1A5EA

Solution nmr structure of tumor suppressor p16ink4a, 18 structures
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
156
structure length
156
Chain Sequence
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TUMOR SUPPRESSOR P16INK4A
publication title Tumor suppressor p16INK4A: determination of solution structure and analyses of its interaction with cyclin-dependent kinase 4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Anti-oncogene
total genus 26
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 1998-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1a5eA00
1BLXB 4LNUD 5CBOA 2PNNA 4DX5D 2RFAA 2XEHA 3DEPA 4CYMD 3NBNB 4F1PA 2KBXA 5ENQD 5AQ7A 4K5BA 3B7BA 3UTMA 3Q9UC 3ZU7B 2XZTG 5AAOA 4UUCA 2DZNA 2DWZA 4Z68A 2BKKB 1BU9A 4DX2A 4JB8P 3JXIA 5EIBE 1K3ZD 4TUMA 2ETCA 2BKGA 3EHRA 5HS0A 4DX6D 1IKND 1K1AA 3F6QA 1MX4A 5KNGA 3TWSA 3AJIA 1BI8B 1SW6A 4C48B 5EIDA 4DUIA 2XZDG 5AQ9A 4B93B 2B0OE 5KBAA 1MYOA 5D66A 1IXVA 3KEAA 4YDWA 5AARA 3TWXA 5CECB 1IHBA 1N11A 4DX1A 3EHQA 3JUEA 1SVXA 1N0RA 3V2XA 4YDYA 3SO8A 4HRMB 3ZNGA 4DRXE 5EILA 4LSZE 5AN8A 3UI2A 4ATZD 3LJNA 4U95D 4HI9A 2DZOA 2ZGGA 4GMRA 5FINA 5KNHD 3W9FA 4BSZB 5JA4D 3NOGD 1A5EA 5EYPF 4J7WA 5ENPD 3T9KA 4HQDA 5CEAA 1TR4A 3UXGA 4OAVB 1BI7B 3TWUA 5ENRD 3J5QB 2Y1LE 4BETA 1AWCB 2MYOA 3TWVA 5JMND 2V5QC 2J8SD 4K5CA 4GPMA 4O1OA 3IXEA 2P2CP 4BESA 1YMPA 4ZFHA 5ITZF 2ETAA 5ENTD 3EU9A 4HLLA 4LG6A 5CERB 1OT8A 1K1BA 4K5AB 1MJ0A 3Q9NC 1N0QA 4U8YD 2QC9A 1MX6A 4HB5A 4G8LA 4BEPA 3J5PA 4HNAD 4O1PA 3V79K 4HI8A 2F37A 2ETBA 3JXJA 3TWQA 5AQAA 3DEOA 3W9GA 1YCSB 2JABA 1DCQA 1DC2A 4BERA 2DVWA 5ENOD 5EYLA 2NYJA 3HG0D 4HRLA 3C5RA 3V30A 4QQIA 1AP7A 3V31A 2KXPC 3ZKJA 2XEEA 4RLYA 2L6BA 1QYMA 2ZGDA 2F8YA 5HKPA 2QYJA 4O60A 4NIKA 5EN5D 1YYHA 2XENA 4J8YA 2V4HC 3B95A 3T8KA 4CZ2D 4OAUC 2FO1E 3AAAC 1BD8A 5FIOA 2A5EA 2HE0A 1WG0A 1MX2A 3NOCD 4QFVA 1WDYA 4U8VD 1D9SA 4DX7D 3TWTA 3ZUVB 5KWDA 4G8KA 3V2OA 1OY3D 4N5QA 1S70B 1UOHA 2Y0BG 5AQBA 4ZHBA 4HRNA 3D9HA 3TWRA 2F8XK 5CBNA 4HBDA 3HRAA 5ENSD 2RFMA 4A63B 5BXOA 5CEDB 5BXUA 4F6RD 5HRYA 2AJAA 1NFIE 2VGEA 1G3NB 4U96D 3TWWA
chains in the Genus database with same CATH superfamily
1A17A 5KJLA 4GTQA 5FZSA 3UM3A 3NBNB 4EECA 2KBXA 4F1PA 3UTMA 3ZU7B 2IFUA 1BU9A 1XGWA 5EIDA 4EZJA 3QDNA 1ZB1A 2PZIA 4E6HA 2B0OE 4GTOA 1SVXA 4AV7A 3ZN3A 3C72A 1LD7A 3G2UA 3S7FA 2GRNB 3FU0A 2IEJA 2R2LA 2J4BA 3VLEA 5KJKA 4FHKA 3FUKA 4HLLA 2Y4UA 4K5AB 3B7RL 2L6JA 1JCQA 1MHQA 1DC2A 2PM6A 3UIPC 3Q49B 5ENOD 1U3CA 1S63A 1UW4B 3C5RA 1S0PA 3GZ2A 4HOQA 3FTXA 4RLYA 3SNXA 4B94A 3ZYMA 2GRQB 3DSUA 4RQIA 2R17C 2VJ8A 3CSTA 3TGOA 2IOLA 1D9SA 5KWDA 2IY0C 2Y0BG 4UWKA 2F8XK 3SHFA 3QK0A 5ENSD 2RFMA 5HQ8A 5C2YA 3G2WA 2F0YA 2L9BA 2PQNA 3GZSA 3RU0A 1VDYA 5AJLA 4HORA 3HYMB 4HVBA 4J8SA 3FUMA 4ILHB 1OWLA 1H6PA 4Y6CA 5A23A 5G2NA 2MRIA 3JXIA 3PZ3A 5D2MC 2VSNA 5KNGA 3CVUA 2XZDG 4B93B 1IXVA 2WPVA 3AG1E 2WM9A 2WXIA 3R7QA 3V2XA 4I6GA 2DIWA 4ATZD 1TNBA 2XS1A 5ENPD 3SF4A 3L08A 3FTSA 3LJ3A 3R9AB 2P9IG 4U04A 5JMND 4KVMA 5ITZF 3FEXA 3Q47B 3D9JA 4JHKA 4HNAD 4XIFA 1DCQA 3E37A 1JWGA 5ANRA 5CRVA 2OEVA 4FJYA 4PS8A 3UT8A 4GZ3A 3RRNB 3PEUB 3UX4A 1Y8MA 3SFXA 3TJPA 2DYRE 3MCXA 3O4ZA 4FU3A 3R7RA 5B3SE 1WDYA 4H7XA 3ZUVB 2X6IA 1UJJA 3FH8A 3URZA 4IULA 3D9HA 2CFZA 2WXMA 3CVQA 4F6RD 2VYIA 5J90A 3S7JA 3VTYA 5LP0A 2RKKA 1BLXB 3D9OA 3RO2A 4XI9A 1OWMA 3FTVA 1HE8A 3TXMA 2AW6A 5FQ8A 3P2BA 1PAQA 4Z68A 3L54A 4CDMA 4A55A 4M7CA 3LPZA 1FVHA 1MX4A 2WXKA 3MV3B 1N4PA 4I17A 3KEAA 2ILRA 5FQ7A 3RRMB 3PRZA 3IHVA 2E0IA 4P29A 4LSZE 4DLQA 3IBEA 3UM0A 4C0MA 4MS6A 3J5QB 5ENRD 2FF4A 3GYZA 3IXEA 3U9WA 3EU9A 5FZQA 3UT4A 2VSYA 4KZ0A 2CHZA 2OOEA 3HXFA 1SA5A 4YVOA 4EZKA 3LY7A 4I1AA 3ZEFA 3V31A 2KCKA 1DNPA 4LNGA 4WNDA 3PE3A 3DBSA 1XNFA 1SZ9A 4A3VA 4WWPA 2WXQA 3RAUA 3Q4AB 1KZOA 4N5QA 1S70B 4WWNA 5CEDB 3T5VA 1ELRA 2GGFA 1DCEA 4F3VA 4GCNA 4U96D 1TYQG 4CGVA 3D9PA 5AENA 2R02A 3PNTB 4DX5D 4UWLA 3C3QA 1O1TA 1OWNA 2DWZA 3FU5A 1E8XA 1E8YA 2PM7A 4LERA 1NL4A 1TN6A 1TNZA 3CHMA 4A1GA 2Y69E 1Z3XA 5ARGA 4XZ4A 4U8HA 3JQ0A 1IHBA 3FTZA 4WNEA 3RJVA 4J6IA 4DI4A 3Q15A 4BSZB 3UXGA 2IO2C 3S7DA 5CHEE 2GRLA 4N3BA 2MYOA 3ZW3A 2XCBA 4JEHA 4RG9A 1K1BA 4GU5A 2VSXE 2EIKE 3TWQA 2H6FA 4I6EA 2EIME 4AXHA 3EHMA 2EINE 2NYJA 3UMVA 1QBQA 3QJZA 2KXPC 2L6BA 4JD2G 3B95A 3FWVA 4HOSA 4N2SA 1BD8A 3NAWA 4PH4B 4DX7D 1H6KA 1OY3D 1KT0A 4G23A 1N52A 3BG0B 3OAWA 4NQ0A 3EDTB 2XEHA 1K8KG 1FPPA 4N3AA 3C98A 3JYSA 3P1UA 1NA3A 4I43A 3D9KA 5G55A 5HI7A 4FA6A 4LRZA 1O5MA 3QC1A 2EQXA 1N11A 5E76A 3PZ4A 3ABME 4XKBA 2KM4A 1OWOA 3GZ1A 3LJNA 2L0TB 4GMRA 3PZ2A 3FTYA 5EYPF 3T9KA 1TR4A 1W3BA 2XPZA 1IHGA 3TWUA 3HXBA 3KSLA 2WQ7A 2X38A 3DPDA 4ZFHA 5CERB 2XQ0A 2XHEA 2MHKA 1X5BA 2P9UG 3AS8A 2P9NG 3CVYA 2YINA 3TL5A 3NB2A 4O1PA 2C2LA 2F37A 4ANXA 5AQAA 3G2TA 3GW4A 1UG3A 4GA0A 4DPRA 1YCSB 3CV0A 5G04J 3I3NA 3EIJA 3PZ1A 1Z5SC 4BERA 5B1BE 1N9AA 2LXLA 4G26A 3D9NA 3I4RB 1ZBPA 2J07A 3S7BA 4ANVA 4W9RA 4OAUC 2KCLA 3SBTB 2A5EA 2HE0A 5IY5E 4WNGA 4HFGA 4CGWA 3V2OA 1HX8A 1LD8A 5FQ6A 1NFIE 2VGEA 4UI9C 4NURA 4UWHA 3IEGA 2RFAA 2WXGA 3CQGB 3CKBA 2R03A 3G2SA 2XZTG 4UUCA 3CVLA 1EYHA 5FQ4A 4U0SA 4N3CA 2BKGA 1K1AA 4KYOB 1SW6A 2IQCA 2GRMA 5KBAA 5AARA 4H7YA 3LEWA 3FTWA 4YDYA 4PUCA 2WMNA 2J08A 3G2VA 4GYYA 1OUVA 4IYPA 4PS3A 1YMPA 4BSXA 1OXJA 1PY1A 3AS4A 3FFLA 2WXHA 4GB9A 3LVQE 3CHOA 3SZ7A 3FUHA 5LCWC 3K9IA 1HO8A 4AM9A 5HKPA 2QYJA 4GA1A 4NIKA 3DPYA 4KT6B 3AAAC 4OVUA 5DBKA 4AOFA 5AQBA 2X3MA 3TWRA 1D8DA 2X6FA 4BT8A 3ML8A 4J8FA 3ONLA 3NZUA 2C0LA 3AU5A 3ENEA 2P9LG 3BUAA 2GW1A 2FI7A 2I1KA 4K5BA 4I9CA 3ASOE 2OV8A 4DX2A 4BFRA 3LKUA 2ETCA 3QNKA 2V4LA 4DX6D 4I1MA 5M72A 1HU3A 2ZIRA 4K03A 3C3OA 5LX8A 2CFUA 4CDRA 4OYSA 4U95D 5FINA 4HI9A 4Q69A 1U3DA 5FWQA 5D0OD 5ARFA 1BI7B 4KVOA 3FH7A 4O1OA 3ESKA 2P2CP 3LVRE 4TRQA 1OT8A 4L2LA 2I9CA 4DLOA 4FC8A 1JUQA 4EHMA 4ILGA 5G05C 4ME2A 2BUGA 3EIQC 2IJGX 2Y4TA 2OEWA 3DSWA 1WM5A 3AG3E 2M63A 4AVXA 2I2OA 2J4DA 4CZ2D 1HG2A 1Z6TA 1N94A 3NOCD 4GPKA 4OVVA 5EX3A 4G8KA 2V0PA 4FJZA 2XCCA 4J0UA 2OCCE 5HRYA 3CR3A 4G1TA 2LUHA 1OCOE 1G3NB 4TUMA 3TWWA 4LCTA 4AY6A 3ULYA 5CRUA 5A7DB 3TG5A 3KS2A 3QOUA 1K3ZD 3B7UX 1WAO1 4HOTA 1IKND 2JLBA 3F6QA 2VGXB 1BI8B 3L82A 5D66A 4YDWA 1TNUA 4DX1A 3JUEA 3CVWA 2BF0X 4DRXE 2J49A 3NOGD 3PREA 3PH0C 4DJAA 1JCRA 1OCCE 3SI5A 3CEQA 1H0AA 2Y1LE 4N39A 5T8IA 2YQ8A 2R05A 4BTAA 4LG6A 3QWVA 1HS6A 1TN8A 3ASHA 2RG8A 2CHWA 4HS2A 2OVBA 5BNWA 4YDEA 4JZYA 4ANUA 2V8SE 4QQIA 3MJWA 1V54E 3VTXA 5JJTA 1GW6A 4J8YA 2LSUA 4URKA 1HG5A 3EU5A 3PS6A 2DYSE 5AJDA 4BT9A 4WWOA 2PQRA 3HRAA 4KMOA 1YA0A 3RRUA 1QNFA 2AJAA 1LF8A 2XGOA 4LNUD 4GTMA 4FADA 2JEKA 4GZDA 4FULA 3UPVA 2DZNA 4JB8P 4B8AA 2HO1A 4DUIA 1H6OA 4I6JA 3LY9A 3CSFA 2LAHA 2H6HA 3TWXA 5CECB 4MRUA 2LSVA 3QKYA 3UQ3A 5AYWD 1H19A 1KT1A 2QY7A 2VGXA 3CHQA 3LDZA 3FUNA 2J9QA 3CVVA 4BETA 4R7LA 2V5QC 4ANWA 3RK6A 5FJYA 3SGHA 3APFA 3PZDA 2Y3AA 4GTRA 2QC9A 3ZIMA 4G8LA 1IYGA 3DEOA 2BTDA 3CHRA 3NQPA 5JJ6A 4I2ZA 3T8MA 3HG0D 1HH8A 3RSEG 3KEZA 4F7AA 1DVPA 3TAXA 4LNBA 2F8YA 4CRWA 3AG2E 2UWJG 3UKRG 3FUIA 3D9LA 3MKQA 2FEZA 5CMWA 3AG4E 4GCOA 4HRNA 1OCRE 3DSXA 3ULQA 1TNYA 5BXOA 3CK8A 3HVEB 4TXPA 2P58C 3FULA 1JCSA 1L5JA 4L2YA 2HR2A 4B89A 1U2VG 4U07A 3WXXA 3ZXSA 3HXCA 3B7TA 4G2VA 2KZTB 5HS0A 4GZ6A 5JHBA 2ZXWE 4PS7A 3OXLA 5B1AE 2IO3C 2FO7A 2PL2A 4JXTA 1N0RA 4ACKA 1KPSB 3OTNA 4N5CA 3B7SA 4J8EA 4V3IA 2ZGGA 4LUNU 2J09A 1HZ4A 3CHPA 3U3WA 2I1JA 2IOSA 4X8QA 2NSZA 3BQOA 2ETAA 3ISMC 1JWFA 1ZU2A 1MJ0A 3QWWA 4U8YD 3ABLE 2H6GA 5T3RA 4BEPA 2NC9A 3FUDA 3JXJA 5KJMA 3E33A 4C9BB 3LS8A 2WQ6A 3V30A 2GRPB 3WG7E 1N4RA 3OXFA 2P9KG 1QYMA 4GYWA 4M3OA 1UJKA 3SD5A 5FIOA 4E85A 4HOUA 2YHEA 1INZA 3MX3A 4G25A 5CBNA 1IQUA 4N2QA 3FUJA 4G11A 1N4SA 3U4TA 3DWLG 5LFAA 2XEVA 3LYAA 3CVPA 4BWRA 3DEPA 2FULA 3B7BA 3HVEA 4JPSA 5J08A 3JQ1A 2XPIA 4XX5A 4L23A 2VTBA 1O1SA 1NI1A 1MYOA 3D9IA 4JC8A 1BPOA 3FEYA 4U0UA 4EQFA 3SO8A 4HRMB 2KZTA 3B13A 4WNFA 2A4ZA 2E2EA 5KNHD 1E8ZA 5CEAA 3L6AA 5BV0A 3SY2A 1FCHA 3UIOC 4GPMA 4A3TA 2QYUA 3IHYA 3X2QE 5ENTD 4CDNA 4GTTA 1Z3YA 3Q7FA 2CHXA 4HB5A 3DSSA 4HI8A 4L1BA 2ETBA 5JJ7A 1LTXA 2L0IA 5A6CA 3MV2B 2XS8A 3MA5A 2DVWA 3MGBA 1E8WA 3ZKJA 1Q2ZA 3QB2A 2ZGDA 4I2WA 1YYHA 3MZLB 2ZISA 5FZRA 4AP2A 1EDUA 2FO1E 3ZYLA 4IN3B 4QFVA 2AXZA 3FU6A 3TWTA 1UOHA 3KD7A 1SA4A 2AVPA 3TXNA 3ASGA 4KBQA 3C3RA 1QZ2A 3CLJA 4UI9K 2HM8A 2WXOA 4CYMD 3ASDA 4JEUA 3ASNE 4KZCA 1IQRA 4JVSA 3APDA 4BY6A 3CHSA 4AY5A 3EHQA 5BUZA 2QFCA 4K0RA 3UI2A 3L22A 1A5EA 1NZNA 1SZAA 4CEMA 4XE0A 2GROB 3EHNA 4WUYA 1O1RA 5CCLA 5BPPA 3E32A 2LNIA 3PEVB 4EPZA 3L17A 2J8SD 3CQCB 4BESA 2XGSA 1N54A 3U66A 3Q7AA 1Y6IA 3JUIA 2LXMA 4D10C 3ESLA 2UY1B 1NP7A 4EBAG 2GRRB 4UQXA 4IRUA 2WMOA 1OWPA 4HRLA 1QQEA 1AP7A 1H2VC 5BW8C 3RO3A 4UWGA 4YNDA 2V4HC 4BX9A 2AXVA 3ZPJA 3T8KA 2QZAA 1WY6A 3R9MA 3ZXPA 3ZGQA 4U8VD 4Q96A 1UN8A 1V55E 3D3MA 1EF1C 4MKTA 4G24A 3I4GA 4UQZA 3AU4A 3CGHA 5CBOA 4CCAA 4B8CB 2LO6A 5AQ7A 3FU3A 3ZYKA 1RW2A 2ONDA 4RG6A 1E90A 3PVLA 4Q94A 3FDHA 2B6CA 3ZHEB 4TUUA 2XRYA 4XEIG 5LOZA 4GTVA 3ZNGA 3ZFWA 5EILA 5AN8A 3D9MA 3NF1A 3UINC 5JA4D 1E7VA 4APFA 2MOWA 3DXKG 2AXUA 3HIZA 3L9TA 4K5CA 2EILE 4JW1A 4BTBA 1N0QA 3VLDA 3FP3A 1N95A 3FUEA 4RVBA 2R59A 3V79K 5AIJA 4YDOA 4JHJA 1SQMA 2JABA 1KLXA 2KC7A 4UI9J 3Q75A 3O48A 4A1SA 1EPUA 2UY1A 3T5XA 2XENA 3DRAA 3HXEA 2VSOE 3PDNA 3SFYA 3LXUX 3E34A 3BEEA 3CK7A 1TJFA 5G04C 3MKQB 3UT7A 3NZSA 4FLBA 4UQYA 2PNNA 4GAAA 5H7PA 4TXQA 3Q9UC 2X6KA 5FT9A 1B89A 1TNOA 5BV1A 1KZPA 1HF8A 4MBGA 3L16A 5AQ9A 4WAFA 4XI0A 4AIFA 3ZVVA 4J8DA 3Q79A 4DI3A 3U64A 2DZOA 5T4YA 4U7EB 3ZHEA 4J7WA 1TEZA 5LCWJ 4OAVB 3CIAA 2YNQA 1FT1A 1AWCB 3TWVA 5ENNA 2AWIA 4JA9A 2Q7FA 4KXKB 4EZLA 1HFAA 2BEDA 5CMYA 3HDXA 3LY8A 3ULEG 3ZRHA 2DBAA 3E30A 4EBAA 1P5QA 5EDSA 2HYZA 2CG2A 2WXLA 3ZYQA 2OVFA 4TXRA 5ANLA 3JCKC 3PNLB 4C0EA 2H6IA 3RIBA 1D8EA 1RZ4A 4O6FA 4HBDA 2P9PG 4JA7A 4YVQC 3UM2A 4TV3A 4B0ZA 3PUKA 5ENQD 4APOA 5AAOA 3BG1B 5EIBE 1N4QA 1HXIA 3EHRA 4GZCA 1E7UA 4AJWA 4C48B 4DK5A 4I1OB 1JPLA 2WXNA 5KCMA 3Q73A 4MLPA 2KCVA 3APCA 1MZCA 5JHAA 2R5SA 1H2UA 2VTBB 1X81A 5G05J 3W9FA 4HQDA 3DSVA 3MEKA 3ML9A 2DCPA 3VLFA 1TJCA 4GA2A 3AS5A 3UKUG 2VGYA 3Q5MA 1ELKA 3I5PA 3ONKA 3Q9NC 3ASFA 3N71A 4BX8A 2WXPA 4NACA 2IONA 5KJNA 2I6HA 3FUFA 2CG3A 2XGMA 5EYLA 3PUJA 3IKOB 3S2AA 4ILIA 4JHRA 4GMLA 3LCAA 3FY4A 4PDXA 2V5FA 5EKQD 3PE4A 3OXGA 3DXMG 3CVNA 1WG0A 2P9SG 4GYOA 2WQHA 2C0MA 2KATA 3IV0A 4F53A 4HLEA 2WXJA 3QARA 5DIZA 5C1DA 3SBSA 4A63B 2X6HA 3KAEA 2WVIA 3EJNA 5BT1A 2FBNA 3CKCA 3CVXA 2EIJE 2RD0A 4GTSA 5E75A 4RSYA 4CT0A 2WXRA 4F1SA 5D0QD 1NA0A 5CCMA 4FP7A 2NXPA 2BKKB 5EX0A 3KSQA 3UM1A 1TN7A 3TWSA 3AJIA 4U0ZA 1ELWA 4JL0A 2IF4A 2ZU6B 1H2TC 3BU8A 3EUVA 4FLHA 4GZ5A 3ABKE 2XRZA 4Y6WA 1PC2A 1MQSA 4CT4A 4L9PA 2YHCA 3FH5A 2VQ2A 4XKCA 1S64A 3L13A 1FVFA 3HHMA 3E4BA 1MX6A 3FHEA 3J5PA 2WXFA 4GTPA 3MKRA 3W9GA 3DSTA 2XPYA 1UN9A 2X6JA 2LAIA 4I9EA 3Q78A 1E96B 4FHJA 2XEEA 3MYVA 3QWPA 4O60A 3HXDA 4LEUA 4UWFA 4GMJA 5EN5D 3SQVA 3UUXA 4NRHB 2IU1A 4U63A 5FTPA 4ATGA 1MX2A 3TG4A 4ACLA 3SFZA 4HXIA 3QAQA 4ZHBA 3FTUA 1OCZE 3CK9A 5BXUA 1FT2A 2WB2A 4ABNA 4AEZC 4L7TA 2A5UA 3RKVA
chains in the Genus database with same CATH topology
1BLXB 4LNUD 5CBOA 2PNNA 4DX5D 2RFAA 2XEHA 3DEPA 4CYMD 3NBNB 4F1PA 2KBXA 5ENQD 5AQ7A 4K5BA 3B7BA 3UTMA 3Q9UC 3ZU7B 2XZTG 5AAOA 4UUCA 2DZNA 2DWZA 4Z68A 2BKKB 1BU9A 4DX2A 4JB8P 3JXIA 5EIBE 1K3ZD 4TUMA 2ETCA 2BKGA 3EHRA 5HS0A 4DX6D 1IKND 1K1AA 3F6QA 1MX4A 5KNGA 3TWSA 3AJIA 1BI8B 1SW6A 4C48B 5EIDA 4DUIA 2XZDG 5AQ9A 4B93B 2B0OE 5KBAA 1MYOA 5D66A 1IXVA 3KEAA 4YDWA 5AARA 3TWXA 5CECB 1IHBA 1N11A 4DX1A 3EHQA 3JUEA 1SVXA 1N0RA 3V2XA 4YDYA 3SO8A 4HRMB 3ZNGA 4DRXE 5EILA 4LSZE 5AN8A 3UI2A 4ATZD 3LJNA 4U95D 4HI9A 2DZOA 2ZGGA 4GMRA 5FINA 5KNHD 3W9FA 4BSZB 5JA4D 3NOGD 1A5EA 5EYPF 4J7WA 5ENPD 3T9KA 4HQDA 5CEAA 1TR4A 3UXGA 4OAVB 1BI7B 3TWUA 5ENRD 3J5QB 2Y1LE 4BETA 1AWCB 2MYOA 3TWVA 5JMND 2V5QC 2J8SD 4K5CA 4GPMA 4O1OA 3IXEA 2P2CP 4BESA 1YMPA 4ZFHA 5ITZF 2ETAA 5ENTD 3EU9A 4HLLA 4LG6A 5CERB 1OT8A 1K1BA 4K5AB 1MJ0A 3Q9NC 1N0QA 4U8YD 2QC9A 1MX6A 4HB5A 4G8LA 4BEPA 3J5PA 4HNAD 4O1PA 3V79K 4HI8A 2F37A 2ETBA 3JXJA 3TWQA 5AQAA 3DEOA 3W9GA 1YCSB 2JABA 1DCQA 1DC2A 4BERA 2DVWA 5ENOD 5EYLA 2NYJA 3HG0D 4HRLA 3C5RA 3V30A 4QQIA 1AP7A 3V31A 2KXPC 3ZKJA 2XEEA 4RLYA 2L6BA 1QYMA 2ZGDA 2F8YA 5HKPA 2QYJA 4O60A 4NIKA 5EN5D 1YYHA 2XENA 4J8YA 2V4HC 3B95A 3T8KA 4CZ2D 4OAUC 2FO1E 3AAAC 1BD8A 5FIOA 2A5EA 2HE0A 1WG0A 1MX2A 3NOCD 4QFVA 1WDYA 4U8VD 1D9SA 4DX7D 3TWTA 3ZUVB 5KWDA 4G8KA 3V2OA 1OY3D 4N5QA 1S70B 1UOHA 2Y0BG 5AQBA 4ZHBA 4HRNA 3D9HA 3TWRA 2F8XK 5CBNA 4HBDA 3HRAA 5ENSD 2RFMA 4A63B 5BXOA 5CEDB 5BXUA 4F6RD 5HRYA 2AJAA 1NFIE 2VGEA 1G3NB 4U96D 3TWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BLX B;  4LNU D;  5CBO A;  2PNN A;  4DX5 D;  2RFA A;  2XEH A;  3DEP A;  4CYM D;  3NBN B;  4F1P A;  2KBX A;  5ENQ D;  5AQ7 A;  4K5B A;  3B7B A;  3UTM A;  3Q9U C;  3ZU7 B;  2XZT G;  5AAO A;  4UUC A;  2DZN A;  2DWZ A;  4Z68 A;  2BKK B;  1BU9 A;  4DX2 A;  4JB8 P;  3JXI A;  5EIB E;  1K3Z D;  4TUM A;  2ETC A;  2BKG A;  3EHR A;  5HS0 A;  4DX6 D;  1IKN D;  1K1A A;  3F6Q A;  1MX4 A;  5KNG A;  3TWS A;  3AJI A;  1BI8 B;  1SW6 A;  4C48 B;  5EID A;  4DUI A;  2XZD G;  5AQ9 A;  4B93 B;  2B0O E;  5KBA A;  1MYO A;  5D66 A;  1IXV A;  3KEA A;  4YDW A;  5AAR A;  3TWX A;  5CEC B;  1IHB A;  1N11 A;  4DX1 A;  3EHQ A;  3JUE A;  1SVX A;  1N0R A;  3V2X A;  4YDY A;  3SO8 A;  4HRM B;  3ZNG A;  4DRX E;  5EIL A;  4LSZ E;  5AN8 A;  3UI2 A;  4ATZ D;  3LJN A;  4U95 D;  4HI9 A;  2DZO A;  2ZGG A;  4GMR A;  5FIN A;  5KNH D;  3W9F A;  4BSZ B;  5JA4 D;  3NOG D;  1A5E A;  5EYP F;  4J7W A;  5ENP D;  3T9K A;  4HQD A;  5CEA A;  1TR4 A;  3UXG A;  4OAV B;  1BI7 B;  3TWU A;  5ENR D;  3J5Q B;  2Y1L E;  4BET A;  1AWC B;  2MYO A;  3TWV A;  5JMN D;  2V5Q C;  2J8S D;  4K5C A;  4GPM A;  4O1O A;  3IXE A;  2P2C P;  4BES A;  1YMP A;  4ZFH A;  5ITZ F;  2ETA A;  5ENT D;  3EU9 A;  4HLL A;  4LG6 A;  5CER B;  1OT8 A;  1K1B A;  4K5A B;  1MJ0 A;  3Q9N C;  1N0Q A;  4U8Y D;  2QC9 A;  1MX6 A;  4HB5 A;  4G8L A;  4BEP A;  3J5P A;  4HNA D;  4O1P A;  3V79 K;  4HI8 A;  2F37 A;  2ETB A;  3JXJ A;  3TWQ A;  5AQA A;  3DEO A;  3W9G A;  1YCS B;  2JAB A;  1DCQ A;  1DC2 A;  4BER A;  2DVW A;  5ENO D;  5EYL A;  2NYJ A;  3HG0 D;  4HRL A;  3C5R A;  3V30 A;  4QQI A;  1AP7 A;  3V31 A;  2KXP C;  3ZKJ A;  2XEE A;  4RLY A;  2L6B A;  1QYM A;  2ZGD A;  2F8Y A;  5HKP A;  2QYJ A;  4O60 A;  4NIK A;  5EN5 D;  1YYH A;  2XEN A;  4J8Y A;  2V4H C;  3B95 A;  3T8K A;  4CZ2 D;  4OAU C;  2FO1 E;  3AAA C;  1BD8 A;  5FIO A;  2A5E A;  2HE0 A;  1WG0 A;  1MX2 A;  3NOC D;  4QFV A;  1WDY A;  4U8V D;  1D9S A;  4DX7 D;  3TWT A;  3ZUV B;  5KWD A;  4G8K A;  3V2O A;  1OY3 D;  4N5Q A;  1S70 B;  1UOH A;  2Y0B G;  5AQB A;  4ZHB A;  4HRN A;  3D9H A;  3TWR A;  2F8X K;  5CBN A;  4HBD A;  3HRA A;  5ENS D;  2RFM A;  4A63 B;  5BXO A;  5CED B;  5BXU A;  4F6R D;  5HRY A;  2AJA A;  1NFI E;  2VGE A;  1G3N B;  4U96 D;  3TWW A; 
#chains in the Genus database with same CATH topology
 1A17 A;  5KJL A;  4GTQ A;  5FZS A;  3UM3 A;  3NBN B;  4EEC A;  2KBX A;  4F1P A;  3UTM A;  3ZU7 B;  2IFU A;  1BU9 A;  1XGW A;  5EID A;  4EZJ A;  3QDN A;  1ZB1 A;  2PZI A;  4E6H A;  2B0O E;  4GTO A;  1SVX A;  4AV7 A;  3ZN3 A;  3C72 A;  1LD7 A;  3G2U A;  3S7F A;  2GRN B;  3FU0 A;  2IEJ A;  2R2L A;  2J4B A;  3VLE A;  5KJK A;  4FHK A;  3FUK A;  4HLL A;  2Y4U A;  4K5A B;  3B7R L;  2L6J A;  1JCQ A;  1MHQ A;  1DC2 A;  2PM6 A;  3UIP C;  3Q49 B;  5ENO D;  1U3C A;  1S63 A;  1UW4 B;  3C5R A;  1S0P A;  3GZ2 A;  4HOQ A;  3FTX A;  4RLY A;  3SNX A;  4B94 A;  3ZYM A;  2GRQ B;  3DSU A;  4RQI A;  2R17 C;  2VJ8 A;  3CST A;  3TGO A;  2IOL A;  1D9S A;  5KWD A;  2IY0 C;  2Y0B G;  4UWK A;  2F8X K;  3SHF A;  3QK0 A;  5ENS D;  2RFM A;  5HQ8 A;  5C2Y A;  3G2W A;  2F0Y A;  2L9B A;  2PQN A;  3GZS A;  3RU0 A;  1VDY A;  5AJL A;  4HOR A;  3HYM B;  4HVB A;  4J8S A;  3FUM A;  4ILH B;  1OWL A;  1H6P A;  4Y6C A;  5A23 A;  5G2N A;  2MRI A;  3JXI A;  3PZ3 A;  5D2M C;  2VSN A;  5KNG A;  3CVU A;  2XZD G;  4B93 B;  1IXV A;  2WPV A;  3AG1 E;  2WM9 A;  2WXI A;  3R7Q A;  3V2X A;  4I6G A;  2DIW A;  4ATZ D;  1TNB A;  2XS1 A;  5ENP D;  3SF4 A;  3L08 A;  3FTS A;  3LJ3 A;  3R9A B;  2P9I G;  4U04 A;  5JMN D;  4KVM A;  5ITZ F;  3FEX A;  3Q47 B;  3D9J A;  4JHK A;  4HNA D;  4XIF A;  1DCQ A;  3E37 A;  1JWG A;  5ANR A;  5CRV A;  2OEV A;  4FJY A;  4PS8 A;  3UT8 A;  4GZ3 A;  3RRN B;  3PEU B;  3UX4 A;  1Y8M A;  3SFX A;  3TJP A;  2DYR E;  3MCX A;  3O4Z A;  4FU3 A;  3R7R A;  5B3S E;  1WDY A;  4H7X A;  3ZUV B;  2X6I A;  1UJJ A;  3FH8 A;  3URZ A;  4IUL A;  3D9H A;  2CFZ A;  2WXM A;  3CVQ A;  4F6R D;  2VYI A;  5J90 A;  3S7J A;  3VTY A;  5LP0 A;  2RKK A;  1BLX B;  3D9O A;  3RO2 A;  4XI9 A;  1OWM A;  3FTV A;  1HE8 A;  3TXM A;  2AW6 A;  5FQ8 A;  3P2B A;  1PAQ A;  4Z68 A;  3L54 A;  4CDM A;  4A55 A;  4M7C A;  3LPZ A;  1FVH A;  1MX4 A;  2WXK A;  3MV3 B;  1N4P A;  4I17 A;  3KEA A;  2ILR A;  5FQ7 A;  3RRM B;  3PRZ A;  3IHV A;  2E0I A;  4P29 A;  4LSZ E;  4DLQ A;  3IBE A;  3UM0 A;  4C0M A;  4MS6 A;  3J5Q B;  5ENR D;  2FF4 A;  3GYZ A;  3IXE A;  3U9W A;  3EU9 A;  5FZQ A;  3UT4 A;  2VSY A;  4KZ0 A;  2CHZ A;  2OOE A;  3HXF A;  1SA5 A;  4YVO A;  4EZK A;  3LY7 A;  4I1A A;  3ZEF A;  3V31 A;  2KCK A;  1DNP A;  4LNG A;  4WND A;  3PE3 A;  3DBS A;  1XNF A;  1SZ9 A;  4A3V A;  4WWP A;  2WXQ A;  3RAU A;  3Q4A B;  1KZO A;  4N5Q A;  1S70 B;  4WWN A;  5CED B;  3T5V A;  1ELR A;  2GGF A;  1DCE A;  4F3V A;  4GCN A;  4U96 D;  1TYQ G;  4CGV A;  3D9P A;  5AEN A;  2R02 A;  3PNT B;  4DX5 D;  4UWL A;  3C3Q A;  1O1T A;  1OWN A;  2DWZ A;  3FU5 A;  1E8X A;  1E8Y A;  2PM7 A;  4LER A;  1NL4 A;  1TN6 A;  1TNZ A;  3CHM A;  4A1G A;  2Y69 E;  1Z3X A;  5ARG A;  4XZ4 A;  4U8H A;  3JQ0 A;  1IHB A;  3FTZ A;  4WNE A;  3RJV A;  4J6I A;  4DI4 A;  3Q15 A;  4BSZ B;  3UXG A;  2IO2 C;  3S7D A;  5CHE E;  2GRL A;  4N3B A;  2MYO A;  3ZW3 A;  2XCB A;  4JEH A;  4RG9 A;  1K1B A;  4GU5 A;  2VSX E;  2EIK E;  3TWQ A;  2H6F A;  4I6E A;  2EIM E;  4AXH A;  3EHM A;  2EIN E;  2NYJ A;  3UMV A;  1QBQ A;  3QJZ A;  2KXP C;  2L6B A;  4JD2 G;  3B95 A;  3FWV A;  4HOS A;  4N2S A;  1BD8 A;  3NAW A;  4PH4 B;  4DX7 D;  1H6K A;  1OY3 D;  1KT0 A;  4G23 A;  1N52 A;  3BG0 B;  3OAW A;  4NQ0 A;  3EDT B;  2XEH A;  1K8K G;  1FPP A;  4N3A A;  3C98 A;  3JYS A;  3P1U A;  1NA3 A;  4I43 A;  3D9K A;  5G55 A;  5HI7 A;  4FA6 A;  4LRZ A;  1O5M A;  3QC1 A;  2EQX A;  1N11 A;  5E76 A;  3PZ4 A;  3ABM E;  4XKB A;  2KM4 A;  1OWO A;  3GZ1 A;  3LJN A;  2L0T B;  4GMR A;  3PZ2 A;  3FTY A;  5EYP F;  3T9K A;  1TR4 A;  1W3B A;  2XPZ A;  1IHG A;  3TWU A;  3HXB A;  3KSL A;  2WQ7 A;  2X38 A;  3DPD A;  4ZFH A;  5CER B;  2XQ0 A;  2XHE A;  2MHK A;  1X5B A;  2P9U G;  3AS8 A;  2P9N G;  3CVY A;  2YIN A;  3TL5 A;  3NB2 A;  4O1P A;  2C2L A;  2F37 A;  4ANX A;  5AQA A;  3G2T A;  3GW4 A;  1UG3 A;  4GA0 A;  4DPR A;  1YCS B;  3CV0 A;  5G04 J;  3I3N A;  3EIJ A;  3PZ1 A;  1Z5S C;  4BER A;  5B1B E;  1N9A A;  2LXL A;  4G26 A;  3D9N A;  3I4R B;  1ZBP A;  2J07 A;  3S7B A;  4ANV A;  4W9R A;  4OAU C;  2KCL A;  3SBT B;  2A5E A;  2HE0 A;  5IY5 E;  4WNG A;  4HFG A;  4CGW A;  3V2O A;  1HX8 A;  1LD8 A;  5FQ6 A;  1NFI E;  2VGE A;  4UI9 C;  4NUR A;  4UWH A;  3IEG A;  2RFA A;  2WXG A;  3CQG B;  3CKB A;  2R03 A;  3G2S A;  2XZT G;  4UUC A;  3CVL A;  1EYH A;  5FQ4 A;  4U0S A;  4N3C A;  2BKG A;  1K1A A;  4KYO B;  1SW6 A;  2IQC A;  2GRM A;  5KBA A;  5AAR A;  4H7Y A;  3LEW A;  3FTW A;  4YDY A;  4PUC A;  2WMN A;  2J08 A;  3G2V A;  4GYY A;  1OUV A;  4IYP A;  4PS3 A;  1YMP A;  4BSX A;  1OXJ A;  1PY1 A;  3AS4 A;  3FFL A;  2WXH A;  4GB9 A;  3LVQ E;  3CHO A;  3SZ7 A;  3FUH A;  5LCW C;  3K9I A;  1HO8 A;  4AM9 A;  5HKP A;  2QYJ A;  4GA1 A;  4NIK A;  3DPY A;  4KT6 B;  3AAA C;  4OVU A;  5DBK A;  4AOF A;  5AQB A;  2X3M A;  3TWR A;  1D8D A;  2X6F A;  4BT8 A;  3ML8 A;  4J8F A;  3ONL A;  3NZU A;  2C0L A;  3AU5 A;  3ENE A;  2P9L G;  3BUA A;  2GW1 A;  2FI7 A;  2I1K A;  4K5B A;  4I9C A;  3ASO E;  2OV8 A;  4DX2 A;  4BFR A;  3LKU A;  2ETC A;  3QNK A;  2V4L A;  4DX6 D;  4I1M A;  5M72 A;  1HU3 A;  2ZIR A;  4K03 A;  3C3O A;  5LX8 A;  2CFU A;  4CDR A;  4OYS A;  4U95 D;  5FIN A;  4HI9 A;  4Q69 A;  1U3D A;  5FWQ A;  5D0O D;  5ARF A;  1BI7 B;  4KVO A;  3FH7 A;  4O1O A;  3ESK A;  2P2C P;  3LVR E;  4TRQ A;  1OT8 A;  4L2L A;  2I9C A;  4DLO A;  4FC8 A;  1JUQ A;  4EHM A;  4ILG A;  5G05 C;  4ME2 A;  2BUG A;  3EIQ C;  2IJG X;  2Y4T A;  2OEW A;  3DSW A;  1WM5 A;  3AG3 E;  2M63 A;  4AVX A;  2I2O A;  2J4D A;  4CZ2 D;  1HG2 A;  1Z6T A;  1N94 A;  3NOC D;  4GPK A;  4OVV A;  5EX3 A;  4G8K A;  2V0P A;  4FJZ A;  2XCC A;  4J0U A;  2OCC E;  5HRY A;  3CR3 A;  4G1T A;  2LUH A;  1OCO E;  1G3N B;  4TUM A;  3TWW A;  4LCT A;  4AY6 A;  3ULY A;  5CRU A;  5A7D B;  3TG5 A;  3KS2 A;  3QOU A;  1K3Z D;  3B7U X;  1WAO 1;  4HOT A;  1IKN D;  2JLB A;  3F6Q A;  2VGX B;  1BI8 B;  3L82 A;  5D66 A;  4YDW A;  1TNU A;  4DX1 A;  3JUE A;  3CVW A;  2BF0 X;  4DRX E;  2J49 A;  3NOG D;  3PRE A;  3PH0 C;  4DJA A;  1JCR A;  1OCC E;  3SI5 A;  3CEQ A;  1H0A A;  2Y1L E;  4N39 A;  5T8I A;  2YQ8 A;  2R05 A;  4BTA A;  4LG6 A;  3QWV A;  1HS6 A;  1TN8 A;  3ASH A;  2RG8 A;  2CHW A;  4HS2 A;  2OVB A;  5BNW A;  4YDE A;  4JZY A;  4ANU A;  2V8S E;  4QQI A;  3MJW A;  1V54 E;  3VTX A;  5JJT A;  1GW6 A;  4J8Y A;  2LSU A;  4URK A;  1HG5 A;  3EU5 A;  3PS6 A;  2DYS E;  5AJD A;  4BT9 A;  4WWO A;  2PQR A;  3HRA A;  4KMO A;  1YA0 A;  3RRU A;  1QNF A;  2AJA A;  1LF8 A;  2XGO A;  4LNU D;  4GTM A;  4FAD A;  2JEK A;  4GZD A;  4FUL A;  3UPV A;  2DZN A;  4JB8 P;  4B8A A;  2HO1 A;  4DUI A;  1H6O A;  4I6J A;  3LY9 A;  3CSF A;  2LAH A;  2H6H A;  3TWX A;  5CEC B;  4MRU A;  2LSV A;  3QKY A;  3UQ3 A;  5AYW D;  1H19 A;  1KT1 A;  2QY7 A;  2VGX A;  3CHQ A;  3LDZ A;  3FUN A;  2J9Q A;  3CVV A;  4BET A;  4R7L A;  2V5Q C;  4ANW A;  3RK6 A;  5FJY A;  3SGH A;  3APF A;  3PZD A;  2Y3A A;  4GTR A;  2QC9 A;  3ZIM A;  4G8L A;  1IYG A;  3DEO A;  2BTD A;  3CHR A;  3NQP A;  5JJ6 A;  4I2Z A;  3T8M A;  3HG0 D;  1HH8 A;  3RSE G;  3KEZ A;  4F7A A;  1DVP A;  3TAX A;  4LNB A;  2F8Y A;  4CRW A;  3AG2 E;  2UWJ G;  3UKR G;  3FUI A;  3D9L A;  3MKQ A;  2FEZ A;  5CMW A;  3AG4 E;  4GCO A;  4HRN A;  1OCR E;  3DSX A;  3ULQ A;  1TNY A;  5BXO A;  3CK8 A;  3HVE B;  4TXP A;  2P58 C;  3FUL A;  1JCS A;  1L5J A;  4L2Y A;  2HR2 A;  4B89 A;  1U2V G;  4U07 A;  3WXX A;  3ZXS A;  3HXC A;  3B7T A;  4G2V A;  2KZT B;  5HS0 A;  4GZ6 A;  5JHB A;  2ZXW E;  4PS7 A;  3OXL A;  5B1A E;  2IO3 C;  2FO7 A;  2PL2 A;  4JXT A;  1N0R A;  4ACK A;  1KPS B;  3OTN A;  4N5C A;  3B7S A;  4J8E A;  4V3I A;  2ZGG A;  4LUN U;  2J09 A;  1HZ4 A;  3CHP A;  3U3W A;  2I1J A;  2IOS A;  4X8Q A;  2NSZ A;  3BQO A;  2ETA A;  3ISM C;  1JWF A;  1ZU2 A;  1MJ0 A;  3QWW A;  4U8Y D;  3ABL E;  2H6G A;  5T3R A;  4BEP A;  2NC9 A;  3FUD A;  3JXJ A;  5KJM A;  3E33 A;  4C9B B;  3LS8 A;  2WQ6 A;  3V30 A;  2GRP B;  3WG7 E;  1N4R A;  3OXF A;  2P9K G;  1QYM A;  4GYW A;  4M3O A;  1UJK A;  3SD5 A;  5FIO A;  4E85 A;  4HOU A;  2YHE A;  1INZ A;  3MX3 A;  4G25 A;  5CBN A;  1IQU A;  4N2Q A;  3FUJ A;  4G11 A;  1N4S A;  3U4T A;  3DWL G;  5LFA A;  2XEV A;  3LYA A;  3CVP A;  4BWR A;  3DEP A;  2FUL A;  3B7B A;  3HVE A;  4JPS A;  5J08 A;  3JQ1 A;  2XPI A;  4XX5 A;  4L23 A;  2VTB A;  1O1S A;  1NI1 A;  1MYO A;  3D9I A;  4JC8 A;  1BPO A;  3FEY A;  4U0U A;  4EQF A;  3SO8 A;  4HRM B;  2KZT A;  3B13 A;  4WNF A;  2A4Z A;  2E2E A;  5KNH D;  1E8Z A;  5CEA A;  3L6A A;  5BV0 A;  3SY2 A;  1FCH A;  3UIO C;  4GPM A;  4A3T A;  2QYU A;  3IHY A;  3X2Q E;  5ENT D;  4CDN A;  4GTT A;  1Z3Y A;  3Q7F A;  2CHX A;  4HB5 A;  3DSS A;  4HI8 A;  4L1B A;  2ETB A;  5JJ7 A;  1LTX A;  2L0I A;  5A6C A;  3MV2 B;  2XS8 A;  3MA5 A;  2DVW A;  3MGB A;  1E8W A;  3ZKJ A;  1Q2Z A;  3QB2 A;  2ZGD A;  4I2W A;  1YYH A;  3MZL B;  2ZIS A;  5FZR A;  4AP2 A;  1EDU A;  2FO1 E;  3ZYL A;  4IN3 B;  4QFV A;  2AXZ A;  3FU6 A;  3TWT A;  1UOH A;  3KD7 A;  1SA4 A;  2AVP A;  3TXN A;  3ASG A;  4KBQ A;  3C3R A;  1QZ2 A;  3CLJ A;  4UI9 K;  2HM8 A;  2WXO A;  4CYM D;  3ASD A;  4JEU A;  3ASN E;  4KZC A;  1IQR A;  4JVS A;  3APD A;  4BY6 A;  3CHS A;  4AY5 A;  3EHQ A;  5BUZ A;  2QFC A;  4K0R A;  3UI2 A;  3L22 A;  1A5E A;  1NZN A;  1SZA A;  4CEM A;  4XE0 A;  2GRO B;  3EHN A;  4WUY A;  1O1R A;  5CCL A;  5BPP A;  3E32 A;  2LNI A;  3PEV B;  4EPZ A;  3L17 A;  2J8S D;  3CQC B;  4BES A;  2XGS A;  1N54 A;  3U66 A;  3Q7A A;  1Y6I A;  3JUI A;  2LXM A;  4D10 C;  3ESL A;  2UY1 B;  1NP7 A;  4EBA G;  2GRR B;  4UQX A;  4IRU A;  2WMO A;  1OWP A;  4HRL A;  1QQE A;  1AP7 A;  1H2V C;  5BW8 C;  3RO3 A;  4UWG A;  4YND A;  2V4H C;  4BX9 A;  2AXV A;  3ZPJ A;  3T8K A;  2QZA A;  1WY6 A;  3R9M A;  3ZXP A;  3ZGQ A;  4U8V D;  4Q96 A;  1UN8 A;  1V55 E;  3D3M A;  1EF1 C;  4MKT A;  4G24 A;  3I4G A;  4UQZ A;  3AU4 A;  3CGH A;  5CBO A;  4CCA A;  4B8C B;  2LO6 A;  5AQ7 A;  3FU3 A;  3ZYK A;  1RW2 A;  2OND A;  4RG6 A;  1E90 A;  3PVL A;  4Q94 A;  3FDH A;  2B6C A;  3ZHE B;  4TUU A;  2XRY A;  4XEI G;  5LOZ A;  4GTV A;  3ZNG A;  3ZFW A;  5EIL A;  5AN8 A;  3D9M A;  3NF1 A;  3UIN C;  5JA4 D;  1E7V A;  4APF A;  2MOW A;  3DXK G;  2AXU A;  3HIZ A;  3L9T A;  4K5C A;  2EIL E;  4JW1 A;  4BTB A;  1N0Q A;  3VLD A;  3FP3 A;  1N95 A;  3FUE A;  4RVB A;  2R59 A;  3V79 K;  5AIJ A;  4YDO A;  4JHJ A;  1SQM A;  2JAB A;  1KLX A;  2KC7 A;  4UI9 J;  3Q75 A;  3O48 A;  4A1S A;  1EPU A;  2UY1 A;  3T5X A;  2XEN A;  3DRA A;  3HXE A;  2VSO E;  3PDN A;  3SFY A;  3LXU X;  3E34 A;  3BEE A;  3CK7 A;  1TJF A;  5G04 C;  3MKQ B;  3UT7 A;  3NZS A;  4FLB A;  4UQY A;  2PNN A;  4GAA A;  5H7P A;  4TXQ A;  3Q9U C;  2X6K A;  5FT9 A;  1B89 A;  1TNO A;  5BV1 A;  1KZP A;  1HF8 A;  4MBG A;  3L16 A;  5AQ9 A;  4WAF A;  4XI0 A;  4AIF A;  3ZVV A;  4J8D A;  3Q79 A;  4DI3 A;  3U64 A;  2DZO A;  5T4Y A;  4U7E B;  3ZHE A;  4J7W A;  1TEZ A;  5LCW J;  4OAV B;  3CIA A;  2YNQ A;  1FT1 A;  1AWC B;  3TWV A;  5ENN A;  2AWI A;  4JA9 A;  2Q7F A;  4KXK B;  4EZL A;  1HFA A;  2BED A;  5CMY A;  3HDX A;  3LY8 A;  3ULE G;  3ZRH A;  2DBA A;  3E30 A;  4EBA A;  1P5Q A;  5EDS A;  2HYZ A;  2CG2 A;  2WXL A;  3ZYQ A;  2OVF A;  4TXR A;  5ANL A;  3JCK C;  3PNL B;  4C0E A;  2H6I A;  3RIB A;  1D8E A;  1RZ4 A;  4O6F A;  4HBD A;  2P9P G;  4JA7 A;  4YVQ C;  3UM2 A;  4TV3 A;  4B0Z A;  3PUK A;  5ENQ D;  4APO A;  5AAO A;  3BG1 B;  5EIB E;  1N4Q A;  1HXI A;  3EHR A;  4GZC A;  1E7U A;  4AJW A;  4C48 B;  4DK5 A;  4I1O B;  1JPL A;  2WXN A;  5KCM A;  3Q73 A;  4MLP A;  2KCV A;  3APC A;  1MZC A;  5JHA A;  2R5S A;  1H2U A;  2VTB B;  1X81 A;  5G05 J;  3W9F A;  4HQD A;  3DSV A;  3MEK A;  3ML9 A;  2DCP A;  3VLF A;  1TJC A;  4GA2 A;  3AS5 A;  3UKU G;  2VGY A;  3Q5M A;  1ELK A;  3I5P A;  3ONK A;  3Q9N C;  3ASF A;  3N71 A;  4BX8 A;  2WXP A;  4NAC A;  2ION A;  5KJN A;  2I6H A;  3FUF A;  2CG3 A;  2XGM A;  5EYL A;  3PUJ A;  3IKO B;  3S2A A;  4ILI A;  4JHR A;  4GML A;  3LCA A;  3FY4 A;  4PDX A;  2V5F A;  5EKQ D;  3PE4 A;  3OXG A;  3DXM G;  3CVN A;  1WG0 A;  2P9S G;  4GYO A;  2WQH A;  2C0M A;  2KAT A;  3IV0 A;  4F53 A;  4HLE A;  2WXJ A;  3QAR A;  5DIZ A;  5C1D A;  3SBS A;  4A63 B;  2X6H A;  3KAE A;  2WVI A;  3EJN A;  5BT1 A;  2FBN A;  3CKC A;  3CVX A;  2EIJ E;  2RD0 A;  4GTS A;  5E75 A;  4RSY A;  4CT0 A;  2WXR A;  4F1S A;  5D0Q D;  1NA0 A;  5CCM A;  4FP7 A;  2NXP A;  2BKK B;  5EX0 A;  3KSQ A;  3UM1 A;  1TN7 A;  3TWS A;  3AJI A;  4U0Z A;  1ELW A;  4JL0 A;  2IF4 A;  2ZU6 B;  1H2T C;  3BU8 A;  3EUV A;  4FLH A;  4GZ5 A;  3ABK E;  2XRZ A;  4Y6W A;  1PC2 A;  1MQS A;  4CT4 A;  4L9P A;  2YHC A;  3FH5 A;  2VQ2 A;  4XKC A;  1S64 A;  3L13 A;  1FVF A;  3HHM A;  3E4B A;  1MX6 A;  3FHE A;  3J5P A;  2WXF A;  4GTP A;  3MKR A;  3W9G A;  3DST A;  2XPY A;  1UN9 A;  2X6J A;  2LAI A;  4I9E A;  3Q78 A;  1E96 B;  4FHJ A;  2XEE A;  3MYV A;  3QWP A;  4O60 A;  3HXD A;  4LEU A;  4UWF A;  4GMJ A;  5EN5 D;  3SQV A;  3UUX A;  4NRH B;  2IU1 A;  4U63 A;  5FTP A;  4ATG A;  1MX2 A;  3TG4 A;  4ACL A;  3SFZ A;  4HXI A;  3QAQ A;  4ZHB A;  3FTU A;  1OCZ E;  3CK9 A;  5BXU A;  1FT2 A;  2WB2 A;  4ABN A;  4AEZ C;  4L7T A;  2A5U A;  3RKV A; 
#chains in the Genus database with same CATH homology
 1BLX B;  4LNU D;  5CBO A;  2PNN A;  4DX5 D;  2RFA A;  2XEH A;  3DEP A;  4CYM D;  3NBN B;  4F1P A;  2KBX A;  5ENQ D;  5AQ7 A;  4K5B A;  3B7B A;  3UTM A;  3Q9U C;  3ZU7 B;  2XZT G;  5AAO A;  4UUC A;  2DZN A;  2DWZ A;  4Z68 A;  2BKK B;  1BU9 A;  4DX2 A;  4JB8 P;  3JXI A;  5EIB E;  1K3Z D;  4TUM A;  2ETC A;  2BKG A;  3EHR A;  5HS0 A;  4DX6 D;  1IKN D;  1K1A A;  3F6Q A;  1MX4 A;  5KNG A;  3TWS A;  3AJI A;  1BI8 B;  1SW6 A;  4C48 B;  5EID A;  4DUI A;  2XZD G;  5AQ9 A;  4B93 B;  2B0O E;  5KBA A;  1MYO A;  5D66 A;  1IXV A;  3KEA A;  4YDW A;  5AAR A;  3TWX A;  5CEC B;  1IHB A;  1N11 A;  4DX1 A;  3EHQ A;  3JUE A;  1SVX A;  1N0R A;  3V2X A;  4YDY A;  3SO8 A;  4HRM B;  3ZNG A;  4DRX E;  5EIL A;  4LSZ E;  5AN8 A;  3UI2 A;  4ATZ D;  3LJN A;  4U95 D;  4HI9 A;  2DZO A;  2ZGG A;  4GMR A;  5FIN A;  5KNH D;  3W9F A;  4BSZ B;  5JA4 D;  3NOG D;  1A5E A;  5EYP F;  4J7W A;  5ENP D;  3T9K A;  4HQD A;  5CEA A;  1TR4 A;  3UXG A;  4OAV B;  1BI7 B;  3TWU A;  5ENR D;  3J5Q B;  2Y1L E;  4BET A;  1AWC B;  2MYO A;  3TWV A;  5JMN D;  2V5Q C;  2J8S D;  4K5C A;  4GPM A;  4O1O A;  3IXE A;  2P2C P;  4BES A;  1YMP A;  4ZFH A;  5ITZ F;  2ETA A;  5ENT D;  3EU9 A;  4HLL A;  4LG6 A;  5CER B;  1OT8 A;  1K1B A;  4K5A B;  1MJ0 A;  3Q9N C;  1N0Q A;  4U8Y D;  2QC9 A;  1MX6 A;  4HB5 A;  4G8L A;  4BEP A;  3J5P A;  4HNA D;  4O1P A;  3V79 K;  4HI8 A;  2F37 A;  2ETB A;  3JXJ A;  3TWQ A;  5AQA A;  3DEO A;  3W9G A;  1YCS B;  2JAB A;  1DCQ A;  1DC2 A;  4BER A;  2DVW A;  5ENO D;  5EYL A;  2NYJ A;  3HG0 D;  4HRL A;  3C5R A;  3V30 A;  4QQI A;  1AP7 A;  3V31 A;  2KXP C;  3ZKJ A;  2XEE A;  4RLY A;  2L6B A;  1QYM A;  2ZGD A;  2F8Y A;  5HKP A;  2QYJ A;  4O60 A;  4NIK A;  5EN5 D;  1YYH A;  2XEN A;  4J8Y A;  2V4H C;  3B95 A;  3T8K A;  4CZ2 D;  4OAU C;  2FO1 E;  3AAA C;  1BD8 A;  5FIO A;  2A5E A;  2HE0 A;  1WG0 A;  1MX2 A;  3NOC D;  4QFV A;  1WDY A;  4U8V D;  1D9S A;  4DX7 D;  3TWT A;  3ZUV B;  5KWD A;  4G8K A;  3V2O A;  1OY3 D;  4N5Q A;  1S70 B;  1UOH A;  2Y0B G;  5AQB A;  4ZHB A;  4HRN A;  3D9H A;  3TWR A;  2F8X K;  5CBN A;  4HBD A;  3HRA A;  5ENS D;  2RFM A;  4A63 B;  5BXO A;  5CED B;  5BXU A;  4F6R D;  5HRY A;  2AJA A;  1NFI E;  2VGE A;  1G3N B;  4U96 D;  3TWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...