA 2VGEA 3DEPA 2V4HC 5ITZF 1N11A 4LSZE 3UTMA 3Q9NC 3ZUVB 1IKND 2ZGDA 3TWXA 1MX4A 2KBXA 4HRLA 4HQDA 2DWZA 3UXGA 4K5AB 4YDWA 4G8KA 5EIDA 5CECB 4BERA 1YYHA 2Y0BG 3NOGD 5AQAA 4ZFHA 5ENTD 5AQ9A 4NIKA 1AP7A 2ETAA 4QQIA 4HI9A 3TWVA 5CEDB 5JMND 2MYOA 3TWWA 1MJ0A 4UUCA 2XEHA 3NOCD 1MYOA 1SVXA 2Y1LE 4G8LA 5FINA 4ATZD 4N5QA 3HRAA 2QYJA 1BI7B 1K3ZD 1BLXB 1BI8B 4CZ2D 5CERB 3TWRA 4U8VD 2XEEA 4BEPA 3EHQA 1YMPA 4U96D 3V2OA 4YDYA 2DVWA 5ENRD 4QFVA 4TUMA 5KNGA 5JA4D 1AWCB 5D66A 4DX6D 4OAUC 1S70B 3J5PA 3F6QA 3AJIA 3EU9A 1A5EA 2DZOA 2HE0A 3T8KA 3W9GA 1BU9A 1D9SA 2B0OE 5EN5D 5BXUA 4A63B 3TWQA 5KWDA 3NBNB 4GMRA 3JXIA 1MX2A
chains in the Genus database with same CATH superfamily
5C2YA 1N0QA 1IXVA 2IOLA 5LFAA 3CVPA 4TV3A 2I2OA 3VLFA 4B93B 1BPOA 4BFRA 5EDSA 3SY2A 4M7CA 2YHCA 2L6BA 3FUHA 4EQFA 1TN6A 2DBAA 1INZA 1FVHA 3EJNA 4JPSA 1SQMA 2F0YA 3CQGB 3JUEA 3RIBA 3UINC 4YVOA 3HYMB 3ULYA 4L2YA 4GZ5A 3TXMA 3HXBA 2GGFA 2XCCA 3ABME 3QC1A 3OTNA 2UY1A 3PREA 3PEUB 4N3CA 3U3WA 4WUYA 4HOUA 4PS3A 2XPIA 3LJNA 4NACA 2CG3A 2EIKE 2BKKB 5CCLA 3DXMG 4K5BA 2GRNB 3ZUVB 3CR3A 3L13A 1HH8A 2AXVA 3FUIA 2XCBA 4G1TA 2PL2A 3Q49B 5AQ9A 3ENEA 5B1AE 1H19A 2XEHA 2I9CA 3QJZA 1OXJA 4CT0A 4L2LA 1DCEA 4ANWA 2J09A 3PNLB 5CERB 2E0IA 3SQVA 3PZ4A 3L82A 1OWNA 3MKQB 1UJKA 3APCA 5ARGA 4B0ZA 2V8SE 3I5PA 3I4RB 4U8HA 3HVEA 4GAAA 4GMLA 4LCTA 3FWVA 1U3DA 3AG3E 3EHMA 2V0PA 4ILGA 3I3NA 3QKYA 2J4BA 3I4GA 4GTOA 4KYOB 3VTYA 4HS2A 3GYZA 4LRZA 4K03A 1ZB1A 4AEZC 1DCQA 1HU3A 3SGHA 4XI9A 2XPYA 4CCAA 2ZU6B 4J6IA 2VYIA 4AOFA 3SBSA 3SNXA 2I1JA 3SBTB 5CCMA 4N5CA 4HOSA 4FP7A 4A3VA 3FUJA 1FT2A 4F53A 1X5BA 3EU5A 3MCXA 3BU8A 3ML8A 3UTMA 4ACLA 1MX4A 2CFUA 3FTXA 4AP2A 4DK5A 2KZTB 1IYGA 3HRAA 2DYRE 1BI7B 1K3ZD 2Y4TA 2XQ0A 2DVWA 3KAEA 1JCSA 3B7TA 3GZ1A 3W9GA 5BXUA 1N94A 4GTPA 2VTBA 2P2CP 4G11A 3VTXA 5C1DA 3ESKA 4GPMA 2DZNA 1NA0A 4W9RA 4EECA 2V5FA 3KEAA 3FUNA 4U95D 2P9NG 1SZ9A 2IO3C 5DIZA 3K9IA 3LS8A 1NI1A 4RLYA 1Z6TA 2HR2A 3PRZA 3QAQA 3SF4A 4XKCA 3UT8A 2OOEA 3Q5MA 5ENOD 2NYJA 4DX1A 4IULA 2X6HA 2ETCA 4O1OA 3ZNGA 4UI9C 4F1PA 1OCCE 3DSTA 3FTZA 1FVFA 2QYUA 4HLLA 3CHRA 4APOA 2CG2A 1YA0A 2ZGGA 1HO8A 2EQXA 2X6FA 3KD7A 4D10C 5BUZA 3UXGA 1YYHA 5G04J 1H0AA 1LTXA 3MZLB 1HFAA 1JWFA 2GRQB 3CK8A 2MYOA 1ELRA 3IHVA 3FH7A 2XRYA 2QYJA 4ANXA 3ZRHA 3MKRA 1E8WA 3EHQA 1YMPA 2UY1B 3L08A 4MKTA 1TYQG 3ESLA 4GZCA 3LY7A 2XS1A 4EPZA 3RJVA 3P2BA 3HXDA 1ELKA 4RQIA 2XHEA 1TJCA 4UWLA 3C5RA 1HG5A 3AG2E 3C3QA 3HG0D 3D9KA 5BV0A 1XNFA 3L6AA 3CHOA 3LXUX 3FU5A 1N4SA 4DRXE 3CVLA 4HBDA 1OWLA 2RKKA 3ONKA 2RFMA 3V2XA 2R59A 3ZKJA 3CVNA 4JEHA 4GTVA 5M72A 2E2EA 1FCHA 5AAOA 2R05A 3BG0B 3UKRG 2WVIA 2EINE 3FUKA 5EYPF 5JHBA 4TRQA 3C3RA 3HIZA 2AXZA 4IN3B 5EX3A 3JXJA 5G2NA 3HVEB 3IKOB 3W9FA 4N39A 3RK6A 2R03A 4B89A 4CRWA 3O48A 4HVBA 3UUXA 5AJDA 4Y6WA 4HFGA 5AQAA 3WG7E 5A6CA 2QY7A 1MYOA 1SVXA 4I43A 4NRHB 5JJ7A 4FC8A 4LUNU 3FUEA 4BX9A 1UW4B 2IFUA 5AIJA 2EIME 4AIFA 2P9PG 3ULEG 1D9SA 4NURA 4A1SA 2LSVA 4GCNA 2WXRA 4EZLA 3QDNA 4KT6B 3NF1A 5ENQD 3MJWA 3S7FA 3Q15A 2C2LA 2NXPA 1TJFA 1KZOA 2L0IA 4I2ZA 3PVLA 1K1AA 1X81A 4F7AA 4J7WA 3IXEA 4I2WA 5EX0A 3PE3A 3PH0C 5CMWA 3E34A 2XENA 4BSZB 3FEYA 1A17A 1DC2A 4UQYA 1OT8A 3TWUA 1N54A 5J90A 3D9MA 5CHEE 5A7DB 3TWSA 4WNEA 1N9AA 5ENNA 4DJAA 1V54E 3EHRA 2AJAA 4Q69A 3DSSA 3NZSA 2KBXA 4HRLA 1Y8MA 4YDWA 3ASNE 4F3VA 1EPUA 4AXHA 1IQRA 3R7QA 3D9IA 4GTQA 3Q4AB 1UJJA 3ZYLA 3DXKG 1N52A 4BSXA 2L6JA 4BEPA 2LSUA 4BWRA 1QZ2A 2HE0A 4ILIA 3G2UA 1ZBPA 2LXLA 4UI9K 3UMVA 2XGOA 4ME2A 4U8YD 1E8YA 3DEOA 3HHMA 4OVVA 3UM2A 3ASGA 3S7JA 3R9MA 5BNWA 3AS8A 4GB9A 1WAO1 1G3NB 4FLHA 4XZ4A 3EIQC 3G2VA 4Y6CA 3HXFA 2J8SD 1WDYA 5A23A 1EDUA 2ZISA 1D8EA 3GZSA 4GTSA 3HXEA 2Y3AA 2C0LA 2NSZA 4KBQA 5AYWD 3FTVA 3PNTB 3QWWA 1H2VC 4CYMD 4J0UA 3Q9NC 3L9TA 1IKND 3MX3A 4A55A 3ZYQA 3ZXPA 4HQDA 1O5MA 3ZPJA 4GZDA 1ELWA 5FQ6A 5T8IA 3KSLA 5LOZA 5D0QD 4FU3A 2LAIA 4FA6A 1BLXB 1GW6A 1UG3A 3V2OA 2WXMA 4GZ6A 4DX6D 4WNGA 4P29A 4DI4A 1Q2ZA 2XEVA 5LCWC 3ZYKA 1JCRA 3D9HA 5AN8A 4HI8A 3PZ2A 2CFZA 3S7BA 4DI3A 3LCAA 4BESA 5AJLA 3CHPA 2WQHA 4TXPA 5CRVA 4Q94A 1B89A 4DX2A 2X6KA 1N95A 3FTUA 3FTWA 4CGVA 3TWTA 1E8ZA 2HM8A 3ZYMA 5AQ7A 1Z5SC 2BF0X 2F37A 3NB2A 2JLBA 3LPZA 3PZ1A 1U3CA 3CHQA 2AXUA 2L9BA 5B1BE 2VGXA 1OCRE 2F8YA 2YQ8A 2R2LA 3EHNA 4G2VA 3R9AB 4DPRA 3PE4A 3CGHA 3HXCA 2ETBA 5G05J 3FTSA 4KVOA 4L9PA 1TR4A 4HRMB 4GCOA 4U0UA 5EILA 1W3BA 4C0MA 3Q47B 2V4LA 2CHWA 2IQCA 4G8KA 3KEZA 3D9JA 4CDNA 2MOWA 4ZFHA 2LNIA 3Q73A 5G55A 3TWWA 3EDTB 1E96B 4CEMA 1KLXA 3UT7A 3RO3A 4NQ0A 5T4YA 3TGOA 2PQRA 1TNBA 5BT1A 2AW6A 3C3OA 3APFA 1SA4A 3J5PA 1KT0A 3D9PA 3UM0A 2GRMA 4LERA 4JVSA 2OVBA 4L1BA 5AQBA 1MHQA 3MYVA 4FJZA 3ZU7B 1LD8A 3FUMA 2IOSA 2RFAA 2PQNA 2IY0C 3RU0A 5HRYA 2RG8A 2HYZA 1H6KA 4O1PA 3GZ2A 1WG0A 3CLJA 3U66A 4LG6A 4WNFA 4N2QA 3JQ0A 1E7VA 1LF8A 2WXKA 2BKGA 3ONLA 5D0OD 4R7LA 3OAWA 2XZDG 2R5SA 3E32A 1SW6A 4I1OB 2JEKA 5HS0A 4DX7D 2XRZA 3UX4A 2CHZA 2WQ7A 3UM1A 3L22A 3X2QE 4AV7A 4ILHB 3FHEA 2GRPB 2LUHA 4RG6A 4PS8A 1TEZA 3RRMB 3MV3B 5JJTA 1JWGA 5ENTD 1AP7A 4LNGA 3S2AA 1MJ0A 1L5JA 4N5QA 2KC7A 4GA2A 1PC2A 2VSOE 5J08A 3RKVA 1H2TC 2WB2A 4TXRA 4DLQA 1A5EA 3RSEG 5H7PA 5KWDA 4FLBA 3ZFWA 2XGMA 2X6JA 4JXTA 2LXMA 2YHEA 4H7XA 4K0RA 1YCSB 3T9KA 4U0SA 5EKQD 3FP3A 2FULA 4OYSA 4DX5D 4BTBA 2WXGA 4YDEA 3QNKA 5HQ8A 3JCKC 4A3TA 4TXQA 2MHKA 4I6EA 4XX5A 3SFXA 3DPYA 1O1SA 1NFIE 3VLEA 4ZHBA 4C48B 1JPLA 4GYWA 1BD8A 2WXOA 2WXQA 1MX6A 3ZW3A 1QYMA 4BY6A 2KCLA 2KXPC 1N4QA 1N11A 3ZGQA 2DWZA 3CHSA 3CEQA 3FFLA 3AU5A 1E7UA 4I17A 4NIKA 2VSNA 4KMOA 5FJYA 3NOCD 4AVXA 5FINA 4ATGA 4KVMA 2VGXB 2I1KA 4TUMA 4PH4B 1VDYA 5JA4D 4BT9A 3UIOC 4UWHA 3SD5A 3MEKA 3EU9A 3T8KA 4WWOA 4G26A 3NBNB 4MS6A 3ISMC 3DSWA 3ZN3A 1U2VG 2NC9A 3ASHA 2KCKA 3D9OA 5IY5E 2XS8A 3FU6A 3OXLA 5LX8A 3AS4A 3FU0A 2FI7A 3ZEFA 1N4PA 1ZU2A 4LNBA 3MKQA 4J8SA 4GTMA 5FQ8A 2P9LG 3TAXA 4Q96A 4G23A 5BXOA 1UN9A 3G2TA 5ENSD 1JCQA 4MLPA 2RD0A 4AY6A 2B6CA 2EILE 1E90A 4YVQC 3V30A 3R7RA 3TG4A 5CBOA 2EIJE 3KSQA 1N0RA 4LEUA 1O1TA 5CBNA 4XE0A 5ENPD 2PM7A 4OAVB 2AWIA 3PUKA 4XIFA 3MGBA 2VGYA 3CVVA 4G24A 4EBAG 4GTRA 2Y0BG 5ARFA 2VTBB 3IHYA 4QQIA 3TWVA 5CEDB 2ONDA 2Q7FA 1OWOA 1BI8B 2X3MA 3AU4A 4B8AA 1P5QA 4A1GA 4URKA 2H6FA 4GA0A 5BV1A 2OV8A 3SI5A 2ZIRA 1HS6A 1H6OA 1S0PA 3F6QA 1BU9A 4GYOA 2J9QA 3CSTA 4N3AA 3JXIA 1HXIA 3B7SA 3BG1B 4RVBA 3MA5A 4JHRA 4J8DA 1WM5A 4IRUA 4AJWA 2XPZA 4F6RD 2KM4A 5EIBE 3MV2B 3ML9A 1QQEA 4UWFA 2R17C 2WXLA 4JZYA 3QWVA 3GW4A 4GMJA 4JB8P 4UWKA 5KJMA 4DUIA 3L17A 2P9SG 5ANLA 3Q9UC 4KXKB 5FTPA 4L23A 3BQOA 3U64A 3EIJA 1OCOE 3E37A 4O60A 5B3SE 1K8KG 5G04C 2WMNA 4GU5A 2V4HC 3D3MA 4I1MA 4UI9J 3IV0A 2X38A 2XGSA 2Y69E 2A5UA 2WM9A 4CDRA 2ETAA 2LO6A 4ABNA 2WQ6A 4AY5A 4DLOA 4G8LA 4XKBA 4U0ZA 2FO7A 2VSYA 3E30A 3CVUA 1SZAA 3ZXSA 4A63B 4U04A 4GMRA 5JHAA 5FZQA 2GROB 3ABKE 3LJ3A 2DIWA 3DSVA 4KZCA 3ASOE 3FTYA 3ZVVA 4Z68A 3E33A 5KCMA 3UI2A 4I6GA 4JW1A 5FWQA 3CIAA 3IBEA 3ASFA 4JHKA 2ILRA 1S64A 3UPVA 4K5CA 2FF4A 5FZRA 4JC8A 4CDMA 4EZJA 2IJGX 2AVPA 3D9LA 4HOQA 3UKUG 2BEDA 3FH5A 4I9CA 1K1BA 5D2MC 4J8FA 4HOTA 4E6HA 4HLEA 1TNZA 1DVPA 3Q7AA 4HRNA 2FO1E 2VGEA 5ANRA 1TN7A 2VJ8A 3SHFA 3DSXA 3JUIA 5E76A 1DNPA 1HE8A 3TXNA 1QBQA 1O1RA 4BERA 1XGWA 3UQ3A 4M3OA 4UUCA 3AG4E 1KPSB 1LD7A 4ATZD 3CKCA 2C0MA 1FPPA 4I9EA 2DYSE 2IONA 1D8DA 4CZ2D 4JHJA 3AG1E 1TNOA 3TWRA 3CQCB 3CVYA 2OEVA 3HDXA 2L0TB 4OAUC 2WXJA 3B13A 3CSFA 4E85A 1IHBA 4V3IA 3UIPC 3CK7A 1TN8A 1UOHA 3G2SA 1NP7A 2IF4A 5BPPA 3DWLG 4WWPA 4J8YA 1PY1A 4PDXA 1OY3D 2JABA 4O6FA 3Q7FA 5LP0A 3CVWA 3QK0A 2P58C 5FQ4A 3J5QB 1EYHA 3UM3A 3QWPA 3JQ1A 4JEUA 3ULQA 4JA9A 3V79K 4HNAD 3PS6A 4PS7A 1HX8A 3RRUA 2J08A 4AM9A 3NZUA 2GW1A 4U63A 3CK9A 3SO8A 2OVFA 4LNUD 4N3BA 5HKPA 2X6IA 3CKBA 3LYAA 4TUUA 3RAUA 3AAAC 4HB5A 5KBAA 5EYLA 5ITZF 5FT9A 4LSZE 3LY9A 3AS5A 3CV0A 3SZ7A 4MBGA 3TWXA 1UN8A 2P9IG 2H6HA 3T8MA 4RG9A 4WAFA 3WXXA 3PDNA 3LVQE 3ZIMA 3CVQA 1EF1C 4APFA 4U07A 1HZ4A 3LEWA 2WXHA 3VLDA 3G2WA 4F1SA 5KNGA 2J07A 5CRUA 1AWCB 4G25A 4JA7A 2QZAA 2B0OE 3PZDA 3QB2A 2BTDA 4HORA 3PEVB 3FULA 1SA5A 3DRAA 2ZXWE 3C72A 4WWNA 2QFCA 3TL5A 3U4TA 5AARA 2GRRB 3ZHEA 1PAQA 3L16A 1V55E 4ACKA 4OVUA 4BETA 2DCPA 3FEXA 3JYSA 3U9WA 3APDA 1KZPA 3FUDA 1H6PA 2H6IA 3TG5A 3KS2A 4XI0A 2Y4UA 4C0EA 4HXIA 3RRNB 2M63A 3CHMA 4FADA 4UWGA 2UWJG 3Q75A 3DEPA 3BUAA 4BTAA 4BX8A 4FHJA 4XEIG 4L7TA 4GPKA 3NOGD 2WPVA 1Z3XA 4HI9A 1OUVA 1NA3A 2WXNA 3ASDA 2H6GA 4B94A 3T5XA 3DBSA 4IYPA 1Y6IA 2VQ2A 3BEEA 3PZ3A 3FDHA 1S70B 3QOUA 2IEJA 1OCZE 5EN5D 4CT4A 1KT1A 2YINA 5CMYA 3O4ZA 1H2UA 2MRIA 5KJKA 3LY8A 3TJPA 2V5QC 4UQXA 4FHKA 4MRUA 3PUJA 5LCWJ 3P1UA 4N2SA 1HF8A 4FULA 3FU3A 1OWMA 4UQZA 4GA1A 3B7BA 3LDZA 3DSUA 4EBAA 3Q78A 2PZIA 4GZ3A 5CEAA 2FBNA 3B95A 5G05C 3V31A 4RSYA 4YNDA 2WXPA 5BW8C 3URZA 1RZ4A 4I6JA 4B8CB 1HG2A 1FT1A 3UT4A 2PM6A 4K5AB 1IHGA 2J49A 5EIDA 5CECB 2IU1A 4GTTA 5JMND 1S63A 2WXIA 3LVRE 5FQ7A 2P9UG 2KCVA 1QNFA 4U96D 4YDYA 5ENRD 1N4RA 1RW2A 2OEWA 1E8XA 2LAHA 3N71A 3CVXA 3TWQA 2I6HA 2CHXA 1WY6A 1Z3YA 4I1AA 4EZKA 3S7DA 2R02A 4PUCA 2XZTG 3OXGA 4YDOA 1JUQA 2F8XK 3OXFA 5JJ6A 1NZNA 3IEGA 2QC9A 2GRLA 4FJYA 3D9NA 1TNYA 5AENA 3T5VA 5FZSA 3QARA 2KZTA 2PNNA 2A5EA 3LKUA 5KJNA 1NL4A 5KNHD 3FUFA 2BUGA 3FH8A 4WNDA 3NAWA 4JD2G 5E75A 3C98A 3EUVA 4U7EB 5T3RA 2KATA 3SFZA 5FIOA 2VSXE 2HO1A 4ANVA 2WXFA 3B7RL 2P9KG 4EHMA 3ZHEB 2ZGDA 1IQUA 5DBKA 4BT8A 1MZCA 4C9BB 4H7YA 2OCCE 2IO2C 2FEZA 3ABLE 2A4ZA 4X8QA 2Y1LE 3E4BA 3DPDA 4CGWA 4J8EA 3B7UX 4U8VD 2XEEA 4JL0A 1OWPA 3SFYA 3Q79A 4QFVA 4KZ0A 5KJLA 5HI7A 5D66A 1TNUA 2YNQA 4ANUA 3L54A 3AJIA 2DZOA 3RO2A 3FY4A 4GYYA 2WMOA 1MQSA 3NQPA 2J4DA 1MX2A
chains in the Genus database with same CATH topology
1N0QA 1IHBA 2P2CP 3D9HA 5ENQD 1IXVA 2V5QC 1UOHA 5AN8A 4HI8A 1YCSB 3C5RA 5AQBA 4GPMA 3HG0D 4BESA 2DZNA 2XZTG 3T9KA 4Z68A 4U8YD 5AARA 3UI2A 3ZU7B 4J8YA 3DEOA 4B93B 2F8XK 3KEAA 4DRXE 4DX2A 1OY3D 1K1AA 4F6RD 2JABA 2RFAA 4U95D 4DX5D 5EIBE 4J7WA 2L6BA 3TWTA 4HBDA 2QC9A 5AQ7A 2RFMA 3IXEA 4RLYA 5HRYA 3V2XA 1G3NB 3ZKJA 4K5CA 2F37A 4O1PA 3B7BA 2XENA 3J5QB 3JUEA 1WG0A 4BSZB 4BETA 5AAOA 5CEAA 1DCQA 2J8SD 4LG6A 5BXOA 2PNNA 3B95A 1DC2A 2A5EA 5ENOD 5ENSD 1WDYA 1OT8A 3V79K 2NYJA 4HNAD 2BKGA 4JB8P 5EYPF 1NFIE 3TWUA 2F8YA 4ZHBA 3V31A 5KNHD 4C48B 4DUIA 4DX1A 3V30A 1K1BA 3Q9UC 2ETCA 3TWSA 3JXJA 5CBOA 4O1OA 1BD8A 3ZNGA 2XZDG 1N0RA 3W9FA 3SO8A 1SW6A 2ETBA 1MX6A 4LNUD 4O60A 5FIOA 5HS0A 4F1PA 4HRNA 3LJNA 1QYMA 1TR4A 5HKPA 4DX7D 5CBNA 2FO1E 3EHRA 4HLLA 4HRMB 2AJAA 5ENPD 2BKKB 4CYMD 4K5BA 4OAVB 3AAAC 4HB5A 5EILA 5KBAA 2KXPC 2ZGGA 5EYLA 2VGEA 3DEPA 2V4HC 5ITZF 1N11A 4LSZE 3UTMA 3Q9NC 3ZUVB 1IKND 2ZGDA 3TWXA 1MX4A 2KBXA 4HRLA 4HQDA 2DWZA 3UXGA 4K5AB 4YDWA 4G8KA 5EIDA 5CECB 4BERA 1YYHA 2Y0BG 3NOGD 5AQAA 4ZFHA 5ENTD 5AQ9A 4NIKA 1AP7A 2ETAA 4QQIA 4HI9A 3TWVA 5CEDB 5JMND 2MYOA 3TWWA 1MJ0A 4UUCA 2XEHA 3NOCD 1MYOA 1SVXA 2Y1LE 4G8LA 5FINA 4ATZD 4N5QA 3HRAA 2QYJA 1BI7B 1K3ZD 1BLXB 1BI8B 4CZ2D 5CERB 3TWRA 4U8VD 2XEEA 4BEPA 3EHQA 1YMPA 4U96D 3V2OA 4YDYA 2DVWA 5ENRD 4QFVA 4TUMA 5KNGA 5JA4D 1AWCB 5D66A 4DX6D 4OAUC 1S70B 3J5PA 3F6QA 3AJIA 3EU9A 1A5EA 2DZOA 2HE0A 3T8KA 3W9GA 1BU9A 1D9SA 2B0OE 5EN5D 5BXUA 4A63B 3TWQA 5KWDA 3NBNB 4GMRA 3JXIA 1MX2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N0Q A;  1IHB A;  2P2C P;  3D9H A;  5ENQ D;  1IXV A;  2V5Q C;  1UOH A;  5AN8 A;  4HI8 A;  1YCS B;  3C5R A;  5AQB A;  4GPM A;  3HG0 D;  4BES A;  2DZN A;  2XZT G;  3T9K A;  4Z68 A;  4U8Y D;  5AAR A;  3UI2 A;  3ZU7 B;  4J8Y A;  3DEO A;  4B93 B;  2F8X K;  3KEA A;  4DRX E;  4DX2 A;  1OY3 D;  1K1A A;  4F6R D;  2JAB A;  2RFA A;  4U95 D;  4DX5 D;  5EIB E;  4J7W A;  2L6B A;  3TWT A;  4HBD A;  2QC9 A;  5AQ7 A;  2RFM A;  3IXE A;  4RLY A;  5HRY A;  3V2X A;  1G3N B;  3ZKJ A;  4K5C A;  2F37 A;  4O1P A;  3B7B A;  2XEN A;  3J5Q B;  3JUE A;  1WG0 A;  4BSZ B;  4BET A;  5AAO A;  5CEA A;  1DCQ A;  2J8S D;  4LG6 A;  5BXO A;  2PNN A;  3B95 A;  1DC2 A;  2A5E A;  5ENO D;  5ENS D;  1WDY A;  1OT8 A;  3V79 K;  2NYJ A;  4HNA D;  2BKG A;  4JB8 P;  5EYP F;  1NFI E;  3TWU A;  2F8Y A;  4ZHB A;  3V31 A;  5KNH D;  4C48 B;  4DUI A;  4DX1 A;  3V30 A;  1K1B A;  3Q9U C;  2ETC A;  3TWS A;  3JXJ A;  5CBO A;  4O1O A;  1BD8 A;  3ZNG A;  2XZD G;  1N0R A;  3W9F A;  3SO8 A;  1SW6 A;  2ETB A;  1MX6 A;  4LNU D;  4O60 A;  5FIO A;  5HS0 A;  4F1P A;  4HRN A;  3LJN A;  1QYM A;  1TR4 A;  5HKP A;  4DX7 D;  5CBN A;  2FO1 E;  3EHR A;  4HLL A;  4HRM B;  2AJA A;  5ENP D;  2BKK B;  4CYM D;  4K5B A;  4OAV B;  3AAA C;  4HB5 A;  5EIL A;  5KBA A;  2KXP C;  2ZGG A;  5EYL A;  2VGE A;  3DEP A;  2V4H C;  5ITZ F;  1N11 A;  4LSZ E;  3UTM A;  3Q9N C;  3ZUV B;  1IKN D;  2ZGD A;  3TWX A;  1MX4 A;  2KBX A;  4HRL A;  4HQD A;  2DWZ A;  3UXG A;  4K5A B;  4YDW A;  4G8K A;  5EID A;  5CEC B;  4BER A;  1YYH A;  2Y0B G;  3NOG D;  5AQA A;  4ZFH A;  5ENT D;  5AQ9 A;  4NIK A;  1AP7 A;  2ETA A;  4QQI A;  4HI9 A;  3TWV A;  5CED B;  5JMN D;  2MYO A;  3TWW A;  1MJ0 A;  4UUC A;  2XEH A;  3NOC D;  1MYO A;  1SVX A;  2Y1L E;  4G8L A;  5FIN A;  4ATZ D;  4N5Q A;  3HRA A;  2QYJ A;  1BI7 B;  1K3Z D;  1BLX B;  1BI8 B;  4CZ2 D;  5CER B;  3TWR A;  4U8V D;  2XEE A;  4BEP A;  3EHQ A;  1YMP A;  4U96 D;  3V2O A;  4YDY A;  2DVW A;  5ENR D;  4QFV A;  4TUM A;  5KNG A;  5JA4 D;  1AWC B;  5D66 A;  4DX6 D;  4OAU C;  1S70 B;  3J5P A;  3F6Q A;  3AJI A;  3EU9 A;  1A5E A;  2DZO A;  2HE0 A;  3T8K A;  3W9G A;  1BU9 A;  1D9S A;  2B0O E;  5EN5 D;  5BXU A;  4A63 B;  3TWQ A;  5KWD A;  3NBN B;  4GMR A;  3JXI A;  1MX2 A; 
#chains in the Genus database with same CATH topology
 5C2Y A;  1N0Q A;  1IXV A;  2IOL A;  5LFA A;  3CVP A;  4TV3 A;  2I2O A;  3VLF A;  4B93 B;  1BPO A;  4BFR A;  5EDS A;  3SY2 A;  4M7C A;  2YHC A;  2L6B A;  3FUH A;  4EQF A;  1TN6 A;  2DBA A;  1INZ A;  1FVH A;  3EJN A;  4JPS A;  1SQM A;  2F0Y A;  3CQG B;  3JUE A;  3RIB A;  3UIN C;  4YVO A;  3HYM B;  3ULY A;  4L2Y A;  4GZ5 A;  3TXM A;  3HXB A;  2GGF A;  2XCC A;  3ABM E;  3QC1 A;  3OTN A;  2UY1 A;  3PRE A;  3PEU B;  4N3C A;  3U3W A;  4WUY A;  4HOU A;  4PS3 A;  2XPI A;  3LJN A;  4NAC A;  2CG3 A;  2EIK E;  2BKK B;  5CCL A;  3DXM G;  4K5B A;  2GRN B;  3ZUV B;  3CR3 A;  3L13 A;  1HH8 A;  2AXV A;  3FUI A;  2XCB A;  4G1T A;  2PL2 A;  3Q49 B;  5AQ9 A;  3ENE A;  5B1A E;  1H19 A;  2XEH A;  2I9C A;  3QJZ A;  1OXJ A;  4CT0 A;  4L2L A;  1DCE A;  4ANW A;  2J09 A;  3PNL B;  5CER B;  2E0I A;  3SQV A;  3PZ4 A;  3L82 A;  1OWN A;  3MKQ B;  1UJK A;  3APC A;  5ARG A;  4B0Z A;  2V8S E;  3I5P A;  3I4R B;  4U8H A;  3HVE A;  4GAA A;  4GML A;  4LCT A;  3FWV A;  1U3D A;  3AG3 E;  3EHM A;  2V0P A;  4ILG A;  3I3N A;  3QKY A;  2J4B A;  3I4G A;  4GTO A;  4KYO B;  3VTY A;  4HS2 A;  3GYZ A;  4LRZ A;  4K03 A;  1ZB1 A;  4AEZ C;  1DCQ A;  1HU3 A;  3SGH A;  4XI9 A;  2XPY A;  4CCA A;  2ZU6 B;  4J6I A;  2VYI A;  4AOF A;  3SBS A;  3SNX A;  2I1J A;  3SBT B;  5CCM A;  4N5C A;  4HOS A;  4FP7 A;  4A3V A;  3FUJ A;  1FT2 A;  4F53 A;  1X5B A;  3EU5 A;  3MCX A;  3BU8 A;  3ML8 A;  3UTM A;  4ACL A;  1MX4 A;  2CFU A;  3FTX A;  4AP2 A;  4DK5 A;  2KZT B;  1IYG A;  3HRA A;  2DYR E;  1BI7 B;  1K3Z D;  2Y4T A;  2XQ0 A;  2DVW A;  3KAE A;  1JCS A;  3B7T A;  3GZ1 A;  3W9G A;  5BXU A;  1N94 A;  4GTP A;  2VTB A;  2P2C P;  4G11 A;  3VTX A;  5C1D A;  3ESK A;  4GPM A;  2DZN A;  1NA0 A;  4W9R A;  4EEC A;  2V5F A;  3KEA A;  3FUN A;  4U95 D;  2P9N G;  1SZ9 A;  2IO3 C;  5DIZ A;  3K9I A;  3LS8 A;  1NI1 A;  4RLY A;  1Z6T A;  2HR2 A;  3PRZ A;  3QAQ A;  3SF4 A;  4XKC A;  3UT8 A;  2OOE A;  3Q5M A;  5ENO D;  2NYJ A;  4DX1 A;  4IUL A;  2X6H A;  2ETC A;  4O1O A;  3ZNG A;  4UI9 C;  4F1P A;  1OCC E;  3DST A;  3FTZ A;  1FVF A;  2QYU A;  4HLL A;  3CHR A;  4APO A;  2CG2 A;  1YA0 A;  2ZGG A;  1HO8 A;  2EQX A;  2X6F A;  3KD7 A;  4D10 C;  5BUZ A;  3UXG A;  1YYH A;  5G04 J;  1H0A A;  1LTX A;  3MZL B;  1HFA A;  1JWF A;  2GRQ B;  3CK8 A;  2MYO A;  1ELR A;  3IHV A;  3FH7 A;  2XRY A;  2QYJ A;  4ANX A;  3ZRH A;  3MKR A;  1E8W A;  3EHQ A;  1YMP A;  2UY1 B;  3L08 A;  4MKT A;  1TYQ G;  3ESL A;  4GZC A;  3LY7 A;  2XS1 A;  4EPZ A;  3RJV A;  3P2B A;  3HXD A;  1ELK A;  4RQI A;  2XHE A;  1TJC A;  4UWL A;  3C5R A;  1HG5 A;  3AG2 E;  3C3Q A;  3HG0 D;  3D9K A;  5BV0 A;  1XNF A;  3L6A A;  3CHO A;  3LXU X;  3FU5 A;  1N4S A;  4DRX E;  3CVL A;  4HBD A;  1OWL A;  2RKK A;  3ONK A;  2RFM A;  3V2X A;  2R59 A;  3ZKJ A;  3CVN A;  4JEH A;  4GTV A;  5M72 A;  2E2E A;  1FCH A;  5AAO A;  2R05 A;  3BG0 B;  3UKR G;  2WVI A;  2EIN E;  3FUK A;  5EYP F;  5JHB A;  4TRQ A;  3C3R A;  3HIZ A;  2AXZ A;  4IN3 B;  5EX3 A;  3JXJ A;  5G2N A;  3HVE B;  3IKO B;  3W9F A;  4N39 A;  3RK6 A;  2R03 A;  4B89 A;  4CRW A;  3O48 A;  4HVB A;  3UUX A;  5AJD A;  4Y6W A;  4HFG A;  5AQA A;  3WG7 E;  5A6C A;  2QY7 A;  1MYO A;  1SVX A;  4I43 A;  4NRH B;  5JJ7 A;  4FC8 A;  4LUN U;  3FUE A;  4BX9 A;  1UW4 B;  2IFU A;  5AIJ A;  2EIM E;  4AIF A;  2P9P G;  3ULE G;  1D9S A;  4NUR A;  4A1S A;  2LSV A;  4GCN A;  2WXR A;  4EZL A;  3QDN A;  4KT6 B;  3NF1 A;  5ENQ D;  3MJW A;  3S7F A;  3Q15 A;  2C2L A;  2NXP A;  1TJF A;  1KZO A;  2L0I A;  4I2Z A;  3PVL A;  1K1A A;  1X81 A;  4F7A A;  4J7W A;  3IXE A;  4I2W A;  5EX0 A;  3PE3 A;  3PH0 C;  5CMW A;  3E34 A;  2XEN A;  4BSZ B;  3FEY A;  1A17 A;  1DC2 A;  4UQY A;  1OT8 A;  3TWU A;  1N54 A;  5J90 A;  3D9M A;  5CHE E;  5A7D B;  3TWS A;  4WNE A;  1N9A A;  5ENN A;  4DJA A;  1V54 E;  3EHR A;  2AJA A;  4Q69 A;  3DSS A;  3NZS A;  2KBX A;  4HRL A;  1Y8M A;  4YDW A;  3ASN E;  4F3V A;  1EPU A;  4AXH A;  1IQR A;  3R7Q A;  3D9I A;  4GTQ A;  3Q4A B;  1UJJ A;  3ZYL A;  3DXK G;  1N52 A;  4BSX A;  2L6J A;  4BEP A;  2LSU A;  4BWR A;  1QZ2 A;  2HE0 A;  4ILI A;  3G2U A;  1ZBP A;  2LXL A;  4UI9 K;  3UMV A;  2XGO A;  4ME2 A;  4U8Y D;  1E8Y A;  3DEO A;  3HHM A;  4OVV A;  3UM2 A;  3ASG A;  3S7J A;  3R9M A;  5BNW A;  3AS8 A;  4GB9 A;  1WAO 1;  1G3N B;  4FLH A;  4XZ4 A;  3EIQ C;  3G2V A;  4Y6C A;  3HXF A;  2J8S D;  1WDY A;  5A23 A;  1EDU A;  2ZIS A;  1D8E A;  3GZS A;  4GTS A;  3HXE A;  2Y3A A;  2C0L A;  2NSZ A;  4KBQ A;  5AYW D;  3FTV A;  3PNT B;  3QWW A;  1H2V C;  4CYM D;  4J0U A;  3Q9N C;  3L9T A;  1IKN D;  3MX3 A;  4A55 A;  3ZYQ A;  3ZXP A;  4HQD A;  1O5M A;  3ZPJ A;  4GZD A;  1ELW A;  5FQ6 A;  5T8I A;  3KSL A;  5LOZ A;  5D0Q D;  4FU3 A;  2LAI A;  4FA6 A;  1BLX B;  1GW6 A;  1UG3 A;  3V2O A;  2WXM A;  4GZ6 A;  4DX6 D;  4WNG A;  4P29 A;  4DI4 A;  1Q2Z A;  2XEV A;  5LCW C;  3ZYK A;  1JCR A;  3D9H A;  5AN8 A;  4HI8 A;  3PZ2 A;  2CFZ A;  3S7B A;  4DI3 A;  3LCA A;  4BES A;  5AJL A;  3CHP A;  2WQH A;  4TXP A;  5CRV A;  4Q94 A;  1B89 A;  4DX2 A;  2X6K A;  1N95 A;  3FTU A;  3FTW A;  4CGV A;  3TWT A;  1E8Z A;  2HM8 A;  3ZYM A;  5AQ7 A;  1Z5S C;  2BF0 X;  2F37 A;  3NB2 A;  2JLB A;  3LPZ A;  3PZ1 A;  1U3C A;  3CHQ A;  2AXU A;  2L9B A;  5B1B E;  2VGX A;  1OCR E;  2F8Y A;  2YQ8 A;  2R2L A;  3EHN A;  4G2V A;  3R9A B;  4DPR A;  3PE4 A;  3CGH A;  3HXC A;  2ETB A;  5G05 J;  3FTS A;  4KVO A;  4L9P A;  1TR4 A;  4HRM B;  4GCO A;  4U0U A;  5EIL A;  1W3B A;  4C0M A;  3Q47 B;  2V4L A;  2CHW A;  2IQC A;  4G8K A;  3KEZ A;  3D9J A;  4CDN A;  2MOW A;  4ZFH A;  2LNI A;  3Q73 A;  5G55 A;  3TWW A;  3EDT B;  1E96 B;  4CEM A;  1KLX A;  3UT7 A;  3RO3 A;  4NQ0 A;  5T4Y A;  3TGO A;  2PQR A;  1TNB A;  5BT1 A;  2AW6 A;  3C3O A;  3APF A;  1SA4 A;  3J5P A;  1KT0 A;  3D9P A;  3UM0 A;  2GRM A;  4LER A;  4JVS A;  2OVB A;  4L1B A;  5AQB A;  1MHQ A;  3MYV A;  4FJZ A;  3ZU7 B;  1LD8 A;  3FUM A;  2IOS A;  2RFA A;  2PQN A;  2IY0 C;  3RU0 A;  5HRY A;  2RG8 A;  2HYZ A;  1H6K A;  4O1P A;  3GZ2 A;  1WG0 A;  3CLJ A;  3U66 A;  4LG6 A;  4WNF A;  4N2Q A;  3JQ0 A;  1E7V A;  1LF8 A;  2WXK A;  2BKG A;  3ONL A;  5D0O D;  4R7L A;  3OAW A;  2XZD G;  2R5S A;  3E32 A;  1SW6 A;  4I1O B;  2JEK A;  5HS0 A;  4DX7 D;  2XRZ A;  3UX4 A;  2CHZ A;  2WQ7 A;  3UM1 A;  3L22 A;  3X2Q E;  4AV7 A;  4ILH B;  3FHE A;  2GRP B;  2LUH A;  4RG6 A;  4PS8 A;  1TEZ A;  3RRM B;  3MV3 B;  5JJT A;  1JWG A;  5ENT D;  1AP7 A;  4LNG A;  3S2A A;  1MJ0 A;  1L5J A;  4N5Q A;  2KC7 A;  4GA2 A;  1PC2 A;  2VSO E;  5J08 A;  3RKV A;  1H2T C;  2WB2 A;  4TXR A;  4DLQ A;  1A5E A;  3RSE G;  5H7P A;  5KWD A;  4FLB A;  3ZFW A;  2XGM A;  2X6J A;  4JXT A;  2LXM A;  2YHE A;  4H7X A;  4K0R A;  1YCS B;  3T9K A;  4U0S A;  5EKQ D;  3FP3 A;  2FUL A;  4OYS A;  4DX5 D;  4BTB A;  2WXG A;  4YDE A;  3QNK A;  5HQ8 A;  3JCK C;  4A3T A;  4TXQ A;  2MHK A;  4I6E A;  4XX5 A;  3SFX A;  3DPY A;  1O1S A;  1NFI E;  3VLE A;  4ZHB A;  4C48 B;  1JPL A;  4GYW A;  1BD8 A;  2WXO A;  2WXQ A;  1MX6 A;  3ZW3 A;  1QYM A;  4BY6 A;  2KCL A;  2KXP C;  1N4Q A;  1N11 A;  3ZGQ A;  2DWZ A;  3CHS A;  3CEQ A;  3FFL A;  3AU5 A;  1E7U A;  4I17 A;  4NIK A;  2VSN A;  4KMO A;  5FJY A;  3NOC D;  4AVX A;  5FIN A;  4ATG A;  4KVM A;  2VGX B;  2I1K A;  4TUM A;  4PH4 B;  1VDY A;  5JA4 D;  4BT9 A;  3UIO C;  4UWH A;  3SD5 A;  3MEK A;  3EU9 A;  3T8K A;  4WWO A;  4G26 A;  3NBN B;  4MS6 A;  3ISM C;  3DSW A;  3ZN3 A;  1U2V G;  2NC9 A;  3ASH A;  2KCK A;  3D9O A;  5IY5 E;  2XS8 A;  3FU6 A;  3OXL A;  5LX8 A;  3AS4 A;  3FU0 A;  2FI7 A;  3ZEF A;  1N4P A;  1ZU2 A;  4LNB A;  3MKQ A;  4J8S A;  4GTM A;  5FQ8 A;  2P9L G;  3TAX A;  4Q96 A;  4G23 A;  5BXO A;  1UN9 A;  3G2T A;  5ENS D;  1JCQ A;  4MLP A;  2RD0 A;  4AY6 A;  2B6C A;  2EIL E;  1E90 A;  4YVQ C;  3V30 A;  3R7R A;  3TG4 A;  5CBO A;  2EIJ E;  3KSQ A;  1N0R A;  4LEU A;  1O1T A;  5CBN A;  4XE0 A;  5ENP D;  2PM7 A;  4OAV B;  2AWI A;  3PUK A;  4XIF A;  3MGB A;  2VGY A;  3CVV A;  4G24 A;  4EBA G;  4GTR A;  2Y0B G;  5ARF A;  2VTB B;  3IHY A;  4QQI A;  3TWV A;  5CED B;  2OND A;  2Q7F A;  1OWO A;  1BI8 B;  2X3M A;  3AU4 A;  4B8A A;  1P5Q A;  4A1G A;  4URK A;  2H6F A;  4GA0 A;  5BV1 A;  2OV8 A;  3SI5 A;  2ZIR A;  1HS6 A;  1H6O A;  1S0P A;  3F6Q A;  1BU9 A;  4GYO A;  2J9Q A;  3CST A;  4N3A A;  3JXI A;  1HXI A;  3B7S A;  3BG1 B;  4RVB A;  3MA5 A;  4JHR A;  4J8D A;  1WM5 A;  4IRU A;  4AJW A;  2XPZ A;  4F6R D;  2KM4 A;  5EIB E;  3MV2 B;  3ML9 A;  1QQE A;  4UWF A;  2R17 C;  2WXL A;  4JZY A;  3QWV A;  3GW4 A;  4GMJ A;  4JB8 P;  4UWK A;  5KJM A;  4DUI A;  3L17 A;  2P9S G;  5ANL A;  3Q9U C;  4KXK B;  5FTP A;  4L23 A;  3BQO A;  3U64 A;  3EIJ A;  1OCO E;  3E37 A;  4O60 A;  5B3S E;  1K8K G;  5G04 C;  2WMN A;  4GU5 A;  2V4H C;  3D3M A;  4I1M A;  4UI9 J;  3IV0 A;  2X38 A;  2XGS A;  2Y69 E;  2A5U A;  2WM9 A;  4CDR A;  2ETA A;  2LO6 A;  4ABN A;  2WQ6 A;  4AY5 A;  4DLO A;  4G8L A;  4XKB A;  4U0Z A;  2FO7 A;  2VSY A;  3E30 A;  3CVU A;  1SZA A;  3ZXS A;  4A63 B;  4U04 A;  4GMR A;  5JHA A;  5FZQ A;  2GRO B;  3ABK E;  3LJ3 A;  2DIW A;  3DSV A;  4KZC A;  3ASO E;  3FTY A;  3ZVV A;  4Z68 A;  3E33 A;  5KCM A;  3UI2 A;  4I6G A;  4JW1 A;  5FWQ A;  3CIA A;  3IBE A;  3ASF A;  4JHK A;  2ILR A;  1S64 A;  3UPV A;  4K5C A;  2FF4 A;  5FZR A;  4JC8 A;  4CDM A;  4EZJ A;  2IJG X;  2AVP A;  3D9L A;  4HOQ A;  3UKU G;  2BED A;  3FH5 A;  4I9C A;  1K1B A;  5D2M C;  4J8F A;  4HOT A;  4E6H A;  4HLE A;  1TNZ A;  1DVP A;  3Q7A A;  4HRN A;  2FO1 E;  2VGE A;  5ANR A;  1TN7 A;  2VJ8 A;  3SHF A;  3DSX A;  3JUI A;  5E76 A;  1DNP A;  1HE8 A;  3TXN A;  1QBQ A;  1O1R A;  4BER A;  1XGW A;  3UQ3 A;  4M3O A;  4UUC A;  3AG4 E;  1KPS B;  1LD7 A;  4ATZ D;  3CKC A;  2C0M A;  1FPP A;  4I9E A;  2DYS E;  2ION A;  1D8D A;  4CZ2 D;  4JHJ A;  3AG1 E;  1TNO A;  3TWR A;  3CQC B;  3CVY A;  2OEV A;  3HDX A;  2L0T B;  4OAU C;  2WXJ A;  3B13 A;  3CSF A;  4E85 A;  1IHB A;  4V3I A;  3UIP C;  3CK7 A;  1TN8 A;  1UOH A;  3G2S A;  1NP7 A;  2IF4 A;  5BPP A;  3DWL G;  4WWP A;  4J8Y A;  1PY1 A;  4PDX A;  1OY3 D;  2JAB A;  4O6F A;  3Q7F A;  5LP0 A;  3CVW A;  3QK0 A;  2P58 C;  5FQ4 A;  3J5Q B;  1EYH A;  3UM3 A;  3QWP A;  3JQ1 A;  4JEU A;  3ULQ A;  4JA9 A;  3V79 K;  4HNA D;  3PS6 A;  4PS7 A;  1HX8 A;  3RRU A;  2J08 A;  4AM9 A;  3NZU A;  2GW1 A;  4U63 A;  3CK9 A;  3SO8 A;  2OVF A;  4LNU D;  4N3B A;  5HKP A;  2X6I A;  3CKB A;  3LYA A;  4TUU A;  3RAU A;  3AAA C;  4HB5 A;  5KBA A;  5EYL A;  5ITZ F;  5FT9 A;  4LSZ E;  3LY9 A;  3AS5 A;  3CV0 A;  3SZ7 A;  4MBG A;  3TWX A;  1UN8 A;  2P9I G;  2H6H A;  3T8M A;  4RG9 A;  4WAF A;  3WXX A;  3PDN A;  3LVQ E;  3ZIM A;  3CVQ A;  1EF1 C;  4APF A;  4U07 A;  1HZ4 A;  3LEW A;  2WXH A;  3VLD A;  3G2W A;  4F1S A;  5KNG A;  2J07 A;  5CRU A;  1AWC B;  4G25 A;  4JA7 A;  2QZA A;  2B0O E;  3PZD A;  3QB2 A;  2BTD A;  4HOR A;  3PEV B;  3FUL A;  1SA5 A;  3DRA A;  2ZXW E;  3C72 A;  4WWN A;  2QFC A;  3TL5 A;  3U4T A;  5AAR A;  2GRR B;  3ZHE A;  1PAQ A;  3L16 A;  1V55 E;  4ACK A;  4OVU A;  4BET A;  2DCP A;  3FEX A;  3JYS A;  3U9W A;  3APD A;  1KZP A;  3FUD A;  1H6P A;  2H6I A;  3TG5 A;  3KS2 A;  4XI0 A;  2Y4U A;  4C0E A;  4HXI A;  3RRN B;  2M63 A;  3CHM A;  4FAD A;  4UWG A;  2UWJ G;  3Q75 A;  3DEP A;  3BUA A;  4BTA A;  4BX8 A;  4FHJ A;  4XEI G;  4L7T A;  4GPK A;  3NOG D;  2WPV A;  1Z3X A;  4HI9 A;  1OUV A;  1NA3 A;  2WXN A;  3ASD A;  2H6G A;  4B94 A;  3T5X A;  3DBS A;  4IYP A;  1Y6I A;  2VQ2 A;  3BEE A;  3PZ3 A;  3FDH A;  1S70 B;  3QOU A;  2IEJ A;  1OCZ E;  5EN5 D;  4CT4 A;  1KT1 A;  2YIN A;  5CMY A;  3O4Z A;  1H2U A;  2MRI A;  5KJK A;  3LY8 A;  3TJP A;  2V5Q C;  4UQX A;  4FHK A;  4MRU A;  3PUJ A;  5LCW J;  3P1U A;  4N2S A;  1HF8 A;  4FUL A;  3FU3 A;  1OWM A;  4UQZ A;  4GA1 A;  3B7B A;  3LDZ A;  3DSU A;  4EBA A;  3Q78 A;  2PZI A;  4GZ3 A;  5CEA A;  2FBN A;  3B95 A;  5G05 C;  3V31 A;  4RSY A;  4YND A;  2WXP A;  5BW8 C;  3URZ A;  1RZ4 A;  4I6J A;  4B8C B;  1HG2 A;  1FT1 A;  3UT4 A;  2PM6 A;  4K5A B;  1IHG A;  2J49 A;  5EID A;  5CEC B;  2IU1 A;  4GTT A;  5JMN D;  1S63 A;  2WXI A;  3LVR E;  5FQ7 A;  2P9U G;  2KCV A;  1QNF A;  4U96 D;  4YDY A;  5ENR D;  1N4R A;  1RW2 A;  2OEW A;  1E8X A;  2LAH A;  3N71 A;  3CVX A;  3TWQ A;  2I6H A;  2CHX A;  1WY6 A;  1Z3Y A;  4I1A A;  4EZK A;  3S7D A;  2R02 A;  4PUC A;  2XZT G;  3OXG A;  4YDO A;  1JUQ A;  2F8X K;  3OXF A;  5JJ6 A;  1NZN A;  3IEG A;  2QC9 A;  2GRL A;  4FJY A;  3D9N A;  1TNY A;  5AEN A;  3T5V A;  5FZS A;  3QAR A;  2KZT A;  2PNN A;  2A5E A;  3LKU A;  5KJN A;  1NL4 A;  5KNH D;  3FUF A;  2BUG A;  3FH8 A;  4WND A;  3NAW A;  4JD2 G;  5E75 A;  3C98 A;  3EUV A;  4U7E B;  5T3R A;  2KAT A;  3SFZ A;  5FIO A;  2VSX E;  2HO1 A;  4ANV A;  2WXF A;  3B7R L;  2P9K G;  4EHM A;  3ZHE B;  2ZGD A;  1IQU A;  5DBK A;  4BT8 A;  1MZC A;  4C9B B;  4H7Y A;  2OCC E;  2IO2 C;  2FEZ A;  3ABL E;  2A4Z A;  4X8Q A;  2Y1L E;  3E4B A;  3DPD A;  4CGW A;  4J8E A;  3B7U X;  4U8V D;  2XEE A;  4JL0 A;  1OWP A;  3SFY A;  3Q79 A;  4QFV A;  4KZ0 A;  5KJL A;  5HI7 A;  5D66 A;  1TNU A;  2YNQ A;  4ANU A;  3L54 A;  3AJI A;  2DZO A;  3RO2 A;  3FY4 A;  4GYY A;  2WMO A;  1MQS A;  3NQP A;  2J4D A;  1MX2 A; 
#chains in the Genus database with same CATH homology
 1N0Q A;  1IHB A;  2P2C P;  3D9H A;  5ENQ D;  1IXV A;  2V5Q C;  1UOH A;  5AN8 A;  4HI8 A;  1YCS B;  3C5R A;  5AQB A;  4GPM A;  3HG0 D;  4BES A;  2DZN A;  2XZT G;  3T9K A;  4Z68 A;  4U8Y D;  5AAR A;  3UI2 A;  3ZU7 B;  4J8Y A;  3DEO A;  4B93 B;  2F8X K;  3KEA A;  4DRX E;  4DX2 A;  1OY3 D;  1K1A A;  4F6R D;  2JAB A;  2RFA A;  4U95 D;  4DX5 D;  5EIB E;  4J7W A;  2L6B A;  3TWT A;  4HBD A;  2QC9 A;  5AQ7 A;  2RFM A;  3IXE A;  4RLY A;  5HRY A;  3V2X A;  1G3N B;  3ZKJ A;  4K5C A;  2F37 A;  4O1P A;  3B7B A;  2XEN A;  3J5Q B;  3JUE A;  1WG0 A;  4BSZ B;  4BET A;  5AAO A;  5CEA A;  1DCQ A;  2J8S D;  4LG6 A;  5BXO A;  2PNN A;  3B95 A;  1DC2 A;  2A5E A;  5ENO D;  5ENS D;  1WDY A;  1OT8 A;  3V79 K;  2NYJ A;  4HNA D;  2BKG A;  4JB8 P;  5EYP F;  1NFI E;  3TWU A;  2F8Y A;  4ZHB A;  3V31 A;  5KNH D;  4C48 B;  4DUI A;  4DX1 A;  3V30 A;  1K1B A;  3Q9U C;  2ETC A;  3TWS A;  3JXJ A;  5CBO A;  4O1O A;  1BD8 A;  3ZNG A;  2XZD G;  1N0R A;  3W9F A;  3SO8 A;  1SW6 A;  2ETB A;  1MX6 A;  4LNU D;  4O60 A;  5FIO A;  5HS0 A;  4F1P A;  4HRN A;  3LJN A;  1QYM A;  1TR4 A;  5HKP A;  4DX7 D;  5CBN A;  2FO1 E;  3EHR A;  4HLL A;  4HRM B;  2AJA A;  5ENP D;  2BKK B;  4CYM D;  4K5B A;  4OAV B;  3AAA C;  4HB5 A;  5EIL A;  5KBA A;  2KXP C;  2ZGG A;  5EYL A;  2VGE A;  3DEP A;  2V4H C;  5ITZ F;  1N11 A;  4LSZ E;  3UTM A;  3Q9N C;  3ZUV B;  1IKN D;  2ZGD A;  3TWX A;  1MX4 A;  2KBX A;  4HRL A;  4HQD A;  2DWZ A;  3UXG A;  4K5A B;  4YDW A;  4G8K A;  5EID A;  5CEC B;  4BER A;  1YYH A;  2Y0B G;  3NOG D;  5AQA A;  4ZFH A;  5ENT D;  5AQ9 A;  4NIK A;  1AP7 A;  2ETA A;  4QQI A;  4HI9 A;  3TWV A;  5CED B;  5JMN D;  2MYO A;  3TWW A;  1MJ0 A;  4UUC A;  2XEH A;  3NOC D;  1MYO A;  1SVX A;  2Y1L E;  4G8L A;  5FIN A;  4ATZ D;  4N5Q A;  3HRA A;  2QYJ A;  1BI7 B;  1K3Z D;  1BLX B;  1BI8 B;  4CZ2 D;  5CER B;  3TWR A;  4U8V D;  2XEE A;  4BEP A;  3EHQ A;  1YMP A;  4U96 D;  3V2O A;  4YDY A;  2DVW A;  5ENR D;  4QFV A;  4TUM A;  5KNG A;  5JA4 D;  1AWC B;  5D66 A;  4DX6 D;  4OAU C;  1S70 B;  3J5P A;  3F6Q A;  3AJI A;  3EU9 A;  1A5E A;  2DZO A;  2HE0 A;  3T8K A;  3W9G A;  1BU9 A;  1D9S A;  2B0O E;  5EN5 D;  5BXU A;  4A63 B;  3TWQ A;  5KWD A;  3NBN B;  4GMR A;  3JXI A;  1MX2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...