1A5EA

Solution nmr structure of tumor suppressor p16ink4a, 18 structures
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
156
structure length
156
Chain Sequence
b'MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TUMOR SUPPRESSOR P16INK4A
publication title Tumor suppressor p16INK4A: determination of solution structure and analyses of its interaction with cyclin-dependent kinase 4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Anti-oncogene
total genus 26
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 1998-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1a5eA00
3C5RA 4CYMD 2J8SD 4RLYA 4DUIA 3TWRA 4F6RD 2XZTG 1MX6A 4BSZB 5HRYA 4HRMB 4U95D 1AWCB 2DWZA 4GMRA 3JUEA 3B7BA 1QYMA 1YMPA 2F8YA 3LJNA 4HI8A 5EYPF 4DX7D 4O60A 3SO8A 5CEDB 5ENQD 3JXJA 3T8KA 4HNAD 5ITZF 5HS0A 5KBAA 1N0RA 2ZGDA 4JB8P 3AAAC 2A5EA 2V4HC 2QYJA 2ETCA 5CERB 3V2XA 3UI2A 1BD8A 3TWQA 2PNNA 4LNUD 2DZOA 4U8YD 3EHRA 5AAOA 4F1PA 4QFVA 3W9GA 3TWTA 2P2CP 5CECB 5AQ7A 1AP7A 4LG6A 3ZUVB 1OY3D 2L6BA 5AARA 4DX6D 2XENA 3Q9UC 4BEPA 3NOCD 2B0OE 4HBDA 1NFIE 4OAUC 3W9FA 4BETA 3EU9A 3TWWA 4UUCA 3DEOA 1WG0A 3J5QB 3D9HA 1MX4A 4OAVB 1DCQA 4HLLA 3B95A 3TWSA 5ENRD 3IXEA 5KWDA 2F8XK 3DEPA 4N5QA 4G8KA 5CBOA 4K5CA 5BXOA 2JABA 2DZNA 5KNHD 4HRLA 4U8VD 3TWXA 4BERA 4O1PA 2V5QC 2NYJA 4HRNA 5EYLA 2AJAA 1OT8A 5BXUA 5FIOA 3HG0D 3NOGD 4J8YA 3TWUA 2KXPC 1N11A 4DX1A 4J7WA 2Y0BG 3ZKJA 1SW6A 2HE0A 2RFMA 2ZGGA 3EHQA 4YDWA 5EILA 3TWVA 5AQ9A 5FINA 4A63B 4ZHBA 3UTMA 3J5PA 4O1OA 5KNGA 1WDYA 1K1AA 4K5AB 4HB5A 1D9SA 1MJ0A 1UOHA 2VGEA 4NIKA 5ENSD 5D66A 4DX5D 3V30A 5EIBE 2DVWA 3ZU7B 2BKGA 4LSZE 1TR4A 2F37A 2XEHA 1BI8B 2MYOA 3JXIA 3KEAA 4K5BA 4QQIA 5EIDA 1MX2A 5ENTD 4DRXE 5CEAA 4TUMA 4Z68A 1S70B 5JMND 3T9KA 2Y1LE 1G3NB 1A5EA 1BU9A 2ETBA 1IXVA 4B93B 5AQAA 1YCSB 4HQDA 5CBNA 1BLXB 4ATZD 1SVXA 5HKPA 1BI7B 1YYHA 4YDYA 5ENPD 5JA4D 2QC9A 2RFAA 3V2OA 2KBXA 4BESA 3V79K 2FO1E 3UXGA 5EN5D 1DC2A 1IHBA 4ZFHA 1K1BA 5AQBA 3V31A 5ENOD 3ZNGA 3NBNB 4G8LA 2BKKB 4U96D 3Q9NC 1IKND 2XZDG 3HRAA 4HI9A 4DX2A 2ETAA 4C48B 5AN8A 1K3ZD 1N0QA 4GPMA 4CZ2D 1MYOA 3F6QA 3AJIA 2XEEA
chains in the Genus database with same CATH superfamily
2WQHA 3SQVA 4DUIA 2QFCA 5HRYA 3CHQA 4H7XA 2RKKA 5BV0A 3JXJA 3T8KA 5HS0A 5KBAA 2Y4TA 1BD8A 4WNDA 2CG3A 5FQ8A 5D0OD 4TRQA 4QFVA 3KSLA 4JEUA 2R02A 5AQ7A 5BV1A 4KXKB 3QDNA 1FT2A 4FHKA 4IULA 3ZFWA 3DEOA 2XHEA 3FUJA 3TWSA 3E37A 4L2YA 1KLXA 4D10C 1H6OA 2DZNA 1E90A 3ZVVA 3ML9A 5CRVA 3D9PA 2EINE 1Y6IA 2Y0BG 4APFA 1FVFA 2E0IA 5EILA 4ZHBA 3RJVA 5ENSD 5LX8A 2XS8A 2FBNA 2AVPA 4K0RA 5ENTD 3CSFA 1RW2A 2GGFA 4GYWA 3D9MA 4B89A 4EBAG 1O1RA 3URZA 3CK8A 1BLXB 4I43A 3RRNB 5ENPD 4RG9A 3HYMB 1H2UA 3LS8A 2VTBA 1IHBA 4W9RA 3SBSA 3ABME 3R9MA 2C2LA 4EZJA 3S7FA 4LNBA 3PEVB 1S63A 5G05J 2AW6A 2BF0X 2FF4A 2DWZA 1E8YA 1YMPA 2F8YA 4UWFA 1EPUA 3I4RB 3ZHEB 4UWHA 2X6HA 2Y3AA 5ARGA 3LJ3A 4FU3A 3UIOC 4C0EA 3G2TA 3UIPC 5AAOA 3AG4E 2PL2A 3HXEA 4RG6A 3LVRE 3WXXA 1H6PA 1DCQA 4ILIA 4AY6A 3CEQA 2AXVA 2JABA 4CGWA 2IU1A 4CRWA 2R59A 4J8EA 1OT8A 5CCLA 3BG0B 5A7DB 3E32A 3EHQA 3K9IA 3NB2A 3T8MA 2L6JA 2HO1A 2J09A 4I9EA 1SA4A 3NQPA 3KEAA 1S70B 4ILGA 2A4ZA 2H6HA 2H6IA 3FTXA 1SVXA 5HKPA 1YYHA 3Q73A 1KT0A 1N4QA 5JA4D 3V79K 3HVEA 2B6CA 3V31A 2H6GA 3MX3A 3MCXA 1N94A 2V4LA 3Q5MA 2LNIA 4RLYA 2XZTG 4BWRA 4KMOA 2EIKE 3PUKA 4GZ5A 2CHXA 3B7BA 4I2ZA 2GRRB 3B7SA 5C1DA 2H6FA 5BPPA 5CERB 4GZ6A 4JHJA 1TNBA 4GTTA 3PEUB 3CHRA 4GCOA 4UQXA 2X6IA 4DJAA 1DVPA 2XGOA 3NOCD 5CRUA 2ZU6B 1NA0A 4WNEA 3UUXA 1NA3A 1WG0A 2PQNA 4ANVA 4Y6WA 3UINC 4UI9J 3DEPA 3EJNA 2XGSA 1ZBPA 2AXZA 3TWXA 3EU5A 1B89A 3E34A 4P29A 3JUIA 1TNZA 4HRNA 4BSXA 1LD7A 3HXFA 2WXHA 5AQ9A 3GZ1A 4TXRA 4FP7A 5G05C 3PZ2A 3PZ3A 4JHRA 3D9OA 5IY5E 3QWVA 1G3NB 2WQ7A 3PUJA 4AOFA 2BTDA 1IXVA 3ZPJA 2XPZA 3FTYA 3MJWA 2HYZA 2WMNA 4WWNA 1LF8A 3FUIA 3L9TA 3DPYA 2X38A 1HO8A 4ZFHA 4GZDA 3AU4A 2XEVA 3CQCB 4ACKA 2ETAA 4GAAA 3G2VA 3F6QA 2VGXB 3P1UA 1TNOA 4HRMB 4K03A 4U95D 4I1MA 2YNQA 3ENEA 4HI8A 3CV0A 4GTPA 1N0RA 2QYJA 2ETCA 2UWJG 3UM2A 3PH0C 2QYUA 4WWPA 3ZHEA 5G55A 3RU0A 2DYRE 2J08A 5EX3A 3ZGQA 1LD8A 3W9FA 4ME2A 3DBSA 3D9HA 1ZB1A 4LEUA 3JQ0A 4ABNA 5ENRD 1SQMA 3QJZA 4ANWA 5BXOA 4TV3A 3IBEA 4H7YA 5ARFA 1OCZE 5FIOA 3NOGD 3TWUA 3CHOA 4J8YA 1DNPA 2LAHA 3DSTA 1TJCA 3IKOB 2AWIA 4O1OA 5KNGA 2KATA 1D9SA 3Q15A 3G2SA 1NL4A 1HFAA 3ZU7B 1N54A 2J9QA 3EDTB 4I6GA 2WVIA 1NP7A 3ESKA 2Y4UA 2P58C 2L0TB 3ZXPA 2WXQA 3NZSA 3TG5A 4B93B 3CR3A 3VTYA 5CCMA 5EKQD 2Y69E 4JL0A 2XCBA 2WM9A 5AJDA 3FTUA 5EDSA 3JQ1A 3ABLE 2R2LA 4U96D 1FCHA 2P9PG 3ABKE 1H6KA 2AXUA 1H2VC 1N4SA 4B0ZA 4F6RD 1MX6A 1U3CA 2WQ6A 2LO6A 3FWVA 4UI9C 5FTPA 4B8AA 2NXPA 3EIQC 3LJNA 3SO8A 5ENQD 3FTZA 3CIAA 3Q47B 2ZGDA 3MV2B 4L9PA 1PAQA 4LERA 3CHPA 1N95A 3FFLA 1NI1A 3W9GA 3RRUA 1ELKA 1Q2ZA 5AARA 2XENA 3TWWA 3R7QA 5A23A 3CVLA 3KD7A 5JJ7A 1TNYA 3UKRG 4F1SA 3CKCA 3PRZA 2CFUA 2OOEA 1TJFA 2KXPC 3Q78A 3LY8A 3NZUA 3JYSA 5AJLA 4NIKA 1FPPA 5KJLA 4TUMA 4HOUA 3ZIMA 3ISMC 2WB2A 3OXGA 3ONKA 3KSQA 3CK9A 4A55A 2ETBA 1E96B 3ASDA 3VLEA 4N39A 3LXUX 5A6CA 3APCA 2CG2A 5EN5D 1ZU2A 3SF4A 4AIFA 4HI9A 1E8XA 4DX2A 3DXMG 4CZ2D 1QZ2A 4JHKA 2OVBA 2R03A 2QY7A 3UM1A 4CT4A 2YHEA 2PZIA 4O60A 3FDHA 3TGOA 4X8QA 2C0MA 2V4HC 3ZYMA 3TWQA 2PNNA 4M7CA 4L7TA 2QZAA 4ANXA 1JPLA 5E76A 1NFIE 3WG7E 4BETA 3CHMA 5FJYA 1DCEA 2EIJE 5ANLA 4U8HA 4BTBA 2OEVA 4HRLA 3C72A 2WXOA 4NRHB 4Q94A 4LRZA 3ZN3A 5FWQA 3DPDA 4GU5A 4GTSA 3UQ3A 2A5UA 4KYOB 3L54A 2Q7FA 1MJ0A 4I17A 3D9KA 4N5CA 1IQRA 3SGHA 1O1TA 2OCCE 5EIDA 3SBTB 4BFRA 1A5EA 1XNFA 2L0IA 1UG3A 5CBNA 2IOSA 3QNKA 5FZQA 5FZRA 3I5PA 1N9AA 4L1BA 2P9SG 1UJJA 2KBXA 5E75A 4HFGA 3ZYKA 4WAFA 4G23A 5CHEE 5H7PA 4GPMA 3Q75A 4MKTA 5HQ8A 3ASFA 4I1OB 2MOWA 2E2EA 3O48A 3DWLG 5J90A 3IHVA 4DI4A 4O6FA 4EQFA 1SZ9A 1K8KG 3U4TA 2HR2A 2GRNB 2V8SE 5FQ7A 3PZ4A 4GA1A 3CVUA 3Q9UC 3RSEG 2VSOE 1EDUA 1N4PA 4JC8A 3J5QB 1MX4A 5KJNA 4L2LA 2KCLA 5LOZA 2ZIRA 3HXCA 1YA0A 3RK6A 4U8VD 2EIME 4GTMA 3N71A 4CT0A 4XKBA 3PREA 3TWVA 2ZGGA 4YDWA 4A63B 4A3TA 2P9KG 2KCVA 2DVWA 4I1AA 2IQCA 1LTXA 3ZRHA 4ACLA 1JCRA 4CDRA 2ZISA 3MZLB 3UM0A 1IHGA 3UM3A 3ULQA 3CVYA 5D2MC 2RFAA 3RO3A 1MZCA 3HDXA 4G8LA 3FUHA 3ASOE 3U64A 1WY6A 2XS1A 3D9IA 4MS6A 4AEZC 4F7AA 4XIFA 1HZ4A 4BY6A 5HI7A 3VLFA 4A1SA 4URKA 2P9UG 1L5JA 1D8EA 1INZA 2XRYA 3ASNE 3AS5A 2DZOA 4U8YD 3TWTA 4OVUA 1V55E 3MA5A 3PVLA 3SFXA 4PS3A 3IHYA 3CVXA 3MKQB 4EECA 3B7RL 3RO2A 3IXEA 1TYQG 4O1PA 3FUFA 4A1GA 2NYJA 4EZLA 1KZPA 2I9CA 1ELWA 3CGHA 1TEZA 2XQ0A 5B3SE 2MRIA 2RG8A 1S0PA 4CDMA 3UT4A 1TR4A 2L9BA 1S64A 4GMJA 2ILRA 3BEEA 3UPVA 5ENNA 5JJTA 2ZXWE 5AQAA 3E4BA 4HQDA 4JW1A 3ULEG 2JEKA 4JA9A 3SFYA 4YVQC 4GA2A 1OCOE 3V2OA 1N52A 3UXGA 4UWKA 4APOA 3LPZA 2XZDG 3HRAA 3MEKA 1N0QA 3AJIA 4JD2G 4B8CB 4Q69A 4BSZB 4KVOA 3FU6A 1QYMA 3LVQE 3CHSA 1U3DA 2I6HA 3IV0A 2LUHA 3AAAC 2A5EA 2LXLA 3V2XA 3FUEA 1MHQA 4LNGA 3O4ZA 4F1PA 3JCKC 1OY3D 4DX6D 3D9LA 3U3WA 2B0OE 4HBDA 4GA0A 1Z3YA 5B1AE 4IRUA 3LDZA 3FTWA 2F8XK 4MRUA 1JCQA 1E7UA 5CBOA 4K5CA 2IEJA 5KNHD 3UMVA 3FTVA 3PDNA 5EYLA 2AJAA 2I1KA 3KEZA 2XPYA 2HE0A 3CVPA 3C3RA 3QARA 4GTVA 3PE3A 3S7BA 4G2VA 1TN8A 2J4BA 4HB5A 4BT8A 4F53A 4FJZA 5EIBE 3Q49B 3AS4A 3V30A 4XE0A 4U7EB 3BG1B 4B94A 1BU9A 3VLDA 2LSVA 1JCSA 3AG3E 3G2UA 4UWGA 1UW4B 4LCTA 4F3VA 4GPKA 4XZ4A 5FQ4A 3PNTB 2LSUA 2QC9A 3EIJA 4YVOA 4JA7A 1K1BA 3GZSA 5ENOD 4JXTA 5FQ6A 2KM4A 2BKKB 3L16A 1K3ZD 4YNDA 3S7DA 1IYGA 3C5RA 5G04J 4YDEA 4BTAA 4CDNA 1HG2A 4FA6A 1UN8A 3CVNA 4M3OA 3SNXA 4AP2A 3FUKA 4NQ0A 3SY2A 5CEDB 3T5XA 4KT6B 3HXDA 3U66A 3OXLA 2ONDA 4MLPA 2EILE 1H0AA 4A3VA 3EHRA 2WMOA 3CKBA 1JUQA 1QBQA 1KT1A 4G24A 2GRMA 3APFA 4NACA 4XX5A 5CMYA 4TXQA 2OEWA 4N5QA 4G8KA 3C3QA 3MKQA 4BERA 3DSSA 1JWGA 3SHFA 3MV3B 2XPIA 4DX1A 4EPZA 1QNFA 1OWNA 5BNWA 4BX9A 3UTMA 4WNFA 3OXFA 3RIBA 1H19A 2DIWA 3FUNA 4DLOA 2X6FA 4I6EA 3UT8A 3HIZA 4G25A 4DRXE 4BX8A 3T9KA 3UX4A 4FLBA 4CEMA 3FU0A 4GMLA 1YCSB 3CVQA 4U0UA 4KZ0A 3DSWA 3DRAA 4I6JA 3UKUG 3Q9NC 2HM8A 4AVXA 4U0ZA 4C48B 2KCKA 3LEWA 1A17A 2J8SD 3RRMB 1UN9A 3TWRA 3ASGA 3U9WA 3L22A 4FC8A 4PH4B 5T4YA 3QAQA 5ITZF 3CVWA 4JB8P 2GRPB 2X6JA 3APDA 5LFAA 2WXJA 4J6IA 3BUAA 2IJGX 4TXPA 5CECB 3FU3A 3C98A 2P9NG 1SA5A 1XGWA 1H2TC 4JZYA 3SZ7A 3G2WA 2VGXA 4AM9A 3ZEFA 1WM5A 3Q7AA 3FH8A 1Z6TA 2YQ8A 3T5VA 4E6HA 2GRQB 3EHMA 5LP0A 2CHWA 3QB2A 4Z68A 1SW6A 3S7JA 4Y6CA 4EBAA 5FINA 1HG5A 1P5QA 1K1AA 2WXPA 3E33A 4IN3B 4N3AA 5G04C 5D66A 4OYSA 4UWLA 3DXKG 4HXIA 2F37A 1Z5SC 1WAO1 3OAWA 3VTXA 3SI5A 4WUYA 2VSXE 5AYWD 1OUVA 3GZ2A 4JPSA 4OVVA 5FT9A 4N2QA 2VJ8A 4DPRA 2WXIA 3AG2E 1IKND 3B7TA 4AV7A 3QOUA 5G2NA 1UJKA 3FTSA 4XEIG 2MHKA 3TJPA 3R9AB 1AWCB 3NAWA 1OCCE 5EX0A 3FH7A 3AU5A 1ELRA 4HNAD 3FUDA 5M72A 2WXRA 1PY1A 4C0MA 3LCAA 4HLEA 3Q79A 1X5BA 2WXGA 2L6BA 4HOSA 4XKCA 4GTRA 1RZ4A 3FY4A 1TNUA 4IYPA 3MYVA 5FZSA 1KZOA 3ZW3A 3FH5A 2VSYA 2UY1B 4JVSA 4KZCA 4PUCA 3ONLA 2IOLA 4U07A 4U04A 4HOQA 5DBKA 2YHCA 1UOHA 4NURA 4DX5D 5BW8C 2OV8A 4LSZE 4C9BB 3JXIA 3NBNB 2J07A 1MX2A 3L08A 4U63A 1U2VG 2F0YA 2YINA 5BUZA 3UT7A 2IF4A 4R7LA 2WXKA 4GYYA 4YDOA 3HHMA 2IONA 3R7RA 1NZNA 2P9IG 1FVHA 4ILHB 3ZYLA 2GROB 3LYAA 5EYPF 3B13A 2X3MA 4FLHA 3KAEA 1HF8A 2KZTB 2WXMA 5LCWC 3EUVA 3ESLA 5AENA 5J08A 1TN7A 2P2CP 4J0UA 3AG1E 1AP7A 1GW6A 3PZ1A 4BEPA 3LKUA 2DYSE 1E7VA 4AJWA 3ASHA 3PZDA 3ZXSA 4LUNU 4FADA 4GTQA 3I4GA 4G11A 1OCRE 3BQOA 3D9JA 1PC2A 1D8DA 5AIJA 4GYOA 2M63A 3QWPA 4N3CA 4GZ3A 3QKYA 4HS2A 1WDYA 4DK5A 4WNGA 1BPOA 2VGEA 4I2WA 2IFUA 2DCPA 3NF1A 5JMND 2VYIA 3MGBA 4MBGA 3FULA 3BU8A 5ANRA 2NC9A 2R5SA 4PS7A 4E85A 5CMWA 2KC7A 5AN8A 2DBAA 2R05A 4J8SA 3S2AA 4AY5A 2WXNA 3LY9A 4G1TA 1W3BA 4N2SA 3D9NA 4WWOA 3PNLB 2C0LA 2BEDA 4RVBA 4EHMA 2FEZA 3QK0A 4AXHA 3SFZA 2PQRA 1HS6A 4LG6A 4GB9A 3PE4A 4ANUA 5KCMA 3P2BA 3GW4A 4UUCA 4RQIA 1EYHA 3Q7FA 4HLLA 5T3RA 3L17A 4RSYA 3TXMA 4CCAA 2V5QC 3Q4AB 5D0QD 5BXUA 2XCCA 2LAIA 1KPSB 2CHZA 3L82A 2UY1A 3J5PA 2FULA 3I3NA 3AS8A 4J8FA 2GW1A 1Z3XA 2XEHA 5BT1A 2MYOA 3CLJA 4V3IA 2Y1LE 3CK7A 1E8WA 4EZKA 4Q96A 1TN6A 1HXIA 4GZCA 1IQUA 5AQBA 1V54E 4HORA 3KS2A 4XI0A 3RAUA 2J49A 1OWLA 4CYMD 5JHAA 3SD5A 1O1SA 2V5FA 4FHJA 3PS6A 3E30A 4G26A 1X81A 4ATGA 3ULYA 3UI2A 1OWMA 5DIZA 4LNUD 1QQEA 2WXLA 2KZTA 4BT9A 3ZUVB 4UQYA 2V0PA 2IO3C 2EQXA 3DSUA 1HE8A 2IY0C 3TXNA 4GTOA 4OAVB 3DSVA 3B95A 5KWDA 2JLBA 1N4RA 3CQGB 2OVFA 3HG0D 4UI9K 2RFMA 2X6KA 2LXMA 3FP3A 1HX8A 2NSZA 3FU5A 5JJ6A 2IO2C 1OWPA 2VSNA 3MKRA 3IEGA 2VTBB 1Y8MA 4ATZD 1BI7B 2I2OA 1O5MA 3FEYA 2FO1E 1DC2A 3QWWA 2PM6A 3FUMA 3ZNGA 2GRLA 1VDYA 4PDXA 4U0SA 2CFZA 5KJKA 2XEEA 4DI3A 4KBQA 3QC1A 2I1JA 2P9LG 4N3BA 3CVVA 4FULA 4GMRA 3JUEA 2VQ2A 4DX7D 3GYZA 3HXBA 4UQZA 1FT1A 2XGMA 3ZYQA 2WXFA 5KJMA 3LY7A 3FHEA 3L13A 1OXJA 4HVBA 1HU3A 1MQSA 5B1BE 1JWFA 2XRZA 4OAUC 3EU9A 4JEHA 3OTNA 4J8DA 4I9CA 4KVMA 4HOTA 3X2QE 5T8IA 4L23A 5JHBA 3RKVA 2R17C 1OWOA 4CGVA 1N11A 4J7WA 3ZKJA 2VGYA 4K5AB 2PM7A 2FO7A 4TUUA 5C2YA 2BKGA 1SZAA 1BI8B 4K5BA 4QQIA 3D3MA 5CEAA 2FI7A 3C3OA 3TL5A 3FEXA 4FJYA 1HH8A 3L6AA 1E8ZA 3HVEB 4PS8A 3TAXA 4XI9A 4YDYA 5LCWJ 2WPVA 1EF1C 4BESA 3CSTA 2BUGA 3TG4A 3EHNA 2RD0A 4GCNA 3ML8A 3DSXA 2J4DA 4DLQA 3B7UX 1MYOA
chains in the Genus database with same CATH topology
3C5RA 4CYMD 2J8SD 4RLYA 4DUIA 3TWRA 4F6RD 2XZTG 1MX6A 4BSZB 5HRYA 4HRMB 4U95D 1AWCB 2DWZA 4GMRA 3JUEA 3B7BA 1QYMA 1YMPA 2F8YA 3LJNA 4HI8A 5EYPF 4DX7D 4O60A 3SO8A 5CEDB 5ENQD 3JXJA 3T8KA 4HNAD 5ITZF 5HS0A 5KBAA 1N0RA 2ZGDA 4JB8P 3AAAC 2A5EA 2V4HC 2QYJA 2ETCA 5CERB 3V2XA 3UI2A 1BD8A 3TWQA 2PNNA 4LNUD 2DZOA 4U8YD 3EHRA 5AAOA 4F1PA 4QFVA 3W9GA 3TWTA 2P2CP 5CECB 5AQ7A 1AP7A 4LG6A 3ZUVB 1OY3D 2L6BA 5AARA 4DX6D 2XENA 3Q9UC 4BEPA 3NOCD 2B0OE 4HBDA 1NFIE 4OAUC 3W9FA 4BETA 3EU9A 3TWWA 4UUCA 3DEOA 1WG0A 3J5QB 3D9HA 1MX4A 4OAVB 1DCQA 4HLLA 3B95A 3TWSA 5ENRD 3IXEA 5KWDA 2F8XK 3DEPA 4N5QA 4G8KA 5CBOA 4K5CA 5BXOA 2JABA 2DZNA 5KNHD 4HRLA 4U8VD 3TWXA 4BERA 4O1PA 2V5QC 2NYJA 4HRNA 5EYLA 2AJAA 1OT8A 5BXUA 5FIOA 3HG0D 3NOGD 4J8YA 3TWUA 2KXPC 1N11A 4DX1A 4J7WA 2Y0BG 3ZKJA 1SW6A 2HE0A 2RFMA 2ZGGA 3EHQA 4YDWA 5EILA 3TWVA 5AQ9A 5FINA 4A63B 4ZHBA 3UTMA 3J5PA 4O1OA 5KNGA 1WDYA 1K1AA 4K5AB 4HB5A 1D9SA 1MJ0A 1UOHA 2VGEA 4NIKA 5ENSD 5D66A 4DX5D 3V30A 5EIBE 2DVWA 3ZU7B 2BKGA 4LSZE 1TR4A 2F37A 2XEHA 1BI8B 2MYOA 3JXIA 3KEAA 4K5BA 4QQIA 5EIDA 1MX2A 5ENTD 4DRXE 5CEAA 4TUMA 4Z68A 1S70B 5JMND 3T9KA 2Y1LE 1G3NB 1A5EA 1BU9A 2ETBA 1IXVA 4B93B 5AQAA 1YCSB 4HQDA 5CBNA 1BLXB 4ATZD 1SVXA 5HKPA 1BI7B 1YYHA 4YDYA 5ENPD 5JA4D 2QC9A 2RFAA 3V2OA 2KBXA 4BESA 3V79K 2FO1E 3UXGA 5EN5D 1DC2A 1IHBA 4ZFHA 1K1BA 5AQBA 3V31A 5ENOD 3ZNGA 3NBNB 4G8LA 2BKKB 4U96D 3Q9NC 1IKND 2XZDG 3HRAA 4HI9A 4DX2A 2ETAA 4C48B 5AN8A 1K3ZD 1N0QA 4GPMA 4CZ2D 1MYOA 3F6QA 3AJIA 2XEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C5R A;  4CYM D;  2J8S D;  4RLY A;  4DUI A;  3TWR A;  4F6R D;  2XZT G;  1MX6 A;  4BSZ B;  5HRY A;  4HRM B;  4U95 D;  1AWC B;  2DWZ A;  4GMR A;  3JUE A;  3B7B A;  1QYM A;  1YMP A;  2F8Y A;  3LJN A;  4HI8 A;  5EYP F;  4DX7 D;  4O60 A;  3SO8 A;  5CED B;  5ENQ D;  3JXJ A;  3T8K A;  4HNA D;  5ITZ F;  5HS0 A;  5KBA A;  1N0R A;  2ZGD A;  4JB8 P;  3AAA C;  2A5E A;  2V4H C;  2QYJ A;  2ETC A;  5CER B;  3V2X A;  3UI2 A;  1BD8 A;  3TWQ A;  2PNN A;  4LNU D;  2DZO A;  4U8Y D;  3EHR A;  5AAO A;  4F1P A;  4QFV A;  3W9G A;  3TWT A;  2P2C P;  5CEC B;  5AQ7 A;  1AP7 A;  4LG6 A;  3ZUV B;  1OY3 D;  2L6B A;  5AAR A;  4DX6 D;  2XEN A;  3Q9U C;  4BEP A;  3NOC D;  2B0O E;  4HBD A;  1NFI E;  4OAU C;  3W9F A;  4BET A;  3EU9 A;  3TWW A;  4UUC A;  3DEO A;  1WG0 A;  3J5Q B;  3D9H A;  1MX4 A;  4OAV B;  1DCQ A;  4HLL A;  3B95 A;  3TWS A;  5ENR D;  3IXE A;  5KWD A;  2F8X K;  3DEP A;  4N5Q A;  4G8K A;  5CBO A;  4K5C A;  5BXO A;  2JAB A;  2DZN A;  5KNH D;  4HRL A;  4U8V D;  3TWX A;  4BER A;  4O1P A;  2V5Q C;  2NYJ A;  4HRN A;  5EYL A;  2AJA A;  1OT8 A;  5BXU A;  5FIO A;  3HG0 D;  3NOG D;  4J8Y A;  3TWU A;  2KXP C;  1N11 A;  4DX1 A;  4J7W A;  2Y0B G;  3ZKJ A;  1SW6 A;  2HE0 A;  2RFM A;  2ZGG A;  3EHQ A;  4YDW A;  5EIL A;  3TWV A;  5AQ9 A;  5FIN A;  4A63 B;  4ZHB A;  3UTM A;  3J5P A;  4O1O A;  5KNG A;  1WDY A;  1K1A A;  4K5A B;  4HB5 A;  1D9S A;  1MJ0 A;  1UOH A;  2VGE A;  4NIK A;  5ENS D;  5D66 A;  4DX5 D;  3V30 A;  5EIB E;  2DVW A;  3ZU7 B;  2BKG A;  4LSZ E;  1TR4 A;  2F37 A;  2XEH A;  1BI8 B;  2MYO A;  3JXI A;  3KEA A;  4K5B A;  4QQI A;  5EID A;  1MX2 A;  5ENT D;  4DRX E;  5CEA A;  4TUM A;  4Z68 A;  1S70 B;  5JMN D;  3T9K A;  2Y1L E;  1G3N B;  1A5E A;  1BU9 A;  2ETB A;  1IXV A;  4B93 B;  5AQA A;  1YCS B;  4HQD A;  5CBN A;  1BLX B;  4ATZ D;  1SVX A;  5HKP A;  1BI7 B;  1YYH A;  4YDY A;  5ENP D;  5JA4 D;  2QC9 A;  2RFA A;  3V2O A;  2KBX A;  4BES A;  3V79 K;  2FO1 E;  3UXG A;  5EN5 D;  1DC2 A;  1IHB A;  4ZFH A;  1K1B A;  5AQB A;  3V31 A;  5ENO D;  3ZNG A;  3NBN B;  4G8L A;  2BKK B;  4U96 D;  3Q9N C;  1IKN D;  2XZD G;  3HRA A;  4HI9 A;  4DX2 A;  2ETA A;  4C48 B;  5AN8 A;  1K3Z D;  1N0Q A;  4GPM A;  4CZ2 D;  1MYO A;  3F6Q A;  3AJI A;  2XEE A; 
#chains in the Genus database with same CATH topology
 2WQH A;  3SQV A;  4DUI A;  2QFC A;  5HRY A;  3CHQ A;  4H7X A;  2RKK A;  5BV0 A;  3JXJ A;  3T8K A;  5HS0 A;  5KBA A;  2Y4T A;  1BD8 A;  4WND A;  2CG3 A;  5FQ8 A;  5D0O D;  4TRQ A;  4QFV A;  3KSL A;  4JEU A;  2R02 A;  5AQ7 A;  5BV1 A;  4KXK B;  3QDN A;  1FT2 A;  4FHK A;  4IUL A;  3ZFW A;  3DEO A;  2XHE A;  3FUJ A;  3TWS A;  3E37 A;  4L2Y A;  1KLX A;  4D10 C;  1H6O A;  2DZN A;  1E90 A;  3ZVV A;  3ML9 A;  5CRV A;  3D9P A;  2EIN E;  1Y6I A;  2Y0B G;  4APF A;  1FVF A;  2E0I A;  5EIL A;  4ZHB A;  3RJV A;  5ENS D;  5LX8 A;  2XS8 A;  2FBN A;  2AVP A;  4K0R A;  5ENT D;  3CSF A;  1RW2 A;  2GGF A;  4GYW A;  3D9M A;  4B89 A;  4EBA G;  1O1R A;  3URZ A;  3CK8 A;  1BLX B;  4I43 A;  3RRN B;  5ENP D;  4RG9 A;  3HYM B;  1H2U A;  3LS8 A;  2VTB A;  1IHB A;  4W9R A;  3SBS A;  3ABM E;  3R9M A;  2C2L A;  4EZJ A;  3S7F A;  4LNB A;  3PEV B;  1S63 A;  5G05 J;  2AW6 A;  2BF0 X;  2FF4 A;  2DWZ A;  1E8Y A;  1YMP A;  2F8Y A;  4UWF A;  1EPU A;  3I4R B;  3ZHE B;  4UWH A;  2X6H A;  2Y3A A;  5ARG A;  3LJ3 A;  4FU3 A;  3UIO C;  4C0E A;  3G2T A;  3UIP C;  5AAO A;  3AG4 E;  2PL2 A;  3HXE A;  4RG6 A;  3LVR E;  3WXX A;  1H6P A;  1DCQ A;  4ILI A;  4AY6 A;  3CEQ A;  2AXV A;  2JAB A;  4CGW A;  2IU1 A;  4CRW A;  2R59 A;  4J8E A;  1OT8 A;  5CCL A;  3BG0 B;  5A7D B;  3E32 A;  3EHQ A;  3K9I A;  3NB2 A;  3T8M A;  2L6J A;  2HO1 A;  2J09 A;  4I9E A;  1SA4 A;  3NQP A;  3KEA A;  1S70 B;  4ILG A;  2A4Z A;  2H6H A;  2H6I A;  3FTX A;  1SVX A;  5HKP A;  1YYH A;  3Q73 A;  1KT0 A;  1N4Q A;  5JA4 D;  3V79 K;  3HVE A;  2B6C A;  3V31 A;  2H6G A;  3MX3 A;  3MCX A;  1N94 A;  2V4L A;  3Q5M A;  2LNI A;  4RLY A;  2XZT G;  4BWR A;  4KMO A;  2EIK E;  3PUK A;  4GZ5 A;  2CHX A;  3B7B A;  4I2Z A;  2GRR B;  3B7S A;  5C1D A;  2H6F A;  5BPP A;  5CER B;  4GZ6 A;  4JHJ A;  1TNB A;  4GTT A;  3PEU B;  3CHR A;  4GCO A;  4UQX A;  2X6I A;  4DJA A;  1DVP A;  2XGO A;  3NOC D;  5CRU A;  2ZU6 B;  1NA0 A;  4WNE A;  3UUX A;  1NA3 A;  1WG0 A;  2PQN A;  4ANV A;  4Y6W A;  3UIN C;  4UI9 J;  3DEP A;  3EJN A;  2XGS A;  1ZBP A;  2AXZ A;  3TWX A;  3EU5 A;  1B89 A;  3E34 A;  4P29 A;  3JUI A;  1TNZ A;  4HRN A;  4BSX A;  1LD7 A;  3HXF A;  2WXH A;  5AQ9 A;  3GZ1 A;  4TXR A;  4FP7 A;  5G05 C;  3PZ2 A;  3PZ3 A;  4JHR A;  3D9O A;  5IY5 E;  3QWV A;  1G3N B;  2WQ7 A;  3PUJ A;  4AOF A;  2BTD A;  1IXV A;  3ZPJ A;  2XPZ A;  3FTY A;  3MJW A;  2HYZ A;  2WMN A;  4WWN A;  1LF8 A;  3FUI A;  3L9T A;  3DPY A;  2X38 A;  1HO8 A;  4ZFH A;  4GZD A;  3AU4 A;  2XEV A;  3CQC B;  4ACK A;  2ETA A;  4GAA A;  3G2V A;  3F6Q A;  2VGX B;  3P1U A;  1TNO A;  4HRM B;  4K03 A;  4U95 D;  4I1M A;  2YNQ A;  3ENE A;  4HI8 A;  3CV0 A;  4GTP A;  1N0R A;  2QYJ A;  2ETC A;  2UWJ G;  3UM2 A;  3PH0 C;  2QYU A;  4WWP A;  3ZHE A;  5G55 A;  3RU0 A;  2DYR E;  2J08 A;  5EX3 A;  3ZGQ A;  1LD8 A;  3W9F A;  4ME2 A;  3DBS A;  3D9H A;  1ZB1 A;  4LEU A;  3JQ0 A;  4ABN A;  5ENR D;  1SQM A;  3QJZ A;  4ANW A;  5BXO A;  4TV3 A;  3IBE A;  4H7Y A;  5ARF A;  1OCZ E;  5FIO A;  3NOG D;  3TWU A;  3CHO A;  4J8Y A;  1DNP A;  2LAH A;  3DST A;  1TJC A;  3IKO B;  2AWI A;  4O1O A;  5KNG A;  2KAT A;  1D9S A;  3Q15 A;  3G2S A;  1NL4 A;  1HFA A;  3ZU7 B;  1N54 A;  2J9Q A;  3EDT B;  4I6G A;  2WVI A;  1NP7 A;  3ESK A;  2Y4U A;  2P58 C;  2L0T B;  3ZXP A;  2WXQ A;  3NZS A;  3TG5 A;  4B93 B;  3CR3 A;  3VTY A;  5CCM A;  5EKQ D;  2Y69 E;  4JL0 A;  2XCB A;  2WM9 A;  5AJD A;  3FTU A;  5EDS A;  3JQ1 A;  3ABL E;  2R2L A;  4U96 D;  1FCH A;  2P9P G;  3ABK E;  1H6K A;  2AXU A;  1H2V C;  1N4S A;  4B0Z A;  4F6R D;  1MX6 A;  1U3C A;  2WQ6 A;  2LO6 A;  3FWV A;  4UI9 C;  5FTP A;  4B8A A;  2NXP A;  3EIQ C;  3LJN A;  3SO8 A;  5ENQ D;  3FTZ A;  3CIA A;  3Q47 B;  2ZGD A;  3MV2 B;  4L9P A;  1PAQ A;  4LER A;  3CHP A;  1N95 A;  3FFL A;  1NI1 A;  3W9G A;  3RRU A;  1ELK A;  1Q2Z A;  5AAR A;  2XEN A;  3TWW A;  3R7Q A;  5A23 A;  3CVL A;  3KD7 A;  5JJ7 A;  1TNY A;  3UKR G;  4F1S A;  3CKC A;  3PRZ A;  2CFU A;  2OOE A;  1TJF A;  2KXP C;  3Q78 A;  3LY8 A;  3NZU A;  3JYS A;  5AJL A;  4NIK A;  1FPP A;  5KJL A;  4TUM A;  4HOU A;  3ZIM A;  3ISM C;  2WB2 A;  3OXG A;  3ONK A;  3KSQ A;  3CK9 A;  4A55 A;  2ETB A;  1E96 B;  3ASD A;  3VLE A;  4N39 A;  3LXU X;  5A6C A;  3APC A;  2CG2 A;  5EN5 D;  1ZU2 A;  3SF4 A;  4AIF A;  4HI9 A;  1E8X A;  4DX2 A;  3DXM G;  4CZ2 D;  1QZ2 A;  4JHK A;  2OVB A;  2R03 A;  2QY7 A;  3UM1 A;  4CT4 A;  2YHE A;  2PZI A;  4O60 A;  3FDH A;  3TGO A;  4X8Q A;  2C0M A;  2V4H C;  3ZYM A;  3TWQ A;  2PNN A;  4M7C A;  4L7T A;  2QZA A;  4ANX A;  1JPL A;  5E76 A;  1NFI E;  3WG7 E;  4BET A;  3CHM A;  5FJY A;  1DCE A;  2EIJ E;  5ANL A;  4U8H A;  4BTB A;  2OEV A;  4HRL A;  3C72 A;  2WXO A;  4NRH B;  4Q94 A;  4LRZ A;  3ZN3 A;  5FWQ A;  3DPD A;  4GU5 A;  4GTS A;  3UQ3 A;  2A5U A;  4KYO B;  3L54 A;  2Q7F A;  1MJ0 A;  4I17 A;  3D9K A;  4N5C A;  1IQR A;  3SGH A;  1O1T A;  2OCC E;  5EID A;  3SBT B;  4BFR A;  1A5E A;  1XNF A;  2L0I A;  1UG3 A;  5CBN A;  2IOS A;  3QNK A;  5FZQ A;  5FZR A;  3I5P A;  1N9A A;  4L1B A;  2P9S G;  1UJJ A;  2KBX A;  5E75 A;  4HFG A;  3ZYK A;  4WAF A;  4G23 A;  5CHE E;  5H7P A;  4GPM A;  3Q75 A;  4MKT A;  5HQ8 A;  3ASF A;  4I1O B;  2MOW A;  2E2E A;  3O48 A;  3DWL G;  5J90 A;  3IHV A;  4DI4 A;  4O6F A;  4EQF A;  1SZ9 A;  1K8K G;  3U4T A;  2HR2 A;  2GRN B;  2V8S E;  5FQ7 A;  3PZ4 A;  4GA1 A;  3CVU A;  3Q9U C;  3RSE G;  2VSO E;  1EDU A;  1N4P A;  4JC8 A;  3J5Q B;  1MX4 A;  5KJN A;  4L2L A;  2KCL A;  5LOZ A;  2ZIR A;  3HXC A;  1YA0 A;  3RK6 A;  4U8V D;  2EIM E;  4GTM A;  3N71 A;  4CT0 A;  4XKB A;  3PRE A;  3TWV A;  2ZGG A;  4YDW A;  4A63 B;  4A3T A;  2P9K G;  2KCV A;  2DVW A;  4I1A A;  2IQC A;  1LTX A;  3ZRH A;  4ACL A;  1JCR A;  4CDR A;  2ZIS A;  3MZL B;  3UM0 A;  1IHG A;  3UM3 A;  3ULQ A;  3CVY A;  5D2M C;  2RFA A;  3RO3 A;  1MZC A;  3HDX A;  4G8L A;  3FUH A;  3ASO E;  3U64 A;  1WY6 A;  2XS1 A;  3D9I A;  4MS6 A;  4AEZ C;  4F7A A;  4XIF A;  1HZ4 A;  4BY6 A;  5HI7 A;  3VLF A;  4A1S A;  4URK A;  2P9U G;  1L5J A;  1D8E A;  1INZ A;  2XRY A;  3ASN E;  3AS5 A;  2DZO A;  4U8Y D;  3TWT A;  4OVU A;  1V55 E;  3MA5 A;  3PVL A;  3SFX A;  4PS3 A;  3IHY A;  3CVX A;  3MKQ B;  4EEC A;  3B7R L;  3RO2 A;  3IXE A;  1TYQ G;  4O1P A;  3FUF A;  4A1G A;  2NYJ A;  4EZL A;  1KZP A;  2I9C A;  1ELW A;  3CGH A;  1TEZ A;  2XQ0 A;  5B3S E;  2MRI A;  2RG8 A;  1S0P A;  4CDM A;  3UT4 A;  1TR4 A;  2L9B A;  1S64 A;  4GMJ A;  2ILR A;  3BEE A;  3UPV A;  5ENN A;  5JJT A;  2ZXW E;  5AQA A;  3E4B A;  4HQD A;  4JW1 A;  3ULE G;  2JEK A;  4JA9 A;  3SFY A;  4YVQ C;  4GA2 A;  1OCO E;  3V2O A;  1N52 A;  3UXG A;  4UWK A;  4APO A;  3LPZ A;  2XZD G;  3HRA A;  3MEK A;  1N0Q A;  3AJI A;  4JD2 G;  4B8C B;  4Q69 A;  4BSZ B;  4KVO A;  3FU6 A;  1QYM A;  3LVQ E;  3CHS A;  1U3D A;  2I6H A;  3IV0 A;  2LUH A;  3AAA C;  2A5E A;  2LXL A;  3V2X A;  3FUE A;  1MHQ A;  4LNG A;  3O4Z A;  4F1P A;  3JCK C;  1OY3 D;  4DX6 D;  3D9L A;  3U3W A;  2B0O E;  4HBD A;  4GA0 A;  1Z3Y A;  5B1A E;  4IRU A;  3LDZ A;  3FTW A;  2F8X K;  4MRU A;  1JCQ A;  1E7U A;  5CBO A;  4K5C A;  2IEJ A;  5KNH D;  3UMV A;  3FTV A;  3PDN A;  5EYL A;  2AJA A;  2I1K A;  3KEZ A;  2XPY A;  2HE0 A;  3CVP A;  3C3R A;  3QAR A;  4GTV A;  3PE3 A;  3S7B A;  4G2V A;  1TN8 A;  2J4B A;  4HB5 A;  4BT8 A;  4F53 A;  4FJZ A;  5EIB E;  3Q49 B;  3AS4 A;  3V30 A;  4XE0 A;  4U7E B;  3BG1 B;  4B94 A;  1BU9 A;  3VLD A;  2LSV A;  1JCS A;  3AG3 E;  3G2U A;  4UWG A;  1UW4 B;  4LCT A;  4F3V A;  4GPK A;  4XZ4 A;  5FQ4 A;  3PNT B;  2LSU A;  2QC9 A;  3EIJ A;  4YVO A;  4JA7 A;  1K1B A;  3GZS A;  5ENO D;  4JXT A;  5FQ6 A;  2KM4 A;  2BKK B;  3L16 A;  1K3Z D;  4YND A;  3S7D A;  1IYG A;  3C5R A;  5G04 J;  4YDE A;  4BTA A;  4CDN A;  1HG2 A;  4FA6 A;  1UN8 A;  3CVN A;  4M3O A;  3SNX A;  4AP2 A;  3FUK A;  4NQ0 A;  3SY2 A;  5CED B;  3T5X A;  4KT6 B;  3HXD A;  3U66 A;  3OXL A;  2OND A;  4MLP A;  2EIL E;  1H0A A;  4A3V A;  3EHR A;  2WMO A;  3CKB A;  1JUQ A;  1QBQ A;  1KT1 A;  4G24 A;  2GRM A;  3APF A;  4NAC A;  4XX5 A;  5CMY A;  4TXQ A;  2OEW A;  4N5Q A;  4G8K A;  3C3Q A;  3MKQ A;  4BER A;  3DSS A;  1JWG A;  3SHF A;  3MV3 B;  2XPI A;  4DX1 A;  4EPZ A;  1QNF A;  1OWN A;  5BNW A;  4BX9 A;  3UTM A;  4WNF A;  3OXF A;  3RIB A;  1H19 A;  2DIW A;  3FUN A;  4DLO A;  2X6F A;  4I6E A;  3UT8 A;  3HIZ A;  4G25 A;  4DRX E;  4BX8 A;  3T9K A;  3UX4 A;  4FLB A;  4CEM A;  3FU0 A;  4GML A;  1YCS B;  3CVQ A;  4U0U A;  4KZ0 A;  3DSW A;  3DRA A;  4I6J A;  3UKU G;  3Q9N C;  2HM8 A;  4AVX A;  4U0Z A;  4C48 B;  2KCK A;  3LEW A;  1A17 A;  2J8S D;  3RRM B;  1UN9 A;  3TWR A;  3ASG A;  3U9W A;  3L22 A;  4FC8 A;  4PH4 B;  5T4Y A;  3QAQ A;  5ITZ F;  3CVW A;  4JB8 P;  2GRP B;  2X6J A;  3APD A;  5LFA A;  2WXJ A;  4J6I A;  3BUA A;  2IJG X;  4TXP A;  5CEC B;  3FU3 A;  3C98 A;  2P9N G;  1SA5 A;  1XGW A;  1H2T C;  4JZY A;  3SZ7 A;  3G2W A;  2VGX A;  4AM9 A;  3ZEF A;  1WM5 A;  3Q7A A;  3FH8 A;  1Z6T A;  2YQ8 A;  3T5V A;  4E6H A;  2GRQ B;  3EHM A;  5LP0 A;  2CHW A;  3QB2 A;  4Z68 A;  1SW6 A;  3S7J A;  4Y6C A;  4EBA A;  5FIN A;  1HG5 A;  1P5Q A;  1K1A A;  2WXP A;  3E33 A;  4IN3 B;  4N3A A;  5G04 C;  5D66 A;  4OYS A;  4UWL A;  3DXK G;  4HXI A;  2F37 A;  1Z5S C;  1WAO 1;  3OAW A;  3VTX A;  3SI5 A;  4WUY A;  2VSX E;  5AYW D;  1OUV A;  3GZ2 A;  4JPS A;  4OVV A;  5FT9 A;  4N2Q A;  2VJ8 A;  4DPR A;  2WXI A;  3AG2 E;  1IKN D;  3B7T A;  4AV7 A;  3QOU A;  5G2N A;  1UJK A;  3FTS A;  4XEI G;  2MHK A;  3TJP A;  3R9A B;  1AWC B;  3NAW A;  1OCC E;  5EX0 A;  3FH7 A;  3AU5 A;  1ELR A;  4HNA D;  3FUD A;  5M72 A;  2WXR A;  1PY1 A;  4C0M A;  3LCA A;  4HLE A;  3Q79 A;  1X5B A;  2WXG A;  2L6B A;  4HOS A;  4XKC A;  4GTR A;  1RZ4 A;  3FY4 A;  1TNU A;  4IYP A;  3MYV A;  5FZS A;  1KZO A;  3ZW3 A;  3FH5 A;  2VSY A;  2UY1 B;  4JVS A;  4KZC A;  4PUC A;  3ONL A;  2IOL A;  4U07 A;  4U04 A;  4HOQ A;  5DBK A;  2YHC A;  1UOH A;  4NUR A;  4DX5 D;  5BW8 C;  2OV8 A;  4LSZ E;  4C9B B;  3JXI A;  3NBN B;  2J07 A;  1MX2 A;  3L08 A;  4U63 A;  1U2V G;  2F0Y A;  2YIN A;  5BUZ A;  3UT7 A;  2IF4 A;  4R7L A;  2WXK A;  4GYY A;  4YDO A;  3HHM A;  2ION A;  3R7R A;  1NZN A;  2P9I G;  1FVH A;  4ILH B;  3ZYL A;  2GRO B;  3LYA A;  5EYP F;  3B13 A;  2X3M A;  4FLH A;  3KAE A;  1HF8 A;  2KZT B;  2WXM A;  5LCW C;  3EUV A;  3ESL A;  5AEN A;  5J08 A;  1TN7 A;  2P2C P;  4J0U A;  3AG1 E;  1AP7 A;  1GW6 A;  3PZ1 A;  4BEP A;  3LKU A;  2DYS E;  1E7V A;  4AJW A;  3ASH A;  3PZD A;  3ZXS A;  4LUN U;  4FAD A;  4GTQ A;  3I4G A;  4G11 A;  1OCR E;  3BQO A;  3D9J A;  1PC2 A;  1D8D A;  5AIJ A;  4GYO A;  2M63 A;  3QWP A;  4N3C A;  4GZ3 A;  3QKY A;  4HS2 A;  1WDY A;  4DK5 A;  4WNG A;  1BPO A;  2VGE A;  4I2W A;  2IFU A;  2DCP A;  3NF1 A;  5JMN D;  2VYI A;  3MGB A;  4MBG A;  3FUL A;  3BU8 A;  5ANR A;  2NC9 A;  2R5S A;  4PS7 A;  4E85 A;  5CMW A;  2KC7 A;  5AN8 A;  2DBA A;  2R05 A;  4J8S A;  3S2A A;  4AY5 A;  2WXN A;  3LY9 A;  4G1T A;  1W3B A;  4N2S A;  3D9N A;  4WWO A;  3PNL B;  2C0L A;  2BED A;  4RVB A;  4EHM A;  2FEZ A;  3QK0 A;  4AXH A;  3SFZ A;  2PQR A;  1HS6 A;  4LG6 A;  4GB9 A;  3PE4 A;  4ANU A;  5KCM A;  3P2B A;  3GW4 A;  4UUC A;  4RQI A;  1EYH A;  3Q7F A;  4HLL A;  5T3R A;  3L17 A;  4RSY A;  3TXM A;  4CCA A;  2V5Q C;  3Q4A B;  5D0Q D;  5BXU A;  2XCC A;  2LAI A;  1KPS B;  2CHZ A;  3L82 A;  2UY1 A;  3J5P A;  2FUL A;  3I3N A;  3AS8 A;  4J8F A;  2GW1 A;  1Z3X A;  2XEH A;  5BT1 A;  2MYO A;  3CLJ A;  4V3I A;  2Y1L E;  3CK7 A;  1E8W A;  4EZK A;  4Q96 A;  1TN6 A;  1HXI A;  4GZC A;  1IQU A;  5AQB A;  1V54 E;  4HOR A;  3KS2 A;  4XI0 A;  3RAU A;  2J49 A;  1OWL A;  4CYM D;  5JHA A;  3SD5 A;  1O1S A;  2V5F A;  4FHJ A;  3PS6 A;  3E30 A;  4G26 A;  1X81 A;  4ATG A;  3ULY A;  3UI2 A;  1OWM A;  5DIZ A;  4LNU D;  1QQE A;  2WXL A;  2KZT A;  4BT9 A;  3ZUV B;  4UQY A;  2V0P A;  2IO3 C;  2EQX A;  3DSU A;  1HE8 A;  2IY0 C;  3TXN A;  4GTO A;  4OAV B;  3DSV A;  3B95 A;  5KWD A;  2JLB A;  1N4R A;  3CQG B;  2OVF A;  3HG0 D;  4UI9 K;  2RFM A;  2X6K A;  2LXM A;  3FP3 A;  1HX8 A;  2NSZ A;  3FU5 A;  5JJ6 A;  2IO2 C;  1OWP A;  2VSN A;  3MKR A;  3IEG A;  2VTB B;  1Y8M A;  4ATZ D;  1BI7 B;  2I2O A;  1O5M A;  3FEY A;  2FO1 E;  1DC2 A;  3QWW A;  2PM6 A;  3FUM A;  3ZNG A;  2GRL A;  1VDY A;  4PDX A;  4U0S A;  2CFZ A;  5KJK A;  2XEE A;  4DI3 A;  4KBQ A;  3QC1 A;  2I1J A;  2P9L G;  4N3B A;  3CVV A;  4FUL A;  4GMR A;  3JUE A;  2VQ2 A;  4DX7 D;  3GYZ A;  3HXB A;  4UQZ A;  1FT1 A;  2XGM A;  3ZYQ A;  2WXF A;  5KJM A;  3LY7 A;  3FHE A;  3L13 A;  1OXJ A;  4HVB A;  1HU3 A;  1MQS A;  5B1B E;  1JWF A;  2XRZ A;  4OAU C;  3EU9 A;  4JEH A;  3OTN A;  4J8D A;  4I9C A;  4KVM A;  4HOT A;  3X2Q E;  5T8I A;  4L23 A;  5JHB A;  3RKV A;  2R17 C;  1OWO A;  4CGV A;  1N11 A;  4J7W A;  3ZKJ A;  2VGY A;  4K5A B;  2PM7 A;  2FO7 A;  4TUU A;  5C2Y A;  2BKG A;  1SZA A;  1BI8 B;  4K5B A;  4QQI A;  3D3M A;  5CEA A;  2FI7 A;  3C3O A;  3TL5 A;  3FEX A;  4FJY A;  1HH8 A;  3L6A A;  1E8Z A;  3HVE B;  4PS8 A;  3TAX A;  4XI9 A;  4YDY A;  5LCW J;  2WPV A;  1EF1 C;  4BES A;  3CST A;  2BUG A;  3TG4 A;  3EHN A;  2RD0 A;  4GCN A;  3ML8 A;  3DSX A;  2J4D A;  4DLQ A;  3B7U X;  1MYO A; 
#chains in the Genus database with same CATH homology
 3C5R A;  4CYM D;  2J8S D;  4RLY A;  4DUI A;  3TWR A;  4F6R D;  2XZT G;  1MX6 A;  4BSZ B;  5HRY A;  4HRM B;  4U95 D;  1AWC B;  2DWZ A;  4GMR A;  3JUE A;  3B7B A;  1QYM A;  1YMP A;  2F8Y A;  3LJN A;  4HI8 A;  5EYP F;  4DX7 D;  4O60 A;  3SO8 A;  5CED B;  5ENQ D;  3JXJ A;  3T8K A;  4HNA D;  5ITZ F;  5HS0 A;  5KBA A;  1N0R A;  2ZGD A;  4JB8 P;  3AAA C;  2A5E A;  2V4H C;  2QYJ A;  2ETC A;  5CER B;  3V2X A;  3UI2 A;  1BD8 A;  3TWQ A;  2PNN A;  4LNU D;  2DZO A;  4U8Y D;  3EHR A;  5AAO A;  4F1P A;  4QFV A;  3W9G A;  3TWT A;  2P2C P;  5CEC B;  5AQ7 A;  1AP7 A;  4LG6 A;  3ZUV B;  1OY3 D;  2L6B A;  5AAR A;  4DX6 D;  2XEN A;  3Q9U C;  4BEP A;  3NOC D;  2B0O E;  4HBD A;  1NFI E;  4OAU C;  3W9F A;  4BET A;  3EU9 A;  3TWW A;  4UUC A;  3DEO A;  1WG0 A;  3J5Q B;  3D9H A;  1MX4 A;  4OAV B;  1DCQ A;  4HLL A;  3B95 A;  3TWS A;  5ENR D;  3IXE A;  5KWD A;  2F8X K;  3DEP A;  4N5Q A;  4G8K A;  5CBO A;  4K5C A;  5BXO A;  2JAB A;  2DZN A;  5KNH D;  4HRL A;  4U8V D;  3TWX A;  4BER A;  4O1P A;  2V5Q C;  2NYJ A;  4HRN A;  5EYL A;  2AJA A;  1OT8 A;  5BXU A;  5FIO A;  3HG0 D;  3NOG D;  4J8Y A;  3TWU A;  2KXP C;  1N11 A;  4DX1 A;  4J7W A;  2Y0B G;  3ZKJ A;  1SW6 A;  2HE0 A;  2RFM A;  2ZGG A;  3EHQ A;  4YDW A;  5EIL A;  3TWV A;  5AQ9 A;  5FIN A;  4A63 B;  4ZHB A;  3UTM A;  3J5P A;  4O1O A;  5KNG A;  1WDY A;  1K1A A;  4K5A B;  4HB5 A;  1D9S A;  1MJ0 A;  1UOH A;  2VGE A;  4NIK A;  5ENS D;  5D66 A;  4DX5 D;  3V30 A;  5EIB E;  2DVW A;  3ZU7 B;  2BKG A;  4LSZ E;  1TR4 A;  2F37 A;  2XEH A;  1BI8 B;  2MYO A;  3JXI A;  3KEA A;  4K5B A;  4QQI A;  5EID A;  1MX2 A;  5ENT D;  4DRX E;  5CEA A;  4TUM A;  4Z68 A;  1S70 B;  5JMN D;  3T9K A;  2Y1L E;  1G3N B;  1A5E A;  1BU9 A;  2ETB A;  1IXV A;  4B93 B;  5AQA A;  1YCS B;  4HQD A;  5CBN A;  1BLX B;  4ATZ D;  1SVX A;  5HKP A;  1BI7 B;  1YYH A;  4YDY A;  5ENP D;  5JA4 D;  2QC9 A;  2RFA A;  3V2O A;  2KBX A;  4BES A;  3V79 K;  2FO1 E;  3UXG A;  5EN5 D;  1DC2 A;  1IHB A;  4ZFH A;  1K1B A;  5AQB A;  3V31 A;  5ENO D;  3ZNG A;  3NBN B;  4G8L A;  2BKK B;  4U96 D;  3Q9N C;  1IKN D;  2XZD G;  3HRA A;  4HI9 A;  4DX2 A;  2ETA A;  4C48 B;  5AN8 A;  1K3Z D;  1N0Q A;  4GPM A;  4CZ2 D;  1MYO A;  3F6Q A;  3AJI A;  2XEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...