1A5EA

Solution nmr structure of tumor suppressor p16ink4a, 18 structures
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
156
structure length
156
Chain Sequence
b'MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TUMOR SUPPRESSOR P16INK4A
publication title Tumor suppressor p16INK4A: determination of solution structure and analyses of its interaction with cyclin-dependent kinase 4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Anti-oncogene
total genus 26
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 1998-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1a5eA00
3J5QB 4BEPA 1G3NB 3SO8A 3DEPA 4HRLA 1IXVA 5CECB 5ENQD 3J5PA 4K5CA 1BI8B 2ETBA 4QQIA 5HS0A 4J7WA 3D9HA 1K3ZD 3JUEA 2FO1E 3EHQA 1WDYA 4O60A 3V2OA 4O1PA 3TWXA 4OAUC 5JMND 4C48B 4DX6D 5AAOA 5EIDA 4CYMD 3AJIA 3TWQA 1BU9A 2BKGA 3TWSA 4F1PA 4J8YA 4DRXE 4DUIA 1DCQA 3C5RA 1MX6A 1S70B 2KXPC 2QYJA 3TWVA 4DX5D 2AJAA 5CEAA 3V31A 2F8YA 4HLLA 5ENSD 5CBNA 1K1AA 1MX4A 5ENRD 2J8SD 5AARA 4HB5A 5FIOA 5HRYA 2Y1LE 3V2XA 5AQAA 3ZU7B 1BLXB 2QC9A 5BXOA 3LJNA 5JA4D 5AN8A 3V30A 4ATZD 4B93B 1DC2A 4U95D 1BD8A 5AQBA 3ZKJA 2RFMA 3F6QA 3B95A 4A63B 3NOCD 4GMRA 2ETAA 5KWDA 4LG6A 3AAAC 4U8VD 1YMPA 2V4HC 1K1BA 2DZNA 3W9FA 3JXIA 1SW6A 4HNAD 5AQ7A 5CEDB 1BI7B 4G8LA 1IKND 3JXJA 1YCSB 1A5EA 1D9SA 1QYMA 1N11A 1N0QA 3TWTA 3B7BA 4HI9A 4K5AB 4NIKA 5KNHD 2XEHA 5EYLA 2L6BA 1MJ0A 3EU9A 4G8KA 4U8YD 4HQDA 5ENPD 4HI8A 2MYOA 4ZHBA 3Q9UC 2ZGGA 3TWRA 5BXUA 1SVXA 3UI2A 1IHBA 2B0OE 1UOHA 2P2CP 3KEAA 4BERA 2ZGDA 2DWZA 3TWUA 4U96D 1TR4A 3UTMA 3ZUVB 2HE0A 2JABA 4Z68A 4HRNA 5EILA 2PNNA 2ETCA 3DEOA 4LSZE 2XZDG 4HBDA 2XZTG 5FINA 4ZFHA 1AWCB 1AP7A 2DZOA 4GPMA 1YYHA 4OAVB 1N0RA 4CZ2D 4JB8P 4K5BA 2DVWA 4TUMA 2V5QC 4HRMB 3IXEA 3V79K 2F8XK 4YDYA 1NFIE 4YDWA 2NYJA 3TWWA 3NBNB 2XEEA 4DX2A 3HG0D 3T9KA 1OT8A 3UXGA 4QFVA 2A5EA 5ITZF 3EHRA 2Y0BG 2RFAA 5KBAA 5ENTD 5D66A 5CERB 2VGEA 1MYOA 3T8KA 5CBOA 3NOGD 5EYPF 4F6RD 5EIBE 1OY3D 4RLYA 1MX2A 5EN5D 4BSZB 4DX1A 4BESA 2XENA 2F37A 4O1OA 5ENOD 4N5QA 5KNGA 3W9GA 4DX7D 4LNUD 3HRAA 4BETA 3Q9NC 5HKPA 5AQ9A 1WG0A 2BKKB 3ZNGA 4UUCA 2KBXA
chains in the Genus database with same CATH superfamily
4HOSA 4GZ3A 4KVOA 2R02A 3DSVA 3ZN3A 4GZDA 3CHSA 4KVMA 3BEEA 3D9HA 4J7WA 1FT1A 2DYSE 3ASOE 4JEHA 4GAAA 4OAUC 3AJIA 4GZCA 4IN3B 5JJTA 3L6AA 4I9CA 4K0RA 2NXPA 3G2SA 3FUIA 2E2EA 3PEVB 4GTVA 3I4RB 4GMRA 3DPYA 3HXDA 4WNEA 1NL4A 4WNDA 3WXXA 3Q4AB 3B7BA 4HI9A 3VLEA 4UWGA 2YNQA 4EZLA 4N2SA 3FUEA 2XEVA 1UOHA 2WM9A 4Y6CA 4PH4B 5IY5E 4U96D 4O6FA 2OCCE 2HE0A 4AM9A 2X6JA 2R03A 3HXEA 2IONA 3D9IA 5AENA 4CDMA 3KSQA 5D0QD 3CK9A 4K03A 3B7SA 1FPPA 3TWWA 4DX2A 3ZW3A 5G04C 3JQ0A 3G2TA 2OEVA 3Q47B 1ZBPA 4GTTA 2IEJA 1OWNA 4I1OB 3PUKA 3TXMA 4U04A 3PDNA 1ZB1A 3HRAA 4CCAA 4EBAA 3RJVA 2WXKA 1Y8MA 3FY4A 3PZ2A 3L22A 3URZA 2FO1E 4I9EA 4G1TA 3ZYMA 3TWXA 1UN8A 4TUUA 2XHEA 3UIPC 3PUJA 4J8YA 4G26A 3D9JA 2WB2A 3FTSA 4DX5D 2H6HA 3TJPA 4GMJA 3R7QA 2F8YA 4HOTA 3PZDA 1KT1A 3AS8A 3HVEA 3DBSA 3ABLE 5DBKA 3APCA 3F6QA 3NOCD 3CVVA 2VYIA 2PQRA 1FT2A 1BI7B 2IO2C 2GGFA 1OWMA 3DSSA 4JHJA 1EPUA 2WXFA 2MYOA 3ESLA 4ZHBA 3U66A 4C9BB 1DVPA 1XGWA 2EQXA 2P2CP 2F8XK 1AP7A 4A55A 4PS3A 3OXFA 2Y4TA 3V79K 1H2UA 4OVUA 3X2QE 3PEUB 3E37A 1S0PA 3HG0D 4KZCA 3LY9A 3RSEG 3B7RL 5KBAA 5CBOA 3QC1A 2J4BA 2J09A 5T4YA 1QBQA 2NC9A 3LJ3A 5HKPA 4C0MA 3FTXA 1G3NB 4AV7A 3ISMC 4ANVA 4FHJA 4NRHB 5HS0A 3ULEG 3AG4E 2DYRE 4ILHB 2LNIA 3LVQE 1MX6A 5FQ7A 5BW8C 4DK5A 4YVQC 3DSTA 3FHEA 2WXMA 4HOUA 4BY6A 2VGXA 2J8SD 4X8QA 4U63A 3QWWA 1NA3A 3OTNA 1BLXB 4AVXA 5JA4D 2WQHA 4FHKA 4F53A 4LCTA 4DPRA 3AS5A 1QNFA 3FEYA 4WUYA 1HH8A 1V54E 3NF1A 2VTBB 1A5EA 3HYMB 2J9QA 3UT8A 5KNHD 2L6BA 2WMNA 3EHNA 2QYUA 3PRZA 3D9NA 2B0OE 5T3RA 4U0SA 5E75A 2DWZA 2B6CA 1HS6A 1JPLA 4A1SA 3AG1E 2XZDG 4ZFHA 3CVUA 1N52A 4I43A 4HRMB 3PREA 3IHYA 1XNFA 3CK7A 2AWIA 3PH0C 2BTDA 4HFGA 3FU3A 2X6IA 2A5UA 5JJ6A 1E8ZA 2DBAA 2Y4UA 2J49A 2V4LA 3FU5A 4ATGA 4HVBA 2L9BA 4UQZA 2KBXA 4MS6A 4XX5A 1RW2A 4G25A 3MEKA 4CDRA 5ENQD 1HFAA 5CMWA 2ETBA 3QKYA 4F7AA 3IEGA 1P5QA 4DX6D 3FU6A 3SFZA 3FUDA 3E33A 3PE4A 3FUKA 4TXPA 1OWOA 1QQEA 3LCAA 4LERA 3ZYQA 2H6GA 3JQ1A 2XRZA 3ZKJA 1UJKA 2ETAA 5G05C 1YMPA 2V4HC 2PM6A 5AQ7A 4G8LA 2OOEA 2I2OA 1D9SA 4GZ5A 3EIJA 5D2MC 5ENPD 4JA7A 2IO3C 2LSVA 4B8AA 4J0UA 1IHBA 3CVXA 3KSLA 3UTMA 3D9OA 3MX3A 3AS4A 4LSZE 3NAWA 4CDNA 3MJWA 1E7VA 2V5QC 3IXEA 1NFIE 4YDWA 4CT4A 3SI5A 4AEZC 1HF8A 4GYWA 1TEZA 2BF0X 4LNGA 4GU5A 3NOGD 3CSFA 3ZXPA 3Q7FA 3W9GA 3QK0A 4ILGA 3DRAA 4F1SA 5LOZA 1SQMA 3HXBA 3QAQA 4FJYA 1PC2A 4JVSA 3TL5A 4O60A 2JLBA 4WWNA 2RG8A 2H6IA 3DWLG 4GTOA 2LO6A 1BU9A 3TXNA 1DCQA 3ULYA 4B94A 3CKBA 1WY6A 4GYOA 5ENSD 3ZIMA 1TJCA 2UY1B 2XCCA 2Y1LE 3ULQA 4I1AA 4PS8A 4EPZA 2EILE 3PZ1A 1SW6A 4HXIA 2IOLA 4XKBA 5C1DA 2LXMA 4UI9C 2IOSA 4Q96A 2FULA 3ASNE 4U8YD 3S7DA 3Q9UC 3CKCA 3KEAA 1JWGA 1LD8A 3QB2A 3QNKA 4GPMA 3ZVVA 4R7LA 3CHOA 4ACLA 4GMLA 1SA4A 5ENNA 3IHVA 4XI9A 1WAO1 1MYOA 1D8DA 3SBTB 2AVPA 1N95A 2LXLA 1HU3A 3UM3A 2EIJE 4L2LA 5KNGA 2UY1A 2XS8A 3Q7AA 2GRPB 1O1SA 4BEPA 3ML9A 1KZOA 1OUVA 1W3BA 3CQCB 1ELRA 2R5SA 4TXRA 3LPZA 3Q78A 2HO1A 3EHQA 4LRZA 1O1TA 4CYMD 4CGVA 3CHRA 2BKGA 5H7PA 3ZEFA 2Y3AA 4C0EA 4E6HA 1TNBA 4EQFA 4AXHA 2XRYA 4D10C 4LEUA 2CFUA 5FIOA 4FP7A 4IULA 5AQAA 4Q69A 1OCRE 2C0LA 2IJGX 4B93B 2WQ6A 5AQBA 2YQ8A 2XGMA 3W9FA 3PZ4A 1Y6IA 3QOUA 2OVFA 5BV1A 3JXJA 5CCLA 5B3SE 3T8MA 4TXQA 1N0QA 1S63A 4NIKA 3ASFA 1TN8A 4E85A 5ARGA 1U2VG 4HI8A 3TWRA 5JHAA 4JA9A 3O48A 4HRNA 3ENEA 3CHPA 3MZLB 5D0OD 2FO7A 1PY1A 2P9NG 3SQVA 3NBNB 4EZJA 3DXMG 5A7DB 2VGYA 3SHFA 1Z3YA 3LDZA 4ANUA 1PAQA 5BPPA 3HVEB 4Q94A 3DSWA 3Q15A 5EN5D 4I6JA 4WNFA 5ENOD 4OVVA 2KZTA 4DUIA 2M63A 2UWJG 3B7TA 3SY2A 2XS1A 5T8IA 4EECA 4PUCA 4QQIA 1K3ZD 2P58C 1N4SA 3C5RA 2KXPC 1JWFA 3LVRE 3S7JA 3FTUA 4ME2A 3CEQA 1MX4A 3RIBA 4JXTA 5HRYA 3MV3B 1Z5SC 3FH7A 1TJFA 3LJNA 1DC2A 2MHKA 2V0PA 2PQNA 2I9CA 3CGHA 4BT9A 5KWDA 3PE3A 4CEMA 1TN6A 1Q2ZA 2MRIA 2X3MA 4U07A 3G2VA 1EDUA 1MJ0A 1N9AA 2XPZA 4AP2A 4AIFA 5BNWA 3C3QA 4ABNA 1U3CA 3KAEA 3EUVA 5CRVA 5FINA 3CR3A 4MLPA 3C72A 3FDHA 1INZA 3UKRG 3T9KA 2X6FA 5CRUA 3RU0A 3RRNB 1OWPA 2VGXB 5CERB 4U0ZA 2KC7A 4F6RD 4FU3A 3MGBA 1OY3D 1MX2A 2XENA 2F37A 3MA5A 4N5QA 3LS8A 4BETA 2YHEA 3PVLA 4K5CA 4KXKB 3CQGB 3LY7A 4I2ZA 3BU8A 5CHEE 4PDXA 3V31A 4URKA 3L54A 5EX3A 4HB5A 1NZNA 4EZKA 3CVLA 3SD5A 3NZUA 3AAAC 3FU0A 3GZSA 3DPDA 3HHMA 4U8VD 2VSOE 2OV8A 1OCZE 3DSUA 3CIAA 2XQ0A 3DXKG 5LCWJ 3PS6A 4JPSA 2WXQA 2XEHA 3UT4A 3UT7A 1HO8A 3Q79A 5FQ4A 3E30A 2XZTG 4G11A 4I6EA 3CVWA 1YYHA 4CZ2D 1KT0A 3MV2B 4J8EA 4WNGA 3HXCA 1JCQA 2J07A 3FTWA 1H6PA 3N71A 2Y0BG 4APOA 4BX9A 5D66A 2VGEA 3LY8A 4BX8A 2GW1A 2WXIA 2XPIA 5G2NA 4MKTA 4BSZB 4BESA 4CGWA 4N3BA 3Q9NC 5E76A 1N94A 1WG0A 3T5XA 3ZNGA 3P1UA 1HXIA 3U3WA 2PZIA 4UQYA 3J5PA 3OXLA 3O4ZA 1A17A 2WXGA 3AU4A 1N4RA 3V2OA 4O1PA 3D9LA 3TWQA 3TWSA 3FFLA 1HG5A 3P2BA 2AJAA 3FTYA 4GPKA 5ANRA 5FWQA 5FZSA 3SFXA 2V5FA 4I1MA 2AXZA 1IQRA 4GTMA 3UX4A 3ZHEA 3D3MA 2AXUA 2YHCA 2KM4A 2WXOA 1TNYA 4KMOA 4L7TA 3C3OA 2R05A 4NURA 5AJDA 2FF4A 3CSTA 4G24A 3ABME 3WG7E 3UM2A 4YNDA 4JC8A 3EJNA 4PS7A 4CRWA 5KJKA 2LAIA 2NYJA 4V3IA 4ILIA 4DI4A 4J8SA 2A5EA 5ITZF 2DCPA 3RRUA 2BUGA 5KJLA 4O1OA 2WXRA 1E90A 2FEZA 1RZ4A 3C98A 3ABKE 1MQSA 5LFAA 4RSYA 4HRLA 3VTXA 4BTAA 1BI8B 2L6JA 3E34A 4YDEA 2A4ZA 1FCHA 3UIOC 3HIZA 3ZGQA 3BG0B 3EDTB 3FEXA 3L13A 1K1AA 5AARA 4B89A 4GYYA 1UG3A 4BWRA 5FZRA 5KCMA 5AIJA 3QWPA 4AY5A 2E0IA 4FC8A 3VLDA 3SZ7A 3R7RA 4UI9K 4JHKA 1MZCA 1S64A 1SZAA 1H2VC 2GRMA 1OCCE 3UI2A 1H19A 4WAFA 1BPOA 4GA1A 2ZGDA 3R9MA 4ACKA 3SBSA 2WMOA 5FJYA 5FTPA 4K5BA 3U9WA 2Q7FA 3FUJA 3FTVA 4BFRA 5C2YA 1OT8A 1U3DA 5KJMA 2XCBA 3SGHA 1N54A 2QZAA 1OWLA 1OCOE 3MCXA 3PZ3A 2ZXWE 4DX7D 4EHMA 4G2VA 2ZU6B 4UWLA 1SZ9A 4GA0A 3ASHA 3APFA 3DEPA 5HQ8A 4GB9A 3UM1A 3TG5A 4B8CB 1H6KA 3CLJA 3ML8A 3T5VA 2P9KG 3SFYA 5EIDA 2DIWA 3L08A 3RRMB 4DI3A 2RD0A 3JCKC 2VSNA 3CHMA 4G23A 2QC9A 2X6HA 3B95A 4A63B 1E96B 1LF8A 2WXPA 3S2AA 4J6IA 3PNTB 1FVFA 4NACA 4N39A 3K9IA 4W9RA 4YVOA 3UPVA 2PL2A 3TGOA 5BUZA 4K5AB 1E8YA 4JL0A 1FVHA 2L0IA 4GA2A 2KZTB 2P9IG 3BQOA 5BXUA 3B13A 5EDSA 4GTPA 3D9KA 3CHQA 2IFUA 4Z68A 5LP0A 2AW6A 2WXJA 4TUMA 2P9SG 2R59A 4I6GA 1X5BA 2VSXE 2GRQB 4GZ6A 3L17A 1HE8A 2EINE 1E8XA 1K8KG 2I6HA 4U8HA 3FUHA 1TYQG 3G2UA 3Q5MA 3BUAA 4FADA 4LNUD 3MKQA 4L23A 2CHWA 1QZ2A 4UUCA 3L82A 2GRLA 1SA5A 3LEWA 1LD7A 3Q73A 4H7YA 5CMYA 5AAOA 1H6OA 2P9UG 1ZU2A 2CHZA 2QFCA 4B0ZA 5CEAA 1ELWA 3EU5A 3V2XA 4MRUA 5BXOA 3V30A 3I5PA 4ATZD 4U95D 1BD8A 2RFMA 4LG6A 3UM0A 3RK6A 2DZNA 4RQIA 3DSXA 3FUFA 4FJZA 3UINC 5ARFA 1UN9A 1UW4B 2KCLA 4G8KA 3FH8A 2ZGGA 3E4BA 5B1AE 2QY7A 3ZUVB 2JABA 4GTQA 1AWCB 1B89A 1N0RA 4DJAA 3U4TA 3ZYKA 4XIFA 4YDYA 4N5CA 5J08A 4L9PA 4RVBA 4RG6A 3UXGA 4XI0A 4UQXA 1TNUA 4JEUA 2IF4A 4RLYA 4DX1A 4APFA 4BTBA 5AQ9A 3APDA 3EHMA 3SO8A 5CECB 1IXVA 1ELKA 5LCWC 3FH5A 1IHGA 1EF1C 3GW4A 1YA0A 4UWFA 5JMND 2CG3A 3TG4A 4F1PA 4WWPA 5G04J 3ONKA 3LKUA 2NSZA 2X6KA 4AJWA 5CBNA 4HORA 1LTXA 3AG2E 3L9TA 4IYPA 3B7UX 2I1KA 3RAUA 3RO3A 4Y6WA 4I2WA 2C0MA 1TNZA 4TV3A 2L0TB 1TNOA 2WXHA 5CEDB 4JW1A 3SNXA 1DCEA 3GZ1A 4GCOA 1QYMA 4AY6A 4U7EB 3JYSA 5A23A 4P29A 4H7XA 2WVIA 1JCRA 1KLXA 2IY0C 2CG2A 3NB2A 1DNPA 1TR4A 2FI7A 5EILA 2PNNA 2IU1A 4XE0A 3FULA 3OAWA 3ZFWA 5EKQD 3SF4A 2GRNB 4DLOA 5CCMA 3VLFA 3U64A 3MKRA 2V8SE 3QARA 3ASGA 2VQ2A 1N4PA 3ZHEB 4HS2A 1IYGA 3J5QB 4N2QA 5J90A 4GTRA 1N4QA 2H6FA 2CHXA 2IQCA 3JUIA 4A1GA 1HG2A 4BSXA 1S70B 2QYJA 5KJNA 5ENRD 3UKUG 1GW6A 1L5JA 2P9LG 4YDOA 3FWVA 3MYVA 4KBQA 4DLQA 2C2LA 2ONDA 3BG1B 3IKOB 1EYHA 1N11A 2OEWA 1E8WA 4OYSA 4HQDA 2HR2A 1O1RA 2Y69E 4JHRA 3RO2A 3C3RA 4BERA 2AXVA 2ETCA 3KEZA 3LYAA 3TAXA 4MBGA 2DZOA 1H2TC 2FBNA 2KCKA 2ZISA 2LUHA 5HI7A 3AG3E 2JEKA 5G55A 2XGSA 2XGOA 4QFVA 3QWVA 4JD2G 3T8KA 4KT6B 2F0YA 4N3AA 3FUNA 5EYPF 2VTBA 4XEIG 3UQ3A 3ZYLA 1D8EA 3R9AB 3ONLA 4IRUA 3E32A 3JUEA 3KS2A 2XPYA 1UJJA 1WDYA 5M72A 4C48B 4XKCA 2WXNA 4CT0A 5BV0A 4DRXE 3GZ2A 3TWVA 5A6CA 3UUXA 4HLLA 2VSYA 2LSUA 4I17A 3HDXA 4TRQA 4FLBA 4N3CA 2J4DA 3IBEA 5AN8A 4HLEA 2P9PG 1KPSB 3NZSA 4EBAG 2X38A 3ESKA 4HNAD 5JJ7A 1WM5A 3HXFA 1KZPA 2VJ8A 1NA0A 1NP7A 3S7FA 1Z6TA 3CK8A 5DIZA 2KATA 1HX8A 5EYLA 3EU9A 3QJZA 2OVBA 4J8FA 4A3VA 1SVXA 3ZRHA 5FZQA 5ANLA 2R2LA 3DEOA 4M3OA 4HBDA 2HYZA 2PM7A 3D9PA 3ZPJA 4JB8P 3D9MA 4AOFA 2J08A 4UWKA 2WXLA 3NQPA 1JUQA 4BT8A 2XEEA 5LX8A 3IV0A 4FLHA 5G05J 4M7CA 3CVYA 2YINA 3EHRA 5ENTD 3S7BA 4U0UA 1OXJA 4FULA 4L2YA 3FUMA 4UWHA 1X81A 1HZ4A 5EIBE 1TN7A 4NQ0A 3GYZA 2LAHA 1E7UA 2KCVA 5AYWD 2BEDA 2BKKB 1IQUA 3ASDA 2RKKA 4ANXA 2ILRA 3PNLB 4RG9A 3G2WA 4GTSA 3KD7A 4HOQA 1V55E 4KZ0A 3I4GA 2WQ7A 3L16A 3ZU7B 4L1BA 3Q75A 5EX0A 2ZIRA 1NI1A 3LXUX 2GROB 5FQ8A 1K1BA 3FP3A 3JXIA 3OXGA 3AU5A 2EIME 4FA6A 4GCNA 4A3TA 1IKND 2GRRB 4LUNU 1YCSB 4F3VA 3Q49B 3TWTA 5AJLA 1MHQA 3MKQB 3I3NA 2CFZA 4ANWA 5FQ6A 3CVPA 3RKVA 3TWUA 4J8DA 2WPVA 2EIKE 3CVNA 4XZ4A 4OAVB 2DVWA 2MOWA 3UMVA 1Z3XA 5BT1A 3CV0A 4LNBA 3CVQA 3VTYA 2RFAA 1O5MA 2R17C 3FTZA 4JZYA 5B1BE 3EIQC 5JHBA 4UI9J 5FT9A 3QDNA 4KYOB 2HM8A 1JCSA 2I1JA 3ZXSA 1H0AA 1VDYA 4WWOA
chains in the Genus database with same CATH topology
3J5QB 4BEPA 1G3NB 3SO8A 3DEPA 4HRLA 1IXVA 5CECB 5ENQD 3J5PA 4K5CA 1BI8B 2ETBA 4QQIA 5HS0A 4J7WA 3D9HA 1K3ZD 3JUEA 2FO1E 3EHQA 1WDYA 4O60A 3V2OA 4O1PA 3TWXA 4OAUC 5JMND 4C48B 4DX6D 5AAOA 5EIDA 4CYMD 3AJIA 3TWQA 1BU9A 2BKGA 3TWSA 4F1PA 4J8YA 4DRXE 4DUIA 1DCQA 3C5RA 1MX6A 1S70B 2KXPC 2QYJA 3TWVA 4DX5D 2AJAA 5CEAA 3V31A 2F8YA 4HLLA 5ENSD 5CBNA 1K1AA 1MX4A 5ENRD 2J8SD 5AARA 4HB5A 5FIOA 5HRYA 2Y1LE 3V2XA 5AQAA 3ZU7B 1BLXB 2QC9A 5BXOA 3LJNA 5JA4D 5AN8A 3V30A 4ATZD 4B93B 1DC2A 4U95D 1BD8A 5AQBA 3ZKJA 2RFMA 3F6QA 3B95A 4A63B 3NOCD 4GMRA 2ETAA 5KWDA 4LG6A 3AAAC 4U8VD 1YMPA 2V4HC 1K1BA 2DZNA 3W9FA 3JXIA 1SW6A 4HNAD 5AQ7A 5CEDB 1BI7B 4G8LA 1IKND 3JXJA 1YCSB 1A5EA 1D9SA 1QYMA 1N11A 1N0QA 3TWTA 3B7BA 4HI9A 4K5AB 4NIKA 5KNHD 2XEHA 5EYLA 2L6BA 1MJ0A 3EU9A 4G8KA 4U8YD 4HQDA 5ENPD 4HI8A 2MYOA 4ZHBA 3Q9UC 2ZGGA 3TWRA 5BXUA 1SVXA 3UI2A 1IHBA 2B0OE 1UOHA 2P2CP 3KEAA 4BERA 2ZGDA 2DWZA 3TWUA 4U96D 1TR4A 3UTMA 3ZUVB 2HE0A 2JABA 4Z68A 4HRNA 5EILA 2PNNA 2ETCA 3DEOA 4LSZE 2XZDG 4HBDA 2XZTG 5FINA 4ZFHA 1AWCB 1AP7A 2DZOA 4GPMA 1YYHA 4OAVB 1N0RA 4CZ2D 4JB8P 4K5BA 2DVWA 4TUMA 2V5QC 4HRMB 3IXEA 3V79K 2F8XK 4YDYA 1NFIE 4YDWA 2NYJA 3TWWA 3NBNB 2XEEA 4DX2A 3HG0D 3T9KA 1OT8A 3UXGA 4QFVA 2A5EA 5ITZF 3EHRA 2Y0BG 2RFAA 5KBAA 5ENTD 5D66A 5CERB 2VGEA 1MYOA 3T8KA 5CBOA 3NOGD 5EYPF 4F6RD 5EIBE 1OY3D 4RLYA 1MX2A 5EN5D 4BSZB 4DX1A 4BESA 2XENA 2F37A 4O1OA 5ENOD 4N5QA 5KNGA 3W9GA 4DX7D 4LNUD 3HRAA 4BETA 3Q9NC 5HKPA 5AQ9A 1WG0A 2BKKB 3ZNGA 4UUCA 2KBXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J5Q B;  4BEP A;  1G3N B;  3SO8 A;  3DEP A;  4HRL A;  1IXV A;  5CEC B;  5ENQ D;  3J5P A;  4K5C A;  1BI8 B;  2ETB A;  4QQI A;  5HS0 A;  4J7W A;  3D9H A;  1K3Z D;  3JUE A;  2FO1 E;  3EHQ A;  1WDY A;  4O60 A;  3V2O A;  4O1P A;  3TWX A;  4OAU C;  5JMN D;  4C48 B;  4DX6 D;  5AAO A;  5EID A;  4CYM D;  3AJI A;  3TWQ A;  1BU9 A;  2BKG A;  3TWS A;  4F1P A;  4J8Y A;  4DRX E;  4DUI A;  1DCQ A;  3C5R A;  1MX6 A;  1S70 B;  2KXP C;  2QYJ A;  3TWV A;  4DX5 D;  2AJA A;  5CEA A;  3V31 A;  2F8Y A;  4HLL A;  5ENS D;  5CBN A;  1K1A A;  1MX4 A;  5ENR D;  2J8S D;  5AAR A;  4HB5 A;  5FIO A;  5HRY A;  2Y1L E;  3V2X A;  5AQA A;  3ZU7 B;  1BLX B;  2QC9 A;  5BXO A;  3LJN A;  5JA4 D;  5AN8 A;  3V30 A;  4ATZ D;  4B93 B;  1DC2 A;  4U95 D;  1BD8 A;  5AQB A;  3ZKJ A;  2RFM A;  3F6Q A;  3B95 A;  4A63 B;  3NOC D;  4GMR A;  2ETA A;  5KWD A;  4LG6 A;  3AAA C;  4U8V D;  1YMP A;  2V4H C;  1K1B A;  2DZN A;  3W9F A;  3JXI A;  1SW6 A;  4HNA D;  5AQ7 A;  5CED B;  1BI7 B;  4G8L A;  1IKN D;  3JXJ A;  1YCS B;  1A5E A;  1D9S A;  1QYM A;  1N11 A;  1N0Q A;  3TWT A;  3B7B A;  4HI9 A;  4K5A B;  4NIK A;  5KNH D;  2XEH A;  5EYL A;  2L6B A;  1MJ0 A;  3EU9 A;  4G8K A;  4U8Y D;  4HQD A;  5ENP D;  4HI8 A;  2MYO A;  4ZHB A;  3Q9U C;  2ZGG A;  3TWR A;  5BXU A;  1SVX A;  3UI2 A;  1IHB A;  2B0O E;  1UOH A;  2P2C P;  3KEA A;  4BER A;  2ZGD A;  2DWZ A;  3TWU A;  4U96 D;  1TR4 A;  3UTM A;  3ZUV B;  2HE0 A;  2JAB A;  4Z68 A;  4HRN A;  5EIL A;  2PNN A;  2ETC A;  3DEO A;  4LSZ E;  2XZD G;  4HBD A;  2XZT G;  5FIN A;  4ZFH A;  1AWC B;  1AP7 A;  2DZO A;  4GPM A;  1YYH A;  4OAV B;  1N0R A;  4CZ2 D;  4JB8 P;  4K5B A;  2DVW A;  4TUM A;  2V5Q C;  4HRM B;  3IXE A;  3V79 K;  2F8X K;  4YDY A;  1NFI E;  4YDW A;  2NYJ A;  3TWW A;  3NBN B;  2XEE A;  4DX2 A;  3HG0 D;  3T9K A;  1OT8 A;  3UXG A;  4QFV A;  2A5E A;  5ITZ F;  3EHR A;  2Y0B G;  2RFA A;  5KBA A;  5ENT D;  5D66 A;  5CER B;  2VGE A;  1MYO A;  3T8K A;  5CBO A;  3NOG D;  5EYP F;  4F6R D;  5EIB E;  1OY3 D;  4RLY A;  1MX2 A;  5EN5 D;  4BSZ B;  4DX1 A;  4BES A;  2XEN A;  2F37 A;  4O1O A;  5ENO D;  4N5Q A;  5KNG A;  3W9G A;  4DX7 D;  4LNU D;  3HRA A;  4BET A;  3Q9N C;  5HKP A;  5AQ9 A;  1WG0 A;  2BKK B;  3ZNG A;  4UUC A;  2KBX A; 
#chains in the Genus database with same CATH topology
 4HOS A;  4GZ3 A;  4KVO A;  2R02 A;  3DSV A;  3ZN3 A;  4GZD A;  3CHS A;  4KVM A;  3BEE A;  3D9H A;  4J7W A;  1FT1 A;  2DYS E;  3ASO E;  4JEH A;  4GAA A;  4OAU C;  3AJI A;  4GZC A;  4IN3 B;  5JJT A;  3L6A A;  4I9C A;  4K0R A;  2NXP A;  3G2S A;  3FUI A;  2E2E A;  3PEV B;  4GTV A;  3I4R B;  4GMR A;  3DPY A;  3HXD A;  4WNE A;  1NL4 A;  4WND A;  3WXX A;  3Q4A B;  3B7B A;  4HI9 A;  3VLE A;  4UWG A;  2YNQ A;  4EZL A;  4N2S A;  3FUE A;  2XEV A;  1UOH A;  2WM9 A;  4Y6C A;  4PH4 B;  5IY5 E;  4U96 D;  4O6F A;  2OCC E;  2HE0 A;  4AM9 A;  2X6J A;  2R03 A;  3HXE A;  2ION A;  3D9I A;  5AEN A;  4CDM A;  3KSQ A;  5D0Q D;  3CK9 A;  4K03 A;  3B7S A;  1FPP A;  3TWW A;  4DX2 A;  3ZW3 A;  5G04 C;  3JQ0 A;  3G2T A;  2OEV A;  3Q47 B;  1ZBP A;  4GTT A;  2IEJ A;  1OWN A;  4I1O B;  3PUK A;  3TXM A;  4U04 A;  3PDN A;  1ZB1 A;  3HRA A;  4CCA A;  4EBA A;  3RJV A;  2WXK A;  1Y8M A;  3FY4 A;  3PZ2 A;  3L22 A;  3URZ A;  2FO1 E;  4I9E A;  4G1T A;  3ZYM A;  3TWX A;  1UN8 A;  4TUU A;  2XHE A;  3UIP C;  3PUJ A;  4J8Y A;  4G26 A;  3D9J A;  2WB2 A;  3FTS A;  4DX5 D;  2H6H A;  3TJP A;  4GMJ A;  3R7Q A;  2F8Y A;  4HOT A;  3PZD A;  1KT1 A;  3AS8 A;  3HVE A;  3DBS A;  3ABL E;  5DBK A;  3APC A;  3F6Q A;  3NOC D;  3CVV A;  2VYI A;  2PQR A;  1FT2 A;  1BI7 B;  2IO2 C;  2GGF A;  1OWM A;  3DSS A;  4JHJ A;  1EPU A;  2WXF A;  2MYO A;  3ESL A;  4ZHB A;  3U66 A;  4C9B B;  1DVP A;  1XGW A;  2EQX A;  2P2C P;  2F8X K;  1AP7 A;  4A55 A;  4PS3 A;  3OXF A;  2Y4T A;  3V79 K;  1H2U A;  4OVU A;  3X2Q E;  3PEU B;  3E37 A;  1S0P A;  3HG0 D;  4KZC A;  3LY9 A;  3RSE G;  3B7R L;  5KBA A;  5CBO A;  3QC1 A;  2J4B A;  2J09 A;  5T4Y A;  1QBQ A;  2NC9 A;  3LJ3 A;  5HKP A;  4C0M A;  3FTX A;  1G3N B;  4AV7 A;  3ISM C;  4ANV A;  4FHJ A;  4NRH B;  5HS0 A;  3ULE G;  3AG4 E;  2DYR E;  4ILH B;  2LNI A;  3LVQ E;  1MX6 A;  5FQ7 A;  5BW8 C;  4DK5 A;  4YVQ C;  3DST A;  3FHE A;  2WXM A;  4HOU A;  4BY6 A;  2VGX A;  2J8S D;  4X8Q A;  4U63 A;  3QWW A;  1NA3 A;  3OTN A;  1BLX B;  4AVX A;  5JA4 D;  2WQH A;  4FHK A;  4F53 A;  4LCT A;  4DPR A;  3AS5 A;  1QNF A;  3FEY A;  4WUY A;  1HH8 A;  1V54 E;  3NF1 A;  2VTB B;  1A5E A;  3HYM B;  2J9Q A;  3UT8 A;  5KNH D;  2L6B A;  2WMN A;  3EHN A;  2QYU A;  3PRZ A;  3D9N A;  2B0O E;  5T3R A;  4U0S A;  5E75 A;  2DWZ A;  2B6C A;  1HS6 A;  1JPL A;  4A1S A;  3AG1 E;  2XZD G;  4ZFH A;  3CVU A;  1N52 A;  4I43 A;  4HRM B;  3PRE A;  3IHY A;  1XNF A;  3CK7 A;  2AWI A;  3PH0 C;  2BTD A;  4HFG A;  3FU3 A;  2X6I A;  2A5U A;  5JJ6 A;  1E8Z A;  2DBA A;  2Y4U A;  2J49 A;  2V4L A;  3FU5 A;  4ATG A;  4HVB A;  2L9B A;  4UQZ A;  2KBX A;  4MS6 A;  4XX5 A;  1RW2 A;  4G25 A;  3MEK A;  4CDR A;  5ENQ D;  1HFA A;  5CMW A;  2ETB A;  3QKY A;  4F7A A;  3IEG A;  1P5Q A;  4DX6 D;  3FU6 A;  3SFZ A;  3FUD A;  3E33 A;  3PE4 A;  3FUK A;  4TXP A;  1OWO A;  1QQE A;  3LCA A;  4LER A;  3ZYQ A;  2H6G A;  3JQ1 A;  2XRZ A;  3ZKJ A;  1UJK A;  2ETA A;  5G05 C;  1YMP A;  2V4H C;  2PM6 A;  5AQ7 A;  4G8L A;  2OOE A;  2I2O A;  1D9S A;  4GZ5 A;  3EIJ A;  5D2M C;  5ENP D;  4JA7 A;  2IO3 C;  2LSV A;  4B8A A;  4J0U A;  1IHB A;  3CVX A;  3KSL A;  3UTM A;  3D9O A;  3MX3 A;  3AS4 A;  4LSZ E;  3NAW A;  4CDN A;  3MJW A;  1E7V A;  2V5Q C;  3IXE A;  1NFI E;  4YDW A;  4CT4 A;  3SI5 A;  4AEZ C;  1HF8 A;  4GYW A;  1TEZ A;  2BF0 X;  4LNG A;  4GU5 A;  3NOG D;  3CSF A;  3ZXP A;  3Q7F A;  3W9G A;  3QK0 A;  4ILG A;  3DRA A;  4F1S A;  5LOZ A;  1SQM A;  3HXB A;  3QAQ A;  4FJY A;  1PC2 A;  4JVS A;  3TL5 A;  4O60 A;  2JLB A;  4WWN A;  2RG8 A;  2H6I A;  3DWL G;  4GTO A;  2LO6 A;  1BU9 A;  3TXN A;  1DCQ A;  3ULY A;  4B94 A;  3CKB A;  1WY6 A;  4GYO A;  5ENS D;  3ZIM A;  1TJC A;  2UY1 B;  2XCC A;  2Y1L E;  3ULQ A;  4I1A A;  4PS8 A;  4EPZ A;  2EIL E;  3PZ1 A;  1SW6 A;  4HXI A;  2IOL A;  4XKB A;  5C1D A;  2LXM A;  4UI9 C;  2IOS A;  4Q96 A;  2FUL A;  3ASN E;  4U8Y D;  3S7D A;  3Q9U C;  3CKC A;  3KEA A;  1JWG A;  1LD8 A;  3QB2 A;  3QNK A;  4GPM A;  3ZVV A;  4R7L A;  3CHO A;  4ACL A;  4GML A;  1SA4 A;  5ENN A;  3IHV A;  4XI9 A;  1WAO 1;  1MYO A;  1D8D A;  3SBT B;  2AVP A;  1N95 A;  2LXL A;  1HU3 A;  3UM3 A;  2EIJ E;  4L2L A;  5KNG A;  2UY1 A;  2XS8 A;  3Q7A A;  2GRP B;  1O1S A;  4BEP A;  3ML9 A;  1KZO A;  1OUV A;  1W3B A;  3CQC B;  1ELR A;  2R5S A;  4TXR A;  3LPZ A;  3Q78 A;  2HO1 A;  3EHQ A;  4LRZ A;  1O1T A;  4CYM D;  4CGV A;  3CHR A;  2BKG A;  5H7P A;  3ZEF A;  2Y3A A;  4C0E A;  4E6H A;  1TNB A;  4EQF A;  4AXH A;  2XRY A;  4D10 C;  4LEU A;  2CFU A;  5FIO A;  4FP7 A;  4IUL A;  5AQA A;  4Q69 A;  1OCR E;  2C0L A;  2IJG X;  4B93 B;  2WQ6 A;  5AQB A;  2YQ8 A;  2XGM A;  3W9F A;  3PZ4 A;  1Y6I A;  3QOU A;  2OVF A;  5BV1 A;  3JXJ A;  5CCL A;  5B3S E;  3T8M A;  4TXQ A;  1N0Q A;  1S63 A;  4NIK A;  3ASF A;  1TN8 A;  4E85 A;  5ARG A;  1U2V G;  4HI8 A;  3TWR A;  5JHA A;  4JA9 A;  3O48 A;  4HRN A;  3ENE A;  3CHP A;  3MZL B;  5D0O D;  2FO7 A;  1PY1 A;  2P9N G;  3SQV A;  3NBN B;  4EZJ A;  3DXM G;  5A7D B;  2VGY A;  3SHF A;  1Z3Y A;  3LDZ A;  4ANU A;  1PAQ A;  5BPP A;  3HVE B;  4Q94 A;  3DSW A;  3Q15 A;  5EN5 D;  4I6J A;  4WNF A;  5ENO D;  4OVV A;  2KZT A;  4DUI A;  2M63 A;  2UWJ G;  3B7T A;  3SY2 A;  2XS1 A;  5T8I A;  4EEC A;  4PUC A;  4QQI A;  1K3Z D;  2P58 C;  1N4S A;  3C5R A;  2KXP C;  1JWF A;  3LVR E;  3S7J A;  3FTU A;  4ME2 A;  3CEQ A;  1MX4 A;  3RIB A;  4JXT A;  5HRY A;  3MV3 B;  1Z5S C;  3FH7 A;  1TJF A;  3LJN A;  1DC2 A;  2MHK A;  2V0P A;  2PQN A;  2I9C A;  3CGH A;  4BT9 A;  5KWD A;  3PE3 A;  4CEM A;  1TN6 A;  1Q2Z A;  2MRI A;  2X3M A;  4U07 A;  3G2V A;  1EDU A;  1MJ0 A;  1N9A A;  2XPZ A;  4AP2 A;  4AIF A;  5BNW A;  3C3Q A;  4ABN A;  1U3C A;  3KAE A;  3EUV A;  5CRV A;  5FIN A;  3CR3 A;  4MLP A;  3C72 A;  3FDH A;  1INZ A;  3UKR G;  3T9K A;  2X6F A;  5CRU A;  3RU0 A;  3RRN B;  1OWP A;  2VGX B;  5CER B;  4U0Z A;  2KC7 A;  4F6R D;  4FU3 A;  3MGB A;  1OY3 D;  1MX2 A;  2XEN A;  2F37 A;  3MA5 A;  4N5Q A;  3LS8 A;  4BET A;  2YHE A;  3PVL A;  4K5C A;  4KXK B;  3CQG B;  3LY7 A;  4I2Z A;  3BU8 A;  5CHE E;  4PDX A;  3V31 A;  4URK A;  3L54 A;  5EX3 A;  4HB5 A;  1NZN A;  4EZK A;  3CVL A;  3SD5 A;  3NZU A;  3AAA C;  3FU0 A;  3GZS A;  3DPD A;  3HHM A;  4U8V D;  2VSO E;  2OV8 A;  1OCZ E;  3DSU A;  3CIA A;  2XQ0 A;  3DXK G;  5LCW J;  3PS6 A;  4JPS A;  2WXQ A;  2XEH A;  3UT4 A;  3UT7 A;  1HO8 A;  3Q79 A;  5FQ4 A;  3E30 A;  2XZT G;  4G11 A;  4I6E A;  3CVW A;  1YYH A;  4CZ2 D;  1KT0 A;  3MV2 B;  4J8E A;  4WNG A;  3HXC A;  1JCQ A;  2J07 A;  3FTW A;  1H6P A;  3N71 A;  2Y0B G;  4APO A;  4BX9 A;  5D66 A;  2VGE A;  3LY8 A;  4BX8 A;  2GW1 A;  2WXI A;  2XPI A;  5G2N A;  4MKT A;  4BSZ B;  4BES A;  4CGW A;  4N3B A;  3Q9N C;  5E76 A;  1N94 A;  1WG0 A;  3T5X A;  3ZNG A;  3P1U A;  1HXI A;  3U3W A;  2PZI A;  4UQY A;  3J5P A;  3OXL A;  3O4Z A;  1A17 A;  2WXG A;  3AU4 A;  1N4R A;  3V2O A;  4O1P A;  3D9L A;  3TWQ A;  3TWS A;  3FFL A;  1HG5 A;  3P2B A;  2AJA A;  3FTY A;  4GPK A;  5ANR A;  5FWQ A;  5FZS A;  3SFX A;  2V5F A;  4I1M A;  2AXZ A;  1IQR A;  4GTM A;  3UX4 A;  3ZHE A;  3D3M A;  2AXU A;  2YHC A;  2KM4 A;  2WXO A;  1TNY A;  4KMO A;  4L7T A;  3C3O A;  2R05 A;  4NUR A;  5AJD A;  2FF4 A;  3CST A;  4G24 A;  3ABM E;  3WG7 E;  3UM2 A;  4YND A;  4JC8 A;  3EJN A;  4PS7 A;  4CRW A;  5KJK A;  2LAI A;  2NYJ A;  4V3I A;  4ILI A;  4DI4 A;  4J8S A;  2A5E A;  5ITZ F;  2DCP A;  3RRU A;  2BUG A;  5KJL A;  4O1O A;  2WXR A;  1E90 A;  2FEZ A;  1RZ4 A;  3C98 A;  3ABK E;  1MQS A;  5LFA A;  4RSY A;  4HRL A;  3VTX A;  4BTA A;  1BI8 B;  2L6J A;  3E34 A;  4YDE A;  2A4Z A;  1FCH A;  3UIO C;  3HIZ A;  3ZGQ A;  3BG0 B;  3EDT B;  3FEX A;  3L13 A;  1K1A A;  5AAR A;  4B89 A;  4GYY A;  1UG3 A;  4BWR A;  5FZR A;  5KCM A;  5AIJ A;  3QWP A;  4AY5 A;  2E0I A;  4FC8 A;  3VLD A;  3SZ7 A;  3R7R A;  4UI9 K;  4JHK A;  1MZC A;  1S64 A;  1SZA A;  1H2V C;  2GRM A;  1OCC E;  3UI2 A;  1H19 A;  4WAF A;  1BPO A;  4GA1 A;  2ZGD A;  3R9M A;  4ACK A;  3SBS A;  2WMO A;  5FJY A;  5FTP A;  4K5B A;  3U9W A;  2Q7F A;  3FUJ A;  3FTV A;  4BFR A;  5C2Y A;  1OT8 A;  1U3D A;  5KJM A;  2XCB A;  3SGH A;  1N54 A;  2QZA A;  1OWL A;  1OCO E;  3MCX A;  3PZ3 A;  2ZXW E;  4DX7 D;  4EHM A;  4G2V A;  2ZU6 B;  4UWL A;  1SZ9 A;  4GA0 A;  3ASH A;  3APF A;  3DEP A;  5HQ8 A;  4GB9 A;  3UM1 A;  3TG5 A;  4B8C B;  1H6K A;  3CLJ A;  3ML8 A;  3T5V A;  2P9K G;  3SFY A;  5EID A;  2DIW A;  3L08 A;  3RRM B;  4DI3 A;  2RD0 A;  3JCK C;  2VSN A;  3CHM A;  4G23 A;  2QC9 A;  2X6H A;  3B95 A;  4A63 B;  1E96 B;  1LF8 A;  2WXP A;  3S2A A;  4J6I A;  3PNT B;  1FVF A;  4NAC A;  4N39 A;  3K9I A;  4W9R A;  4YVO A;  3UPV A;  2PL2 A;  3TGO A;  5BUZ A;  4K5A B;  1E8Y A;  4JL0 A;  1FVH A;  2L0I A;  4GA2 A;  2KZT B;  2P9I G;  3BQO A;  5BXU A;  3B13 A;  5EDS A;  4GTP A;  3D9K A;  3CHQ A;  2IFU A;  4Z68 A;  5LP0 A;  2AW6 A;  2WXJ A;  4TUM A;  2P9S G;  2R59 A;  4I6G A;  1X5B A;  2VSX E;  2GRQ B;  4GZ6 A;  3L17 A;  1HE8 A;  2EIN E;  1E8X A;  1K8K G;  2I6H A;  4U8H A;  3FUH A;  1TYQ G;  3G2U A;  3Q5M A;  3BUA A;  4FAD A;  4LNU D;  3MKQ A;  4L23 A;  2CHW A;  1QZ2 A;  4UUC A;  3L82 A;  2GRL A;  1SA5 A;  3LEW A;  1LD7 A;  3Q73 A;  4H7Y A;  5CMY A;  5AAO A;  1H6O A;  2P9U G;  1ZU2 A;  2CHZ A;  2QFC A;  4B0Z A;  5CEA A;  1ELW A;  3EU5 A;  3V2X A;  4MRU A;  5BXO A;  3V30 A;  3I5P A;  4ATZ D;  4U95 D;  1BD8 A;  2RFM A;  4LG6 A;  3UM0 A;  3RK6 A;  2DZN A;  4RQI A;  3DSX A;  3FUF A;  4FJZ A;  3UIN C;  5ARF A;  1UN9 A;  1UW4 B;  2KCL A;  4G8K A;  3FH8 A;  2ZGG A;  3E4B A;  5B1A E;  2QY7 A;  3ZUV B;  2JAB A;  4GTQ A;  1AWC B;  1B89 A;  1N0R A;  4DJA A;  3U4T A;  3ZYK A;  4XIF A;  4YDY A;  4N5C A;  5J08 A;  4L9P A;  4RVB A;  4RG6 A;  3UXG A;  4XI0 A;  4UQX A;  1TNU A;  4JEU A;  2IF4 A;  4RLY A;  4DX1 A;  4APF A;  4BTB A;  5AQ9 A;  3APD A;  3EHM A;  3SO8 A;  5CEC B;  1IXV A;  1ELK A;  5LCW C;  3FH5 A;  1IHG A;  1EF1 C;  3GW4 A;  1YA0 A;  4UWF A;  5JMN D;  2CG3 A;  3TG4 A;  4F1P A;  4WWP A;  5G04 J;  3ONK A;  3LKU A;  2NSZ A;  2X6K A;  4AJW A;  5CBN A;  4HOR A;  1LTX A;  3AG2 E;  3L9T A;  4IYP A;  3B7U X;  2I1K A;  3RAU A;  3RO3 A;  4Y6W A;  4I2W A;  2C0M A;  1TNZ A;  4TV3 A;  2L0T B;  1TNO A;  2WXH A;  5CED B;  4JW1 A;  3SNX A;  1DCE A;  3GZ1 A;  4GCO A;  1QYM A;  4AY6 A;  4U7E B;  3JYS A;  5A23 A;  4P29 A;  4H7X A;  2WVI A;  1JCR A;  1KLX A;  2IY0 C;  2CG2 A;  3NB2 A;  1DNP A;  1TR4 A;  2FI7 A;  5EIL A;  2PNN A;  2IU1 A;  4XE0 A;  3FUL A;  3OAW A;  3ZFW A;  5EKQ D;  3SF4 A;  2GRN B;  4DLO A;  5CCM A;  3VLF A;  3U64 A;  3MKR A;  2V8S E;  3QAR A;  3ASG A;  2VQ2 A;  1N4P A;  3ZHE B;  4HS2 A;  1IYG A;  3J5Q B;  4N2Q A;  5J90 A;  4GTR A;  1N4Q A;  2H6F A;  2CHX A;  2IQC A;  3JUI A;  4A1G A;  1HG2 A;  4BSX A;  1S70 B;  2QYJ A;  5KJN A;  5ENR D;  3UKU G;  1GW6 A;  1L5J A;  2P9L G;  4YDO A;  3FWV A;  3MYV A;  4KBQ A;  4DLQ A;  2C2L A;  2OND A;  3BG1 B;  3IKO B;  1EYH A;  1N11 A;  2OEW A;  1E8W A;  4OYS A;  4HQD A;  2HR2 A;  1O1R A;  2Y69 E;  4JHR A;  3RO2 A;  3C3R A;  4BER A;  2AXV A;  2ETC A;  3KEZ A;  3LYA A;  3TAX A;  4MBG A;  2DZO A;  1H2T C;  2FBN A;  2KCK A;  2ZIS A;  2LUH A;  5HI7 A;  3AG3 E;  2JEK A;  5G55 A;  2XGS A;  2XGO A;  4QFV A;  3QWV A;  4JD2 G;  3T8K A;  4KT6 B;  2F0Y A;  4N3A A;  3FUN A;  5EYP F;  2VTB A;  4XEI G;  3UQ3 A;  3ZYL A;  1D8E A;  3R9A B;  3ONL A;  4IRU A;  3E32 A;  3JUE A;  3KS2 A;  2XPY A;  1UJJ A;  1WDY A;  5M72 A;  4C48 B;  4XKC A;  2WXN A;  4CT0 A;  5BV0 A;  4DRX E;  3GZ2 A;  3TWV A;  5A6C A;  3UUX A;  4HLL A;  2VSY A;  2LSU A;  4I17 A;  3HDX A;  4TRQ A;  4FLB A;  4N3C A;  2J4D A;  3IBE A;  5AN8 A;  4HLE A;  2P9P G;  1KPS B;  3NZS A;  4EBA G;  2X38 A;  3ESK A;  4HNA D;  5JJ7 A;  1WM5 A;  3HXF A;  1KZP A;  2VJ8 A;  1NA0 A;  1NP7 A;  3S7F A;  1Z6T A;  3CK8 A;  5DIZ A;  2KAT A;  1HX8 A;  5EYL A;  3EU9 A;  3QJZ A;  2OVB A;  4J8F A;  4A3V A;  1SVX A;  3ZRH A;  5FZQ A;  5ANL A;  2R2L A;  3DEO A;  4M3O A;  4HBD A;  2HYZ A;  2PM7 A;  3D9P A;  3ZPJ A;  4JB8 P;  3D9M A;  4AOF A;  2J08 A;  4UWK A;  2WXL A;  3NQP A;  1JUQ A;  4BT8 A;  2XEE A;  5LX8 A;  3IV0 A;  4FLH A;  5G05 J;  4M7C A;  3CVY A;  2YIN A;  3EHR A;  5ENT D;  3S7B A;  4U0U A;  1OXJ A;  4FUL A;  4L2Y A;  3FUM A;  4UWH A;  1X81 A;  1HZ4 A;  5EIB E;  1TN7 A;  4NQ0 A;  3GYZ A;  2LAH A;  1E7U A;  2KCV A;  5AYW D;  2BED A;  2BKK B;  1IQU A;  3ASD A;  2RKK A;  4ANX A;  2ILR A;  3PNL B;  4RG9 A;  3G2W A;  4GTS A;  3KD7 A;  4HOQ A;  1V55 E;  4KZ0 A;  3I4G A;  2WQ7 A;  3L16 A;  3ZU7 B;  4L1B A;  3Q75 A;  5EX0 A;  2ZIR A;  1NI1 A;  3LXU X;  2GRO B;  5FQ8 A;  1K1B A;  3FP3 A;  3JXI A;  3OXG A;  3AU5 A;  2EIM E;  4FA6 A;  4GCN A;  4A3T A;  1IKN D;  2GRR B;  4LUN U;  1YCS B;  4F3V A;  3Q49 B;  3TWT A;  5AJL A;  1MHQ A;  3MKQ B;  3I3N A;  2CFZ A;  4ANW A;  5FQ6 A;  3CVP A;  3RKV A;  3TWU A;  4J8D A;  2WPV A;  2EIK E;  3CVN A;  4XZ4 A;  4OAV B;  2DVW A;  2MOW A;  3UMV A;  1Z3X A;  5BT1 A;  3CV0 A;  4LNB A;  3CVQ A;  3VTY A;  2RFA A;  1O5M A;  2R17 C;  3FTZ A;  4JZY A;  5B1B E;  3EIQ C;  5JHB A;  4UI9 J;  5FT9 A;  3QDN A;  4KYO B;  2HM8 A;  1JCS A;  2I1J A;  3ZXS A;  1H0A A;  1VDY A;  4WWO A; 
#chains in the Genus database with same CATH homology
 3J5Q B;  4BEP A;  1G3N B;  3SO8 A;  3DEP A;  4HRL A;  1IXV A;  5CEC B;  5ENQ D;  3J5P A;  4K5C A;  1BI8 B;  2ETB A;  4QQI A;  5HS0 A;  4J7W A;  3D9H A;  1K3Z D;  3JUE A;  2FO1 E;  3EHQ A;  1WDY A;  4O60 A;  3V2O A;  4O1P A;  3TWX A;  4OAU C;  5JMN D;  4C48 B;  4DX6 D;  5AAO A;  5EID A;  4CYM D;  3AJI A;  3TWQ A;  1BU9 A;  2BKG A;  3TWS A;  4F1P A;  4J8Y A;  4DRX E;  4DUI A;  1DCQ A;  3C5R A;  1MX6 A;  1S70 B;  2KXP C;  2QYJ A;  3TWV A;  4DX5 D;  2AJA A;  5CEA A;  3V31 A;  2F8Y A;  4HLL A;  5ENS D;  5CBN A;  1K1A A;  1MX4 A;  5ENR D;  2J8S D;  5AAR A;  4HB5 A;  5FIO A;  5HRY A;  2Y1L E;  3V2X A;  5AQA A;  3ZU7 B;  1BLX B;  2QC9 A;  5BXO A;  3LJN A;  5JA4 D;  5AN8 A;  3V30 A;  4ATZ D;  4B93 B;  1DC2 A;  4U95 D;  1BD8 A;  5AQB A;  3ZKJ A;  2RFM A;  3F6Q A;  3B95 A;  4A63 B;  3NOC D;  4GMR A;  2ETA A;  5KWD A;  4LG6 A;  3AAA C;  4U8V D;  1YMP A;  2V4H C;  1K1B A;  2DZN A;  3W9F A;  3JXI A;  1SW6 A;  4HNA D;  5AQ7 A;  5CED B;  1BI7 B;  4G8L A;  1IKN D;  3JXJ A;  1YCS B;  1A5E A;  1D9S A;  1QYM A;  1N11 A;  1N0Q A;  3TWT A;  3B7B A;  4HI9 A;  4K5A B;  4NIK A;  5KNH D;  2XEH A;  5EYL A;  2L6B A;  1MJ0 A;  3EU9 A;  4G8K A;  4U8Y D;  4HQD A;  5ENP D;  4HI8 A;  2MYO A;  4ZHB A;  3Q9U C;  2ZGG A;  3TWR A;  5BXU A;  1SVX A;  3UI2 A;  1IHB A;  2B0O E;  1UOH A;  2P2C P;  3KEA A;  4BER A;  2ZGD A;  2DWZ A;  3TWU A;  4U96 D;  1TR4 A;  3UTM A;  3ZUV B;  2HE0 A;  2JAB A;  4Z68 A;  4HRN A;  5EIL A;  2PNN A;  2ETC A;  3DEO A;  4LSZ E;  2XZD G;  4HBD A;  2XZT G;  5FIN A;  4ZFH A;  1AWC B;  1AP7 A;  2DZO A;  4GPM A;  1YYH A;  4OAV B;  1N0R A;  4CZ2 D;  4JB8 P;  4K5B A;  2DVW A;  4TUM A;  2V5Q C;  4HRM B;  3IXE A;  3V79 K;  2F8X K;  4YDY A;  1NFI E;  4YDW A;  2NYJ A;  3TWW A;  3NBN B;  2XEE A;  4DX2 A;  3HG0 D;  3T9K A;  1OT8 A;  3UXG A;  4QFV A;  2A5E A;  5ITZ F;  3EHR A;  2Y0B G;  2RFA A;  5KBA A;  5ENT D;  5D66 A;  5CER B;  2VGE A;  1MYO A;  3T8K A;  5CBO A;  3NOG D;  5EYP F;  4F6R D;  5EIB E;  1OY3 D;  4RLY A;  1MX2 A;  5EN5 D;  4BSZ B;  4DX1 A;  4BES A;  2XEN A;  2F37 A;  4O1O A;  5ENO D;  4N5Q A;  5KNG A;  3W9G A;  4DX7 D;  4LNU D;  3HRA A;  4BET A;  3Q9N C;  5HKP A;  5AQ9 A;  1WG0 A;  2BKK B;  3ZNG A;  4UUC A;  2KBX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...