1A5EA

Solution nmr structure of tumor suppressor p16ink4a, 18 structures
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
156
structure length
156
Chain Sequence
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Anti-oncogene
molecule keywords TUMOR SUPPRESSOR P16INK4A
publication title Tumor suppressor p16INK4A: determination of solution structure and analyses of its interaction with cyclin-dependent kinase 4.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 1998-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1a5eA00
1WG0A 4HRLA 4O1OA 3LJNA 4F1PA 4K5BA 4LG6A 4LNUD 1UOHA 3T9KA 3UI2A 1BI8B 2V4HC 3AAAC 4K5CA 4C48B 1YMPA 3UTMA 3TWVA 5CEAA 5ENSD 4DRXE 2Y1LE 5KNHD 1IXVA 2ZGGA 2J8SD 3TWRA 5ENTD 4CYMD 2BKGA 2XENA 3EHQA 2BKKB 5EILA 2RFMA 4DX6D 2Y0BG 1IHBA 3TWXA 3J5PA 4QQIA 2RFAA 3ZU7B 4HQDA 3Q9UC 4QFVA 4LSZE 1BLXB 2KBXA 5FIOA 2QYJA 1WDYA 3NBNB 1BI7B 3TWWA 4GMRA 4BSZB 5CBOA 1OT8A 3V79K 3TWSA 3W9FA 4BETA 2ETBA 2XZDG 1MX4A 2ETAA 5HRYA 4DX1A 2ZGDA 4DX7D 2AJAA 1MX2A 1N11A 5D66A 4CZ2D 4OAUC 3HG0D 4GPMA 5AN8A 5AQ9A 5AAOA 1IKND 4ZHBA 5EIBE 1YCSB 4DX2A 3EU9A 4J7WA 3IXEA 2V5QC 3B7BA 4A63B 3SO8A 2A5EA 4HLLA 4N5QA 4RLYA 3TWUA 3V30A 4DX5D 4O60A 3Q9NC 4TUMA 2XEHA 5JA4D 2F8XK 2DWZA 1SVXA 4ATZD 2DVWA 4HI9A 2VGEA 1S70B 4U8VD 5CERB 4YDWA 4UUCA 1DCQA 4OAVB 4BESA 3TWTA 5AQAA 5FINA 5BXUA 2FO1E 3ZKJA 5BXOA 4DUIA 5KBAA 1TR4A 1MYOA 2DZOA 3J5QB 2F37A 3EHRA 5ITZF 3HRAA 4U95D 2ETCA 4HNAD 2DZNA 4U8YD 2MYOA 3DEOA 5AQBA 3C5RA 1MX6A 2B0OE 4HI8A 5CBNA 4NIKA 3KEAA 2P2CP 3NOCD 3TWQA 3JUEA 5ENQD 2F8YA 1G3NB 3ZNGA 1A5EA 1DC2A 5CEDB 4G8KA 3UXGA 4B93B 1AWCB 1K1AA 5HS0A 2NYJA 3JXIA 3B95A 4HRNA 4K5AB 1SW6A 4O1PA 3D9HA 1D9SA 5KNGA 4F6RD 5KWDA 1MJ0A 2L6BA 1BD8A 4BERA 4JB8P 4HBDA 3V2XA 1YYHA 5EYLA 5HKPA 5AARA 4ZFHA 3DEPA 1K3ZD 3NOGD 2HE0A 2PNNA 2QC9A 3AJIA 4G8LA 4HRMB 5EN5D 5ENPD 1K1BA 5EYPF 3JXJA 4Z68A 2KXPC 5CECB 1BU9A 5ENRD 4YDYA 3F6QA 5ENOD 5JMND 3T8KA 3W9GA 2XEEA 3ZUVB 4BEPA 3V2OA 1QYMA 2XZTG 1N0QA 3V31A 1AP7A 1OY3D 5AQ7A 4J8YA 4HB5A 5EIDA 2JABA 1NFIE 4U96D 1N0RA
chains in the Genus database with same CATH superfamily
3R9MA 3FWVA 2OOEA 1N52A 1TNZA 1E7VA 1IHGA 3QKYA 4GTVA 1YMPA 5LCWJ 5BUZA 1E8ZA 3DRAA 2IO3C 3I5PA 3D9NA 3EHQA 3ZYKA 2WXIA 3QNKA 3ZHEA 4LSZE 4WAFA 2WXNA 3DPDA 2ONDA 1B89A 3C3OA 2WXOA 3HXCA 4XE0A 3GZSA 5T4YA 1HX8A 2ZGDA 1DVPA 2DYRE 4DX2A 1D8DA 2LAIA 4HLLA 3PEUB 3CVWA 4GMJA 3RJVA 2DWZA 3LXUX 4X8QA 3EHMA 2FBNA 4M7CA 3TWTA 3D9KA 4I2ZA 2L0TB 5B3SE 5EX0A 3WXXA 5ITZF 3L16A 3SBSA 4RVBA 2B0OE 2VQ2A 2LNIA 1AWCB 4UWGA 4ILIA 4ABNA 3G2UA 4YDOA 4N2QA 2CG3A 3OXFA 4N3BA 1XNFA 3TG5A 3NOGD 2X3MA 2AXZA 3UIOC 4Z68A 2KXPC 4A1SA 2DBAA 2R17C 4GTTA 3PUJA 4U8HA 3U64A 3ZPJA 3LJNA 4CT4A 4LG6A 1SQMA 2P58C 1OWOA 5FQ8A 2WXJA 3G2SA 4DK5A 2L0IA 4BTAA 4XZ4A 3CVVA 3HYMB 2IFUA 3IKOB 4GYYA 2KBXA 3DSXA 4FHKA 3CSFA 2AWIA 3UPVA 1MX2A 2H6GA 4CZ2D 4KXKB 2GROB 3B7BA 2WM9A 2J4BA 3D9LA 2CHZA 4XEIG 3I4GA 4I6GA 4ATZD 2WQ6A 3ZYQA 2VGEA 3FTXA 4MKTA 3ONKA 3AG3E 2R2LA 5C2YA 4DUIA 3HRAA 3FUDA 1JCRA 3FEYA 3NQPA 4JA9A 1HG5A 4L9PA 3TG4A 1FVFA 5ARFA 3X2QE 3AU5A 4FADA 2XPIA 4P29A 2L6BA 2QZAA 4HS2A 5EYLA 5AARA 3ZGQA 2XS8A 2KCLA 1UW4B 5ENRD 1O1SA 5FJYA 3ZUVB 1AP7A 3ZN3A 1OY3D 4Q69A 3HXEA 2CHXA 5A7DB 1N0RA 2EIJE 3MKQB 3URZA 4TXPA 4GTMA 4LNUD 5M72A 5FTPA 5D0QD 3HDXA 4C48B 3TJPA 2PZIA 2Y1LE 3SBTB 4I1AA 3AS8A 2J8SD 1DNPA 1UJKA 4JHRA 4TUUA 4QQIA 4A1GA 2KC7A 5BNWA 4A3TA 1KZOA 3LY8A 5B1BE 2ETAA 3APCA 3Q5MA 4OAUC 1IYGA 1A17A 3MV3B 3KSQA 5AAOA 5EIBE 2V5QC 1ZB1A 3TGOA 2FO7A 1KLXA 4TUMA 1KZPA 1HH8A 4OAVB 2UY1B 1H19A 3MKQA 1EDUA 3BU8A 4GA0A 5CCMA 4U8YD 4FP7A 2PQNA 4L2YA 1TNUA 4UI9K 4UQXA 3ULQA 3R7RA 4PUCA 3EHNA 3G2WA 3Q78A 2JEKA 3UM1A 1E8WA 4KVMA 2L9BA 2FF4A 5JHBA 3OAWA 1O1TA 3DBSA 3CVXA 3U4TA 5KWDA 1OUVA 4BERA 3E34A 3B7RL 3TXMA 2I9CA 1BU9A 3EJNA 4BX8A 2WQ7A 3LJ3A 2J07A 4O1OA 3B13A 4F1PA 5EDSA 4IULA 3AU4A 2P9LG 4FJZA 2UY1A 3DXKG 3PVLA 2WMNA 3I3NA 3Q79A 2AXVA 3SHFA 3EU5A 4ANWA 2XENA 3JQ0A 3B7UX 1H2UA 3ZU7B 5LOZA 3CHQA 1HG2A 4GMRA 1OCRE 2VTBB 4YNDA 1JWGA 1X81A 3IXEA 3CK7A 2A5EA 2ZISA 4I43A 1U2VG 2DYSE 4O60A 4F53A 2DVWA 5ARGA 5J08A 3BEEA 4XX5A 2R59A 1ELWA 3FULA 2AVPA 3L08A 2DZOA 3CHMA 1E90A 2P9PG 3QARA 4ANUA 2XCBA 3JUEA 3FFLA 1QQEA 3IEGA 2EIME 1G3NB 2RKKA 4G8KA 2I6HA 5HS0A 3CV0A 1Y6IA 3ZXSA 4OVVA 1BD8A 4J0UA 4JPSA 2XGMA 2QY7A 4HRMB 1N4SA 3ASGA 3TXNA 3ZYLA 3HXFA 5JMND 2Y4TA 3QJZA 4TRQA 2GRLA 3ABKE 2VTBA 4WNEA 1Z5SC 1Z3XA 5EIDA 2Q7FA 3FP3A 2V8SE 4L2LA 4K5BA 4GTSA 4LEUA 3SGHA 2I2OA 1TJFA 3BG0B 3LYAA 2ZGGA 3D9JA 3FTYA 1EYHA 4LUNU 3Q9UC 5E76A 2H6HA 2IU1A 3NBNB 2J49A 4E6HA 4XI0A 2XEVA 3W9FA 1UN8A 2WXLA 3HG0D 2VSOE 3LY9A 4A3VA 3L9TA 4A63B 4G25A 1OCOE 3QWVA 4V3IA 4J8DA 2H6IA 1DCQA 4WWNA 5FINA 1UN9A 2KCVA 5FQ6A 2F37A 2DZNA 5AQBA 5KJLA 1LF8A 5B1AE 4J6IA 3JCKC 4B93B 2VGYA 4APOA 2GRQB 4GTPA 2IEJA 5EYPF 3PEVB 2BUGA 5CECB 2YHCA 4U0UA 2Y69E 2XEEA 3FH8A 1TYQG 3C3QA 4EZJA 3EIJA 1UG3A 3PDNA 3LY7A 1VDYA 3O48A 2EILE 4FA6A 3G2VA 4U07A 2E2EA 5AENA 3LEWA 5LFAA 3DSWA 4HQDA 1BLXB 1WDYA 4B8AA 4TV3A 4CDNA 2XRYA 4Y6CA 2ETBA 4CCAA 2IQCA 1HFAA 3D9OA 3S7FA 2BTDA 3KS2A 3KSLA 4ANVA 1TNYA 4B94A 4J7WA 4JXTA 2MHKA 1EPUA 3AG2E 1E8YA 1S0PA 4HI9A 4PS7A 4YDWA 1SZAA 4BESA 4JL0A 4ILHB 4EECA 1ZU2A 3AG1E 5KBAA 4C0EA 1MYOA 2CHWA 3TAXA 3D9IA 3OTNA 2XRZA 4K0RA 4W9RA 1V54E 3ASHA 1MX6A 4HI8A 4HOQA 3L82A 1OWLA 4D10C 3B7SA 1XGWA 3LPZA 2R03A 1KPSB 1NA0A 3MX3A 4I17A 2PM6A 3V2XA 3U66A 1UJJA 2JLBA 3S7DA 4N2SA 3UT4A 3DXMG 5A6CA 2YNQA 5AQ7A 3FEXA 3LKUA 5IY5E 1NFIE 3GW4A 4MS6A 3D9MA 3AAAC 1FVHA 4GZ6A 2WXPA 5BPPA 1IXVA 2RFMA 4AV7A 2R5SA 5HI7A 3UKUG 3KD7A 4KVOA 3VLEA 5H7PA 4DX1A 5D66A 3T5XA 3NB2A 5AN8A 3TL5A 1MHQA 4N5QA 1FT1A 2LAHA 3G2TA 4FULA 4N3AA 1SVXA 4G2VA 3RO2A 2XPZA 3C72A 5CRUA 4BWRA 2LXLA 1V55E 4L1BA 5FWQA 1WAO1 3ESKA 3RRMB 1TN8A 4GYWA 2ZXWE 3Q4AB 1N9AA 1D8EA 3C5RA 2ZU6B 2P2CP 3ZRHA 4L7TA 4AVXA 1ELRA 3D9HA 2P9NG 4JB8P 2WQHA 3ASFA 4YVQC 3DEPA 3JUIA 3EDTB 2IO2C 3CQGB 2OVBA 2FI7A 4JEHA 4U96D 3OXLA 3CVPA 1QNFA 2LXMA 2M63A 3D9PA 2C2LA 2AXUA 3DSTA 3ISMC 3S2AA 5CMYA 3T9KA 1L5JA 4K5CA 4I6JA 3RK6A 4WNDA 1Y8MA 2IF4A 2B6CA 5FIOA 3L6AA 1DCEA 4BSZB 2WXGA 2A4ZA 3FUHA 3Q15A 4G24A 4RSYA 1INZA 4CDMA 4G11A 3SQVA 3R7QA 4YDEA 4HOSA 2H6FA 2PQRA 4U7EB 3Q9NC 2HO1A 2P9UG 4DI4A 5G2NA 4TXRA 1YA0A 4BT8A 4A55A 3RU0A 3PZDA 1JUQA 3EHRA 5FQ7A 5AJLA 3CK9A 1TNOA 2QFCA 2GGFA 2F8YA 3CHPA 2V4LA 1K1AA 1N54A 4O1PA 5ANLA 4JA7A 3CK8A 3APDA 3JQ1A 5D2MC 4HBDA 5HKPA 2FEZA 4APFA 4G8LA 1K1BA 3F6QA 4RG6A 2GRPB 3VLFA 3ZXPA 1N0QA 1NA3A 5BV0A 2WXFA 3P1UA 4EZKA 3RAUA 2GRMA 4TXQA 1UOHA 1PAQA 1O5MA 3UIPC 1HU3A 4BX9A 4UWLA 3NZSA 4ACLA 3PE3A 3PS6A 1H0AA 3LCAA 3MJWA 4JW1A 2WXHA 4BFRA 2HYZA 2QYUA 5AQ9A 5C1DA 3RO3A 1NZNA 5EX3A 3TWUA 4DPRA 3FDHA 1S63A 3ZYMA 3PZ1A 4GTOA 3FTSA 4FLHA 1LD7A 1TR4A 1ELKA 4KZCA 3DSSA 3Q7AA 2J09A 4EQFA 3ULYA 2IY0C 2MRIA 4LERA 1DC2A 4UWFA 4RG9A 5D0OD 2GRNB 1OCZE 3ZW3A 4CGWA 4UWHA 4F7AA 4I2WA 4NURA 3WG7E 1H6KA 1OWPA 3MYVA 1LTXA 2IONA 1K3ZD 3AJIA 5EN5D 3T8KA 4B0ZA 5G04C 2YINA 1GW6A 3UT8A 2PM7A 3SZ7A 4GA1A 1Z3YA 4GAAA 4HFGA 3MA5A 4G1TA 5ENNA 3FTUA 2DCPA 1N4PA 1TNBA 3UTMA 5ENSD 3QWWA 2KATA 3TWRA 3GZ1A 2BKGA 3DWLG 3NF1A 5EILA 3FU3A 4CDRA 2Y0BG 2FULA 4DJAA 4QFVA 4DI3A 3AG4E 3SFYA 4EZLA 5CRVA 2EINE 1N4QA 3E4BA 1KT0A 1TJCA 4J8SA 3PUKA 4LNGA 4B8CB 3ZVVA 1IKND 2J08A 4H7XA 3FH7A 5JJTA 2R05A 4DX5D 3AS5A 1ZBPA 2C0LA 3QWPA 1JCSA 4AOFA 4WNFA 2YHEA 3Q49B 5CMWA 5BXUA 4GZ5A 3CVNA 4CRWA 4U95D 2LO6A 4U04A 2P9IG 5E75A 1N4RA 4NIKA 3KEAA 1N94A 3FUEA 2Y3AA 4K5AB 4F6RD 3HIZA 5G04J 2RG8A 4UQYA 3K9IA 1YYHA 3SY2A 2QC9A 3D3MA 2X38A 3FUJA 4BT9A 1HF8A 4N3CA 4FC8A 1IQRA 3HXBA 5ANRA 2RD0A 1Q2ZA 2VSXE 2NC9A 3VTXA 4LRZA 3U3WA 4U0ZA 1HE8A 1IQUA 4AEZC 3PE4A 3FTWA 2VGXB 4HXIA 5J90A 1BI8B 3FUMA 3IHYA 4UI9C 3CQCB 3TWVA 4FLBA 4HVBA 4GTRA 3CVUA 3ESLA 4RQIA 3CGHA 2WB2A 3QAQA 4PDXA 2YQ8A 1PY1A 5BV1A 3V79K 5JJ7A 1FCHA 3ML8A 3CEQA 1H2TC 1N11A 3UKRG 3GYZA 2WVIA 4FU3A 3V30A 4MLPA 3C98A 3FUNA 1RW2A 2XEHA 1TN6A 4J8FA 3DSVA 4U8VD 2F0YA 4LCTA 1U3DA 1OXJA 2X6JA 3ZKJA 3ASDA 3UM0A 4ILGA 2V5FA 2VGXA 4I9EA 4HLEA 3MEKA 3ASNE 4EHMA 1KT1A 3NZUA 2X6FA 5G55A 4AY6A 2P9KG 3UXGA 3EIQC 3B95A 1SW6A 5KNGA 2BEDA 2AW6A 2Y4UA 3E32A 1O1RA 3Q47B 2L6JA 2KM4A 4FHJA 1HO8A 3PRZA 3W9GA 5KJMA 1OWMA 2HR2A 4H7YA 4J8YA 2WPVA 1H6OA 5G05C 3AS4A 4UI9J 2VYIA 1WG0A 3ZIMA 2KCKA 3CLJA 4JC8A 3MKRA 1X5BA 2OCCE 2VSYA 3UX4A 2IOSA 1JWFA 4KMOA 1FPPA 1NP7A 3CHSA 4ATGA 3SD5A 4WWPA 3CSTA 3SI5A 5KCMA 4ACKA 4I1MA 2NXPA 1MX4A 5HRYA 4U63A 3N71A 1OCCE 3ZEFA 1K8KG 3LVRE 1H6PA 4URKA 3UUXA 1S64A 4N39A 3IHVA 4LNBA 2MOWA 2OEVA 2IJGX 1TEZA 4GYOA 4GU5A 4JHKA 2LSVA 5ENQD 1TN7A 4I6EA 4XKBA 4CEMA 3JYSA 2C0MA 4AIFA 2CG2A 5G05J 2HE0A 5ENPD 4GZDA 4YDYA 5ENOD 4BEPA 3UM2A 1RZ4A 1QYMA 4XI9A 4HOTA 2J9QA 2JABA 2ILRA 1HZ4A 4ZFHA 3ZFWA 2XPYA 3BQOA 3BUAA 1P5QA 5FQ4A 4GCOA 4BY6A 5EKQD 2X6IA 3QDNA 3UQ3A 4WWOA 4XIFA 3HVEB 3IBEA 5ENTD 4E85A 3RSEG 3KEZA 3ASOE 4EPZA 1BI7B 3TWWA 2HM8A 5AIJA 1OT8A 2LSUA 3FH5A 4MRUA 4CGVA 2AJAA 4PS8A 2VSNA 3ULEG 3GZ2A 1YCSB 3PNTB 5CHEE 4Q94A 4RLYA 3PH0C 3FTVA 1S70B 2OEWA 2I1JA 2BF0X 4NACA 5AQAA 3RRUA 2CFZA 5BXOA 5FT9A 4Y6WA 3J5QB 4KZ0A 4GZ3A 3RKVA 4XKCA 2I1KA 4CT0A 4N5CA 3L22A 3NOCD 5T8IA 3HVEA 3ZNGA 4GCNA 4GMLA 2CFUA 4AJWA 3MZLB 1JCQA 4JZYA 4GZCA 5AJDA 4M3OA 1MQSA 3ABLE 3CHRA 4EBAA 5FZSA 1E96B 3P2BA 4HB5A 3OXGA 1MZCA 4HRLA 3S7JA 2OV8A 3CVQA 3VLDA 4BTBA 3R9AB 1SZ9A 3Q7FA 3DPYA 3LVQE 5KNHD 4CYMD 3FU0A 4DX6D 1SA4A 1IHBA 2WXKA 2RFAA 4L23A 3QB2A 3CHOA 2P9SG 4GA2A 3RRNB 1E7UA 2QYJA 3MGBA 4EBAG 4G23A 5CBOA 3PREA 4AP2A 4PS3A 1Z6TA 5DBKA 1QBQA 4AY5A 3E30A 4I1OB 4OYSA 4GPMA 3B7TA 3EU9A 2XGSA 3KAEA 3QOUA 3SNXA 3PZ3A 4UUCA 5JJ6A 3ONLA 1WM5A 3PZ4A 2ETCA 1W3BA 2WMOA 4MBGA 5CBNA 3CKBA 2J4DA 4B89A 3T8MA 4ANXA 3O4ZA 3QC1A 4Q96A 4R7LA 2VJ8A 3FU5A 5CEDB 4O6FA 4HRNA 2GRRB 5AYWD 2WXRA 4NRHB 3VTYA 3L54A 4WNGA 2XGOA 1HXIA 4JD2G 3V2OA 2EQXA 2XZTG 3L17A 3CVYA 3T5VA 4GB9A 2NSZA 1N95A 2V4HC 3SFXA 3SF4A 4IRUA 5CEAA 3PNLB 4DRXE 4AM9A 4UQZA 4OVUA 3J5PA 4IYPA 5DIZA 3CR3A 4K03A 3CKCA 5FZRA 4KBQA 4I9CA 1JPLA 4HOUA 4U0SA 2XZDG 5LX8A 4DX7D 5KJKA 3BG1B 2PL2A 4DLQA 4ZHBA 1PC2A 4NQ0A 3APFA 1EF1C 3SO8A 3Q75A 1U3CA 1FT2A 3S7BA 3FUKA 3PZ2A 5BW8C 4F1SA 3C3RA 3I4RB 2X6HA 4GPKA 2GW1A 3LS8A 4BSXA 2XS1A 4HNAD 2XQ0A 2XCCA 3DEOA 4G26A 4IN3B 3UM3A 1OWNA 3TWQA 3FHEA 3HHMA 2WXQA 4YVOA 2A5UA 5BT1A 1SA5A 5HQ8A 4KT6B 3JXIA 3RIBA 1MJ0A 2DIWA 3DSUA 3ML9A 4AXHA 2V0PA 2ZIRA 4UWKA 1E8XA 4GTQA 4F3VA 4JEUA 3IV0A 3V31A 5LP0A 5JHAA 5A23A 1HS6A 1NL4A 2LUHA 2X6KA 3E37A 4J8EA 3UI2A 5KJNA 3FU6A 3EUVA 3FTZA 2BKKB 3TWXA 3HXDA 2WXMA 4WUYA 2R02A 5LCWC 1QZ2A 3NAWA 3TWSA 4JHJA 4BETA 2KZTB 3LDZA 3FUFA 3QK0A 1LD8A 3CVLA 4KYOB 3E33A 4DLOA 3SFZA 1H2VC 3MV2B 4C0MA 5JA4D 2F8XK 5CERB 2OVFA 3Q73A 2FO1E 2UWJG 2IOLA 5T3RA 3UINC 4PH4B 2MYOA 1BPOA 4JVSA 4C9BB 5CCLA 2E0IA 3ZHEB 3UT7A 3FY4A 1A5EA 4ME2A 2NYJA 4FJYA 1D9SA 1NI1A 4HORA 3MCXA 2EIKE 5FZQA 3U9WA 3L13A 3CIAA 2PNNA 3ENEA 3JXJA 2XHEA 1WY6A 2KZTA 3UMVA 3ABME 3FUIA
chains in the Genus database with same CATH topology
1WG0A 4HRLA 4O1OA 3LJNA 4F1PA 4K5BA 4LG6A 4LNUD 1UOHA 3T9KA 3UI2A 1BI8B 2V4HC 3AAAC 4K5CA 4C48B 1YMPA 3UTMA 3TWVA 5CEAA 5ENSD 4DRXE 2Y1LE 5KNHD 1IXVA 2ZGGA 2J8SD 3TWRA 5ENTD 4CYMD 2BKGA 2XENA 3EHQA 2BKKB 5EILA 2RFMA 4DX6D 2Y0BG 1IHBA 3TWXA 3J5PA 4QQIA 2RFAA 3ZU7B 4HQDA 3Q9UC 4QFVA 4LSZE 1BLXB 2KBXA 5FIOA 2QYJA 1WDYA 3NBNB 1BI7B 3TWWA 4GMRA 4BSZB 5CBOA 1OT8A 3V79K 3TWSA 3W9FA 4BETA 2ETBA 2XZDG 1MX4A 2ETAA 5HRYA 4DX1A 2ZGDA 4DX7D 2AJAA 1MX2A 1N11A 5D66A 4CZ2D 4OAUC 3HG0D 4GPMA 5AN8A 5AQ9A 5AAOA 1IKND 4ZHBA 5EIBE 1YCSB 4DX2A 3EU9A 4J7WA 3IXEA 2V5QC 3B7BA 4A63B 3SO8A 2A5EA 4HLLA 4N5QA 4RLYA 3TWUA 3V30A 4DX5D 4O60A 3Q9NC 4TUMA 2XEHA 5JA4D 2F8XK 2DWZA 1SVXA 4ATZD 2DVWA 4HI9A 2VGEA 1S70B 4U8VD 5CERB 4YDWA 4UUCA 1DCQA 4OAVB 4BESA 3TWTA 5AQAA 5FINA 5BXUA 2FO1E 3ZKJA 5BXOA 4DUIA 5KBAA 1TR4A 1MYOA 2DZOA 3J5QB 2F37A 3EHRA 5ITZF 3HRAA 4U95D 2ETCA 4HNAD 2DZNA 4U8YD 2MYOA 3DEOA 5AQBA 3C5RA 1MX6A 2B0OE 4HI8A 5CBNA 4NIKA 3KEAA 2P2CP 3NOCD 3TWQA 3JUEA 5ENQD 2F8YA 1G3NB 3ZNGA 1A5EA 1DC2A 5CEDB 4G8KA 3UXGA 4B93B 1AWCB 1K1AA 5HS0A 2NYJA 3JXIA 3B95A 4HRNA 4K5AB 1SW6A 4O1PA 3D9HA 1D9SA 5KNGA 4F6RD 5KWDA 1MJ0A 2L6BA 1BD8A 4BERA 4JB8P 4HBDA 3V2XA 1YYHA 5EYLA 5HKPA 5AARA 4ZFHA 3DEPA 1K3ZD 3NOGD 2HE0A 2PNNA 2QC9A 3AJIA 4G8LA 4HRMB 5EN5D 5ENPD 1K1BA 5EYPF 3JXJA 4Z68A 2KXPC 5CECB 1BU9A 5ENRD 4YDYA 3F6QA 5ENOD 5JMND 3T8KA 3W9GA 2XEEA 3ZUVB 4BEPA 3V2OA 1QYMA 2XZTG 1N0QA 3V31A 1AP7A 1OY3D 5AQ7A 4J8YA 4HB5A 5EIDA 2JABA 1NFIE 4U96D 1N0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WG0 A;  4HRL A;  4O1O A;  3LJN A;  4F1P A;  4K5B A;  4LG6 A;  4LNU D;  1UOH A;  3T9K A;  3UI2 A;  1BI8 B;  2V4H C;  3AAA C;  4K5C A;  4C48 B;  1YMP A;  3UTM A;  3TWV A;  5CEA A;  5ENS D;  4DRX E;  2Y1L E;  5KNH D;  1IXV A;  2ZGG A;  2J8S D;  3TWR A;  5ENT D;  4CYM D;  2BKG A;  2XEN A;  3EHQ A;  2BKK B;  5EIL A;  2RFM A;  4DX6 D;  2Y0B G;  1IHB A;  3TWX A;  3J5P A;  4QQI A;  2RFA A;  3ZU7 B;  4HQD A;  3Q9U C;  4QFV A;  4LSZ E;  1BLX B;  2KBX A;  5FIO A;  2QYJ A;  1WDY A;  3NBN B;  1BI7 B;  3TWW A;  4GMR A;  4BSZ B;  5CBO A;  1OT8 A;  3V79 K;  3TWS A;  3W9F A;  4BET A;  2ETB A;  2XZD G;  1MX4 A;  2ETA A;  5HRY A;  4DX1 A;  2ZGD A;  4DX7 D;  2AJA A;  1MX2 A;  1N11 A;  5D66 A;  4CZ2 D;  4OAU C;  3HG0 D;  4GPM A;  5AN8 A;  5AQ9 A;  5AAO A;  1IKN D;  4ZHB A;  5EIB E;  1YCS B;  4DX2 A;  3EU9 A;  4J7W A;  3IXE A;  2V5Q C;  3B7B A;  4A63 B;  3SO8 A;  2A5E A;  4HLL A;  4N5Q A;  4RLY A;  3TWU A;  3V30 A;  4DX5 D;  4O60 A;  3Q9N C;  4TUM A;  2XEH A;  5JA4 D;  2F8X K;  2DWZ A;  1SVX A;  4ATZ D;  2DVW A;  4HI9 A;  2VGE A;  1S70 B;  4U8V D;  5CER B;  4YDW A;  4UUC A;  1DCQ A;  4OAV B;  4BES A;  3TWT A;  5AQA A;  5FIN A;  5BXU A;  2FO1 E;  3ZKJ A;  5BXO A;  4DUI A;  5KBA A;  1TR4 A;  1MYO A;  2DZO A;  3J5Q B;  2F37 A;  3EHR A;  5ITZ F;  3HRA A;  4U95 D;  2ETC A;  4HNA D;  2DZN A;  4U8Y D;  2MYO A;  3DEO A;  5AQB A;  3C5R A;  1MX6 A;  2B0O E;  4HI8 A;  5CBN A;  4NIK A;  3KEA A;  2P2C P;  3NOC D;  3TWQ A;  3JUE A;  5ENQ D;  2F8Y A;  1G3N B;  3ZNG A;  1A5E A;  1DC2 A;  5CED B;  4G8K A;  3UXG A;  4B93 B;  1AWC B;  1K1A A;  5HS0 A;  2NYJ A;  3JXI A;  3B95 A;  4HRN A;  4K5A B;  1SW6 A;  4O1P A;  3D9H A;  1D9S A;  5KNG A;  4F6R D;  5KWD A;  1MJ0 A;  2L6B A;  1BD8 A;  4BER A;  4JB8 P;  4HBD A;  3V2X A;  1YYH A;  5EYL A;  5HKP A;  5AAR A;  4ZFH A;  3DEP A;  1K3Z D;  3NOG D;  2HE0 A;  2PNN A;  2QC9 A;  3AJI A;  4G8L A;  4HRM B;  5EN5 D;  5ENP D;  1K1B A;  5EYP F;  3JXJ A;  4Z68 A;  2KXP C;  5CEC B;  1BU9 A;  5ENR D;  4YDY A;  3F6Q A;  5ENO D;  5JMN D;  3T8K A;  3W9G A;  2XEE A;  3ZUV B;  4BEP A;  3V2O A;  1QYM A;  2XZT G;  1N0Q A;  3V31 A;  1AP7 A;  1OY3 D;  5AQ7 A;  4J8Y A;  4HB5 A;  5EID A;  2JAB A;  1NFI E;  4U96 D;  1N0R A; 
#chains in the Genus database with same CATH topology
 3R9M A;  3FWV A;  2OOE A;  1N52 A;  1TNZ A;  1E7V A;  1IHG A;  3QKY A;  4GTV A;  1YMP A;  5LCW J;  5BUZ A;  1E8Z A;  3DRA A;  2IO3 C;  3I5P A;  3D9N A;  3EHQ A;  3ZYK A;  2WXI A;  3QNK A;  3ZHE A;  4LSZ E;  4WAF A;  2WXN A;  3DPD A;  2OND A;  1B89 A;  3C3O A;  2WXO A;  3HXC A;  4XE0 A;  3GZS A;  5T4Y A;  1HX8 A;  2ZGD A;  1DVP A;  2DYR E;  4DX2 A;  1D8D A;  2LAI A;  4HLL A;  3PEU B;  3CVW A;  4GMJ A;  3RJV A;  2DWZ A;  3LXU X;  4X8Q A;  3EHM A;  2FBN A;  4M7C A;  3TWT A;  3D9K A;  4I2Z A;  2L0T B;  5B3S E;  5EX0 A;  3WXX A;  5ITZ F;  3L16 A;  3SBS A;  4RVB A;  2B0O E;  2VQ2 A;  2LNI A;  1AWC B;  4UWG A;  4ILI A;  4ABN A;  3G2U A;  4YDO A;  4N2Q A;  2CG3 A;  3OXF A;  4N3B A;  1XNF A;  3TG5 A;  3NOG D;  2X3M A;  2AXZ A;  3UIO C;  4Z68 A;  2KXP C;  4A1S A;  2DBA A;  2R17 C;  4GTT A;  3PUJ A;  4U8H A;  3U64 A;  3ZPJ A;  3LJN A;  4CT4 A;  4LG6 A;  1SQM A;  2P58 C;  1OWO A;  5FQ8 A;  2WXJ A;  3G2S A;  4DK5 A;  2L0I A;  4BTA A;  4XZ4 A;  3CVV A;  3HYM B;  2IFU A;  3IKO B;  4GYY A;  2KBX A;  3DSX A;  4FHK A;  3CSF A;  2AWI A;  3UPV A;  1MX2 A;  2H6G A;  4CZ2 D;  4KXK B;  2GRO B;  3B7B A;  2WM9 A;  2J4B A;  3D9L A;  2CHZ A;  4XEI G;  3I4G A;  4I6G A;  4ATZ D;  2WQ6 A;  3ZYQ A;  2VGE A;  3FTX A;  4MKT A;  3ONK A;  3AG3 E;  2R2L A;  5C2Y A;  4DUI A;  3HRA A;  3FUD A;  1JCR A;  3FEY A;  3NQP A;  4JA9 A;  1HG5 A;  4L9P A;  3TG4 A;  1FVF A;  5ARF A;  3X2Q E;  3AU5 A;  4FAD A;  2XPI A;  4P29 A;  2L6B A;  2QZA A;  4HS2 A;  5EYL A;  5AAR A;  3ZGQ A;  2XS8 A;  2KCL A;  1UW4 B;  5ENR D;  1O1S A;  5FJY A;  3ZUV B;  1AP7 A;  3ZN3 A;  1OY3 D;  4Q69 A;  3HXE A;  2CHX A;  5A7D B;  1N0R A;  2EIJ E;  3MKQ B;  3URZ A;  4TXP A;  4GTM A;  4LNU D;  5M72 A;  5FTP A;  5D0Q D;  3HDX A;  4C48 B;  3TJP A;  2PZI A;  2Y1L E;  3SBT B;  4I1A A;  3AS8 A;  2J8S D;  1DNP A;  1UJK A;  4JHR A;  4TUU A;  4QQI A;  4A1G A;  2KC7 A;  5BNW A;  4A3T A;  1KZO A;  3LY8 A;  5B1B E;  2ETA A;  3APC A;  3Q5M A;  4OAU C;  1IYG A;  1A17 A;  3MV3 B;  3KSQ A;  5AAO A;  5EIB E;  2V5Q C;  1ZB1 A;  3TGO A;  2FO7 A;  1KLX A;  4TUM A;  1KZP A;  1HH8 A;  4OAV B;  2UY1 B;  1H19 A;  3MKQ A;  1EDU A;  3BU8 A;  4GA0 A;  5CCM A;  4U8Y D;  4FP7 A;  2PQN A;  4L2Y A;  1TNU A;  4UI9 K;  4UQX A;  3ULQ A;  3R7R A;  4PUC A;  3EHN A;  3G2W A;  3Q78 A;  2JEK A;  3UM1 A;  1E8W A;  4KVM A;  2L9B A;  2FF4 A;  5JHB A;  3OAW A;  1O1T A;  3DBS A;  3CVX A;  3U4T A;  5KWD A;  1OUV A;  4BER A;  3E34 A;  3B7R L;  3TXM A;  2I9C A;  1BU9 A;  3EJN A;  4BX8 A;  2WQ7 A;  3LJ3 A;  2J07 A;  4O1O A;  3B13 A;  4F1P A;  5EDS A;  4IUL A;  3AU4 A;  2P9L G;  4FJZ A;  2UY1 A;  3DXK G;  3PVL A;  2WMN A;  3I3N A;  3Q79 A;  2AXV A;  3SHF A;  3EU5 A;  4ANW A;  2XEN A;  3JQ0 A;  3B7U X;  1H2U A;  3ZU7 B;  5LOZ A;  3CHQ A;  1HG2 A;  4GMR A;  1OCR E;  2VTB B;  4YND A;  1JWG A;  1X81 A;  3IXE A;  3CK7 A;  2A5E A;  2ZIS A;  4I43 A;  1U2V G;  2DYS E;  4O60 A;  4F53 A;  2DVW A;  5ARG A;  5J08 A;  3BEE A;  4XX5 A;  2R59 A;  1ELW A;  3FUL A;  2AVP A;  3L08 A;  2DZO A;  3CHM A;  1E90 A;  2P9P G;  3QAR A;  4ANU A;  2XCB A;  3JUE A;  3FFL A;  1QQE A;  3IEG A;  2EIM E;  1G3N B;  2RKK A;  4G8K A;  2I6H A;  5HS0 A;  3CV0 A;  1Y6I A;  3ZXS A;  4OVV A;  1BD8 A;  4J0U A;  4JPS A;  2XGM A;  2QY7 A;  4HRM B;  1N4S A;  3ASG A;  3TXN A;  3ZYL A;  3HXF A;  5JMN D;  2Y4T A;  3QJZ A;  4TRQ A;  2GRL A;  3ABK E;  2VTB A;  4WNE A;  1Z5S C;  1Z3X A;  5EID A;  2Q7F A;  3FP3 A;  2V8S E;  4L2L A;  4K5B A;  4GTS A;  4LEU A;  3SGH A;  2I2O A;  1TJF A;  3BG0 B;  3LYA A;  2ZGG A;  3D9J A;  3FTY A;  1EYH A;  4LUN U;  3Q9U C;  5E76 A;  2H6H A;  2IU1 A;  3NBN B;  2J49 A;  4E6H A;  4XI0 A;  2XEV A;  3W9F A;  1UN8 A;  2WXL A;  3HG0 D;  2VSO E;  3LY9 A;  4A3V A;  3L9T A;  4A63 B;  4G25 A;  1OCO E;  3QWV A;  4V3I A;  4J8D A;  2H6I A;  1DCQ A;  4WWN A;  5FIN A;  1UN9 A;  2KCV A;  5FQ6 A;  2F37 A;  2DZN A;  5AQB A;  5KJL A;  1LF8 A;  5B1A E;  4J6I A;  3JCK C;  4B93 B;  2VGY A;  4APO A;  2GRQ B;  4GTP A;  2IEJ A;  5EYP F;  3PEV B;  2BUG A;  5CEC B;  2YHC A;  4U0U A;  2Y69 E;  2XEE A;  3FH8 A;  1TYQ G;  3C3Q A;  4EZJ A;  3EIJ A;  1UG3 A;  3PDN A;  3LY7 A;  1VDY A;  3O48 A;  2EIL E;  4FA6 A;  3G2V A;  4U07 A;  2E2E A;  5AEN A;  3LEW A;  5LFA A;  3DSW A;  4HQD A;  1BLX B;  1WDY A;  4B8A A;  4TV3 A;  4CDN A;  2XRY A;  4Y6C A;  2ETB A;  4CCA A;  2IQC A;  1HFA A;  3D9O A;  3S7F A;  2BTD A;  3KS2 A;  3KSL A;  4ANV A;  1TNY A;  4B94 A;  4J7W A;  4JXT A;  2MHK A;  1EPU A;  3AG2 E;  1E8Y A;  1S0P A;  4HI9 A;  4PS7 A;  4YDW A;  1SZA A;  4BES A;  4JL0 A;  4ILH B;  4EEC A;  1ZU2 A;  3AG1 E;  5KBA A;  4C0E A;  1MYO A;  2CHW A;  3TAX A;  3D9I A;  3OTN A;  2XRZ A;  4K0R A;  4W9R A;  1V54 E;  3ASH A;  1MX6 A;  4HI8 A;  4HOQ A;  3L82 A;  1OWL A;  4D10 C;  3B7S A;  1XGW A;  3LPZ A;  2R03 A;  1KPS B;  1NA0 A;  3MX3 A;  4I17 A;  2PM6 A;  3V2X A;  3U66 A;  1UJJ A;  2JLB A;  3S7D A;  4N2S A;  3UT4 A;  3DXM G;  5A6C A;  2YNQ A;  5AQ7 A;  3FEX A;  3LKU A;  5IY5 E;  1NFI E;  3GW4 A;  4MS6 A;  3D9M A;  3AAA C;  1FVH A;  4GZ6 A;  2WXP A;  5BPP A;  1IXV A;  2RFM A;  4AV7 A;  2R5S A;  5HI7 A;  3UKU G;  3KD7 A;  4KVO A;  3VLE A;  5H7P A;  4DX1 A;  5D66 A;  3T5X A;  3NB2 A;  5AN8 A;  3TL5 A;  1MHQ A;  4N5Q A;  1FT1 A;  2LAH A;  3G2T A;  4FUL A;  4N3A A;  1SVX A;  4G2V A;  3RO2 A;  2XPZ A;  3C72 A;  5CRU A;  4BWR A;  2LXL A;  1V55 E;  4L1B A;  5FWQ A;  1WAO 1;  3ESK A;  3RRM B;  1TN8 A;  4GYW A;  2ZXW E;  3Q4A B;  1N9A A;  1D8E A;  3C5R A;  2ZU6 B;  2P2C P;  3ZRH A;  4L7T A;  4AVX A;  1ELR A;  3D9H A;  2P9N G;  4JB8 P;  2WQH A;  3ASF A;  4YVQ C;  3DEP A;  3JUI A;  3EDT B;  2IO2 C;  3CQG B;  2OVB A;  2FI7 A;  4JEH A;  4U96 D;  3OXL A;  3CVP A;  1QNF A;  2LXM A;  2M63 A;  3D9P A;  2C2L A;  2AXU A;  3DST A;  3ISM C;  3S2A A;  5CMY A;  3T9K A;  1L5J A;  4K5C A;  4I6J A;  3RK6 A;  4WND A;  1Y8M A;  2IF4 A;  2B6C A;  5FIO A;  3L6A A;  1DCE A;  4BSZ B;  2WXG A;  2A4Z A;  3FUH A;  3Q15 A;  4G24 A;  4RSY A;  1INZ A;  4CDM A;  4G11 A;  3SQV A;  3R7Q A;  4YDE A;  4HOS A;  2H6F A;  2PQR A;  4U7E B;  3Q9N C;  2HO1 A;  2P9U G;  4DI4 A;  5G2N A;  4TXR A;  1YA0 A;  4BT8 A;  4A55 A;  3RU0 A;  3PZD A;  1JUQ A;  3EHR A;  5FQ7 A;  5AJL A;  3CK9 A;  1TNO A;  2QFC A;  2GGF A;  2F8Y A;  3CHP A;  2V4L A;  1K1A A;  1N54 A;  4O1P A;  5ANL A;  4JA7 A;  3CK8 A;  3APD A;  3JQ1 A;  5D2M C;  4HBD A;  5HKP A;  2FEZ A;  4APF A;  4G8L A;  1K1B A;  3F6Q A;  4RG6 A;  2GRP B;  3VLF A;  3ZXP A;  1N0Q A;  1NA3 A;  5BV0 A;  2WXF A;  3P1U A;  4EZK A;  3RAU A;  2GRM A;  4TXQ A;  1UOH A;  1PAQ A;  1O5M A;  3UIP C;  1HU3 A;  4BX9 A;  4UWL A;  3NZS A;  4ACL A;  3PE3 A;  3PS6 A;  1H0A A;  3LCA A;  3MJW A;  4JW1 A;  2WXH A;  4BFR A;  2HYZ A;  2QYU A;  5AQ9 A;  5C1D A;  3RO3 A;  1NZN A;  5EX3 A;  3TWU A;  4DPR A;  3FDH A;  1S63 A;  3ZYM A;  3PZ1 A;  4GTO A;  3FTS A;  4FLH A;  1LD7 A;  1TR4 A;  1ELK A;  4KZC A;  3DSS A;  3Q7A A;  2J09 A;  4EQF A;  3ULY A;  2IY0 C;  2MRI A;  4LER A;  1DC2 A;  4UWF A;  4RG9 A;  5D0O D;  2GRN B;  1OCZ E;  3ZW3 A;  4CGW A;  4UWH A;  4F7A A;  4I2W A;  4NUR A;  3WG7 E;  1H6K A;  1OWP A;  3MYV A;  1LTX A;  2ION A;  1K3Z D;  3AJI A;  5EN5 D;  3T8K A;  4B0Z A;  5G04 C;  2YIN A;  1GW6 A;  3UT8 A;  2PM7 A;  3SZ7 A;  4GA1 A;  1Z3Y A;  4GAA A;  4HFG A;  3MA5 A;  4G1T A;  5ENN A;  3FTU A;  2DCP A;  1N4P A;  1TNB A;  3UTM A;  5ENS D;  3QWW A;  2KAT A;  3TWR A;  3GZ1 A;  2BKG A;  3DWL G;  3NF1 A;  5EIL A;  3FU3 A;  4CDR A;  2Y0B G;  2FUL A;  4DJA A;  4QFV A;  4DI3 A;  3AG4 E;  3SFY A;  4EZL A;  5CRV A;  2EIN E;  1N4Q A;  3E4B A;  1KT0 A;  1TJC A;  4J8S A;  3PUK A;  4LNG A;  4B8C B;  3ZVV A;  1IKN D;  2J08 A;  4H7X A;  3FH7 A;  5JJT A;  2R05 A;  4DX5 D;  3AS5 A;  1ZBP A;  2C0L A;  3QWP A;  1JCS A;  4AOF A;  4WNF A;  2YHE A;  3Q49 B;  5CMW A;  5BXU A;  4GZ5 A;  3CVN A;  4CRW A;  4U95 D;  2LO6 A;  4U04 A;  2P9I G;  5E75 A;  1N4R A;  4NIK A;  3KEA A;  1N94 A;  3FUE A;  2Y3A A;  4K5A B;  4F6R D;  3HIZ A;  5G04 J;  2RG8 A;  4UQY A;  3K9I A;  1YYH A;  3SY2 A;  2QC9 A;  3D3M A;  2X38 A;  3FUJ A;  4BT9 A;  1HF8 A;  4N3C A;  4FC8 A;  1IQR A;  3HXB A;  5ANR A;  2RD0 A;  1Q2Z A;  2VSX E;  2NC9 A;  3VTX A;  4LRZ A;  3U3W A;  4U0Z A;  1HE8 A;  1IQU A;  4AEZ C;  3PE4 A;  3FTW A;  2VGX B;  4HXI A;  5J90 A;  1BI8 B;  3FUM A;  3IHY A;  4UI9 C;  3CQC B;  3TWV A;  4FLB A;  4HVB A;  4GTR A;  3CVU A;  3ESL A;  4RQI A;  3CGH A;  2WB2 A;  3QAQ A;  4PDX A;  2YQ8 A;  1PY1 A;  5BV1 A;  3V79 K;  5JJ7 A;  1FCH A;  3ML8 A;  3CEQ A;  1H2T C;  1N11 A;  3UKR G;  3GYZ A;  2WVI A;  4FU3 A;  3V30 A;  4MLP A;  3C98 A;  3FUN A;  1RW2 A;  2XEH A;  1TN6 A;  4J8F A;  3DSV A;  4U8V D;  2F0Y A;  4LCT A;  1U3D A;  1OXJ A;  2X6J A;  3ZKJ A;  3ASD A;  3UM0 A;  4ILG A;  2V5F A;  2VGX A;  4I9E A;  4HLE A;  3MEK A;  3ASN E;  4EHM A;  1KT1 A;  3NZU A;  2X6F A;  5G55 A;  4AY6 A;  2P9K G;  3UXG A;  3EIQ C;  3B95 A;  1SW6 A;  5KNG A;  2BED A;  2AW6 A;  2Y4U A;  3E32 A;  1O1R A;  3Q47 B;  2L6J A;  2KM4 A;  4FHJ A;  1HO8 A;  3PRZ A;  3W9G A;  5KJM A;  1OWM A;  2HR2 A;  4H7Y A;  4J8Y A;  2WPV A;  1H6O A;  5G05 C;  3AS4 A;  4UI9 J;  2VYI A;  1WG0 A;  3ZIM A;  2KCK A;  3CLJ A;  4JC8 A;  3MKR A;  1X5B A;  2OCC E;  2VSY A;  3UX4 A;  2IOS A;  1JWF A;  4KMO A;  1FPP A;  1NP7 A;  3CHS A;  4ATG A;  3SD5 A;  4WWP A;  3CST A;  3SI5 A;  5KCM A;  4ACK A;  4I1M A;  2NXP A;  1MX4 A;  5HRY A;  4U63 A;  3N71 A;  1OCC E;  3ZEF A;  1K8K G;  3LVR E;  1H6P A;  4URK A;  3UUX A;  1S64 A;  4N39 A;  3IHV A;  4LNB A;  2MOW A;  2OEV A;  2IJG X;  1TEZ A;  4GYO A;  4GU5 A;  4JHK A;  2LSV A;  5ENQ D;  1TN7 A;  4I6E A;  4XKB A;  4CEM A;  3JYS A;  2C0M A;  4AIF A;  2CG2 A;  5G05 J;  2HE0 A;  5ENP D;  4GZD A;  4YDY A;  5ENO D;  4BEP A;  3UM2 A;  1RZ4 A;  1QYM A;  4XI9 A;  4HOT A;  2J9Q A;  2JAB A;  2ILR A;  1HZ4 A;  4ZFH A;  3ZFW A;  2XPY A;  3BQO A;  3BUA A;  1P5Q A;  5FQ4 A;  4GCO A;  4BY6 A;  5EKQ D;  2X6I A;  3QDN A;  3UQ3 A;  4WWO A;  4XIF A;  3HVE B;  3IBE A;  5ENT D;  4E85 A;  3RSE G;  3KEZ A;  3ASO E;  4EPZ A;  1BI7 B;  3TWW A;  2HM8 A;  5AIJ A;  1OT8 A;  2LSU A;  3FH5 A;  4MRU A;  4CGV A;  2AJA A;  4PS8 A;  2VSN A;  3ULE G;  3GZ2 A;  1YCS B;  3PNT B;  5CHE E;  4Q94 A;  4RLY A;  3PH0 C;  3FTV A;  1S70 B;  2OEW A;  2I1J A;  2BF0 X;  4NAC A;  5AQA A;  3RRU A;  2CFZ A;  5BXO A;  5FT9 A;  4Y6W A;  3J5Q B;  4KZ0 A;  4GZ3 A;  3RKV A;  4XKC A;  2I1K A;  4CT0 A;  4N5C A;  3L22 A;  3NOC D;  5T8I A;  3HVE A;  3ZNG A;  4GCN A;  4GML A;  2CFU A;  4AJW A;  3MZL B;  1JCQ A;  4JZY A;  4GZC A;  5AJD A;  4M3O A;  1MQS A;  3ABL E;  3CHR A;  4EBA A;  5FZS A;  1E96 B;  3P2B A;  4HB5 A;  3OXG A;  1MZC A;  4HRL A;  3S7J A;  2OV8 A;  3CVQ A;  3VLD A;  4BTB A;  3R9A B;  1SZ9 A;  3Q7F A;  3DPY A;  3LVQ E;  5KNH D;  4CYM D;  3FU0 A;  4DX6 D;  1SA4 A;  1IHB A;  2WXK A;  2RFA A;  4L23 A;  3QB2 A;  3CHO A;  2P9S G;  4GA2 A;  3RRN B;  1E7U A;  2QYJ A;  3MGB A;  4EBA G;  4G23 A;  5CBO A;  3PRE A;  4AP2 A;  4PS3 A;  1Z6T A;  5DBK A;  1QBQ A;  4AY5 A;  3E30 A;  4I1O B;  4OYS A;  4GPM A;  3B7T A;  3EU9 A;  2XGS A;  3KAE A;  3QOU A;  3SNX A;  3PZ3 A;  4UUC A;  5JJ6 A;  3ONL A;  1WM5 A;  3PZ4 A;  2ETC A;  1W3B A;  2WMO A;  4MBG A;  5CBN A;  3CKB A;  2J4D A;  4B89 A;  3T8M A;  4ANX A;  3O4Z A;  3QC1 A;  4Q96 A;  4R7L A;  2VJ8 A;  3FU5 A;  5CED B;  4O6F A;  4HRN A;  2GRR B;  5AYW D;  2WXR A;  4NRH B;  3VTY A;  3L54 A;  4WNG A;  2XGO A;  1HXI A;  4JD2 G;  3V2O A;  2EQX A;  2XZT G;  3L17 A;  3CVY A;  3T5V A;  4GB9 A;  2NSZ A;  1N95 A;  2V4H C;  3SFX A;  3SF4 A;  4IRU A;  5CEA A;  3PNL B;  4DRX E;  4AM9 A;  4UQZ A;  4OVU A;  3J5P A;  4IYP A;  5DIZ A;  3CR3 A;  4K03 A;  3CKC A;  5FZR A;  4KBQ A;  4I9C A;  1JPL A;  4HOU A;  4U0S A;  2XZD G;  5LX8 A;  4DX7 D;  5KJK A;  3BG1 B;  2PL2 A;  4DLQ A;  4ZHB A;  1PC2 A;  4NQ0 A;  3APF A;  1EF1 C;  3SO8 A;  3Q75 A;  1U3C A;  1FT2 A;  3S7B A;  3FUK A;  3PZ2 A;  5BW8 C;  4F1S A;  3C3R A;  3I4R B;  2X6H A;  4GPK A;  2GW1 A;  3LS8 A;  4BSX A;  2XS1 A;  4HNA D;  2XQ0 A;  2XCC A;  3DEO A;  4G26 A;  4IN3 B;  3UM3 A;  1OWN A;  3TWQ A;  3FHE A;  3HHM A;  2WXQ A;  4YVO A;  2A5U A;  5BT1 A;  1SA5 A;  5HQ8 A;  4KT6 B;  3JXI A;  3RIB A;  1MJ0 A;  2DIW A;  3DSU A;  3ML9 A;  4AXH A;  2V0P A;  2ZIR A;  4UWK A;  1E8X A;  4GTQ A;  4F3V A;  4JEU A;  3IV0 A;  3V31 A;  5LP0 A;  5JHA A;  5A23 A;  1HS6 A;  1NL4 A;  2LUH A;  2X6K A;  3E37 A;  4J8E A;  3UI2 A;  5KJN A;  3FU6 A;  3EUV A;  3FTZ A;  2BKK B;  3TWX A;  3HXD A;  2WXM A;  4WUY A;  2R02 A;  5LCW C;  1QZ2 A;  3NAW A;  3TWS A;  4JHJ A;  4BET A;  2KZT B;  3LDZ A;  3FUF A;  3QK0 A;  1LD8 A;  3CVL A;  4KYO B;  3E33 A;  4DLO A;  3SFZ A;  1H2V C;  3MV2 B;  4C0M A;  5JA4 D;  2F8X K;  5CER B;  2OVF A;  3Q73 A;  2FO1 E;  2UWJ G;  2IOL A;  5T3R A;  3UIN C;  4PH4 B;  2MYO A;  1BPO A;  4JVS A;  4C9B B;  5CCL A;  2E0I A;  3ZHE B;  3UT7 A;  3FY4 A;  1A5E A;  4ME2 A;  2NYJ A;  4FJY A;  1D9S A;  1NI1 A;  4HOR A;  3MCX A;  2EIK E;  5FZQ A;  3U9W A;  3L13 A;  3CIA A;  2PNN A;  3ENE A;  3JXJ A;  2XHE A;  1WY6 A;  2KZT A;  3UMV A;  3ABM E;  3FUI A; 
#chains in the Genus database with same CATH homology
 1WG0 A;  4HRL A;  4O1O A;  3LJN A;  4F1P A;  4K5B A;  4LG6 A;  4LNU D;  1UOH A;  3T9K A;  3UI2 A;  1BI8 B;  2V4H C;  3AAA C;  4K5C A;  4C48 B;  1YMP A;  3UTM A;  3TWV A;  5CEA A;  5ENS D;  4DRX E;  2Y1L E;  5KNH D;  1IXV A;  2ZGG A;  2J8S D;  3TWR A;  5ENT D;  4CYM D;  2BKG A;  2XEN A;  3EHQ A;  2BKK B;  5EIL A;  2RFM A;  4DX6 D;  2Y0B G;  1IHB A;  3TWX A;  3J5P A;  4QQI A;  2RFA A;  3ZU7 B;  4HQD A;  3Q9U C;  4QFV A;  4LSZ E;  1BLX B;  2KBX A;  5FIO A;  2QYJ A;  1WDY A;  3NBN B;  1BI7 B;  3TWW A;  4GMR A;  4BSZ B;  5CBO A;  1OT8 A;  3V79 K;  3TWS A;  3W9F A;  4BET A;  2ETB A;  2XZD G;  1MX4 A;  2ETA A;  5HRY A;  4DX1 A;  2ZGD A;  4DX7 D;  2AJA A;  1MX2 A;  1N11 A;  5D66 A;  4CZ2 D;  4OAU C;  3HG0 D;  4GPM A;  5AN8 A;  5AQ9 A;  5AAO A;  1IKN D;  4ZHB A;  5EIB E;  1YCS B;  4DX2 A;  3EU9 A;  4J7W A;  3IXE A;  2V5Q C;  3B7B A;  4A63 B;  3SO8 A;  2A5E A;  4HLL A;  4N5Q A;  4RLY A;  3TWU A;  3V30 A;  4DX5 D;  4O60 A;  3Q9N C;  4TUM A;  2XEH A;  5JA4 D;  2F8X K;  2DWZ A;  1SVX A;  4ATZ D;  2DVW A;  4HI9 A;  2VGE A;  1S70 B;  4U8V D;  5CER B;  4YDW A;  4UUC A;  1DCQ A;  4OAV B;  4BES A;  3TWT A;  5AQA A;  5FIN A;  5BXU A;  2FO1 E;  3ZKJ A;  5BXO A;  4DUI A;  5KBA A;  1TR4 A;  1MYO A;  2DZO A;  3J5Q B;  2F37 A;  3EHR A;  5ITZ F;  3HRA A;  4U95 D;  2ETC A;  4HNA D;  2DZN A;  4U8Y D;  2MYO A;  3DEO A;  5AQB A;  3C5R A;  1MX6 A;  2B0O E;  4HI8 A;  5CBN A;  4NIK A;  3KEA A;  2P2C P;  3NOC D;  3TWQ A;  3JUE A;  5ENQ D;  2F8Y A;  1G3N B;  3ZNG A;  1A5E A;  1DC2 A;  5CED B;  4G8K A;  3UXG A;  4B93 B;  1AWC B;  1K1A A;  5HS0 A;  2NYJ A;  3JXI A;  3B95 A;  4HRN A;  4K5A B;  1SW6 A;  4O1P A;  3D9H A;  1D9S A;  5KNG A;  4F6R D;  5KWD A;  1MJ0 A;  2L6B A;  1BD8 A;  4BER A;  4JB8 P;  4HBD A;  3V2X A;  1YYH A;  5EYL A;  5HKP A;  5AAR A;  4ZFH A;  3DEP A;  1K3Z D;  3NOG D;  2HE0 A;  2PNN A;  2QC9 A;  3AJI A;  4G8L A;  4HRM B;  5EN5 D;  5ENP D;  1K1B A;  5EYP F;  3JXJ A;  4Z68 A;  2KXP C;  5CEC B;  1BU9 A;  5ENR D;  4YDY A;  3F6Q A;  5ENO D;  5JMN D;  3T8K A;  3W9G A;  2XEE A;  3ZUV B;  4BEP A;  3V2O A;  1QYM A;  2XZT G;  1N0Q A;  3V31 A;  1AP7 A;  1OY3 D;  5AQ7 A;  4J8Y A;  4HB5 A;  5EID A;  2JAB A;  1NFI E;  4U96 D;  1N0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...