1A5EA

Solution nmr structure of tumor suppressor p16ink4a, 18 structures
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
156
structure length
156
Chain Sequence
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tumor suppressor p16INK4A: determination of solution structure and analyses of its interaction with cyclin-dependent kinase 4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Anti-oncogene
molecule keywords TUMOR SUPPRESSOR P16INK4A
total genus 26
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 1998-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1a5eA00
1AWCB 2Y0BG 3ZKJA 4DX7D 2BKGA 3J5PA 2DVWA 2HE0A 4HQDA 5ENQD 4ZFHA 2XZDG 5AN8A 3AAAC 5ENOD 5BXUA 5JA4D 5CBNA 3LJNA 5AQ9A 3JUEA 3NOCD 4NIKA 4Z68A 4K5BA 5EIDA 3TWWA 2ETAA 1IKND 4DX1A 1WG0A 2ZGDA 3EU9A 3IXEA 5ENRD 1MJ0A 4O60A 4UUCA 4HNAD 2XEHA 1N0RA 3Q9UC 3B7BA 1A5EA 3TWQA 4ZHBA 3TWRA 1YCSB 4U8YD 3JXJA 4BEPA 3D9HA 3Q9NC 2BKKB 4QFVA 2DWZA 1DC2A 2KXPC 1G3NB 3W9GA 5KNGA 2L6BA 3TWSA 4DUIA 3AJIA 3UI2A 5CERB 4K5AB 4HRNA 5EYPF 5ENSD 3JXIA 5ENPD 4GPMA 1IHBA 4YDWA 3TWVA 4HLLA 2A5EA 1BI8B 4HRMB 4J7WA 4DX2A 5AAOA 5ITZF 1QYMA 4HRLA 1OY3D 4HBDA 3W9FA 2VGEA 3T9KA 1BU9A 3SO8A 4G8KA 5JMND 2DZNA 5AQBA 3ZU7B 5AQAA 1K3ZD 2XEEA 2QYJA 1N0QA 1SW6A 1YMPA 2XENA 4U96D 4BERA 3EHQA 4F6RD 1YYHA 3T8KA 4B93B 1MX4A 5EIBE 4J8YA 4JB8P 5EYLA 4U8VD 3ZUVB 2B0OE 2JABA 2AJAA 1OT8A 3V2XA 3TWXA 5FINA 5HS0A 1K1AA 5KWDA 2MYOA 1D9SA 3EHRA 4TUMA 3TWUA 3ZNGA 5AQ7A 2KBXA 4DRXE 4F1PA 4HI8A 4BSZB 4DX6D 1IXVA 4G8LA 4GMRA 5AARA 4C48B 5ENTD 4OAVB 2QC9A 5BXOA 1MYOA 4K5CA 5HRYA 3UXGA 4DX5D 4OAUC 1N11A 5FIOA 2F8XK 2J8SD 4CYMD 2RFAA 5D66A 3DEOA 4O1OA 3V31A 3UTMA 2ETBA 4BESA 1K1BA 2PNNA 3KEAA 4QQIA 4ATZD 4LSZE 5KNHD 4RLYA 3V79K 5EN5D 5CEDB 3NOGD 3TWTA 5HKPA 4CZ2D 5CECB 2F8YA 3C5RA 3HRAA 4U95D 2XZTG 5CEAA 2DZOA 4HI9A 1MX2A 4YDYA 3V30A 4BETA 2RFMA 1NFIE 3J5QB 4N5QA 3F6QA 1BLXB 4O1PA 5CBOA 1BD8A 4HB5A 1S70B 2Y1LE 3V2OA 1SVXA 2P2CP 2FO1E 3NBNB 2ZGGA 2V5QC 1AP7A 5KBAA 1WDYA 5EILA 3HG0D 4A63B 1TR4A 1UOHA 2F37A 4LNUD 1DCQA 4LG6A 3DEPA 3B95A 2ETCA 1MX6A 2V4HC 1BI7B 2NYJA
chains in the Genus database with same CATH superfamily
3HYMB 3CVVA 3CVUA 3EHMA 4U04A 5FT9A 3SHFA 2QYUA 5JA4D 4UWGA 4YVQC 1H6OA 5LCWC 4XI0A 3Q49B 3PZ3A 4UQZA 4O60A 4G24A 3Q5MA 4JC8A 2BTDA 1FT1A 2JEKA 3UINC 3ZXSA 3NZUA 2PL2A 3QOUA 3CVQA 5ENSD 3Q78A 3TWVA 4HLLA 3MKQB 3S2AA 5ITZF 3LY7A 2DZNA 4FA6A 3ZU7B 3RKVA 3FU5A 2KCVA 1OUVA 4BERA 4GTPA 3MZLB 3T8KA 3ML8A 2WVIA 5EDSA 3DXMG 2B0OE 3V2XA 2R5SA 4JW1A 1D9SA 2WXQA 2OCCE 2H6FA 1O1RA 2EILE 4FP7A 2GRRB 3TXMA 3HXEA 4AP2A 4M3OA 1TNOA 1IQRA 5CEAA 4CDMA 3BG1B 4B8AA 3D9LA 1QNFA 3JYSA 3UX4A 2IOSA 4KZ0A 5E75A 3ZVVA 4GTMA 2ZISA 4I1AA 2I6HA 3DEPA 3G2VA 3ULQA 2VQ2A 4WNFA 4IRUA 1N4QA 3CSTA 4ZFHA 3AU5A 4FU3A 3NB2A 4JXTA 3CK8A 3ZHEB 1N4SA 4ACLA 3L82A 4K0RA 1WAO1 1IKND 4DX1A 4KT6B 3QNKA 3X2QE 3MEKA 2IOLA 1ZB1A 2CFZA 4BY6A 2L6BA 1OXJA 1E8ZA 3ONLA 3PZ2A 3TG4A 3UIPC 4FADA 3CGHA 2BEDA 3VLDA 5FQ7A 3BQOA 2X3MA 2FO7A 1NA3A 3PNLB 4ANVA 3URZA 3JUIA 3LVRE 2WXIA 4NRHB 1IQUA 1H0AA 2JLBA 4U0UA 2XCBA 3D9PA 1FPPA 4G1TA 4R7LA 3FUEA 3CQGB 3NQPA 2J8SD 3Q7AA 4LSZE 5EN5D 5FQ4A 3ZYLA 2AXUA 5FZRA 5DBKA 4MRUA 1HS6A 2V8SE 2VYIA 1QZ2A 3MGBA 2J09A 2V5QC 4FC8A 3T8MA 5C2YA 1SZ9A 4B94A 1U2VG 4UQXA 5FZQA 1VDYA 1HH8A 2NYJA 2DYRE 2DBAA 4CRWA 4AIFA 1JWFA 4EECA 1TJFA 3Q7FA 2AVPA 1HF8A 2R02A 3FUKA 2LSUA 3E34A 3Q79A 3B7SA 4J6IA 3ASFA 3VTYA 3L6AA 5CMWA 2Y69E 3S7JA 3O4ZA 2NC9A 1NL4A 3FUNA 5CERB 4WWPA 3C3RA 2VTBB 2LAHA 5CCLA 4RQIA 1E7VA 4I17A 3EHQA 3C98A 4B93B 1MX4A 3SF4A 3CVWA 3FTSA 3FEYA 4IULA 1SA5A 4GCNA 1WY6A 4HORA 2QC9A 5BXOA 3SBTB 3NZSA 2F8XK 4CYMD 4URKA 3KS2A 3KSLA 3R7QA 3KEAA 2L6JA 3ZYQA 5LCWJ 4AVXA 5CECB 5FZSA 2I9CA 2C0MA 2X6KA 2GW1A 1SQMA 2QFCA 4J8SA 1ZBPA 2R17C 2VSXE 2H6HA 2WXLA 5BPPA 5ANRA 4LG6A 4UWFA 4GAAA 4N2QA 3PEUB 3FUIA 2I2OA 3TXNA 2LUHA 1X5BA 2WMOA 2GRLA 3G2TA 3OXFA 1LF8A 4I1MA 1KZPA 2IO3C 1WG0A 3PH0C 4GYWA 3PUJA 4NURA 5G04C 2P9PG 3D9HA 1MHQA 4FHKA 2FBNA 1PY1A 3JXIA 2XGOA 1IHBA 2OEWA 4GTQA 4A3TA 3ASDA 3P2BA 3FTZA 1OY3D 1K3ZD 2LXMA 3T5XA 1MZCA 4GCOA 3LXUX 4GZCA 4HI8A 4RG9A 3OAWA 1MYOA 3CIAA 4LUNU 5FJYA 2ZXWE 2GRQB 3RSEG 3FUJA 4G23A 2CG3A 4ILIA 3CKCA 2GROB 2WMNA 4APFA 2Q7FA 1WDYA 4L23A 2Y4UA 5BUZA 5FQ6A 1ELKA 3TL5A 4U0SA 4GZ5A 2Y0BG 1UJKA 2ZU6B 1D8EA 2GGFA 2OOEA 2R03A 3SZ7A 5M72A 3UM0A 5D2MC 3LJNA 3UKUG 4K5BA 5EIDA 1MJ0A 3ONKA 3SFYA 2EIKE 2NSZA 2WB2A 4DI4A 3G2UA 2VJ8A 2C0LA 3UI2A 4J8FA 2LSVA 2IONA 4LCTA 3SGHA 4ABNA 1N52A 3HDXA 1Z5SC 3PNTB 2IQCA 4PS3A 4HRLA 2PQNA 3I4RB 4HBDA 1LD8A 4L2LA 3I4GA 2R05A 2QYJA 3ZYKA 5A23A 3DSSA 3CSFA 4MBGA 4UQYA 3FUFA 4WNEA 2MHKA 4E85A 4G8LA 4OAUC 1OWNA 5FIOA 3CVYA 3ABLE 4HOSA 3FHEA 3FTWA 4P29A 2I1JA 1Z3XA 2XEVA 3OTNA 4I2ZA 2XZTG 3S7DA 2X6FA 3S7BA 3BG0B 2ZIRA 3D9MA 3Q73A 5KJLA 2YQ8A 2X38A 4KYOB 2HM8A 4I9EA 4DLQA 4LRZA 2V5FA 1UOHA 2F37A 3U3WA 1H2TC 3B95A 4B0ZA 4L9PA 3FUHA 3UM3A 1N9AA 1RZ4A 4DX7D 5AYWD 2B6CA 3I3NA 3MV3B 5B1BE 4A1SA 5AQ9A 4NIKA 4TV3A 2ETAA 2ZGDA 2UY1B 4JD2G 4WNDA 2BF0X 1OWLA 4JHRA 2BKKB 1DC2A 3VLEA 4A3VA 1KLXA 2CHZA 3Q47B 5B1AE 2VSOE 2AXVA 3SI5A 3Q4AB 4CEMA 3E32A 3PVLA 3L9TA 3FUMA 3K9IA 5G2NA 4LNBA 3TWXA 3R9AB 3GZ2A 2J9QA 4CGWA 5BNWA 5ENTD 5FTPA 2Y3AA 1FVFA 4A1GA 4HVBA 3UXGA 1KT1A 2WXGA 3CR3A 5D66A 3UT8A 3UM1A 4UI9C 3RO3A 3FH7A 2ILRA 2P58C 1MX2A 3V30A 4W9RA 1N4RA 2NXPA 4RSYA 4BETA 5CBOA 2HR2A 4JA7A 4U7EB 3MYVA 4ANXA 3NBNB 5AJDA 3QARA 2E0IA 5G05C 1JWGA 2RD0A 4OYSA 4L2YA 2UY1A 3FU0A 1EDUA 1OWPA 2V4LA 4L1BA 3ZIMA 2HYZA 3HXCA 3UM2A 2PM7A 2XZDG 4ACKA 3TGOA 2KCLA 3FU6A 1OCOE 4ZHBA 2R2LA 3SD5A 3ESLA 2WXKA 5CCMA 1FT2A 3RU0A 4XKCA 4YDWA 3E33A 1HXIA 3ZN3A 3KD7A 4Q96A 3CLJA 2HO1A 4L7TA 3LY9A 2XEEA 3PDNA 3KAEA 2OVBA 3EU5A 2DCPA 3FDHA 1LTXA 3LVQE 4G26A 3D9KA 3ZPJA 5CMYA 4WAFA 3Q75A 4GMJA 3EHRA 4TUMA 2M63A 4UWHA 1YA0A 3APFA 5BV1A 1K1BA 2PNNA 4F1SA 3IBEA 4YNDA 3R7RA 3D9NA 1E7UA 4GA0A 4KBQA 4I6JA 4K03A 2LO6A 4XKBA 5BW8C 4H7XA 3CVLA 3ABME 3ZEFA 1NI1A 1H6KA 4FJZA 4NACA 1BPOA 3N71A 3OXLA 3EIJA 5LP0A 4EBAG 2H6IA 3QAQA 2XHEA 4BTBA 5HI7A 3HHMA 4A55A 4MKTA 3IKOB 1HU3A 2I1KA 4ME2A 4YDOA 3RK6A 2AW6A 3P1UA 3EU9A 5EX0A 4KVOA 5ANLA 4HNAD 3EJNA 2KCKA 3ZGQA 2MOWA 1S63A 1O1SA 5EYPF 5ENPD 3B7RL 4X8QA 5EX3A 3SBSA 5BT1A 4GTOA 1YYHA 3VLFA 4JB8P 1N4PA 2WXRA 1JUQA 2FULA 3SQVA 2BUGA 1UN9A 4GYYA 3CEQA 4HOUA 4G25A 4DJAA 2WQHA 3ULYA 4BTAA 4FLHA 3DSWA 3C3QA 3E37A 3AG4E 3C3OA 3CVPA 1O1TA 4O1OA 5CRUA 1H2VC 1KT0A 1E8XA 1GW6A 3DSXA 2CHXA 1O5MA 2F8YA 3HRAA 3FTUA 4YDYA 4N3BA 1BLXB 5ARGA 1OCZE 2YHEA 4BX9A 4UWLA 3ENEA 4AXHA 3HG0D 2CG2A 3PZ1A 4JHKA 1X81A 1DVPA 3B7UX 4N3CA 4EZJA 1E8YA 1ZU2A 4I9CA 3QB2A 3U4TA 4AM9A 1U3CA 2WXFA 1N94A 1L5JA 1HE8A 5KJKA 3L22A 3TWRA 3MX3A 4F3VA 3CHMA 3D9IA 2KXPC 3BUAA 1TNYA 1INZA 4YVOA 3ZYMA 3Q15A 2GRNB 1EF1C 5AAOA 3T9KA 4G8KA 1JCQA 5T3RA 3C72A 1N0QA 1YMPA 3UIOC 2WQ6A 1HG2A 2IEJA 4WWNA 4U8VD 4N2SA 3U66A 1DNPA 5KJMA 4F1PA 3DPYA 5AARA 4AOFA 5B3SE 3UTMA 4XIFA 4JPSA 2H6GA 4XI9A 3UPVA 4U95D 2LAIA 4GTRA 5J08A 2DZOA 3FTXA 1HZ4A 4G11A 1AP7A 3ASHA 3QWWA 4C0EA 2F0YA 1W3BA 1KZOA 1MX6A 1BI7B 4ATZD 1AWCB 4U8HA 2XGMA 3NAWA 2FEZA 2KZTA 4EPZA 1TJCA 3DSVA 2YHCA 2CHWA 3I5PA 1IYGA 2KATA 3E4BA 3B7BA 1DCEA 4BT8A 1YCSB 3RRUA 4TUUA 3MKRA 5KNGA 3TWSA 1NA0A 3WXXA 3SFZA 3LYAA 4K5AB 2XPZA 3LJ3A 5JJ7A 1OCCE 4XZ4A 4DX2A 2WXHA 4FULA 4TRQA 3SO8A 4I1OB 2MRIA 3L17A 3IV0A 4LERA 3UUXA 3FWVA 3T5VA 5EYLA 2J07A 2Y4TA 2JABA 4JL0A 5HS0A 4GB9A 3EIQC 3FFLA 5AQ7A 4ANWA 3MA5A 3CQCB 3EHNA 2J4BA 4BWRA 4OAVB 2P9SG 4OVVA 3FTVA 1H6PA 3CHQA 4I6EA 1Z6TA 1FVHA 3CK9A 5KJNA 4O1PA 3LDZA 3ZW3A 3TAXA 1SVXA 2XS1A 3KSQA 4D10C 3AG2E 5A6CA 1DCQA 1LD7A 2ETBA 4BESA 1ELRA 3PE3A 3TJPA 3RRMB 4AY5A 2J08A 3L13A 4Q94A 1P5QA 2LNIA 3QJZA 1TN6A 4AY6A 3JUEA 5JJTA 4HFGA 3L54A 3DSUA 2GRPB 3FY4A 5AENA 4JHJA 2J49A 4PH4B 4BEPA 2P9NG 3ZXPA 3RAUA 4ILHB 3ABKE 4U07A 4F7AA 2DYSE 3RRNB 5T4YA 2P9KG 3DSTA 5JHAA 3ZRHA 1HG5A 4E6HA 2VSNA 1SW6A 1QBQA 4J0UA 2IY0C 4MS6A 1S64A 2AJAA 3QDNA 3OXGA 1KPSB 4GTTA 2KM4A 3MV2B 3FH8A 2KBXA 3TG5A 4GMRA 3LKUA 1TNZA 4K5CA 4IN3B 5G55A 2PZIA 3HVEA 2CFUA 5CRVA 1TNUA 4XX5A 3LY8A 3NF1A 1UG3A 3ML9A 2EIJE 4KXKB 4XEIG 1Y6IA 3LPZA 1S70B 1FCHA 4HS2A 2IFUA 4Y6CA 3KEZA 4BFRA 3GZ1A 3JCKC 1Q2ZA 4LNUD 5D0QD 2ONDA 4FHJA 4I2WA 3PREA 2OEVA 4AEZC 3LS8A 4PS7A 1TYQG 2XPYA 4Z68A 2RKKA 3AS5A 3CKBA 3HVEB 1U3DA 2XRYA 2VGXA 3AS8A 2GRMA 1A5EA 4BX8A 2J4DA 2EQXA 3JXJA 3Q9NC 2FF4A 2DWZA 3LEWA 3MCXA 4H7YA 4U0ZA 2WXMA 4PS8A 3PS6A 2A4ZA 1XGWA 1SZAA 3HIZA 1RW2A 4ATGA 4J7WA 4JEUA 3D9JA 3W9FA 5EKQD 3QK0A 2IO2C 5AQBA 3DBSA 3BU8A 4F6RD 3CK7A 3ZUVB 2WQ7A 3ESKA 4I43A 3U9WA 2MYOA 3ZNGA 1K8KG 3MJWA 3WG7E 5ARFA 4C0MA 2IF4A 4KVMA 1N11A 1NP7A 4FLBA 5D0OD 3QKYA 4GPKA 3DEOA 4J8EA 3AG3E 2XQ0A 3NOGD 4CZ2D 2X6HA 2OV8A 4RG6A 2DIWA 3G2WA 2AWIA 1BD8A 3QC1A 3IHVA 3V2OA 2FO1E 5BV0A 2ETCA 3IEGA 2V4HC 3J5QB 4NQ0A 1E96B 3J5PA 2DVWA 2PQRA 3DXKG 4HQDA 5AN8A 3AAAC 2EIME 1H19A 4GMLA 4GU5A 1OWOA 3TWWA 2EINE 3IXEA 4UUCA 1N0RA 3QWPA 4WUYA 3DWLG 3TWQA 2VGYA 3FH5A 3APCA 4PDXA 2VGXB 4QFVA 3W9GA 1TN8A 4DUIA 2KZTB 3HXFA 4DLOA 1OCRE 4HRNA 1WM5A 2WXPA 1TN7A 4GPMA 1H2UA 1QYMA 1XNFA 3EUVA 5AQAA 1UN8A 4CGVA 3CVXA 4EZLA 3EDTB 3RIBA 1UJJA 4J8YA 4EHMA 5FWQA 3PZ4A 4N3AA 1TEZA 2WPVA 3APDA 4DRXE 2IU1A 4C48B 3ISMC 1N95A 5HRYA 4AV7A 3O48A 1E90A 4JVSA 3HXDA 2RFAA 4ANUA 4XE0A 3V79K 3TWTA 3VTXA 4BT9A 3GYZA 3C5RA 3G2SA 5JJ6A 4LEUA 3U64A 3B7TA 4N5QA 4I6GA 1B89A 2Y1LE 1V55E 1Y8MA 4DK5A 4JA9A 2VTBA 5KCMA 5J90A 4YDEA 5G04J 4IYPA 3ZKJA 5A7DB 2BKGA 4APOA 3PE4A 5BXUA 4U63A 3CHOA 3MKQA 3ASGA 4UI9J 3NOCD 4BSXA 3UQ3A 1HO8A 4JEHA 2XEHA 4N39A 4ILGA 2OVFA 3FU3A 5LOZA 5C1DA 4HOQA 3D9OA 2PM6A 3IHYA 3JQ0A 2A5EA 2WXJA 2VGEA 3AU4A 1BU9A 3UKRG 1JPLA 1PC2A 2XPIA 2QY7A 5EIBE 3FTYA 2XS8A 1OT8A 5FINA 2XCCA 3TWUA 2QZAA 4DX6D 1IXVA 3S7FA 1ELWA 4TXPA 5H7PA 4WNGA 4UI9K 3CHPA 4RLYA 4EQFA 5KNHD 3SFXA 1V54E 3CVNA 4HLEA 4WWOA 1NFIE 1TNBA 3PUKA 2FI7A 3B13A 5EILA 4LNGA 4GYOA 1EYHA 2L9BA 4Q69A 1JCSA 4AJWA 2XGSA 4N5CA 4RVBA 3FUDA 1S0PA 4GZ6A 3QWVA 2YNQA 3SY2A 2WXOA 5ENOD 1EPUA 2AXZA 2WXNA 4O6FA 3D3MA 3PEVB 5ENRD 4J8DA 1PAQA 4KMOA 4HOTA 2RG8A 3ASNE 4HXIA 4B8CB 4U8YD 2P9LG 5FQ8A 5HQ8A 4UWKA 2VSYA 3AS4A 4KZCA 1BI8B 4HRMB 3PRZA 4JZYA 4CDRA 3GW4A 5DIZA 4MLPA 4U96D 3DRAA 1QQEA 1HX8A 1MQSA 4CDNA 1K1AA 3AG1E 2WM9A 2LXLA 2P9UG 3CHSA 4CCAA 4BSZB 3CV0A 2X6JA 4DX5D 4CT4A 1IHGA 3V31A 4QQIA 1Z3YA 1HFAA 5AIJA 4HI9A 4DI3A 3JQ1A 5ENNA 2RFMA 3DPDA 4EBAA 3F6QA 4FJYA 3UT7A 2P2CP 2ZGGA 5IY5E 4GA1A 3UMVA 4M7CA 1TR4A 3FULA 1A17A 3HXBA 3CHRA 3BEEA 2HE0A 5ENQD 4V3IA 4OVUA 4GTVA 4C9BB 5CBNA 4CT0A 4G2VA 3ZHEA 5G05J 2P9IG 4GZ3A 1OWMA 4GA2A 3ASOE 5AJLA 3Q9UC 3E30A 3PZDA 3LCAA 2V0PA 2UWJG 3ULEG 3L16A 1G3NB 3R9MA 4B89A 3AJIA 4PUCA 4GTSA 1NZNA 2X6IA 5E76A 3FP3A 5LFAA 1SA4A 3SNXA 3ZFWA 4GZDA 5JMND 2XRZA 2R59A 2C2LA 4DPRA 2XENA 3RO2A 4TXQA 3L08A 5KWDA 5CHEE 5T8IA 2KC7A 4F53A 2YINA 1UW4B 1N54A 3GZSA 1D8DA 5CEDB 1E8WA 1JCRA 4EZKA 5HKPA 2L0TB 2L0IA 3FEXA 5JHBA 4HB5A 4Y6WA 2IJGX 5KBAA 4TXRA 4A63B 5LX8A 3UT4A 2E2EA 3RJVA 2A5UA
chains in the Genus database with same CATH topology
1AWCB 2Y0BG 3ZKJA 4DX7D 2BKGA 3J5PA 2DVWA 2HE0A 4HQDA 5ENQD 4ZFHA 2XZDG 5AN8A 3AAAC 5ENOD 5BXUA 5JA4D 5CBNA 3LJNA 5AQ9A 3JUEA 3NOCD 4NIKA 4Z68A 4K5BA 5EIDA 3TWWA 2ETAA 1IKND 4DX1A 1WG0A 2ZGDA 3EU9A 3IXEA 5ENRD 1MJ0A 4O60A 4UUCA 4HNAD 2XEHA 1N0RA 3Q9UC 3B7BA 1A5EA 3TWQA 4ZHBA 3TWRA 1YCSB 4U8YD 3JXJA 4BEPA 3D9HA 3Q9NC 2BKKB 4QFVA 2DWZA 1DC2A 2KXPC 1G3NB 3W9GA 5KNGA 2L6BA 3TWSA 4DUIA 3AJIA 3UI2A 5CERB 4K5AB 4HRNA 5EYPF 5ENSD 3JXIA 5ENPD 4GPMA 1IHBA 4YDWA 3TWVA 4HLLA 2A5EA 1BI8B 4HRMB 4J7WA 4DX2A 5AAOA 5ITZF 1QYMA 4HRLA 1OY3D 4HBDA 3W9FA 2VGEA 3T9KA 1BU9A 3SO8A 4G8KA 5JMND 2DZNA 5AQBA 3ZU7B 5AQAA 1K3ZD 2XEEA 2QYJA 1N0QA 1SW6A 1YMPA 2XENA 4U96D 4BERA 3EHQA 4F6RD 1YYHA 3T8KA 4B93B 1MX4A 5EIBE 4J8YA 4JB8P 5EYLA 4U8VD 3ZUVB 2B0OE 2JABA 2AJAA 1OT8A 3V2XA 3TWXA 5FINA 5HS0A 1K1AA 5KWDA 2MYOA 1D9SA 3EHRA 4TUMA 3TWUA 3ZNGA 5AQ7A 2KBXA 4DRXE 4F1PA 4HI8A 4BSZB 4DX6D 1IXVA 4G8LA 4GMRA 5AARA 4C48B 5ENTD 4OAVB 2QC9A 5BXOA 1MYOA 4K5CA 5HRYA 3UXGA 4DX5D 4OAUC 1N11A 5FIOA 2F8XK 2J8SD 4CYMD 2RFAA 5D66A 3DEOA 4O1OA 3V31A 3UTMA 2ETBA 4BESA 1K1BA 2PNNA 3KEAA 4QQIA 4ATZD 4LSZE 5KNHD 4RLYA 3V79K 5EN5D 5CEDB 3NOGD 3TWTA 5HKPA 4CZ2D 5CECB 2F8YA 3C5RA 3HRAA 4U95D 2XZTG 5CEAA 2DZOA 4HI9A 1MX2A 4YDYA 3V30A 4BETA 2RFMA 1NFIE 3J5QB 4N5QA 3F6QA 1BLXB 4O1PA 5CBOA 1BD8A 4HB5A 1S70B 2Y1LE 3V2OA 1SVXA 2P2CP 2FO1E 3NBNB 2ZGGA 2V5QC 1AP7A 5KBAA 1WDYA 5EILA 3HG0D 4A63B 1TR4A 1UOHA 2F37A 4LNUD 1DCQA 4LG6A 3DEPA 3B95A 2ETCA 1MX6A 2V4HC 1BI7B 2NYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AWC B;  2Y0B G;  3ZKJ A;  4DX7 D;  2BKG A;  3J5P A;  2DVW A;  2HE0 A;  4HQD A;  5ENQ D;  4ZFH A;  2XZD G;  5AN8 A;  3AAA C;  5ENO D;  5BXU A;  5JA4 D;  5CBN A;  3LJN A;  5AQ9 A;  3JUE A;  3NOC D;  4NIK A;  4Z68 A;  4K5B A;  5EID A;  3TWW A;  2ETA A;  1IKN D;  4DX1 A;  1WG0 A;  2ZGD A;  3EU9 A;  3IXE A;  5ENR D;  1MJ0 A;  4O60 A;  4UUC A;  4HNA D;  2XEH A;  1N0R A;  3Q9U C;  3B7B A;  1A5E A;  3TWQ A;  4ZHB A;  3TWR A;  1YCS B;  4U8Y D;  3JXJ A;  4BEP A;  3D9H A;  3Q9N C;  2BKK B;  4QFV A;  2DWZ A;  1DC2 A;  2KXP C;  1G3N B;  3W9G A;  5KNG A;  2L6B A;  3TWS A;  4DUI A;  3AJI A;  3UI2 A;  5CER B;  4K5A B;  4HRN A;  5EYP F;  5ENS D;  3JXI A;  5ENP D;  4GPM A;  1IHB A;  4YDW A;  3TWV A;  4HLL A;  2A5E A;  1BI8 B;  4HRM B;  4J7W A;  4DX2 A;  5AAO A;  5ITZ F;  1QYM A;  4HRL A;  1OY3 D;  4HBD A;  3W9F A;  2VGE A;  3T9K A;  1BU9 A;  3SO8 A;  4G8K A;  5JMN D;  2DZN A;  5AQB A;  3ZU7 B;  5AQA A;  1K3Z D;  2XEE A;  2QYJ A;  1N0Q A;  1SW6 A;  1YMP A;  2XEN A;  4U96 D;  4BER A;  3EHQ A;  4F6R D;  1YYH A;  3T8K A;  4B93 B;  1MX4 A;  5EIB E;  4J8Y A;  4JB8 P;  5EYL A;  4U8V D;  3ZUV B;  2B0O E;  2JAB A;  2AJA A;  1OT8 A;  3V2X A;  3TWX A;  5FIN A;  5HS0 A;  1K1A A;  5KWD A;  2MYO A;  1D9S A;  3EHR A;  4TUM A;  3TWU A;  3ZNG A;  5AQ7 A;  2KBX A;  4DRX E;  4F1P A;  4HI8 A;  4BSZ B;  4DX6 D;  1IXV A;  4G8L A;  4GMR A;  5AAR A;  4C48 B;  5ENT D;  4OAV B;  2QC9 A;  5BXO A;  1MYO A;  4K5C A;  5HRY A;  3UXG A;  4DX5 D;  4OAU C;  1N11 A;  5FIO A;  2F8X K;  2J8S D;  4CYM D;  2RFA A;  5D66 A;  3DEO A;  4O1O A;  3V31 A;  3UTM A;  2ETB A;  4BES A;  1K1B A;  2PNN A;  3KEA A;  4QQI A;  4ATZ D;  4LSZ E;  5KNH D;  4RLY A;  3V79 K;  5EN5 D;  5CED B;  3NOG D;  3TWT A;  5HKP A;  4CZ2 D;  5CEC B;  2F8Y A;  3C5R A;  3HRA A;  4U95 D;  2XZT G;  5CEA A;  2DZO A;  4HI9 A;  1MX2 A;  4YDY A;  3V30 A;  4BET A;  2RFM A;  1NFI E;  3J5Q B;  4N5Q A;  3F6Q A;  1BLX B;  4O1P A;  5CBO A;  1BD8 A;  4HB5 A;  1S70 B;  2Y1L E;  3V2O A;  1SVX A;  2P2C P;  2FO1 E;  3NBN B;  2ZGG A;  2V5Q C;  1AP7 A;  5KBA A;  1WDY A;  5EIL A;  3HG0 D;  4A63 B;  1TR4 A;  1UOH A;  2F37 A;  4LNU D;  1DCQ A;  4LG6 A;  3DEP A;  3B95 A;  2ETC A;  1MX6 A;  2V4H C;  1BI7 B;  2NYJ A; 
#chains in the Genus database with same CATH topology
 3HYM B;  3CVV A;  3CVU A;  3EHM A;  4U04 A;  5FT9 A;  3SHF A;  2QYU A;  5JA4 D;  4UWG A;  4YVQ C;  1H6O A;  5LCW C;  4XI0 A;  3Q49 B;  3PZ3 A;  4UQZ A;  4O60 A;  4G24 A;  3Q5M A;  4JC8 A;  2BTD A;  1FT1 A;  2JEK A;  3UIN C;  3ZXS A;  3NZU A;  2PL2 A;  3QOU A;  3CVQ A;  5ENS D;  3Q78 A;  3TWV A;  4HLL A;  3MKQ B;  3S2A A;  5ITZ F;  3LY7 A;  2DZN A;  4FA6 A;  3ZU7 B;  3RKV A;  3FU5 A;  2KCV A;  1OUV A;  4BER A;  4GTP A;  3MZL B;  3T8K A;  3ML8 A;  2WVI A;  5EDS A;  3DXM G;  2B0O E;  3V2X A;  2R5S A;  4JW1 A;  1D9S A;  2WXQ A;  2OCC E;  2H6F A;  1O1R A;  2EIL E;  4FP7 A;  2GRR B;  3TXM A;  3HXE A;  4AP2 A;  4M3O A;  1TNO A;  1IQR A;  5CEA A;  4CDM A;  3BG1 B;  4B8A A;  3D9L A;  1QNF A;  3JYS A;  3UX4 A;  2IOS A;  4KZ0 A;  5E75 A;  3ZVV A;  4GTM A;  2ZIS A;  4I1A A;  2I6H A;  3DEP A;  3G2V A;  3ULQ A;  2VQ2 A;  4WNF A;  4IRU A;  1N4Q A;  3CST A;  4ZFH A;  3AU5 A;  4FU3 A;  3NB2 A;  4JXT A;  3CK8 A;  3ZHE B;  1N4S A;  4ACL A;  3L82 A;  4K0R A;  1WAO 1;  1IKN D;  4DX1 A;  4KT6 B;  3QNK A;  3X2Q E;  3MEK A;  2IOL A;  1ZB1 A;  2CFZ A;  4BY6 A;  2L6B A;  1OXJ A;  1E8Z A;  3ONL A;  3PZ2 A;  3TG4 A;  3UIP C;  4FAD A;  3CGH A;  2BED A;  3VLD A;  5FQ7 A;  3BQO A;  2X3M A;  2FO7 A;  1NA3 A;  3PNL B;  4ANV A;  3URZ A;  3JUI A;  3LVR E;  2WXI A;  4NRH B;  1IQU A;  1H0A A;  2JLB A;  4U0U A;  2XCB A;  3D9P A;  1FPP A;  4G1T A;  4R7L A;  3FUE A;  3CQG B;  3NQP A;  2J8S D;  3Q7A A;  4LSZ E;  5EN5 D;  5FQ4 A;  3ZYL A;  2AXU A;  5FZR A;  5DBK A;  4MRU A;  1HS6 A;  2V8S E;  2VYI A;  1QZ2 A;  3MGB A;  2J09 A;  2V5Q C;  4FC8 A;  3T8M A;  5C2Y A;  1SZ9 A;  4B94 A;  1U2V G;  4UQX A;  5FZQ A;  1VDY A;  1HH8 A;  2NYJ A;  2DYR E;  2DBA A;  4CRW A;  4AIF A;  1JWF A;  4EEC A;  1TJF A;  3Q7F A;  2AVP A;  1HF8 A;  2R02 A;  3FUK A;  2LSU A;  3E34 A;  3Q79 A;  3B7S A;  4J6I A;  3ASF A;  3VTY A;  3L6A A;  5CMW A;  2Y69 E;  3S7J A;  3O4Z A;  2NC9 A;  1NL4 A;  3FUN A;  5CER B;  4WWP A;  3C3R A;  2VTB B;  2LAH A;  5CCL A;  4RQI A;  1E7V A;  4I17 A;  3EHQ A;  3C98 A;  4B93 B;  1MX4 A;  3SF4 A;  3CVW A;  3FTS A;  3FEY A;  4IUL A;  1SA5 A;  4GCN A;  1WY6 A;  4HOR A;  2QC9 A;  5BXO A;  3SBT B;  3NZS A;  2F8X K;  4CYM D;  4URK A;  3KS2 A;  3KSL A;  3R7Q A;  3KEA A;  2L6J A;  3ZYQ A;  5LCW J;  4AVX A;  5CEC B;  5FZS A;  2I9C A;  2C0M A;  2X6K A;  2GW1 A;  1SQM A;  2QFC A;  4J8S A;  1ZBP A;  2R17 C;  2VSX E;  2H6H A;  2WXL A;  5BPP A;  5ANR A;  4LG6 A;  4UWF A;  4GAA A;  4N2Q A;  3PEU B;  3FUI A;  2I2O A;  3TXN A;  2LUH A;  1X5B A;  2WMO A;  2GRL A;  3G2T A;  3OXF A;  1LF8 A;  4I1M A;  1KZP A;  2IO3 C;  1WG0 A;  3PH0 C;  4GYW A;  3PUJ A;  4NUR A;  5G04 C;  2P9P G;  3D9H A;  1MHQ A;  4FHK A;  2FBN A;  1PY1 A;  3JXI A;  2XGO A;  1IHB A;  2OEW A;  4GTQ A;  4A3T A;  3ASD A;  3P2B A;  3FTZ A;  1OY3 D;  1K3Z D;  2LXM A;  3T5X A;  1MZC A;  4GCO A;  3LXU X;  4GZC A;  4HI8 A;  4RG9 A;  3OAW A;  1MYO A;  3CIA A;  4LUN U;  5FJY A;  2ZXW E;  2GRQ B;  3RSE G;  3FUJ A;  4G23 A;  2CG3 A;  4ILI A;  3CKC A;  2GRO B;  2WMN A;  4APF A;  2Q7F A;  1WDY A;  4L23 A;  2Y4U A;  5BUZ A;  5FQ6 A;  1ELK A;  3TL5 A;  4U0S A;  4GZ5 A;  2Y0B G;  1UJK A;  2ZU6 B;  1D8E A;  2GGF A;  2OOE A;  2R03 A;  3SZ7 A;  5M72 A;  3UM0 A;  5D2M C;  3LJN A;  3UKU G;  4K5B A;  5EID A;  1MJ0 A;  3ONK A;  3SFY A;  2EIK E;  2NSZ A;  2WB2 A;  4DI4 A;  3G2U A;  2VJ8 A;  2C0L A;  3UI2 A;  4J8F A;  2LSV A;  2ION A;  4LCT A;  3SGH A;  4ABN A;  1N52 A;  3HDX A;  1Z5S C;  3PNT B;  2IQC A;  4PS3 A;  4HRL A;  2PQN A;  3I4R B;  4HBD A;  1LD8 A;  4L2L A;  3I4G A;  2R05 A;  2QYJ A;  3ZYK A;  5A23 A;  3DSS A;  3CSF A;  4MBG A;  4UQY A;  3FUF A;  4WNE A;  2MHK A;  4E85 A;  4G8L A;  4OAU C;  1OWN A;  5FIO A;  3CVY A;  3ABL E;  4HOS A;  3FHE A;  3FTW A;  4P29 A;  2I1J A;  1Z3X A;  2XEV A;  3OTN A;  4I2Z A;  2XZT G;  3S7D A;  2X6F A;  3S7B A;  3BG0 B;  2ZIR A;  3D9M A;  3Q73 A;  5KJL A;  2YQ8 A;  2X38 A;  4KYO B;  2HM8 A;  4I9E A;  4DLQ A;  4LRZ A;  2V5F A;  1UOH A;  2F37 A;  3U3W A;  1H2T C;  3B95 A;  4B0Z A;  4L9P A;  3FUH A;  3UM3 A;  1N9A A;  1RZ4 A;  4DX7 D;  5AYW D;  2B6C A;  3I3N A;  3MV3 B;  5B1B E;  4A1S A;  5AQ9 A;  4NIK A;  4TV3 A;  2ETA A;  2ZGD A;  2UY1 B;  4JD2 G;  4WND A;  2BF0 X;  1OWL A;  4JHR A;  2BKK B;  1DC2 A;  3VLE A;  4A3V A;  1KLX A;  2CHZ A;  3Q47 B;  5B1A E;  2VSO E;  2AXV A;  3SI5 A;  3Q4A B;  4CEM A;  3E32 A;  3PVL A;  3L9T A;  3FUM A;  3K9I A;  5G2N A;  4LNB A;  3TWX A;  3R9A B;  3GZ2 A;  2J9Q A;  4CGW A;  5BNW A;  5ENT D;  5FTP A;  2Y3A A;  1FVF A;  4A1G A;  4HVB A;  3UXG A;  1KT1 A;  2WXG A;  3CR3 A;  5D66 A;  3UT8 A;  3UM1 A;  4UI9 C;  3RO3 A;  3FH7 A;  2ILR A;  2P58 C;  1MX2 A;  3V30 A;  4W9R A;  1N4R A;  2NXP A;  4RSY A;  4BET A;  5CBO A;  2HR2 A;  4JA7 A;  4U7E B;  3MYV A;  4ANX A;  3NBN B;  5AJD A;  3QAR A;  2E0I A;  5G05 C;  1JWG A;  2RD0 A;  4OYS A;  4L2Y A;  2UY1 A;  3FU0 A;  1EDU A;  1OWP A;  2V4L A;  4L1B A;  3ZIM A;  2HYZ A;  3HXC A;  3UM2 A;  2PM7 A;  2XZD G;  4ACK A;  3TGO A;  2KCL A;  3FU6 A;  1OCO E;  4ZHB A;  2R2L A;  3SD5 A;  3ESL A;  2WXK A;  5CCM A;  1FT2 A;  3RU0 A;  4XKC A;  4YDW A;  3E33 A;  1HXI A;  3ZN3 A;  3KD7 A;  4Q96 A;  3CLJ A;  2HO1 A;  4L7T A;  3LY9 A;  2XEE A;  3PDN A;  3KAE A;  2OVB A;  3EU5 A;  2DCP A;  3FDH A;  1LTX A;  3LVQ E;  4G26 A;  3D9K A;  3ZPJ A;  5CMY A;  4WAF A;  3Q75 A;  4GMJ A;  3EHR A;  4TUM A;  2M63 A;  4UWH A;  1YA0 A;  3APF A;  5BV1 A;  1K1B A;  2PNN A;  4F1S A;  3IBE A;  4YND A;  3R7R A;  3D9N A;  1E7U A;  4GA0 A;  4KBQ A;  4I6J A;  4K03 A;  2LO6 A;  4XKB A;  5BW8 C;  4H7X A;  3CVL A;  3ABM E;  3ZEF A;  1NI1 A;  1H6K A;  4FJZ A;  4NAC A;  1BPO A;  3N71 A;  3OXL A;  3EIJ A;  5LP0 A;  4EBA G;  2H6I A;  3QAQ A;  2XHE A;  4BTB A;  5HI7 A;  3HHM A;  4A55 A;  4MKT A;  3IKO B;  1HU3 A;  2I1K A;  4ME2 A;  4YDO A;  3RK6 A;  2AW6 A;  3P1U A;  3EU9 A;  5EX0 A;  4KVO A;  5ANL A;  4HNA D;  3EJN A;  2KCK A;  3ZGQ A;  2MOW A;  1S63 A;  1O1S A;  5EYP F;  5ENP D;  3B7R L;  4X8Q A;  5EX3 A;  3SBS A;  5BT1 A;  4GTO A;  1YYH A;  3VLF A;  4JB8 P;  1N4P A;  2WXR A;  1JUQ A;  2FUL A;  3SQV A;  2BUG A;  1UN9 A;  4GYY A;  3CEQ A;  4HOU A;  4G25 A;  4DJA A;  2WQH A;  3ULY A;  4BTA A;  4FLH A;  3DSW A;  3C3Q A;  3E37 A;  3AG4 E;  3C3O A;  3CVP A;  1O1T A;  4O1O A;  5CRU A;  1H2V C;  1KT0 A;  1E8X A;  1GW6 A;  3DSX A;  2CHX A;  1O5M A;  2F8Y A;  3HRA A;  3FTU A;  4YDY A;  4N3B A;  1BLX B;  5ARG A;  1OCZ E;  2YHE A;  4BX9 A;  4UWL A;  3ENE A;  4AXH A;  3HG0 D;  2CG2 A;  3PZ1 A;  4JHK A;  1X81 A;  1DVP A;  3B7U X;  4N3C A;  4EZJ A;  1E8Y A;  1ZU2 A;  4I9C A;  3QB2 A;  3U4T A;  4AM9 A;  1U3C A;  2WXF A;  1N94 A;  1L5J A;  1HE8 A;  5KJK A;  3L22 A;  3TWR A;  3MX3 A;  4F3V A;  3CHM A;  3D9I A;  2KXP C;  3BUA A;  1TNY A;  1INZ A;  4YVO A;  3ZYM A;  3Q15 A;  2GRN B;  1EF1 C;  5AAO A;  3T9K A;  4G8K A;  1JCQ A;  5T3R A;  3C72 A;  1N0Q A;  1YMP A;  3UIO C;  2WQ6 A;  1HG2 A;  2IEJ A;  4WWN A;  4U8V D;  4N2S A;  3U66 A;  1DNP A;  5KJM A;  4F1P A;  3DPY A;  5AAR A;  4AOF A;  5B3S E;  3UTM A;  4XIF A;  4JPS A;  2H6G A;  4XI9 A;  3UPV A;  4U95 D;  2LAI A;  4GTR A;  5J08 A;  2DZO A;  3FTX A;  1HZ4 A;  4G11 A;  1AP7 A;  3ASH A;  3QWW A;  4C0E A;  2F0Y A;  1W3B A;  1KZO A;  1MX6 A;  1BI7 B;  4ATZ D;  1AWC B;  4U8H A;  2XGM A;  3NAW A;  2FEZ A;  2KZT A;  4EPZ A;  1TJC A;  3DSV A;  2YHC A;  2CHW A;  3I5P A;  1IYG A;  2KAT A;  3E4B A;  3B7B A;  1DCE A;  4BT8 A;  1YCS B;  3RRU A;  4TUU A;  3MKR A;  5KNG A;  3TWS A;  1NA0 A;  3WXX A;  3SFZ A;  3LYA A;  4K5A B;  2XPZ A;  3LJ3 A;  5JJ7 A;  1OCC E;  4XZ4 A;  4DX2 A;  2WXH A;  4FUL A;  4TRQ A;  3SO8 A;  4I1O B;  2MRI A;  3L17 A;  3IV0 A;  4LER A;  3UUX A;  3FWV A;  3T5V A;  5EYL A;  2J07 A;  2Y4T A;  2JAB A;  4JL0 A;  5HS0 A;  4GB9 A;  3EIQ C;  3FFL A;  5AQ7 A;  4ANW A;  3MA5 A;  3CQC B;  3EHN A;  2J4B A;  4BWR A;  4OAV B;  2P9S G;  4OVV A;  3FTV A;  1H6P A;  3CHQ A;  4I6E A;  1Z6T A;  1FVH A;  3CK9 A;  5KJN A;  4O1P A;  3LDZ A;  3ZW3 A;  3TAX A;  1SVX A;  2XS1 A;  3KSQ A;  4D10 C;  3AG2 E;  5A6C A;  1DCQ A;  1LD7 A;  2ETB A;  4BES A;  1ELR A;  3PE3 A;  3TJP A;  3RRM B;  4AY5 A;  2J08 A;  3L13 A;  4Q94 A;  1P5Q A;  2LNI A;  3QJZ A;  1TN6 A;  4AY6 A;  3JUE A;  5JJT A;  4HFG A;  3L54 A;  3DSU A;  2GRP B;  3FY4 A;  5AEN A;  4JHJ A;  2J49 A;  4PH4 B;  4BEP A;  2P9N G;  3ZXP A;  3RAU A;  4ILH B;  3ABK E;  4U07 A;  4F7A A;  2DYS E;  3RRN B;  5T4Y A;  2P9K G;  3DST A;  5JHA A;  3ZRH A;  1HG5 A;  4E6H A;  2VSN A;  1SW6 A;  1QBQ A;  4J0U A;  2IY0 C;  4MS6 A;  1S64 A;  2AJA A;  3QDN A;  3OXG A;  1KPS B;  4GTT A;  2KM4 A;  3MV2 B;  3FH8 A;  2KBX A;  3TG5 A;  4GMR A;  3LKU A;  1TNZ A;  4K5C A;  4IN3 B;  5G55 A;  2PZI A;  3HVE A;  2CFU A;  5CRV A;  1TNU A;  4XX5 A;  3LY8 A;  3NF1 A;  1UG3 A;  3ML9 A;  2EIJ E;  4KXK B;  4XEI G;  1Y6I A;  3LPZ A;  1S70 B;  1FCH A;  4HS2 A;  2IFU A;  4Y6C A;  3KEZ A;  4BFR A;  3GZ1 A;  3JCK C;  1Q2Z A;  4LNU D;  5D0Q D;  2OND A;  4FHJ A;  4I2W A;  3PRE A;  2OEV A;  4AEZ C;  3LS8 A;  4PS7 A;  1TYQ G;  2XPY A;  4Z68 A;  2RKK A;  3AS5 A;  3CKB A;  3HVE B;  1U3D A;  2XRY A;  2VGX A;  3AS8 A;  2GRM A;  1A5E A;  4BX8 A;  2J4D A;  2EQX A;  3JXJ A;  3Q9N C;  2FF4 A;  2DWZ A;  3LEW A;  3MCX A;  4H7Y A;  4U0Z A;  2WXM A;  4PS8 A;  3PS6 A;  2A4Z A;  1XGW A;  1SZA A;  3HIZ A;  1RW2 A;  4ATG A;  4J7W A;  4JEU A;  3D9J A;  3W9F A;  5EKQ D;  3QK0 A;  2IO2 C;  5AQB A;  3DBS A;  3BU8 A;  4F6R D;  3CK7 A;  3ZUV B;  2WQ7 A;  3ESK A;  4I43 A;  3U9W A;  2MYO A;  3ZNG A;  1K8K G;  3MJW A;  3WG7 E;  5ARF A;  4C0M A;  2IF4 A;  4KVM A;  1N11 A;  1NP7 A;  4FLB A;  5D0O D;  3QKY A;  4GPK A;  3DEO A;  4J8E A;  3AG3 E;  2XQ0 A;  3NOG D;  4CZ2 D;  2X6H A;  2OV8 A;  4RG6 A;  2DIW A;  3G2W A;  2AWI A;  1BD8 A;  3QC1 A;  3IHV A;  3V2O A;  2FO1 E;  5BV0 A;  2ETC A;  3IEG A;  2V4H C;  3J5Q B;  4NQ0 A;  1E96 B;  3J5P A;  2DVW A;  2PQR A;  3DXK G;  4HQD A;  5AN8 A;  3AAA C;  2EIM E;  1H19 A;  4GML A;  4GU5 A;  1OWO A;  3TWW A;  2EIN E;  3IXE A;  4UUC A;  1N0R A;  3QWP A;  4WUY A;  3DWL G;  3TWQ A;  2VGY A;  3FH5 A;  3APC A;  4PDX A;  2VGX B;  4QFV A;  3W9G A;  1TN8 A;  4DUI A;  2KZT B;  3HXF A;  4DLO A;  1OCR E;  4HRN A;  1WM5 A;  2WXP A;  1TN7 A;  4GPM A;  1H2U A;  1QYM A;  1XNF A;  3EUV A;  5AQA A;  1UN8 A;  4CGV A;  3CVX A;  4EZL A;  3EDT B;  3RIB A;  1UJJ A;  4J8Y A;  4EHM A;  5FWQ A;  3PZ4 A;  4N3A A;  1TEZ A;  2WPV A;  3APD A;  4DRX E;  2IU1 A;  4C48 B;  3ISM C;  1N95 A;  5HRY A;  4AV7 A;  3O48 A;  1E90 A;  4JVS A;  3HXD A;  2RFA A;  4ANU A;  4XE0 A;  3V79 K;  3TWT A;  3VTX A;  4BT9 A;  3GYZ A;  3C5R A;  3G2S A;  5JJ6 A;  4LEU A;  3U64 A;  3B7T A;  4N5Q A;  4I6G A;  1B89 A;  2Y1L E;  1V55 E;  1Y8M A;  4DK5 A;  4JA9 A;  2VTB A;  5KCM A;  5J90 A;  4YDE A;  5G04 J;  4IYP A;  3ZKJ A;  5A7D B;  2BKG A;  4APO A;  3PE4 A;  5BXU A;  4U63 A;  3CHO A;  3MKQ A;  3ASG A;  4UI9 J;  3NOC D;  4BSX A;  3UQ3 A;  1HO8 A;  4JEH A;  2XEH A;  4N39 A;  4ILG A;  2OVF A;  3FU3 A;  5LOZ A;  5C1D A;  4HOQ A;  3D9O A;  2PM6 A;  3IHY A;  3JQ0 A;  2A5E A;  2WXJ A;  2VGE A;  3AU4 A;  1BU9 A;  3UKR G;  1JPL A;  1PC2 A;  2XPI A;  2QY7 A;  5EIB E;  3FTY A;  2XS8 A;  1OT8 A;  5FIN A;  2XCC A;  3TWU A;  2QZA A;  4DX6 D;  1IXV A;  3S7F A;  1ELW A;  4TXP A;  5H7P A;  4WNG A;  4UI9 K;  3CHP A;  4RLY A;  4EQF A;  5KNH D;  3SFX A;  1V54 E;  3CVN A;  4HLE A;  4WWO A;  1NFI E;  1TNB A;  3PUK A;  2FI7 A;  3B13 A;  5EIL A;  4LNG A;  4GYO A;  1EYH A;  2L9B A;  4Q69 A;  1JCS A;  4AJW A;  2XGS A;  4N5C A;  4RVB A;  3FUD A;  1S0P A;  4GZ6 A;  3QWV A;  2YNQ A;  3SY2 A;  2WXO A;  5ENO D;  1EPU A;  2AXZ A;  2WXN A;  4O6F A;  3D3M A;  3PEV B;  5ENR D;  4J8D A;  1PAQ A;  4KMO A;  4HOT A;  2RG8 A;  3ASN E;  4HXI A;  4B8C B;  4U8Y D;  2P9L G;  5FQ8 A;  5HQ8 A;  4UWK A;  2VSY A;  3AS4 A;  4KZC A;  1BI8 B;  4HRM B;  3PRZ A;  4JZY A;  4CDR A;  3GW4 A;  5DIZ A;  4MLP A;  4U96 D;  3DRA A;  1QQE A;  1HX8 A;  1MQS A;  4CDN A;  1K1A A;  3AG1 E;  2WM9 A;  2LXL A;  2P9U G;  3CHS A;  4CCA A;  4BSZ B;  3CV0 A;  2X6J A;  4DX5 D;  4CT4 A;  1IHG A;  3V31 A;  4QQI A;  1Z3Y A;  1HFA A;  5AIJ A;  4HI9 A;  4DI3 A;  3JQ1 A;  5ENN A;  2RFM A;  3DPD A;  4EBA A;  3F6Q A;  4FJY A;  3UT7 A;  2P2C P;  2ZGG A;  5IY5 E;  4GA1 A;  3UMV A;  4M7C A;  1TR4 A;  3FUL A;  1A17 A;  3HXB A;  3CHR A;  3BEE A;  2HE0 A;  5ENQ D;  4V3I A;  4OVU A;  4GTV A;  4C9B B;  5CBN A;  4CT0 A;  4G2V A;  3ZHE A;  5G05 J;  2P9I G;  4GZ3 A;  1OWM A;  4GA2 A;  3ASO E;  5AJL A;  3Q9U C;  3E30 A;  3PZD A;  3LCA A;  2V0P A;  2UWJ G;  3ULE G;  3L16 A;  1G3N B;  3R9M A;  4B89 A;  3AJI A;  4PUC A;  4GTS A;  1NZN A;  2X6I A;  5E76 A;  3FP3 A;  5LFA A;  1SA4 A;  3SNX A;  3ZFW A;  4GZD A;  5JMN D;  2XRZ A;  2R59 A;  2C2L A;  4DPR A;  2XEN A;  3RO2 A;  4TXQ A;  3L08 A;  5KWD A;  5CHE E;  5T8I A;  2KC7 A;  4F53 A;  2YIN A;  1UW4 B;  1N54 A;  3GZS A;  1D8D A;  5CED B;  1E8W A;  1JCR A;  4EZK A;  5HKP A;  2L0T B;  2L0I A;  3FEX A;  5JHB A;  4HB5 A;  4Y6W A;  2IJG X;  5KBA A;  4TXR A;  4A63 B;  5LX8 A;  3UT4 A;  2E2E A;  3RJV A;  2A5U A; 
#chains in the Genus database with same CATH homology
 1AWC B;  2Y0B G;  3ZKJ A;  4DX7 D;  2BKG A;  3J5P A;  2DVW A;  2HE0 A;  4HQD A;  5ENQ D;  4ZFH A;  2XZD G;  5AN8 A;  3AAA C;  5ENO D;  5BXU A;  5JA4 D;  5CBN A;  3LJN A;  5AQ9 A;  3JUE A;  3NOC D;  4NIK A;  4Z68 A;  4K5B A;  5EID A;  3TWW A;  2ETA A;  1IKN D;  4DX1 A;  1WG0 A;  2ZGD A;  3EU9 A;  3IXE A;  5ENR D;  1MJ0 A;  4O60 A;  4UUC A;  4HNA D;  2XEH A;  1N0R A;  3Q9U C;  3B7B A;  1A5E A;  3TWQ A;  4ZHB A;  3TWR A;  1YCS B;  4U8Y D;  3JXJ A;  4BEP A;  3D9H A;  3Q9N C;  2BKK B;  4QFV A;  2DWZ A;  1DC2 A;  2KXP C;  1G3N B;  3W9G A;  5KNG A;  2L6B A;  3TWS A;  4DUI A;  3AJI A;  3UI2 A;  5CER B;  4K5A B;  4HRN A;  5EYP F;  5ENS D;  3JXI A;  5ENP D;  4GPM A;  1IHB A;  4YDW A;  3TWV A;  4HLL A;  2A5E A;  1BI8 B;  4HRM B;  4J7W A;  4DX2 A;  5AAO A;  5ITZ F;  1QYM A;  4HRL A;  1OY3 D;  4HBD A;  3W9F A;  2VGE A;  3T9K A;  1BU9 A;  3SO8 A;  4G8K A;  5JMN D;  2DZN A;  5AQB A;  3ZU7 B;  5AQA A;  1K3Z D;  2XEE A;  2QYJ A;  1N0Q A;  1SW6 A;  1YMP A;  2XEN A;  4U96 D;  4BER A;  3EHQ A;  4F6R D;  1YYH A;  3T8K A;  4B93 B;  1MX4 A;  5EIB E;  4J8Y A;  4JB8 P;  5EYL A;  4U8V D;  3ZUV B;  2B0O E;  2JAB A;  2AJA A;  1OT8 A;  3V2X A;  3TWX A;  5FIN A;  5HS0 A;  1K1A A;  5KWD A;  2MYO A;  1D9S A;  3EHR A;  4TUM A;  3TWU A;  3ZNG A;  5AQ7 A;  2KBX A;  4DRX E;  4F1P A;  4HI8 A;  4BSZ B;  4DX6 D;  1IXV A;  4G8L A;  4GMR A;  5AAR A;  4C48 B;  5ENT D;  4OAV B;  2QC9 A;  5BXO A;  1MYO A;  4K5C A;  5HRY A;  3UXG A;  4DX5 D;  4OAU C;  1N11 A;  5FIO A;  2F8X K;  2J8S D;  4CYM D;  2RFA A;  5D66 A;  3DEO A;  4O1O A;  3V31 A;  3UTM A;  2ETB A;  4BES A;  1K1B A;  2PNN A;  3KEA A;  4QQI A;  4ATZ D;  4LSZ E;  5KNH D;  4RLY A;  3V79 K;  5EN5 D;  5CED B;  3NOG D;  3TWT A;  5HKP A;  4CZ2 D;  5CEC B;  2F8Y A;  3C5R A;  3HRA A;  4U95 D;  2XZT G;  5CEA A;  2DZO A;  4HI9 A;  1MX2 A;  4YDY A;  3V30 A;  4BET A;  2RFM A;  1NFI E;  3J5Q B;  4N5Q A;  3F6Q A;  1BLX B;  4O1P A;  5CBO A;  1BD8 A;  4HB5 A;  1S70 B;  2Y1L E;  3V2O A;  1SVX A;  2P2C P;  2FO1 E;  3NBN B;  2ZGG A;  2V5Q C;  1AP7 A;  5KBA A;  1WDY A;  5EIL A;  3HG0 D;  4A63 B;  1TR4 A;  1UOH A;  2F37 A;  4LNU D;  1DCQ A;  4LG6 A;  3DEP A;  3B95 A;  2ETC A;  1MX6 A;  2V4H C;  1BI7 B;  2NYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...