2LSUA

The nmr high resolution structure of yeast tah1 in a free form
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
110
structure length
110
Chain Sequence
SQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSKLQYRLELAQGAVGSVQIPVVEVDELPEGYDRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords TPR repeat-containing protein associated with Hsp90
publication title High-Resolution Structural Analysis Shows How Tah1 Tethers Hsp90 to the R2TP Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 25
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14559 TPR_19 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2lsuA00
4A1SA 3GZ2A 4J0UA 3JYSA 2FEZA 5G05C 3CEQA 2VGXA 4NQ0A 4GYWA 1W3BA 3Q5MA 5FT9A 4U04A 4H7YA 1OUVA 3AS5A 3LPZA 3S7BA 3CVQA 2LSVA 5BT1A 2GW1A 2PQNA 4GA1A 4I17A 3TG4A 1HXIA 2XEVA 1Y8MA 3QWWA 1FCHA 4JA9A 3CK7A 5FJYA 3FFLA 3LY9A 1NA3A 3LY7A 2FO7A 3OXFA 4I9EA 3VTYA 3KS2A 3MV2B 4UQZA 1IYGA 5KJKA 3SF4A 2LSUA 1A17A 1WM5A 3Q47B 1HZ4A 4B94A 4WNFA 4AY6A 2HYZA 4WUYA 4N3BA 2Y4TA 2KC7A 3ASGA 5G05J 3ESKA 1KT1A 4XI9A 4JA7A 1ZBPA 3AS8A 3RIBA 4J8DA 3VTXA 2NC9A 3QKYA 4GCNA 4JHRA 4BT9A 5A6CA 3FP3A 4YVQC 3RO2A 2P58C 1TJCA 3ZFWA 2HR2A 4IN3B 3NF1A 1IHGA 5G04C 3URZA 4UQXA 4BTBA 4HOQA 3FWVA 3Q15A 5CHEE 1HH8A 2C0MA 5FZQA 3O48A 5LCWC 2XGOA 3CVPA 3KD7A 4N39A 3WXXA 3OXGA 5KJNA 2VQ2A 5EKQD 3TGOA 2L6JA 5AYWD 4APOA 4GZ5A 2HO1A 2C2LA 4BTAA 3MA5A 4Y6CA 5JJTA 2UY1B 1ELWA 2XCBA 4J8FA 4AM9A 2IF4A 1KT0A 4U07A 3CKCA 1KLXA 4RG6A 4I2WA 2E2EA 3U3WA 5JJ6A 3S7FA 3S7JA 3CVNA 3N71A 2YHCA 4LEUA 3U4TA 3QWPA 2PQRA 3ASHA 2V5FA 5G04J 3ASFA 5DBKA 2KCLA 3BEEA 3UPVA 4N3CA 4BT8A 1WAO1 1QQEA 2VYIA 2IFUA 4WNEA 5LCWJ 2KATA 2WQHA 4W9RA 4H7XA 2VSYA 3RO3A 2ONDA 4G26A 5M72A 2VGXB 4XIFA 4JL0A 4UI9K 3GW4A 3QOUA 4GPKA 2FF4A 4NRHB 5FZSA 4U0UA 3PDNA 5CCMA 2KCKA 4U0ZA 3ULQA 4UQYA 2AVPA 4GYYA 3HYMB 4N5CA 2PL2A 4XI0A 2OOEA 4CGVA 5ARFA 2XGMA 2Q7FA 4KYOB 4AIFA 3IEGA 4CGWA 5KJMA 2XCCA 4GA2A 3RU0A 4CDRA 5CCLA 3CK9A 4HORA 3PE4A 2XGSA 5D0OD 2VSNA 4G2VA 5ARGA 3Q49B 3TG5A 3KAEA 5HI7A 2J9QA 1B89A 3MKRA 5EX0A 4UI9J 3LKUA 4N2QA 5C1DA 2XPIA 5A7DB 2QFCA 2MHKA 2YQ8A 3S7DA 5KJLA 2JLBA 4WNGA 3R9AB 5BW8C 1XNFA 1ELRA 1NZNA 3GZ1A 5JJ7A 4GA0A 4GYOA 3TAXA 3AS4A 3K9IA 3ZHEB 4N3AA 4N2SA 4RG9A 4AY5A 3CV0A 4ME2A 4ABNA 2LNIA 4G1TA 2I6HA 4I9CA 3OXLA 3LYAA 4HOTA 2R5SA 3CVLA 4O6FA 5FZRA 4GZ3A 3ZPJA 1PC2A 2FBNA 4GZ6A 4UI9C 2Y4UA 4WNDA 3Q4AB 4F3VA 4G23A 2WPVA 2VGYA 4KXKB 4YNDA 3EDTB 2C0LA 2PZIA 1YA0A 3MEKA 5D0QD 4U0SA 2DBAA 3RJVA 4BWRA 2BUGA 3QWVA 3ZGQA 5BNWA 4HOUA 3LCAA 3MV3B 2UY1A 4KBQA 4I2ZA 3GYZA 1E96B 3UQ3A 1QZ2A 3ZN3A 3LY8A 4GCOA 3ZHEA 1ZU2A 4G25A 4Y6WA 5DIZA 4HOSA 1P5QA 3CKBA 4EQFA 4I1AA 5FTPA 2KCVA 3QDNA 3ASDA 4G24A 5EX3A 4J8EA 5HQ8A 3E4BA 3SZ7A 4YVOA 2UWJG 2FI7A 3PE3A 3CK8A 3UUXA 3RKVA 1NA0A
chains in the Genus database with same CATH superfamily
4A1SA 3GZ2A 3V31A 3C3OA 4F53A 1XGWA 1Q2ZA 2VGXA 4NQ0A 3Q9NC 5FT9A 3DSWA 1Z6TA 1S70B 3JCKC 2CG2A 1OUVA 4C48B 1OCZE 4FC8A 2WXOA 3S7BA 3CVQA 2XRYA 4LNUD 1HG2A 2GW1A 3ASNE 2A5EA 4P29A 2L6BA 3ZVVA 1FCHA 3T5XA 1IQRA 2AWIA 2CG3A 1Z5SC 4FJYA 5EYLA 5FJYA 1NA3A 3ZXPA 4I6EA 4U63A 3OXFA 2P2CP 4CDNA 5KJKA 4WAFA 1HZ4A 5ENTD 2MOWA 1MX2A 3T8KA 4WNFA 4B94A 2J07A 1OXJA 4N3BA 4O1OA 3CSFA 3ONLA 2R03A 5CERB 1N94A 3ASGA 3JXIA 3MKQB 2PM6A 4BSZB 2QZAA 3IHYA 1WY6A 1MJ0A 1KT1A 4JA7A 4DX2A 3RIBA 4J8DA 2CHZA 2NC9A 3PEUB 4KVOA 4A1GA 4ANVA 1NI1A 1Z3XA 1TYQG 5ENNA 4YVQC 3IXEA 4KT6B 3CHQA 3NF1A 4Q96A 4FU3A 5CEDB 2GRPB 1KZOA 4UQXA 1D8EA 3D9PA 3FWVA 4GTSA 5A23A 2WXIA 1MZCA 1BLXB 4AOFA 5ENQD 2XGOA 3T8MA 4DRXE 1JCRA 3GZSA 3KD7A 2Y69E 5KJNA 5EKQD 1EYHA 4APOA 2IY0C 3FU5A 2EILE 1X5BA 4O1PA 3CR3A 4BTAA 3MA5A 2UY1B 1WG0A 3S2AA 2XCBA 4J8FA 3C72A 3IV0A 1UOHA 5E76A 1KT0A 3EIJA 3FUIA 1KLXA 3SNXA 1DC2A 3S7FA 3S7JA 2ETCA 3N71A 1N9AA 1LD8A 1H0AA 2AW6A 4NIKA 2KCLA 4HXIA 4ACLA 3UPVA 4BT8A 1QQEA 2VYIA 4EZLA 2IEJA 4L7TA 5LCWJ 3HDXA 4DI3A 1TN7A 1UJJA 1SQMA 1DCQA 4JL0A 2ZIRA 3R9MA 4JC8A 4L9PA 2CHXA 5HRYA 2FF4A 4C9BB 1E8YA 4U0UA 3UINC 4UUCA 2CFZA 2KCKA 3ULQA 2IJGX 3CQCB 2OEWA 4N5CA 3HXFA 4CGVA 4KYOB 4GA2A 4K03A 3UKRG 2R02A 1TJFA 3PZDA 1YMPA 3V79K 4G11A 5CCLA 1HE8A 2XQ0A 4I6GA 3EHRA 1ELKA 2VSNA 1MX4A 1E8WA 1BI8B 4EBAA 2ZGDA 2XZTG 2BKKB 4G2VA 2B0OE 1SZAA 5ARGA 4XZ4A 3Q9UC 3PVLA 2LO6A 2EINE 5AQ9A 2J9QA 4AP2A 1B89A 1N54A 3D9OA 3CGHA 3MKRA 2E0IA 4BEPA 2IU1A 4TUMA 1OCOE 2IONA 3D9NA 5C1DA 5A7DB 2YQ8A 3AJIA 2XENA 3S7DA 5AJLA 4TXPA 4ZHBA 4U95D 5LOZA 3R9AB 2WM9A 3I5PA 1IKND 3PEVB 4Q69A 2VTBB 3TAXA 2WXQA 3ZHEB 3BG1B 4N2SA 3FTZA 5C2YA 4G1TA 4XKCA 4DX1A 4X8QA 1OY3D 4L2YA 2YINA 3ZYMA 2DCPA 2KZTA 4GTQA 4M3OA 5FZRA 4UWGA 4AVXA 5KCMA 2V5QC 2GRNB 3T5VA 2EIME 4PS8A 3EIQC 3MCXA 4JXTA 3FH7A 2VGYA 4AV7A 1U3DA 3EDTB 2C0LA 2RD0A 5B1AE 3RK6A 4FJZA 3LXUX 4U96D 4CT0A 3CHSA 3FEYA 2L0IA 4DI4A 4IULA 4HOUA 3LCAA 3JQ0A 2WXGA 4ANXA 4I2ZA 1N4QA 4EBAG 1PAQA 3UXGA 3UQ3A 5ANRA 3C3RA 3ZN3A 3TXNA 4GCOA 4LNGA 3ZHEA 3UMVA 3CKBA 1OT8A 4FLBA 4DLQA 3CIAA 1FT2A 4RSYA 3ASDA 3ZW3A 3EU5A 1L5JA 2DZNA 1NP7A 2QY7A 1DCEA 4J0UA 3JYSA 5G05C 4N5QA 3DWLG 1IQUA 3HG0D 3NZSA 3NOGD 3D9LA 2L0TB 2WXFA 1UN8A 2LSVA 5BXOA 2PQNA 4GA1A 1JPLA 2DWZA 3HXBA 2XEVA 4JD2G 2X3MA 3CHRA 4UWLA 3QWWA 5CBOA 4ILGA 4J6IA 3FFLA 3DBSA 5BV0A 3LY9A 4ILIA 2RFAA 3CVVA 3MV2B 4FHJA 2LSUA 2BEDA 3RSEG 4GTOA 3Q47B 5JA4D 4CRWA 2HYZA 3PZ1A 3CHMA 2IO3C 3ZYQA 2X6HA 3HXCA 2BTDA 3ESKA 3SD5A 5ITZF 2RG8A 2OV8A 3SFXA 2GGFA 3SFZA 1TNYA 3RRUA 4K0RA 3Q75A 4DLOA 3G2SA 3DPYA 4BT9A 4I1OB 3FTSA 3RO2A 2RKKA 4IN3B 2HM8A 4HLEA 1K1BA 4I1MA 3NB2A 4JVSA 5G04C 2EQXA 4BTBA 5H7PA 4HOQA 3Q15A 5CHEE 4XEIG 4FULA 3D9IA 3DEOA 1JWGA 3O48A 3FUKA 1UW4B 2P9UG 4AJWA 3U9WA 3DRAA 3PZ4A 4N39A 2R05A 4BX9A 2VQ2A 3I3NA 2L6JA 4HQDA 4ZFHA 4LERA 3JUIA 4GZ5A 2HO1A 2LAHA 4XX5A 4GTMA 3Q73A 1N4SA 3TWQA 1TN8A 1PY1A 4Y6CA 1TEZA 2J08A 4Z68A 1ELWA 3VLEA 4AM9A 2LXLA 3L16A 5EIBE 3LVRE 3TWWA 2V0PA 4RG6A 2E2EA 2VSOE 5HS0A 3U3WA 4FA6A 3E34A 2YHCA 2X6IA 2V5FA 5AAOA 1N4PA 1INZA 2MYOA 4GZCA 3ASFA 1IHBA 3QAQA 3APDA 3UT4A 2IFUA 3CHOA 4IYPA 4L2LA 5LP0A 3FUJA 2ONDA 4G26A 3ZNGA 5M72A 2WB2A 1KPSB 2NYJA 2I9CA 3NOCD 3V30A 3ZKJA 3QOUA 4GPKA 1FVHA 2ZISA 1HG5A 2GRMA 3L9TA 2AVPA 3FU6A 1K3ZD 1QYMA 3EU9A 3HYMB 3APFA 3ML8A 3C5RA 2VJ8A 4XE0A 2XGMA 2J8SD 4F7AA 4AIFA 3C3QA 3IEGA 4CGWA 3UM3A 3L13A 4CDRA 3CK9A 2YHEA 4HVBA 1K1AA 2F8YA 4HI9A 5D0OD 3HXEA 3CVXA 3FU3A 4J8YA 4BFRA 3Q49B 4K5BA 3TG5A 3E37A 4I6JA 4BSXA 5ENOD 2X6JA 4UI9J 1JCQA 5ENSD 3CVUA 2EIJE 4GU5A 2QFCA 2MHKA 2M63A 3ZIMA 5FINA 4AXHA 4LNBA 1O1TA 1ELRA 4PS7A 4CYMD 2ETAA 3SY2A 4XKBA 4GA0A 3V2XA 5D2MC 1Z3YA 3MKQA 3OTNA 3L6AA 4RG9A 3E32A 4AY5A 3B7BA 4ME2A 4CT4A 2I1KA 4TXRA 2I6HA 1G3NB 3D3MA 1N0QA 4HOTA 3FTXA 2R17C 5CBNA 3CVLA 3FUFA 3E30A 2DIWA 3DSSA 3G2UA 1PC2A 5BV1A 2BKGA 4UI9C 5BXUA 2Y1LE 4UWHA 4B8CB 3Q4AB 2HE0A 3EHMA 3AU4A 2VSXE 4KXKB 4YNDA 4Q94A 2GRLA 2JEKA 1YYHA 2ZXWE 3EJNA 3RJVA 5JHBA 3AAAC 3T9KA 3KEAA 3QWVA 2VGEA 4ANWA 3O4ZA 2WXLA 1YCSB 2QC9A 4HFGA 1BU9A 1MHQA 2FULA 3L54A 3MV3B 4HRLA 4V3IA 2UY1A 4C0EA 2GROB 2WXPA 1TR4A 3FTYA 5G55A 1QZ2A 2IOSA 3LY8A 3MJWA 5JMND 5DIZA 2KXPC 2KM4A 4HOSA 5KBAA 1H2VC 4NURA 3L17A 4FADA 3QDNA 4PDXA 3QNKA 3E4BA 3SZ7A 4DJAA 5CMWA 4APFA 1HF8A 3PE3A 3CK8A 4EPZA 3WG7E 2FEZA 4A3VA 3VLDA 3FTWA 5EN5D 4GYWA 2F8XK 1W3BA 3ZEFA 3IHVA 3ZUVB 4GAAA 4U04A 4H7YA 4MS6A 4JHKA 1N11A 3AS5A 3LPZA 2XS8A 3UX4A 4I17A 3D9KA 1HXIA 1U2VG 2JABA 1Y8MA 1LTXA 3ABME 4JA9A 1EDUA 4J8SA 3FTUA 1N52A 1SA4A 1TNZA 3LY7A 3VTYA 3D9MA 3KS2A 4MKTA 1IYGA 2H6IA 1A17A 4D10C 2EIKE 3RRMB 2LUHA 3ASOE 1O5MA 2XPZA 4PUCA 4WUYA 2Y4TA 3J5PA 5JHAA 4QFVA 3BUAA 3KEZA 5FWQA 2KC7A 3BG0B 3D9JA 3IKOB 1Y6IA 3PH0C 3V2OA 5G05J 1SZ9A 2WQ7A 3G2VA 5T4YA 1TNUA 2DYSE 1BI7B 3SFYA 1ZBPA 4E85A 3VTXA 3MGBA 3QKYA 3ZXSA 2VTBA 3DXMG 5A6CA 2Y0BG 1SA5A 3FP3A 1NL4A 5ENPD 4EZKA 2P58C 3PNLB 1TJCA 2HR2A 5EILA 4DX7D 2R59A 4GB9A 1IHGA 5KNGA 5BPPA 3B7TA 3R7RA 3URZA 3HVEB 3VLFA 1HH8A 4L1BA 4OVUA 2C0MA 2WXRA 3CVPA 4JZYA 4CZ2D 3NZUA 3WXXA 2WMNA 4HB5A 2J49A 3DSXA 1TNOA 3TGOA 5AYWD 1SVXA 4GZDA 2AXUA 2C2LA 2PM7A 3Q7AA 2P9SG 4A55A 5AARA 5JJTA 2J09A 4UWFA 3HHMA 5KWDA 4HRMB 5AIJA 3TXMA 5BUZA 3SBTB 2WQ6A 3DSVA 3HRAA 2FO1E 3U64A 3UI2A 5B3SE 5JJ6A 3MYVA 2WXKA 2CFUA 3PS6A 4I43A 4LEUA 3QWPA 3FEXA 3ASHA 4F1PA 4HBDA 2WXJA 4EZJA 5G04J 5DBKA 1BD8A 4KVMA 4GTPA 4N3CA 4LCTA 1HU3A 5CECB 3UKUG 4FLHA 2XRZA 2KATA 2WQHA 4ANUA 2VSYA 3J5QB 4MBGA 2LXMA 4L23A 2VGXB 2XEHA 4UI9K 3HVEA 3ENEA 4EECA 3GW4A 3ULEG 4NRHB 5FZSA 2PNNA 3PDNA 5CCMA 4BY6A 4U0ZA 2DZOA 4UQYA 3TWRA 2XS1A 1EF1C 2PL2A 4UWKA 4XI0A 1E7UA 4ACKA 5ARFA 2ZGGA 2OVFA 3U66A 2XCCA 3RU0A 4HNAD 2XGSA 1E7VA 4KZ0A 3ZYLA 1RZ4A 4DX6D 4U8VD 4JB8P 2V4HC 3G2WA 4HS2A 2H6HA 3APCA 3KAEA 3P2BA 5HI7A 3LJNA 1K8KG 4BERA 1UG3A 2P9KG 5EX0A 1D9SA 1HFAA 4ILHB 3LKUA 4N2QA 2XPIA 1H6OA 3UM1A 5HKPA 2LAIA 5KJLA 1H6KA 3NAWA 3LDZA 4GTTA 4TUUA 1KZPA 1N0RA 4LSZE 5ANLA 3PZ3A 4B93B 3GZ1A 4GYOA 5G2NA 3K9IA 4DK5A 4N3AA 4F6RD 5T8IA 2LNIA 4C0MA 3F6QA 4G8KA 2P9LG 4I9CA 3PUJA 4HI8A 3OXLA 3LYAA 2XEEA 2R5SA 3ULYA 4O6FA 4K5CA 1DVPA 3DSTA 2QYJA 1NFIE 3ZPJA 3EHQA 3AG1E 5J08A 1FVFA 4QQIA 4KMOA 3AG3E 4F3VA 4G23A 3L22A 5FQ4A 1BPOA 3FHEA 2F37A 2PZIA 1YA0A 3L82A 2WXNA 3E33A 3W9GA 3KSQA 4EHMA 4U0SA 2OVBA 3CQGB 1DNPA 4GTVA 3ZGQA 2X38A 5BNWA 3IBEA 4LG6A 2I2OA 3SHFA 4YDEA 5AQAA 1OCCE 4KBQA 3AG2E 2X6FA 5IY5E 3GYZA 3PNTB 1E96B 2CHWA 3Q79A 2P9PG 3CHPA 4NACA 2A5UA 1HS6A 1ZU2A 4Y6WA 3OAWA 1P5QA 1S63A 4LUNU 1H6PA 4B89A 4JW1A 4B0ZA 3BU8A 4EQFA 4GMRA 4GMJA 3RRNB 5FTPA 1ZB1A 2KCVA 3QB2A 3FUNA 4F1SA 3SGHA 1TNBA 2UWJG 4A3TA 4FHKA 3ISMC 1GW6A 1H2UA 1MQSA 3UUXA 1NA0A 4RLYA 1O1RA 1RW2A 3C98A 3P1UA 4AEZC 3CEQA 2WXHA 4BESA 3UM0A 3Q5MA 1SW6A 4MLPA 3JQ1A 5AQBA 4A63B 4GPMA 2MRIA 3JXJA 3SBSA 3TWSA 3MX3A 5BT1A 3TG4A 3LJ3A 3B13A 3FH8A 3TWVA 1V54E 1V55E 4BX8A 3CVYA 3LEWA 3TWTA 3CK7A 2BF0X 3D9HA 2X6KA 2FO7A 3AG4E 4I9EA 4UQZA 3SF4A 3QC1A 1MX6A 4O60A 1WM5A 3KSLA 3UIOC 2RFMA 2WXMA 3SQVA 3FUDA 4URKA 4AY6A 2YNQA 4KZCA 2QYUA 1QNFA 2WMOA 4RQIA 1FT1A 3UIPC 4TRQA 1EPUA 5FQ6A 2V8SE 2XZDG 4XI9A 3ABLE 3AS8A 3UT7A 1HO8A 2DVWA 4HLLA 1UJKA 1X81A 4GCNA 3I4GA 4JHRA 2KZTB 1OWNA 1N4RA 1AP7A 4BETA 4OAUC 3B7SA 3MZLB 5J90A 3ZFWA 2NXPA 4JPSA 1H2TC 1FPPA 1JUQA 3QARA 3I4RB 3LS8A 1S0PA 2IQCA 3HIZA 5FZQA 3EUVA 5LCWC 3FULA 4OAVB 3EHNA 5D66A 4JHJA 5B1BE 2NSZA 4B8AA 1VDYA 3ML9A 3OXGA 3DSUA 2IO2C 3TWUA 4U8HA 4K5AB 4DUIA 4TXQA 3FTVA 2H6FA 3PUKA 3JUEA 2H6GA 3FY4A 1O1SA 2IF4A 5KNHD 3LVQE 2GRQB 4CDMA 1OWLA 4U07A 3CKCA 3UTMA 4GMLA 2OEVA 4I2WA 3G2TA 3CVNA 4WWNA 3FUEA 1E8XA 3U4TA 2Y3AA 2PQRA 4MRUA 2ETBA 2F0YA 3BEEA 1WAO1 3DEPA 3CVWA 4IRUA 4WNEA 1OWOA 4U7EB 1UN9A 2AJAA 4W9RA 4H7XA 4WWOA 2ILRA 3TWXA 3RO3A 3ZYKA 3DXKG 1HX8A 4YDOA 4XIFA 1OWPA 3CSTA 4G8LA 4HRNA 2L9BA 3RAUA 5LFAA 2GRRB 3ONKA 3SO8A 4ATZD 5CRVA 4GYYA 2ZU6B 1TN6A 2OOEA 2Q7FA 5FQ8A 2J4BA 3PZ2A 5KJMA 3UT8A 5AJDA 4HORA 4CCAA 3PE4A 2DYRE 1H19A 4JEHA 2AXVA 3PREA 4PH4B 4R7LA 3FH5A 4WWPA 3ESLA 3B95A 5CRUA 3PRZA 3Q78A 2AXZA 3NBNB 4RVBA 2JLBA 4GTRA 4WNGA 5AQ7A 4U8YD 1E8ZA 3Q7FA 5BW8C 3R7QA 1XNFA 2P9NG 3B7RL 1JWFA 1NZNA 5JJ7A 3AU5A 4YDYA 4PS3A 3AS4A 3B7UX 5FIOA 3QJZA 3CV0A 3FUHA 4ABNA 1OCRE 3NQPA 5T3RA 3QK0A 1LD7A 3TJPA 3BQOA 4JEUA 4DX5D 2V4LA 4GZ3A 3FU0A 5CMYA 1MYOA 2FBNA 4GZ6A 1E90A 3ZU7B 2Y4UA 3L08A 4WNDA 5AENA 4M7CA 1WDYA 2WPVA 4YDWA 4FP7A 2R2LA 3ABKE 3DPDA 5EIDA 3HXDA 1N95A 5CEAA 3MEKA 5D0QD 4OVVA 2XPYA 3ZRHA 2DBAA 3FDHA 3FUMA 4BWRA 2BUGA 2IOLA 1LF8A 1JCSA 5FQ7A 1A5EA 4OYSA 2B6CA 4J7WA 5EDSA 1IXVA 4DPRA 2OCCE 1OWMA 4E6HA 1QBQA 2I1JA 3X2QE 5E75A 2KBXA 1D8DA 2WVIA 4ATGA 3W9FA 2J4DA 4G25A 2XHEA 2P9IG 1U3CA 5ENRD 5LX8A 3CLJA 4I1AA 5EYPF 4G24A 5EX3A 1AWCB 4J8EA 5HQ8A 2A4ZA 5AN8A 4YVOA 4LRZA 2FI7A 3UM2A 4CEMA 3SI5A 3TL5A 4TV3A 3RKVA 1S64A
chains in the Genus database with same CATH topology
4A1SA 3GZ2A 4J0UA 3C98A 3JYSA 3P1UA 2FEZA 5G05C 4AEZC 4A3VA 4F53A 3VLDA 3CEQA 3FTWA 1XGWA 2VGXA 2WXHA 4NQ0A 4GYWA 1IQUA 3NZSA 1W3BA 3Q5MA 5FT9A 3ZEFA 3IHVA 4GAAA 4MLPA 3D9LA 1Z6TA 3JQ1A 4U04A 4H7YA 2L0TB 2CG2A 3JCKC 4MS6A 1OUVA 4FC8A 4JHKA 2MRIA 3AS5A 2WXOA 3LPZA 2WXFA 3CVQA 3S7BA 3UX4A 1UN8A 3SBSA 2XRYA 2LSVA 3MX3A 5BT1A 1HG2A 2GW1A 2PQNA 4GA1A 3D9KA 4I17A 3TG4A 1HXIA 3B13A 3LJ3A 3FH8A 1JPLA 2XEVA 4P29A 1Y8MA 3ZVVA 2X3MA 3CHRA 4UWLA 3QWWA 1FCHA 3T5XA 1IQRA 2AWIA 4BX8A 3CVYA 2CG3A 3LEWA 4FJYA 4JA9A 4ILGA 3CK7A 4J6IA 1EDUA 4J8SA 5FJYA 3FTUA 3FFLA 3DBSA 2BF0X 5BV0A 3LY9A 1NA3A 4ILIA 2X6KA 1N52A 4I6EA 4U63A 3CVVA 3LY7A 2FO7A 3OXFA 4I9EA 3VTYA 3D9MA 3KS2A 3MV2B 4MKTA 4UQZA 4CDNA 5KJKA 4FHJA 1IYGA 4WAFA 3SF4A 3QC1A 2LSUA 1A17A 4D10C 1WM5A 3RRMB 3Q47B 1HZ4A 2WXMA 3FUDA 4URKA 2MOWA 4B94A 4WNFA 4CRWA 4AY6A 2J07A 2HYZA 2XPZA 2YNQA 4PUCA 4WUYA 4KZCA 2Y4TA 4N3BA 3CHMA 5JHAA 4QFVA 3CSFA 3KEZA 3ONLA 3ZYQA 5FWQA 2KC7A 3BG0B 2X6HA 3D9JA 3ASGA 3IKOB 1Y6IA 3PH0C 2BTDA 5G05J 3ESKA 1SZ9A 1QNFA 2WMOA 2WQ7A 3G2VA 3SD5A 3MKQB 5T4YA 2PM6A 2RG8A 2OV8A 4TRQA 1EPUA 3IHYA 5FQ6A 1WY6A 1KT1A 2V8SE 4XI9A 2GGFA 4JA7A 1ZBPA 3AS8A 3SFZA 3RIBA 4E85A 3UT7A 3RRUA 4K0RA 1HO8A 2CHZA 4J8DA 3VTXA 2NC9A 3MGBA 4DLOA 1UJKA 3PEUB 3QKYA 4KVOA 4GCNA 4A1GA 3I4GA 4ANVA 4JHRA 3G2SA 2KZTB 3ZXSA 2VTBA 1OWNA 4BT9A 5A6CA 4I1OB 1Z3XA 3FP3A 3FTSA 3B7SA 5ENNA 4EZKA 3MZLB 4YVQC 3RO2A 2P58C 5J90A 3PNLB 1TJCA 3ZFWA 2NXPA 2HR2A 4IN3B 4JPSA 4KT6B 3CHQA 3NF1A 4Q96A 4FU3A 2HM8A 4HLEA 1H2TC 2R59A 4GB9A 4I1MA 1IHGA 4JVSA 5BPPA 5G04C 3B7TA 3R7RA 3URZA 2EQXA 1JUQA 4UQXA 4BTBA 3HVEB 3QARA 4HOQA 3I4RB 3D9PA 3FWVA 3Q15A 5CHEE 3VLFA 3LS8A 1HH8A 1S0PA 2IQCA 4FULA 4L1BA 4OVUA 3HIZA 5A23A 2WXIA 2C0MA 5FZQA 3D9IA 1JWGA 3O48A 2WXRA 3FUKA 5LCWC 1UW4B 4AOFA 4AJWA 3U9WA 2XGOA 3FULA 3CVPA 3T8MA 4JZYA 3EHNA 4JHJA 3GZSA 3NZUA 3KD7A 2NSZA 4N39A 3WXXA 1VDYA 3ML9A 3OXGA 4B8AA 5KJNA 2WMNA 4BX9A 2J49A 2VQ2A 3I3NA 5EKQD 1EYHA 2L6JA 3TGOA 5AYWD 4APOA 4LERA 3FU5A 4GZDA 3JUIA 4GZ5A 2HO1A 2LAHA 2AXUA 4U8HA 4XX5A 2C2LA 1X5BA 3CR3A 4BTAA 2PM7A 1PY1A 3MA5A 4Y6CA 1TEZA 2J08A 3FTVA 4A55A 5JJTA 2J09A 4UWFA 3HHMA 2UY1B 5AIJA 3PUKA 3S2AA 3FY4A 3TXMA 5BUZA 3SBTB 1ELWA 2WQ6A 2XCBA 4J8FA 3VLEA 4AM9A 2IF4A 3L16A 3IV0A 3LVQE 5E76A 1KT0A 4CDMA 3EIJA 3FUIA 3U64A 1OWLA 3LVRE 4U07A 3CKCA 1KLXA 2V0PA 4GMLA 4RG6A 4I2WA 3SNXA 2E2EA 2VSOE 3G2TA 3U3WA 5JJ6A 4FA6A 3S7FA 3S7JA 3CVNA 4WWNA 3MYVA 2WXKA 3FUEA 3N71A 2YHCA 1E8XA 2CFUA 3PS6A 2X6IA 4I43A 4LEUA 3U4TA 3QWPA 2Y3AA 2PQRA 3FEXA 1H0AA 3ASHA 2V5FA 2AW6A 4MRUA 2WXJA 4EZJA 1INZA 4GZCA 5G04J 3ASFA 5DBKA 2KCLA 3QAQA 4HXIA 4ACLA 3APDA 3BEEA 4KVMA 3UPVA 4N3CA 4BT8A 1WAO1 4LCTA 1HU3A 3UT4A 1QQEA 2VYIA 3CVWA 2IFUA 3CHOA 4IYPA 4IRUA 4L2LA 4EZLA 4L7TA 4WNEA 1OWOA 4FLHA 5LCWJ 2XRZA 1UN9A 2KATA 2WQHA 5LP0A 4W9RA 4H7XA 4ANUA 4WWOA 3HDXA 2ILRA 2VSYA 4DI3A 3RO3A 3FUJA 2ONDA 4G26A 3ZYKA 1UJJA 5M72A 2WB2A 1SQMA 2I9CA 1HX8A 4L23A 2VGXB 4XIFA 1OWPA 4JL0A 4UI9K 3HVEA 3CSTA 3ENEA 4EECA 3GW4A 4JC8A 3QOUA 4GPKA 2CHXA 1FVHA 2FF4A 4NRHB 2L9BA 4C9BB 1E8YA 5FZSA 4U0UA 1HG5A 2GRMA 3PDNA 5CCMA 5LFAA 4BY6A 2CFZA 2KCKA 4U0ZA 3ULQA 2IJGX 3ONKA 3CQCB 4UQYA 2AVPA 3FU6A 4GYYA 3HYMB 3APFA 4N5CA 1EF1C 2ZU6B 3ML8A 2PL2A 2VJ8A 4UWKA 4XE0A 4XI0A 1E7UA 2OOEA 4ACKA 5ARFA 4CGVA 2XGMA 2Q7FA 4KYOB 5FQ8A 2J4BA 4F7AA 4AIFA 3IEGA 2OVFA 4CGWA 5KJMA 3U66A 2XCCA 3UT8A 4GA2A 4K03A 3L13A 5AJDA 3RU0A 1TJFA 3PZDA 4CDRA 4G11A 5CCLA 3CK9A 4HORA 4CCAA 1HE8A 2YHEA 3PE4A 4HVBA 2XGSA 2XQ0A 1E7VA 4I6GA 1H19A 5D0OD 4KZ0A 1ELKA 2VSNA 3ZYLA 1E8WA 4EBAA 4JEHA 4G2VA 3CVXA 2AXVA 3FU3A 1SZAA 5ARGA 3PREA 4XZ4A 3PVLA 3G2WA 3Q49B 4HS2A 4BFRA 4PH4B 3TG5A 3APCA 3KAEA 4R7LA 2LO6A 3P2BA 5HI7A 3FH5A 2J9QA 4I6JA 1UG3A 4AP2A 4BSXA 4WWPA 2X6JA 1B89A 1N54A 3D9OA 3CGHA 3MKRA 2E0IA 3ESLA 5EX0A 4UI9J 1HFAA 4ILHB 2IU1A 2IONA 3D9NA 3LKUA 4GU5A 2XPIA 5C1DA 3PRZA 3CVUA 4N2QA 5A7DB 2QFCA 2MHKA 2AXZA 2YQ8A 2M63A 2LAIA 4RVBA 3ZIMA 3S7DA 5KJLA 5AJLA 2JLBA 1H6KA 4WNGA 4AXHA 3LDZA 1E8ZA 5LOZA 3R9AB 2WM9A 4TUUA 5BW8C 3R7QA 1XNFA 3B7RL 3I5PA 5ANLA 1ELRA 4PS7A 1JWFA 1NZNA 3GZ1A 3PEVB 4Q69A 5JJ7A 3AU5A 4XKBA 2VTBB 4GA0A 4GYOA 3TAXA 2WXQA 4PS3A 1Z3YA 3AS4A 5G2NA 3K9IA 3ZHEB 3MKQA 4DK5A 3B7UX 3OTNA 3BG1B 3L6AA 3QJZA 4N3AA 4N2SA 3FTZA 4RG9A 4AY5A 3CV0A 4ME2A 4CT4A 5C2YA 3FUHA 5T8IA 4ABNA 2I1KA 2LNIA 4C0MA 4G1TA 4XKCA 3NQPA 5T3RA 2I6HA 4I9CA 3D3MA 3QK0A 3PUJA 4L2YA 2YINA 3ZYMA 3TJPA 3OXLA 2DCPA 3LYAA 4HOTA 3FTXA 2R17C 4JEUA 2KZTA 2R5SA 3CVLA 4O6FA 2V4LA 3FUFA 4M3OA 5FZRA 4GZ3A 1DVPA 4UWGA 4AVXA 2DIWA 3FU0A 5CMYA 3G2UA 5KCMA 3ZPJA 1PC2A 2FBNA 5BV1A 4GZ6A 3T5VA 4PS8A 5J08A 1FVFA 1E90A 3EIQC 4UI9C 4UWHA 3MCXA 4B8CB 2Y4UA 3L08A 4WNDA 4KMOA 3Q4AB 4F3VA 4JXTA 5AENA 4G23A 3FH7A 3L22A 3EHMA 5FQ4A 1BPOA 2WPVA 3AU4A 2VGYA 4FP7A 4AV7A 2VSXE 4KXKB 3FHEA 4YNDA 3DPDA 1U3DA 3EDTB 2C0LA 4Q94A 2RD0A 2GRLA 2PZIA 1YA0A 3RK6A 3MEKA 5D0QD 2WXNA 4OVVA 2XPYA 3ZRHA 4FJZA 2JEKA 4U0SA 2DBAA 3FDHA 2OVBA 3EJNA 3CQGB 3FUMA 3LXUX 3RJVA 5JHBA 1DNPA 4BWRA 2BUGA 2IOLA 4CT0A 3CHSA 3FEYA 3QWVA 1LF8A 2L0IA 3ZGQA 4ANWA 3O4ZA 2X38A 2WXLA 5FQ7A 4DI4A 5BNWA 4IULA 4HFGA 3IBEA 4OYSA 4HOUA 1MHQA 2FULA 3LCAA 2I2OA 5EDSA 3JQ0A 3L54A 4DPRA 3SHFA 3MV3B 1OWMA 4V3IA 2UY1A 2WXGA 4KBQA 4C0EA 4E6HA 4ANXA 4I2ZA 2I1JA 2X6FA 5E75A 3GYZA 2WXPA 3PNTB 4EBAG 1E96B 2CHWA 3FTYA 1PAQA 5G55A 2WVIA 3CHPA 1QZ2A 5ANRA 3UQ3A 2IOSA 4NACA 2A5UA 3ZN3A 4ATGA 3TXNA 3LY8A 1HS6A 3MJWA 4GCOA 2J4DA 3ZHEA 1ZU2A 4G25A 2XHEA 4Y6WA 5DIZA 3UMVA 3OAWA 2KM4A 1P5QA 4HOSA 1H2VC 1U3CA 3CKBA 4LUNU 4B89A 4FLBA 4JW1A 4B0ZA 4DLQA 5LX8A 3CLJA 3CIAA 4EQFA 4NURA 4GMJA 3L17A 3RRNB 4I1AA 5FTPA 2KCVA 4RSYA 4FADA 3QB2A 3QDNA 3ASDA 3FUNA 4PDXA 4G24A 5EX3A 3QNKA 4J8EA 4F1SA 5HQ8A 2A4ZA 3ZW3A 3E4BA 3SGHA 3SZ7A 4YVOA 4DJAA 5CMWA 1L5JA 4LRZA 2UWJG 2FI7A 4A3TA 4FHKA 1NP7A 1GW6A 2QY7A 1H2UA 3SI5A 4APFA 1HF8A 1MQSA 4CEMA 3TL5A 3PE3A 3CK8A 4TV3A 3RKVA 3UUXA 1NA0A 4EPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A1S A;  3GZ2 A;  4J0U A;  3JYS A;  2FEZ A;  5G05 C;  3CEQ A;  2VGX A;  4NQ0 A;  4GYW A;  1W3B A;  3Q5M A;  5FT9 A;  4U04 A;  4H7Y A;  1OUV A;  3AS5 A;  3LPZ A;  3S7B A;  3CVQ A;  2LSV A;  5BT1 A;  2GW1 A;  2PQN A;  4GA1 A;  4I17 A;  3TG4 A;  1HXI A;  2XEV A;  1Y8M A;  3QWW A;  1FCH A;  4JA9 A;  3CK7 A;  5FJY A;  3FFL A;  3LY9 A;  1NA3 A;  3LY7 A;  2FO7 A;  3OXF A;  4I9E A;  3VTY A;  3KS2 A;  3MV2 B;  4UQZ A;  1IYG A;  5KJK A;  3SF4 A;  2LSU A;  1A17 A;  1WM5 A;  3Q47 B;  1HZ4 A;  4B94 A;  4WNF A;  4AY6 A;  2HYZ A;  4WUY A;  4N3B A;  2Y4T A;  2KC7 A;  3ASG A;  5G05 J;  3ESK A;  1KT1 A;  4XI9 A;  4JA7 A;  1ZBP A;  3AS8 A;  3RIB A;  4J8D A;  3VTX A;  2NC9 A;  3QKY A;  4GCN A;  4JHR A;  4BT9 A;  5A6C A;  3FP3 A;  4YVQ C;  3RO2 A;  2P58 C;  1TJC A;  3ZFW A;  2HR2 A;  4IN3 B;  3NF1 A;  1IHG A;  5G04 C;  3URZ A;  4UQX A;  4BTB A;  4HOQ A;  3FWV A;  3Q15 A;  5CHE E;  1HH8 A;  2C0M A;  5FZQ A;  3O48 A;  5LCW C;  2XGO A;  3CVP A;  3KD7 A;  4N39 A;  3WXX A;  3OXG A;  5KJN A;  2VQ2 A;  5EKQ D;  3TGO A;  2L6J A;  5AYW D;  4APO A;  4GZ5 A;  2HO1 A;  2C2L A;  4BTA A;  3MA5 A;  4Y6C A;  5JJT A;  2UY1 B;  1ELW A;  2XCB A;  4J8F A;  4AM9 A;  2IF4 A;  1KT0 A;  4U07 A;  3CKC A;  1KLX A;  4RG6 A;  4I2W A;  2E2E A;  3U3W A;  5JJ6 A;  3S7F A;  3S7J A;  3CVN A;  3N71 A;  2YHC A;  4LEU A;  3U4T A;  3QWP A;  2PQR A;  3ASH A;  2V5F A;  5G04 J;  3ASF A;  5DBK A;  2KCL A;  3BEE A;  3UPV A;  4N3C A;  4BT8 A;  1WAO 1;  1QQE A;  2VYI A;  2IFU A;  4WNE A;  5LCW J;  2KAT A;  2WQH A;  4W9R A;  4H7X A;  2VSY A;  3RO3 A;  2OND A;  4G26 A;  5M72 A;  2VGX B;  4XIF A;  4JL0 A;  4UI9 K;  3GW4 A;  3QOU A;  4GPK A;  2FF4 A;  4NRH B;  5FZS A;  4U0U A;  3PDN A;  5CCM A;  2KCK A;  4U0Z A;  3ULQ A;  4UQY A;  2AVP A;  4GYY A;  3HYM B;  4N5C A;  2PL2 A;  4XI0 A;  2OOE A;  4CGV A;  5ARF A;  2XGM A;  2Q7F A;  4KYO B;  4AIF A;  3IEG A;  4CGW A;  5KJM A;  2XCC A;  4GA2 A;  3RU0 A;  4CDR A;  5CCL A;  3CK9 A;  4HOR A;  3PE4 A;  2XGS A;  5D0O D;  2VSN A;  4G2V A;  5ARG A;  3Q49 B;  3TG5 A;  3KAE A;  5HI7 A;  2J9Q A;  1B89 A;  3MKR A;  5EX0 A;  4UI9 J;  3LKU A;  4N2Q A;  5C1D A;  2XPI A;  5A7D B;  2QFC A;  2MHK A;  2YQ8 A;  3S7D A;  5KJL A;  2JLB A;  4WNG A;  3R9A B;  5BW8 C;  1XNF A;  1ELR A;  1NZN A;  3GZ1 A;  5JJ7 A;  4GA0 A;  4GYO A;  3TAX A;  3AS4 A;  3K9I A;  3ZHE B;  4N3A A;  4N2S A;  4RG9 A;  4AY5 A;  3CV0 A;  4ME2 A;  4ABN A;  2LNI A;  4G1T A;  2I6H A;  4I9C A;  3OXL A;  3LYA A;  4HOT A;  2R5S A;  3CVL A;  4O6F A;  5FZR A;  4GZ3 A;  3ZPJ A;  1PC2 A;  2FBN A;  4GZ6 A;  4UI9 C;  2Y4U A;  4WND A;  3Q4A B;  4F3V A;  4G23 A;  2WPV A;  2VGY A;  4KXK B;  4YND A;  3EDT B;  2C0L A;  2PZI A;  1YA0 A;  3MEK A;  5D0Q D;  4U0S A;  2DBA A;  3RJV A;  4BWR A;  2BUG A;  3QWV A;  3ZGQ A;  5BNW A;  4HOU A;  3LCA A;  3MV3 B;  2UY1 A;  4KBQ A;  4I2Z A;  3GYZ A;  1E96 B;  3UQ3 A;  1QZ2 A;  3ZN3 A;  3LY8 A;  4GCO A;  3ZHE A;  1ZU2 A;  4G25 A;  4Y6W A;  5DIZ A;  4HOS A;  1P5Q A;  3CKB A;  4EQF A;  4I1A A;  5FTP A;  2KCV A;  3QDN A;  3ASD A;  4G24 A;  5EX3 A;  4J8E A;  5HQ8 A;  3E4B A;  3SZ7 A;  4YVO A;  2UWJ G;  2FI7 A;  3PE3 A;  3CK8 A;  3UUX A;  3RKV A;  1NA0 A; 
#chains in the Genus database with same CATH topology
 4A1S A;  3GZ2 A;  3V31 A;  3C3O A;  4F53 A;  1XGW A;  1Q2Z A;  2VGX A;  4NQ0 A;  3Q9N C;  5FT9 A;  3DSW A;  1Z6T A;  1S70 B;  3JCK C;  2CG2 A;  1OUV A;  4C48 B;  1OCZ E;  4FC8 A;  2WXO A;  3S7B A;  3CVQ A;  2XRY A;  4LNU D;  1HG2 A;  2GW1 A;  3ASN E;  2A5E A;  4P29 A;  2L6B A;  3ZVV A;  1FCH A;  3T5X A;  1IQR A;  2AWI A;  2CG3 A;  1Z5S C;  4FJY A;  5EYL A;  5FJY A;  1NA3 A;  3ZXP A;  4I6E A;  4U63 A;  3OXF A;  2P2C P;  4CDN A;  5KJK A;  4WAF A;  1HZ4 A;  5ENT D;  2MOW A;  1MX2 A;  3T8K A;  4WNF A;  4B94 A;  2J07 A;  1OXJ A;  4N3B A;  4O1O A;  3CSF A;  3ONL A;  2R03 A;  5CER B;  1N94 A;  3ASG A;  3JXI A;  3MKQ B;  2PM6 A;  4BSZ B;  2QZA A;  3IHY A;  1WY6 A;  1MJ0 A;  1KT1 A;  4JA7 A;  4DX2 A;  3RIB A;  4J8D A;  2CHZ A;  2NC9 A;  3PEU B;  4KVO A;  4A1G A;  4ANV A;  1NI1 A;  1Z3X A;  1TYQ G;  5ENN A;  4YVQ C;  3IXE A;  4KT6 B;  3CHQ A;  3NF1 A;  4Q96 A;  4FU3 A;  5CED B;  2GRP B;  1KZO A;  4UQX A;  1D8E A;  3D9P A;  3FWV A;  4GTS A;  5A23 A;  2WXI A;  1MZC A;  1BLX B;  4AOF A;  5ENQ D;  2XGO A;  3T8M A;  4DRX E;  1JCR A;  3GZS A;  3KD7 A;  2Y69 E;  5KJN A;  5EKQ D;  1EYH A;  4APO A;  2IY0 C;  3FU5 A;  2EIL E;  1X5B A;  4O1P A;  3CR3 A;  4BTA A;  3MA5 A;  2UY1 B;  1WG0 A;  3S2A A;  2XCB A;  4J8F A;  3C72 A;  3IV0 A;  1UOH A;  5E76 A;  1KT0 A;  3EIJ A;  3FUI A;  1KLX A;  3SNX A;  1DC2 A;  3S7F A;  3S7J A;  2ETC A;  3N71 A;  1N9A A;  1LD8 A;  1H0A A;  2AW6 A;  4NIK A;  2KCL A;  4HXI A;  4ACL A;  3UPV A;  4BT8 A;  1QQE A;  2VYI A;  4EZL A;  2IEJ A;  4L7T A;  5LCW J;  3HDX A;  4DI3 A;  1TN7 A;  1UJJ A;  1SQM A;  1DCQ A;  4JL0 A;  2ZIR A;  3R9M A;  4JC8 A;  4L9P A;  2CHX A;  5HRY A;  2FF4 A;  4C9B B;  1E8Y A;  4U0U A;  3UIN C;  4UUC A;  2CFZ A;  2KCK A;  3ULQ A;  2IJG X;  3CQC B;  2OEW A;  4N5C A;  3HXF A;  4CGV A;  4KYO B;  4GA2 A;  4K03 A;  3UKR G;  2R02 A;  1TJF A;  3PZD A;  1YMP A;  3V79 K;  4G11 A;  5CCL A;  1HE8 A;  2XQ0 A;  4I6G A;  3EHR A;  1ELK A;  2VSN A;  1MX4 A;  1E8W A;  1BI8 B;  4EBA A;  2ZGD A;  2XZT G;  2BKK B;  4G2V A;  2B0O E;  1SZA A;  5ARG A;  4XZ4 A;  3Q9U C;  3PVL A;  2LO6 A;  2EIN E;  5AQ9 A;  2J9Q A;  4AP2 A;  1B89 A;  1N54 A;  3D9O A;  3CGH A;  3MKR A;  2E0I A;  4BEP A;  2IU1 A;  4TUM A;  1OCO E;  2ION A;  3D9N A;  5C1D A;  5A7D B;  2YQ8 A;  3AJI A;  2XEN A;  3S7D A;  5AJL A;  4TXP A;  4ZHB A;  4U95 D;  5LOZ A;  3R9A B;  2WM9 A;  3I5P A;  1IKN D;  3PEV B;  4Q69 A;  2VTB B;  3TAX A;  2WXQ A;  3ZHE B;  3BG1 B;  4N2S A;  3FTZ A;  5C2Y A;  4G1T A;  4XKC A;  4DX1 A;  4X8Q A;  1OY3 D;  4L2Y A;  2YIN A;  3ZYM A;  2DCP A;  2KZT A;  4GTQ A;  4M3O A;  5FZR A;  4UWG A;  4AVX A;  5KCM A;  2V5Q C;  2GRN B;  3T5V A;  2EIM E;  4PS8 A;  3EIQ C;  3MCX A;  4JXT A;  3FH7 A;  2VGY A;  4AV7 A;  1U3D A;  3EDT B;  2C0L A;  2RD0 A;  5B1A E;  3RK6 A;  4FJZ A;  3LXU X;  4U96 D;  4CT0 A;  3CHS A;  3FEY A;  2L0I A;  4DI4 A;  4IUL A;  4HOU A;  3LCA A;  3JQ0 A;  2WXG A;  4ANX A;  4I2Z A;  1N4Q A;  4EBA G;  1PAQ A;  3UXG A;  3UQ3 A;  5ANR A;  3C3R A;  3ZN3 A;  3TXN A;  4GCO A;  4LNG A;  3ZHE A;  3UMV A;  3CKB A;  1OT8 A;  4FLB A;  4DLQ A;  3CIA A;  1FT2 A;  4RSY A;  3ASD A;  3ZW3 A;  3EU5 A;  1L5J A;  2DZN A;  1NP7 A;  2QY7 A;  1DCE A;  4J0U A;  3JYS A;  5G05 C;  4N5Q A;  3DWL G;  1IQU A;  3HG0 D;  3NZS A;  3NOG D;  3D9L A;  2L0T B;  2WXF A;  1UN8 A;  2LSV A;  5BXO A;  2PQN A;  4GA1 A;  1JPL A;  2DWZ A;  3HXB A;  2XEV A;  4JD2 G;  2X3M A;  3CHR A;  4UWL A;  3QWW A;  5CBO A;  4ILG A;  4J6I A;  3FFL A;  3DBS A;  5BV0 A;  3LY9 A;  4ILI A;  2RFA A;  3CVV A;  3MV2 B;  4FHJ A;  2LSU A;  2BED A;  3RSE G;  4GTO A;  3Q47 B;  5JA4 D;  4CRW A;  2HYZ A;  3PZ1 A;  3CHM A;  2IO3 C;  3ZYQ A;  2X6H A;  3HXC A;  2BTD A;  3ESK A;  3SD5 A;  5ITZ F;  2RG8 A;  2OV8 A;  3SFX A;  2GGF A;  3SFZ A;  1TNY A;  3RRU A;  4K0R A;  3Q75 A;  4DLO A;  3G2S A;  3DPY A;  4BT9 A;  4I1O B;  3FTS A;  3RO2 A;  2RKK A;  4IN3 B;  2HM8 A;  4HLE A;  1K1B A;  4I1M A;  3NB2 A;  4JVS A;  5G04 C;  2EQX A;  4BTB A;  5H7P A;  4HOQ A;  3Q15 A;  5CHE E;  4XEI G;  4FUL A;  3D9I A;  3DEO A;  1JWG A;  3O48 A;  3FUK A;  1UW4 B;  2P9U G;  4AJW A;  3U9W A;  3DRA A;  3PZ4 A;  4N39 A;  2R05 A;  4BX9 A;  2VQ2 A;  3I3N A;  2L6J A;  4HQD A;  4ZFH A;  4LER A;  3JUI A;  4GZ5 A;  2HO1 A;  2LAH A;  4XX5 A;  4GTM A;  3Q73 A;  1N4S A;  3TWQ A;  1TN8 A;  1PY1 A;  4Y6C A;  1TEZ A;  2J08 A;  4Z68 A;  1ELW A;  3VLE A;  4AM9 A;  2LXL A;  3L16 A;  5EIB E;  3LVR E;  3TWW A;  2V0P A;  4RG6 A;  2E2E A;  2VSO E;  5HS0 A;  3U3W A;  4FA6 A;  3E34 A;  2YHC A;  2X6I A;  2V5F A;  5AAO A;  1N4P A;  1INZ A;  2MYO A;  4GZC A;  3ASF A;  1IHB A;  3QAQ A;  3APD A;  3UT4 A;  2IFU A;  3CHO A;  4IYP A;  4L2L A;  5LP0 A;  3FUJ A;  2OND A;  4G26 A;  3ZNG A;  5M72 A;  2WB2 A;  1KPS B;  2NYJ A;  2I9C A;  3NOC D;  3V30 A;  3ZKJ A;  3QOU A;  4GPK A;  1FVH A;  2ZIS A;  1HG5 A;  2GRM A;  3L9T A;  2AVP A;  3FU6 A;  1K3Z D;  1QYM A;  3EU9 A;  3HYM B;  3APF A;  3ML8 A;  3C5R A;  2VJ8 A;  4XE0 A;  2XGM A;  2J8S D;  4F7A A;  4AIF A;  3C3Q A;  3IEG A;  4CGW A;  3UM3 A;  3L13 A;  4CDR A;  3CK9 A;  2YHE A;  4HVB A;  1K1A A;  2F8Y A;  4HI9 A;  5D0O D;  3HXE A;  3CVX A;  3FU3 A;  4J8Y A;  4BFR A;  3Q49 B;  4K5B A;  3TG5 A;  3E37 A;  4I6J A;  4BSX A;  5ENO D;  2X6J A;  4UI9 J;  1JCQ A;  5ENS D;  3CVU A;  2EIJ E;  4GU5 A;  2QFC A;  2MHK A;  2M63 A;  3ZIM A;  5FIN A;  4AXH A;  4LNB A;  1O1T A;  1ELR A;  4PS7 A;  4CYM D;  2ETA A;  3SY2 A;  4XKB A;  4GA0 A;  3V2X A;  5D2M C;  1Z3Y A;  3MKQ A;  3OTN A;  3L6A A;  4RG9 A;  3E32 A;  4AY5 A;  3B7B A;  4ME2 A;  4CT4 A;  2I1K A;  4TXR A;  2I6H A;  1G3N B;  3D3M A;  1N0Q A;  4HOT A;  3FTX A;  2R17 C;  5CBN A;  3CVL A;  3FUF A;  3E30 A;  2DIW A;  3DSS A;  3G2U A;  1PC2 A;  5BV1 A;  2BKG A;  4UI9 C;  5BXU A;  2Y1L E;  4UWH A;  4B8C B;  3Q4A B;  2HE0 A;  3EHM A;  3AU4 A;  2VSX E;  4KXK B;  4YND A;  4Q94 A;  2GRL A;  2JEK A;  1YYH A;  2ZXW E;  3EJN A;  3RJV A;  5JHB A;  3AAA C;  3T9K A;  3KEA A;  3QWV A;  2VGE A;  4ANW A;  3O4Z A;  2WXL A;  1YCS B;  2QC9 A;  4HFG A;  1BU9 A;  1MHQ A;  2FUL A;  3L54 A;  3MV3 B;  4HRL A;  4V3I A;  2UY1 A;  4C0E A;  2GRO B;  2WXP A;  1TR4 A;  3FTY A;  5G55 A;  1QZ2 A;  2IOS A;  3LY8 A;  3MJW A;  5JMN D;  5DIZ A;  2KXP C;  2KM4 A;  4HOS A;  5KBA A;  1H2V C;  4NUR A;  3L17 A;  4FAD A;  3QDN A;  4PDX A;  3QNK A;  3E4B A;  3SZ7 A;  4DJA A;  5CMW A;  4APF A;  1HF8 A;  3PE3 A;  3CK8 A;  4EPZ A;  3WG7 E;  2FEZ A;  4A3V A;  3VLD A;  3FTW A;  5EN5 D;  4GYW A;  2F8X K;  1W3B A;  3ZEF A;  3IHV A;  3ZUV B;  4GAA A;  4U04 A;  4H7Y A;  4MS6 A;  4JHK A;  1N11 A;  3AS5 A;  3LPZ A;  2XS8 A;  3UX4 A;  4I17 A;  3D9K A;  1HXI A;  1U2V G;  2JAB A;  1Y8M A;  1LTX A;  3ABM E;  4JA9 A;  1EDU A;  4J8S A;  3FTU A;  1N52 A;  1SA4 A;  1TNZ A;  3LY7 A;  3VTY A;  3D9M A;  3KS2 A;  4MKT A;  1IYG A;  2H6I A;  1A17 A;  4D10 C;  2EIK E;  3RRM B;  2LUH A;  3ASO E;  1O5M A;  2XPZ A;  4PUC A;  4WUY A;  2Y4T A;  3J5P A;  5JHA A;  4QFV A;  3BUA A;  3KEZ A;  5FWQ A;  2KC7 A;  3BG0 B;  3D9J A;  3IKO B;  1Y6I A;  3PH0 C;  3V2O A;  5G05 J;  1SZ9 A;  2WQ7 A;  3G2V A;  5T4Y A;  1TNU A;  2DYS E;  1BI7 B;  3SFY A;  1ZBP A;  4E85 A;  3VTX A;  3MGB A;  3QKY A;  3ZXS A;  2VTB A;  3DXM G;  5A6C A;  2Y0B G;  1SA5 A;  3FP3 A;  1NL4 A;  5ENP D;  4EZK A;  2P58 C;  3PNL B;  1TJC A;  2HR2 A;  5EIL A;  4DX7 D;  2R59 A;  4GB9 A;  1IHG A;  5KNG A;  5BPP A;  3B7T A;  3R7R A;  3URZ A;  3HVE B;  3VLF A;  1HH8 A;  4L1B A;  4OVU A;  2C0M A;  2WXR A;  3CVP A;  4JZY A;  4CZ2 D;  3NZU A;  3WXX A;  2WMN A;  4HB5 A;  2J49 A;  3DSX A;  1TNO A;  3TGO A;  5AYW D;  1SVX A;  4GZD A;  2AXU A;  2C2L A;  2PM7 A;  3Q7A A;  2P9S G;  4A55 A;  5AAR A;  5JJT A;  2J09 A;  4UWF A;  3HHM A;  5KWD A;  4HRM B;  5AIJ A;  3TXM A;  5BUZ A;  3SBT B;  2WQ6 A;  3DSV A;  3HRA A;  2FO1 E;  3U64 A;  3UI2 A;  5B3S E;  5JJ6 A;  3MYV A;  2WXK A;  2CFU A;  3PS6 A;  4I43 A;  4LEU A;  3QWP A;  3FEX A;  3ASH A;  4F1P A;  4HBD A;  2WXJ A;  4EZJ A;  5G04 J;  5DBK A;  1BD8 A;  4KVM A;  4GTP A;  4N3C A;  4LCT A;  1HU3 A;  5CEC B;  3UKU G;  4FLH A;  2XRZ A;  2KAT A;  2WQH A;  4ANU A;  2VSY A;  3J5Q B;  4MBG A;  2LXM A;  4L23 A;  2VGX B;  2XEH A;  4UI9 K;  3HVE A;  3ENE A;  4EEC A;  3GW4 A;  3ULE G;  4NRH B;  5FZS A;  2PNN A;  3PDN A;  5CCM A;  4BY6 A;  4U0Z A;  2DZO A;  4UQY A;  3TWR A;  2XS1 A;  1EF1 C;  2PL2 A;  4UWK A;  4XI0 A;  1E7U A;  4ACK A;  5ARF A;  2ZGG A;  2OVF A;  3U66 A;  2XCC A;  3RU0 A;  4HNA D;  2XGS A;  1E7V A;  4KZ0 A;  3ZYL A;  1RZ4 A;  4DX6 D;  4U8V D;  4JB8 P;  2V4H C;  3G2W A;  4HS2 A;  2H6H A;  3APC A;  3KAE A;  3P2B A;  5HI7 A;  3LJN A;  1K8K G;  4BER A;  1UG3 A;  2P9K G;  5EX0 A;  1D9S A;  1HFA A;  4ILH B;  3LKU A;  4N2Q A;  2XPI A;  1H6O A;  3UM1 A;  5HKP A;  2LAI A;  5KJL A;  1H6K A;  3NAW A;  3LDZ A;  4GTT A;  4TUU A;  1KZP A;  1N0R A;  4LSZ E;  5ANL A;  3PZ3 A;  4B93 B;  3GZ1 A;  4GYO A;  5G2N A;  3K9I A;  4DK5 A;  4N3A A;  4F6R D;  5T8I A;  2LNI A;  4C0M A;  3F6Q A;  4G8K A;  2P9L G;  4I9C A;  3PUJ A;  4HI8 A;  3OXL A;  3LYA A;  2XEE A;  2R5S A;  3ULY A;  4O6F A;  4K5C A;  1DVP A;  3DST A;  2QYJ A;  1NFI E;  3ZPJ A;  3EHQ A;  3AG1 E;  5J08 A;  1FVF A;  4QQI A;  4KMO A;  3AG3 E;  4F3V A;  4G23 A;  3L22 A;  5FQ4 A;  1BPO A;  3FHE A;  2F37 A;  2PZI A;  1YA0 A;  3L82 A;  2WXN A;  3E33 A;  3W9G A;  3KSQ A;  4EHM A;  4U0S A;  2OVB A;  3CQG B;  1DNP A;  4GTV A;  3ZGQ A;  2X38 A;  5BNW A;  3IBE A;  4LG6 A;  2I2O A;  3SHF A;  4YDE A;  5AQA A;  1OCC E;  4KBQ A;  3AG2 E;  2X6F A;  5IY5 E;  3GYZ A;  3PNT B;  1E96 B;  2CHW A;  3Q79 A;  2P9P G;  3CHP A;  4NAC A;  2A5U A;  1HS6 A;  1ZU2 A;  4Y6W A;  3OAW A;  1P5Q A;  1S63 A;  4LUN U;  1H6P A;  4B89 A;  4JW1 A;  4B0Z A;  3BU8 A;  4EQF A;  4GMR A;  4GMJ A;  3RRN B;  5FTP A;  1ZB1 A;  2KCV A;  3QB2 A;  3FUN A;  4F1S A;  3SGH A;  1TNB A;  2UWJ G;  4A3T A;  4FHK A;  3ISM C;  1GW6 A;  1H2U A;  1MQS A;  3UUX A;  1NA0 A;  4RLY A;  1O1R A;  1RW2 A;  3C98 A;  3P1U A;  4AEZ C;  3CEQ A;  2WXH A;  4BES A;  3UM0 A;  3Q5M A;  1SW6 A;  4MLP A;  3JQ1 A;  5AQB A;  4A63 B;  4GPM A;  2MRI A;  3JXJ A;  3SBS A;  3TWS A;  3MX3 A;  5BT1 A;  3TG4 A;  3LJ3 A;  3B13 A;  3FH8 A;  3TWV A;  1V54 E;  1V55 E;  4BX8 A;  3CVY A;  3LEW A;  3TWT A;  3CK7 A;  2BF0 X;  3D9H A;  2X6K A;  2FO7 A;  3AG4 E;  4I9E A;  4UQZ A;  3SF4 A;  3QC1 A;  1MX6 A;  4O60 A;  1WM5 A;  3KSL A;  3UIO C;  2RFM A;  2WXM A;  3SQV A;  3FUD A;  4URK A;  4AY6 A;  2YNQ A;  4KZC A;  2QYU A;  1QNF A;  2WMO A;  4RQI A;  1FT1 A;  3UIP C;  4TRQ A;  1EPU A;  5FQ6 A;  2V8S E;  2XZD G;  4XI9 A;  3ABL E;  3AS8 A;  3UT7 A;  1HO8 A;  2DVW A;  4HLL A;  1UJK A;  1X81 A;  4GCN A;  3I4G A;  4JHR A;  2KZT B;  1OWN A;  1N4R A;  1AP7 A;  4BET A;  4OAU C;  3B7S A;  3MZL B;  5J90 A;  3ZFW A;  2NXP A;  4JPS A;  1H2T C;  1FPP A;  1JUQ A;  3QAR A;  3I4R B;  3LS8 A;  1S0P A;  2IQC A;  3HIZ A;  5FZQ A;  3EUV A;  5LCW C;  3FUL A;  4OAV B;  3EHN A;  5D66 A;  4JHJ A;  5B1B E;  2NSZ A;  4B8A A;  1VDY A;  3ML9 A;  3OXG A;  3DSU A;  2IO2 C;  3TWU A;  4U8H A;  4K5A B;  4DUI A;  4TXQ A;  3FTV A;  2H6F A;  3PUK A;  3JUE A;  2H6G A;  3FY4 A;  1O1S A;  2IF4 A;  5KNH D;  3LVQ E;  2GRQ B;  4CDM A;  1OWL A;  4U07 A;  3CKC A;  3UTM A;  4GML A;  2OEV A;  4I2W A;  3G2T A;  3CVN A;  4WWN A;  3FUE A;  1E8X A;  3U4T A;  2Y3A A;  2PQR A;  4MRU A;  2ETB A;  2F0Y A;  3BEE A;  1WAO 1;  3DEP A;  3CVW A;  4IRU A;  4WNE A;  1OWO A;  4U7E B;  1UN9 A;  2AJA A;  4W9R A;  4H7X A;  4WWO A;  2ILR A;  3TWX A;  3RO3 A;  3ZYK A;  3DXK G;  1HX8 A;  4YDO A;  4XIF A;  1OWP A;  3CST A;  4G8L A;  4HRN A;  2L9B A;  3RAU A;  5LFA A;  2GRR B;  3ONK A;  3SO8 A;  4ATZ D;  5CRV A;  4GYY A;  2ZU6 B;  1TN6 A;  2OOE A;  2Q7F A;  5FQ8 A;  2J4B A;  3PZ2 A;  5KJM A;  3UT8 A;  5AJD A;  4HOR A;  4CCA A;  3PE4 A;  2DYR E;  1H19 A;  4JEH A;  2AXV A;  3PRE A;  4PH4 B;  4R7L A;  3FH5 A;  4WWP A;  3ESL A;  3B95 A;  5CRU A;  3PRZ A;  3Q78 A;  2AXZ A;  3NBN B;  4RVB A;  2JLB A;  4GTR A;  4WNG A;  5AQ7 A;  4U8Y D;  1E8Z A;  3Q7F A;  5BW8 C;  3R7Q A;  1XNF A;  2P9N G;  3B7R L;  1JWF A;  1NZN A;  5JJ7 A;  3AU5 A;  4YDY A;  4PS3 A;  3AS4 A;  3B7U X;  5FIO A;  3QJZ A;  3CV0 A;  3FUH A;  4ABN A;  1OCR E;  3NQP A;  5T3R A;  3QK0 A;  1LD7 A;  3TJP A;  3BQO A;  4JEU A;  4DX5 D;  2V4L A;  4GZ3 A;  3FU0 A;  5CMY A;  1MYO A;  2FBN A;  4GZ6 A;  1E90 A;  3ZU7 B;  2Y4U A;  3L08 A;  4WND A;  5AEN A;  4M7C A;  1WDY A;  2WPV A;  4YDW A;  4FP7 A;  2R2L A;  3ABK E;  3DPD A;  5EID A;  3HXD A;  1N95 A;  5CEA A;  3MEK A;  5D0Q D;  4OVV A;  2XPY A;  3ZRH A;  2DBA A;  3FDH A;  3FUM A;  4BWR A;  2BUG A;  2IOL A;  1LF8 A;  1JCS A;  5FQ7 A;  1A5E A;  4OYS A;  2B6C A;  4J7W A;  5EDS A;  1IXV A;  4DPR A;  2OCC E;  1OWM A;  4E6H A;  1QBQ A;  2I1J A;  3X2Q E;  5E75 A;  2KBX A;  1D8D A;  2WVI A;  4ATG A;  3W9F A;  2J4D A;  4G25 A;  2XHE A;  2P9I G;  1U3C A;  5ENR D;  5LX8 A;  3CLJ A;  4I1A A;  5EYP F;  4G24 A;  5EX3 A;  1AWC B;  4J8E A;  5HQ8 A;  2A4Z A;  5AN8 A;  4YVO A;  4LRZ A;  2FI7 A;  3UM2 A;  4CEM A;  3SI5 A;  3TL5 A;  4TV3 A;  3RKV A;  1S64 A; 
#chains in the Genus database with same CATH homology
 4A1S A;  3GZ2 A;  4J0U A;  3C98 A;  3JYS A;  3P1U A;  2FEZ A;  5G05 C;  4AEZ C;  4A3V A;  4F53 A;  3VLD A;  3CEQ A;  3FTW A;  1XGW A;  2VGX A;  2WXH A;  4NQ0 A;  4GYW A;  1IQU A;  3NZS A;  1W3B A;  3Q5M A;  5FT9 A;  3ZEF A;  3IHV A;  4GAA A;  4MLP A;  3D9L A;  1Z6T A;  3JQ1 A;  4U04 A;  4H7Y A;  2L0T B;  2CG2 A;  3JCK C;  4MS6 A;  1OUV A;  4FC8 A;  4JHK A;  2MRI A;  3AS5 A;  2WXO A;  3LPZ A;  2WXF A;  3CVQ A;  3S7B A;  3UX4 A;  1UN8 A;  3SBS A;  2XRY A;  2LSV A;  3MX3 A;  5BT1 A;  1HG2 A;  2GW1 A;  2PQN A;  4GA1 A;  3D9K A;  4I17 A;  3TG4 A;  1HXI A;  3B13 A;  3LJ3 A;  3FH8 A;  1JPL A;  2XEV A;  4P29 A;  1Y8M A;  3ZVV A;  2X3M A;  3CHR A;  4UWL A;  3QWW A;  1FCH A;  3T5X A;  1IQR A;  2AWI A;  4BX8 A;  3CVY A;  2CG3 A;  3LEW A;  4FJY A;  4JA9 A;  4ILG A;  3CK7 A;  4J6I A;  1EDU A;  4J8S A;  5FJY A;  3FTU A;  3FFL A;  3DBS A;  2BF0 X;  5BV0 A;  3LY9 A;  1NA3 A;  4ILI A;  2X6K A;  1N52 A;  4I6E A;  4U63 A;  3CVV A;  3LY7 A;  2FO7 A;  3OXF A;  4I9E A;  3VTY A;  3D9M A;  3KS2 A;  3MV2 B;  4MKT A;  4UQZ A;  4CDN A;  5KJK A;  4FHJ A;  1IYG A;  4WAF A;  3SF4 A;  3QC1 A;  2LSU A;  1A17 A;  4D10 C;  1WM5 A;  3RRM B;  3Q47 B;  1HZ4 A;  2WXM A;  3FUD A;  4URK A;  2MOW A;  4B94 A;  4WNF A;  4CRW A;  4AY6 A;  2J07 A;  2HYZ A;  2XPZ A;  2YNQ A;  4PUC A;  4WUY A;  4KZC A;  2Y4T A;  4N3B A;  3CHM A;  5JHA A;  4QFV A;  3CSF A;  3KEZ A;  3ONL A;  3ZYQ A;  5FWQ A;  2KC7 A;  3BG0 B;  2X6H A;  3D9J A;  3ASG A;  3IKO B;  1Y6I A;  3PH0 C;  2BTD A;  5G05 J;  3ESK A;  1SZ9 A;  1QNF A;  2WMO A;  2WQ7 A;  3G2V A;  3SD5 A;  3MKQ B;  5T4Y A;  2PM6 A;  2RG8 A;  2OV8 A;  4TRQ A;  1EPU A;  3IHY A;  5FQ6 A;  1WY6 A;  1KT1 A;  2V8S E;  4XI9 A;  2GGF A;  4JA7 A;  1ZBP A;  3AS8 A;  3SFZ A;  3RIB A;  4E85 A;  3UT7 A;  3RRU A;  4K0R A;  1HO8 A;  2CHZ A;  4J8D A;  3VTX A;  2NC9 A;  3MGB A;  4DLO A;  1UJK A;  3PEU B;  3QKY A;  4KVO A;  4GCN A;  4A1G A;  3I4G A;  4ANV A;  4JHR A;  3G2S A;  2KZT B;  3ZXS A;  2VTB A;  1OWN A;  4BT9 A;  5A6C A;  4I1O B;  1Z3X A;  3FP3 A;  3FTS A;  3B7S A;  5ENN A;  4EZK A;  3MZL B;  4YVQ C;  3RO2 A;  2P58 C;  5J90 A;  3PNL B;  1TJC A;  3ZFW A;  2NXP A;  2HR2 A;  4IN3 B;  4JPS A;  4KT6 B;  3CHQ A;  3NF1 A;  4Q96 A;  4FU3 A;  2HM8 A;  4HLE A;  1H2T C;  2R59 A;  4GB9 A;  4I1M A;  1IHG A;  4JVS A;  5BPP A;  5G04 C;  3B7T A;  3R7R A;  3URZ A;  2EQX A;  1JUQ A;  4UQX A;  4BTB A;  3HVE B;  3QAR A;  4HOQ A;  3I4R B;  3D9P A;  3FWV A;  3Q15 A;  5CHE E;  3VLF A;  3LS8 A;  1HH8 A;  1S0P A;  2IQC A;  4FUL A;  4L1B A;  4OVU A;  3HIZ A;  5A23 A;  2WXI A;  2C0M A;  5FZQ A;  3D9I A;  1JWG A;  3O48 A;  2WXR A;  3FUK A;  5LCW C;  1UW4 B;  4AOF A;  4AJW A;  3U9W A;  2XGO A;  3FUL A;  3CVP A;  3T8M A;  4JZY A;  3EHN A;  4JHJ A;  3GZS A;  3NZU A;  3KD7 A;  2NSZ A;  4N39 A;  3WXX A;  1VDY A;  3ML9 A;  3OXG A;  4B8A A;  5KJN A;  2WMN A;  4BX9 A;  2J49 A;  2VQ2 A;  3I3N A;  5EKQ D;  1EYH A;  2L6J A;  3TGO A;  5AYW D;  4APO A;  4LER A;  3FU5 A;  4GZD A;  3JUI A;  4GZ5 A;  2HO1 A;  2LAH A;  2AXU A;  4U8H A;  4XX5 A;  2C2L A;  1X5B A;  3CR3 A;  4BTA A;  2PM7 A;  1PY1 A;  3MA5 A;  4Y6C A;  1TEZ A;  2J08 A;  3FTV A;  4A55 A;  5JJT A;  2J09 A;  4UWF A;  3HHM A;  2UY1 B;  5AIJ A;  3PUK A;  3S2A A;  3FY4 A;  3TXM A;  5BUZ A;  3SBT B;  1ELW A;  2WQ6 A;  2XCB A;  4J8F A;  3VLE A;  4AM9 A;  2IF4 A;  3L16 A;  3IV0 A;  3LVQ E;  5E76 A;  1KT0 A;  4CDM A;  3EIJ A;  3FUI A;  3U64 A;  1OWL A;  3LVR E;  4U07 A;  3CKC A;  1KLX A;  2V0P A;  4GML A;  4RG6 A;  4I2W A;  3SNX A;  2E2E A;  2VSO E;  3G2T A;  3U3W A;  5JJ6 A;  4FA6 A;  3S7F A;  3S7J A;  3CVN A;  4WWN A;  3MYV A;  2WXK A;  3FUE A;  3N71 A;  2YHC A;  1E8X A;  2CFU A;  3PS6 A;  2X6I A;  4I43 A;  4LEU A;  3U4T A;  3QWP A;  2Y3A A;  2PQR A;  3FEX A;  1H0A A;  3ASH A;  2V5F A;  2AW6 A;  4MRU A;  2WXJ A;  4EZJ A;  1INZ A;  4GZC A;  5G04 J;  3ASF A;  5DBK A;  2KCL A;  3QAQ A;  4HXI A;  4ACL A;  3APD A;  3BEE A;  4KVM A;  3UPV A;  4N3C A;  4BT8 A;  1WAO 1;  4LCT A;  1HU3 A;  3UT4 A;  1QQE A;  2VYI A;  3CVW A;  2IFU A;  3CHO A;  4IYP A;  4IRU A;  4L2L A;  4EZL A;  4L7T A;  4WNE A;  1OWO A;  4FLH A;  5LCW J;  2XRZ A;  1UN9 A;  2KAT A;  2WQH A;  5LP0 A;  4W9R A;  4H7X A;  4ANU A;  4WWO A;  3HDX A;  2ILR A;  2VSY A;  4DI3 A;  3RO3 A;  3FUJ A;  2OND A;  4G26 A;  3ZYK A;  1UJJ A;  5M72 A;  2WB2 A;  1SQM A;  2I9C A;  1HX8 A;  4L23 A;  2VGX B;  4XIF A;  1OWP A;  4JL0 A;  4UI9 K;  3HVE A;  3CST A;  3ENE A;  4EEC A;  3GW4 A;  4JC8 A;  3QOU A;  4GPK A;  2CHX A;  1FVH A;  2FF4 A;  4NRH B;  2L9B A;  4C9B B;  1E8Y A;  5FZS A;  4U0U A;  1HG5 A;  2GRM A;  3PDN A;  5CCM A;  5LFA A;  4BY6 A;  2CFZ A;  2KCK A;  4U0Z A;  3ULQ A;  2IJG X;  3ONK A;  3CQC B;  4UQY A;  2AVP A;  3FU6 A;  4GYY A;  3HYM B;  3APF A;  4N5C A;  1EF1 C;  2ZU6 B;  3ML8 A;  2PL2 A;  2VJ8 A;  4UWK A;  4XE0 A;  4XI0 A;  1E7U A;  2OOE A;  4ACK A;  5ARF A;  4CGV A;  2XGM A;  2Q7F A;  4KYO B;  5FQ8 A;  2J4B A;  4F7A A;  4AIF A;  3IEG A;  2OVF A;  4CGW A;  5KJM A;  3U66 A;  2XCC A;  3UT8 A;  4GA2 A;  4K03 A;  3L13 A;  5AJD A;  3RU0 A;  1TJF A;  3PZD A;  4CDR A;  4G11 A;  5CCL A;  3CK9 A;  4HOR A;  4CCA A;  1HE8 A;  2YHE A;  3PE4 A;  4HVB A;  2XGS A;  2XQ0 A;  1E7V A;  4I6G A;  1H19 A;  5D0O D;  4KZ0 A;  1ELK A;  2VSN A;  3ZYL A;  1E8W A;  4EBA A;  4JEH A;  4G2V A;  3CVX A;  2AXV A;  3FU3 A;  1SZA A;  5ARG A;  3PRE A;  4XZ4 A;  3PVL A;  3G2W A;  3Q49 B;  4HS2 A;  4BFR A;  4PH4 B;  3TG5 A;  3APC A;  3KAE A;  4R7L A;  2LO6 A;  3P2B A;  5HI7 A;  3FH5 A;  2J9Q A;  4I6J A;  1UG3 A;  4AP2 A;  4BSX A;  4WWP A;  2X6J A;  1B89 A;  1N54 A;  3D9O A;  3CGH A;  3MKR A;  2E0I A;  3ESL A;  5EX0 A;  4UI9 J;  1HFA A;  4ILH B;  2IU1 A;  2ION A;  3D9N A;  3LKU A;  4GU5 A;  2XPI A;  5C1D A;  3PRZ A;  3CVU A;  4N2Q A;  5A7D B;  2QFC A;  2MHK A;  2AXZ A;  2YQ8 A;  2M63 A;  2LAI A;  4RVB A;  3ZIM A;  3S7D A;  5KJL A;  5AJL A;  2JLB A;  1H6K A;  4WNG A;  4AXH A;  3LDZ A;  1E8Z A;  5LOZ A;  3R9A B;  2WM9 A;  4TUU A;  5BW8 C;  3R7Q A;  1XNF A;  3B7R L;  3I5P A;  5ANL A;  1ELR A;  4PS7 A;  1JWF A;  1NZN A;  3GZ1 A;  3PEV B;  4Q69 A;  5JJ7 A;  3AU5 A;  4XKB A;  2VTB B;  4GA0 A;  4GYO A;  3TAX A;  2WXQ A;  4PS3 A;  1Z3Y A;  3AS4 A;  5G2N A;  3K9I A;  3ZHE B;  3MKQ A;  4DK5 A;  3B7U X;  3OTN A;  3BG1 B;  3L6A A;  3QJZ A;  4N3A A;  4N2S A;  3FTZ A;  4RG9 A;  4AY5 A;  3CV0 A;  4ME2 A;  4CT4 A;  5C2Y A;  3FUH A;  5T8I A;  4ABN A;  2I1K A;  2LNI A;  4C0M A;  4G1T A;  4XKC A;  3NQP A;  5T3R A;  2I6H A;  4I9C A;  3D3M A;  3QK0 A;  3PUJ A;  4L2Y A;  2YIN A;  3ZYM A;  3TJP A;  3OXL A;  2DCP A;  3LYA A;  4HOT A;  3FTX A;  2R17 C;  4JEU A;  2KZT A;  2R5S A;  3CVL A;  4O6F A;  2V4L A;  3FUF A;  4M3O A;  5FZR A;  4GZ3 A;  1DVP A;  4UWG A;  4AVX A;  2DIW A;  3FU0 A;  5CMY A;  3G2U A;  5KCM A;  3ZPJ A;  1PC2 A;  2FBN A;  5BV1 A;  4GZ6 A;  3T5V A;  4PS8 A;  5J08 A;  1FVF A;  1E90 A;  3EIQ C;  4UI9 C;  4UWH A;  3MCX A;  4B8C B;  2Y4U A;  3L08 A;  4WND A;  4KMO A;  3Q4A B;  4F3V A;  4JXT A;  5AEN A;  4G23 A;  3FH7 A;  3L22 A;  3EHM A;  5FQ4 A;  1BPO A;  2WPV A;  3AU4 A;  2VGY A;  4FP7 A;  4AV7 A;  2VSX E;  4KXK B;  3FHE A;  4YND A;  3DPD A;  1U3D A;  3EDT B;  2C0L A;  4Q94 A;  2RD0 A;  2GRL A;  2PZI A;  1YA0 A;  3RK6 A;  3MEK A;  5D0Q D;  2WXN A;  4OVV A;  2XPY A;  3ZRH A;  4FJZ A;  2JEK A;  4U0S A;  2DBA A;  3FDH A;  2OVB A;  3EJN A;  3CQG B;  3FUM A;  3LXU X;  3RJV A;  5JHB A;  1DNP A;  4BWR A;  2BUG A;  2IOL A;  4CT0 A;  3CHS A;  3FEY A;  3QWV A;  1LF8 A;  2L0I A;  3ZGQ A;  4ANW A;  3O4Z A;  2X38 A;  2WXL A;  5FQ7 A;  4DI4 A;  5BNW A;  4IUL A;  4HFG A;  3IBE A;  4OYS A;  4HOU A;  1MHQ A;  2FUL A;  3LCA A;  2I2O A;  5EDS A;  3JQ0 A;  3L54 A;  4DPR A;  3SHF A;  3MV3 B;  1OWM A;  4V3I A;  2UY1 A;  2WXG A;  4KBQ A;  4C0E A;  4E6H A;  4ANX A;  4I2Z A;  2I1J A;  2X6F A;  5E75 A;  3GYZ A;  2WXP A;  3PNT B;  4EBA G;  1E96 B;  2CHW A;  3FTY A;  1PAQ A;  5G55 A;  2WVI A;  3CHP A;  1QZ2 A;  5ANR A;  3UQ3 A;  2IOS A;  4NAC A;  2A5U A;  3ZN3 A;  4ATG A;  3TXN A;  3LY8 A;  1HS6 A;  3MJW A;  4GCO A;  2J4D A;  3ZHE A;  1ZU2 A;  4G25 A;  2XHE A;  4Y6W A;  5DIZ A;  3UMV A;  3OAW A;  2KM4 A;  1P5Q A;  4HOS A;  1H2V C;  1U3C A;  3CKB A;  4LUN U;  4B89 A;  4FLB A;  4JW1 A;  4B0Z A;  4DLQ A;  5LX8 A;  3CLJ A;  3CIA A;  4EQF A;  4NUR A;  4GMJ A;  3L17 A;  3RRN B;  4I1A A;  5FTP A;  2KCV A;  4RSY A;  4FAD A;  3QB2 A;  3QDN A;  3ASD A;  3FUN A;  4PDX A;  4G24 A;  5EX3 A;  3QNK A;  4J8E A;  4F1S A;  5HQ8 A;  2A4Z A;  3ZW3 A;  3E4B A;  3SGH A;  3SZ7 A;  4YVO A;  4DJA A;  5CMW A;  1L5J A;  4LRZ A;  2UWJ G;  2FI7 A;  4A3T A;  4FHK A;  1NP7 A;  1GW6 A;  2QY7 A;  1H2U A;  3SI5 A;  4APF A;  1HF8 A;  1MQS A;  4CEM A;  3TL5 A;  3PE3 A;  3CK8 A;  4TV3 A;  3RKV A;  3UUX A;  1NA0 A;  4EPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...