3AG4E

Bovine heart cytochrome c oxidase in the cyanide ion-bound fully reduced state at 100 k
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 42
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 3ag4E00
2OCCE 2EINE 2DYSE 5B3SE 1OCCE 1V54E 3WG7E 1OCOE 3AG3E 3ABME 3ASOE 3X2QE 2EIKE 2Y69E 1OCZE 5B1AE 2EIME 5B1BE 3AG4E 5IY5E 3AG1E 3ABKE 2DYRE 3AG2E 2EILE 2EIJE 2ZXWE 1V55E 1OCRE 3ABLE 3ASNE
chains in the Genus database with same CATH superfamily
4BESA 3FU6A 2I1JA 3S7BA 2WXKA 3ESLA 5KJNA 4UI9C 2L6BA 4GZ3A 1JCSA 5A7DB 3FH5A 2IO2C 1H0AA 2P9IG 4FADA 4BX8A 4Q96A 3GZ1A 3ABLE 4GTOA 3ML9A 5ENPD 2FO7A 1WDYA 4I9CA 2ZIRA 4ZFHA 4HOTA 1IXVA 4LSZE 3D9JA 3NB2A 4GTQA 5JJ6A 3T9KA 1N4QA 4BTAA 2DVWA 2KBXA 3C98A 3CHQA 5KNGA 2WXNA 1FCHA 3DSXA 2L0IA 3FTVA 2Y0BG 2P9SG 3FTXA 3UM0A 3OXLA 1WM5A 5AJLA 3Q47B 4CDMA 3Q49B 4HOSA 5BW8C 4QQIA 4CGWA 3L16A 2C0LA 3W9GA 4U8HA 3R7QA 5BT1A 1NP7A 4I6EA 3IEGA 5ANRA 1TN6A 2EIME 1NFIE 4JW1A 5CCMA 4Q94A 3CVUA 5EX0A 4WWPA 1GW6A 3SD5A 2A5EA 1SA4A 3TJPA 4BETA 2HE0A 5ITZF 3MX3A 5KCMA 3SNXA 4YDWA 3R9MA 4TXPA 1N4RA 4U63A 5JHAA 4G23A 2F8XK 1P5QA 2E0IA 3T8KA 2ETAA 1N9AA 3HXBA 2QYUA 3S7JA 3UT8A 3FU5A 5CMWA 3NAWA 2OV8A 3UIOC 4DX2A 3TWVA 2AXUA 4WNFA 2J08A 1G3NB 3O48A 3ASOE 4F7AA 4ATZD 4F1PA 3QAQA 2JABA 3UUXA 3TWRA 3OTNA 2Y3AA 3NQPA 4KZ0A 4O6FA 2LAHA 3Q78A 3LVQE 4MLPA 4JB8P 5AN8A 3SY2A 2DCPA 2XZDG 5EYLA 4CGVA 1B89A 2OVFA 5ENNA 3BEEA 3SFZA 4ME2A 4J6IA 3FTWA 1H2UA 1BLXB 3ABKE 4FU3A 3E37A 2BF0X 3E33A 1BI7B 1ZB1A 1MZCA 3P1UA 4M7CA 4DK5A 1Y6IA 3FTZA 3EJNA 5FJYA 4L23A 2R5SA 2VSXE 3FTUA 3CHRA 5FWQA 2WXIA 3FP3A 3FU0A 3S2AA 4HRLA 2R03A 5FQ7A 1WY6A 2EQXA 3ASFA 3V2OA 4GU5A 1N54A 2HYZA 3EU5A 4N3BA 3NZUA 2IY0C 4GPKA 1HX8A 2R17C 3MEKA 2M63A 3MJWA 3FDHA 1EDUA 2XEHA 1FT1A 4L2LA 1D9SA 4ACLA 4APFA 2HM8A 1PC2A 3DEOA 4YVQC 4MKTA 2XHEA 4CDRA 1N0RA 2VGXA 4HORA 3CVQA 5C1DA 3PDNA 4JXTA 1TNZA 2Y69E 4KZCA 2PNNA 4JA9A 4N5CA 1HXIA 4GMRA 4GZ6A 3CIAA 5AQ7A 3CVLA 2C2LA 4JEUA 2EILE 3RIBA 1OT8A 4JHRA 4AXHA 4HI8A 1S70B 4UQZA 4GTVA 2FEZA 1UG3A 3HXEA 3LPZA 4JVSA 4LNBA 1U2VG 2BKKB 4N3CA 1H6PA 3CV0A 1PAQA 2AXZA 3SF4A 2H6FA 4HFGA 2BUGA 3SI5A 3CKBA 4YDYA 2WXLA 4B94A 4BERA 4LCTA 4N2SA 4EQFA 1TNOA 2GROB 1NA3A 2MHKA 4P29A 4EPZA 4OVVA 1Z3YA 4FP7A 3EHNA 2FI7A 1HO8A 1Q2ZA 4GAAA 2F0YA 5AIJA 3EDTB 3TGOA 4C0MA 4IULA 3PZ4A 3RRUA 5EKQD 4U96D 5HKPA 5ENRD 4ILIA 5DIZA 3FUEA 4GPMA 3DBSA 4A1SA 4J0UA 4WNEA 3JUEA 4U0ZA 4UWKA 2IFUA 4AV7A 1E96B 1Z3XA 5KNHD 2E2EA 1JWFA 2IO3C 3DSSA 2RD0A 4BWRA 4H7YA 1OCCE 5DBKA 4YNDA 4GYOA 4MS6A 4G2VA 3DEPA 3V79K 3KEAA 3QWWA 1INZA 4AP2A 5T8IA 2A5UA 3D9KA 1U3DA 3RAUA 2QYJA 4XI9A 3ZNGA 1QNFA 1L5JA 3ZXPA 4G8LA 2RFAA 3Q7AA 5H7PA 2ETBA 3D9PA 5B1BE 1K1BA 2X38A 5D66A 2LUHA 1FT2A 5ENQD 3ZRHA 4U0SA 1JWGA 3G2VA 1TJCA 3FY4A 4W9RA 1OWOA 2Q7FA 2UY1B 2WXPA 4GTSA 2AXVA 3C3RA 1ZU2A 2ZISA 3B7RL 4F3VA 5HQ8A 3FULA 4YDOA 4LUNU 3DSVA 3ISMC 1K3ZD 1LTXA 1QQEA 3B7TA 4UWLA 3S7DA 2MOWA 3FUDA 4J8YA 4PDXA 2ZGDA 1TNBA 2V0PA 1N95A 4CT4A 3PNLB 3V30A 5CERB 3UM2A 2X6IA 2VJ8A 1N94A 3PE4A 3LCAA 1LD7A 2EINE 1SW6A 3U66A 4KBQA 4R7LA 2H6HA 4BX9A 5AQBA 2XRYA 3NOGD 3PVLA 4FHJA 4K0RA 3PZDA 3ONLA 1TN8A 2HR2A 4J8EA 4UQYA 5LFAA 2RFMA 2CHZA 2JEKA 3RO2A 2IQCA 3ULYA 3ZYLA 1SZAA 3EHRA 4HOQA 4UQXA 4PS3A 3EU9A 4JEHA 2I6HA 1N0QA 2VSNA 3ASNE 2XPIA 3LS8A 4IN3B 4PUCA 3ASDA 2LNIA 2YINA 5AJDA 2X6KA 4BY6A 4FHKA 4RVBA 4L2YA 3G2TA 3FEYA 1E8ZA 2PM7A 3E34A 3ZFWA 4FJZA 1IHGA 5AENA 4JC8A 2CHXA 2OCCE 1JUQA 3HXFA 4O60A 3T5XA 3MKRA 4ANVA 3QNKA 2FBNA 2HO1A 3ZKJA 5AQ9A 3MA5A 3J5PA 2AW6A 4E6HA 3C3QA 3Q5MA 4DX7D 3EIQC 3TWUA 2CFZA 1DCEA 1KZPA 3UT4A 5AYWD 4U95D 4GZDA 3ZHEA 1TNYA 2LSUA 1OWNA 4X8QA 3RJVA 1EF1C 4FC8A 4FLHA 3L17A 2IJGX 4A3TA 2V4LA 2WXRA 1NZNA 1OCRE 4XKCA 3PS6A 3R7RA 4ANUA 1WG0A 5ENTD 4GMJA 3ZW3A 2J09A 3AU5A 3D9NA 3PEVB 2WXMA 3CK9A 3LJNA 4JHKA 3AG4E 2DBAA 3IBEA 4ANXA 1Y8MA 3GW4A 1KZOA 3EHMA 1U3CA 2VTBA 3LEWA 4WWOA 2ILRA 1H19A 1FPPA 2WXGA 3N71A 3PREA 4EBAG 4DX5D 4J8SA 2PQRA 1XGWA 4QFVA 3LY7A 4G1TA 3MYVA 4O1PA 3HIZA 4NRHB 3KSQA 3AG2E 2WQ6A 3FUJA 4H7XA 3B7SA 2KM4A 3UT7A 2LXMA 5FZRA 2DWZA 2CFUA 4UI9J 4DJAA 2CG2A 3WXXA 4DRXE 5CHEE 2DYRE 3P2BA 2H6GA 3ML8A 3S7FA 3LVRE 3HRAA 1UJJA 3WG7E 1AP7A 4HI9A 1E7VA 5G04J 3I5PA 4B93B 1ELWA 1OCZE 1D8DA 4I1AA 5J08A 2DZOA 3JQ0A 1MX6A 5CRUA 5KJLA 4U0UA 3E32A 3CVWA 4DI3A 1KT0A 5M72A 1H2VC 4LNUD 3EUVA 2XENA 3QOUA 2WQHA 4LG6A 4DLOA 4E85A 4ANWA 4G24A 4DLQA 3F6QA 2QY7A 2P9NG 2XGMA 1JPLA 2I2OA 5LCWJ 5ARFA 2GRQB 5G55A 3SBTB 5CBNA 3AAAC 4RLYA 1OCOE 4Y6CA 3GZSA 1NI1A 4BSZB 1O1RA 3JUIA 1FVFA 3QC1A 3SQVA 4GA1A 2CG3A 2VSYA 1AWCB 3UKRG 3UXGA 2LAIA 3FWVA 2C0MA 3AU4A 3U64A 4TXRA 1TN7A 3FFLA 3VTXA 3FH7A 4WAFA 3FHEA 1EYHA 3QJZA 2XRZA 5ANLA 4JA7A 1DVPA 3JCKC 2I1KA 4YDEA 1V55E 3BQOA 3D9IA 2YHEA 3UTMA 2FO1E 4D10C 5JHBA 3ZUVB 5FT9A 2ONDA 3L13A 3HXCA 2EIJE 1Z6TA 4GYWA 1X81A 1YCSB 4I9EA 5FIOA 4A1GA 3DSTA 1HG5A 3I4GA 3PZ1A 5G05J 4A3VA 2KC7A 1SQMA 1IHBA 3C5RA 3CGHA 3B95A 4WNGA 5EN5D 3MGBA 2H6IA 3BUAA 2KCVA 4L9PA 3AS5A 2X6HA 3FEXA 1OXJA 3U9WA 5D2MC 2IU1A 2VGXB 4G11A 2OEVA 4AEZC 4CDNA 5KJMA 2KCKA 1BPOA 4RG6A 3BG0B 3RSEG 3ZGQA 4IRUA 4F53A 2OVBA 4U04A 4FJYA 4UWHA 4AY5A 1ZBPA 1NL4A 3TG4A 3CHOA 3SO8A 3L82A 2FF4A 3FUMA 3UM3A 5FQ6A 5KWDA 1HG2A 2XPZA 3IHVA 2JLBA 3DXKG 4CRWA 5B3SE 5JJTA 3Q9NC 4WUYA 4UUCA 5EX3A 3CVYA 2EIKE 1O1SA 3FUNA 3G2WA 4CCAA 3UQ3A 2UWJG 3FUFA 4MBGA 4G26A 2GRMA 3TWTA 2NXPA 2KATA 4HQDA 2WXJA 1W3BA 1KLXA 3GZ2A 4RQIA 3SGHA 4XIFA 1V54E 4EZLA 3IXEA 3DXMG 2Y4UA 4WWNA 3QB2A 3U3WA 3UKUG 3AJIA 4BT9A 4K5AB 3OAWA 3NOCD 3PEUB 2V8SE 5LP0A 2LO6A 4ATGA 1UN8A 3HVEA 4U07A 3NZSA 3Q9UC 4OYSA 2V5QC 2OEWA 3TG5A 1O5MA 2RKKA 1S0PA 1IQRA 3SFXA 3SHFA 4N39A 5BNWA 3Q79A 2WB2A 3LYAA 4JHJA 4K03A 2R02A 3I3NA 3PH0C 3AG3E 4KT6B 4NIKA 3UINC 4L7TA 4B8CB 2R2LA 3CKCA 4A63B 4Z68A 1MYOA 4F1SA 2LXLA 3DPYA 2PL2A 3FTYA 2L9BA 2J9QA 3ZYKA 3U4TA 3HHMA 3QDNA 5KJKA 4RG9A 2VGYA 3Q75A 2KXPC 4Q69A 2X3MA 4TUMA 3B7BA 3APFA 1HS6A 1HFAA 3PUJA 3JQ1A 4DI4A 4EZKA 1BD8A 2OOEA 5CMYA 5LOZA 5G05C 5HRYA 4RSYA 2ETCA 3LY9A 3CQCB 2VGEA 4U7EB 3TXMA 2WVIA 1A17A 1H6KA 3PRZA 3Q15A 1XNFA 2WM9A 1SVXA 4B8AA 4BFRA 4BTBA 1DNPA 3MKQB 1HZ4A 4PH4B 1OWPA 2P2CP 3HG0D 2WPVA 2IEJA 3ABME 4V3IA 3FUKA 3IKOB 5JJ7A 3GYZA 3ZIMA 2WQ7A 1FVHA 1JCRA 4HRMB 2R59A 2GRLA 2P9PG 3W9FA 5BUZA 5KBAA 4I2WA 4ABNA 5G2NA 3ZVVA 5ARGA 1QZ2A 3KAEA 1H2TC 2KZTB 3CSFA 3VTYA 5A6CA 1OWMA 4J7WA 4B89A 3KS2A 4JPSA 2WMOA 3L54A 3RK6A 1YA0A 2DZNA 3TWQA 3AS4A 1TYQG 4AM9A 4EZJA 3LDZA 4JZYA 2NSZA 1YYHA 3MV2B 4WNDA 1BU9A 4F6RD 3CK8A 4KXKB 2XS1A 4CZ2D 2GRNB 2PZIA 1DCQA 4XZ4A 1QBQA 2J4BA 4L1BA 3ENEA 3DSUA 3QK0A 4DPRA 3CHPA 4LEUA 3DPDA 4ILHB 2XCBA 2I9CA 4PS8A 1VDYA 3C3OA 4UWGA 3IHYA 1N4SA 3LKUA 3BG1B 5BXOA 3ULQA 2XQ0A 3R9AB 4YVOA 3JXJA 4A55A 4I43A 3CEQA 5C2YA 5HI7A 2XPYA 2XS8A 1IYGA 3L08A 1RZ4A 1HF8A 2ZGGA 3AS8A 3OXGA 3DWLG 5B1AE 1QYMA 1JCQA 4HVBA 4XEIG 2FULA 1MHQA 5D0QD 2DYSE 3QARA 4PS7A 2GRPB 4AJWA 1K8KG 2VTBB 3APDA 3UIPC 1E7UA 1MQSA 3E30A 3T8MA 3UX4A 3CR3A 3SFYA 3EHQA 2PQNA 4GCOA 1IKND 1E8YA 3Q7FA 2A4ZA 3X2QE 4N2QA 2L0TB 2ZU6B 4EBAA 2J49A 5AQAA 4KVOA 2QC9A 2MYOA 3Q73A 3L6AA 4XI0A 5AAOA 4AIFA 4GA0A 3IV0A 5FZQA 4BEPA 1HE8A 3CLJA 2GGFA 3FUHA 4I6JA 4N5QA 3NBNB 4ZHBA 4HB5A 1E8XA 1S64A 2CHWA 4GTRA 5CCLA 3QWVA 2J8SD 5IY5E 5E75A 2IONA 3D9HA 4HNAD 4HBDA 4HRNA 4U8YD 3G2UA 2R05A 1TR4A 3FH8A 1D8EA 2WXQA 3D9LA 1A5EA 4DUIA 4TUUA 1UJKA 1IQUA 3RRNB 3TXNA 3CVPA 3TAXA 3SZ7A 3RU0A 2Y4TA 1UW4B 5FTPA 4GMLA 1LD8A 2GW1A 3OXFA 4FA6A 2VYIA 3E4BA 5EDSA 4GZ5A 3L9TA 1OUVA 4I1MA 4JD2G 3ONKA 2QFCA 4U8VD 3D9OA 3T5VA 5JA4D 1H6OA 2KCLA 2QZAA 3CVXA 4OAVB 4I2ZA 5EILA 4NACA 4K5CA 4EECA 4HOUA 5EIBE 1WAO1 4I17A 2WMNA 2IF4A 4J8FA 4XKBA 1NA0A 5CEDB 3JXIA 3ASGA 2B0OE 3V2XA 3UPVA 4GTTA 2ZXWE 4Y6WA 2P9LG 2XCCA 1E90A 4CEMA 4TV3A 5BXUA 3CK7A 2XGSA 4URKA 4TXQA 5BPPA 4LERA 1MJ0A 3D9MA 4KMOA 1KPSB 2YNQA 3LJ3A 4AY6A 3AG1E 2X6JA 3L22A 2NC9A 1SA5A 3HYMB 2GRRB 3B7UX 4AOFA 1N52A 3APCA 3MV3B 1DC2A 4I1OB 4KVMA 2DIWA 1TJFA 4OVUA 4O1OA 4GYYA 4UWFA 1S63A 3ZPJA 3VLDA 2IOSA 3CQGB 3URZA 4EHMA 2LSVA 4GTMA 2B6CA 2WXHA 4HXIA 4C48B 3TWWA 3I4RB 5AARA 3JYSA 3HXDA 3J5QB 2J07A 2P9KG 3FUIA 1ELRA 3EIJA 3VLEA 1Z5SC 3UMVA 2VQ2A 3CHMA 3ZEFA 1RW2A 1TEZA 3D3MA 4FLBA 5T3RA 4HLEA 2BTDA 1EPUA 1K1AA 4G8KA 4LRZA 3PZ3A 5LX8A 5HS0A 5CEAA 2YQ8A 4APOA 4G25A 4CT0A 5LCWC 2XEVA 3PE3A 4MRUA 3CSTA 3PNTB 4CYMD 3UM1A 3O4ZA 3PUKA 3G2SA 4DX1A 2AVPA 5EYPF 2PM6A 2VSOE 3HVEB 1TNUA 2UY1A 4K5BA 1HH8A 3CVNA 3RO3A 4HLLA 5FZSA 3CVVA 4OAUC 5CRVA 3RRMB 3MCXA 3PZ2A 2MRIA 4B0ZA 3TWSA 3QKYA 4DX6D 3K9IA 4IYPA 3KEZA 4AVXA 2XEEA 1LF8A 1E8WA 1SZ9A 5CBOA 5E76A 2YHCA 3KD7A 2V5FA 3ULEG 3ZYMA 1N11A 2IOLA 3B13A 5EIDA 1OWLA 5ENOD 4KYOB 2AWIA 1MX2A 3SBSA 2XGOA 3VLFA 2RG8A 4GCNA 2Y1LE 4GB9A 1ELKA 3BU8A 4M3OA 3CHSA 3DRAA 4XE0A 2BKGA 2V4HC 5FQ8A 3ZXSA 3UI2A 3FTSA 3C72A 3LXUX 4I6GA 3LY8A 1HU3A 4BSXA 2X6FA 1X5BA 2WXOA 3RKVA 3ESKA 4BT8A 1OY3D 4ACKA 5FQ4A 1MX4A 5FINA 4FULA 1YMPA 2BEDA 3MKQA 4J8DA 5J90A 3ASHA 4GA2A 3TWXA 5T4YA 4XX5A 4GZCA 4NQ0A 2F8YA 3ZYQA 5BV0A 1KT1A 4LNGA 5G04C 3QWPA 1PY1A 3Q4AB 2P9UG 2J4DA 3DSWA 1O1TA 5JMND 3MZLB 2L6JA 4UI9K 4C0EA 3ZU7B 2KZTA 4ILGA 1UOHA 4TRQA 5D0OD 1N4PA 2NYJA 3ZHEB 3FU3A 4GTPA 3NF1A 3TL5A 2XZTG 4NURA 1BI8B 4HS2A 4JL0A 3HDXA 5BV1A 3V31A 4C9BB 5A23A 2AJAA 4N3AA 1UN9A 3KSLA 3ZN3A 2P58C 5CECB 5ENSD 2WXFA 2F37A
chains in the Genus database with same CATH topology
2OCCE 2EINE 2DYSE 5B3SE 1OCCE 1V54E 3WG7E 1OCOE 3AG3E 3ABME 3ASOE 3X2QE 2EIKE 2Y69E 1OCZE 5B1AE 2EIME 5B1BE 3AG4E 5IY5E 3AG1E 3ABKE 2DYRE 3AG2E 2EILE 2EIJE 2ZXWE 1V55E 1OCRE 3ABLE 3ASNE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OCC E;  2EIN E;  2DYS E;  5B3S E;  1OCC E;  1V54 E;  3WG7 E;  1OCO E;  3AG3 E;  3ABM E;  3ASO E;  3X2Q E;  2EIK E;  2Y69 E;  1OCZ E;  5B1A E;  2EIM E;  5B1B E;  3AG4 E;  5IY5 E;  3AG1 E;  3ABK E;  2DYR E;  3AG2 E;  2EIL E;  2EIJ E;  2ZXW E;  1V55 E;  1OCR E;  3ABL E;  3ASN E; 
#chains in the Genus database with same CATH topology
 4BES A;  3FU6 A;  2I1J A;  3S7B A;  2WXK A;  3ESL A;  5KJN A;  4UI9 C;  2L6B A;  4GZ3 A;  1JCS A;  5A7D B;  3FH5 A;  2IO2 C;  1H0A A;  2P9I G;  4FAD A;  4BX8 A;  4Q96 A;  3GZ1 A;  3ABL E;  4GTO A;  3ML9 A;  5ENP D;  2FO7 A;  1WDY A;  4I9C A;  2ZIR A;  4ZFH A;  4HOT A;  1IXV A;  4LSZ E;  3D9J A;  3NB2 A;  4GTQ A;  5JJ6 A;  3T9K A;  1N4Q A;  4BTA A;  2DVW A;  2KBX A;  3C98 A;  3CHQ A;  5KNG A;  2WXN A;  1FCH A;  3DSX A;  2L0I A;  3FTV A;  2Y0B G;  2P9S G;  3FTX A;  3UM0 A;  3OXL A;  1WM5 A;  5AJL A;  3Q47 B;  4CDM A;  3Q49 B;  4HOS A;  5BW8 C;  4QQI A;  4CGW A;  3L16 A;  2C0L A;  3W9G A;  4U8H A;  3R7Q A;  5BT1 A;  1NP7 A;  4I6E A;  3IEG A;  5ANR A;  1TN6 A;  2EIM E;  1NFI E;  4JW1 A;  5CCM A;  4Q94 A;  3CVU A;  5EX0 A;  4WWP A;  1GW6 A;  3SD5 A;  2A5E A;  1SA4 A;  3TJP A;  4BET A;  2HE0 A;  5ITZ F;  3MX3 A;  5KCM A;  3SNX A;  4YDW A;  3R9M A;  4TXP A;  1N4R A;  4U63 A;  5JHA A;  4G23 A;  2F8X K;  1P5Q A;  2E0I A;  3T8K A;  2ETA A;  1N9A A;  3HXB A;  2QYU A;  3S7J A;  3UT8 A;  3FU5 A;  5CMW A;  3NAW A;  2OV8 A;  3UIO C;  4DX2 A;  3TWV A;  2AXU A;  4WNF A;  2J08 A;  1G3N B;  3O48 A;  3ASO E;  4F7A A;  4ATZ D;  4F1P A;  3QAQ A;  2JAB A;  3UUX A;  3TWR A;  3OTN A;  2Y3A A;  3NQP A;  4KZ0 A;  4O6F A;  2LAH A;  3Q78 A;  3LVQ E;  4MLP A;  4JB8 P;  5AN8 A;  3SY2 A;  2DCP A;  2XZD G;  5EYL A;  4CGV A;  1B89 A;  2OVF A;  5ENN A;  3BEE A;  3SFZ A;  4ME2 A;  4J6I A;  3FTW A;  1H2U A;  1BLX B;  3ABK E;  4FU3 A;  3E37 A;  2BF0 X;  3E33 A;  1BI7 B;  1ZB1 A;  1MZC A;  3P1U A;  4M7C A;  4DK5 A;  1Y6I A;  3FTZ A;  3EJN A;  5FJY A;  4L23 A;  2R5S A;  2VSX E;  3FTU A;  3CHR A;  5FWQ A;  2WXI A;  3FP3 A;  3FU0 A;  3S2A A;  4HRL A;  2R03 A;  5FQ7 A;  1WY6 A;  2EQX A;  3ASF A;  3V2O A;  4GU5 A;  1N54 A;  2HYZ A;  3EU5 A;  4N3B A;  3NZU A;  2IY0 C;  4GPK A;  1HX8 A;  2R17 C;  3MEK A;  2M63 A;  3MJW A;  3FDH A;  1EDU A;  2XEH A;  1FT1 A;  4L2L A;  1D9S A;  4ACL A;  4APF A;  2HM8 A;  1PC2 A;  3DEO A;  4YVQ C;  4MKT A;  2XHE A;  4CDR A;  1N0R A;  2VGX A;  4HOR A;  3CVQ A;  5C1D A;  3PDN A;  4JXT A;  1TNZ A;  2Y69 E;  4KZC A;  2PNN A;  4JA9 A;  4N5C A;  1HXI A;  4GMR A;  4GZ6 A;  3CIA A;  5AQ7 A;  3CVL A;  2C2L A;  4JEU A;  2EIL E;  3RIB A;  1OT8 A;  4JHR A;  4AXH A;  4HI8 A;  1S70 B;  4UQZ A;  4GTV A;  2FEZ A;  1UG3 A;  3HXE A;  3LPZ A;  4JVS A;  4LNB A;  1U2V G;  2BKK B;  4N3C A;  1H6P A;  3CV0 A;  1PAQ A;  2AXZ A;  3SF4 A;  2H6F A;  4HFG A;  2BUG A;  3SI5 A;  3CKB A;  4YDY A;  2WXL A;  4B94 A;  4BER A;  4LCT A;  4N2S A;  4EQF A;  1TNO A;  2GRO B;  1NA3 A;  2MHK A;  4P29 A;  4EPZ A;  4OVV A;  1Z3Y A;  4FP7 A;  3EHN A;  2FI7 A;  1HO8 A;  1Q2Z A;  4GAA A;  2F0Y A;  5AIJ A;  3EDT B;  3TGO A;  4C0M A;  4IUL A;  3PZ4 A;  3RRU A;  5EKQ D;  4U96 D;  5HKP A;  5ENR D;  4ILI A;  5DIZ A;  3FUE A;  4GPM A;  3DBS A;  4A1S A;  4J0U A;  4WNE A;  3JUE A;  4U0Z A;  4UWK A;  2IFU A;  4AV7 A;  1E96 B;  1Z3X A;  5KNH D;  2E2E A;  1JWF A;  2IO3 C;  3DSS A;  2RD0 A;  4BWR A;  4H7Y A;  1OCC E;  5DBK A;  4YND A;  4GYO A;  4MS6 A;  4G2V A;  3DEP A;  3V79 K;  3KEA A;  3QWW A;  1INZ A;  4AP2 A;  5T8I A;  2A5U A;  3D9K A;  1U3D A;  3RAU A;  2QYJ A;  4XI9 A;  3ZNG A;  1QNF A;  1L5J A;  3ZXP A;  4G8L A;  2RFA A;  3Q7A A;  5H7P A;  2ETB A;  3D9P A;  5B1B E;  1K1B A;  2X38 A;  5D66 A;  2LUH A;  1FT2 A;  5ENQ D;  3ZRH A;  4U0S A;  1JWG A;  3G2V A;  1TJC A;  3FY4 A;  4W9R A;  1OWO A;  2Q7F A;  2UY1 B;  2WXP A;  4GTS A;  2AXV A;  3C3R A;  1ZU2 A;  2ZIS A;  3B7R L;  4F3V A;  5HQ8 A;  3FUL A;  4YDO A;  4LUN U;  3DSV A;  3ISM C;  1K3Z D;  1LTX A;  1QQE A;  3B7T A;  4UWL A;  3S7D A;  2MOW A;  3FUD A;  4J8Y A;  4PDX A;  2ZGD A;  1TNB A;  2V0P A;  1N95 A;  4CT4 A;  3PNL B;  3V30 A;  5CER B;  3UM2 A;  2X6I A;  2VJ8 A;  1N94 A;  3PE4 A;  3LCA A;  1LD7 A;  2EIN E;  1SW6 A;  3U66 A;  4KBQ A;  4R7L A;  2H6H A;  4BX9 A;  5AQB A;  2XRY A;  3NOG D;  3PVL A;  4FHJ A;  4K0R A;  3PZD A;  3ONL A;  1TN8 A;  2HR2 A;  4J8E A;  4UQY A;  5LFA A;  2RFM A;  2CHZ A;  2JEK A;  3RO2 A;  2IQC A;  3ULY A;  3ZYL A;  1SZA A;  3EHR A;  4HOQ A;  4UQX A;  4PS3 A;  3EU9 A;  4JEH A;  2I6H A;  1N0Q A;  2VSN A;  3ASN E;  2XPI A;  3LS8 A;  4IN3 B;  4PUC A;  3ASD A;  2LNI A;  2YIN A;  5AJD A;  2X6K A;  4BY6 A;  4FHK A;  4RVB A;  4L2Y A;  3G2T A;  3FEY A;  1E8Z A;  2PM7 A;  3E34 A;  3ZFW A;  4FJZ A;  1IHG A;  5AEN A;  4JC8 A;  2CHX A;  2OCC E;  1JUQ A;  3HXF A;  4O60 A;  3T5X A;  3MKR A;  4ANV A;  3QNK A;  2FBN A;  2HO1 A;  3ZKJ A;  5AQ9 A;  3MA5 A;  3J5P A;  2AW6 A;  4E6H A;  3C3Q A;  3Q5M A;  4DX7 D;  3EIQ C;  3TWU A;  2CFZ A;  1DCE A;  1KZP A;  3UT4 A;  5AYW D;  4U95 D;  4GZD A;  3ZHE A;  1TNY A;  2LSU A;  1OWN A;  4X8Q A;  3RJV A;  1EF1 C;  4FC8 A;  4FLH A;  3L17 A;  2IJG X;  4A3T A;  2V4L A;  2WXR A;  1NZN A;  1OCR E;  4XKC A;  3PS6 A;  3R7R A;  4ANU A;  1WG0 A;  5ENT D;  4GMJ A;  3ZW3 A;  2J09 A;  3AU5 A;  3D9N A;  3PEV B;  2WXM A;  3CK9 A;  3LJN A;  4JHK A;  3AG4 E;  2DBA A;  3IBE A;  4ANX A;  1Y8M A;  3GW4 A;  1KZO A;  3EHM A;  1U3C A;  2VTB A;  3LEW A;  4WWO A;  2ILR A;  1H19 A;  1FPP A;  2WXG A;  3N71 A;  3PRE A;  4EBA G;  4DX5 D;  4J8S A;  2PQR A;  1XGW A;  4QFV A;  3LY7 A;  4G1T A;  3MYV A;  4O1P A;  3HIZ A;  4NRH B;  3KSQ A;  3AG2 E;  2WQ6 A;  3FUJ A;  4H7X A;  3B7S A;  2KM4 A;  3UT7 A;  2LXM A;  5FZR A;  2DWZ A;  2CFU A;  4UI9 J;  4DJA A;  2CG2 A;  3WXX A;  4DRX E;  5CHE E;  2DYR E;  3P2B A;  2H6G A;  3ML8 A;  3S7F A;  3LVR E;  3HRA A;  1UJJ A;  3WG7 E;  1AP7 A;  4HI9 A;  1E7V A;  5G04 J;  3I5P A;  4B93 B;  1ELW A;  1OCZ E;  1D8D A;  4I1A A;  5J08 A;  2DZO A;  3JQ0 A;  1MX6 A;  5CRU A;  5KJL A;  4U0U A;  3E32 A;  3CVW A;  4DI3 A;  1KT0 A;  5M72 A;  1H2V C;  4LNU D;  3EUV A;  2XEN A;  3QOU A;  2WQH A;  4LG6 A;  4DLO A;  4E85 A;  4ANW A;  4G24 A;  4DLQ A;  3F6Q A;  2QY7 A;  2P9N G;  2XGM A;  1JPL A;  2I2O A;  5LCW J;  5ARF A;  2GRQ B;  5G55 A;  3SBT B;  5CBN A;  3AAA C;  4RLY A;  1OCO E;  4Y6C A;  3GZS A;  1NI1 A;  4BSZ B;  1O1R A;  3JUI A;  1FVF A;  3QC1 A;  3SQV A;  4GA1 A;  2CG3 A;  2VSY A;  1AWC B;  3UKR G;  3UXG A;  2LAI A;  3FWV A;  2C0M A;  3AU4 A;  3U64 A;  4TXR A;  1TN7 A;  3FFL A;  3VTX A;  3FH7 A;  4WAF A;  3FHE A;  1EYH A;  3QJZ A;  2XRZ A;  5ANL A;  4JA7 A;  1DVP A;  3JCK C;  2I1K A;  4YDE A;  1V55 E;  3BQO A;  3D9I A;  2YHE A;  3UTM A;  2FO1 E;  4D10 C;  5JHB A;  3ZUV B;  5FT9 A;  2OND A;  3L13 A;  3HXC A;  2EIJ E;  1Z6T A;  4GYW A;  1X81 A;  1YCS B;  4I9E A;  5FIO A;  4A1G A;  3DST A;  1HG5 A;  3I4G A;  3PZ1 A;  5G05 J;  4A3V A;  2KC7 A;  1SQM A;  1IHB A;  3C5R A;  3CGH A;  3B95 A;  4WNG A;  5EN5 D;  3MGB A;  2H6I A;  3BUA A;  2KCV A;  4L9P A;  3AS5 A;  2X6H A;  3FEX A;  1OXJ A;  3U9W A;  5D2M C;  2IU1 A;  2VGX B;  4G11 A;  2OEV A;  4AEZ C;  4CDN A;  5KJM A;  2KCK A;  1BPO A;  4RG6 A;  3BG0 B;  3RSE G;  3ZGQ A;  4IRU A;  4F53 A;  2OVB A;  4U04 A;  4FJY A;  4UWH A;  4AY5 A;  1ZBP A;  1NL4 A;  3TG4 A;  3CHO A;  3SO8 A;  3L82 A;  2FF4 A;  3FUM A;  3UM3 A;  5FQ6 A;  5KWD A;  1HG2 A;  2XPZ A;  3IHV A;  2JLB A;  3DXK G;  4CRW A;  5B3S E;  5JJT A;  3Q9N C;  4WUY A;  4UUC A;  5EX3 A;  3CVY A;  2EIK E;  1O1S A;  3FUN A;  3G2W A;  4CCA A;  3UQ3 A;  2UWJ G;  3FUF A;  4MBG A;  4G26 A;  2GRM A;  3TWT A;  2NXP A;  2KAT A;  4HQD A;  2WXJ A;  1W3B A;  1KLX A;  3GZ2 A;  4RQI A;  3SGH A;  4XIF A;  1V54 E;  4EZL A;  3IXE A;  3DXM G;  2Y4U A;  4WWN A;  3QB2 A;  3U3W A;  3UKU G;  3AJI A;  4BT9 A;  4K5A B;  3OAW A;  3NOC D;  3PEU B;  2V8S E;  5LP0 A;  2LO6 A;  4ATG A;  1UN8 A;  3HVE A;  4U07 A;  3NZS A;  3Q9U C;  4OYS A;  2V5Q C;  2OEW A;  3TG5 A;  1O5M A;  2RKK A;  1S0P A;  1IQR A;  3SFX A;  3SHF A;  4N39 A;  5BNW A;  3Q79 A;  2WB2 A;  3LYA A;  4JHJ A;  4K03 A;  2R02 A;  3I3N A;  3PH0 C;  3AG3 E;  4KT6 B;  4NIK A;  3UIN C;  4L7T A;  4B8C B;  2R2L A;  3CKC A;  4A63 B;  4Z68 A;  1MYO A;  4F1S A;  2LXL A;  3DPY A;  2PL2 A;  3FTY A;  2L9B A;  2J9Q A;  3ZYK A;  3U4T A;  3HHM A;  3QDN A;  5KJK A;  4RG9 A;  2VGY A;  3Q75 A;  2KXP C;  4Q69 A;  2X3M A;  4TUM A;  3B7B A;  3APF A;  1HS6 A;  1HFA A;  3PUJ A;  3JQ1 A;  4DI4 A;  4EZK A;  1BD8 A;  2OOE A;  5CMY A;  5LOZ A;  5G05 C;  5HRY A;  4RSY A;  2ETC A;  3LY9 A;  3CQC B;  2VGE A;  4U7E B;  3TXM A;  2WVI A;  1A17 A;  1H6K A;  3PRZ A;  3Q15 A;  1XNF A;  2WM9 A;  1SVX A;  4B8A A;  4BFR A;  4BTB A;  1DNP A;  3MKQ B;  1HZ4 A;  4PH4 B;  1OWP A;  2P2C P;  3HG0 D;  2WPV A;  2IEJ A;  3ABM E;  4V3I A;  3FUK A;  3IKO B;  5JJ7 A;  3GYZ A;  3ZIM A;  2WQ7 A;  1FVH A;  1JCR A;  4HRM B;  2R59 A;  2GRL A;  2P9P G;  3W9F A;  5BUZ A;  5KBA A;  4I2W A;  4ABN A;  5G2N A;  3ZVV A;  5ARG A;  1QZ2 A;  3KAE A;  1H2T C;  2KZT B;  3CSF A;  3VTY A;  5A6C A;  1OWM A;  4J7W A;  4B89 A;  3KS2 A;  4JPS A;  2WMO A;  3L54 A;  3RK6 A;  1YA0 A;  2DZN A;  3TWQ A;  3AS4 A;  1TYQ G;  4AM9 A;  4EZJ A;  3LDZ A;  4JZY A;  2NSZ A;  1YYH A;  3MV2 B;  4WND A;  1BU9 A;  4F6R D;  3CK8 A;  4KXK B;  2XS1 A;  4CZ2 D;  2GRN B;  2PZI A;  1DCQ A;  4XZ4 A;  1QBQ A;  2J4B A;  4L1B A;  3ENE A;  3DSU A;  3QK0 A;  4DPR A;  3CHP A;  4LEU A;  3DPD A;  4ILH B;  2XCB A;  2I9C A;  4PS8 A;  1VDY A;  3C3O A;  4UWG A;  3IHY A;  1N4S A;  3LKU A;  3BG1 B;  5BXO A;  3ULQ A;  2XQ0 A;  3R9A B;  4YVO A;  3JXJ A;  4A55 A;  4I43 A;  3CEQ A;  5C2Y A;  5HI7 A;  2XPY A;  2XS8 A;  1IYG A;  3L08 A;  1RZ4 A;  1HF8 A;  2ZGG A;  3AS8 A;  3OXG A;  3DWL G;  5B1A E;  1QYM A;  1JCQ A;  4HVB A;  4XEI G;  2FUL A;  1MHQ A;  5D0Q D;  2DYS E;  3QAR A;  4PS7 A;  2GRP B;  4AJW A;  1K8K G;  2VTB B;  3APD A;  3UIP C;  1E7U A;  1MQS A;  3E30 A;  3T8M A;  3UX4 A;  3CR3 A;  3SFY A;  3EHQ A;  2PQN A;  4GCO A;  1IKN D;  1E8Y A;  3Q7F A;  2A4Z A;  3X2Q E;  4N2Q A;  2L0T B;  2ZU6 B;  4EBA A;  2J49 A;  5AQA A;  4KVO A;  2QC9 A;  2MYO A;  3Q73 A;  3L6A A;  4XI0 A;  5AAO A;  4AIF A;  4GA0 A;  3IV0 A;  5FZQ A;  4BEP A;  1HE8 A;  3CLJ A;  2GGF A;  3FUH A;  4I6J A;  4N5Q A;  3NBN B;  4ZHB A;  4HB5 A;  1E8X A;  1S64 A;  2CHW A;  4GTR A;  5CCL A;  3QWV A;  2J8S D;  5IY5 E;  5E75 A;  2ION A;  3D9H A;  4HNA D;  4HBD A;  4HRN A;  4U8Y D;  3G2U A;  2R05 A;  1TR4 A;  3FH8 A;  1D8E A;  2WXQ A;  3D9L A;  1A5E A;  4DUI A;  4TUU A;  1UJK A;  1IQU A;  3RRN B;  3TXN A;  3CVP A;  3TAX A;  3SZ7 A;  3RU0 A;  2Y4T A;  1UW4 B;  5FTP A;  4GML A;  1LD8 A;  2GW1 A;  3OXF A;  4FA6 A;  2VYI A;  3E4B A;  5EDS A;  4GZ5 A;  3L9T A;  1OUV A;  4I1M A;  4JD2 G;  3ONK A;  2QFC A;  4U8V D;  3D9O A;  3T5V A;  5JA4 D;  1H6O A;  2KCL A;  2QZA A;  3CVX A;  4OAV B;  4I2Z A;  5EIL A;  4NAC A;  4K5C A;  4EEC A;  4HOU A;  5EIB E;  1WAO 1;  4I17 A;  2WMN A;  2IF4 A;  4J8F A;  4XKB A;  1NA0 A;  5CED B;  3JXI A;  3ASG A;  2B0O E;  3V2X A;  3UPV A;  4GTT A;  2ZXW E;  4Y6W A;  2P9L G;  2XCC A;  1E90 A;  4CEM A;  4TV3 A;  5BXU A;  3CK7 A;  2XGS A;  4URK A;  4TXQ A;  5BPP A;  4LER A;  1MJ0 A;  3D9M A;  4KMO A;  1KPS B;  2YNQ A;  3LJ3 A;  4AY6 A;  3AG1 E;  2X6J A;  3L22 A;  2NC9 A;  1SA5 A;  3HYM B;  2GRR B;  3B7U X;  4AOF A;  1N52 A;  3APC A;  3MV3 B;  1DC2 A;  4I1O B;  4KVM A;  2DIW A;  1TJF A;  4OVU A;  4O1O A;  4GYY A;  4UWF A;  1S63 A;  3ZPJ A;  3VLD A;  2IOS A;  3CQG B;  3URZ A;  4EHM A;  2LSV A;  4GTM A;  2B6C A;  2WXH A;  4HXI A;  4C48 B;  3TWW A;  3I4R B;  5AAR A;  3JYS A;  3HXD A;  3J5Q B;  2J07 A;  2P9K G;  3FUI A;  1ELR A;  3EIJ A;  3VLE A;  1Z5S C;  3UMV A;  2VQ2 A;  3CHM A;  3ZEF A;  1RW2 A;  1TEZ A;  3D3M A;  4FLB A;  5T3R A;  4HLE A;  2BTD A;  1EPU A;  1K1A A;  4G8K A;  4LRZ A;  3PZ3 A;  5LX8 A;  5HS0 A;  5CEA A;  2YQ8 A;  4APO A;  4G25 A;  4CT0 A;  5LCW C;  2XEV A;  3PE3 A;  4MRU A;  3CST A;  3PNT B;  4CYM D;  3UM1 A;  3O4Z A;  3PUK A;  3G2S A;  4DX1 A;  2AVP A;  5EYP F;  2PM6 A;  2VSO E;  3HVE B;  1TNU A;  2UY1 A;  4K5B A;  1HH8 A;  3CVN A;  3RO3 A;  4HLL A;  5FZS A;  3CVV A;  4OAU C;  5CRV A;  3RRM B;  3MCX A;  3PZ2 A;  2MRI A;  4B0Z A;  3TWS A;  3QKY A;  4DX6 D;  3K9I A;  4IYP A;  3KEZ A;  4AVX A;  2XEE A;  1LF8 A;  1E8W A;  1SZ9 A;  5CBO A;  5E76 A;  2YHC A;  3KD7 A;  2V5F A;  3ULE G;  3ZYM A;  1N11 A;  2IOL A;  3B13 A;  5EID A;  1OWL A;  5ENO D;  4KYO B;  2AWI A;  1MX2 A;  3SBS A;  2XGO A;  3VLF A;  2RG8 A;  4GCN A;  2Y1L E;  4GB9 A;  1ELK A;  3BU8 A;  4M3O A;  3CHS A;  3DRA A;  4XE0 A;  2BKG A;  2V4H C;  5FQ8 A;  3ZXS A;  3UI2 A;  3FTS A;  3C72 A;  3LXU X;  4I6G A;  3LY8 A;  1HU3 A;  4BSX A;  2X6F A;  1X5B A;  2WXO A;  3RKV A;  3ESK A;  4BT8 A;  1OY3 D;  4ACK A;  5FQ4 A;  1MX4 A;  5FIN A;  4FUL A;  1YMP A;  2BED A;  3MKQ A;  4J8D A;  5J90 A;  3ASH A;  4GA2 A;  3TWX A;  5T4Y A;  4XX5 A;  4GZC A;  4NQ0 A;  2F8Y A;  3ZYQ A;  5BV0 A;  1KT1 A;  4LNG A;  5G04 C;  3QWP A;  1PY1 A;  3Q4A B;  2P9U G;  2J4D A;  3DSW A;  1O1T A;  5JMN D;  3MZL B;  2L6J A;  4UI9 K;  4C0E A;  3ZU7 B;  2KZT A;  4ILG A;  1UOH A;  4TRQ A;  5D0O D;  1N4P A;  2NYJ A;  3ZHE B;  3FU3 A;  4GTP A;  3NF1 A;  3TL5 A;  2XZT G;  4NUR A;  1BI8 B;  4HS2 A;  4JL0 A;  3HDX A;  5BV1 A;  3V31 A;  4C9B B;  5A23 A;  2AJA A;  4N3A A;  1UN9 A;  3KSL A;  3ZN3 A;  2P58 C;  5CEC B;  5ENS D;  2WXF A;  2F37 A; 
#chains in the Genus database with same CATH homology
 2OCC E;  2EIN E;  2DYS E;  5B3S E;  1OCC E;  1V54 E;  3WG7 E;  1OCO E;  3AG3 E;  3ABM E;  3ASO E;  3X2Q E;  2EIK E;  2Y69 E;  1OCZ E;  5B1A E;  2EIM E;  5B1B E;  3AG4 E;  5IY5 E;  3AG1 E;  3ABK E;  2DYR E;  3AG2 E;  2EIL E;  2EIJ E;  2ZXW E;  1V55 E;  1OCR E;  3ABL E;  3ASN E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...