3AG4E

Bovine heart cytochrome c oxidase in the cyanide ion-bound fully reduced state at 100 k
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 42
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 3ag4E00
2EIME 1OCCE 1OCZE 5B3SE 3AG2E 2OCCE 2EILE 3AG1E 3AG4E 3ASNE 5IY5E 5B1AE 2DYRE 2EIJE 3ABKE 3ABME 3ABLE 3ASOE 1OCRE 3WG7E 5B1BE 2DYSE 2Y69E 3X2QE 1V54E 1OCOE 3AG3E 2EINE 2ZXWE 1V55E 2EIKE
chains in the Genus database with same CATH superfamily
3SHFA 3CSTA 5B3SE 5EKQD 3HXDA 3ZHEA 4LNUD 3UIPC 3IHVA 3ESKA 4WNGA 1WAO1 2JLBA 3R9AB 5D66A 3U3WA 3QWPA 3D9IA 3B7RL 4J8YA 2PL2A 4W9RA 5G04J 4C48B 4MLPA 3FTUA 1UW4B 2A5UA 3UM1A 2DWZA 3TXNA 2Y1LE 3SFZA 2KZTA 3KD7A 2DIWA 2Y4UA 3FTWA 4XEIG 4WNEA 2XS1A 1MQSA 4HBDA 4G25A 2KATA 3O4ZA 2WXRA 3UX4A 2V0PA 3Q9UC 4F1SA 2L0IA 3AS8A 1MYOA 3I4GA 2FO7A 4KT6B 3IBEA 4JD2G 5LFAA 4GA2A 3GW4A 5JJ6A 2QC9A 3C3OA 2LSVA 4HB5A 4FJZA 3FTSA 1VDYA 1N54A 4APFA 3PEVB 4IULA 3HXBA 2OOEA 3R7QA 3T5VA 1UN8A 4K5AB 1BD8A 2WXJA 4HRMB 3FH7A 3ZUVB 2P9PG 3T8KA 4JHRA 3CVYA 2F8YA 3SD5A 4FC8A 3PE4A 4AOFA 4OAUC 2I1KA 3MV3B 5BV1A 2B0OE 3UM2A 2HO1A 1OT8A 5AENA 3SZ7A 2I9CA 3FH5A 5AQ9A 4CGWA 1TN7A 2Y0BG 4TV3A 4DX1A 3CHOA 4ANXA 2GW1A 1EYHA 2GRNB 3ABKE 3B7TA 2VQ2A 2VGYA 3HXCA 5FQ7A 2P9IG 3FHEA 4PS3A 2WXLA 1DCQA 4N5CA 3AU5A 1DNPA 3UMVA 4B8AA 4JHKA 3AG2E 5HKPA 4DUIA 1H19A 2FI7A 3NQPA 2ETCA 5AARA 2ZISA 5KCMA 1N4QA 3PVLA 2XCBA 4HOQA 2EINE 4O60A 2EIKE 3V79K 2AJAA 3B7UX 2XZTG 3PNTB 3G2WA 2X6HA 3CK8A 5CHEE 1O1RA 2IEJA 4QFVA 4CDNA 1BLXB 2QFCA 5LCWC 4PS7A 5BXUA 2NYJA 3DWLG 1MX2A 3DRAA 4G8KA 5ANLA 3DBSA 2ILRA 5FQ6A 3TJPA 2ONDA 3ULYA 2NSZA 4YDOA 1EDUA 4I1AA 3TWWA 1PC2A 4WWOA 2HYZA 4ATGA 5FT9A 1OWOA 3SI5A 3OXLA 3CIAA 5EILA 2XRZA 3EU5A 2ETAA 4YNDA 2DYSE 3C3QA 4HRNA 3DEPA 2EQXA 4CGVA 4JEHA 3W9FA 4HI8A 4FA6A 4OAVB 2J08A 4GZCA 1D8EA 3EIJA 4M3OA 3T9KA 2RFAA 2LO6A 4CDRA 4YDWA 4U96D 3IV0A 3VLEA 2EILE 1E7VA 1X81A 3FY4A 2J4BA 2RG8A 3J5QB 1N4SA 3FTXA 3PREA 3OXFA 5G2NA 5FWQA 3P1UA 5JMND 2A4ZA 4JC8A 4BY6A 3FU0A 1E8ZA 4CT0A 3CVLA 4NURA 4TUMA 2WXMA 1S63A 3I3NA 3MV2B 3TWTA 3S7JA 4KVMA 3MGBA 3FU6A 2YQ8A 1OXJA 3D9MA 3QDNA 4BESA 2MHKA 3VTXA 4I2ZA 2WQ6A 3JQ1A 3PZ3A 4YDYA 3ASHA 3IHYA 4N3BA 1OY3D 4GZ3A 4BWRA 3ZPJA 4ME2A 3BG0B 2L0TB 4GCNA 5EYLA 1H2TC 3U9WA 2VJ8A 2WXOA 5FZSA 1L5JA 4BSXA 4GZ5A 2GRPB 1KT1A 3S2AA 4JHJA 2IOLA 1TJCA 5CMYA 1BU9A 4IN3B 3FH8A 4G8LA 3FEXA 3IXEA 3UM3A 3E4BA 4RG9A 3EJNA 3UINC 3VLDA 2R5SA 4KMOA 4MRUA 4JW1A 3N71A 3G2SA 3ZYMA 4A55A 3IKOB 2DVWA 4HQDA 1WM5A 2NXPA 2ZGDA 4PDXA 5KBAA 4ILGA 3MA5A 2X6JA 4B0ZA 1SA5A 1HO8A 4HORA 2WPVA 4YVOA 3W9GA 4EZJA 5G04C 1N0QA 4CZ2D 3EHMA 3V2XA 4GTTA 2DZOA 2VSNA 2HE0A 5ENRD 1LD8A 3PUJA 1HFAA 2CG3A 3EUVA 4ANVA 3L22A 3SFYA 4EQFA 3LJNA 2J4DA 2X38A 4I9EA 1N11A 1O1SA 1MZCA 2AXZA 4CYMD 4GB9A 4RSYA 4U8HA 4CDMA 4NACA 3L17A 3UT7A 2H6IA 3S7DA 4J8FA 4PH4B 3D9HA 2GRRB 4UI9C 4LRZA 4F1PA 3ZXSA 2LXLA 5EX3A 1H2VC 2LAIA 4OYSA 3RO3A 3VTYA 2WXKA 4EZLA 4GTMA 1K3ZD 4DK5A 1SA4A 3ASGA 3FUDA 4GZDA 3DPYA 3RKVA 4MS6A 3L16A 5FIOA 4U07A 1NZNA 2R02A 3JUEA 1MX6A 5FJYA 1ZU2A 3APFA 4RQIA 1ELRA 3PUKA 4G11A 4F53A 4K0RA 5AIJA 4GTVA 4DX5D 4CEMA 5HS0A 2PZIA 2CHWA 4QQIA 4WWNA 5EDSA 1NFIE 4F7AA 4DI4A 3LPZA 2PM7A 4UQZA 3CVQA 3ZRHA 2YHEA 4IRUA 3CEQA 3FULA 4GZ6A 3ASNE 4JB8P 1SW6A 4U0UA 4BT8A 4BX8A 3ULEG 4NRHB 1MHQA 1HG2A 1V54E 3D9JA 3GZSA 3AS5A 1K1BA 1GW6A 1TYQG 3CLJA 2X6FA 4I1MA 4R7LA 3ZW3A 2XPZA 3TWXA 3PZ1A 3SY2A 3EHRA 3BG1B 4Y6CA 1AWCB 3CVUA 3Q78A 3X2QE 3AU4A 1HU3A 4NQ0A 2XGSA 1Y8MA 4L1BA 4BT9A 3KEZA 4XKCA 3FUJA 3VLFA 3TWUA 4HVBA 2VYIA 4I9CA 3Q7AA 2WMNA 1N95A 3PEUB 4FP7A 2FEZA 1YYHA 2WMOA 4LERA 5IY5E 5EYPF 4U04A 1AP7A 3D9KA 2ZU6B 1H2UA 4ANWA 2BF0X 4TXPA 4HLLA 2DBAA 3CQCB 4UQXA 4J8DA 1U3CA 3UQ3A 1LD7A 5J90A 4GTPA 1SZ9A 2C0LA 3UUXA 2CHZA 4EZKA 3CSFA 4FLHA 4WAFA 1ZB1A 1FVFA 5JJTA 3G2VA 2BEDA 4FU3A 1ELWA 2RFMA 1K8KG 4LUNU 5ENNA 2VGXB 2FULA 4L23A 4B94A 4U8YD 4URKA 4JEUA 3CVXA 2C2LA 3B13A 2XS8A 5EIDA 2LXMA 3FUEA 4ZHBA 1XNFA 1KZOA 3DSSA 2XEEA 1OCOE 3BUAA 1KZPA 3FWVA 4BFRA 3NZUA 4GMJA 3L9TA 1Z5SC 1OCCE 4HRLA 5CBNA 4J7WA 4U8VD 3LYAA 1S70B 3DXMG 3ASOE 2V5QC 3L6AA 3BQOA 3FUHA 4L9PA 2IU1A 4MKTA 3CKBA 4YVQC 1JCQA 3TWVA 1YMPA 1QYMA 1IKND 1UG3A 4UWGA 3R9MA 3Q75A 2XEVA 3HG0D 5CCMA 2MOWA 1N9AA 5ENQD 3NOGD 3D9OA 3V2OA 3UKRG 2P9SG 2L6JA 1DC2A 2CFZA 3PZ2A 2VSOE 2KM4A 5EIBE 3CKCA 3CK9A 3NZSA 2DCPA 4AP2A 2VGEA 3FUFA 4Q96A 4C0EA 4U0ZA 1MX4A 4I6JA 2XENA 2IONA 5JJ7A 2ZGGA 4XKBA 3MJWA 3L54A 3FUMA 1NA0A 1OCZE 4FADA 4O1OA 5T4YA 2HM8A 2R05A 4JVSA 4Q94A 2WQ7A 5AQAA 4I6GA 3ZNGA 4GMRA 5BV0A 2KXPC 4I1OB 4LEUA 3EDTB 2I1JA 2FO1E 2MRIA 2IQCA 3QARA 3FUIA 5CMWA 2AVPA 3ZXPA 4AIFA 3DSUA 3FEYA 1YCSB 2AXVA 3PNLB 1RW2A 3DXKG 4UWLA 2F8XK 4UWHA 2A5EA 1HS6A 4B89A 5EX0A 1FT1A 3KEAA 2EIME 3OTNA 4G1TA 1LF8A 1QZ2A 1Z3YA 4I43A 1WDYA 4JA9A 4XIFA 3G2TA 4DX6D 5BNWA 3RK6A 1S64A 1Z3XA 3TWRA 2QYUA 1HF8A 3B95A 3CVNA 3Q5MA 3JXJA 3KSQA 2Y69E 2WB2A 5A6CA 3DEOA 4P29A 3MKQB 4GU5A 2BKGA 4E85A 4U0SA 4HOSA 4CCAA 3LXUX 2P9LG 4JZYA 5AJLA 1OWNA 3J5PA 4U63A 3ZIMA 2E0IA 3BEEA 1NA3A 1OWMA 3HRAA 4ILHB 3ZYQA 1E8XA 2IY0C 2ZIRA 3SGHA 4CT4A 3SO8A 4EPZA 3ISMC 2EIJE 4I17A 4FHJA 3HXEA 3LY9A 3CHPA 2AWIA 2P2CP 1UJKA 1Z6TA 2KCKA 2OEWA 2Y4TA 2E2EA 3DSWA 5ARGA 2IJGX 4GTQA 5AYWD 3LS8A 2X3MA 3CHSA 1HE8A 2R17C 3UKUG 3CVWA 3E34A 3FTYA 1Q2ZA 5JHBA 4F6RD 5JHAA 2CFUA 3Q73A 2KC7A 2VTBA 5G05J 4FULA 4AEZC 4GPKA 1TNYA 5CRUA 5ANRA 5CERB 4XX5A 1ZBPA 3F6QA 2PQRA 3NB2A 4DLQA 4GAAA 4U95D 3UIOC 1EF1C 4KVOA 4I6EA 4KZ0A 3TG4A 4DJAA 3RSEG 3AAAC 3AG1E 3UI2A 1O1TA 5D0OD 3ABLE 3LKUA 1EPUA 3I5PA 3ULQA 4N3CA 1HXIA 2JABA 3IEGA 5FTPA 3LY7A 2LAHA 1IQRA 3ML9A 4DPRA 4HI9A 4MBGA 4N3AA 3CGHA 4BX9A 3FP3A 1SZAA 2GRQB 1SVXA 4WUYA 3DSTA 3QC1A 5ENOD 4KXKB 3D9LA 5AJDA 2BTDA 4ANUA 3EU9A 3U66A 5CCLA 3OAWA 3T5XA 1OUVA 2VGXA 4EBAA 3CV0A 3MZLB 2WXHA 3PS6A 1TEZA 4WNFA 4HLEA 4RG6A 4AXHA 4JL0A 4AVXA 2J49A 3GYZA 3LEWA 3SF4A 1BPOA 5CRVA 2M63A 3EHQA 5AN8A 2CHXA 4Z68A 4BEPA 2V5FA 1NL4A 2QZAA 4FHKA 3ONLA 5KWDA 1YA0A 4WWPA 1OWLA 5M72A 2I2OA 2XGOA 4O1PA 4XE0A 1PAQA 2UWJG 5CECB 3Q47B 5FZQA 5EN5D 3RRUA 2R03A 5JA4D 1HG5A 1ELKA 2PQNA 3E30A 3DPDA 4F3VA 2OVBA 3L13A 4N2QA 4DX7D 2FF4A 4UQYA 4XI9A 4TXQA 3FUNA 2Y3AA 1FCHA 1N4PA 2HR2A 4OVUA 3HDXA 2LNIA 4PUCA 4HOUA 2VTBB 4DI3A 3CQGB 4YDEA 4G23A 2L9BA 5C1DA 4V3IA 5HQ8A 5CEAA 1UOHA 2RKKA 2J09A 3RJVA 1D8DA 4HNAD 1G3NB 3LCAA 2ZXWE 5FQ4A 3CR3A 4J0UA 4UWFA 4TRQA 4RVBA 4B93B 3MX3A 1P5QA 4L7TA 2P9UG 3RO2A 4K5CA 3SQVA 3D3MA 3RIBA 2WQHA 3APDA 4ACKA 4BTAA 3LJ3A 1S0PA 1IXVA 3R7RA 1UN9A 4GTSA 5B1AE 2XGMA 4GA1A 3SBSA 3HHMA 1JPLA 2J07A 2WXPA 1D9SA 3QKYA 2AXUA 3QNKA 2IO2C 3EHNA 3HVEB 2OCCE 1QBQA 4LSZE 3ZGQA 3HIZA 4UI9J 4L2YA 3P2BA 4Y6WA 3UPVA 5AAOA 4A3TA 3C98A 3L08A 5AQBA 3Q7FA 4CRWA 3HXFA 3Q15A 1QNFA 2RD0A 3ESLA 3QWWA 3MKQA 4N5QA 3U64A 5AQ7A 2WXQA 4E6HA 4BETA 3PH0C 3MYVA 2H6HA 2L6BA 3ZN3A 4EECA 4FLBA 3TGOA 3KS2A 5KJMA 5H7PA 4LG6A 4JXTA 2VSYA 4ZFHA 3ZYLA 3KSLA 4IYPA 5KJLA 3GZ1A 5ARFA 3AS4A 3QOUA 1XGWA 1B89A 4GMLA 2J8SD 3QK0A 2XQ0A 5G55A 3CK7A 3NAWA 3JYSA 3S7FA 3JQ0A 4FJYA 1NP7A 2OVFA 4G26A 2OEVA 3CHQA 1IQUA 4AY6A 4NIKA 3TAXA 4BERA 2DYRE 5HRYA 2IO3C 2P9KG 3JXIA 3OXGA 3E37A 3HYMB 2WXIA 2IF4A 1W3BA 2V4HC 3UT8A 3CHMA 3FFLA 3KAEA 4GYWA 1SQMA 3AG4E 4EHMA 2FBNA 1N52A 4PS8A 1H0AA 1Y6IA 3ZHEB 5J08A 3CHRA 1TNZA 5BPPA 1KLXA 5E76A 5D0QD 2BUGA 2R59A 5G05C 1O5MA 4XI0A 1INZA 4KZCA 4GYOA 5LOZA 1TNUA 3MKRA 4O6FA 3ONKA 3EIQC 2P9NG 1E90A 4AJWA 3PRZA 1FPPA 4K5BA 4JPSA 3TG5A 3PE3A 3ZFWA 2PNNA 2MYOA 2QY7A 3Q49B 2KZTB 5HI7A 3RRMB 1TR4A 4GYYA 1IHGA 4K03A 2R2LA 2VSXE 5T8IA 3UT4A 4GTRA 3CVVA 4AY5A 5E75A 5C2YA 2XZDG 2AW6A 3URZA 4A1SA 5FINA 3FU5A 4ILIA 4X8QA 2XRYA 3APCA 4KYOB 3V31A 2XPYA 4GCOA 5FZRA 3RU0A 4A1GA 3FDHA 3ENEA 3ML8A 4M7CA 4LNBA 3ZVVA 1JCRA 3GZ2A 2YINA 5KNHD 3ZYKA 3SBTB 4J8SA 1KT0A 2YNQA 4UUCA 4AM9A 1IHBA 2IFUA 4GPMA 4ACLA 3SNXA 3BU8A 1FT2A 3QWVA 3CVPA 1E7UA 3NBNB 4C9BB 2XPIA 1U3DA 3B7SA 4UWKA 3ASDA 2XCCA 3JCKC 3TWSA 3V30A 4BTBA 1WG0A 2CG2A 2UY1A 4GTOA 1JWFA 2F37A 5ITZF 2JEKA 3S7BA 5CEDB 1N94A 1RZ4A 2PM6A 1U2VG 1DVPA 5T3RA 2J9QA 4A3VA 5DBKA 2C0MA 2BKKB 3FU3A 2WXFA 1TN6A 5BXOA 2WXGA 1BI8B 4HXIA 5LCWJ 1JCSA 3UXGA 2P58C 3WG7E 5BW8C 4J6IA 4Q69A 5ENSD 1HZ4A 1JWGA 3AG3E 2YHCA 2KCVA 2GGFA 1UJJA 3Q79A 4L2LA 4GA0A 4APOA 4XZ4A 3C3RA 1JUQA 3ASFA 1HX8A 3ABME 4N39A 1OCRE 1H6PA 2H6FA 4I2WA 2XHEA 4DLOA 1NI1A 4H7YA 4JA7A 1X5BA 5KNGA 2QYJA 4OVVA 3NF1A 3ZEFA 1FVHA 4C0MA 2V8SE 1BI7B 3T8MA 4DX2A 2KCLA 1TNBA 2DZNA 3G2UA 5ENTD 3FTZA 4WNDA 3ZKJA 2KBXA 3D9PA 4ABNA 1QQEA 4LCTA 1V55E 3TWQA 3MCXA 3K9IA 1HH8A 1E8YA 4G2VA 2B6CA 1KPSB 5D2MC 4RLYA 3JUIA 2GRLA 3DSXA 1MJ0A 3RAUA 4D10C 2V4LA 5B1BE 5LX8A 2F0YA 4H7XA 4AV7A 3B7BA 1N0RA 3MEKA 3HVEA 2WVIA 5FQ8A 3TL5A 5A7DB 5BUZA 2X6IA 1TJFA 3LDZA 3PZDA 4EBAG 5CBOA 4G24A 5KJKA 4UI9K 3Q9NC 1E8WA 4DRXE 5DIZA 4HS2A 3E33A 1WY6A 3Q4AB 3L82A 1N4RA 3WXXA 3DSVA 4HFGA 1A17A 3LVQE 1LTXA 2I6HA 5A23A 1A5EA 2GRMA 2Q7FA 3QAQA 4J8EA 4KBQA 2IOSA 4A63B 1PY1A 4TUUA 2H6GA 5LP0A 3I4RB 3LY8A 1K1AA 2WM9A 3PZ4A 3QB2A 2OV8A 3C5RA 3E32A 3U4TA 5BT1A 2X6KA 2LSUA 3LVRE 3TXMA 3QJZA 3C72A 3UTMA 1TN8A 3FTVA 4LNGA 2ETBA 4U7EB 4HOTA 2UY1B 1TNOA 5ENPD 2GROB 1IYGA 2XEHA 3PDNA 3FUKA 3ZU7B 4TXRA 3AJIA 4ATZD 1E96B 5KJNA 3D9NA 1H6OA 3SFXA 3O48A 4BSZB 1H6KA 2NC9A 3UM0A 3NOCD 1DCEA 1OWPA 4B8CB 4N2SA 3RRNB 2LUHA 2WXNA
chains in the Genus database with same CATH topology
2EIME 1OCCE 1OCZE 5B3SE 3AG2E 2OCCE 2EILE 3AG1E 3AG4E 3ASNE 5IY5E 5B1AE 2DYRE 2EIJE 3ABKE 3ABME 3ABLE 3ASOE 1OCRE 3WG7E 5B1BE 2DYSE 2Y69E 3X2QE 1V54E 1OCOE 3AG3E 2EINE 2ZXWE 1V55E 2EIKE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIM E;  1OCC E;  1OCZ E;  5B3S E;  3AG2 E;  2OCC E;  2EIL E;  3AG1 E;  3AG4 E;  3ASN E;  5IY5 E;  5B1A E;  2DYR E;  2EIJ E;  3ABK E;  3ABM E;  3ABL E;  3ASO E;  1OCR E;  3WG7 E;  5B1B E;  2DYS E;  2Y69 E;  3X2Q E;  1V54 E;  1OCO E;  3AG3 E;  2EIN E;  2ZXW E;  1V55 E;  2EIK E; 
#chains in the Genus database with same CATH topology
 3SHF A;  3CST A;  5B3S E;  5EKQ D;  3HXD A;  3ZHE A;  4LNU D;  3UIP C;  3IHV A;  3ESK A;  4WNG A;  1WAO 1;  2JLB A;  3R9A B;  5D66 A;  3U3W A;  3QWP A;  3D9I A;  3B7R L;  4J8Y A;  2PL2 A;  4W9R A;  5G04 J;  4C48 B;  4MLP A;  3FTU A;  1UW4 B;  2A5U A;  3UM1 A;  2DWZ A;  3TXN A;  2Y1L E;  3SFZ A;  2KZT A;  3KD7 A;  2DIW A;  2Y4U A;  3FTW A;  4XEI G;  4WNE A;  2XS1 A;  1MQS A;  4HBD A;  4G25 A;  2KAT A;  3O4Z A;  2WXR A;  3UX4 A;  2V0P A;  3Q9U C;  4F1S A;  2L0I A;  3AS8 A;  1MYO A;  3I4G A;  2FO7 A;  4KT6 B;  3IBE A;  4JD2 G;  5LFA A;  4GA2 A;  3GW4 A;  5JJ6 A;  2QC9 A;  3C3O A;  2LSV A;  4HB5 A;  4FJZ A;  3FTS A;  1VDY A;  1N54 A;  4APF A;  3PEV B;  4IUL A;  3HXB A;  2OOE A;  3R7Q A;  3T5V A;  1UN8 A;  4K5A B;  1BD8 A;  2WXJ A;  4HRM B;  3FH7 A;  3ZUV B;  2P9P G;  3T8K A;  4JHR A;  3CVY A;  2F8Y A;  3SD5 A;  4FC8 A;  3PE4 A;  4AOF A;  4OAU C;  2I1K A;  3MV3 B;  5BV1 A;  2B0O E;  3UM2 A;  2HO1 A;  1OT8 A;  5AEN A;  3SZ7 A;  2I9C A;  3FH5 A;  5AQ9 A;  4CGW A;  1TN7 A;  2Y0B G;  4TV3 A;  4DX1 A;  3CHO A;  4ANX A;  2GW1 A;  1EYH A;  2GRN B;  3ABK E;  3B7T A;  2VQ2 A;  2VGY A;  3HXC A;  5FQ7 A;  2P9I G;  3FHE A;  4PS3 A;  2WXL A;  1DCQ A;  4N5C A;  3AU5 A;  1DNP A;  3UMV A;  4B8A A;  4JHK A;  3AG2 E;  5HKP A;  4DUI A;  1H19 A;  2FI7 A;  3NQP A;  2ETC A;  5AAR A;  2ZIS A;  5KCM A;  1N4Q A;  3PVL A;  2XCB A;  4HOQ A;  2EIN E;  4O60 A;  2EIK E;  3V79 K;  2AJA A;  3B7U X;  2XZT G;  3PNT B;  3G2W A;  2X6H A;  3CK8 A;  5CHE E;  1O1R A;  2IEJ A;  4QFV A;  4CDN A;  1BLX B;  2QFC A;  5LCW C;  4PS7 A;  5BXU A;  2NYJ A;  3DWL G;  1MX2 A;  3DRA A;  4G8K A;  5ANL A;  3DBS A;  2ILR A;  5FQ6 A;  3TJP A;  2OND A;  3ULY A;  2NSZ A;  4YDO A;  1EDU A;  4I1A A;  3TWW A;  1PC2 A;  4WWO A;  2HYZ A;  4ATG A;  5FT9 A;  1OWO A;  3SI5 A;  3OXL A;  3CIA A;  5EIL A;  2XRZ A;  3EU5 A;  2ETA A;  4YND A;  2DYS E;  3C3Q A;  4HRN A;  3DEP A;  2EQX A;  4CGV A;  4JEH A;  3W9F A;  4HI8 A;  4FA6 A;  4OAV B;  2J08 A;  4GZC A;  1D8E A;  3EIJ A;  4M3O A;  3T9K A;  2RFA A;  2LO6 A;  4CDR A;  4YDW A;  4U96 D;  3IV0 A;  3VLE A;  2EIL E;  1E7V A;  1X81 A;  3FY4 A;  2J4B A;  2RG8 A;  3J5Q B;  1N4S A;  3FTX A;  3PRE A;  3OXF A;  5G2N A;  5FWQ A;  3P1U A;  5JMN D;  2A4Z A;  4JC8 A;  4BY6 A;  3FU0 A;  1E8Z A;  4CT0 A;  3CVL A;  4NUR A;  4TUM A;  2WXM A;  1S63 A;  3I3N A;  3MV2 B;  3TWT A;  3S7J A;  4KVM A;  3MGB A;  3FU6 A;  2YQ8 A;  1OXJ A;  3D9M A;  3QDN A;  4BES A;  2MHK A;  3VTX A;  4I2Z A;  2WQ6 A;  3JQ1 A;  3PZ3 A;  4YDY A;  3ASH A;  3IHY A;  4N3B A;  1OY3 D;  4GZ3 A;  4BWR A;  3ZPJ A;  4ME2 A;  3BG0 B;  2L0T B;  4GCN A;  5EYL A;  1H2T C;  3U9W A;  2VJ8 A;  2WXO A;  5FZS A;  1L5J A;  4BSX A;  4GZ5 A;  2GRP B;  1KT1 A;  3S2A A;  4JHJ A;  2IOL A;  1TJC A;  5CMY A;  1BU9 A;  4IN3 B;  3FH8 A;  4G8L A;  3FEX A;  3IXE A;  3UM3 A;  3E4B A;  4RG9 A;  3EJN A;  3UIN C;  3VLD A;  2R5S A;  4KMO A;  4MRU A;  4JW1 A;  3N71 A;  3G2S A;  3ZYM A;  4A55 A;  3IKO B;  2DVW A;  4HQD A;  1WM5 A;  2NXP A;  2ZGD A;  4PDX A;  5KBA A;  4ILG A;  3MA5 A;  2X6J A;  4B0Z A;  1SA5 A;  1HO8 A;  4HOR A;  2WPV A;  4YVO A;  3W9G A;  4EZJ A;  5G04 C;  1N0Q A;  4CZ2 D;  3EHM A;  3V2X A;  4GTT A;  2DZO A;  2VSN A;  2HE0 A;  5ENR D;  1LD8 A;  3PUJ A;  1HFA A;  2CG3 A;  3EUV A;  4ANV A;  3L22 A;  3SFY A;  4EQF A;  3LJN A;  2J4D A;  2X38 A;  4I9E A;  1N11 A;  1O1S A;  1MZC A;  2AXZ A;  4CYM D;  4GB9 A;  4RSY A;  4U8H A;  4CDM A;  4NAC A;  3L17 A;  3UT7 A;  2H6I A;  3S7D A;  4J8F A;  4PH4 B;  3D9H A;  2GRR B;  4UI9 C;  4LRZ A;  4F1P A;  3ZXS A;  2LXL A;  5EX3 A;  1H2V C;  2LAI A;  4OYS A;  3RO3 A;  3VTY A;  2WXK A;  4EZL A;  4GTM A;  1K3Z D;  4DK5 A;  1SA4 A;  3ASG A;  3FUD A;  4GZD A;  3DPY A;  3RKV A;  4MS6 A;  3L16 A;  5FIO A;  4U07 A;  1NZN A;  2R02 A;  3JUE A;  1MX6 A;  5FJY A;  1ZU2 A;  3APF A;  4RQI A;  1ELR A;  3PUK A;  4G11 A;  4F53 A;  4K0R A;  5AIJ A;  4GTV A;  4DX5 D;  4CEM A;  5HS0 A;  2PZI A;  2CHW A;  4QQI A;  4WWN A;  5EDS A;  1NFI E;  4F7A A;  4DI4 A;  3LPZ A;  2PM7 A;  4UQZ A;  3CVQ A;  3ZRH A;  2YHE A;  4IRU A;  3CEQ A;  3FUL A;  4GZ6 A;  3ASN E;  4JB8 P;  1SW6 A;  4U0U A;  4BT8 A;  4BX8 A;  3ULE G;  4NRH B;  1MHQ A;  1HG2 A;  1V54 E;  3D9J A;  3GZS A;  3AS5 A;  1K1B A;  1GW6 A;  1TYQ G;  3CLJ A;  2X6F A;  4I1M A;  4R7L A;  3ZW3 A;  2XPZ A;  3TWX A;  3PZ1 A;  3SY2 A;  3EHR A;  3BG1 B;  4Y6C A;  1AWC B;  3CVU A;  3Q78 A;  3X2Q E;  3AU4 A;  1HU3 A;  4NQ0 A;  2XGS A;  1Y8M A;  4L1B A;  4BT9 A;  3KEZ A;  4XKC A;  3FUJ A;  3VLF A;  3TWU A;  4HVB A;  2VYI A;  4I9C A;  3Q7A A;  2WMN A;  1N95 A;  3PEU B;  4FP7 A;  2FEZ A;  1YYH A;  2WMO A;  4LER A;  5IY5 E;  5EYP F;  4U04 A;  1AP7 A;  3D9K A;  2ZU6 B;  1H2U A;  4ANW A;  2BF0 X;  4TXP A;  4HLL A;  2DBA A;  3CQC B;  4UQX A;  4J8D A;  1U3C A;  3UQ3 A;  1LD7 A;  5J90 A;  4GTP A;  1SZ9 A;  2C0L A;  3UUX A;  2CHZ A;  4EZK A;  3CSF A;  4FLH A;  4WAF A;  1ZB1 A;  1FVF A;  5JJT A;  3G2V A;  2BED A;  4FU3 A;  1ELW A;  2RFM A;  1K8K G;  4LUN U;  5ENN A;  2VGX B;  2FUL A;  4L23 A;  4B94 A;  4U8Y D;  4URK A;  4JEU A;  3CVX A;  2C2L A;  3B13 A;  2XS8 A;  5EID A;  2LXM A;  3FUE A;  4ZHB A;  1XNF A;  1KZO A;  3DSS A;  2XEE A;  1OCO E;  3BUA A;  1KZP A;  3FWV A;  4BFR A;  3NZU A;  4GMJ A;  3L9T A;  1Z5S C;  1OCC E;  4HRL A;  5CBN A;  4J7W A;  4U8V D;  3LYA A;  1S70 B;  3DXM G;  3ASO E;  2V5Q C;  3L6A A;  3BQO A;  3FUH A;  4L9P A;  2IU1 A;  4MKT A;  3CKB A;  4YVQ C;  1JCQ A;  3TWV A;  1YMP A;  1QYM A;  1IKN D;  1UG3 A;  4UWG A;  3R9M A;  3Q75 A;  2XEV A;  3HG0 D;  5CCM A;  2MOW A;  1N9A A;  5ENQ D;  3NOG D;  3D9O A;  3V2O A;  3UKR G;  2P9S G;  2L6J A;  1DC2 A;  2CFZ A;  3PZ2 A;  2VSO E;  2KM4 A;  5EIB E;  3CKC A;  3CK9 A;  3NZS A;  2DCP A;  4AP2 A;  2VGE A;  3FUF A;  4Q96 A;  4C0E A;  4U0Z A;  1MX4 A;  4I6J A;  2XEN A;  2ION A;  5JJ7 A;  2ZGG A;  4XKB A;  3MJW A;  3L54 A;  3FUM A;  1NA0 A;  1OCZ E;  4FAD A;  4O1O A;  5T4Y A;  2HM8 A;  2R05 A;  4JVS A;  4Q94 A;  2WQ7 A;  5AQA A;  4I6G A;  3ZNG A;  4GMR A;  5BV0 A;  2KXP C;  4I1O B;  4LEU A;  3EDT B;  2I1J A;  2FO1 E;  2MRI A;  2IQC A;  3QAR A;  3FUI A;  5CMW A;  2AVP A;  3ZXP A;  4AIF A;  3DSU A;  3FEY A;  1YCS B;  2AXV A;  3PNL B;  1RW2 A;  3DXK G;  4UWL A;  2F8X K;  4UWH A;  2A5E A;  1HS6 A;  4B89 A;  5EX0 A;  1FT1 A;  3KEA A;  2EIM E;  3OTN A;  4G1T A;  1LF8 A;  1QZ2 A;  1Z3Y A;  4I43 A;  1WDY A;  4JA9 A;  4XIF A;  3G2T A;  4DX6 D;  5BNW A;  3RK6 A;  1S64 A;  1Z3X A;  3TWR A;  2QYU A;  1HF8 A;  3B95 A;  3CVN A;  3Q5M A;  3JXJ A;  3KSQ A;  2Y69 E;  2WB2 A;  5A6C A;  3DEO A;  4P29 A;  3MKQ B;  4GU5 A;  2BKG A;  4E85 A;  4U0S A;  4HOS A;  4CCA A;  3LXU X;  2P9L G;  4JZY A;  5AJL A;  1OWN A;  3J5P A;  4U63 A;  3ZIM A;  2E0I A;  3BEE A;  1NA3 A;  1OWM A;  3HRA A;  4ILH B;  3ZYQ A;  1E8X A;  2IY0 C;  2ZIR A;  3SGH A;  4CT4 A;  3SO8 A;  4EPZ A;  3ISM C;  2EIJ E;  4I17 A;  4FHJ A;  3HXE A;  3LY9 A;  3CHP A;  2AWI A;  2P2C P;  1UJK A;  1Z6T A;  2KCK A;  2OEW A;  2Y4T A;  2E2E A;  3DSW A;  5ARG A;  2IJG X;  4GTQ A;  5AYW D;  3LS8 A;  2X3M A;  3CHS A;  1HE8 A;  2R17 C;  3UKU G;  3CVW A;  3E34 A;  3FTY A;  1Q2Z A;  5JHB A;  4F6R D;  5JHA A;  2CFU A;  3Q73 A;  2KC7 A;  2VTB A;  5G05 J;  4FUL A;  4AEZ C;  4GPK A;  1TNY A;  5CRU A;  5ANR A;  5CER B;  4XX5 A;  1ZBP A;  3F6Q A;  2PQR A;  3NB2 A;  4DLQ A;  4GAA A;  4U95 D;  3UIO C;  1EF1 C;  4KVO A;  4I6E A;  4KZ0 A;  3TG4 A;  4DJA A;  3RSE G;  3AAA C;  3AG1 E;  3UI2 A;  1O1T A;  5D0O D;  3ABL E;  3LKU A;  1EPU A;  3I5P A;  3ULQ A;  4N3C A;  1HXI A;  2JAB A;  3IEG A;  5FTP A;  3LY7 A;  2LAH A;  1IQR A;  3ML9 A;  4DPR A;  4HI9 A;  4MBG A;  4N3A A;  3CGH A;  4BX9 A;  3FP3 A;  1SZA A;  2GRQ B;  1SVX A;  4WUY A;  3DST A;  3QC1 A;  5ENO D;  4KXK B;  3D9L A;  5AJD A;  2BTD A;  4ANU A;  3EU9 A;  3U66 A;  5CCL A;  3OAW A;  3T5X A;  1OUV A;  2VGX A;  4EBA A;  3CV0 A;  3MZL B;  2WXH A;  3PS6 A;  1TEZ A;  4WNF A;  4HLE A;  4RG6 A;  4AXH A;  4JL0 A;  4AVX A;  2J49 A;  3GYZ A;  3LEW A;  3SF4 A;  1BPO A;  5CRV A;  2M63 A;  3EHQ A;  5AN8 A;  2CHX A;  4Z68 A;  4BEP A;  2V5F A;  1NL4 A;  2QZA A;  4FHK A;  3ONL A;  5KWD A;  1YA0 A;  4WWP A;  1OWL A;  5M72 A;  2I2O A;  2XGO A;  4O1P A;  4XE0 A;  1PAQ A;  2UWJ G;  5CEC B;  3Q47 B;  5FZQ A;  5EN5 D;  3RRU A;  2R03 A;  5JA4 D;  1HG5 A;  1ELK A;  2PQN A;  3E30 A;  3DPD A;  4F3V A;  2OVB A;  3L13 A;  4N2Q A;  4DX7 D;  2FF4 A;  4UQY A;  4XI9 A;  4TXQ A;  3FUN A;  2Y3A A;  1FCH A;  1N4P A;  2HR2 A;  4OVU A;  3HDX A;  2LNI A;  4PUC A;  4HOU A;  2VTB B;  4DI3 A;  3CQG B;  4YDE A;  4G23 A;  2L9B A;  5C1D A;  4V3I A;  5HQ8 A;  5CEA A;  1UOH A;  2RKK A;  2J09 A;  3RJV A;  1D8D A;  4HNA D;  1G3N B;  3LCA A;  2ZXW E;  5FQ4 A;  3CR3 A;  4J0U A;  4UWF A;  4TRQ A;  4RVB A;  4B93 B;  3MX3 A;  1P5Q A;  4L7T A;  2P9U G;  3RO2 A;  4K5C A;  3SQV A;  3D3M A;  3RIB A;  2WQH A;  3APD A;  4ACK A;  4BTA A;  3LJ3 A;  1S0P A;  1IXV A;  3R7R A;  1UN9 A;  4GTS A;  5B1A E;  2XGM A;  4GA1 A;  3SBS A;  3HHM A;  1JPL A;  2J07 A;  2WXP A;  1D9S A;  3QKY A;  2AXU A;  3QNK A;  2IO2 C;  3EHN A;  3HVE B;  2OCC E;  1QBQ A;  4LSZ E;  3ZGQ A;  3HIZ A;  4UI9 J;  4L2Y A;  3P2B A;  4Y6W A;  3UPV A;  5AAO A;  4A3T A;  3C98 A;  3L08 A;  5AQB A;  3Q7F A;  4CRW A;  3HXF A;  3Q15 A;  1QNF A;  2RD0 A;  3ESL A;  3QWW A;  3MKQ A;  4N5Q A;  3U64 A;  5AQ7 A;  2WXQ A;  4E6H A;  4BET A;  3PH0 C;  3MYV A;  2H6H A;  2L6B A;  3ZN3 A;  4EEC A;  4FLB A;  3TGO A;  3KS2 A;  5KJM A;  5H7P A;  4LG6 A;  4JXT A;  2VSY A;  4ZFH A;  3ZYL A;  3KSL A;  4IYP A;  5KJL A;  3GZ1 A;  5ARF A;  3AS4 A;  3QOU A;  1XGW A;  1B89 A;  4GML A;  2J8S D;  3QK0 A;  2XQ0 A;  5G55 A;  3CK7 A;  3NAW A;  3JYS A;  3S7F A;  3JQ0 A;  4FJY A;  1NP7 A;  2OVF A;  4G26 A;  2OEV A;  3CHQ A;  1IQU A;  4AY6 A;  4NIK A;  3TAX A;  4BER A;  2DYR E;  5HRY A;  2IO3 C;  2P9K G;  3JXI A;  3OXG A;  3E37 A;  3HYM B;  2WXI A;  2IF4 A;  1W3B A;  2V4H C;  3UT8 A;  3CHM A;  3FFL A;  3KAE A;  4GYW A;  1SQM A;  3AG4 E;  4EHM A;  2FBN A;  1N52 A;  4PS8 A;  1H0A A;  1Y6I A;  3ZHE B;  5J08 A;  3CHR A;  1TNZ A;  5BPP A;  1KLX A;  5E76 A;  5D0Q D;  2BUG A;  2R59 A;  5G05 C;  1O5M A;  4XI0 A;  1INZ A;  4KZC A;  4GYO A;  5LOZ A;  1TNU A;  3MKR A;  4O6F A;  3ONK A;  3EIQ C;  2P9N G;  1E90 A;  4AJW A;  3PRZ A;  1FPP A;  4K5B A;  4JPS A;  3TG5 A;  3PE3 A;  3ZFW A;  2PNN A;  2MYO A;  2QY7 A;  3Q49 B;  2KZT B;  5HI7 A;  3RRM B;  1TR4 A;  4GYY A;  1IHG A;  4K03 A;  2R2L A;  2VSX E;  5T8I A;  3UT4 A;  4GTR A;  3CVV A;  4AY5 A;  5E75 A;  5C2Y A;  2XZD G;  2AW6 A;  3URZ A;  4A1S A;  5FIN A;  3FU5 A;  4ILI A;  4X8Q A;  2XRY A;  3APC A;  4KYO B;  3V31 A;  2XPY A;  4GCO A;  5FZR A;  3RU0 A;  4A1G A;  3FDH A;  3ENE A;  3ML8 A;  4M7C A;  4LNB A;  3ZVV A;  1JCR A;  3GZ2 A;  2YIN A;  5KNH D;  3ZYK A;  3SBT B;  4J8S A;  1KT0 A;  2YNQ A;  4UUC A;  4AM9 A;  1IHB A;  2IFU A;  4GPM A;  4ACL A;  3SNX A;  3BU8 A;  1FT2 A;  3QWV A;  3CVP A;  1E7U A;  3NBN B;  4C9B B;  2XPI A;  1U3D A;  3B7S A;  4UWK A;  3ASD A;  2XCC A;  3JCK C;  3TWS A;  3V30 A;  4BTB A;  1WG0 A;  2CG2 A;  2UY1 A;  4GTO A;  1JWF A;  2F37 A;  5ITZ F;  2JEK A;  3S7B A;  5CED B;  1N94 A;  1RZ4 A;  2PM6 A;  1U2V G;  1DVP A;  5T3R A;  2J9Q A;  4A3V A;  5DBK A;  2C0M A;  2BKK B;  3FU3 A;  2WXF A;  1TN6 A;  5BXO A;  2WXG A;  1BI8 B;  4HXI A;  5LCW J;  1JCS A;  3UXG A;  2P58 C;  3WG7 E;  5BW8 C;  4J6I A;  4Q69 A;  5ENS D;  1HZ4 A;  1JWG A;  3AG3 E;  2YHC A;  2KCV A;  2GGF A;  1UJJ A;  3Q79 A;  4L2L A;  4GA0 A;  4APO A;  4XZ4 A;  3C3R A;  1JUQ A;  3ASF A;  1HX8 A;  3ABM E;  4N39 A;  1OCR E;  1H6P A;  2H6F A;  4I2W A;  2XHE A;  4DLO A;  1NI1 A;  4H7Y A;  4JA7 A;  1X5B A;  5KNG A;  2QYJ A;  4OVV A;  3NF1 A;  3ZEF A;  1FVH A;  4C0M A;  2V8S E;  1BI7 B;  3T8M A;  4DX2 A;  2KCL A;  1TNB A;  2DZN A;  3G2U A;  5ENT D;  3FTZ A;  4WND A;  3ZKJ A;  2KBX A;  3D9P A;  4ABN A;  1QQE A;  4LCT A;  1V55 E;  3TWQ A;  3MCX A;  3K9I A;  1HH8 A;  1E8Y A;  4G2V A;  2B6C A;  1KPS B;  5D2M C;  4RLY A;  3JUI A;  2GRL A;  3DSX A;  1MJ0 A;  3RAU A;  4D10 C;  2V4L A;  5B1B E;  5LX8 A;  2F0Y A;  4H7X A;  4AV7 A;  3B7B A;  1N0R A;  3MEK A;  3HVE A;  2WVI A;  5FQ8 A;  3TL5 A;  5A7D B;  5BUZ A;  2X6I A;  1TJF A;  3LDZ A;  3PZD A;  4EBA G;  5CBO A;  4G24 A;  5KJK A;  4UI9 K;  3Q9N C;  1E8W A;  4DRX E;  5DIZ A;  4HS2 A;  3E33 A;  1WY6 A;  3Q4A B;  3L82 A;  1N4R A;  3WXX A;  3DSV A;  4HFG A;  1A17 A;  3LVQ E;  1LTX A;  2I6H A;  5A23 A;  1A5E A;  2GRM A;  2Q7F A;  3QAQ A;  4J8E A;  4KBQ A;  2IOS A;  4A63 B;  1PY1 A;  4TUU A;  2H6G A;  5LP0 A;  3I4R B;  3LY8 A;  1K1A A;  2WM9 A;  3PZ4 A;  3QB2 A;  2OV8 A;  3C5R A;  3E32 A;  3U4T A;  5BT1 A;  2X6K A;  2LSU A;  3LVR E;  3TXM A;  3QJZ A;  3C72 A;  3UTM A;  1TN8 A;  3FTV A;  4LNG A;  2ETB A;  4U7E B;  4HOT A;  2UY1 B;  1TNO A;  5ENP D;  2GRO B;  1IYG A;  2XEH A;  3PDN A;  3FUK A;  3ZU7 B;  4TXR A;  3AJI A;  4ATZ D;  1E96 B;  5KJN A;  3D9N A;  1H6O A;  3SFX A;  3O48 A;  4BSZ B;  1H6K A;  2NC9 A;  3UM0 A;  3NOC D;  1DCE A;  1OWP A;  4B8C B;  4N2S A;  3RRN B;  2LUH A;  2WXN A; 
#chains in the Genus database with same CATH homology
 2EIM E;  1OCC E;  1OCZ E;  5B3S E;  3AG2 E;  2OCC E;  2EIL E;  3AG1 E;  3AG4 E;  3ASN E;  5IY5 E;  5B1A E;  2DYR E;  2EIJ E;  3ABK E;  3ABM E;  3ABL E;  3ASO E;  1OCR E;  3WG7 E;  5B1B E;  2DYS E;  2Y69 E;  3X2Q E;  1V54 E;  1OCO E;  3AG3 E;  2EIN E;  2ZXW E;  1V55 E;  2EIK E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...