3AG4E

Bovine heart cytochrome c oxidase in the cyanide ion-bound fully reduced state at 100 k
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
total genus 42
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 3ag4E00
2EINE 3ABKE 1V55E 3AG3E 3AG2E 5B3SE 2EILE 3X2QE 2DYRE 3WG7E 2EIJE 3ABLE 1OCCE 5B1BE 1V54E 2Y69E 3ASOE 3AG4E 5IY5E 1OCZE 3ASNE 2EIKE 5B1AE 3AG1E 1OCOE 2DYSE 1OCRE 2OCCE 2EIME 3ABME 2ZXWE
chains in the Genus database with same CATH superfamily
4AY5A 3UIPC 5BV1A 4WUYA 4J7WA 2AWIA 1JCQA 4BSZB 2P2CP 4J8DA 2P9LG 2VQ2A 3VLEA 1S64A 5D2MC 4LUNU 3PZ1A 5CERB 2NYJA 3HXFA 4PH4B 3DSSA 5JMND 4FHJA 3E32A 3SFYA 4UWFA 3EHMA 4GTRA 4QQIA 1WG0A 4HXIA 1N52A 3GZSA 5EDSA 3JUIA 3CK9A 3CVNA 3IHYA 4Q69A 2QYUA 1BI7B 3KSQA 4RLYA 1OWMA 5G05J 3QAQA 1B89A 5EIDA 3JXJA 2IQCA 5KNGA 3UT4A 5EX3A 3CV0A 1PY1A 1S0PA 4OVUA 1H2UA 4NRHB 3Q4AB 4WAFA 1IKND 2GROB 3HRAA 4FU3A 3UT8A 2ZGGA 4XI0A 4AV7A 3R9AB 2R5SA 3LDZA 4AY6A 3ZPJA 2P9IG 2PNNA 3CVVA 4AP2A 3ZKJA 2J08A 2F8XK 3PEVB 3NOGD 4ILGA 3G2UA 4U04A 4GTTA 5AN8A 4HRNA 2L0IA 3TWVA 4FLBA 2OEVA 3EIJA 1TNUA 3OXFA 4EBAG 4BT9A 3FEYA 3L13A 2WXRA 3L22A 3UM3A 2A4ZA 5CMWA 2CG2A 3C3QA 3V30A 5G55A 1BLXB 2WXPA 4ME2A 2DWZA 5JJ6A 4DX1A 4G8KA 3JQ0A 3SBTB 4YVOA 4H7YA 3Q47B 3KAEA 3T9KA 3MKQB 3C98A 1TN7A 3HVEA 2OVFA 3CVXA 4UQZA 1SA4A 4DUIA 5HKPA 1H6OA 3CR3A 2Y3AA 3APCA 1HE8A 1H6KA 3E37A 2IO3C 4TUUA 2XPZA 3C5RA 3LJNA 3DXMG 1YA0A 2R02A 1RZ4A 5AAOA 3UKUG 4ILHB 1JCRA 3BEEA 5BUZA 2VJ8A 3L08A 1Y6IA 5HRYA 4YDEA 3AU4A 2EQXA 5LFAA 1YYHA 2EIKE 2ETAA 3RSEG 1MQSA 5KNHD 3SY2A 5M72A 2GW1A 4LRZA 3LVQE 3LEWA 1VDYA 4GU5A 4Q96A 5AENA 4APOA 4FULA 1TR4A 4I1MA 4MLPA 3SF4A 3ZRHA 4GYOA 3PUJA 5E76A 4HFGA 1OY3D 5BV0A 5T4YA 1PC2A 4E85A 4RQIA 3T5VA 2IEJA 1SQMA 4GZ3A 3NBNB 3FDHA 5B3SE 3EHRA 4UI9K 4C0EA 2PL2A 5CMYA 2J49A 3PE4A 3PS6A 4XE0A 2XHEA 1DC2A 3CK8A 4RSYA 3S7DA 3FH8A 4B8CB 3Q78A 2F37A 5ENNA 2C0LA 3WG7E 2UWJG 1RW2A 2P58C 5HI7A 4DRXE 2FF4A 4YDWA 3FU0A 4JA9A 5CCLA 2FO7A 1O1RA 4P29A 2Y0BG 3T5XA 1IHGA 4A1GA 5FQ4A 4JHRA 5BT1A 5ENPD 5DIZA 1NA3A 4G26A 4N3AA 4F3VA 2KCVA 4ANWA 5A6CA 2P9SG 3LJ3A 3CHOA 4JW1A 2CG3A 2XGMA 1IQUA 4J8EA 4RVBA 3UPVA 2WB2A 2VSOE 4N2QA 1SZ9A 2ONDA 3FTVA 5H7PA 3I4GA 1N95A 4K0RA 4BFRA 3ZHEB 3RRNB 1UJKA 1HFAA 2H6FA 2UY1B 3UTMA 2RD0A 5BXUA 4V3IA 4BX9A 1DCEA 3NB2A 4DX2A 4GA2A 5J08A 1BI8B 2C2LA 3MKQA 3ZFWA 1HZ4A 5ANRA 3GZ2A 3CVQA 3ESLA 5KWDA 1JWFA 4ABNA 3OAWA 4DLQA 1ZU2A 3ESKA 3LS8A 4OAVB 2YHEA 1ZB1A 3Q15A 5BPPA 4PS3A 3BG1B 4GZDA 4JHKA 4JPSA 4NURA 1GW6A 4KT6B 1ZBPA 3FY4A 3LYAA 1SA5A 3P1UA 2GRLA 2KM4A 2A5EA 1D8DA 2BF0X 5AQ9A 1MX6A 4G8LA 3HDXA 1H2VC 2VTBB 4HNAD 2OCCE 1HH8A 1A17A 3SGHA 2Y4UA 3HXBA 1S63A 3EHQA 4LG6A 5ARGA 2LO6A 3ZYMA 4APFA 2AVPA 2KZTB 3ONKA 2IO2C 4TV3A 2LXMA 4WWNA 3TWXA 4H7XA 4ANVA 3OTNA 3U4TA 2A5UA 2QYJA 2AXUA 4EQFA 4RG9A 4MS6A 4O1PA 1ELRA 4IYPA 1Z3YA 4LNGA 3BG0B 5KJLA 3SI5A 4K5AB 3UX4A 4GCNA 4L1BA 3ZXPA 2ILRA 3J5QB 2OVBA 3Q7AA 4N2SA 5LP0A 2ETCA 2AW6A 4AVXA 4HOTA 5EILA 3ZU7B 2QC9A 5JJTA 2WM9A 1NZNA 1Y8MA 2FO1E 3CHMA 4HRLA 2WXJA 4GA0A 5CBNA 1KZOA 2XGSA 3NF1A 3SD5A 3ABLE 2FEZA 4M3OA 5A7DB 2RFAA 3S7FA 1IXVA 1SW6A 3JQ1A 3C3RA 3IKOB 3L6AA 4E6HA 4CGWA 5CCMA 3PREA 1N4PA 3MA5A 4F1PA 5FQ6A 3L16A 5AJLA 2F0YA 4FC8A 4WNDA 3Q73A 3B95A 4BERA 3CLJA 1YCSB 4UI9J 3IBEA 1P5QA 1DVPA 1K1AA 4GMJA 2OEWA 1IYGA 2VYIA 3HHMA 4I9EA 3ZHEA 2WXNA 3RAUA 2UY1A 2HO1A 3U64A 1V54E 3APDA 3ASOE 4CEMA 4DLOA 3I4RB 4DK5A 1OWNA 1WAO1 4EZKA 2HYZA 4B8AA 2BKGA 2V5FA 3FTWA 3ZIMA 3V2OA 2WPVA 1N0QA 3UI2A 3LPZA 4NIKA 5FT9A 3X2QE 3UIOC 4AM9A 4N3CA 1LD8A 1TNOA 2LAIA 5FQ7A 3C72A 3TWUA 5CEDB 4B89A 5HQ8A 3JXIA 3B7UX 5FIOA 2XEHA 4TXPA 3HG0D 4EBAA 4U95D 4HOUA 4UWGA 3QWVA 3QWPA 4JB8P 2M63A 3FEXA 5AARA 4U8VD 4BTBA 4AIFA 4F7AA 2R17C 3APFA 3G2WA 1TJCA 2DCPA 3FU3A 4M7CA 4JZYA 1EDUA 1PAQA 3UM0A 2BEDA 3NZUA 3IHVA 5CEAA 1U3CA 5ENQD 4J8FA 2Q7FA 1TNBA 3ISMC 3FUJA 5AQ7A 4FADA 3EJNA 3FTZA 2EIME 1MJ0A 2R2LA 3RKVA 4L23A 5AQBA 5CHEE 2J8SD 4MRUA 2PM6A 1QZ2A 4C0MA 4UWHA 3RO3A 2VSXE 4EPZA 4YVQC 3G2TA 2KC7A 1OCZE 5EKQD 1N4QA 1EF1C 5FQ8A 4O60A 4DI3A 4JXTA 4GZ6A 4UQYA 3CHPA 1KZPA 1OCRE 4CT4A 3B7SA 2R59A 3RO2A 3FTYA 4XKCA 3QNKA 2EILE 3ULEG 3MCXA 4J8SA 3B7TA 3D9IA 3CQCB 2OOEA 3RIBA 4HVBA 4Z68A 4DX5D 2RFMA 5EN5D 4FJYA 5D0QD 1MHQA 3DWLG 2AJAA 3ASGA 5C1DA 4U8YD 5C2YA 2XGOA 3KSLA 4KYOB 4BY6A 2GRNB 3VLDA 3CEQA 4CDNA 1LTXA 1OT8A 4GTVA 3LY8A 4HOSA 1D8EA 3Q5MA 2NSZA 4KVMA 2CFZA 4GZ5A 1ELKA 4GYWA 3SZ7A 1U3DA 3ONLA 5CRVA 5FZSA 4O1OA 4DX6D 3NZSA 3D9PA 3V31A 3L82A 3FH7A 4JC8A 1N0RA 5B1AE 3ZYLA 2IOLA 3AG1E 4G11A 3G2VA 1DNPA 3UUXA 2X6HA 3ABKE 4Y6CA 2FULA 1E8ZA 2DBAA 3HXDA 5T8IA 5FWQA 1TN6A 3AS8A 3DSXA 3D9NA 4TRQA 4BT8A 4F6RD 3Q49B 2V4LA 3SO8A 2X3MA 3O48A 3HXCA 3ULQA 5EYLA 5KBAA 3MV2B 4XX5A 3ZXSA 2LUHA 3SBSA 4LSZE 4XI9A 4HLLA 2NXPA 4EZJA 2ZISA 2L9BA 3PH0C 1FT1A 4JL0A 3CVWA 1JWGA 4U0UA 4YDYA 3ZYQA 5KJMA 5AQAA 3RRUA 4UWKA 2ZXWE 1QQEA 2EINE 3CVUA 4HOQA 3UQ3A 3E30A 3TG5A 4U96D 1OWPA 3FU5A 1X5BA 1E8XA 4NACA 3I5PA 4KBQA 5FTPA 2P9NG 4OYSA 2H6GA 4UWLA 2RG8A 5ARFA 3N71A 1XNFA 4L2LA 3DXKG 3FTSA 3T8KA 4JD2G 4TXQA 4LNBA 3AAAC 3TWQA 3JUEA 5FJYA 3GYZA 4AOFA 3ZNGA 1DCQA 3T8MA 4GTMA 4J0UA 2PQRA 4I43A 3D3MA 5CBOA 3GZ1A 2X38A 3QB2A 1N4SA 4TXRA 4I2ZA 3W9FA 2P9KG 3KEAA 4GB9A 1HG5A 3EHNA 3QDNA 4BTAA 1H19A 3J5PA 4F1SA 2VGYA 2ZGDA 1IHBA 2XPYA 2IJGX 2XS1A 4K5BA 3QOUA 1E7VA 5EX0A 1UW4B 4DPRA 4JA7A 3FTXA 3FUNA 2E0IA 4YNDA 4GPMA 5EYPF 5CRUA 1N9AA 2EIJE 2XENA 2QZAA 4IRUA 1OXJA 5JHBA 3MYVA 5ITZF 2IONA 1E96B 1K8KG 4BESA 4HORA 4AJWA 4C9BB 4CRWA 3SFXA 1X81A 2P9PG 2AXVA 2J4BA 3TWSA 3TWTA 1K1BA 4ANXA 3CGHA 3F6QA 4ATZD 5J90A 3DSUA 2XS8A 4G1TA 4BEPA 3WXXA 2XCCA 1HX8A 3DSWA 1JPLA 2L0TB 3B13A 3JYSA 1HO8A 4XEIG 3VTYA 2LSVA 3D9JA 3LY7A 1NA0A 2XQ0A 4UI9C 3FUHA 4BSXA 3PZ2A 3AS5A 3AJIA 2Y1LE 3E34A 1MX2A 1H2TC 3Q7FA 4JEUA 5AIJA 4KZCA 3CVLA 3OXGA 4CYMD 1W3BA 4ACLA 3QARA 3U66A 2XRYA 2R03A 4J6IA 2YNQA 2CHXA 3LXUX 4A3TA 2KXPC 4ANUA 2WQ7A 2YHCA 1A5EA 5LX8A 3Q75A 3K9IA 2BKKB 4IN3B 3ASDA 3FUKA 4N5QA 2BTDA 3DPYA 1QNFA 1WY6A 4AEZC 1NFIE 4OAUC 4DI4A 4I1AA 2IOSA 4MKTA 1KLXA 5ANLA 2ZIRA 4HLEA 1WDYA 2CHWA 3IEGA 3FU6A 4LERA 2NC9A 2WXKA 3FWVA 2I9CA 3EUVA 3FUMA 2YINA 5G05C 4HRMB 1E8WA 4PS8A 4FP7A 2JLBA 4A3VA 3ZEFA 3CQGB 5G04J 1UG3A 2JABA 2WXLA 4GTOA 3BQOA 3Q9NC 3GW4A 3HVEB 4K03A 2HE0A 3NOCD 5KJKA 1E8YA 4JHJA 1FVFA 1MX4A 2MYOA 3MJWA 3ZVVA 3ASHA 1HF8A 3ZN3A 4BX8A 2HR2A 3PZ3A 3NQPA 2WXOA 4OVVA 4LNUD 4TUMA 3UT7A 4CGVA 4GCOA 4L9PA 3PZ4A 3TGOA 3KD7A 5IY5E 5JJ7A 1TNYA 5FINA 4ZHBA 3VTXA 3HXEA 2XZDG 3PNTB 4YDOA 4G23A 4I2WA 4I6EA 2H6HA 3FUEA 3FTUA 3R9MA 1N94A 4URKA 2V5QC 2J09A 2LXLA 1O1TA 4G24A 1HG2A 1NL4A 1Z5SC 5G2NA 3IV0A 4GAAA 4XKBA 1YMPA 4J8YA 1HXIA 1NP7A 3HYMB 1E7UA 2LAHA 3CHRA 3B7RL 3L9TA 4CDRA 1V55E 2JEKA 2XRZA 3P2BA 2VGEA 3CVYA 4LEUA 4KMOA 4K5CA 2WXIA 2V0PA 3E33A 4F53A 4NQ0A 2QY7A 3RRMB 2VTBA 2DYSE 3RK6A 4PS7A 4HS2A 3AU5A 2LSUA 2WXFA 2J4DA 1KT1A 4GTPA 3D9HA 3QC1A 4I9CA 4ZFHA 3PVLA 2DZNA 2KZTA 3CK7A 4I6JA 4WWOA 5AYWD 3KS2A 5ENSD 2WMOA 1HS6A 3D9OA 2XEVA 5BNWA 3PNLB 5LCWJ 4WWPA 2WXQA 3LKUA 4KXKB 1N11A 2V8SE 2AXZA 3SNXA 5D0OD 5E75A 5ENRD 2IY0C 3DSTA 3EU5A 4I17A 3HIZA 2R05A 4C48B 1U2VG 2WMNA 3TWWA 3MKRA 4U0SA 3DBSA 3UKRG 1H6PA 3TJPA 2H6IA 4IULA 3FUFA 3D9LA 5CECB 4GYYA 1EYHA 3CKCA 3TG4A 3MGBA 4U07A 1N4RA 2J07A 4HI8A 3LCAA 3DSVA 1LF8A 4CZ2D 2DVWA 1IQRA 1OWOA 3SFZA 5B1BE 1Z3XA 3UM2A 3Q9UC 4B93B 3TWRA 3UMVA 5T3RA 4JVSA 4CCAA 1OCOE 2OV8A 3ULYA 4I1OB 5BW8C 4I6GA 2YQ8A 2I1JA 1FVHA 2KATA 4Y6WA 1BD8A 3EIQC 4UQXA 2V4HC 2L6BA 3QKYA 4B0ZA 2P9UG 1UN8A 5ENOD 1L5JA 4JEHA 3IXEA 3G2SA 2CHZA 2VSYA 1TN8A 5D66A 4BWRA 3RU0A 1NI1A 1O1SA 2KCLA 1UOHA 3SQVA 3DRAA 4ATGA 2VGXB 4WNEA 1TEZA 2WXMA 4Q94A 1G3NB 4G2VA 2KCKA 3U9WA 4O6FA 2CFUA 4EECA 3CKBA 3MZLB 3L54A 3ZW3A 4PUCA 3ASFA 4N39A 1WM5A 4LCTA 3S7BA 4L7TA 3PDNA 3ABME 4CDMA 1BPOA 3LY9A 2GRPB 3UM1A 1N54A 3PE3A 1ELWA 3Q79A 2VSNA 2DYRE 1XGWA 1E90A 2XZTG 3V79K 3NAWA 1TNZA 4GMLA 4KVOA 3TXNA 3FP3A 3UINC 3MV3B 2I2OA 2PQNA 4R7LA 1FCHA 1UJJA 1AWCB 3ZGQA 3ML8A 4GTSA 3QJZA 1EPUA 4L2YA 3V2XA 1O5MA 3PEUB 2BUGA 4KZ0A 2XCBA 4HQDA 3UXGA 4WNGA 2RKKA 3OXLA 4ACKA 1MZCA 3E4BA 2B6CA 3S7JA 1TJFA 3PRZA 2IF4A 3CSTA 4U8HA 2FBNA 4DJAA 4XZ4A 1Q2ZA 3FHEA 3D9KA 4A55A 5JA4D 3VLFA 2Y69E 4N5CA 3QK0A 4U63A 5BXOA 5JHAA 3CIAA 3MEKA 2GGFA 1KPSB 4DX7D 3EDTB 3BU8A 2B0OE 3TXMA 2L6JA 5KJNA 3FUIA 4GPKA 3W9GA 5LOZA 4RG6A 3ML9A 3AS4A 4FHKA 3TL5A 5HS0A 2ZU6B 3CVPA 3FULA 3DEPA 5FZQA 4BETA 3PZDA 1JCSA 4U7EB 1SZAA 1AP7A 2IFUA 4GA1A 4GMRA 3B7BA 4B94A 3ENEA 4A63B 2WVIA 3URZA 2GRRB 2XPIA 2MRIA 4ILIA 2QFCA 2X6KA 5FZRA 4XIFA 5G04C 4G25A 4FJZA 3TAXA 4N3BA 1UN9A 4A1SA 1KT0A 2PZIA 3O4ZA 3EU9A 3L17A 2E2EA 3R7QA 3FUDA 2LNIA 4AXHA 3CHSA 1FT2A 2MOWA 3C3OA 3PUKA 1K3ZD 2PM7A 2J9QA 3ZYKA 3DEOA 1FPPA 2VGXA 5EIBE 5A23A 4HI9A 4GTQA 3AG2E 4EZLA 3I3NA 3FFLA 4FLHA 4EHMA 3ZUVB 1OUVA 4CT0A 3AG4E 1TYQG 5ENTD 3S2AA 3CHQA 4PDXA 4FA6A 2X6FA 3BUAA 1LD7A 3LVRE 3QWWA 1S70B 1HU3A 3RJVA 2C0MA 2DIWA 2X6IA 3AG3E 2I1KA 4QFVA 2GRQB 2WQHA 1BU9A 2WXHA 5KCMA 5DBKA 2F8YA 1OCCE 2KBXA 4U0ZA 3DPDA 1SVXA 4GZCA 3KEZA 4X8QA 2XEEA 3ASNE 2DZOA 4UUCA 1JUQA 2MHKA 3D9MA 1INZA 3FH5A 3U3WA 3CSFA 1Z6TA 5AJDA 2FI7A 2X6JA 1QYMA 2Y4TA 4MBGA 2GRMA 1OWLA 1H0AA 4HB5A 2ETBA 1MYOA 1QBQA 4D10C 2HM8A 3MX3A 4WNFA 4W9RA 2WQ6A 3SHFA 5LCWC 3R7RA 4HBDA 1D9SA 2I6HA 2WXGA 2IU1A 3JCKC
chains in the Genus database with same CATH topology
2EINE 3ABKE 1V55E 3AG3E 3AG2E 5B3SE 2EILE 3X2QE 2DYRE 3WG7E 2EIJE 3ABLE 1OCCE 5B1BE 1V54E 2Y69E 3ASOE 3AG4E 5IY5E 1OCZE 3ASNE 2EIKE 5B1AE 3AG1E 1OCOE 2DYSE 1OCRE 2OCCE 2EIME 3ABME 2ZXWE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIN E;  3ABK E;  1V55 E;  3AG3 E;  3AG2 E;  5B3S E;  2EIL E;  3X2Q E;  2DYR E;  3WG7 E;  2EIJ E;  3ABL E;  1OCC E;  5B1B E;  1V54 E;  2Y69 E;  3ASO E;  3AG4 E;  5IY5 E;  1OCZ E;  3ASN E;  2EIK E;  5B1A E;  3AG1 E;  1OCO E;  2DYS E;  1OCR E;  2OCC E;  2EIM E;  3ABM E;  2ZXW E; 
#chains in the Genus database with same CATH topology
 4AY5 A;  3UIP C;  5BV1 A;  4WUY A;  4J7W A;  2AWI A;  1JCQ A;  4BSZ B;  2P2C P;  4J8D A;  2P9L G;  2VQ2 A;  3VLE A;  1S64 A;  5D2M C;  4LUN U;  3PZ1 A;  5CER B;  2NYJ A;  3HXF A;  4PH4 B;  3DSS A;  5JMN D;  4FHJ A;  3E32 A;  3SFY A;  4UWF A;  3EHM A;  4GTR A;  4QQI A;  1WG0 A;  4HXI A;  1N52 A;  3GZS A;  5EDS A;  3JUI A;  3CK9 A;  3CVN A;  3IHY A;  4Q69 A;  2QYU A;  1BI7 B;  3KSQ A;  4RLY A;  1OWM A;  5G05 J;  3QAQ A;  1B89 A;  5EID A;  3JXJ A;  2IQC A;  5KNG A;  3UT4 A;  5EX3 A;  3CV0 A;  1PY1 A;  1S0P A;  4OVU A;  1H2U A;  4NRH B;  3Q4A B;  4WAF A;  1IKN D;  2GRO B;  3HRA A;  4FU3 A;  3UT8 A;  2ZGG A;  4XI0 A;  4AV7 A;  3R9A B;  2R5S A;  3LDZ A;  4AY6 A;  3ZPJ A;  2P9I G;  2PNN A;  3CVV A;  4AP2 A;  3ZKJ A;  2J08 A;  2F8X K;  3PEV B;  3NOG D;  4ILG A;  3G2U A;  4U04 A;  4GTT A;  5AN8 A;  4HRN A;  2L0I A;  3TWV A;  4FLB A;  2OEV A;  3EIJ A;  1TNU A;  3OXF A;  4EBA G;  4BT9 A;  3FEY A;  3L13 A;  2WXR A;  3L22 A;  3UM3 A;  2A4Z A;  5CMW A;  2CG2 A;  3C3Q A;  3V30 A;  5G55 A;  1BLX B;  2WXP A;  4ME2 A;  2DWZ A;  5JJ6 A;  4DX1 A;  4G8K A;  3JQ0 A;  3SBT B;  4YVO A;  4H7Y A;  3Q47 B;  3KAE A;  3T9K A;  3MKQ B;  3C98 A;  1TN7 A;  3HVE A;  2OVF A;  3CVX A;  4UQZ A;  1SA4 A;  4DUI A;  5HKP A;  1H6O A;  3CR3 A;  2Y3A A;  3APC A;  1HE8 A;  1H6K A;  3E37 A;  2IO3 C;  4TUU A;  2XPZ A;  3C5R A;  3LJN A;  3DXM G;  1YA0 A;  2R02 A;  1RZ4 A;  5AAO A;  3UKU G;  4ILH B;  1JCR A;  3BEE A;  5BUZ A;  2VJ8 A;  3L08 A;  1Y6I A;  5HRY A;  4YDE A;  3AU4 A;  2EQX A;  5LFA A;  1YYH A;  2EIK E;  2ETA A;  3RSE G;  1MQS A;  5KNH D;  3SY2 A;  5M72 A;  2GW1 A;  4LRZ A;  3LVQ E;  3LEW A;  1VDY A;  4GU5 A;  4Q96 A;  5AEN A;  4APO A;  4FUL A;  1TR4 A;  4I1M A;  4MLP A;  3SF4 A;  3ZRH A;  4GYO A;  3PUJ A;  5E76 A;  4HFG A;  1OY3 D;  5BV0 A;  5T4Y A;  1PC2 A;  4E85 A;  4RQI A;  3T5V A;  2IEJ A;  1SQM A;  4GZ3 A;  3NBN B;  3FDH A;  5B3S E;  3EHR A;  4UI9 K;  4C0E A;  2PL2 A;  5CMY A;  2J49 A;  3PE4 A;  3PS6 A;  4XE0 A;  2XHE A;  1DC2 A;  3CK8 A;  4RSY A;  3S7D A;  3FH8 A;  4B8C B;  3Q78 A;  2F37 A;  5ENN A;  2C0L A;  3WG7 E;  2UWJ G;  1RW2 A;  2P58 C;  5HI7 A;  4DRX E;  2FF4 A;  4YDW A;  3FU0 A;  4JA9 A;  5CCL A;  2FO7 A;  1O1R A;  4P29 A;  2Y0B G;  3T5X A;  1IHG A;  4A1G A;  5FQ4 A;  4JHR A;  5BT1 A;  5ENP D;  5DIZ A;  1NA3 A;  4G26 A;  4N3A A;  4F3V A;  2KCV A;  4ANW A;  5A6C A;  2P9S G;  3LJ3 A;  3CHO A;  4JW1 A;  2CG3 A;  2XGM A;  1IQU A;  4J8E A;  4RVB A;  3UPV A;  2WB2 A;  2VSO E;  4N2Q A;  1SZ9 A;  2OND A;  3FTV A;  5H7P A;  3I4G A;  1N95 A;  4K0R A;  4BFR A;  3ZHE B;  3RRN B;  1UJK A;  1HFA A;  2H6F A;  2UY1 B;  3UTM A;  2RD0 A;  5BXU A;  4V3I A;  4BX9 A;  1DCE A;  3NB2 A;  4DX2 A;  4GA2 A;  5J08 A;  1BI8 B;  2C2L A;  3MKQ A;  3ZFW A;  1HZ4 A;  5ANR A;  3GZ2 A;  3CVQ A;  3ESL A;  5KWD A;  1JWF A;  4ABN A;  3OAW A;  4DLQ A;  1ZU2 A;  3ESK A;  3LS8 A;  4OAV B;  2YHE A;  1ZB1 A;  3Q15 A;  5BPP A;  4PS3 A;  3BG1 B;  4GZD A;  4JHK A;  4JPS A;  4NUR A;  1GW6 A;  4KT6 B;  1ZBP A;  3FY4 A;  3LYA A;  1SA5 A;  3P1U A;  2GRL A;  2KM4 A;  2A5E A;  1D8D A;  2BF0 X;  5AQ9 A;  1MX6 A;  4G8L A;  3HDX A;  1H2V C;  2VTB B;  4HNA D;  2OCC E;  1HH8 A;  1A17 A;  3SGH A;  2Y4U A;  3HXB A;  1S63 A;  3EHQ A;  4LG6 A;  5ARG A;  2LO6 A;  3ZYM A;  4APF A;  2AVP A;  2KZT B;  3ONK A;  2IO2 C;  4TV3 A;  2LXM A;  4WWN A;  3TWX A;  4H7X A;  4ANV A;  3OTN A;  3U4T A;  2A5U A;  2QYJ A;  2AXU A;  4EQF A;  4RG9 A;  4MS6 A;  4O1P A;  1ELR A;  4IYP A;  1Z3Y A;  4LNG A;  3BG0 B;  5KJL A;  3SI5 A;  4K5A B;  3UX4 A;  4GCN A;  4L1B A;  3ZXP A;  2ILR A;  3J5Q B;  2OVB A;  3Q7A A;  4N2S A;  5LP0 A;  2ETC A;  2AW6 A;  4AVX A;  4HOT A;  5EIL A;  3ZU7 B;  2QC9 A;  5JJT A;  2WM9 A;  1NZN A;  1Y8M A;  2FO1 E;  3CHM A;  4HRL A;  2WXJ A;  4GA0 A;  5CBN A;  1KZO A;  2XGS A;  3NF1 A;  3SD5 A;  3ABL E;  2FEZ A;  4M3O A;  5A7D B;  2RFA A;  3S7F A;  1IXV A;  1SW6 A;  3JQ1 A;  3C3R A;  3IKO B;  3L6A A;  4E6H A;  4CGW A;  5CCM A;  3PRE A;  1N4P A;  3MA5 A;  4F1P A;  5FQ6 A;  3L16 A;  5AJL A;  2F0Y A;  4FC8 A;  4WND A;  3Q73 A;  3B95 A;  4BER A;  3CLJ A;  1YCS B;  4UI9 J;  3IBE A;  1P5Q A;  1DVP A;  1K1A A;  4GMJ A;  2OEW A;  1IYG A;  2VYI A;  3HHM A;  4I9E A;  3ZHE A;  2WXN A;  3RAU A;  2UY1 A;  2HO1 A;  3U64 A;  1V54 E;  3APD A;  3ASO E;  4CEM A;  4DLO A;  3I4R B;  4DK5 A;  1OWN A;  1WAO 1;  4EZK A;  2HYZ A;  4B8A A;  2BKG A;  2V5F A;  3FTW A;  3ZIM A;  3V2O A;  2WPV A;  1N0Q A;  3UI2 A;  3LPZ A;  4NIK A;  5FT9 A;  3X2Q E;  3UIO C;  4AM9 A;  4N3C A;  1LD8 A;  1TNO A;  2LAI A;  5FQ7 A;  3C72 A;  3TWU A;  5CED B;  4B89 A;  5HQ8 A;  3JXI A;  3B7U X;  5FIO A;  2XEH A;  4TXP A;  3HG0 D;  4EBA A;  4U95 D;  4HOU A;  4UWG A;  3QWV A;  3QWP A;  4JB8 P;  2M63 A;  3FEX A;  5AAR A;  4U8V D;  4BTB A;  4AIF A;  4F7A A;  2R17 C;  3APF A;  3G2W A;  1TJC A;  2DCP A;  3FU3 A;  4M7C A;  4JZY A;  1EDU A;  1PAQ A;  3UM0 A;  2BED A;  3NZU A;  3IHV A;  5CEA A;  1U3C A;  5ENQ D;  4J8F A;  2Q7F A;  1TNB A;  3ISM C;  3FUJ A;  5AQ7 A;  4FAD A;  3EJN A;  3FTZ A;  2EIM E;  1MJ0 A;  2R2L A;  3RKV A;  4L23 A;  5AQB A;  5CHE E;  2J8S D;  4MRU A;  2PM6 A;  1QZ2 A;  4C0M A;  4UWH A;  3RO3 A;  2VSX E;  4EPZ A;  4YVQ C;  3G2T A;  2KC7 A;  1OCZ E;  5EKQ D;  1N4Q A;  1EF1 C;  5FQ8 A;  4O60 A;  4DI3 A;  4JXT A;  4GZ6 A;  4UQY A;  3CHP A;  1KZP A;  1OCR E;  4CT4 A;  3B7S A;  2R59 A;  3RO2 A;  3FTY A;  4XKC A;  3QNK A;  2EIL E;  3ULE G;  3MCX A;  4J8S A;  3B7T A;  3D9I A;  3CQC B;  2OOE A;  3RIB A;  4HVB A;  4Z68 A;  4DX5 D;  2RFM A;  5EN5 D;  4FJY A;  5D0Q D;  1MHQ A;  3DWL G;  2AJA A;  3ASG A;  5C1D A;  4U8Y D;  5C2Y A;  2XGO A;  3KSL A;  4KYO B;  4BY6 A;  2GRN B;  3VLD A;  3CEQ A;  4CDN A;  1LTX A;  1OT8 A;  4GTV A;  3LY8 A;  4HOS A;  1D8E A;  3Q5M A;  2NSZ A;  4KVM A;  2CFZ A;  4GZ5 A;  1ELK A;  4GYW A;  3SZ7 A;  1U3D A;  3ONL A;  5CRV A;  5FZS A;  4O1O A;  4DX6 D;  3NZS A;  3D9P A;  3V31 A;  3L82 A;  3FH7 A;  4JC8 A;  1N0R A;  5B1A E;  3ZYL A;  2IOL A;  3AG1 E;  4G11 A;  3G2V A;  1DNP A;  3UUX A;  2X6H A;  3ABK E;  4Y6C A;  2FUL A;  1E8Z A;  2DBA A;  3HXD A;  5T8I A;  5FWQ A;  1TN6 A;  3AS8 A;  3DSX A;  3D9N A;  4TRQ A;  4BT8 A;  4F6R D;  3Q49 B;  2V4L A;  3SO8 A;  2X3M A;  3O48 A;  3HXC A;  3ULQ A;  5EYL A;  5KBA A;  3MV2 B;  4XX5 A;  3ZXS A;  2LUH A;  3SBS A;  4LSZ E;  4XI9 A;  4HLL A;  2NXP A;  4EZJ A;  2ZIS A;  2L9B A;  3PH0 C;  1FT1 A;  4JL0 A;  3CVW A;  1JWG A;  4U0U A;  4YDY A;  3ZYQ A;  5KJM A;  5AQA A;  3RRU A;  4UWK A;  2ZXW E;  1QQE A;  2EIN E;  3CVU A;  4HOQ A;  3UQ3 A;  3E30 A;  3TG5 A;  4U96 D;  1OWP A;  3FU5 A;  1X5B A;  1E8X A;  4NAC A;  3I5P A;  4KBQ A;  5FTP A;  2P9N G;  4OYS A;  2H6G A;  4UWL A;  2RG8 A;  5ARF A;  3N71 A;  1XNF A;  4L2L A;  3DXK G;  3FTS A;  3T8K A;  4JD2 G;  4TXQ A;  4LNB A;  3AAA C;  3TWQ A;  3JUE A;  5FJY A;  3GYZ A;  4AOF A;  3ZNG A;  1DCQ A;  3T8M A;  4GTM A;  4J0U A;  2PQR A;  4I43 A;  3D3M A;  5CBO A;  3GZ1 A;  2X38 A;  3QB2 A;  1N4S A;  4TXR A;  4I2Z A;  3W9F A;  2P9K G;  3KEA A;  4GB9 A;  1HG5 A;  3EHN A;  3QDN A;  4BTA A;  1H19 A;  3J5P A;  4F1S A;  2VGY A;  2ZGD A;  1IHB A;  2XPY A;  2IJG X;  2XS1 A;  4K5B A;  3QOU A;  1E7V A;  5EX0 A;  1UW4 B;  4DPR A;  4JA7 A;  3FTX A;  3FUN A;  2E0I A;  4YND A;  4GPM A;  5EYP F;  5CRU A;  1N9A A;  2EIJ E;  2XEN A;  2QZA A;  4IRU A;  1OXJ A;  5JHB A;  3MYV A;  5ITZ F;  2ION A;  1E96 B;  1K8K G;  4BES A;  4HOR A;  4AJW A;  4C9B B;  4CRW A;  3SFX A;  1X81 A;  2P9P G;  2AXV A;  2J4B A;  3TWS A;  3TWT A;  1K1B A;  4ANX A;  3CGH A;  3F6Q A;  4ATZ D;  5J90 A;  3DSU A;  2XS8 A;  4G1T A;  4BEP A;  3WXX A;  2XCC A;  1HX8 A;  3DSW A;  1JPL A;  2L0T B;  3B13 A;  3JYS A;  1HO8 A;  4XEI G;  3VTY A;  2LSV A;  3D9J A;  3LY7 A;  1NA0 A;  2XQ0 A;  4UI9 C;  3FUH A;  4BSX A;  3PZ2 A;  3AS5 A;  3AJI A;  2Y1L E;  3E34 A;  1MX2 A;  1H2T C;  3Q7F A;  4JEU A;  5AIJ A;  4KZC A;  3CVL A;  3OXG A;  4CYM D;  1W3B A;  4ACL A;  3QAR A;  3U66 A;  2XRY A;  2R03 A;  4J6I A;  2YNQ A;  2CHX A;  3LXU X;  4A3T A;  2KXP C;  4ANU A;  2WQ7 A;  2YHC A;  1A5E A;  5LX8 A;  3Q75 A;  3K9I A;  2BKK B;  4IN3 B;  3ASD A;  3FUK A;  4N5Q A;  2BTD A;  3DPY A;  1QNF A;  1WY6 A;  4AEZ C;  1NFI E;  4OAU C;  4DI4 A;  4I1A A;  2IOS A;  4MKT A;  1KLX A;  5ANL A;  2ZIR A;  4HLE A;  1WDY A;  2CHW A;  3IEG A;  3FU6 A;  4LER A;  2NC9 A;  2WXK A;  3FWV A;  2I9C A;  3EUV A;  3FUM A;  2YIN A;  5G05 C;  4HRM B;  1E8W A;  4PS8 A;  4FP7 A;  2JLB A;  4A3V A;  3ZEF A;  3CQG B;  5G04 J;  1UG3 A;  2JAB A;  2WXL A;  4GTO A;  3BQO A;  3Q9N C;  3GW4 A;  3HVE B;  4K03 A;  2HE0 A;  3NOC D;  5KJK A;  1E8Y A;  4JHJ A;  1FVF A;  1MX4 A;  2MYO A;  3MJW A;  3ZVV A;  3ASH A;  1HF8 A;  3ZN3 A;  4BX8 A;  2HR2 A;  3PZ3 A;  3NQP A;  2WXO A;  4OVV A;  4LNU D;  4TUM A;  3UT7 A;  4CGV A;  4GCO A;  4L9P A;  3PZ4 A;  3TGO A;  3KD7 A;  5IY5 E;  5JJ7 A;  1TNY A;  5FIN A;  4ZHB A;  3VTX A;  3HXE A;  2XZD G;  3PNT B;  4YDO A;  4G23 A;  4I2W A;  4I6E A;  2H6H A;  3FUE A;  3FTU A;  3R9M A;  1N94 A;  4URK A;  2V5Q C;  2J09 A;  2LXL A;  1O1T A;  4G24 A;  1HG2 A;  1NL4 A;  1Z5S C;  5G2N A;  3IV0 A;  4GAA A;  4XKB A;  1YMP A;  4J8Y A;  1HXI A;  1NP7 A;  3HYM B;  1E7U A;  2LAH A;  3CHR A;  3B7R L;  3L9T A;  4CDR A;  1V55 E;  2JEK A;  2XRZ A;  3P2B A;  2VGE A;  3CVY A;  4LEU A;  4KMO A;  4K5C A;  2WXI A;  2V0P A;  3E33 A;  4F53 A;  4NQ0 A;  2QY7 A;  3RRM B;  2VTB A;  2DYS E;  3RK6 A;  4PS7 A;  4HS2 A;  3AU5 A;  2LSU A;  2WXF A;  2J4D A;  1KT1 A;  4GTP A;  3D9H A;  3QC1 A;  4I9C A;  4ZFH A;  3PVL A;  2DZN A;  2KZT A;  3CK7 A;  4I6J A;  4WWO A;  5AYW D;  3KS2 A;  5ENS D;  2WMO A;  1HS6 A;  3D9O A;  2XEV A;  5BNW A;  3PNL B;  5LCW J;  4WWP A;  2WXQ A;  3LKU A;  4KXK B;  1N11 A;  2V8S E;  2AXZ A;  3SNX A;  5D0O D;  5E75 A;  5ENR D;  2IY0 C;  3DST A;  3EU5 A;  4I17 A;  3HIZ A;  2R05 A;  4C48 B;  1U2V G;  2WMN A;  3TWW A;  3MKR A;  4U0S A;  3DBS A;  3UKR G;  1H6P A;  3TJP A;  2H6I A;  4IUL A;  3FUF A;  3D9L A;  5CEC B;  4GYY A;  1EYH A;  3CKC A;  3TG4 A;  3MGB A;  4U07 A;  1N4R A;  2J07 A;  4HI8 A;  3LCA A;  3DSV A;  1LF8 A;  4CZ2 D;  2DVW A;  1IQR A;  1OWO A;  3SFZ A;  5B1B E;  1Z3X A;  3UM2 A;  3Q9U C;  4B93 B;  3TWR A;  3UMV A;  5T3R A;  4JVS A;  4CCA A;  1OCO E;  2OV8 A;  3ULY A;  4I1O B;  5BW8 C;  4I6G A;  2YQ8 A;  2I1J A;  1FVH A;  2KAT A;  4Y6W A;  1BD8 A;  3EIQ C;  4UQX A;  2V4H C;  2L6B A;  3QKY A;  4B0Z A;  2P9U G;  1UN8 A;  5ENO D;  1L5J A;  4JEH A;  3IXE A;  3G2S A;  2CHZ A;  2VSY A;  1TN8 A;  5D66 A;  4BWR A;  3RU0 A;  1NI1 A;  1O1S A;  2KCL A;  1UOH A;  3SQV A;  3DRA A;  4ATG A;  2VGX B;  4WNE A;  1TEZ A;  2WXM A;  4Q94 A;  1G3N B;  4G2V A;  2KCK A;  3U9W A;  4O6F A;  2CFU A;  4EEC A;  3CKB A;  3MZL B;  3L54 A;  3ZW3 A;  4PUC A;  3ASF A;  4N39 A;  1WM5 A;  4LCT A;  3S7B A;  4L7T A;  3PDN A;  3ABM E;  4CDM A;  1BPO A;  3LY9 A;  2GRP B;  3UM1 A;  1N54 A;  3PE3 A;  1ELW A;  3Q79 A;  2VSN A;  2DYR E;  1XGW A;  1E90 A;  2XZT G;  3V79 K;  3NAW A;  1TNZ A;  4GML A;  4KVO A;  3TXN A;  3FP3 A;  3UIN C;  3MV3 B;  2I2O A;  2PQN A;  4R7L A;  1FCH A;  1UJJ A;  1AWC B;  3ZGQ A;  3ML8 A;  4GTS A;  3QJZ A;  1EPU A;  4L2Y A;  3V2X A;  1O5M A;  3PEU B;  2BUG A;  4KZ0 A;  2XCB A;  4HQD A;  3UXG A;  4WNG A;  2RKK A;  3OXL A;  4ACK A;  1MZC A;  3E4B A;  2B6C A;  3S7J A;  1TJF A;  3PRZ A;  2IF4 A;  3CST A;  4U8H A;  2FBN A;  4DJA A;  4XZ4 A;  1Q2Z A;  3FHE A;  3D9K A;  4A55 A;  5JA4 D;  3VLF A;  2Y69 E;  4N5C A;  3QK0 A;  4U63 A;  5BXO A;  5JHA A;  3CIA A;  3MEK A;  2GGF A;  1KPS B;  4DX7 D;  3EDT B;  3BU8 A;  2B0O E;  3TXM A;  2L6J A;  5KJN A;  3FUI A;  4GPK A;  3W9G A;  5LOZ A;  4RG6 A;  3ML9 A;  3AS4 A;  4FHK A;  3TL5 A;  5HS0 A;  2ZU6 B;  3CVP A;  3FUL A;  3DEP A;  5FZQ A;  4BET A;  3PZD A;  1JCS A;  4U7E B;  1SZA A;  1AP7 A;  2IFU A;  4GA1 A;  4GMR A;  3B7B A;  4B94 A;  3ENE A;  4A63 B;  2WVI A;  3URZ A;  2GRR B;  2XPI A;  2MRI A;  4ILI A;  2QFC A;  2X6K A;  5FZR A;  4XIF A;  5G04 C;  4G25 A;  4FJZ A;  3TAX A;  4N3B A;  1UN9 A;  4A1S A;  1KT0 A;  2PZI A;  3O4Z A;  3EU9 A;  3L17 A;  2E2E A;  3R7Q A;  3FUD A;  2LNI A;  4AXH A;  3CHS A;  1FT2 A;  2MOW A;  3C3O A;  3PUK A;  1K3Z D;  2PM7 A;  2J9Q A;  3ZYK A;  3DEO A;  1FPP A;  2VGX A;  5EIB E;  5A23 A;  4HI9 A;  4GTQ A;  3AG2 E;  4EZL A;  3I3N A;  3FFL A;  4FLH A;  4EHM A;  3ZUV B;  1OUV A;  4CT0 A;  3AG4 E;  1TYQ G;  5ENT D;  3S2A A;  3CHQ A;  4PDX A;  4FA6 A;  2X6F A;  3BUA A;  1LD7 A;  3LVR E;  3QWW A;  1S70 B;  1HU3 A;  3RJV A;  2C0M A;  2DIW A;  2X6I A;  3AG3 E;  2I1K A;  4QFV A;  2GRQ B;  2WQH A;  1BU9 A;  2WXH A;  5KCM A;  5DBK A;  2F8Y A;  1OCC E;  2KBX A;  4U0Z A;  3DPD A;  1SVX A;  4GZC A;  3KEZ A;  4X8Q A;  2XEE A;  3ASN E;  2DZO A;  4UUC A;  1JUQ A;  2MHK A;  3D9M A;  1INZ A;  3FH5 A;  3U3W A;  3CSF A;  1Z6T A;  5AJD A;  2FI7 A;  2X6J A;  1QYM A;  2Y4T A;  4MBG A;  2GRM A;  1OWL A;  1H0A A;  4HB5 A;  2ETB A;  1MYO A;  1QBQ A;  4D10 C;  2HM8 A;  3MX3 A;  4WNF A;  4W9R A;  2WQ6 A;  3SHF A;  5LCW C;  3R7R A;  4HBD A;  1D9S A;  2I6H A;  2WXG A;  2IU1 A;  3JCK C; 
#chains in the Genus database with same CATH homology
 2EIN E;  3ABK E;  1V55 E;  3AG3 E;  3AG2 E;  5B3S E;  2EIL E;  3X2Q E;  2DYR E;  3WG7 E;  2EIJ E;  3ABL E;  1OCC E;  5B1B E;  1V54 E;  2Y69 E;  3ASO E;  3AG4 E;  5IY5 E;  1OCZ E;  3ASN E;  2EIK E;  5B1A E;  3AG1 E;  1OCO E;  2DYS E;  1OCR E;  2OCC E;  2EIM E;  3ABM E;  2ZXW E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...