3R9AB

Human alanine-glyoxylate aminotransferase in complex with the tpr domain of human pex5p
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
315
structure length
289
Chain Sequence
b'QFEEENPLRDHPQPFEEGLRRLQEGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACETLRDWLRYTPAYAHLVDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFGLPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine--pyruvate aminotransferase
publication title Molecular requirements for peroxisomal targeting of alanine-glyoxylate aminotransferase as an essential determinant in primary hyperoxaluria type 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transport protein
total genus 116
structure length 289
sequence length 315
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13181 TPR_8 Tetratricopeptide repeat
B PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3r9aB00
2Y4UA 4GA1A 4UQYA 1WAO1 2KCKA 3RO2A 2Y4TA 5M72A 2VGXB 4N3BA 5EKQD 3CK8A 4UI9C 2UWJG 3LKUA 4WNEA 4WNDA 2Q7FA 3QOUA 3ASGA 1KT1A 4AY6A 3KAEA 3QWPA 4J8FA 5G05C 2LSUA 1ELWA 3RO3A 5C1DA 4EQFA 3LCAA 3HYMB 4H7YA 4GCOA 2FEZA 3ASDA 3TG5A 3TGOA 3PE3A 4JA7A 2VGXA 1XNFA 5HI7A 5LCWJ 2KCVA 2DBAA 3VTXA 3LPZA 1Y8MA 2KATA 3O48A 4JL0A 3OXFA 1NZNA 3UPVA 4HOQA 4BT9A 5FT9A 4HORA 3LYAA 4O6FA 2PZIA 2VGYA 3R9AB 2XEVA 2VYIA 1TJCA 4HOTA 2ONDA 2WQHA 3TAXA 3AS5A 4GCNA 5LCWC 3IEGA 3E4BA 3GZ2A 3SF4A 4W9RA 2XPIA 3BEEA 2IF4A 2NC9A 3CK7A 4BTAA 5D0QD 3Q15A 2GW1A 1ELRA 2E2EA 2VSYA 3K9IA 3MA5A 5FZQA 4BT8A 5FZRA 4AIFA 3CVLA 2I6HA 3AS4A 2PL2A 4RG6A 2FI7A 4BWRA 5EX3A 1ZU2A 3CEQA 4WNFA 3URZA 3ASFA 4G26A 4U0ZA 5EX0A 2XCCA 5JJ7A 2LSVA 2IFUA 2UY1A 3U4TA 3JYSA 4WUYA 1KT0A 5A7DB 3NF1A 1ZBPA 4I2ZA 4XI9A 3ASHA 5FJYA 2P58C 4GA2A 4KBQA 4U07A 4J0UA 2PQRA 4I9EA 3MKRA 5JJTA 1A17A 3VTYA 4N2QA 5ARFA 2C0LA 5HQ8A 3UQ3A 2MHKA 4N5CA 3LY8A 3CKBA 3MV3B 4XI0A 3Q49B 5CCMA 5A6CA 1NA0A 4Y6WA 5DBKA 4NQ0A 4GZ5A 4U04A 1KLXA 4UI9K 4GYWA 2VSNA 2XGSA 3OXLA 4WNGA 5DIZA 5D0OD 2FBNA 4J8DA 3MV2B 5BNWA 4G23A 4LEUA 2PQNA 2HR2A 2OOEA 3Q5MA 2C0MA 2YHCA 3OXGA 4J8EA 4N2SA 3RKVA 2QFCA 4GYYA 3QKYA 1HXIA 3N71A 4GZ6A 4KXKB 3FWVA 1WM5A 2YQ8A 4CGVA 3S7JA 2UY1B 2KC7A 4I9CA 3ZHEA 2JLBA 2VQ2A 4IN3B 4I2WA 2AVPA 2J9QA 3PE4A 5CHEE 2V5FA 1QQEA 4XIFA 3SZ7A 3ZPJA 4KYOB 2BUGA 1PC2A 4CDRA 3AS8A 4N3CA 3S7FA 3RU0A 1W3BA 4U0UA 1NA3A 5ARGA 3UUXA 4ABNA 3ULQA 4HOSA 2XCBA 2KCLA 4Y6CA 1IHGA 5AYWD 2HO1A 1FCHA 5KJNA 5KJMA 1HZ4A 3FFLA 4I1AA 3ZN3A 1B89A 4HOUA 4H7XA 3FP3A 5JJ6A 4AY5A 3QWWA 2C2LA 4G1TA 4BTBA 3EDTB 4CGWA 3S7BA 4YNDA 4YVQC 4UQXA 4UQZA 4JA9A 2R5SA 3CK9A 2FO7A 4JHRA 3GZ1A 4U0SA 4N39A 3ESKA 4YVOA 3MEKA 4GA0A 2XGMA 3LY9A 5FZSA 1YA0A 3CVNA 3KS2A 2WPVA 4G24A 3TG4A 1E96B 3ZHEB 4NRHB 5G04J 2FF4A 3KD7A 3Q4AB 3CVQA 2L6JA 1HH8A 4GZ3A 4B94A 3QWVA 3PDNA 3U3WA 3RIBA 3LY7A 4I17A 1QZ2A 2XGOA 4G2VA 4A1SA 3QDNA 5CCLA 4APOA 2LNIA 4ME2A 5BT1A 4AM9A 4RG9A 5KJKA 3Q47B 4G25A 3CVPA 3RJVA 1OUVA 4UI9J 3ZGQA 5G04C 3GW4A 3S7DA 4N3AA 1IYGA 3WXXA 3CV0A 4GYOA 3ZFWA 2HYZA 4GPKA 5BW8C 3GYZA 5G05J 4F3VA 3CKCA 5FTPA 5KJLA 1P5QA
chains in the Genus database with same CATH superfamily
2Y4UA 4LCTA 2P9PG 4GTOA 3VLEA 4DJAA 3RO2A 2Y4TA 2VGXB 4N3BA 1JUQA 4GTMA 1UN9A 2QYJA 1IKND 2UWJG 2ETBA 5EIDA 3HRAA 4U8YD 4WNDA 2QYUA 3QNKA 1KT1A 4HXIA 3KAEA 1MZCA 3TXNA 2P2CP 4RLYA 2LSUA 4ANUA 3HXCA 3LCAA 4B93B 1G3NB 2KXPC 1TNOA 4BY6A 3CLJA 3CVWA 3TGOA 1TR4A 4DK5A 2VGXA 1N4PA 3T5XA 3SNXA 2XEEA 5FWQA 2H6GA 3LPZA 1Y8MA 2KATA 4GTRA 4GMLA 3UPVA 3CHPA 1MX6A 1FT1A 4KT6B 2PZIA 4N5QA 1Q2ZA 1OT8A 1SZ9A 4OAVB 2DZOA 2X38A 2IOSA 5EILA 4GPMA 4AV7A 3IEGA 3W9FA 3HHMA 3GZ2A 3SF4A 3W9GA 1HX8A 3ONLA 1SA4A 1A5EA 4EBAA 1MX4A 4CEMA 2Y3AA 3VLDA 3Q15A 4E85A 4BERA 4AOFA 3PZDA 3FUHA 4HLLA 2PM6A 4AIFA 1AWCB 4I1MA 2BTDA 3TWRA 1IHBA 1BU9A 3Q9NC 4KVMA 4IYPA 4F7AA 2LSVA 3Q75A 3JYSA 4LERA 1HFAA 2V4LA 3PNLB 1FVHA 2GRMA 3FTVA 1OY3D 4TRQA 2ZISA 4L9PA 3C3RA 3ZXPA 3FUNA 4XKCA 2PQRA 3MKRA 1ZB1A 3BG1B 5ARFA 3Q73A 3QB2A 3PZ2A 1K1AA 4J8YA 2MHKA 2P9LG 4ACKA 4BSXA 2HE0A 3ZYQA 3UT4A 4UWFA 2GRRB 2F37A 2WXGA 4TXQA 1UOHA 2AXVA 2YNQA 5LX8A 1YCSB 3CQGB 1INZA 1NA0A 1D9SA 5DBKA 2FO1E 2VSNA 3OXLA 2MOWA 5D0OD 1HS6A 4J8DA 2CFUA 1N54A 2YINA 3MV2B 3UX4A 4MLPA 4DX7D 4HI8A 2PQNA 1WDYA 2OOEA 3UXGA 2YHCA 3ZW3A 3E32A 4N2SA 1S63A 4JPSA 4M7CA 1BI7B 5CECB 4GYYA 4KVOA 1H2TC 2OVBA 3I4RB 3QKYA 5FINA 3RRUA 5G55A 4JVSA 1HXIA 3G2WA 3N71A 5EYLA 4L23A 5T3RA 2YQ8A 3MKQB 4CGVA 2ETAA 3C3QA 3B95A 3PZ3A 2F0YA 3B7UX 4I9CA 1O1RA 4I2WA 3UI2A 3NBNB 2OVFA 1QQEA 4XIFA 3ASOE 3ZPJA 3ZKJA 4KYOB 3UT7A 3SBSA 3CHRA 5LP0A 4CDRA 3AS8A 4TUMA 3QAQA 1IXVA 3RU0A 2ZGDA 5ARGA 5CBOA 2WXMA 3LVQE 1H2UA 3DBSA 4ABNA 3JQ0A 3TJPA 2XCBA 2Y1LE 2KCLA 1SA5A 2XS1A 2CHZA 2GRPB 3DRAA 2HO1A 4HNAD 3V31A 5AJDA 4CDNA 2R2LA 4B89A 3ZN3A 4DX1A 3PEUB 4AY5A 4XX5A 3EDTB 1WY6A 3HDXA 4CGWA 5AAOA 3CIAA 4HI9A 4YVQC 2WM9A 2CG3A 2J08A 3CK9A 3SFXA 4U0SA 4IULA 4XZ4A 4GA0A 2XGMA 5KWDA 3AU5A 3JQ1A 1YA0A 3KS2A 2BEDA 4O1OA 3MX3A 3LEWA 5EIBE 4G24A 3TG4A 4LNBA 3UIOC 4GTPA 3V30A 3SQVA 1MQSA 2CHXA 2AXUA 4DI3A 2GROB 2DZNA 2BKGA 3QWVA 2NXPA 3U3WA 3RIBA 2I9CA 3T8KA 3D9PA 1N94A 5LOZA 3CHSA 2L0TB 5FQ8A 3SFYA 5BT1A 3IHVA 4HRNA 3LJNA 3Q47B 3FUDA 1JCQA 4FA6A 3KEZA 1UW4B 4GTQA 3CVPA 1OUVA 3ZGQA 3ZU7B 5D66A 5EDSA 3BUAA 2L6BA 4UWLA 1FVFA 5AQ7A 4C0EA 4EHMA 2HYZA 3RRMB 3GZSA 3EJNA 5BXOA 2X6KA 4LRZA 5FTPA 3TWVA 3PS6A 4GA1A 1NP7A 2IJGX 5AJLA 4UQYA 2KCKA 3SD5A 3U9WA 3CVVA 5EKQD 3R9MA 2BKKB 4YDYA 1U3CA 2Q7FA 4WWNA 3ASGA 2OEWA 2WVIA 4UWGA 5ANRA 3FUKA 5B1AE 3UMVA 4J8FA 1SQMA 4EQFA 3DSWA 4EZJA 4OAUC 2FEZA 3ASDA 4JA7A 2LAHA 5ENTD 2JEKA 1XNFA 5LCWJ 2KCVA 4FU3A 3OTNA 2MYOA 4JL0A 3TL5A 2LUHA 1NZNA 5CEDB 4R7LA 4G8LA 3L17A 3LXUX 4I1OB 2ZIRA 3MYVA 4TXRA 2A5EA 1E7VA 3LYAA 2X3MA 3AG4E 1U3DA 3E30A 3R9AB 4U95D 5ENPD 2WXRA 3ZYKA 3J5PA 4C0MA 2WQHA 3TAXA 2VGEA 4ATZD 1OWNA 2Y0BG 2DIWA 5LCWC 3E4BA 2XPIA 3FUIA 5E76A 4I6JA 2Y69E 3CK7A 4BTAA 5D0QD 2GW1A 2VSYA 2WQ7A 2XRZA 3ZYLA 3ENEA 4MS6A 5FZQA 1N0RA 2CFZA 2AJAA 5FZRA 4JZYA 2XENA 1S64A 3AS4A 4RG6A 4U7EB 2YHEA 1JWGA 5AQAA 5EX3A 3D9HA 5JHAA 3Q9UC 3ASFA 1H6OA 3WG7E 2XCCA 4C48B 5E75A 3G2UA 3JXJA 2GRQB 3NF1A 1ZBPA 4GA2A 3FH7A 4B0ZA 4I9EA 1DCEA 2I2OA 3VTYA 4BEPA 3ZIMA 2C0LA 5HQ8A 3EHMA 3DSVA 3TWQA 3BU8A 3EU5A 2EQXA 3TWXA 3LY8A 1HE8A 3CKBA 4XI0A 3ESLA 4DRXE 3NAWA 3TWSA 5CCMA 2EILE 3O4ZA 5CERB 2OEVA 1O1SA 3D9OA 1WG0A 3PNTB 4NQ0A 3AU4A 4KZ0A 4U04A 3HG0D 1LD8A 2IU1A 4K03A 1V55E 3PUKA 4U8HA 3PVLA 5FQ6A 4JD2G 4DPRA 4YDWA 3QK0A 2PNNA 3HXDA 4GZCA 4PUCA 3UT8A 2XEHA 2C0MA 3JXIA 3BQOA 2J07A 3OXGA 4AEZC 3C98A 3SGHA 3RKVA 4U63A 2QFCA 1IQRA 4AP2A 2DWZA 2KM4A 1JCRA 5CEAA 3UM0A 1WM5A 3FUFA 4NURA 5AARA 3PREA 3APCA 5ENSD 3AG3E 1TNBA 4BX9A 2J09A 4GTTA 3ZHEA 2JLBA 4RVBA 4E6HA 5CHEE 3ZXSA 2RFMA 2IONA 4NIKA 4OVUA 1PC2A 3EHNA 3HIZA 1RW2A 3S7FA 4X8QA 4HS2A 1W3BA 4ANXA 4LNUD 1N0QA 2L9BA 2A5UA 3TWUA 3AJIA 2F8XK 4FLHA 3Q7AA 4MBGA 3ML8A 3AG2E 3B7RL 3ULQA 5D2MC 1E90A 4HQDA 2DYRE 3L6AA 1IHGA 2PM7A 1D8DA 5B1BE 3R7RA 2IY0C 4I6EA 1FCHA 3CVXA 1HF8A 4EPZA 3EHRA 3D9LA 1B89A 5KNGA 4H7XA 1EPUA 2C2LA 4LUNU 2VTBA 3S7BA 1TYQG 3D9JA 3FULA 3I5PA 4UQZA 2P9IG 4JA9A 3UM2A 3AG1E 3KEAA 4JHRA 3GZ1A 5BPPA 5CMYA 4BESA 3G2TA 3LS8A 3D9NA 3CSFA 3LY9A 5HS0A 5FZSA 3DSTA 3LDZA 4CT4A 4CRWA 3LVRE 3UTMA 3PRZA 2WXIA 2WMNA 2CHWA 2OV8A 5EN5D 1H0AA 4NRHB 4L2YA 3CVQA 2L6JA 1HH8A 2XZTG 2WXHA 4GZ3A 4B94A 4HB5A 5LFAA 3DSXA 3FEXA 4HLEA 4I17A 2DVWA 4K5CA 4EBAG 5CCLA 5ANLA 2XS8A 1KZOA 4APOA 1TNYA 5H7PA 5ITZF 1NI1A 5KJKA 3ABKE 4G25A 4JC8A 1N9AA 4XE0A 2IO3C 2NSZA 1N4SA 3OAWA 2WB2A 1DC2A 3FUEA 3ABME 4BETA 5BW8C 5G05J 4F3VA 4GAAA 3DEOA 4I6GA 5C2YA 5B3SE 2AWIA 3FH8A 3T9KA 3EUVA 3FU3A 4U96D 2OCCE 4GTSA 2GRLA 4WNEA 4XKBA 3UKUG 2AW6A 2KZTA 3APDA 4DLQA 4HRLA 1MJ0A 4FJZA 1S70B 5G05C 3RK6A 1SVXA 4G8KA 1ELWA 4GMRA 4WWOA 3RO3A 3TWTA 5FQ4A 3HYMB 3SFZA 4YDOA 4Q94A 5AQBA 3PE3A 1N95A 3HVEB 2DBAA 3VTXA 3CHMA 3QJZA 1N52A 3OXFA 4FHKA 2WXPA 1TNUA 4O60A 1N4QA 5FT9A 1Z5SC 1OCRE 3S2AA 4CCAA 4HORA 1BD8A 4ILGA 2RKKA 3SHFA 4AVXA 1EYHA 4UWHA 2V8SE 5HRYA 1E8XA 3NQPA 2RD0A 4DX6D 1DNPA 1TJCA 2CG2A 4HOTA 3HVEA 1TN8A 3KSLA 4QQIA 4GCNA 3DXKG 1N11A 4W9RA 4PS8A 5AENA 2NC9A 2H6FA 4LNGA 4HVBA 2GRNB 4A55A 1ELRA 2QY7A 2E2EA 2MRIA 3B13A 3K9IA 1H19A 2ZU6B 4BT8A 3B7TA 4TXPA 1Z3YA 2I6HA 4JW1A 3HXEA 2PL2A 3C3OA 2FI7A 1QBQA 3FTXA 5AQ9A 3E33A 4EECA 3CEQA 1H6PA 2R05A 4RSYA 1HU3A 2M63A 4G26A 3IV0A 5EX0A 3G2VA 2IFUA 2UY1A 3FUJA 1TNZA 2V4HC 3U66A 5CRVA 4L2LA 1BPOA 4OVVA 3D9MA 4XI9A 3ASHA 2P58C 1AP7A 2EIKE 2WXJA 5JJTA 2XQ0A 1A17A 3SY2A 2VSXE 3DEPA 4N2QA 3ASNE 1IQUA 4NACA 1JPLA 2L0IA 3UQ3A 4CZ2D 3FU5A 4ANVA 1LD7A 4M3OA 3ZVVA 1DVPA 4UUCA 5IY5E 5A6CA 1E8YA 2EINE 1H6KA 4GZ5A 5FIOA 4GYWA 3FH5A 2XGSA 3UINC 2FBNA 2R59A 5KBAA 4LG6A 5CRUA 3FEYA 3L22A 3DPYA 3MCXA 2HR2A 4K5AB 3ONKA 4K5BA 3Q5MA 1UN8A 4J8EA 4UWKA 3UIPC 2IQCA 4MRUA 1DCQA 3CVUA 4C9BB 3I3NA 1UG3A 4KXKB 3NOGD 2LXLA 3MGBA 4L7TA 2R03A 2NYJA 4YDEA 2VQ2A 1JCSA 4IN3B 2AVPA 2J9QA 2V5FA 1BI8B 4FLBA 1UJJA 4J6IA 2J4BA 1VDYA 3NOCD 3CHQA 4BSZB 2I1KA 3FTWA 3RAUA 4U8VD 1MHQA 1TN7A 3UKRG 4U0UA 1NA3A 1XGWA 2ZGGA 1QNFA 3UUXA 3CR3A 4GMJA 2A4ZA 4TUUA 1NFIE 3DWLG 5KJMA 2WXFA 1MYOA 2IO2C 4HOUA 3FP3A 1O5MA 3ABLE 4QFVA 2P9NG 4URKA 5JMND 4D10C 4UQXA 2R5SA 2FO7A 4WAFA 1KZPA 3ZNGA 4N39A 3DXMG 1EF1C 3FTZA 3MEKA 1TN6A 3FTUA 3CVNA 4FHJA 4DUIA 1E7UA 5T4YA 5BV0A 4FADA 1Z3XA 3L08A 5AIJA 1E96B 3JUIA 3ZHEB 3PZ1A 2ETCA 4HRMB 4DX2A 1YYHA 3Q79A 4A3VA 4F1PA 5G04J 2FF4A 2RG8A 4KZCA 3DSUA 4A3TA 4P29A 3C5RA 3ZEFA 3E34A 4JHJA 3V79K 2IOLA 3APFA 5BV1A 4AXHA 1QZ2A 4G2VA 3QDNA 5ENOD 1E8WA 3VLFA 4A1GA 2LNIA 3P2BA 1D8EA 4Z68A 2J8SD 2VSOE 2LAIA 2EIME 3FHEA 3QARA 4FC8A 4UI9J 3P1UA 1U2VG 5G04C 2WXLA 1PAQA 2RFAA 3G2SA 5T8IA 3S7DA 1S0PA 3WXXA 4GZDA 4ILIA 3ZFWA 3FUMA 4B8AA 4GPKA 3GYZA 2VTBB 5BUZA 1RZ4A 4I43A 3MZLB 4ZHBA 2WXOA 2QZAA 5KJLA 4ILHB 3PEVB 3ISMC 1P5QA 1WAO1 4JHKA 1K1BA 5M72A 3FTSA 4APFA 4JB8P 3FU6A 3CK8A 4UI9C 1TJFA 3LKUA 3ZUVB 1HG5A 3QOUA 3IKOB 3PUJA 5CMWA 3JCKC 3T8MA 3SI5A 4AY6A 3QWPA 4MKTA 2WXQA 4RQIA 1L5JA 5C1DA 2BF0X 3CQCB 4GB9A 4H7YA 4GCOA 3TG5A 1MX2A 1V54E 4J7WA 5HI7A 3FY4A 3UM1A 4O1PA 1SW6A 2XRYA 5J08A 3KSQA 3O48A 1QYMA 1X81A 5HKPA 3CSTA 4HOQA 2H6IA 4BT9A 3EIQC 4BX8A 1PY1A 3FTYA 4OYSA 4O6FA 1H2VC 2VGYA 4ATGA 3Q7FA 2XEVA 1NL4A 4Q96A 3MJWA 4JEUA 2P9SG 2VYIA 4HFGA 4B8CB 3IXEA 5CBNA 2ONDA 3NB2A 3AS5A 2KBXA 4JEHA 3PH0C 1BLXB 3BEEA 2IF4A 3QC1A 3PZ4A 2FULA 3AAAC 4F1SA 1YMPA 2WMOA 1OWPA 2F8YA 2X6FA 3MA5A 2KZTB 1OWLA 4EZLA 3D3MA 3CVLA 1EDUA 5BXUA 5KNHD 4BWRA 1ZU2A 3DSSA 4K0RA 4CT0A 4WNFA 3URZA 2XPZA 3RRNB 3TWWA 5G2NA 4U0ZA 3MKQA 5JJ7A 4EZKA 1KPSB 3U4TA 4WUYA 3C72A 4F6RD 1KT0A 2X6JA 4IRUA 5A7DB 2J49A 1N4RA 4I2ZA 4GU5A 5FJYA 5ENNA 2VJ8A 1OWOA 4PDXA 4KBQA 4U07A 1Y6IA 2H6HA 3DPDA 1ELKA 4J0UA 2R17C 3LJ3A 2DYSE 4XEIG 3CGHA 4N5CA 3E37A 3IHYA 3MV3B 3R7QA 3J5QB 3Q49B 3ULEG 2X6HA 4FULA 5FQ7A 3V2XA 3L82A 2IEJA 2LO6A 4KMOA 4Y6WA 1KLXA 4UI9K 5ENQD 3JUEA 1X5BA 3ZYMA 4WNGA 5DIZA 4LSZE 3I4GA 2R02A 4F53A 2ILRA 2LXMA 5BNWA 3SBTB 4G23A 4LEUA 3EU9A 2ZXWE 3V2OA 4BFRA 2P9KG 4ANWA 5AN8A 1OWMA 1OXJA 3X2QE 2E0IA 3HXBA 3L9TA 4GZ6A 3FWVA 4V3IA 2B6CA 2JABA 3S7JA 2UY1B 2KC7A 3NZSA 5ENRD 3EIJA 1GW6A 4GTVA 4FP7A 3Q78A 3PE4A 2HM8A 3SZ7A 1FPPA 4ACLA 2BUGA 3B7SA 1OCOE 3RSEG 4AJWA 3NZUA 4N3CA 2DCPA 3D9KA 2I1JA 2AXZA 5JHBA 3L54A 3CVYA 3FU0A 4HOSA 4ZFHA 5A23A 4Y6CA 5KCMA 1UJKA 5AYWD 5KJNA 1HZ4A 3FFLA 4TV3A 4I1AA 4DI4A 5JJ6A 3QWWA 4G1TA 4WWPA 1Z6TA 4BTBA 2V0PA 3CHOA 4DLOA 4YNDA 4PS3A 2J4DA 3L16A 1OCZE 2X6IA 4DX5D 5J90A 2XPYA 3UM3A 2GGFA 2B0OE 3ESKA 4YVOA 5EYPF 2XZDG 1LTXA 3BG0B 1K3ZD 4A63B 2WPVA 3HXFA 3B7BA 1OCCE 3TXMA 1FT2A 4CYMD 3KD7A 3Q4AB 4J8SA 3ZRHA 5JA4D 1HO8A 4HBDA 3PDNA 1JWFA 1LF8A 3LY7A 2V5QC 2XGOA 4A1SA 4Q69A 1E8ZA 3F6QA 1TEZA 4CDMA 2EIJE 3IBEA 4ME2A 4G11A 2WXNA 2P9UG 4AM9A 2WQ6A 4RG9A 2QC9A 3U64A 4PS7A 3SO8A 4L1BA 1K8KG 3RJVA 3GW4A 3D9IA 3ML9A 1O1TA 4N3AA 1IYGA 3CV0A 4GYOA 1SZAA 2XHEA 1HG2A 4PH4B 2WXKA 4JXTA 3CKCA 3ULYA 3FDHA 4FJYA 3L13A 3T5VA 3EHQA
chains in the Genus database with same CATH topology
2Y4UA 4LCTA 3PS6A 4GA1A 1NP7A 2IJGX 5AJLA 4UQYA 3VLEA 1WAO1 2KCKA 3FU3A 4JHKA 4DJAA 3RO2A 2Y4TA 5M72A 3FTSA 3SD5A 2VGXB 4N3BA 3U9WA 4APFA 1JUQA 3CVVA 5EKQD 1UN9A 3CK8A 3FU6A 4UI9C 1TJFA 2UWJG 2GRLA 3LKUA 4WNEA 4WNDA 4XKBA 2AW6A 1U3CA 1HG5A 2KZTA 2Q7FA 3QOUA 4WWNA 3APDA 3ASGA 3QNKA 3IKOB 3PUJA 5CMWA 3JCKC 3T8MA 4DLQA 1KT1A 2WVIA 4HXIA 3SI5A 4AY6A 3KAEA 4UWGA 3QWPA 5ANRA 4MKTA 3TXNA 3FUKA 4FJZA 3UMVA 2WXQA 4J8FA 5G05C 3RK6A 1SQMA 2LSUA 1ELWA 1L5JA 4WWOA 4ANUA 3RO3A 5C1DA 2BF0X 3CQCB 3LCAA 3HYMB 4GB9A 5FQ4A 4EQFA 4EZJA 4H7YA 3SFZA 4Q94A 4GCOA 2FEZA 3ASDA 3CLJA 3TG5A 4BY6A 3CVWA 3TGOA 3PE3A 4DK5A 4JA7A 2LAHA 2VGXA 2JEKA 1XNFA 5HI7A 3FY4A 2KCVA 3T5XA 5LCWJ 3SNXA 3HVEB 2DBAA 4FU3A 3VTXA 2XRYA 3OTNA 3CHMA 5J08A 5FWQA 3QJZA 1N52A 3LPZA 1Y8MA 2KATA 3O48A 4JL0A 3OXFA 4GMLA 3TL5A 4FHKA 2WXPA 1NZNA 3UPVA 3CHPA 4R7LA 3CSTA 4HOQA 3L17A 4BT9A 3LXUX 3EIQC 4I1OB 5FT9A 4BX8A 3MYVA 3S2AA 1E7VA 4CCAA 1PY1A 3FTYA 4OYSA 3LYAA 4ILGA 3SHFA 4HORA 4KT6B 2PZIA 4O6FA 1H2VC 2X3MA 2VGYA 4AVXA 4ATGA 1U3DA 1EYHA 4UWHA 2V8SE 1SZ9A 3R9AB 2XEVA 4Q96A 1E8XA 3NQPA 3MJWA 4JEUA 2VYIA 2WXRA 3ZYKA 2X38A 2RD0A 4HFGA 1DNPA 1TJCA 2CG2A 4B8CB 4C0MA 2ONDA 4HOTA 2WQHA 3HVEA 3TAXA 2IOSA 4AV7A 1OWNA 3AS5A 4GCNA 2DIWA 4JEHA 5LCWC 3IEGA 3E4BA 3PH0C 3HHMA 3GZ2A 3SF4A 4W9RA 2XPIA 1HX8A 3ONLA 3BEEA 4PS8A 5AENA 2IF4A 3FUIA 3QC1A 4EBAA 5E76A 4CEMA 2NC9A 4I6JA 4HVBA 2Y3AA 3CK7A 4A55A 3VLDA 4BTAA 5D0QD 2FULA 3Q15A 2GW1A 4E85A 1ELRA 2QY7A 4F1SA 2WMOA 4AOFA 1OWPA 2E2EA 2VSYA 2WQ7A 2MRIA 2XRZA 3B13A 2X6FA 3K9IA 3PZDA 3MA5A 1H19A 2KZTB 1OWLA 2ZU6B 3ENEA 4MS6A 3ZYLA 3FUHA 5FZQA 2CFZA 4BT8A 3B7TA 5FZRA 4EZLA 2PM6A 4AIFA 3D3MA 4I1MA 3CVLA 1Z3YA 4JZYA 1EDUA 2I6HA 2BTDA 4JW1A 3AS4A 2PL2A 4RG6A 2YHEA 2FI7A 1JWGA 3FTXA 4BWRA 5EX3A 1ZU2A 5JHAA 4EECA 3CEQA 4K0RA 4CT0A 4WNFA 3URZA 2XPZA 3RRNB 3ASFA 4RSYA 1HU3A 2M63A 4G26A 3IV0A 4KVMA 5G2NA 4U0ZA 4IYPA 3MKQA 5EX0A 2XCCA 5JJ7A 3G2VA 4F7AA 2LSVA 2IFUA 2UY1A 4EZKA 5E75A 3U4TA 3JYSA 3FUJA 3G2UA 1HFAA 4LERA 2V4LA 4WUYA 1KT0A 2X6JA 4IRUA 3PNLB 3U66A 5A7DB 2J49A 4L2LA 1BPOA 4OVVA 1FVHA 2GRMA 3FTVA 3NF1A 3D9MA 1ZBPA 4I2ZA 4TRQA 4XI9A 4GU5A 3ASHA 5FJYA 2P58C 5ENNA 3FUNA 4GA2A 3FH7A 2VJ8A 4XKCA 1OWOA 4PDXA 4KBQA 4U07A 1Y6IA 3DPDA 4B0ZA 1ELKA 4J0UA 2PQRA 2WXJA 4I9EA 2R17C 3LJ3A 3MKRA 5JJTA 3BG1B 2I2OA 1A17A 2XQ0A 2VSXE 3VTYA 4N2QA 5ARFA 3ZIMA 2C0LA 1IQUA 4NACA 5HQ8A 3QB2A 3CGHA 1JPLA 3EHMA 2L0IA 3UQ3A 2MHKA 4ACKA 4BSXA 3FU5A 4N5CA 4ANVA 2EQXA 4M3OA 3ZYQA 3UT4A 3LY8A 1HE8A 3CKBA 3IHYA 3MV3B 4UWFA 3ZVVA 2WXGA 4XI0A 3R7QA 3ESLA 1DVPA 3Q49B 5CCMA 2AXVA 2X6HA 4FULA 2YNQA 3O4ZA 5LX8A 5FQ7A 3CQGB 5A6CA 1E8YA 3D9OA 1INZA 2LO6A 3PNTB 4KMOA 1NA0A 4Y6WA 5DBKA 4NQ0A 1H6KA 3AU4A 4GZ5A 4KZ0A 4U04A 1KLXA 4UI9K 4GYWA 2IU1A 4K03A 1X5BA 3ZYMA 2VSNA 3FH5A 2XGSA 3OXLA 4WNGA 5DIZA 2MOWA 5D0OD 2FBNA 2R59A 3PUKA 4U8HA 1HS6A 3PVLA 3I4GA 4J8DA 5FQ6A 4DPRA 2CFUA 3QK0A 1N54A 2YINA 4GZCA 4F53A 2ILRA 3MV2B 5BNWA 4PUCA 3SBTB 3UX4A 4G23A 4MLPA 4LEUA 3FEYA 3L22A 3MCXA 2PQNA 3UT8A 2HR2A 3ONKA 2OOEA 3Q5MA 2C0MA 4BFRA 1UN8A 2YHCA 4ANWA 2J07A 3OXGA 4AEZC 1OWMA 3ZW3A 3C98A 4J8EA 4N2SA 4JPSA 3RKVA 4U63A 2QFCA 3SGHA 4UWKA 1IQRA 2E0IA 4AP2A 4GYYA 2KM4A 4KVOA 1H2TC 2OVBA 3I4RB 3QKYA 2IQCA 4MRUA 5G55A 3RRUA 4JVSA 1HXIA 3G2WA 3N71A 4GZ6A 4C9BB 3CVUA 3I3NA 4L23A 5T3RA 1UG3A 4KXKB 3FWVA 4V3IA 1WM5A 2YQ8A 3FUFA 3MGBA 3MKQB 4CGVA 4NURA 3S7JA 4L7TA 2UY1B 2KC7A 3APCA 3NZSA 3PREA 4BX9A 3B7UX 4I9CA 2J09A 3ZHEA 2JLBA 2VQ2A 3EIJA 1GW6A 4IN3B 4FP7A 4I2WA 2AVPA 4RVBA 4E6HA 2J9QA 3PE4A 5CHEE 3ZXSA 2V5FA 2HM8A 2OVFA 1QQEA 4XIFA 4FLBA 1UJJA 3SZ7A 4J6IA 3ZPJA 4KYOB 3UT7A 2IONA 3SBSA 3CHRA 4OVUA 2J4BA 4ACLA 5LP0A 2BUGA 3B7SA 1PC2A 3EHNA 4AJWA 1VDYA 3HIZA 4CDRA 3CHQA 3AS8A 3NZUA 2I1KA 3QAQA 4N3CA 3FTWA 3S7FA 1MHQA 2DCPA 3D9KA 3RU0A 2I1JA 4HS2A 1W3BA 4U0UA 4ANXA 1NA3A 1XGWA 2AXZA 5ARGA 2WXMA 2L9BA 3LVQE 5JHBA 1H2UA 3DBSA 3L54A 1QNFA 2A5UA 3CVYA 3UUXA 4FLHA 4ABNA 3JQ0A 3CR3A 3TJPA 3ML8A 3B7RL 3FU0A 3ULQA 4HOSA 2XCBA 1E90A 2KCLA 5A23A 4Y6CA 3L6AA 5KCMA 1IHGA 1UJKA 2PM7A 2CHZA 5AYWD 4GMJA 2A4ZA 3R7RA 4TUUA 2HO1A 4I6EA 1FCHA 5KJNA 3CVXA 5AJDA 1HF8A 5KJMA 4EPZA 1HZ4A 4CDNA 3FFLA 4TV3A 4I1AA 4B89A 2WXFA 3D9LA 3ZN3A 1B89A 4HOUA 4DI4A 4H7XA 3FP3A 1EPUA 3PEUB 5JJ6A 4AY5A 3QWWA 4XX5A 2C2LA 4G1TA 4LUNU 4WWPA 1Z6TA 4BTBA 3EDTB 2V0PA 1WY6A 3CHOA 3HDXA 4CGWA 4DLOA 2VTBA 4QFVA 4URKA 3CIAA 3S7BA 3D9JA 4YNDA 3FULA 3I5PA 4YVQC 4D10C 2WM9A 4UQXA 4JA9A 4PS3A 4UQZA 2CG3A 2R5SA 2J08A 2J4DA 3CK9A 2FO7A 4JHRA 3GZ1A 4WAFA 5BPPA 3L16A 4U0SA 5CMYA 4IULA 4N39A 2X6IA 4XZ4A 5J90A 2XPYA 2GGFA 1EF1C 3ESKA 3FTZA 3G2TA 3MEKA 4YVOA 4GA0A 2XGMA 3FTUA 3LS8A 3D9NA 3CSFA 3LY9A 5FZSA 3AU5A 3BG0B 3JQ1A 1YA0A 3CVNA 4FHJA 3KS2A 3LDZA 4CT4A 4CRWA 1E7UA 5T4YA 3LVRE 5BV0A 2WPVA 3MX3A 3LEWA 3PRZA 1Z3XA 4G24A 4FADA 3L08A 2WXIA 3TG4A 3TXMA 5AIJA 1E96B 2WMNA 2CHWA 3JUIA 3ZHEB 2OV8A 4A3VA 1H0AA 1MQSA 2CHXA 4NRHB 5G04J 2FF4A 3KD7A 3Q4AB 3CVQA 2AXUA 4L2YA 2RG8A 2L6JA 4KZCA 4DI3A 4A3TA 4P29A 1HH8A 4J8SA 2WXHA 4GZ3A 3ZEFA 3ZRHA 4B94A 5LFAA 1HO8A 3QWVA 4JHJA 3PDNA 2NXPA 1JWFA 1LF8A 3U3WA 3FEXA 2IOLA 4HLEA 3RIBA 3LY7A 3APFA 4I17A 2I9CA 5BV1A 4AXHA 3D9PA 1QZ2A 2XGOA 4G2VA 4A1SA 5LOZA 3QDNA 4Q69A 1E8ZA 3CHSA 2L0TB 4EBAG 5CCLA 1TEZA 5ANLA 4CDMA 1E8WA 3VLFA 4APOA 4A1GA 5FQ8A 2LNIA 3IBEA 3P2BA 4ME2A 4G11A 5BT1A 2WXNA 3IHVA 4AM9A 2WQ6A 4RG9A 5KJKA 2VSOE 2LAIA 3FUDA 3Q47B 4FA6A 3U64A 3KEZA 4G25A 4PS7A 1UW4B 4JC8A 3FHEA 4L1BA 3QARA 3CVPA 4FC8A 4XE0A 1OUVA 3RJVA 4UI9J 3ZGQA 2NSZA 3P1UA 5G04C 2WXLA 5EDSA 3GW4A 1PAQA 3D9IA 3ML9A 3OAWA 3G2SA 5T8IA 3S7DA 4UWLA 1FVFA 2WB2A 4N3AA 1S0PA 3FUEA 3WXXA 1IYGA 3CV0A 4GYOA 4C0EA 4GZDA 4ILIA 3ZFWA 3FUMA 2HYZA 4B8AA 1SZAA 4GPKA 3RRMB 2XHEA 1HG2A 5BW8C 3GYZA 5G05J 4F3VA 2VTBB 4PH4B 5BUZA 3GZSA 3EJNA 2WXKA 4GAAA 4JXTA 4I6GA 2X6KA 3CKCA 5C2YA 4LRZA 4I43A 3MZLB 5FTPA 2WXOA 5KJLA 3FDHA 2AWIA 4FJYA 4ILHB 3L13A 3T5VA 3PEVB 3FH8A 1P5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y4U A;  4GA1 A;  4UQY A;  1WAO 1;  2KCK A;  3RO2 A;  2Y4T A;  5M72 A;  2VGX B;  4N3B A;  5EKQ D;  3CK8 A;  4UI9 C;  2UWJ G;  3LKU A;  4WNE A;  4WND A;  2Q7F A;  3QOU A;  3ASG A;  1KT1 A;  4AY6 A;  3KAE A;  3QWP A;  4J8F A;  5G05 C;  2LSU A;  1ELW A;  3RO3 A;  5C1D A;  4EQF A;  3LCA A;  3HYM B;  4H7Y A;  4GCO A;  2FEZ A;  3ASD A;  3TG5 A;  3TGO A;  3PE3 A;  4JA7 A;  2VGX A;  1XNF A;  5HI7 A;  5LCW J;  2KCV A;  2DBA A;  3VTX A;  3LPZ A;  1Y8M A;  2KAT A;  3O48 A;  4JL0 A;  3OXF A;  1NZN A;  3UPV A;  4HOQ A;  4BT9 A;  5FT9 A;  4HOR A;  3LYA A;  4O6F A;  2PZI A;  2VGY A;  3R9A B;  2XEV A;  2VYI A;  1TJC A;  4HOT A;  2OND A;  2WQH A;  3TAX A;  3AS5 A;  4GCN A;  5LCW C;  3IEG A;  3E4B A;  3GZ2 A;  3SF4 A;  4W9R A;  2XPI A;  3BEE A;  2IF4 A;  2NC9 A;  3CK7 A;  4BTA A;  5D0Q D;  3Q15 A;  2GW1 A;  1ELR A;  2E2E A;  2VSY A;  3K9I A;  3MA5 A;  5FZQ A;  4BT8 A;  5FZR A;  4AIF A;  3CVL A;  2I6H A;  3AS4 A;  2PL2 A;  4RG6 A;  2FI7 A;  4BWR A;  5EX3 A;  1ZU2 A;  3CEQ A;  4WNF A;  3URZ A;  3ASF A;  4G26 A;  4U0Z A;  5EX0 A;  2XCC A;  5JJ7 A;  2LSV A;  2IFU A;  2UY1 A;  3U4T A;  3JYS A;  4WUY A;  1KT0 A;  5A7D B;  3NF1 A;  1ZBP A;  4I2Z A;  4XI9 A;  3ASH A;  5FJY A;  2P58 C;  4GA2 A;  4KBQ A;  4U07 A;  4J0U A;  2PQR A;  4I9E A;  3MKR A;  5JJT A;  1A17 A;  3VTY A;  4N2Q A;  5ARF A;  2C0L A;  5HQ8 A;  3UQ3 A;  2MHK A;  4N5C A;  3LY8 A;  3CKB A;  3MV3 B;  4XI0 A;  3Q49 B;  5CCM A;  5A6C A;  1NA0 A;  4Y6W A;  5DBK A;  4NQ0 A;  4GZ5 A;  4U04 A;  1KLX A;  4UI9 K;  4GYW A;  2VSN A;  2XGS A;  3OXL A;  4WNG A;  5DIZ A;  5D0O D;  2FBN A;  4J8D A;  3MV2 B;  5BNW A;  4G23 A;  4LEU A;  2PQN A;  2HR2 A;  2OOE A;  3Q5M A;  2C0M A;  2YHC A;  3OXG A;  4J8E A;  4N2S A;  3RKV A;  2QFC A;  4GYY A;  3QKY A;  1HXI A;  3N71 A;  4GZ6 A;  4KXK B;  3FWV A;  1WM5 A;  2YQ8 A;  4CGV A;  3S7J A;  2UY1 B;  2KC7 A;  4I9C A;  3ZHE A;  2JLB A;  2VQ2 A;  4IN3 B;  4I2W A;  2AVP A;  2J9Q A;  3PE4 A;  5CHE E;  2V5F A;  1QQE A;  4XIF A;  3SZ7 A;  3ZPJ A;  4KYO B;  2BUG A;  1PC2 A;  4CDR A;  3AS8 A;  4N3C A;  3S7F A;  3RU0 A;  1W3B A;  4U0U A;  1NA3 A;  5ARG A;  3UUX A;  4ABN A;  3ULQ A;  4HOS A;  2XCB A;  2KCL A;  4Y6C A;  1IHG A;  5AYW D;  2HO1 A;  1FCH A;  5KJN A;  5KJM A;  1HZ4 A;  3FFL A;  4I1A A;  3ZN3 A;  1B89 A;  4HOU A;  4H7X A;  3FP3 A;  5JJ6 A;  4AY5 A;  3QWW A;  2C2L A;  4G1T A;  4BTB A;  3EDT B;  4CGW A;  3S7B A;  4YND A;  4YVQ C;  4UQX A;  4UQZ A;  4JA9 A;  2R5S A;  3CK9 A;  2FO7 A;  4JHR A;  3GZ1 A;  4U0S A;  4N39 A;  3ESK A;  4YVO A;  3MEK A;  4GA0 A;  2XGM A;  3LY9 A;  5FZS A;  1YA0 A;  3CVN A;  3KS2 A;  2WPV A;  4G24 A;  3TG4 A;  1E96 B;  3ZHE B;  4NRH B;  5G04 J;  2FF4 A;  3KD7 A;  3Q4A B;  3CVQ A;  2L6J A;  1HH8 A;  4GZ3 A;  4B94 A;  3QWV A;  3PDN A;  3U3W A;  3RIB A;  3LY7 A;  4I17 A;  1QZ2 A;  2XGO A;  4G2V A;  4A1S A;  3QDN A;  5CCL A;  4APO A;  2LNI A;  4ME2 A;  5BT1 A;  4AM9 A;  4RG9 A;  5KJK A;  3Q47 B;  4G25 A;  3CVP A;  3RJV A;  1OUV A;  4UI9 J;  3ZGQ A;  5G04 C;  3GW4 A;  3S7D A;  4N3A A;  1IYG A;  3WXX A;  3CV0 A;  4GYO A;  3ZFW A;  2HYZ A;  4GPK A;  5BW8 C;  3GYZ A;  5G05 J;  4F3V A;  3CKC A;  5FTP A;  5KJL A;  1P5Q A; 
#chains in the Genus database with same CATH topology
 2Y4U A;  4LCT A;  2P9P G;  4GTO A;  3VLE A;  4DJA A;  3RO2 A;  2Y4T A;  2VGX B;  4N3B A;  1JUQ A;  4GTM A;  1UN9 A;  2QYJ A;  1IKN D;  2UWJ G;  2ETB A;  5EID A;  3HRA A;  4U8Y D;  4WND A;  2QYU A;  3QNK A;  1KT1 A;  4HXI A;  3KAE A;  1MZC A;  3TXN A;  2P2C P;  4RLY A;  2LSU A;  4ANU A;  3HXC A;  3LCA A;  4B93 B;  1G3N B;  2KXP C;  1TNO A;  4BY6 A;  3CLJ A;  3CVW A;  3TGO A;  1TR4 A;  4DK5 A;  2VGX A;  1N4P A;  3T5X A;  3SNX A;  2XEE A;  5FWQ A;  2H6G A;  3LPZ A;  1Y8M A;  2KAT A;  4GTR A;  4GML A;  3UPV A;  3CHP A;  1MX6 A;  1FT1 A;  4KT6 B;  2PZI A;  4N5Q A;  1Q2Z A;  1OT8 A;  1SZ9 A;  4OAV B;  2DZO A;  2X38 A;  2IOS A;  5EIL A;  4GPM A;  4AV7 A;  3IEG A;  3W9F A;  3HHM A;  3GZ2 A;  3SF4 A;  3W9G A;  1HX8 A;  3ONL A;  1SA4 A;  1A5E A;  4EBA A;  1MX4 A;  4CEM A;  2Y3A A;  3VLD A;  3Q15 A;  4E85 A;  4BER A;  4AOF A;  3PZD A;  3FUH A;  4HLL A;  2PM6 A;  4AIF A;  1AWC B;  4I1M A;  2BTD A;  3TWR A;  1IHB A;  1BU9 A;  3Q9N C;  4KVM A;  4IYP A;  4F7A A;  2LSV A;  3Q75 A;  3JYS A;  4LER A;  1HFA A;  2V4L A;  3PNL B;  1FVH A;  2GRM A;  3FTV A;  1OY3 D;  4TRQ A;  2ZIS A;  4L9P A;  3C3R A;  3ZXP A;  3FUN A;  4XKC A;  2PQR A;  3MKR A;  1ZB1 A;  3BG1 B;  5ARF A;  3Q73 A;  3QB2 A;  3PZ2 A;  1K1A A;  4J8Y A;  2MHK A;  2P9L G;  4ACK A;  4BSX A;  2HE0 A;  3ZYQ A;  3UT4 A;  4UWF A;  2GRR B;  2F37 A;  2WXG A;  4TXQ A;  1UOH A;  2AXV A;  2YNQ A;  5LX8 A;  1YCS B;  3CQG B;  1INZ A;  1NA0 A;  1D9S A;  5DBK A;  2FO1 E;  2VSN A;  3OXL A;  2MOW A;  5D0O D;  1HS6 A;  4J8D A;  2CFU A;  1N54 A;  2YIN A;  3MV2 B;  3UX4 A;  4MLP A;  4DX7 D;  4HI8 A;  2PQN A;  1WDY A;  2OOE A;  3UXG A;  2YHC A;  3ZW3 A;  3E32 A;  4N2S A;  1S63 A;  4JPS A;  4M7C A;  1BI7 B;  5CEC B;  4GYY A;  4KVO A;  1H2T C;  2OVB A;  3I4R B;  3QKY A;  5FIN A;  3RRU A;  5G55 A;  4JVS A;  1HXI A;  3G2W A;  3N71 A;  5EYL A;  4L23 A;  5T3R A;  2YQ8 A;  3MKQ B;  4CGV A;  2ETA A;  3C3Q A;  3B95 A;  3PZ3 A;  2F0Y A;  3B7U X;  4I9C A;  1O1R A;  4I2W A;  3UI2 A;  3NBN B;  2OVF A;  1QQE A;  4XIF A;  3ASO E;  3ZPJ A;  3ZKJ A;  4KYO B;  3UT7 A;  3SBS A;  3CHR A;  5LP0 A;  4CDR A;  3AS8 A;  4TUM A;  3QAQ A;  1IXV A;  3RU0 A;  2ZGD A;  5ARG A;  5CBO A;  2WXM A;  3LVQ E;  1H2U A;  3DBS A;  4ABN A;  3JQ0 A;  3TJP A;  2XCB A;  2Y1L E;  2KCL A;  1SA5 A;  2XS1 A;  2CHZ A;  2GRP B;  3DRA A;  2HO1 A;  4HNA D;  3V31 A;  5AJD A;  4CDN A;  2R2L A;  4B89 A;  3ZN3 A;  4DX1 A;  3PEU B;  4AY5 A;  4XX5 A;  3EDT B;  1WY6 A;  3HDX A;  4CGW A;  5AAO A;  3CIA A;  4HI9 A;  4YVQ C;  2WM9 A;  2CG3 A;  2J08 A;  3CK9 A;  3SFX A;  4U0S A;  4IUL A;  4XZ4 A;  4GA0 A;  2XGM A;  5KWD A;  3AU5 A;  3JQ1 A;  1YA0 A;  3KS2 A;  2BED A;  4O1O A;  3MX3 A;  3LEW A;  5EIB E;  4G24 A;  3TG4 A;  4LNB A;  3UIO C;  4GTP A;  3V30 A;  3SQV A;  1MQS A;  2CHX A;  2AXU A;  4DI3 A;  2GRO B;  2DZN A;  2BKG A;  3QWV A;  2NXP A;  3U3W A;  3RIB A;  2I9C A;  3T8K A;  3D9P A;  1N94 A;  5LOZ A;  3CHS A;  2L0T B;  5FQ8 A;  3SFY A;  5BT1 A;  3IHV A;  4HRN A;  3LJN A;  3Q47 B;  3FUD A;  1JCQ A;  4FA6 A;  3KEZ A;  1UW4 B;  4GTQ A;  3CVP A;  1OUV A;  3ZGQ A;  3ZU7 B;  5D66 A;  5EDS A;  3BUA A;  2L6B A;  4UWL A;  1FVF A;  5AQ7 A;  4C0E A;  4EHM A;  2HYZ A;  3RRM B;  3GZS A;  3EJN A;  5BXO A;  2X6K A;  4LRZ A;  5FTP A;  3TWV A;  3PS6 A;  4GA1 A;  1NP7 A;  2IJG X;  5AJL A;  4UQY A;  2KCK A;  3SD5 A;  3U9W A;  3CVV A;  5EKQ D;  3R9M A;  2BKK B;  4YDY A;  1U3C A;  2Q7F A;  4WWN A;  3ASG A;  2OEW A;  2WVI A;  4UWG A;  5ANR A;  3FUK A;  5B1A E;  3UMV A;  4J8F A;  1SQM A;  4EQF A;  3DSW A;  4EZJ A;  4OAU C;  2FEZ A;  3ASD A;  4JA7 A;  2LAH A;  5ENT D;  2JEK A;  1XNF A;  5LCW J;  2KCV A;  4FU3 A;  3OTN A;  2MYO A;  4JL0 A;  3TL5 A;  2LUH A;  1NZN A;  5CED B;  4R7L A;  4G8L A;  3L17 A;  3LXU X;  4I1O B;  2ZIR A;  3MYV A;  4TXR A;  2A5E A;  1E7V A;  3LYA A;  2X3M A;  3AG4 E;  1U3D A;  3E30 A;  3R9A B;  4U95 D;  5ENP D;  2WXR A;  3ZYK A;  3J5P A;  4C0M A;  2WQH A;  3TAX A;  2VGE A;  4ATZ D;  1OWN A;  2Y0B G;  2DIW A;  5LCW C;  3E4B A;  2XPI A;  3FUI A;  5E76 A;  4I6J A;  2Y69 E;  3CK7 A;  4BTA A;  5D0Q D;  2GW1 A;  2VSY A;  2WQ7 A;  2XRZ A;  3ZYL A;  3ENE A;  4MS6 A;  5FZQ A;  1N0R A;  2CFZ A;  2AJA A;  5FZR A;  4JZY A;  2XEN A;  1S64 A;  3AS4 A;  4RG6 A;  4U7E B;  2YHE A;  1JWG A;  5AQA A;  5EX3 A;  3D9H A;  5JHA A;  3Q9U C;  3ASF A;  1H6O A;  3WG7 E;  2XCC A;  4C48 B;  5E75 A;  3G2U A;  3JXJ A;  2GRQ B;  3NF1 A;  1ZBP A;  4GA2 A;  3FH7 A;  4B0Z A;  4I9E A;  1DCE A;  2I2O A;  3VTY A;  4BEP A;  3ZIM A;  2C0L A;  5HQ8 A;  3EHM A;  3DSV A;  3TWQ A;  3BU8 A;  3EU5 A;  2EQX A;  3TWX A;  3LY8 A;  1HE8 A;  3CKB A;  4XI0 A;  3ESL A;  4DRX E;  3NAW A;  3TWS A;  5CCM A;  2EIL E;  3O4Z A;  5CER B;  2OEV A;  1O1S A;  3D9O A;  1WG0 A;  3PNT B;  4NQ0 A;  3AU4 A;  4KZ0 A;  4U04 A;  3HG0 D;  1LD8 A;  2IU1 A;  4K03 A;  1V55 E;  3PUK A;  4U8H A;  3PVL A;  5FQ6 A;  4JD2 G;  4DPR A;  4YDW A;  3QK0 A;  2PNN A;  3HXD A;  4GZC A;  4PUC A;  3UT8 A;  2XEH A;  2C0M A;  3JXI A;  3BQO A;  2J07 A;  3OXG A;  4AEZ C;  3C98 A;  3SGH A;  3RKV A;  4U63 A;  2QFC A;  1IQR A;  4AP2 A;  2DWZ A;  2KM4 A;  1JCR A;  5CEA A;  3UM0 A;  1WM5 A;  3FUF A;  4NUR A;  5AAR A;  3PRE A;  3APC A;  5ENS D;  3AG3 E;  1TNB A;  4BX9 A;  2J09 A;  4GTT A;  3ZHE A;  2JLB A;  4RVB A;  4E6H A;  5CHE E;  3ZXS A;  2RFM A;  2ION A;  4NIK A;  4OVU A;  1PC2 A;  3EHN A;  3HIZ A;  1RW2 A;  3S7F A;  4X8Q A;  4HS2 A;  1W3B A;  4ANX A;  4LNU D;  1N0Q A;  2L9B A;  2A5U A;  3TWU A;  3AJI A;  2F8X K;  4FLH A;  3Q7A A;  4MBG A;  3ML8 A;  3AG2 E;  3B7R L;  3ULQ A;  5D2M C;  1E90 A;  4HQD A;  2DYR E;  3L6A A;  1IHG A;  2PM7 A;  1D8D A;  5B1B E;  3R7R A;  2IY0 C;  4I6E A;  1FCH A;  3CVX A;  1HF8 A;  4EPZ A;  3EHR A;  3D9L A;  1B89 A;  5KNG A;  4H7X A;  1EPU A;  2C2L A;  4LUN U;  2VTB A;  3S7B A;  1TYQ G;  3D9J A;  3FUL A;  3I5P A;  4UQZ A;  2P9I G;  4JA9 A;  3UM2 A;  3AG1 E;  3KEA A;  4JHR A;  3GZ1 A;  5BPP A;  5CMY A;  4BES A;  3G2T A;  3LS8 A;  3D9N A;  3CSF A;  3LY9 A;  5HS0 A;  5FZS A;  3DST A;  3LDZ A;  4CT4 A;  4CRW A;  3LVR E;  3UTM A;  3PRZ A;  2WXI A;  2WMN A;  2CHW A;  2OV8 A;  5EN5 D;  1H0A A;  4NRH B;  4L2Y A;  3CVQ A;  2L6J A;  1HH8 A;  2XZT G;  2WXH A;  4GZ3 A;  4B94 A;  4HB5 A;  5LFA A;  3DSX A;  3FEX A;  4HLE A;  4I17 A;  2DVW A;  4K5C A;  4EBA G;  5CCL A;  5ANL A;  2XS8 A;  1KZO A;  4APO A;  1TNY A;  5H7P A;  5ITZ F;  1NI1 A;  5KJK A;  3ABK E;  4G25 A;  4JC8 A;  1N9A A;  4XE0 A;  2IO3 C;  2NSZ A;  1N4S A;  3OAW A;  2WB2 A;  1DC2 A;  3FUE A;  3ABM E;  4BET A;  5BW8 C;  5G05 J;  4F3V A;  4GAA A;  3DEO A;  4I6G A;  5C2Y A;  5B3S E;  2AWI A;  3FH8 A;  3T9K A;  3EUV A;  3FU3 A;  4U96 D;  2OCC E;  4GTS A;  2GRL A;  4WNE A;  4XKB A;  3UKU G;  2AW6 A;  2KZT A;  3APD A;  4DLQ A;  4HRL A;  1MJ0 A;  4FJZ A;  1S70 B;  5G05 C;  3RK6 A;  1SVX A;  4G8K A;  1ELW A;  4GMR A;  4WWO A;  3RO3 A;  3TWT A;  5FQ4 A;  3HYM B;  3SFZ A;  4YDO A;  4Q94 A;  5AQB A;  3PE3 A;  1N95 A;  3HVE B;  2DBA A;  3VTX A;  3CHM A;  3QJZ A;  1N52 A;  3OXF A;  4FHK A;  2WXP A;  1TNU A;  4O60 A;  1N4Q A;  5FT9 A;  1Z5S C;  1OCR E;  3S2A A;  4CCA A;  4HOR A;  1BD8 A;  4ILG A;  2RKK A;  3SHF A;  4AVX A;  1EYH A;  4UWH A;  2V8S E;  5HRY A;  1E8X A;  3NQP A;  2RD0 A;  4DX6 D;  1DNP A;  1TJC A;  2CG2 A;  4HOT A;  3HVE A;  1TN8 A;  3KSL A;  4QQI A;  4GCN A;  3DXK G;  1N11 A;  4W9R A;  4PS8 A;  5AEN A;  2NC9 A;  2H6F A;  4LNG A;  4HVB A;  2GRN B;  4A55 A;  1ELR A;  2QY7 A;  2E2E A;  2MRI A;  3B13 A;  3K9I A;  1H19 A;  2ZU6 B;  4BT8 A;  3B7T A;  4TXP A;  1Z3Y A;  2I6H A;  4JW1 A;  3HXE A;  2PL2 A;  3C3O A;  2FI7 A;  1QBQ A;  3FTX A;  5AQ9 A;  3E33 A;  4EEC A;  3CEQ A;  1H6P A;  2R05 A;  4RSY A;  1HU3 A;  2M63 A;  4G26 A;  3IV0 A;  5EX0 A;  3G2V A;  2IFU A;  2UY1 A;  3FUJ A;  1TNZ A;  2V4H C;  3U66 A;  5CRV A;  4L2L A;  1BPO A;  4OVV A;  3D9M A;  4XI9 A;  3ASH A;  2P58 C;  1AP7 A;  2EIK E;  2WXJ A;  5JJT A;  2XQ0 A;  1A17 A;  3SY2 A;  2VSX E;  3DEP A;  4N2Q A;  3ASN E;  1IQU A;  4NAC A;  1JPL A;  2L0I A;  3UQ3 A;  4CZ2 D;  3FU5 A;  4ANV A;  1LD7 A;  4M3O A;  3ZVV A;  1DVP A;  4UUC A;  5IY5 E;  5A6C A;  1E8Y A;  2EIN E;  1H6K A;  4GZ5 A;  5FIO A;  4GYW A;  3FH5 A;  2XGS A;  3UIN C;  2FBN A;  2R59 A;  5KBA A;  4LG6 A;  5CRU A;  3FEY A;  3L22 A;  3DPY A;  3MCX A;  2HR2 A;  4K5A B;  3ONK A;  4K5B A;  3Q5M A;  1UN8 A;  4J8E A;  4UWK A;  3UIP C;  2IQC A;  4MRU A;  1DCQ A;  3CVU A;  4C9B B;  3I3N A;  1UG3 A;  4KXK B;  3NOG D;  2LXL A;  3MGB A;  4L7T A;  2R03 A;  2NYJ A;  4YDE A;  2VQ2 A;  1JCS A;  4IN3 B;  2AVP A;  2J9Q A;  2V5F A;  1BI8 B;  4FLB A;  1UJJ A;  4J6I A;  2J4B A;  1VDY A;  3NOC D;  3CHQ A;  4BSZ B;  2I1K A;  3FTW A;  3RAU A;  4U8V D;  1MHQ A;  1TN7 A;  3UKR G;  4U0U A;  1NA3 A;  1XGW A;  2ZGG A;  1QNF A;  3UUX A;  3CR3 A;  4GMJ A;  2A4Z A;  4TUU A;  1NFI E;  3DWL G;  5KJM A;  2WXF A;  1MYO A;  2IO2 C;  4HOU A;  3FP3 A;  1O5M A;  3ABL E;  4QFV A;  2P9N G;  4URK A;  5JMN D;  4D10 C;  4UQX A;  2R5S A;  2FO7 A;  4WAF A;  1KZP A;  3ZNG A;  4N39 A;  3DXM G;  1EF1 C;  3FTZ A;  3MEK A;  1TN6 A;  3FTU A;  3CVN A;  4FHJ A;  4DUI A;  1E7U A;  5T4Y A;  5BV0 A;  4FAD A;  1Z3X A;  3L08 A;  5AIJ A;  1E96 B;  3JUI A;  3ZHE B;  3PZ1 A;  2ETC A;  4HRM B;  4DX2 A;  1YYH A;  3Q79 A;  4A3V A;  4F1P A;  5G04 J;  2FF4 A;  2RG8 A;  4KZC A;  3DSU A;  4A3T A;  4P29 A;  3C5R A;  3ZEF A;  3E34 A;  4JHJ A;  3V79 K;  2IOL A;  3APF A;  5BV1 A;  4AXH A;  1QZ2 A;  4G2V A;  3QDN A;  5ENO D;  1E8W A;  3VLF A;  4A1G A;  2LNI A;  3P2B A;  1D8E A;  4Z68 A;  2J8S D;  2VSO E;  2LAI A;  2EIM E;  3FHE A;  3QAR A;  4FC8 A;  4UI9 J;  3P1U A;  1U2V G;  5G04 C;  2WXL A;  1PAQ A;  2RFA A;  3G2S A;  5T8I A;  3S7D A;  1S0P A;  3WXX A;  4GZD A;  4ILI A;  3ZFW A;  3FUM A;  4B8A A;  4GPK A;  3GYZ A;  2VTB B;  5BUZ A;  1RZ4 A;  4I43 A;  3MZL B;  4ZHB A;  2WXO A;  2QZA A;  5KJL A;  4ILH B;  3PEV B;  3ISM C;  1P5Q A;  1WAO 1;  4JHK A;  1K1B A;  5M72 A;  3FTS A;  4APF A;  4JB8 P;  3FU6 A;  3CK8 A;  4UI9 C;  1TJF A;  3LKU A;  3ZUV B;  1HG5 A;  3QOU A;  3IKO B;  3PUJ A;  5CMW A;  3JCK C;  3T8M A;  3SI5 A;  4AY6 A;  3QWP A;  4MKT A;  2WXQ A;  4RQI A;  1L5J A;  5C1D A;  2BF0 X;  3CQC B;  4GB9 A;  4H7Y A;  4GCO A;  3TG5 A;  1MX2 A;  1V54 E;  4J7W A;  5HI7 A;  3FY4 A;  3UM1 A;  4O1P A;  1SW6 A;  2XRY A;  5J08 A;  3KSQ A;  3O48 A;  1QYM A;  1X81 A;  5HKP A;  3CST A;  4HOQ A;  2H6I A;  4BT9 A;  3EIQ C;  4BX8 A;  1PY1 A;  3FTY A;  4OYS A;  4O6F A;  1H2V C;  2VGY A;  4ATG A;  3Q7F A;  2XEV A;  1NL4 A;  4Q96 A;  3MJW A;  4JEU A;  2P9S G;  2VYI A;  4HFG A;  4B8C B;  3IXE A;  5CBN A;  2OND A;  3NB2 A;  3AS5 A;  2KBX A;  4JEH A;  3PH0 C;  1BLX B;  3BEE A;  2IF4 A;  3QC1 A;  3PZ4 A;  2FUL A;  3AAA C;  4F1S A;  1YMP A;  2WMO A;  1OWP A;  2F8Y A;  2X6F A;  3MA5 A;  2KZT B;  1OWL A;  4EZL A;  3D3M A;  3CVL A;  1EDU A;  5BXU A;  5KNH D;  4BWR A;  1ZU2 A;  3DSS A;  4K0R A;  4CT0 A;  4WNF A;  3URZ A;  2XPZ A;  3RRN B;  3TWW A;  5G2N A;  4U0Z A;  3MKQ A;  5JJ7 A;  4EZK A;  1KPS B;  3U4T A;  4WUY A;  3C72 A;  4F6R D;  1KT0 A;  2X6J A;  4IRU A;  5A7D B;  2J49 A;  1N4R A;  4I2Z A;  4GU5 A;  5FJY A;  5ENN A;  2VJ8 A;  1OWO A;  4PDX A;  4KBQ A;  4U07 A;  1Y6I A;  2H6H A;  3DPD A;  1ELK A;  4J0U A;  2R17 C;  3LJ3 A;  2DYS E;  4XEI G;  3CGH A;  4N5C A;  3E37 A;  3IHY A;  3MV3 B;  3R7Q A;  3J5Q B;  3Q49 B;  3ULE G;  2X6H A;  4FUL A;  5FQ7 A;  3V2X A;  3L82 A;  2IEJ A;  2LO6 A;  4KMO A;  4Y6W A;  1KLX A;  4UI9 K;  5ENQ D;  3JUE A;  1X5B A;  3ZYM A;  4WNG A;  5DIZ A;  4LSZ E;  3I4G A;  2R02 A;  4F53 A;  2ILR A;  2LXM A;  5BNW A;  3SBT B;  4G23 A;  4LEU A;  3EU9 A;  2ZXW E;  3V2O A;  4BFR A;  2P9K G;  4ANW A;  5AN8 A;  1OWM A;  1OXJ A;  3X2Q E;  2E0I A;  3HXB A;  3L9T A;  4GZ6 A;  3FWV A;  4V3I A;  2B6C A;  2JAB A;  3S7J A;  2UY1 B;  2KC7 A;  3NZS A;  5ENR D;  3EIJ A;  1GW6 A;  4GTV A;  4FP7 A;  3Q78 A;  3PE4 A;  2HM8 A;  3SZ7 A;  1FPP A;  4ACL A;  2BUG A;  3B7S A;  1OCO E;  3RSE G;  4AJW A;  3NZU A;  4N3C A;  2DCP A;  3D9K A;  2I1J A;  2AXZ A;  5JHB A;  3L54 A;  3CVY A;  3FU0 A;  4HOS A;  4ZFH A;  5A23 A;  4Y6C A;  5KCM A;  1UJK A;  5AYW D;  5KJN A;  1HZ4 A;  3FFL A;  4TV3 A;  4I1A A;  4DI4 A;  5JJ6 A;  3QWW A;  4G1T A;  4WWP A;  1Z6T A;  4BTB A;  2V0P A;  3CHO A;  4DLO A;  4YND A;  4PS3 A;  2J4D A;  3L16 A;  1OCZ E;  2X6I A;  4DX5 D;  5J90 A;  2XPY A;  3UM3 A;  2GGF A;  2B0O E;  3ESK A;  4YVO A;  5EYP F;  2XZD G;  1LTX A;  3BG0 B;  1K3Z D;  4A63 B;  2WPV A;  3HXF A;  3B7B A;  1OCC E;  3TXM A;  1FT2 A;  4CYM D;  3KD7 A;  3Q4A B;  4J8S A;  3ZRH A;  5JA4 D;  1HO8 A;  4HBD A;  3PDN A;  1JWF A;  1LF8 A;  3LY7 A;  2V5Q C;  2XGO A;  4A1S A;  4Q69 A;  1E8Z A;  3F6Q A;  1TEZ A;  4CDM A;  2EIJ E;  3IBE A;  4ME2 A;  4G11 A;  2WXN A;  2P9U G;  4AM9 A;  2WQ6 A;  4RG9 A;  2QC9 A;  3U64 A;  4PS7 A;  3SO8 A;  4L1B A;  1K8K G;  3RJV A;  3GW4 A;  3D9I A;  3ML9 A;  1O1T A;  4N3A A;  1IYG A;  3CV0 A;  4GYO A;  1SZA A;  2XHE A;  1HG2 A;  4PH4 B;  2WXK A;  4JXT A;  3CKC A;  3ULY A;  3FDH A;  4FJY A;  3L13 A;  3T5V A;  3EHQ A; 
#chains in the Genus database with same CATH homology
 2Y4U A;  4LCT A;  3PS6 A;  4GA1 A;  1NP7 A;  2IJG X;  5AJL A;  4UQY A;  3VLE A;  1WAO 1;  2KCK A;  3FU3 A;  4JHK A;  4DJA A;  3RO2 A;  2Y4T A;  5M72 A;  3FTS A;  3SD5 A;  2VGX B;  4N3B A;  3U9W A;  4APF A;  1JUQ A;  3CVV A;  5EKQ D;  1UN9 A;  3CK8 A;  3FU6 A;  4UI9 C;  1TJF A;  2UWJ G;  2GRL A;  3LKU A;  4WNE A;  4WND A;  4XKB A;  2AW6 A;  1U3C A;  1HG5 A;  2KZT A;  2Q7F A;  3QOU A;  4WWN A;  3APD A;  3ASG A;  3QNK A;  3IKO B;  3PUJ A;  5CMW A;  3JCK C;  3T8M A;  4DLQ A;  1KT1 A;  2WVI A;  4HXI A;  3SI5 A;  4AY6 A;  3KAE A;  4UWG A;  3QWP A;  5ANR A;  4MKT A;  3TXN A;  3FUK A;  4FJZ A;  3UMV A;  2WXQ A;  4J8F A;  5G05 C;  3RK6 A;  1SQM A;  2LSU A;  1ELW A;  1L5J A;  4WWO A;  4ANU A;  3RO3 A;  5C1D A;  2BF0 X;  3CQC B;  3LCA A;  3HYM B;  4GB9 A;  5FQ4 A;  4EQF A;  4EZJ A;  4H7Y A;  3SFZ A;  4Q94 A;  4GCO A;  2FEZ A;  3ASD A;  3CLJ A;  3TG5 A;  4BY6 A;  3CVW A;  3TGO A;  3PE3 A;  4DK5 A;  4JA7 A;  2LAH A;  2VGX A;  2JEK A;  1XNF A;  5HI7 A;  3FY4 A;  2KCV A;  3T5X A;  5LCW J;  3SNX A;  3HVE B;  2DBA A;  4FU3 A;  3VTX A;  2XRY A;  3OTN A;  3CHM A;  5J08 A;  5FWQ A;  3QJZ A;  1N52 A;  3LPZ A;  1Y8M A;  2KAT A;  3O48 A;  4JL0 A;  3OXF A;  4GML A;  3TL5 A;  4FHK A;  2WXP A;  1NZN A;  3UPV A;  3CHP A;  4R7L A;  3CST A;  4HOQ A;  3L17 A;  4BT9 A;  3LXU X;  3EIQ C;  4I1O B;  5FT9 A;  4BX8 A;  3MYV A;  3S2A A;  1E7V A;  4CCA A;  1PY1 A;  3FTY A;  4OYS A;  3LYA A;  4ILG A;  3SHF A;  4HOR A;  4KT6 B;  2PZI A;  4O6F A;  1H2V C;  2X3M A;  2VGY A;  4AVX A;  4ATG A;  1U3D A;  1EYH A;  4UWH A;  2V8S E;  1SZ9 A;  3R9A B;  2XEV A;  4Q96 A;  1E8X A;  3NQP A;  3MJW A;  4JEU A;  2VYI A;  2WXR A;  3ZYK A;  2X38 A;  2RD0 A;  4HFG A;  1DNP A;  1TJC A;  2CG2 A;  4B8C B;  4C0M A;  2OND A;  4HOT A;  2WQH A;  3HVE A;  3TAX A;  2IOS A;  4AV7 A;  1OWN A;  3AS5 A;  4GCN A;  2DIW A;  4JEH A;  5LCW C;  3IEG A;  3E4B A;  3PH0 C;  3HHM A;  3GZ2 A;  3SF4 A;  4W9R A;  2XPI A;  1HX8 A;  3ONL A;  3BEE A;  4PS8 A;  5AEN A;  2IF4 A;  3FUI A;  3QC1 A;  4EBA A;  5E76 A;  4CEM A;  2NC9 A;  4I6J A;  4HVB A;  2Y3A A;  3CK7 A;  4A55 A;  3VLD A;  4BTA A;  5D0Q D;  2FUL A;  3Q15 A;  2GW1 A;  4E85 A;  1ELR A;  2QY7 A;  4F1S A;  2WMO A;  4AOF A;  1OWP A;  2E2E A;  2VSY A;  2WQ7 A;  2MRI A;  2XRZ A;  3B13 A;  2X6F A;  3K9I A;  3PZD A;  3MA5 A;  1H19 A;  2KZT B;  1OWL A;  2ZU6 B;  3ENE A;  4MS6 A;  3ZYL A;  3FUH A;  5FZQ A;  2CFZ A;  4BT8 A;  3B7T A;  5FZR A;  4EZL A;  2PM6 A;  4AIF A;  3D3M A;  4I1M A;  3CVL A;  1Z3Y A;  4JZY A;  1EDU A;  2I6H A;  2BTD A;  4JW1 A;  3AS4 A;  2PL2 A;  4RG6 A;  2YHE A;  2FI7 A;  1JWG A;  3FTX A;  4BWR A;  5EX3 A;  1ZU2 A;  5JHA A;  4EEC A;  3CEQ A;  4K0R A;  4CT0 A;  4WNF A;  3URZ A;  2XPZ A;  3RRN B;  3ASF A;  4RSY A;  1HU3 A;  2M63 A;  4G26 A;  3IV0 A;  4KVM A;  5G2N A;  4U0Z A;  4IYP A;  3MKQ A;  5EX0 A;  2XCC A;  5JJ7 A;  3G2V A;  4F7A A;  2LSV A;  2IFU A;  2UY1 A;  4EZK A;  5E75 A;  3U4T A;  3JYS A;  3FUJ A;  3G2U A;  1HFA A;  4LER A;  2V4L A;  4WUY A;  1KT0 A;  2X6J A;  4IRU A;  3PNL B;  3U66 A;  5A7D B;  2J49 A;  4L2L A;  1BPO A;  4OVV A;  1FVH A;  2GRM A;  3FTV A;  3NF1 A;  3D9M A;  1ZBP A;  4I2Z A;  4TRQ A;  4XI9 A;  4GU5 A;  3ASH A;  5FJY A;  2P58 C;  5ENN A;  3FUN A;  4GA2 A;  3FH7 A;  2VJ8 A;  4XKC A;  1OWO A;  4PDX A;  4KBQ A;  4U07 A;  1Y6I A;  3DPD A;  4B0Z A;  1ELK A;  4J0U A;  2PQR A;  2WXJ A;  4I9E A;  2R17 C;  3LJ3 A;  3MKR A;  5JJT A;  3BG1 B;  2I2O A;  1A17 A;  2XQ0 A;  2VSX E;  3VTY A;  4N2Q A;  5ARF A;  3ZIM A;  2C0L A;  1IQU A;  4NAC A;  5HQ8 A;  3QB2 A;  3CGH A;  1JPL A;  3EHM A;  2L0I A;  3UQ3 A;  2MHK A;  4ACK A;  4BSX A;  3FU5 A;  4N5C A;  4ANV A;  2EQX A;  4M3O A;  3ZYQ A;  3UT4 A;  3LY8 A;  1HE8 A;  3CKB A;  3IHY A;  3MV3 B;  4UWF A;  3ZVV A;  2WXG A;  4XI0 A;  3R7Q A;  3ESL A;  1DVP A;  3Q49 B;  5CCM A;  2AXV A;  2X6H A;  4FUL A;  2YNQ A;  3O4Z A;  5LX8 A;  5FQ7 A;  3CQG B;  5A6C A;  1E8Y A;  3D9O A;  1INZ A;  2LO6 A;  3PNT B;  4KMO A;  1NA0 A;  4Y6W A;  5DBK A;  4NQ0 A;  1H6K A;  3AU4 A;  4GZ5 A;  4KZ0 A;  4U04 A;  1KLX A;  4UI9 K;  4GYW A;  2IU1 A;  4K03 A;  1X5B A;  3ZYM A;  2VSN A;  3FH5 A;  2XGS A;  3OXL A;  4WNG A;  5DIZ A;  2MOW A;  5D0O D;  2FBN A;  2R59 A;  3PUK A;  4U8H A;  1HS6 A;  3PVL A;  3I4G A;  4J8D A;  5FQ6 A;  4DPR A;  2CFU A;  3QK0 A;  1N54 A;  2YIN A;  4GZC A;  4F53 A;  2ILR A;  3MV2 B;  5BNW A;  4PUC A;  3SBT B;  3UX4 A;  4G23 A;  4MLP A;  4LEU A;  3FEY A;  3L22 A;  3MCX A;  2PQN A;  3UT8 A;  2HR2 A;  3ONK A;  2OOE A;  3Q5M A;  2C0M A;  4BFR A;  1UN8 A;  2YHC A;  4ANW A;  2J07 A;  3OXG A;  4AEZ C;  1OWM A;  3ZW3 A;  3C98 A;  4J8E A;  4N2S A;  4JPS A;  3RKV A;  4U63 A;  2QFC A;  3SGH A;  4UWK A;  1IQR A;  2E0I A;  4AP2 A;  4GYY A;  2KM4 A;  4KVO A;  1H2T C;  2OVB A;  3I4R B;  3QKY A;  2IQC A;  4MRU A;  5G55 A;  3RRU A;  4JVS A;  1HXI A;  3G2W A;  3N71 A;  4GZ6 A;  4C9B B;  3CVU A;  3I3N A;  4L23 A;  5T3R A;  1UG3 A;  4KXK B;  3FWV A;  4V3I A;  1WM5 A;  2YQ8 A;  3FUF A;  3MGB A;  3MKQ B;  4CGV A;  4NUR A;  3S7J A;  4L7T A;  2UY1 B;  2KC7 A;  3APC A;  3NZS A;  3PRE A;  4BX9 A;  3B7U X;  4I9C A;  2J09 A;  3ZHE A;  2JLB A;  2VQ2 A;  3EIJ A;  1GW6 A;  4IN3 B;  4FP7 A;  4I2W A;  2AVP A;  4RVB A;  4E6H A;  2J9Q A;  3PE4 A;  5CHE E;  3ZXS A;  2V5F A;  2HM8 A;  2OVF A;  1QQE A;  4XIF A;  4FLB A;  1UJJ A;  3SZ7 A;  4J6I A;  3ZPJ A;  4KYO B;  3UT7 A;  2ION A;  3SBS A;  3CHR A;  4OVU A;  2J4B A;  4ACL A;  5LP0 A;  2BUG A;  3B7S A;  1PC2 A;  3EHN A;  4AJW A;  1VDY A;  3HIZ A;  4CDR A;  3CHQ A;  3AS8 A;  3NZU A;  2I1K A;  3QAQ A;  4N3C A;  3FTW A;  3S7F A;  1MHQ A;  2DCP A;  3D9K A;  3RU0 A;  2I1J A;  4HS2 A;  1W3B A;  4U0U A;  4ANX A;  1NA3 A;  1XGW A;  2AXZ A;  5ARG A;  2WXM A;  2L9B A;  3LVQ E;  5JHB A;  1H2U A;  3DBS A;  3L54 A;  1QNF A;  2A5U A;  3CVY A;  3UUX A;  4FLH A;  4ABN A;  3JQ0 A;  3CR3 A;  3TJP A;  3ML8 A;  3B7R L;  3FU0 A;  3ULQ A;  4HOS A;  2XCB A;  1E90 A;  2KCL A;  5A23 A;  4Y6C A;  3L6A A;  5KCM A;  1IHG A;  1UJK A;  2PM7 A;  2CHZ A;  5AYW D;  4GMJ A;  2A4Z A;  3R7R A;  4TUU A;  2HO1 A;  4I6E A;  1FCH A;  5KJN A;  3CVX A;  5AJD A;  1HF8 A;  5KJM A;  4EPZ A;  1HZ4 A;  4CDN A;  3FFL A;  4TV3 A;  4I1A A;  4B89 A;  2WXF A;  3D9L A;  3ZN3 A;  1B89 A;  4HOU A;  4DI4 A;  4H7X A;  3FP3 A;  1EPU A;  3PEU B;  5JJ6 A;  4AY5 A;  3QWW A;  4XX5 A;  2C2L A;  4G1T A;  4LUN U;  4WWP A;  1Z6T A;  4BTB A;  3EDT B;  2V0P A;  1WY6 A;  3CHO A;  3HDX A;  4CGW A;  4DLO A;  2VTB A;  4QFV A;  4URK A;  3CIA A;  3S7B A;  3D9J A;  4YND A;  3FUL A;  3I5P A;  4YVQ C;  4D10 C;  2WM9 A;  4UQX A;  4JA9 A;  4PS3 A;  4UQZ A;  2CG3 A;  2R5S A;  2J08 A;  2J4D A;  3CK9 A;  2FO7 A;  4JHR A;  3GZ1 A;  4WAF A;  5BPP A;  3L16 A;  4U0S A;  5CMY A;  4IUL A;  4N39 A;  2X6I A;  4XZ4 A;  5J90 A;  2XPY A;  2GGF A;  1EF1 C;  3ESK A;  3FTZ A;  3G2T A;  3MEK A;  4YVO A;  4GA0 A;  2XGM A;  3FTU A;  3LS8 A;  3D9N A;  3CSF A;  3LY9 A;  5FZS A;  3AU5 A;  3BG0 B;  3JQ1 A;  1YA0 A;  3CVN A;  4FHJ A;  3KS2 A;  3LDZ A;  4CT4 A;  4CRW A;  1E7U A;  5T4Y A;  3LVR E;  5BV0 A;  2WPV A;  3MX3 A;  3LEW A;  3PRZ A;  1Z3X A;  4G24 A;  4FAD A;  3L08 A;  2WXI A;  3TG4 A;  3TXM A;  5AIJ A;  1E96 B;  2WMN A;  2CHW A;  3JUI A;  3ZHE B;  2OV8 A;  4A3V A;  1H0A A;  1MQS A;  2CHX A;  4NRH B;  5G04 J;  2FF4 A;  3KD7 A;  3Q4A B;  3CVQ A;  2AXU A;  4L2Y A;  2RG8 A;  2L6J A;  4KZC A;  4DI3 A;  4A3T A;  4P29 A;  1HH8 A;  4J8S A;  2WXH A;  4GZ3 A;  3ZEF A;  3ZRH A;  4B94 A;  5LFA A;  1HO8 A;  3QWV A;  4JHJ A;  3PDN A;  2NXP A;  1JWF A;  1LF8 A;  3U3W A;  3FEX A;  2IOL A;  4HLE A;  3RIB A;  3LY7 A;  3APF A;  4I17 A;  2I9C A;  5BV1 A;  4AXH A;  3D9P A;  1QZ2 A;  2XGO A;  4G2V A;  4A1S A;  5LOZ A;  3QDN A;  4Q69 A;  1E8Z A;  3CHS A;  2L0T B;  4EBA G;  5CCL A;  1TEZ A;  5ANL A;  4CDM A;  1E8W A;  3VLF A;  4APO A;  4A1G A;  5FQ8 A;  2LNI A;  3IBE A;  3P2B A;  4ME2 A;  4G11 A;  5BT1 A;  2WXN A;  3IHV A;  4AM9 A;  2WQ6 A;  4RG9 A;  5KJK A;  2VSO E;  2LAI A;  3FUD A;  3Q47 B;  4FA6 A;  3U64 A;  3KEZ A;  4G25 A;  4PS7 A;  1UW4 B;  4JC8 A;  3FHE A;  4L1B A;  3QAR A;  3CVP A;  4FC8 A;  4XE0 A;  1OUV A;  3RJV A;  4UI9 J;  3ZGQ A;  2NSZ A;  3P1U A;  5G04 C;  2WXL A;  5EDS A;  3GW4 A;  1PAQ A;  3D9I A;  3ML9 A;  3OAW A;  3G2S A;  5T8I A;  3S7D A;  4UWL A;  1FVF A;  2WB2 A;  4N3A A;  1S0P A;  3FUE A;  3WXX A;  1IYG A;  3CV0 A;  4GYO A;  4C0E A;  4GZD A;  4ILI A;  3ZFW A;  3FUM A;  2HYZ A;  4B8A A;  1SZA A;  4GPK A;  3RRM B;  2XHE A;  1HG2 A;  5BW8 C;  3GYZ A;  5G05 J;  4F3V A;  2VTB B;  4PH4 B;  5BUZ A;  3GZS A;  3EJN A;  2WXK A;  4GAA A;  4JXT A;  4I6G A;  2X6K A;  3CKC A;  5C2Y A;  4LRZ A;  4I43 A;  3MZL B;  5FTP A;  2WXO A;  5KJL A;  3FDH A;  2AWI A;  4FJY A;  4ILH B;  3L13 A;  3T5V A;  3PEV B;  3FH8 A;  1P5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...