2LSUA

The nmr high resolution structure of yeast tah1 in a free form
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
110
structure length
110
Chain Sequence
SQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSKLQYRLELAQGAVGSVQIPVVEVDELPEGYDRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TPR repeat-containing protein associated with Hsp90
publication title High-Resolution Structural Analysis Shows How Tah1 Tethers Hsp90 to the R2TP Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 25
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14559 TPR_19 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2lsuA00
5JJ6A 1ELRA 2Y4UA 4RG9A 4G26A 3TGOA 1KT0A 2PL2A 2DBAA 3R9AB 3LYAA 3RO3A 3UPVA 4U0ZA 4F3VA 2XCBA 3LY9A 1NA0A 3MA5A 4UI9K 4GA0A 3ZGQA 4I2WA 2LNIA 1QQEA 4N2SA 1FCHA 4G23A 3CK8A 4N2QA 4WNFA 3S7BA 3UQ3A 3FFLA 4WNGA 1HH8A 3LKUA 4HOUA 4GA1A 1KT1A 4CGVA 3KAEA 3CVPA 2KCKA 2WPVA 5KJLA 3MV2B 2YQ8A 4YVOA 4RG6A 5LCWC 4H7YA 5EX3A 4BWRA 3LY8A 2UY1B 4Y6WA 2XGOA 5ARGA 4BTBA 3AS8A 3RIBA 4U07A 3O48A 3ASFA 2GW1A 3TAXA 4HOQA 3CV0A 5G04J 3GYZA 3KS2A 3RKVA 3MEKA 3LCAA 3MKRA 4G1TA 4CGWA 1NA3A 3CKBA 2FO7A 3UUXA 4UI9J 3S7DA 3BEEA 5EX0A 5C1DA 4KBQA 1WM5A 5ARFA 5JJ7A 1NZNA 3KD7A 4G24A 3TG4A 3Q47B 5D0OD 3FWVA 5G04C 1PC2A 3MV3B 3GZ2A 4I2ZA 5M72A 2C0MA 3U3WA 5EKQD 3PDNA 3CVQA 4GZ3A 4I1AA 4GPKA 3IEGA 4N3CA 5AYWD 3S7FA 1ELWA 2IFUA 2I6HA 4GYYA 1WAO1 4O6FA 4XI9A 4BT9A 2VYIA 2QFCA 4KYOB 4AY6A 2L6JA 1TJCA 2PQRA 4JL0A 4APOA 2HYZA 5FTPA 3U4TA 4LEUA 4A1SA 4I9CA 3N71A 4ABNA 5CCLA 3AS4A 2E2EA 4JA9A 3URZA 4H7XA 4N5CA 5JJTA 4NRHB 5DBKA 3CK7A 3Q49B 2KC7A 1B89A 2PZIA 4U04A 2NC9A 4IN3B 4YNDA 3LPZA 5D0QD 4Y6CA 2OOEA 2BUGA 3PE3A 4XIFA 3CVLA 3NF1A 2XCCA 4KXKB 2XEVA 3S7JA 1Y8MA 3QWPA 3QOUA 4J8FA 5FZQA 2FF4A 4J8DA 3JYSA 3RU0A 4G25A 3ULQA 5FZRA 5G05J 5CHEE 4GYWA 3RO2A 3CK9A 4G2VA 1YA0A 2WQHA 2P58C 3GW4A 4XI0A 3OXLA 4AY5A 4B94A 4ME2A 3ESKA 3QKYA 4N39A 3QWVA 1HXIA 3SF4A 3WXXA 3CVNA 2XPIA 5G05C 1E96B 1ZU2A 1A17A 3OXGA 3EDTB 4UI9C 5HI7A 4GCOA 5FZSA 4JA7A 4GZ5A 5FJYA 4N3AA 4I9EA 2V5FA 4UQYA 4HOSA 4W9RA 4JHRA 3ASDA 4N3BA 2LSVA 4HOTA 1KLXA 2C2LA 4WNDA 4J0UA 2VGYA 3Q5MA 3RJVA 2FBNA 2AVPA 1QZ2A 2Y4TA 2KCVA 2XGMA 5KJKA 3OXFA 3AS5A 3CKCA 1XNFA 1OUVA 2XGSA 5BT1A 4BTAA 2JLBA 3QWWA 4CDRA 3QDNA 4AM9A 4BT8A 3K9IA 2KATA 2J9QA 2FI7A 1P5QA 5LCWJ 4YVQC 2LSUA 5A7DB 3E4BA 2UWJG 4I17A 2IF4A 4AIFA 3ASHA 2C0LA 4GA2A 2R5SA 3PE4A 5BNWA 4HORA 3ZFWA 4GCNA 4U0UA 2Q7FA 1HZ4A 5KJNA 5DIZA 5FT9A 2FEZA 2VQ2A 4UQXA 3FP3A 2UY1A 3GZ1A 3Q4AB 2HR2A 2HO1A 4WUYA 4GZ6A 2KCLA 3VTYA 2VGXA 5HQ8A 5A6CA 3LY7A 3ASGA 2VGXB 1IYGA 2PQNA 4J8EA 3ZHEA 1W3BA 1IHGA 2VSYA 3VTXA 5CCMA 3CEQA 3TG5A 3HYMB 3ZHEB 4GYOA 3Q15A 5BW8C 4NQ0A 2ONDA 2MHKA 2VSNA 4EQFA 5KJMA 1ZBPA 2YHCA 3ZPJA 4WNEA 4UQZA 4U0SA 3SZ7A 3ZN3A
chains in the Genus database with same CATH superfamily
1SA5A 2ZIRA 4GPMA 5JJ6A 3BG0B 4LG6A 3HXCA 3PREA 4RG9A 1KT0A 4K03A 2DBAA 4FJYA 3RO3A 2DWZA 4BFRA 4U0ZA 4HB5A 4F1PA 1FVFA 5CBOA 3D9KA 2MRIA 3DSUA 4CT0A 3LJNA 4UI9K 5E76A 3C5RA 2CFZA 4KT6B 1NL4A 2QY7A 1Y6IA 4G23A 1ELKA 2XEHA 2GRMA 2R05A 4N2QA 3S7BA 2V8SE 2VSXE 3UQ3A 5J90A 1JPLA 3L9TA 3UIPC 2HM8A 2I2OA 4A1GA 3AG2E 4JW1A 4YDYA 3NOGD 3L08A 3RRUA 4GA1A 1N52A 2X6JA 4CGVA 2WPVA 2DVWA 2LO6A 3JQ1A 2X38A 3R7QA 2XS1A 2YHEA 3Q7FA 5CEAA 4UWFA 4BSZB 4KMOA 4TV3A 4K0RA 5LFAA 3VLEA 1HS6A 3AS8A 2NSZA 3RIBA 3CV0A 2FO1E 4TXPA 1OWNA 3PH0C 4PH4B 4G1TA 1DNPA 2KXPC 3D9JA 5ANLA 4R7LA 4CGWA 4O1PA 4EECA 1G3NB 3ESLA 4KVMA 4UI9J 4ZHBA 3R7RA 4KBQA 1OT8A 4F7AA 5CMYA 4G24A 5D0OD 2WXGA 3TWUA 3JXIA 1H19A 3FU0A 1RW2A 1UN8A 2WXRA 3PDNA 2LAIA 3UINC 3IEGA 4FULA 1H6OA 4I1OB 2I6HA 1WAO1 4BT9A 4LRZA 2F8XK 5BV1A 2QFCA 4KYOB 3FULA 2ZGGA 2ZGDA 1H6KA 3BQOA 2PQRA 3QAQA 4BETA 4GTOA 4OVUA 2HYZA 5FTPA 3U9WA 4LEUA 1BU9A 4I9CA 4ABNA 4LNBA 1KZPA 4DI4A 2R03A 3EHNA 3DWLG 3ZNGA 4N5CA 4JC8A 1OXJA 5C2YA 3SO8A 2CHWA 3TWVA 5KWDA 3TWXA 1LD7A 4B0ZA 5T4YA 3EIQC 1FT1A 4IULA 5D0QD 3ZU7B 1UJKA 1BD8A 3PE3A 3GZSA 3NOCD 1EYHA 4CDNA 4FLBA 3CVLA 1Z6TA 2F8YA 2Y0BG 3G2WA 4CCAA 3UKRG 4KXKB 2XEVA 3S7JA 3QWPA 2CG2A 4DLQA 4JHJA 1TNYA 3ZXSA 2IONA 5FZRA 2R59A 3IKOB 4L9PA 1N0RA 2CG3A 4EPZA 5CHEE 4JB8P 3C72A 3UT4A 4PS7A 3FTXA 4B8CB 4G2VA 1MQSA 4AV7A 5CECB 2WXOA 2GRNB 4XI0A 4GTVA 4AY5A 1MZCA 4TUUA 4Q94A 2YNQA 4N39A 1HXIA 3UT7A 3CHRA 1JCRA 4DX2A 3CVUA 3F6QA 4XKCA 2ZU6B 1ZU2A 2A5EA 5HI7A 2A4ZA 5FZSA 5HKPA 2J4BA 3LS8A 4N3AA 4I9EA 4WWPA 2OEWA 4HOTA 3L6AA 4I43A 3MZLB 3RJVA 3FUIA 3FUDA 1K8KG 2KCVA 3FH8A 3PUKA 3TWTA 5BT1A 4CDRA 3MCXA 3HIZA 2P9LG 1SW6A 4APFA 1KPSB 4L7TA 3PUJA 3T8KA 2Y69E 4AOFA 3HDXA 1N4PA 3NB2A 3MJWA 3ASHA 2C0LA 4XX5A 3CLJA 2WQ6A 3ZW3A 4Z68A 5FT9A 2FEZA 4A55A 5H7PA 3T8MA 3CQGB 3RRNB 1TNOA 2RD0A 4B93B 4G8LA 4FP7A 4WUYA 2GRLA 1AWCB 5AQBA 2VGXA 2WVIA 1E8ZA 5HQ8A 1NFIE 3LY7A 4ANUA 2ETAA 1TN7A 1H2VC 1TNZA 1BPOA 1W3BA 2XS8A 2VSYA 1TNUA 3VTXA 1UN9A 5CCMA 3CEQA 3ZHEB 2MOWA 4GYOA 1O1TA 4HNAD 3QNKA 4EQFA 1ZBPA 4WNEA 1E7VA 4U0SA 2OVBA 1PY1A 4G8KA 3CHOA 1ELRA 2Y4UA 5AAOA 3FTUA 3FUNA 3HG0D 2XRYA 3AG4E 4OYSA 2PL2A 2FULA 3ZUVB 2E0IA 3R9AB 2X6HA 4LNUD 1U2VG 4GTQA 1N95A 3HRAA 3UPVA 1MX4A 4C48B 3CVWA 3ZYKA 4UWGA 1OCZE 4ANWA 4ANXA 1SQMA 2LXMA 3FTVA 1H0AA 3TWRA 3C3QA 5B1AE 4JZYA 3FTWA 1QQEA 4N2SA 3D9MA 3QARA 4I1MA 4WNFA 2J4DA 4FJZA 4ILHB 3NZSA 4UWKA 4MS6A 3ENEA 3CHSA 4HFGA 3FFLA 4WNGA 3UM2A 3EHMA 1O5MA 1GW6A 2F37A 4ILIA 3I5PA 3KAEA 3CVPA 4GAAA 4JEHA 3B7UX 2AXUA 3E37A 3MV2B 4RG6A 3AAAC 5LCWC 3PEVB 2ZXWE 3T5VA 4MLPA 3LY8A 3D9OA 4GZCA 1X81A 4BTBA 3CIAA 3FU6A 3DSSA 3O48A 2GW1A 3TAXA 3U64A 3KS2A 3LJ3A 1H2UA 1HE8A 1INZA 3G2TA 1NA3A 3SI5A 1DCEA 4PUCA 4B8AA 3RK6A 4NURA 5EX0A 2P9PG 1U3CA 5D2MC 3U66A 5ARFA 3D9IA 2F0YA 5G04C 3PVLA 2WB2A 3MV3B 3GZ2A 4K5AB 5M72A 2IY0C 4GZ3A 4GPKA 4KVOA 4N3CA 4EZJA 1IQUA 3Q73A 5FQ4A 3EU9A 2IFUA 4UUCA 4D10C 4GYYA 1ZB1A 4XI9A 5ITZF 3DBSA 3ZKJA 4TXRA 1NI1A 1QYMA 3E30A 1TYQG 4JL0A 3UTMA 4ANVA 4APOA 3KEZA 3N71A 2E2EA 1QBQA 2L0TB 3PS6A 3DSTA 2IQCA 3DSXA 3Q49B 2R17C 2KC7A 1JUQA 1UJJA 2RKKA 2OCCE 2LXLA 2NC9A 2JEKA 4IN3B 2B6CA 1WDYA 4Y6CA 2BUGA 1UW4B 3V31A 3R9MA 3UM0A 1OWOA 3UX4A 5BUZA 2WXMA 2XCCA 5CMWA 1RZ4A 2AW6A 5EYLA 4J8FA 2FF4A 4AXHA 3JYSA 4J8YA 4J7WA 5ENQD 3OTNA 1OWPA 1DVPA 3TJPA 4G25A 2R02A 2GGFA 3DEPA 3ONKA 5G05J 2DYSE 3ULEG 1K1AA 4GYWA 4F53A 3B7RL 3KEAA 3CK9A 1MX2A 2AXZA 2VSOE 1N54A 1A5EA 2BEDA 2WQHA 2P9IG 4B94A 3FUKA 3ESKA 1EPUA 1EDUA 3QKYA 5LOZA 3DRAA 4LERA 3AJIA 3SF4A 2XRZA 3B13A 3CVXA 1E96B 3W9FA 1HG5A 4GTMA 2VTBB 3SQVA 5ENPD 3JCKC 5J08A 2IO2C 4E85A 3FUEA 4PS3A 4W9RA 3DEOA 1HX8A 3CVYA 5BV0A 4WAFA 2RFMA 2MYOA 3DPYA 3VLFA 3UIOC 4ACKA 1QZ2A 5EILA 1H2TC 4U7EB 4DRXE 1SVXA 2XGMA 3LVQE 2EIJE 5BXUA 2PM7A 1S70B 1XNFA 1OUVA 4PDXA 1H6PA 3I4RB 4JEUA 3K9IA 2J9QA 3SY2A 2FI7A 5LCWJ 5A7DB 3E4BA 3G2VA 4I17A 4AIFA 2WMNA 3OAWA 2WXFA 3E32A 5AQ9A 2GRPB 4DLOA 4I6JA 4HORA 4GCNA 4U0UA 4UWHA 2Q7FA 2WXQA 4CYMD 2VQ2A 4UQXA 2L6BA 2UY1A 5ENNA 3ZYMA 3TXNA 2HR2A 5B3SE 3V2XA 1WY6A 3VTYA 3TWSA 2NXPA 5A6CA 4U63A 5KNHD 3MGBA 1IYGA 3ZHEA 4ACLA 3FEXA 4DJAA 4HRMB 1TR4A 5FIOA 2ILRA 3EHQA 2PM6A 5KJMA 3AG1E 4XE0A 4FA6A 5ENTD 4OAVB 4UQZA 5G2NA 3ZN3A 4X8QA 5EYPF 4HBDA 2IO3C 1IKND 5G55A 2H6HA 3TGOA 4AP2A 4TRQA 3RRMB 4HRLA 4PS8A 2IOLA 5LX8A 3Q78A 3LYAA 4U8HA 2WXHA 2XCBA 4EZLA 5AJLA 3LY9A 5FQ7A 2M63A 1NA0A 2DCPA 3SHFA 1OWMA 5FINA 3L16A 3ZGQA 4I2WA 4UWLA 1JWFA 4DI3A 2VGEA 2H6IA 4NIKA 3B95A 3KSQA 5CEDB 1N4SA 5KCMA 2J09A 1WG0A 5EDSA 3FU5A 3L82A 3EUVA 4U8VD 2EILE 5D66A 3W9GA 2BKGA 4I6EA 2LAHA 3X2QE 2WXPA 4YVOA 3CR3A 2B0OE 2UY1B 1E8WA 5HRYA 1E8YA 3QJZA 1D8EA 1FVHA 2AJAA 3FUJA 4U07A 3ZEFA 3CGHA 1YMPA 3GYZA 3RKVA 3DPDA 3MEKA 3ONLA 4AVXA 3LCAA 2QYUA 3LXUX 2FO7A 3IHVA 3UUXA 3SBSA 3PZ1A 3FH5A 3BEEA 4BESA 5A23A 4BX8A 4L2YA 3IV0A 4ATZD 1WM5A 1EF1C 2L0IA 5JJ7A 1OCOE 4BSXA 4OAUC 4AJWA 2Y1LE 3SFYA 1PC2A 1V54E 3ABKE 3FUHA 5EKQD 2OV8A 1SA4A 1OCCE 4URKA 1L5JA 1VDYA 3IBEA 4I1AA 4V3IA 4QFVA 2WXJA 2I1JA 1QNFA 3NBNB 2DYRE 4L1BA 1XGWA 2KBXA 2KZTA 2L6JA 3UI2A 1TJCA 1KZOA 1U3DA 3FUFA 4F1SA 3U4TA 3PZ4A 3UM1A 2QZAA 1K1BA 3MKQA 3URZA 4H7XA 5JJTA 5DBKA 4M3OA 2L9BA 1N94A 1S64A 2XENA 1B89A 3Q9UC 3PNLB 1TN8A 1FT2A 4EZKA 4MBGA 1N4QA 4YNDA 5HS0A 4C9BB 3VLDA 1DCQA 2EIME 2IEJA 5KBAA 2X6FA 4U8YD 1TN6A 1N4RA 1Y8MA 3L17A 4HI8A 4HS2A 5JMND 1N9AA 3I4GA 3FY4A 1Q2ZA 2X6IA 1FPPA 3CHPA 1HG2A 4GB9A 4K5CA 1Z5SC 3PEUB 1YA0A 2WXLA 3GW4A 4DX5D 3OXLA 4IYPA 2KM4A 4ME2A 4JVSA 1TJFA 3D3MA 3QWVA 2VTBA 2XHEA 2XZTG 3HHMA 4CDMA 5ENRD 1OY3D 2V0PA 4JA7A 4GZ5A 3ZYQA 2AWIA 4UQYA 4MRUA 4JHRA 3ASDA 3ML8A 2LSVA 1KLXA 2C2LA 2RFAA 2IOSA 3EU5A 1S63A 2FBNA 5T3RA 4M7CA 1E7UA 4GTTA 2EQXA 1HF8A 1O1RA 2KZTB 3FEYA 4O1OA 2DZNA 5ENOD 4L2LA 3AU5A 3FTZA 2P9UG 4ILGA 3AU4A 2JLBA 2NYJA 3TWQA 3QDNA 4U96D 1SZAA 3EIJA 4AM9A 3MKQB 4BT8A 3APFA 4CZ2D 1P5QA 3B7TA 2LSUA 2DIWA 3HXEA 2UWJG 5AARA 4JD2G 2IF4A 3I3NA 5CRVA 4JPSA 3QB2A 2X6KA 1S0PA 1X5BA 2GROB 1K3ZD 2H6GA 5BNWA 2XEEA 3PRZA 3ABLE 5DIZA 5AN8A 2J8SD 3AG3E 4BX9A 3Q4AB 4L23A 3HXDA 2HO1A 4GZ6A 1Z3YA 2KCLA 1PAQA 3HVEB 2GRQB 1MJ0A 3ASGA 4RLYA 3FH7A 5CRUA 1IHGA 4CT4A 3HYMB 4C0MA 2LUHA 5BW8C 4NQ0A 4I6GA 2MHKA 3J5QB 2XQ0A 1BLXB 3ZPJA 2J08A 1D9SA 4ZFHA 3P2BA 2EIKE 3SZ7A 3MA5A 3QK0A 2WXNA 3CSFA 2BTDA 4E6HA 4F6RD 2P2CP 4EBAG 4G26A 3ASOE 2WMOA 4FHJA 3D9LA 3ZIMA 4BERA 2ZISA 4HVBA 4KZCA 4F3VA 3T9KA 3V2OA 4U95D 3LDZA 4N5QA 5AJDA 5LP0A 2OEVA 3E33A 4GA0A 4DX6D 2HE0A 3UXGA 2LNIA 3SGHA 4K5BA 3JXJA 1YYHA 1FCHA 2YINA 3FTSA 4IRUA 1UOHA 3IHYA 3CK8A 4KZ0A 2GRRB 3ML9A 5JA4D 4RSYA 1HO8A 1MYOA 3FDHA 3BU8A 1HH8A 3LKUA 3ZRHA 3UMVA 2V4HC 4J8SA 3G2SA 4HOUA 3JUIA 4AEZC 3APCA 1KT1A 3HXBA 1V55E 2KCKA 4A3TA 5KJLA 5T8IA 4RQIA 1HU3A 4DX7D 4EHMA 5KNGA 3ASNE 3PZ3A 5EIDA 2AXVA 5EN5D 2YQ8A 3E34A 4H7YA 2BKKB 1NP7A 5EX3A 3MYVA 4BWRA 3IXEA 4JHKA 1LTXA 4Y6WA 2XGOA 5ARGA 3MX3A 4HLEA 4GU5A 2P9KG 3ASFA 4DK5A 4HOQA 4GMLA 5G04J 3NQPA 2J07A 5ENSD 2V5QC 5ANRA 3MKRA 2QC9A 3ZXPA 4DX1A 3T5XA 3CQCB 3CKBA 2IU1A 5FQ8A 4YDEA 3S7DA 1DC2A 4WWOA 1OCRE 3BG1B 3QC1A 5C1DA 4XEIG 1NZNA 3TWWA 3KD7A 2RG8A 3TG4A 3Q47B 1JCQA 2EINE 3EJNA 3FWVA 3PZDA 1HFAA 4I2ZA 2C0MA 3U3WA 2CHXA 3DXMG 3CVQA 4O60A 3CVVA 3LEWA 1BI8B 3G2UA 4P29A 3C98A 4JXTA 3PNTB 5AYWD 3S7FA 1ELWA 4O6FA 5FQ6A 3SFXA 2VYIA 4AY6A 3APDA 3HXFA 4LUNU 3SD5A 1UG3A 2XZDG 2WM9A 3B7SA 4A1SA 1IQRA 4XZ4A 4J6IA 4A63B 5CCLA 5CBNA 3AS4A 3LVRE 4JA9A 3NZUA 4TUMA 4A3VA 4NRHB 3PZ2A 3CK7A 4HQDA 4DPRA 1OWLA 3RSEG 4Q69A 4CEMA 2PZIA 3FUMA 1TEZA 4U04A 3BUAA 4Q96A 1IXVA 2WQ7A 3EHRA 3C3RA 4YDOA 3LPZA 1JCSA 3D9PA 2OOEA 1E8XA 5IY5E 4G11A 3FU3A 4XIFA 2CFUA 1N11A 2R2LA 2I1KA 1Z3XA 3CSTA 3NF1A 4FC8A 3SFZA 3QOUA 5FZQA 4J8DA 2X3MA 3ISMC 3SBTB 3RU0A 4HI9A 3ULQA 5AIJA 4HLLA 1JWGA 3UKUG 4FHKA 2CHZA 4LCTA 4TXQA 5E75A 3RO2A 4GTPA 2H6FA 3DSVA 2ETBA 3B7BA 2P58C 3JQ0A 4MKTA 3DXKG 4WWNA 2VJ8A 4HXIA 3DSWA 3TXMA 4LSZE 4GMJA 3C3OA 4FU3A 3Q7AA 3WXXA 2IJGX 3CVNA 4LNGA 2XPIA 4C0EA 5G05C 3Q79A 5EIBE 3UM3A 3ULYA 2QYJA 1A17A 4NACA 2Y3AA 2XPYA 1IHBA 3OXGA 1D8DA 3EDTB 4UI9C 4ATGA 1SZ9A 4HRNA 4GCOA 4FLHA 5FJYA 3S2AA 2V5FA 4HOSA 5JHAA 3CHMA 3FTYA 4N3BA 4GMRA 1E90A 2P9SG 4WNDA 4J0UA 5B1BE 2VGYA 3Q5MA 3ABME 2AVPA 3Q75A 2Y4TA 4QQIA 1MHQA 4FADA 5KJKA 3OXFA 2P9NG 3AS5A 5BPPA 2WXKA 3J5PA 3CKCA 3O4ZA 2XGSA 4BTAA 3QWWA 4GTRA 4RVBA 2I9CA 3V30A 2KATA 3L54A 2V4LA 5FWQA 4YVQC 2XPZA 3V79K 4OVVA 5BXOA 3D9HA 2OVFA 4GA2A 4GTSA 3P1UA 2R5SA 1LF8A 4CRWA 1LD8A 3PE4A 3ZFWA 1HZ4A 4GZDA 4DUIA 5KJNA 1N0QA 3FP3A 3HVEA 5CERB 3GZ1A 3CHQA 2A5UA 3L13A 3Q9NC 4BY6A 2DZOA 3D9NA 3ZYLA 3WG7E 1BI7B 4EBAA 3ZVVA 3L22A 2VGXB 1YCSB 2PQNA 4J8EA 1AP7A 4B89A 1O1SA 2ETCA 3KSLA 3NAWA 3TG5A 5AENA 3FHEA 3Q15A 2JABA 3TL5A 3SNXA 2PNNA 3JUEA 5AQAA 5AQ7A 1MX6A 2J49A 2ONDA 2VSNA 2WXIA 4BEPA 5JHBA 4YDWA 3RAUA 2YHCA 2BF0X 1TNBA 3UT8A 4XKBA
chains in the Genus database with same CATH topology
3QK0A 3CHOA 5JJ6A 2WXNA 1ELRA 2Y4UA 3BG0B 3CSFA 2BTDA 3FTUA 4E6HA 5G55A 3FUNA 3PREA 4EBAG 4RG9A 2XRYA 4G26A 3TGOA 4OYSA 4AP2A 1KT0A 4TRQA 4K03A 2PL2A 2WMOA 4FHJA 2DBAA 3RRMB 3D9LA 2FULA 2E0IA 4PS8A 3ZIMA 4FJYA 3R9AB 2IOLA 5LX8A 2X6HA 3LYAA 3RO3A 4HVBA 4KZCA 3UPVA 4BFRA 4U0ZA 3CVWA 4U8HA 3ZYKA 4UWGA 4F3VA 2WXHA 2XCBA 1FVFA 4EZLA 5AJLA 4ANWA 4ANXA 3LY9A 5FQ7A 2M63A 1NA0A 2DCPA 3LDZA 1SQMA 3D9KA 5AJDA 5LP0A 3SHFA 2MRIA 4CT0A 1OWMA 4UI9K 4GA0A 3L16A 3ZGQA 3FTVA 1H0AA 5E76A 4I2WA 4JZYA 4UWLA 3FTWA 2CFZA 2LNIA 1JWFA 4KT6B 3SGHA 4DI3A 1QQEA 4N2SA 1FCHA 2QY7A 2YINA 3D9MA 1Y6IA 3FTSA 4IRUA 4G23A 3IHYA 1ELKA 3QARA 3CK8A 2GRMA 4KZ0A 4N2QA 4I1MA 4WNFA 2V8SE 2VSXE 3S7BA 2J4DA 4FJZA 4ILHB 3NZSA 4UWKA 3UQ3A 4MS6A 3ENEA 5KCMA 3ML9A 2J09A 1JPLA 4RSYA 5J90A 1HO8A 3CHSA 3FDHA 4HFGA 3FFLA 4WNGA 1HH8A 2HM8A 2I2OA 3LKUA 3ZRHA 3EHMA 3UMVA 1GW6A 3FU5A 4ILIA 4JW1A 4A1GA 5EDSA 3L08A 4J8SA 3G2SA 3I5PA 4HOUA 3JUIA 4GA1A 3RRUA 4AEZC 1N52A 3APCA 1KT1A 2X6JA 4CGVA 3KAEA 3CVPA 2KCKA 4A3TA 2WPVA 4GAAA 4JEHA 5T8IA 5KJLA 2LO6A 3B7UX 3JQ1A 4I6EA 1HU3A 2X38A 3R7QA 2YHEA 2AXUA 2AXVA 2LAHA 2WXPA 3MV2B 2YQ8A 4YVOA 4RG6A 5LCWC 4UWFA 4H7YA 1NP7A 5EX3A 3PEVB 3CR3A 3MYVA 4BWRA 3T5VA 4MLPA 3LY8A 4JHKA 3D9OA 4KMOA 4TV3A 2UY1B 4K0RA 4Y6WA 4GZCA 1E8WA 2XGOA 5LFAA 1E8YA 5ARGA 3MX3A 3QJZA 4BTBA 4HLEA 3CIAA 1HS6A 3AS8A 1FVHA 3FU6A 4GU5A 2NSZA 3FUJA 4U07A 3RIBA 3ZEFA 3CGHA 3O48A 3ASFA 4DK5A 2GW1A 3TAXA 4HOQA 3CV0A 4GMLA 5G04J 3NQPA 2J07A 3U64A 1OWNA 3GYZA 3KS2A 3DPDA 3LJ3A 3PH0C 4PH4B 3RKVA 3MEKA 3ONLA 3LCAA 5ANRA 4AVXA 3MKRA 3LXUX 1H2UA 1HE8A 4G1TA 1INZA 1DNPA 3D9JA 3G2TA 3CQCB 5ANLA 3T5XA 4R7LA 4CGWA 1NA3A 3SI5A 3CKBA 2FO7A 2IU1A 3IHVA 5FQ8A 3UUXA 4EECA 3ESLA 4PUCA 4KVMA 3SBSA 4UI9J 4B8AA 3FH5A 3BEEA 4NURA 4WWOA 5EX0A 3RK6A 3S7DA 3BG1B 3QC1A 5A23A 1U3CA 4BX8A 4L2YA 3IV0A 3R7RA 5C1DA 4KBQA 1WM5A 3U66A 1EF1C 2L0IA 5ARFA 5JJ7A 4F7AA 1NZNA 3D9IA 4BSXA 5CMYA 3KD7A 2RG8A 4G24A 3TG4A 3Q47B 5D0OD 2WXGA 3EJNA 4AJWA 3FWVA 5G04C 3PZDA 1PC2A 1H19A 3PVLA 2WB2A 1HFAA 3MV3B 3GZ2A 4I2ZA 5M72A 2C0MA 3FUHA 3FU0A 3U3WA 5EKQD 1UN8A 2OV8A 2CHXA 2WXRA 4URKA 3PDNA 1L5JA 2LAIA 1VDYA 3IBEA 3CVQA 4GZ3A 4I1AA 3CVVA 3LEWA 4GPKA 3G2UA 3IEGA 4P29A 3C98A 4FULA 4QFVA 4V3IA 4JXTA 4KVOA 3PNTB 4N3CA 4EZJA 1IQUA 5FQ4A 5AYWD 2WXJA 3S7FA 4I1OB 1ELWA 2IFUA 4D10C 2I1JA 2I6HA 4GYYA 1QNFA 1WAO1 4O6FA 4XI9A 4BT9A 5FQ6A 4L1BA 4LRZA 2VYIA 5BV1A 2QFCA 4KYOB 1XGWA 3FULA 3DBSA 2KZTA 2L6JA 4AY6A 1H6KA 1TJCA 5G2NA 2PQRA 3QAQA 3APDA 4JL0A 4LUNU 4OVUA 3SD5A 1UG3A 4ANVA 4APOA 1U3DA 3FUFA 2HYZA 5FTPA 3U9WA 4F1SA 2WM9A 3B7SA 3U4TA 3KEZA 4LEUA 4A1SA 1IQRA 4I9CA 3N71A 4J6IA 4XZ4A 4ABNA 5CCLA 4DI4A 3AS4A 3LVRE 2E2EA 3EHNA 3MKQA 3NZUA 4JA9A 3URZA 4H7XA 4N5CA 5JJTA 4JC8A 5C2YA 2L0TB 4NRHB 4A3VA 5DBKA 4M3OA 3PS6A 2CHWA 2IQCA 2L9BA 3CK7A 4DPRA 3Q49B 1OWLA 2R17C 4Q69A 2KC7A 1JUQA 1UJJA 4B0ZA 4CEMA 1B89A 2PZIA 3FUMA 3PNLB 5T4YA 1TEZA 4U04A 3EIQC 4Q96A 2NC9A 4EZKA 2JEKA 2WQ7A 4IN3B 4YNDA 3LPZA 4C9BB 3VLDA 4IULA 5D0QD 3D9PA 4Y6CA 1UJKA 1E8XA 2OOEA 2BUGA 1UW4B 4G11A 3PE3A 3FU3A 3GZSA 2X6FA 4XIFA 2CFUA 1EYHA 1OWOA 4CDNA 4FLBA 3UX4A 5BUZA 2WXMA 1Z6TA 3CVLA 2I1KA 1Z3XA 3CSTA 2XCCA 3G2WA 3NF1A 4FC8A 2XEVA 4KXKB 3S7JA 2AW6A 3SFZA 4CCAA 5CMWA 1Y8MA 3QWPA 3L17A 3QOUA 4J8FA 2CG2A 4HS2A 2FF4A 4J8DA 5FZQA 4AXHA 4DLQA 4JHJA 3JYSA 3OTNA 1OWPA 2X3MA 2IONA 3SBTB 3ZXSA 1DVPA 3RU0A 3TJPA 4G25A 3ULQA 5FZRA 2R59A 3IKOB 5AIJA 1JWGA 2GGFA 3I4GA 2CG3A 4FHKA 2CHZA 3FY4A 3ONKA 4LCTA 5G05J 4EPZA 5CHEE 4GYWA 4F53A 2X6IA 3UT4A 4PS7A 3FTXA 3B7RL 4B8CB 5E75A 3RO2A 3CK9A 4G2VA 3CHPA 1HG2A 4GB9A 2AXZA 1MQSA 3PEUB 2VSOE 1N54A 4AV7A 1YA0A 2WXLA 2WXOA 2WQHA 2P58C 3GW4A 3JQ0A 4XI0A 4MKTA 4WWNA 3OXLA 4AY5A 2VJ8A 4HXIA 4IYPA 2KM4A 3TXMA 4B94A 4GMJA 4TUUA 4ME2A 3FUKA 4JVSA 3ESKA 4Q94A 1EPUA 1EDUA 3QKYA 2YNQA 1TJFA 4LERA 5LOZA 3D3MA 4N39A 3QWVA 1HXIA 4FU3A 3SF4A 3WXXA 2VTBA 3UT7A 3CHRA 2XRZA 3CVUA 3B13A 2IJGX 3CVNA 4C0EA 2XPIA 3CVXA 2XHEA 5G05C 4XKCA 1E96B 2ZU6B 1ZU2A 1A17A 4NACA 2Y3AA 2XPYA 1HG5A 3OXGA 2VTBB 3HHMA 4CDMA 3EDTB 3JCKC 4UI9C 4ATGA 1SZ9A 5J08A 2V0PA 5HI7A 2A4ZA 4GCOA 5FZSA 4E85A 2J4BA 3FUEA 4FLHA 4JA7A 4GZ5A 3LS8A 5FJYA 4N3AA 3S2AA 3ZYQA 2AWIA 4I9EA 2V5FA 4UQYA 4WWPA 4HOSA 4PS3A 4W9RA 4MRUA 4JHRA 5JHAA 3CHMA 3ASDA 1HX8A 3ML8A 3CVYA 3FTYA 2LSVA 4N3BA 4WAFA 3L6AA 1KLXA 2C2LA 5BV0A 4HOTA 1E90A 2IOSA 3VLFA 4WNDA 4I43A 3MZLB 4J0UA 2VGYA 3Q5MA 3RJVA 2FBNA 5T3RA 4ACKA 1E7UA 2AVPA 2EQXA 1HF8A 1QZ2A 2Y4TA 1H2TC 3FUIA 3FUDA 1MHQA 2KZTB 3FEYA 2KCVA 2XGMA 3FH8A 3LVQE 3PUKA 4FADA 5KJKA 3OXFA 3AS5A 5BPPA 2PM7A 2WXKA 3AU5A 3CKCA 3O4ZA 4L2LA 3FTZA 1XNFA 1OUVA 2XGSA 5BT1A 4ILGA 4BTAA 3AU4A 2JLBA 3QWWA 4PDXA 4CDRA 3QDNA 3MCXA 3I4RB 3HIZA 4RVBA 1SZAA 3EIJA 4JEUA 3MKQB 4AM9A 4BT8A 4APFA 2I9CA 3APFA 3K9IA 4L7TA 3PUJA 2KATA 2J9QA 3L54A 2FI7A 1P5QA 2V4LA 3B7TA 5FWQA 4AOFA 4YVQC 3HDXA 2LSUA 2DIWA 5A7DB 5LCWJ 2XPZA 3E4BA 3G2VA 3SZ7A 2UWJG 4I17A 3MJWA 2IF4A 4OVVA 3I3NA 4AIFA 3ASHA 2WMNA 4JPSA 3OAWA 2WXFA 2OVFA 3QB2A 2C0LA 4DLOA 2X6KA 4GA2A 1S0PA 3P1UA 2R5SA 1LF8A 1X5BA 3VLEA 4CRWA 4XX5A 3CLJA 4I6JA 3PE4A 5BNWA 2WQ6A 4HORA 3ZFWA 4GCNA 4U0UA 4UWHA 2Q7FA 3ZW3A 1HZ4A 4GZDA 3PRZA 5KJNA 5DIZA 5FT9A 2WXQA 2FEZA 4A55A 3T8MA 3CQGB 3RRNB 2VQ2A 4UQXA 3FP3A 4BX9A 3HVEA 2UY1A 5ENNA 3GZ1A 3CHQA 2A5UA 2RD0A 3TXNA 3Q4AB 3ZYMA 3L13A 4L23A 4FP7A 2HR2A 2HO1A 4WUYA 1WY6A 4GZ6A 1Z3YA 2GRLA 2KCLA 3VTYA 1PAQA 2VGXA 2WVIA 1E8ZA 4BY6A 3HVEB 5HQ8A 2NXPA 3D9NA 3ZYLA 3LY7A 5A6CA 4ANUA 3ASGA 4EBAA 3ZVVA 3FH7A 1H2VC 4U63A 3L22A 3MGBA 2VGXB 1IYGA 2PQNA 4J8EA 3ZHEA 1BPOA 1W3BA 1IHGA 2VSYA 4ACLA 4B89A 3FEXA 3VTXA 1UN9A 5CCMA 4DJAA 3CEQA 4CT4A 3TG5A 3HYMB 5AENA 4C0MA 3FHEA 3ZHEB 2MOWA 4GYOA 3Q15A 3SNXA 5BW8C 3TL5A 4NQ0A 2ILRA 4I6GA 3QNKA 2J49A 2ONDA 2MHKA 2PM6A 2VSNA 4EQFA 2WXIA 5JHBA 4XE0A 2XQ0A 5KJMA 4FA6A 1ZBPA 2YHCA 3ZPJA 2BF0X 2J08A 4WNEA 1E7VA 4UQZA 3UT8A 3P2BA 4U0SA 2OVBA 4XKBA 3MA5A 3ZN3A 1PY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JJ6 A;  1ELR A;  2Y4U A;  4RG9 A;  4G26 A;  3TGO A;  1KT0 A;  2PL2 A;  2DBA A;  3R9A B;  3LYA A;  3RO3 A;  3UPV A;  4U0Z A;  4F3V A;  2XCB A;  3LY9 A;  1NA0 A;  3MA5 A;  4UI9 K;  4GA0 A;  3ZGQ A;  4I2W A;  2LNI A;  1QQE A;  4N2S A;  1FCH A;  4G23 A;  3CK8 A;  4N2Q A;  4WNF A;  3S7B A;  3UQ3 A;  3FFL A;  4WNG A;  1HH8 A;  3LKU A;  4HOU A;  4GA1 A;  1KT1 A;  4CGV A;  3KAE A;  3CVP A;  2KCK A;  2WPV A;  5KJL A;  3MV2 B;  2YQ8 A;  4YVO A;  4RG6 A;  5LCW C;  4H7Y A;  5EX3 A;  4BWR A;  3LY8 A;  2UY1 B;  4Y6W A;  2XGO A;  5ARG A;  4BTB A;  3AS8 A;  3RIB A;  4U07 A;  3O48 A;  3ASF A;  2GW1 A;  3TAX A;  4HOQ A;  3CV0 A;  5G04 J;  3GYZ A;  3KS2 A;  3RKV A;  3MEK A;  3LCA A;  3MKR A;  4G1T A;  4CGW A;  1NA3 A;  3CKB A;  2FO7 A;  3UUX A;  4UI9 J;  3S7D A;  3BEE A;  5EX0 A;  5C1D A;  4KBQ A;  1WM5 A;  5ARF A;  5JJ7 A;  1NZN A;  3KD7 A;  4G24 A;  3TG4 A;  3Q47 B;  5D0O D;  3FWV A;  5G04 C;  1PC2 A;  3MV3 B;  3GZ2 A;  4I2Z A;  5M72 A;  2C0M A;  3U3W A;  5EKQ D;  3PDN A;  3CVQ A;  4GZ3 A;  4I1A A;  4GPK A;  3IEG A;  4N3C A;  5AYW D;  3S7F A;  1ELW A;  2IFU A;  2I6H A;  4GYY A;  1WAO 1;  4O6F A;  4XI9 A;  4BT9 A;  2VYI A;  2QFC A;  4KYO B;  4AY6 A;  2L6J A;  1TJC A;  2PQR A;  4JL0 A;  4APO A;  2HYZ A;  5FTP A;  3U4T A;  4LEU A;  4A1S A;  4I9C A;  3N71 A;  4ABN A;  5CCL A;  3AS4 A;  2E2E A;  4JA9 A;  3URZ A;  4H7X A;  4N5C A;  5JJT A;  4NRH B;  5DBK A;  3CK7 A;  3Q49 B;  2KC7 A;  1B89 A;  2PZI A;  4U04 A;  2NC9 A;  4IN3 B;  4YND A;  3LPZ A;  5D0Q D;  4Y6C A;  2OOE A;  2BUG A;  3PE3 A;  4XIF A;  3CVL A;  3NF1 A;  2XCC A;  4KXK B;  2XEV A;  3S7J A;  1Y8M A;  3QWP A;  3QOU A;  4J8F A;  5FZQ A;  2FF4 A;  4J8D A;  3JYS A;  3RU0 A;  4G25 A;  3ULQ A;  5FZR A;  5G05 J;  5CHE E;  4GYW A;  3RO2 A;  3CK9 A;  4G2V A;  1YA0 A;  2WQH A;  2P58 C;  3GW4 A;  4XI0 A;  3OXL A;  4AY5 A;  4B94 A;  4ME2 A;  3ESK A;  3QKY A;  4N39 A;  3QWV A;  1HXI A;  3SF4 A;  3WXX A;  3CVN A;  2XPI A;  5G05 C;  1E96 B;  1ZU2 A;  1A17 A;  3OXG A;  3EDT B;  4UI9 C;  5HI7 A;  4GCO A;  5FZS A;  4JA7 A;  4GZ5 A;  5FJY A;  4N3A A;  4I9E A;  2V5F A;  4UQY A;  4HOS A;  4W9R A;  4JHR A;  3ASD A;  4N3B A;  2LSV A;  4HOT A;  1KLX A;  2C2L A;  4WND A;  4J0U A;  2VGY A;  3Q5M A;  3RJV A;  2FBN A;  2AVP A;  1QZ2 A;  2Y4T A;  2KCV A;  2XGM A;  5KJK A;  3OXF A;  3AS5 A;  3CKC A;  1XNF A;  1OUV A;  2XGS A;  5BT1 A;  4BTA A;  2JLB A;  3QWW A;  4CDR A;  3QDN A;  4AM9 A;  4BT8 A;  3K9I A;  2KAT A;  2J9Q A;  2FI7 A;  1P5Q A;  5LCW J;  4YVQ C;  2LSU A;  5A7D B;  3E4B A;  2UWJ G;  4I17 A;  2IF4 A;  4AIF A;  3ASH A;  2C0L A;  4GA2 A;  2R5S A;  3PE4 A;  5BNW A;  4HOR A;  3ZFW A;  4GCN A;  4U0U A;  2Q7F A;  1HZ4 A;  5KJN A;  5DIZ A;  5FT9 A;  2FEZ A;  2VQ2 A;  4UQX A;  3FP3 A;  2UY1 A;  3GZ1 A;  3Q4A B;  2HR2 A;  2HO1 A;  4WUY A;  4GZ6 A;  2KCL A;  3VTY A;  2VGX A;  5HQ8 A;  5A6C A;  3LY7 A;  3ASG A;  2VGX B;  1IYG A;  2PQN A;  4J8E A;  3ZHE A;  1W3B A;  1IHG A;  2VSY A;  3VTX A;  5CCM A;  3CEQ A;  3TG5 A;  3HYM B;  3ZHE B;  4GYO A;  3Q15 A;  5BW8 C;  4NQ0 A;  2OND A;  2MHK A;  2VSN A;  4EQF A;  5KJM A;  1ZBP A;  2YHC A;  3ZPJ A;  4WNE A;  4UQZ A;  4U0S A;  3SZ7 A;  3ZN3 A; 
#chains in the Genus database with same CATH topology
 1SA5 A;  2ZIR A;  4GPM A;  5JJ6 A;  3BG0 B;  4LG6 A;  3HXC A;  3PRE A;  4RG9 A;  1KT0 A;  4K03 A;  2DBA A;  4FJY A;  3RO3 A;  2DWZ A;  4BFR A;  4U0Z A;  4HB5 A;  4F1P A;  1FVF A;  5CBO A;  3D9K A;  2MRI A;  3DSU A;  4CT0 A;  3LJN A;  4UI9 K;  5E76 A;  3C5R A;  2CFZ A;  4KT6 B;  1NL4 A;  2QY7 A;  1Y6I A;  4G23 A;  1ELK A;  2XEH A;  2GRM A;  2R05 A;  4N2Q A;  3S7B A;  2V8S E;  2VSX E;  3UQ3 A;  5J90 A;  1JPL A;  3L9T A;  3UIP C;  2HM8 A;  2I2O A;  4A1G A;  3AG2 E;  4JW1 A;  4YDY A;  3NOG D;  3L08 A;  3RRU A;  4GA1 A;  1N52 A;  2X6J A;  4CGV A;  2WPV A;  2DVW A;  2LO6 A;  3JQ1 A;  2X38 A;  3R7Q A;  2XS1 A;  2YHE A;  3Q7F A;  5CEA A;  4UWF A;  4BSZ B;  4KMO A;  4TV3 A;  4K0R A;  5LFA A;  3VLE A;  1HS6 A;  3AS8 A;  2NSZ A;  3RIB A;  3CV0 A;  2FO1 E;  4TXP A;  1OWN A;  3PH0 C;  4PH4 B;  4G1T A;  1DNP A;  2KXP C;  3D9J A;  5ANL A;  4R7L A;  4CGW A;  4O1P A;  4EEC A;  1G3N B;  3ESL A;  4KVM A;  4UI9 J;  4ZHB A;  3R7R A;  4KBQ A;  1OT8 A;  4F7A A;  5CMY A;  4G24 A;  5D0O D;  2WXG A;  3TWU A;  3JXI A;  1H19 A;  3FU0 A;  1RW2 A;  1UN8 A;  2WXR A;  3PDN A;  2LAI A;  3UIN C;  3IEG A;  4FUL A;  1H6O A;  4I1O B;  2I6H A;  1WAO 1;  4BT9 A;  4LRZ A;  2F8X K;  5BV1 A;  2QFC A;  4KYO B;  3FUL A;  2ZGG A;  2ZGD A;  1H6K A;  3BQO A;  2PQR A;  3QAQ A;  4BET A;  4GTO A;  4OVU A;  2HYZ A;  5FTP A;  3U9W A;  4LEU A;  1BU9 A;  4I9C A;  4ABN A;  4LNB A;  1KZP A;  4DI4 A;  2R03 A;  3EHN A;  3DWL G;  3ZNG A;  4N5C A;  4JC8 A;  1OXJ A;  5C2Y A;  3SO8 A;  2CHW A;  3TWV A;  5KWD A;  3TWX A;  1LD7 A;  4B0Z A;  5T4Y A;  3EIQ C;  1FT1 A;  4IUL A;  5D0Q D;  3ZU7 B;  1UJK A;  1BD8 A;  3PE3 A;  3GZS A;  3NOC D;  1EYH A;  4CDN A;  4FLB A;  3CVL A;  1Z6T A;  2F8Y A;  2Y0B G;  3G2W A;  4CCA A;  3UKR G;  4KXK B;  2XEV A;  3S7J A;  3QWP A;  2CG2 A;  4DLQ A;  4JHJ A;  1TNY A;  3ZXS A;  2ION A;  5FZR A;  2R59 A;  3IKO B;  4L9P A;  1N0R A;  2CG3 A;  4EPZ A;  5CHE E;  4JB8 P;  3C72 A;  3UT4 A;  4PS7 A;  3FTX A;  4B8C B;  4G2V A;  1MQS A;  4AV7 A;  5CEC B;  2WXO A;  2GRN B;  4XI0 A;  4GTV A;  4AY5 A;  1MZC A;  4TUU A;  4Q94 A;  2YNQ A;  4N39 A;  1HXI A;  3UT7 A;  3CHR A;  1JCR A;  4DX2 A;  3CVU A;  3F6Q A;  4XKC A;  2ZU6 B;  1ZU2 A;  2A5E A;  5HI7 A;  2A4Z A;  5FZS A;  5HKP A;  2J4B A;  3LS8 A;  4N3A A;  4I9E A;  4WWP A;  2OEW A;  4HOT A;  3L6A A;  4I43 A;  3MZL B;  3RJV A;  3FUI A;  3FUD A;  1K8K G;  2KCV A;  3FH8 A;  3PUK A;  3TWT A;  5BT1 A;  4CDR A;  3MCX A;  3HIZ A;  2P9L G;  1SW6 A;  4APF A;  1KPS B;  4L7T A;  3PUJ A;  3T8K A;  2Y69 E;  4AOF A;  3HDX A;  1N4P A;  3NB2 A;  3MJW A;  3ASH A;  2C0L A;  4XX5 A;  3CLJ A;  2WQ6 A;  3ZW3 A;  4Z68 A;  5FT9 A;  2FEZ A;  4A55 A;  5H7P A;  3T8M A;  3CQG B;  3RRN B;  1TNO A;  2RD0 A;  4B93 B;  4G8L A;  4FP7 A;  4WUY A;  2GRL A;  1AWC B;  5AQB A;  2VGX A;  2WVI A;  1E8Z A;  5HQ8 A;  1NFI E;  3LY7 A;  4ANU A;  2ETA A;  1TN7 A;  1H2V C;  1TNZ A;  1BPO A;  1W3B A;  2XS8 A;  2VSY A;  1TNU A;  3VTX A;  1UN9 A;  5CCM A;  3CEQ A;  3ZHE B;  2MOW A;  4GYO A;  1O1T A;  4HNA D;  3QNK A;  4EQF A;  1ZBP A;  4WNE A;  1E7V A;  4U0S A;  2OVB A;  1PY1 A;  4G8K A;  3CHO A;  1ELR A;  2Y4U A;  5AAO A;  3FTU A;  3FUN A;  3HG0 D;  2XRY A;  3AG4 E;  4OYS A;  2PL2 A;  2FUL A;  3ZUV B;  2E0I A;  3R9A B;  2X6H A;  4LNU D;  1U2V G;  4GTQ A;  1N95 A;  3HRA A;  3UPV A;  1MX4 A;  4C48 B;  3CVW A;  3ZYK A;  4UWG A;  1OCZ E;  4ANW A;  4ANX A;  1SQM A;  2LXM A;  3FTV A;  1H0A A;  3TWR A;  3C3Q A;  5B1A E;  4JZY A;  3FTW A;  1QQE A;  4N2S A;  3D9M A;  3QAR A;  4I1M A;  4WNF A;  2J4D A;  4FJZ A;  4ILH B;  3NZS A;  4UWK A;  4MS6 A;  3ENE A;  3CHS A;  4HFG A;  3FFL A;  4WNG A;  3UM2 A;  3EHM A;  1O5M A;  1GW6 A;  2F37 A;  4ILI A;  3I5P A;  3KAE A;  3CVP A;  4GAA A;  4JEH A;  3B7U X;  2AXU A;  3E37 A;  3MV2 B;  4RG6 A;  3AAA C;  5LCW C;  3PEV B;  2ZXW E;  3T5V A;  4MLP A;  3LY8 A;  3D9O A;  4GZC A;  1X81 A;  4BTB A;  3CIA A;  3FU6 A;  3DSS A;  3O48 A;  2GW1 A;  3TAX A;  3U64 A;  3KS2 A;  3LJ3 A;  1H2U A;  1HE8 A;  1INZ A;  3G2T A;  1NA3 A;  3SI5 A;  1DCE A;  4PUC A;  4B8A A;  3RK6 A;  4NUR A;  5EX0 A;  2P9P G;  1U3C A;  5D2M C;  3U66 A;  5ARF A;  3D9I A;  2F0Y A;  5G04 C;  3PVL A;  2WB2 A;  3MV3 B;  3GZ2 A;  4K5A B;  5M72 A;  2IY0 C;  4GZ3 A;  4GPK A;  4KVO A;  4N3C A;  4EZJ A;  1IQU A;  3Q73 A;  5FQ4 A;  3EU9 A;  2IFU A;  4UUC A;  4D10 C;  4GYY A;  1ZB1 A;  4XI9 A;  5ITZ F;  3DBS A;  3ZKJ A;  4TXR A;  1NI1 A;  1QYM A;  3E30 A;  1TYQ G;  4JL0 A;  3UTM A;  4ANV A;  4APO A;  3KEZ A;  3N71 A;  2E2E A;  1QBQ A;  2L0T B;  3PS6 A;  3DST A;  2IQC A;  3DSX A;  3Q49 B;  2R17 C;  2KC7 A;  1JUQ A;  1UJJ A;  2RKK A;  2OCC E;  2LXL A;  2NC9 A;  2JEK A;  4IN3 B;  2B6C A;  1WDY A;  4Y6C A;  2BUG A;  1UW4 B;  3V31 A;  3R9M A;  3UM0 A;  1OWO A;  3UX4 A;  5BUZ A;  2WXM A;  2XCC A;  5CMW A;  1RZ4 A;  2AW6 A;  5EYL A;  4J8F A;  2FF4 A;  4AXH A;  3JYS A;  4J8Y A;  4J7W A;  5ENQ D;  3OTN A;  1OWP A;  1DVP A;  3TJP A;  4G25 A;  2R02 A;  2GGF A;  3DEP A;  3ONK A;  5G05 J;  2DYS E;  3ULE G;  1K1A A;  4GYW A;  4F53 A;  3B7R L;  3KEA A;  3CK9 A;  1MX2 A;  2AXZ A;  2VSO E;  1N54 A;  1A5E A;  2BED A;  2WQH A;  2P9I G;  4B94 A;  3FUK A;  3ESK A;  1EPU A;  1EDU A;  3QKY A;  5LOZ A;  3DRA A;  4LER A;  3AJI A;  3SF4 A;  2XRZ A;  3B13 A;  3CVX A;  1E96 B;  3W9F A;  1HG5 A;  4GTM A;  2VTB B;  3SQV A;  5ENP D;  3JCK C;  5J08 A;  2IO2 C;  4E85 A;  3FUE A;  4PS3 A;  4W9R A;  3DEO A;  1HX8 A;  3CVY A;  5BV0 A;  4WAF A;  2RFM A;  2MYO A;  3DPY A;  3VLF A;  3UIO C;  4ACK A;  1QZ2 A;  5EIL A;  1H2T C;  4U7E B;  4DRX E;  1SVX A;  2XGM A;  3LVQ E;  2EIJ E;  5BXU A;  2PM7 A;  1S70 B;  1XNF A;  1OUV A;  4PDX A;  1H6P A;  3I4R B;  4JEU A;  3K9I A;  2J9Q A;  3SY2 A;  2FI7 A;  5LCW J;  5A7D B;  3E4B A;  3G2V A;  4I17 A;  4AIF A;  2WMN A;  3OAW A;  2WXF A;  3E32 A;  5AQ9 A;  2GRP B;  4DLO A;  4I6J A;  4HOR A;  4GCN A;  4U0U A;  4UWH A;  2Q7F A;  2WXQ A;  4CYM D;  2VQ2 A;  4UQX A;  2L6B A;  2UY1 A;  5ENN A;  3ZYM A;  3TXN A;  2HR2 A;  5B3S E;  3V2X A;  1WY6 A;  3VTY A;  3TWS A;  2NXP A;  5A6C A;  4U63 A;  5KNH D;  3MGB A;  1IYG A;  3ZHE A;  4ACL A;  3FEX A;  4DJA A;  4HRM B;  1TR4 A;  5FIO A;  2ILR A;  3EHQ A;  2PM6 A;  5KJM A;  3AG1 E;  4XE0 A;  4FA6 A;  5ENT D;  4OAV B;  4UQZ A;  5G2N A;  3ZN3 A;  4X8Q A;  5EYP F;  4HBD A;  2IO3 C;  1IKN D;  5G55 A;  2H6H A;  3TGO A;  4AP2 A;  4TRQ A;  3RRM B;  4HRL A;  4PS8 A;  2IOL A;  5LX8 A;  3Q78 A;  3LYA A;  4U8H A;  2WXH A;  2XCB A;  4EZL A;  5AJL A;  3LY9 A;  5FQ7 A;  2M63 A;  1NA0 A;  2DCP A;  3SHF A;  1OWM A;  5FIN A;  3L16 A;  3ZGQ A;  4I2W A;  4UWL A;  1JWF A;  4DI3 A;  2VGE A;  2H6I A;  4NIK A;  3B95 A;  3KSQ A;  5CED B;  1N4S A;  5KCM A;  2J09 A;  1WG0 A;  5EDS A;  3FU5 A;  3L82 A;  3EUV A;  4U8V D;  2EIL E;  5D66 A;  3W9G A;  2BKG A;  4I6E A;  2LAH A;  3X2Q E;  2WXP A;  4YVO A;  3CR3 A;  2B0O E;  2UY1 B;  1E8W A;  5HRY A;  1E8Y A;  3QJZ A;  1D8E A;  1FVH A;  2AJA A;  3FUJ A;  4U07 A;  3ZEF A;  3CGH A;  1YMP A;  3GYZ A;  3RKV A;  3DPD A;  3MEK A;  3ONL A;  4AVX A;  3LCA A;  2QYU A;  3LXU X;  2FO7 A;  3IHV A;  3UUX A;  3SBS A;  3PZ1 A;  3FH5 A;  3BEE A;  4BES A;  5A23 A;  4BX8 A;  4L2Y A;  3IV0 A;  4ATZ D;  1WM5 A;  1EF1 C;  2L0I A;  5JJ7 A;  1OCO E;  4BSX A;  4OAU C;  4AJW A;  2Y1L E;  3SFY A;  1PC2 A;  1V54 E;  3ABK E;  3FUH A;  5EKQ D;  2OV8 A;  1SA4 A;  1OCC E;  4URK A;  1L5J A;  1VDY A;  3IBE A;  4I1A A;  4V3I A;  4QFV A;  2WXJ A;  2I1J A;  1QNF A;  3NBN B;  2DYR E;  4L1B A;  1XGW A;  2KBX A;  2KZT A;  2L6J A;  3UI2 A;  1TJC A;  1KZO A;  1U3D A;  3FUF A;  4F1S A;  3U4T A;  3PZ4 A;  3UM1 A;  2QZA A;  1K1B A;  3MKQ A;  3URZ A;  4H7X A;  5JJT A;  5DBK A;  4M3O A;  2L9B A;  1N94 A;  1S64 A;  2XEN A;  1B89 A;  3Q9U C;  3PNL B;  1TN8 A;  1FT2 A;  4EZK A;  4MBG A;  1N4Q A;  4YND A;  5HS0 A;  4C9B B;  3VLD A;  1DCQ A;  2EIM E;  2IEJ A;  5KBA A;  2X6F A;  4U8Y D;  1TN6 A;  1N4R A;  1Y8M A;  3L17 A;  4HI8 A;  4HS2 A;  5JMN D;  1N9A A;  3I4G A;  3FY4 A;  1Q2Z A;  2X6I A;  1FPP A;  3CHP A;  1HG2 A;  4GB9 A;  4K5C A;  1Z5S C;  3PEU B;  1YA0 A;  2WXL A;  3GW4 A;  4DX5 D;  3OXL A;  4IYP A;  2KM4 A;  4ME2 A;  4JVS A;  1TJF A;  3D3M A;  3QWV A;  2VTB A;  2XHE A;  2XZT G;  3HHM A;  4CDM A;  5ENR D;  1OY3 D;  2V0P A;  4JA7 A;  4GZ5 A;  3ZYQ A;  2AWI A;  4UQY A;  4MRU A;  4JHR A;  3ASD A;  3ML8 A;  2LSV A;  1KLX A;  2C2L A;  2RFA A;  2IOS A;  3EU5 A;  1S63 A;  2FBN A;  5T3R A;  4M7C A;  1E7U A;  4GTT A;  2EQX A;  1HF8 A;  1O1R A;  2KZT B;  3FEY A;  4O1O A;  2DZN A;  5ENO D;  4L2L A;  3AU5 A;  3FTZ A;  2P9U G;  4ILG A;  3AU4 A;  2JLB A;  2NYJ A;  3TWQ A;  3QDN A;  4U96 D;  1SZA A;  3EIJ A;  4AM9 A;  3MKQ B;  4BT8 A;  3APF A;  4CZ2 D;  1P5Q A;  3B7T A;  2LSU A;  2DIW A;  3HXE A;  2UWJ G;  5AAR A;  4JD2 G;  2IF4 A;  3I3N A;  5CRV A;  4JPS A;  3QB2 A;  2X6K A;  1S0P A;  1X5B A;  2GRO B;  1K3Z D;  2H6G A;  5BNW A;  2XEE A;  3PRZ A;  3ABL E;  5DIZ A;  5AN8 A;  2J8S D;  3AG3 E;  4BX9 A;  3Q4A B;  4L23 A;  3HXD A;  2HO1 A;  4GZ6 A;  1Z3Y A;  2KCL A;  1PAQ A;  3HVE B;  2GRQ B;  1MJ0 A;  3ASG A;  4RLY A;  3FH7 A;  5CRU A;  1IHG A;  4CT4 A;  3HYM B;  4C0M A;  2LUH A;  5BW8 C;  4NQ0 A;  4I6G A;  2MHK A;  3J5Q B;  2XQ0 A;  1BLX B;  3ZPJ A;  2J08 A;  1D9S A;  4ZFH A;  3P2B A;  2EIK E;  3SZ7 A;  3MA5 A;  3QK0 A;  2WXN A;  3CSF A;  2BTD A;  4E6H A;  4F6R D;  2P2C P;  4EBA G;  4G26 A;  3ASO E;  2WMO A;  4FHJ A;  3D9L A;  3ZIM A;  4BER A;  2ZIS A;  4HVB A;  4KZC A;  4F3V A;  3T9K A;  3V2O A;  4U95 D;  3LDZ A;  4N5Q A;  5AJD A;  5LP0 A;  2OEV A;  3E33 A;  4GA0 A;  4DX6 D;  2HE0 A;  3UXG A;  2LNI A;  3SGH A;  4K5B A;  3JXJ A;  1YYH A;  1FCH A;  2YIN A;  3FTS A;  4IRU A;  1UOH A;  3IHY A;  3CK8 A;  4KZ0 A;  2GRR B;  3ML9 A;  5JA4 D;  4RSY A;  1HO8 A;  1MYO A;  3FDH A;  3BU8 A;  1HH8 A;  3LKU A;  3ZRH A;  3UMV A;  2V4H C;  4J8S A;  3G2S A;  4HOU A;  3JUI A;  4AEZ C;  3APC A;  1KT1 A;  3HXB A;  1V55 E;  2KCK A;  4A3T A;  5KJL A;  5T8I A;  4RQI A;  1HU3 A;  4DX7 D;  4EHM A;  5KNG A;  3ASN E;  3PZ3 A;  5EID A;  2AXV A;  5EN5 D;  2YQ8 A;  3E34 A;  4H7Y A;  2BKK B;  1NP7 A;  5EX3 A;  3MYV A;  4BWR A;  3IXE A;  4JHK A;  1LTX A;  4Y6W A;  2XGO A;  5ARG A;  3MX3 A;  4HLE A;  4GU5 A;  2P9K G;  3ASF A;  4DK5 A;  4HOQ A;  4GML A;  5G04 J;  3NQP A;  2J07 A;  5ENS D;  2V5Q C;  5ANR A;  3MKR A;  2QC9 A;  3ZXP A;  4DX1 A;  3T5X A;  3CQC B;  3CKB A;  2IU1 A;  5FQ8 A;  4YDE A;  3S7D A;  1DC2 A;  4WWO A;  1OCR E;  3BG1 B;  3QC1 A;  5C1D A;  4XEI G;  1NZN A;  3TWW A;  3KD7 A;  2RG8 A;  3TG4 A;  3Q47 B;  1JCQ A;  2EIN E;  3EJN A;  3FWV A;  3PZD A;  1HFA A;  4I2Z A;  2C0M A;  3U3W A;  2CHX A;  3DXM G;  3CVQ A;  4O60 A;  3CVV A;  3LEW A;  1BI8 B;  3G2U A;  4P29 A;  3C98 A;  4JXT A;  3PNT B;  5AYW D;  3S7F A;  1ELW A;  4O6F A;  5FQ6 A;  3SFX A;  2VYI A;  4AY6 A;  3APD A;  3HXF A;  4LUN U;  3SD5 A;  1UG3 A;  2XZD G;  2WM9 A;  3B7S A;  4A1S A;  1IQR A;  4XZ4 A;  4J6I A;  4A63 B;  5CCL A;  5CBN A;  3AS4 A;  3LVR E;  4JA9 A;  3NZU A;  4TUM A;  4A3V A;  4NRH B;  3PZ2 A;  3CK7 A;  4HQD A;  4DPR A;  1OWL A;  3RSE G;  4Q69 A;  4CEM A;  2PZI A;  3FUM A;  1TEZ A;  4U04 A;  3BUA A;  4Q96 A;  1IXV A;  2WQ7 A;  3EHR A;  3C3R A;  4YDO A;  3LPZ A;  1JCS A;  3D9P A;  2OOE A;  1E8X A;  5IY5 E;  4G11 A;  3FU3 A;  4XIF A;  2CFU A;  1N11 A;  2R2L A;  2I1K A;  1Z3X A;  3CST A;  3NF1 A;  4FC8 A;  3SFZ A;  3QOU A;  5FZQ A;  4J8D A;  2X3M A;  3ISM C;  3SBT B;  3RU0 A;  4HI9 A;  3ULQ A;  5AIJ A;  4HLL A;  1JWG A;  3UKU G;  4FHK A;  2CHZ A;  4LCT A;  4TXQ A;  5E75 A;  3RO2 A;  4GTP A;  2H6F A;  3DSV A;  2ETB A;  3B7B A;  2P58 C;  3JQ0 A;  4MKT A;  3DXK G;  4WWN A;  2VJ8 A;  4HXI A;  3DSW A;  3TXM A;  4LSZ E;  4GMJ A;  3C3O A;  4FU3 A;  3Q7A A;  3WXX A;  2IJG X;  3CVN A;  4LNG A;  2XPI A;  4C0E A;  5G05 C;  3Q79 A;  5EIB E;  3UM3 A;  3ULY A;  2QYJ A;  1A17 A;  4NAC A;  2Y3A A;  2XPY A;  1IHB A;  3OXG A;  1D8D A;  3EDT B;  4UI9 C;  4ATG A;  1SZ9 A;  4HRN A;  4GCO A;  4FLH A;  5FJY A;  3S2A A;  2V5F A;  4HOS A;  5JHA A;  3CHM A;  3FTY A;  4N3B A;  4GMR A;  1E90 A;  2P9S G;  4WND A;  4J0U A;  5B1B E;  2VGY A;  3Q5M A;  3ABM E;  2AVP A;  3Q75 A;  2Y4T A;  4QQI A;  1MHQ A;  4FAD A;  5KJK A;  3OXF A;  2P9N G;  3AS5 A;  5BPP A;  2WXK A;  3J5P A;  3CKC A;  3O4Z A;  2XGS A;  4BTA A;  3QWW A;  4GTR A;  4RVB A;  2I9C A;  3V30 A;  2KAT A;  3L54 A;  2V4L A;  5FWQ A;  4YVQ C;  2XPZ A;  3V79 K;  4OVV A;  5BXO A;  3D9H A;  2OVF A;  4GA2 A;  4GTS A;  3P1U A;  2R5S A;  1LF8 A;  4CRW A;  1LD8 A;  3PE4 A;  3ZFW A;  1HZ4 A;  4GZD A;  4DUI A;  5KJN A;  1N0Q A;  3FP3 A;  3HVE A;  5CER B;  3GZ1 A;  3CHQ A;  2A5U A;  3L13 A;  3Q9N C;  4BY6 A;  2DZO A;  3D9N A;  3ZYL A;  3WG7 E;  1BI7 B;  4EBA A;  3ZVV A;  3L22 A;  2VGX B;  1YCS B;  2PQN A;  4J8E A;  1AP7 A;  4B89 A;  1O1S A;  2ETC A;  3KSL A;  3NAW A;  3TG5 A;  5AEN A;  3FHE A;  3Q15 A;  2JAB A;  3TL5 A;  3SNX A;  2PNN A;  3JUE A;  5AQA A;  5AQ7 A;  1MX6 A;  2J49 A;  2OND A;  2VSN A;  2WXI A;  4BEP A;  5JHB A;  4YDW A;  3RAU A;  2YHC A;  2BF0 X;  1TNB A;  3UT8 A;  4XKB A; 
#chains in the Genus database with same CATH homology
 3QK0 A;  3CHO A;  5JJ6 A;  2WXN A;  1ELR A;  2Y4U A;  3BG0 B;  3CSF A;  2BTD A;  3FTU A;  4E6H A;  5G55 A;  3FUN A;  3PRE A;  4EBA G;  4RG9 A;  2XRY A;  4G26 A;  3TGO A;  4OYS A;  4AP2 A;  1KT0 A;  4TRQ A;  4K03 A;  2PL2 A;  2WMO A;  4FHJ A;  2DBA A;  3RRM B;  3D9L A;  2FUL A;  2E0I A;  4PS8 A;  3ZIM A;  4FJY A;  3R9A B;  2IOL A;  5LX8 A;  2X6H A;  3LYA A;  3RO3 A;  4HVB A;  4KZC A;  3UPV A;  4BFR A;  4U0Z A;  3CVW A;  4U8H A;  3ZYK A;  4UWG A;  4F3V A;  2WXH A;  2XCB A;  1FVF A;  4EZL A;  5AJL A;  4ANW A;  4ANX A;  3LY9 A;  5FQ7 A;  2M63 A;  1NA0 A;  2DCP A;  3LDZ A;  1SQM A;  3D9K A;  5AJD A;  5LP0 A;  3SHF A;  2MRI A;  4CT0 A;  1OWM A;  4UI9 K;  4GA0 A;  3L16 A;  3ZGQ A;  3FTV A;  1H0A A;  5E76 A;  4I2W A;  4JZY A;  4UWL A;  3FTW A;  2CFZ A;  2LNI A;  1JWF A;  4KT6 B;  3SGH A;  4DI3 A;  1QQE A;  4N2S A;  1FCH A;  2QY7 A;  2YIN A;  3D9M A;  1Y6I A;  3FTS A;  4IRU A;  4G23 A;  3IHY A;  1ELK A;  3QAR A;  3CK8 A;  2GRM A;  4KZ0 A;  4N2Q A;  4I1M A;  4WNF A;  2V8S E;  2VSX E;  3S7B A;  2J4D A;  4FJZ A;  4ILH B;  3NZS A;  4UWK A;  3UQ3 A;  4MS6 A;  3ENE A;  5KCM A;  3ML9 A;  2J09 A;  1JPL A;  4RSY A;  5J90 A;  1HO8 A;  3CHS A;  3FDH A;  4HFG A;  3FFL A;  4WNG A;  1HH8 A;  2HM8 A;  2I2O A;  3LKU A;  3ZRH A;  3EHM A;  3UMV A;  1GW6 A;  3FU5 A;  4ILI A;  4JW1 A;  4A1G A;  5EDS A;  3L08 A;  4J8S A;  3G2S A;  3I5P A;  4HOU A;  3JUI A;  4GA1 A;  3RRU A;  4AEZ C;  1N52 A;  3APC A;  1KT1 A;  2X6J A;  4CGV A;  3KAE A;  3CVP A;  2KCK A;  4A3T A;  2WPV A;  4GAA A;  4JEH A;  5T8I A;  5KJL A;  2LO6 A;  3B7U X;  3JQ1 A;  4I6E A;  1HU3 A;  2X38 A;  3R7Q A;  2YHE A;  2AXU A;  2AXV A;  2LAH A;  2WXP A;  3MV2 B;  2YQ8 A;  4YVO A;  4RG6 A;  5LCW C;  4UWF A;  4H7Y A;  1NP7 A;  5EX3 A;  3PEV B;  3CR3 A;  3MYV A;  4BWR A;  3T5V A;  4MLP A;  3LY8 A;  4JHK A;  3D9O A;  4KMO A;  4TV3 A;  2UY1 B;  4K0R A;  4Y6W A;  4GZC A;  1E8W A;  2XGO A;  5LFA A;  1E8Y A;  5ARG A;  3MX3 A;  3QJZ A;  4BTB A;  4HLE A;  3CIA A;  1HS6 A;  3AS8 A;  1FVH A;  3FU6 A;  4GU5 A;  2NSZ A;  3FUJ A;  4U07 A;  3RIB A;  3ZEF A;  3CGH A;  3O48 A;  3ASF A;  4DK5 A;  2GW1 A;  3TAX A;  4HOQ A;  3CV0 A;  4GML A;  5G04 J;  3NQP A;  2J07 A;  3U64 A;  1OWN A;  3GYZ A;  3KS2 A;  3DPD A;  3LJ3 A;  3PH0 C;  4PH4 B;  3RKV A;  3MEK A;  3ONL A;  3LCA A;  5ANR A;  4AVX A;  3MKR A;  3LXU X;  1H2U A;  1HE8 A;  4G1T A;  1INZ A;  1DNP A;  3D9J A;  3G2T A;  3CQC B;  5ANL A;  3T5X A;  4R7L A;  4CGW A;  1NA3 A;  3SI5 A;  3CKB A;  2FO7 A;  2IU1 A;  3IHV A;  5FQ8 A;  3UUX A;  4EEC A;  3ESL A;  4PUC A;  4KVM A;  3SBS A;  4UI9 J;  4B8A A;  3FH5 A;  3BEE A;  4NUR A;  4WWO A;  5EX0 A;  3RK6 A;  3S7D A;  3BG1 B;  3QC1 A;  5A23 A;  1U3C A;  4BX8 A;  4L2Y A;  3IV0 A;  3R7R A;  5C1D A;  4KBQ A;  1WM5 A;  3U66 A;  1EF1 C;  2L0I A;  5ARF A;  5JJ7 A;  4F7A A;  1NZN A;  3D9I A;  4BSX A;  5CMY A;  3KD7 A;  2RG8 A;  4G24 A;  3TG4 A;  3Q47 B;  5D0O D;  2WXG A;  3EJN A;  4AJW A;  3FWV A;  5G04 C;  3PZD A;  1PC2 A;  1H19 A;  3PVL A;  2WB2 A;  1HFA A;  3MV3 B;  3GZ2 A;  4I2Z A;  5M72 A;  2C0M A;  3FUH A;  3FU0 A;  3U3W A;  5EKQ D;  1UN8 A;  2OV8 A;  2CHX A;  2WXR A;  4URK A;  3PDN A;  1L5J A;  2LAI A;  1VDY A;  3IBE A;  3CVQ A;  4GZ3 A;  4I1A A;  3CVV A;  3LEW A;  4GPK A;  3G2U A;  3IEG A;  4P29 A;  3C98 A;  4FUL A;  4QFV A;  4V3I A;  4JXT A;  4KVO A;  3PNT B;  4N3C A;  4EZJ A;  1IQU A;  5FQ4 A;  5AYW D;  2WXJ A;  3S7F A;  4I1O B;  1ELW A;  2IFU A;  4D10 C;  2I1J A;  2I6H A;  4GYY A;  1QNF A;  1WAO 1;  4O6F A;  4XI9 A;  4BT9 A;  5FQ6 A;  4L1B A;  4LRZ A;  2VYI A;  5BV1 A;  2QFC A;  4KYO B;  1XGW A;  3FUL A;  3DBS A;  2KZT A;  2L6J A;  4AY6 A;  1H6K A;  1TJC A;  5G2N A;  2PQR A;  3QAQ A;  3APD A;  4JL0 A;  4LUN U;  4OVU A;  3SD5 A;  1UG3 A;  4ANV A;  4APO A;  1U3D A;  3FUF A;  2HYZ A;  5FTP A;  3U9W A;  4F1S A;  2WM9 A;  3B7S A;  3U4T A;  3KEZ A;  4LEU A;  4A1S A;  1IQR A;  4I9C A;  3N71 A;  4J6I A;  4XZ4 A;  4ABN A;  5CCL A;  4DI4 A;  3AS4 A;  3LVR E;  2E2E A;  3EHN A;  3MKQ A;  3NZU A;  4JA9 A;  3URZ A;  4H7X A;  4N5C A;  5JJT A;  4JC8 A;  5C2Y A;  2L0T B;  4NRH B;  4A3V A;  5DBK A;  4M3O A;  3PS6 A;  2CHW A;  2IQC A;  2L9B A;  3CK7 A;  4DPR A;  3Q49 B;  1OWL A;  2R17 C;  4Q69 A;  2KC7 A;  1JUQ A;  1UJJ A;  4B0Z A;  4CEM A;  1B89 A;  2PZI A;  3FUM A;  3PNL B;  5T4Y A;  1TEZ A;  4U04 A;  3EIQ C;  4Q96 A;  2NC9 A;  4EZK A;  2JEK A;  2WQ7 A;  4IN3 B;  4YND A;  3LPZ A;  4C9B B;  3VLD A;  4IUL A;  5D0Q D;  3D9P A;  4Y6C A;  1UJK A;  1E8X A;  2OOE A;  2BUG A;  1UW4 B;  4G11 A;  3PE3 A;  3FU3 A;  3GZS A;  2X6F A;  4XIF A;  2CFU A;  1EYH A;  1OWO A;  4CDN A;  4FLB A;  3UX4 A;  5BUZ A;  2WXM A;  1Z6T A;  3CVL A;  2I1K A;  1Z3X A;  3CST A;  2XCC A;  3G2W A;  3NF1 A;  4FC8 A;  2XEV A;  4KXK B;  3S7J A;  2AW6 A;  3SFZ A;  4CCA A;  5CMW A;  1Y8M A;  3QWP A;  3L17 A;  3QOU A;  4J8F A;  2CG2 A;  4HS2 A;  2FF4 A;  4J8D A;  5FZQ A;  4AXH A;  4DLQ A;  4JHJ A;  3JYS A;  3OTN A;  1OWP A;  2X3M A;  2ION A;  3SBT B;  3ZXS A;  1DVP A;  3RU0 A;  3TJP A;  4G25 A;  3ULQ A;  5FZR A;  2R59 A;  3IKO B;  5AIJ A;  1JWG A;  2GGF A;  3I4G A;  2CG3 A;  4FHK A;  2CHZ A;  3FY4 A;  3ONK A;  4LCT A;  5G05 J;  4EPZ A;  5CHE E;  4GYW A;  4F53 A;  2X6I A;  3UT4 A;  4PS7 A;  3FTX A;  3B7R L;  4B8C B;  5E75 A;  3RO2 A;  3CK9 A;  4G2V A;  3CHP A;  1HG2 A;  4GB9 A;  2AXZ A;  1MQS A;  3PEU B;  2VSO E;  1N54 A;  4AV7 A;  1YA0 A;  2WXL A;  2WXO A;  2WQH A;  2P58 C;  3GW4 A;  3JQ0 A;  4XI0 A;  4MKT A;  4WWN A;  3OXL A;  4AY5 A;  2VJ8 A;  4HXI A;  4IYP A;  2KM4 A;  3TXM A;  4B94 A;  4GMJ A;  4TUU A;  4ME2 A;  3FUK A;  4JVS A;  3ESK A;  4Q94 A;  1EPU A;  1EDU A;  3QKY A;  2YNQ A;  1TJF A;  4LER A;  5LOZ A;  3D3M A;  4N39 A;  3QWV A;  1HXI A;  4FU3 A;  3SF4 A;  3WXX A;  2VTB A;  3UT7 A;  3CHR A;  2XRZ A;  3CVU A;  3B13 A;  2IJG X;  3CVN A;  4C0E A;  2XPI A;  3CVX A;  2XHE A;  5G05 C;  4XKC A;  1E96 B;  2ZU6 B;  1ZU2 A;  1A17 A;  4NAC A;  2Y3A A;  2XPY A;  1HG5 A;  3OXG A;  2VTB B;  3HHM A;  4CDM A;  3EDT B;  3JCK C;  4UI9 C;  4ATG A;  1SZ9 A;  5J08 A;  2V0P A;  5HI7 A;  2A4Z A;  4GCO A;  5FZS A;  4E85 A;  2J4B A;  3FUE A;  4FLH A;  4JA7 A;  4GZ5 A;  3LS8 A;  5FJY A;  4N3A A;  3S2A A;  3ZYQ A;  2AWI A;  4I9E A;  2V5F A;  4UQY A;  4WWP A;  4HOS A;  4PS3 A;  4W9R A;  4MRU A;  4JHR A;  5JHA A;  3CHM A;  3ASD A;  1HX8 A;  3ML8 A;  3CVY A;  3FTY A;  2LSV A;  4N3B A;  4WAF A;  3L6A A;  1KLX A;  2C2L A;  5BV0 A;  4HOT A;  1E90 A;  2IOS A;  3VLF A;  4WND A;  4I43 A;  3MZL B;  4J0U A;  2VGY A;  3Q5M A;  3RJV A;  2FBN A;  5T3R A;  4ACK A;  1E7U A;  2AVP A;  2EQX A;  1HF8 A;  1QZ2 A;  2Y4T A;  1H2T C;  3FUI A;  3FUD A;  1MHQ A;  2KZT B;  3FEY A;  2KCV A;  2XGM A;  3FH8 A;  3LVQ E;  3PUK A;  4FAD A;  5KJK A;  3OXF A;  3AS5 A;  5BPP A;  2PM7 A;  2WXK A;  3AU5 A;  3CKC A;  3O4Z A;  4L2L A;  3FTZ A;  1XNF A;  1OUV A;  2XGS A;  5BT1 A;  4ILG A;  4BTA A;  3AU4 A;  2JLB A;  3QWW A;  4PDX A;  4CDR A;  3QDN A;  3MCX A;  3I4R B;  3HIZ A;  4RVB A;  1SZA A;  3EIJ A;  4JEU A;  3MKQ B;  4AM9 A;  4BT8 A;  4APF A;  2I9C A;  3APF A;  3K9I A;  4L7T A;  3PUJ A;  2KAT A;  2J9Q A;  3L54 A;  2FI7 A;  1P5Q A;  2V4L A;  3B7T A;  5FWQ A;  4AOF A;  4YVQ C;  3HDX A;  2LSU A;  2DIW A;  5A7D B;  5LCW J;  2XPZ A;  3E4B A;  3G2V A;  3SZ7 A;  2UWJ G;  4I17 A;  3MJW A;  2IF4 A;  4OVV A;  3I3N A;  4AIF A;  3ASH A;  2WMN A;  4JPS A;  3OAW A;  2WXF A;  2OVF A;  3QB2 A;  2C0L A;  4DLO A;  2X6K A;  4GA2 A;  1S0P A;  3P1U A;  2R5S A;  1LF8 A;  1X5B A;  3VLE A;  4CRW A;  4XX5 A;  3CLJ A;  4I6J A;  3PE4 A;  5BNW A;  2WQ6 A;  4HOR A;  3ZFW A;  4GCN A;  4U0U A;  4UWH A;  2Q7F A;  3ZW3 A;  1HZ4 A;  4GZD A;  3PRZ A;  5KJN A;  5DIZ A;  5FT9 A;  2WXQ A;  2FEZ A;  4A55 A;  3T8M A;  3CQG B;  3RRN B;  2VQ2 A;  4UQX A;  3FP3 A;  4BX9 A;  3HVE A;  2UY1 A;  5ENN A;  3GZ1 A;  3CHQ A;  2A5U A;  2RD0 A;  3TXN A;  3Q4A B;  3ZYM A;  3L13 A;  4L23 A;  4FP7 A;  2HR2 A;  2HO1 A;  4WUY A;  1WY6 A;  4GZ6 A;  1Z3Y A;  2GRL A;  2KCL A;  3VTY A;  1PAQ A;  2VGX A;  2WVI A;  1E8Z A;  4BY6 A;  3HVE B;  5HQ8 A;  2NXP A;  3D9N A;  3ZYL A;  3LY7 A;  5A6C A;  4ANU A;  3ASG A;  4EBA A;  3ZVV A;  3FH7 A;  1H2V C;  4U63 A;  3L22 A;  3MGB A;  2VGX B;  1IYG A;  2PQN A;  4J8E A;  3ZHE A;  1BPO A;  1W3B A;  1IHG A;  2VSY A;  4ACL A;  4B89 A;  3FEX A;  3VTX A;  1UN9 A;  5CCM A;  4DJA A;  3CEQ A;  4CT4 A;  3TG5 A;  3HYM B;  5AEN A;  4C0M A;  3FHE A;  3ZHE B;  2MOW A;  4GYO A;  3Q15 A;  3SNX A;  5BW8 C;  3TL5 A;  4NQ0 A;  2ILR A;  4I6G A;  3QNK A;  2J49 A;  2OND A;  2MHK A;  2PM6 A;  2VSN A;  4EQF A;  2WXI A;  5JHB A;  4XE0 A;  2XQ0 A;  5KJM A;  4FA6 A;  1ZBP A;  2YHC A;  3ZPJ A;  2BF0 X;  2J08 A;  4WNE A;  1E7V A;  4UQZ A;  3UT8 A;  3P2B A;  4U0S A;  2OVB A;  4XKB A;  3MA5 A;  3ZN3 A;  1PY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...