3R9AB

Human alanine-glyoxylate aminotransferase in complex with the tpr domain of human pex5p
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
315
structure length
289
Chain Sequence
QFEEENPLRDHPQPFEEGLRRLQEGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACETLRDWLRYTPAYAHLVDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFGLPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular requirements for peroxisomal targeting of alanine-glyoxylate aminotransferase as an essential determinant in primary hyperoxaluria type 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transport protein
molecule keywords Serine--pyruvate aminotransferase
total genus 116
structure length 289
sequence length 315
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13181 TPR_8 Tetratricopeptide repeat
B PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3r9aB00
2KATA 4GA0A 2PQNA 4BT8A 3ASDA 1KT1A 3MV3B 3Q5MA 3CVNA 3ZHEB 4UQZA 3RJVA 4AIFA 3UPVA 3TAXA 1ELWA 5BT1A 4BTAA 3CVLA 4HOQA 4U0UA 5DBKA 2FI7A 2XCBA 2KCVA 2XGMA 3K9IA 4NQ0A 5CHEE 4AY5A 5KJMA 4J8FA 5KJKA 5BW8C 2E2EA 3AS8A 5A6CA 5KJLA 3ZHEA 2WPVA 3UUXA 4APOA 2KCKA 4UI9J 5BNWA 5M72A 3LY9A 4Y6CA 1TJCA 2HR2A 4KBQA 3MA5A 1OUVA 3FWVA 4I1AA 5FJYA 3CKCA 3Q47B 4YNDA 3VTXA 2AVPA 2Q7FA 1WM5A 3S7BA 3NF1A 4YVOA 4AM9A 3U3WA 2VGYA 2DBAA 1NZNA 2VGXB 2ONDA 3E4BA 3QWWA 4I2ZA 2XEVA 3GZ1A 4J8EA 2V5FA 3SF4A 5FTPA 3EDTB 3MKRA 2C2LA 3CVQA 5G05J 3LY7A 3AS5A 4BTBA 2Y4UA 3Q15A 4GPKA 3Q49B 4I9EA 4N5CA 3QWVA 4G24A 3LCAA 4G26A 4JA9A 2VYIA 3CK7A 4RG9A 4WNEA 5D0QD 5ARGA 2LNIA 4U04A 1ELRA 1FCHA 5ARFA 2VQ2A 4N3BA 3PE3A 2QFCA 4AY6A 2XPIA 3ZPJA 2FBNA 4JHRA 4N39A 4UQYA 4I9CA 4I2WA 3RIBA 3OXLA 2NC9A 4GZ6A 4GZ5A 2L6JA 1IHGA 2XGOA 2VSNA 4N3CA 1YA0A 2BUGA 2GW1A 3QOUA 1E96B 2FEZA 4GYYA 4KXKB 3CK9A 4UQXA 3SZ7A 4WNGA 1NA0A 3ASFA 4I17A 4Y6WA 5HI7A 3WXXA 3FFLA 3VTYA 5CCMA 5JJTA 2Y4TA 2UY1A 4XI9A 3CK8A 2MHKA 2PL2A 4WNFA 3GYZA 4CGVA 2LSUA 4JA7A 4RG6A 4GCNA 4NRHB 3TG5A 3S7JA 4HOTA 3N71A 4GA1A 2IF4A 2JLBA 4GA2A 4B94A 2J9QA 2KC7A 2FO7A 2KCLA 2UY1B 3MEKA 4U0SA 2HYZA 3UQ3A 3TGOA 1B89A 2VSYA 4IN3B 4N2QA 5HQ8A 4A1SA 1A17A 5FT9A 5G05C 2FF4A 4F3VA 5CCLA 3QKYA 4UI9C 3BEEA 1ZU2A 3CVPA 1PC2A 4ME2A 1WAO1 1ZBPA 4BWRA 2WQHA 3OXFA 4GYWA 3S7DA 1Y8MA 3KD7A 4N3AA 2XCCA 4HOUA 3ULQA 3PE4A 3ESKA 1KLXA 4J8DA 3TG4A 2YHCA 3QWPA 3OXGA 4U0ZA 4XIFA 3CV0A 2C0LA 4CGWA 4G25A 3IEGA 4G1TA 2OOEA 1HH8A 3ASHA 3LKUA 2PZIA 2R5SA 4UI9K 4EQFA 4H7YA 3MV2B 4GCOA 4WUYA 4CDRA 4GZ3A 4N2SA 3RO2A 3KAEA 2PQRA 3RKVA 4ABNA 5G04J 2I6HA 1HZ4A 4KYOB 3PDNA 4HOSA 3O48A 3RO3A 3AS4A 2YQ8A 5D0OD 5DIZA 2P58C 3ZFWA 5LCWC 4U07A 3GW4A 2IFUA 2LSVA 5G04C 5AYWD 1KT0A 5FZQA 3R9AB 3GZ2A 3CEQA 2VGXA 4GYOA 5JJ6A 2C0MA 3U4TA 1W3BA 3Q4AB 1HXIA 3FP3A 5EX3A 3RU0A 4WNDA 3LYAA 4JL0A 4YVQC 4BT9A 5KJNA 3KS2A 1NA3A 5FZRA 4W9RA 5C1DA 4HORA 5EKQD 1XNFA 5EX0A 4J0UA 3JYSA 5A7DB 3ZN3A 3ZGQA 5LCWJ 5JJ7A 4H7XA 3ASGA 1P5QA 4G23A 4XI0A 2XGSA 1QZ2A 1QQEA 3URZA 4O6FA 3QDNA 3S7FA 2UWJG 4LEUA 3CKBA 1IYGA 4G2VA 3LY8A 2HO1A 3HYMB 3LPZA 5FZSA
chains in the Genus database with same CATH superfamily
4G11A 3E37A 3Q5MA 3TAXA 5E75A 4WWNA 1K3ZD 3D9IA 2I2OA 2XHEA 4AM9A 3TWTA 4HNAD 2F0YA 3NOCD 3QNKA 1IKND 2LXLA 4I6JA 5ENQD 3G2SA 3FU3A 3CK7A 3TWRA 4BETA 1OY3D 1N0QA 1DNPA 4XKCA 3TWWA 3O4ZA 3NQPA 3RKVA 1JCSA 5D0QD 1IHGA 1QNFA 5BXUA 3WXXA 4ILIA 5E76A 4AXHA 2PL2A 3S7JA 2JLBA 4D10C 3R9MA 2XENA 4APFA 2WXGA 2VGEA 4AJWA 4YDWA 1U3CA 2B6CA 4DPRA 1NI1A 4ATGA 3ZRHA 4MKTA 4CGWA 3CVUA 5KNGA 1JUQA 1TN6A 4JD2G 5HS0A 5T4YA 4ABNA 1VDYA 5G04J 2XQ0A 3CIAA 1OCCE 1UOHA 5B3SE 5FZQA 4BSXA 3CEQA 3Q73A 3LYAA 4HBDA 5FZRA 1OXJA 5EKQD 1H0AA 1XNFA 2ETCA 2R05A 3ZN3A 1DCEA 3G2WA 5FQ7A 4TXRA 3NZSA 4LEUA 3CKBA 2DCPA 2EQXA 3T5VA 4PDXA 3SFZA 3VLDA 4L2YA 2KCVA 2XGMA 2E2EA 1LD7A 5CMWA 3E33A 5M72A 1TN8A 1JPLA 3T8KA 3AJIA 3B7BA 3VTXA 4FADA 2IO3C 2ONDA 3FTZA 4J8EA 3EIQC 1OWNA 3CVQA 3TJPA 3TXNA 4AY6A 3UM2A 2WMOA 4A3TA 3HXCA 3OXLA 4KXKB 3CK9A 5ITZF 2LAIA 4I17A 3U64A 2UY1A 3C3QA 5LFAA 3FY4A 4TXPA 5CECB 5CEDB 3MEKA 5G05C 5AQBA 3BEEA 2P9LG 1PC2A 4EPZA 1WAO1 3E30A 4BEPA 3T8MA 2X6KA 2J49A 3HXEA 3KSQA 1EF1C 3KSLA 3CV0A 3APDA 3C3OA 5J90A 3D9JA 4EQFA 2KXPC 3CHMA 4DX1A 2XRYA 4FU3A 5D0OD 4I43A 3GW4A 4UWKA 2WXFA 3HRAA 2RD0A 2AXZA 1HXIA 3FP3A 2FULA 2ETAA 3JYSA 3KEAA 4KT6B 3BUAA 4XI0A 2BTDA 4O1PA 4CT0A 3URZA 3QDNA 1IYGA 3LY8A 3SY2A 1LF8A 2BKKB 4OYSA 3HVEB 2X38A 4JEHA 5DBKA 1Z6TA 1S64A 1FT1A 3UTMA 5KWDA 2CHZA 5FJYA 4XEIG 3C5RA 1RZ4A 4L9PA 3QWWA 2EIME 3SF4A 1O1RA 4WWPA 2WXNA 1H19A 2VQ2A 3G2VA 4KVOA 5AJDA 3ESLA 5LP0A 2NC9A 2L6JA 1YA0A 4DX2A 4I6GA 1HG2A 1MHQA 4CGVA 2LSUA 4GA2A 5AQAA 5KCMA 2OCCE 2L0TB 4IN3B 3Q79A 3ZUVB 2R2LA 4JC8A 3DSSA 3ZW3A 1HX8A 2Y0BG 3EIJA 4GYWA 3PREA 3NZUA 4TRQA 4EZLA 1E8ZA 4U0ZA 1E90A 2VJ8A 1U3DA 2R5SA 4PS7A 4PS8A 5AENA 3RK6A 1K1AA 4RSYA 2B0OE 3CSTA 2P58C 5FQ8A 4U07A 4UWLA 3V2XA 3G2TA 5AYWD 1KT0A 4K03A 2Y3AA 1BI7B 1O1TA 4WNDA 1HO8A 3B7TA 2GGFA 4G23A 1SZ9A 4ZFHA 2MRIA 1HF8A 5AQ9A 3FTYA 5AARA 3Q7AA 4U63A 3HG0D 2FI7A 5KJMA 5BW8C 2EIKE 2WXQA 4GTOA 4HI8A 3AS5A 4I9EA 4X8QA 1FCHA 2AXUA 1E8YA 2QFCA 1OCRE 3MCXA 4N39A 3SBSA 3L9TA 1OCZE 2BUGA 1Z3XA 2GW1A 3UIPC 1EDUA 1EPUA 3VTYA 3FU6A 4XI9A 4A63B 2GRMA 3LVQE 4GCNA 2KC7A 1WDYA 2R02A 4A1SA 4DUIA 3D3MA 1ZU2A 2L6BA 1Y8MA 1ELKA 2IJGX 3KEZA 3TL5A 4DK5A 4G25A 3ULYA 3ML8A 4H7YA 1TR4A 5CBOA 2PQRA 3AAAC 4XKBA 1YYHA 3PDNA 4GMRA 2XPYA 3DEPA 3X2QE 3L13A 5AAOA 2P9IG 3DRAA 5C1DA 1HE8A 1P5QA 3B95A 4GTRA 5FZSA 2PQNA 3DWLG 1KT1A 4RLYA 2KZTB 3AG4E 3SQVA 5BPPA 3RJVA 2PNNA 4AY5A 5KJLA 1RW2A 2J08A 2X6HA 4UI9J 3JCKC 4K5CA 3FWVA 3S7BA 1IQRA 5T8IA 3UXGA 3ASNE 3EDTB 2BEDA 3Q15A 1INZA 4WNEA 4JW1A 4JHRA 4UQYA 2WQ6A 5EIBE 4PH4B 5JHBA 3VLFA 1NFIE 2ILRA 4JHKA 4ANUA 2ZXWE 3FUFA 4CZ2D 2QZAA 2DVWA 2AWIA 3ZIMA 4DI3A 3ULQA 4KMOA 1Z3YA 3OXGA 3BQOA 4EHMA 2X3MA 3APCA 3DEOA 3PZ2A 4O1OA 4CDRA 2IOLA 1SVXA 4FHJA 3AS4A 4BSZB 2WXKA 3AG2E 3ZVVA 1FT2A 2YHEA 4JVSA 5EYPF 3U4TA 3PS6A 4BESA 5CRVA 3EU9A 1JCRA 4OAUC 4LNGA 2NSZA 4H7XA 1S0PA 3DBSA 5T3RA 1HS6A 2KATA 4TXQA 2WXJA 3ZHEB 3CVLA 4DX5D 4U95D 4HLEA 2WPVA 4BFRA 1TEZA 2IU1A 3MA5A 1OUVA 1MQSA 3HXBA 2DBAA 3E4BA 2V4HC 1NP7A 2Y4UA 3Q49B 3C98A 3Q9UC 2ETBA 3D9PA 3LXUX 3FHEA 2VSXE 2XPIA 3ZPJA 4I9CA 3S2AA 4UQXA 2A5UA 4QQIA 4Y6WA 3FFLA 1QBQA 3GYZA 3ONLA 4B94A 2IF4A 3IKOB 2KZTA 2UY1B 1B89A 1N4QA 5IY5E 2RFMA 3TWSA 2P9KG 4BWRA 3FULA 4ILHB 4GTPA 2Y1LE 4FLHA 2M63A 3QJZA 4UI9K 3DXKG 1BI8B 4KYOB 5DIZA 2BKGA 3CGHA 2LSVA 4HLLA 4HS2A 3IXEA 2GRQB 2XZDG 4WAFA 4AV7A 3KS2A 1TNBA 1N94A 5EX0A 5A7DB 5LCWJ 5FQ6A 3L54A 4GMJA 3CVYA 1D8EA 3MV3B 1MX6A 4LSZE 3SNXA 4DI4A 2EILE 5BT1A 4QFVA 1SW6A 3CVXA 2ZGDA 5A6CA 3CHOA 3MZLB 5BNWA 1BU9A 1JWFA 1DC2A 2VGXB 4JZYA 4M7CA 4N3BA 3RRUA 3PH0C 4R7LA 1EYHA 2H6IA 4E85A 4J8YA 3EHQA 4NURA 1N0RA 2YNQA 3TG5A 1AWCB 2VSYA 1A17A 4GZDA 4F3VA 4UI9C 3C72A 5CEAA 2IQCA 4HOUA 3PE4A 3ESKA 4F7AA 3HHMA 2R59A 4L23A 4UWFA 5ANLA 2RG8A 3SFXA 4C0EA 3FDHA 4HOSA 1X81A 3O48A 3NAWA 4NIKA 3MKQB 3TWVA 3EU5A 5G04C 3LJ3A 3SHFA 2KM4A 3CQGB 5ENSD 3UX4A 2P2CP 4UWHA 3RU0A 2WXIA 4LUNU 2J4BA 2OV8A 3UKUG 4TV3A 2FO1E 2XGSA 2YINA 1XGWA 1X5BA 1MZCA 5ENNA 4AIFA 4AVXA 3FUJA 3UUXA 2HR2A 1S63A 1HFAA 5JMND 3T5XA 2ZISA 2J09A 2EINE 2X6JA 1Q2ZA 5G05J 1E7UA 4K5AB 5ARFA 2GROB 3SGHA 4GZ6A 5ANRA 3QOUA 1SQMA 1E96B 3SZ7A 4O60A 3MGBA 5JJTA 2AW6A 3JUEA 3W9GA 3PUKA 3RAUA 1OT8A 3F6QA 1MX2A 1N11A 2I1KA 3APFA 4IYPA 4LERA 3JXJA 4HRLA 2WQHA 5HKPA 4FLBA 4G1TA 1V55E 3V30A 3EHMA 3L16A 4Z68A 2WMNA 1HZ4A 3AU5A 3PVLA 3RO3A 5LCWC 4GYOA 2C0MA 4C0MA 2OEVA 4FJZA 2I1JA 3MJWA 4F6RD 4TUUA 3UM0A 3Q75A 1OCOE 3SBTB 2VSOE 2CHXA 2RFAA 3ZYQA 4B93B 4OVVA 3AG1E 2PM6A 4APOA 4LRZA 3ASOE 2GRPB 3QK0A 2VTBA 3V79K 2LNIA 4GTTA 1H2TC 2FBNA 4CDNA 4BT8A 1FVFA 3HVEA 4C48B 2QYUA 2MHKA 1PY1A 3UI2A 2BF0X 2HYZA 3LS8A 3DXMG 3QKYA 2X6IA 3FUNA 4WWOA 2JABA 5B1AE 3L22A 4FC8A 4M3OA 2J4DA 2IO2C 2E0IA 3ASHA 2PZIA 4BERA 4FULA 3PNLB 5FWQA 2F37A 2ZU6B 2HE0A 4BY6A 3UKRG 3IHVA 1LTXA 4IRUA 1Y6IA 3UT8A 3V31A 5EX3A 3Q4AB 4P29A 1O1SA 5KJNA 3ENEA 3ZGQA 3ZNGA 2IEJA 1UN8A 4Q96A 3S7FA 3ZU7B 4E6HA 3MKRA 4IULA 3CVNA 1ELWA 4FP7A 4J7WA 3LJNA 1G3NB 3TWQA 3ZHEA 3WG7E 3FUKA 3CVVA 3IV0A 2QY7A 2Q7FA 5D66A 2LUHA 5AN8A 2L9BA 3D9NA 3NF1A 5G2NA 4YVOA 1TNUA 1FPPA 2XEVA 1UG3A 2CHWA 4GPKA 2WM9A 3LDZA 4F53A 3UPVA 4N3CA 3RSEG 1QYMA 4JA7A 4NRHB 3CLJA 4B0ZA 3MKQA 4U8VD 3TGOA 2LAHA 1D8DA 3S7DA 3IBEA 3I4GA 5JA4D 3FTXA 2YHCA 2P9NG 4XE0A 3LKUA 1O5MA 3MV2B 4AOFA 4F1PA 4DX7D 4C9BB 4N2SA 2H6GA 1E8XA 5BUZA 3EHNA 3DSUA 4YDOA 2DYRE 2YQ8A 3QAQA 4J6IA 1HG5A 2P9PG 2VGXA 2ZIRA 1W3BA 3CHSA 4YVQC 4I6EA 3T9KA 2H6HA 2XRZA 1UW4B 1QQEA 4O6FA 3Q9NC 1WY6A 1A5EA 4Q69A 1H6KA 1GW6A 5BV0A 3K9IA 4GAAA 1OWOA 5KJKA 2F8XK 3ULEG 2KCKA 3TWUA 2ZGGA 4I1AA 3ZXPA 4K0RA 1KZOA 5AQ7A 3L08A 2V5FA 4G8KA 2IY0C 1OWPA 3QWVA 4FA6A 4JA9A 2VYIA 2WVIA 3BU8A 1IXVA 1LD8A 3CR3A 1SA5A 4GZ5A 5EYLA 5CCMA 4GTQA 4MRUA 4GTMA 2V0PA 4HOTA 2KCLA 2H6FA 5AJLA 2AJAA 4N2QA 4A3VA 5FT9A 1ZBPA 5D2MC 4UWGA 2GRNB 4XIFA 2C0LA 4HI9A 1HH8A 3PRZA 3ZEFA 4L1BA 2F8YA 4HFGA 4FJYA 4NACA 5LOZA 3CHPA 1MYOA 4MBGA 3RRMB 3FEYA 4GA0A 3ASDA 4PUCA 5FQ4A 3R7RA 4BTAA 4GMLA 5CHEE 2VTBB 1TJCA 3FH5A 3PUJA 5J08A 3Q47B 1TNZA 4RQIA 2AVPA 1WM5A 3U3WA 4I2ZA 2C2LA 4U96D 4DRXE 3LY7A 4G26A 3ABKE 4ZHBA 4GZCA 4JXTA 4UUCA 2MOWA 3CHRA 2J8SD 3P1UA 2XGOA 4GTVA 2IOSA 1OWMA 3ASFA 3FTUA 3E34A 4XX5A 3FUEA 3FTWA 3HXDA 4MS6A 4OAVB 1SZAA 2WXLA 3SD5A 2XCCA 1H6PA 1NL4A 3U9WA 3EUVA 4B8CB 2CG2A 4Q94A 4YDYA 4WUYA 4ANVA 5ENPD 2X6FA 2DZOA 4JPSA 5H7PA 3NB2A 1BLXB 1FVHA 2XPZA 3L17A 1E8WA 1UJJA 3AU4A 1JCQA 3SI5A 1NA3A 3FU5A 3PEUB 5JJ7A 2UWJG 4G2VA 2CG3A 3ZXSA 3R7QA 4CRWA 3L6AA 2GRLA 2WXRA 4ACLA 2LXMA 3E32A 3FH8A 4XZ4A 3CKCA 4ANXA 3PZ1A 1N9AA 2R03A 3JQ1A 1Z5SC 4TUMA 3GZ1A 4EZKA 1BD8A 4GU5A 4V3IA 3ONKA 4G24A 1ELRA 4I1OB 3EHRA 4KVMA 5HRYA 2QC9A 3FEXA 4KZ0A 1NA0A 5HI7A 3LVRE 4EZJA 2Y4TA 4WNFA 3N71A 3UM1A 4AEZC 4DJAA 3NBNB 1YMPA 4CCAA 2FO7A 3RRNB 3CHQA 2FF4A 2DWZA 3SFYA 1UN9A 4L7TA 1WG0A 3CVPA 3OXFA 3KD7A 1TNYA 1IQUA 3Q78A 1U2VG 3IEGA 4URKA 3Q7FA 4J8SA 3UINC 3FTSA 4DLQA 2I6HA 3ZYLA 1N54A 4HRMB 4U8YD 1TN7A 3I3NA 2CFUA 3NOGD 4A55A 4JEUA 3HIZA 2DZNA 2OEWA 3GZ2A 3W9FA 3HDXA 4YDEA 3IHYA 2WB2A 5ENTD 5LX8A 2V4LA 3DPDA 3B13A 3LPZA 4A1GA 4B8AA 3UIOC 4NQ0A 4J8FA 4Y6CA 2GRRB 1NZNA 3I4RB 4HORA 2A4ZA 3DSXA 5FTPA 3I5PA 3ZKJA 1UJKA 4U8HA 5C2YA 3DSVA 5ARGA 3CSFA 1N4RA 3PE3A 3BG0B 5FIOA 2P9UG 2JEKA 1PAQA 3FUHA 5KBAA 2VSNA 3EJNA 3JUIA 1DCQA 4L2LA 5G55A 2L0IA 2R17C 1OWLA 3CK8A 3PEVB 4CT4A 4GA1A 2WXPA 3CQCB 3UM3A 3FH7A 3U66A 3ZYMA 4U0SA 3FUMA 3UQ3A 2XS8A 4ACKA 3MX3A 4JHJA 5HQ8A 5CCLA 3DSTA 1SA4A 3TWXA 1D9SA 4LNBA 1KLXA 4J8DA 1N4PA 4I1MA 3PZDA 4GTSA 4CDMA 2EIJE 4GCOA 2KBXA 3KAEA 4HVBA 2Y69E 5EN5D 3UT7A 3R9AB 5JJ6A 4BT9A 4JL0A 2DYSE 2AXVA 1KPSB 3ASGA 1IHBA 5BV1A 4ATZD 5EIDA 4GYYA 3HYMB 3ISMC 3D9OA 3ZYKA 4B89A 3B7SA 3PNTB 4UQZA 1TNOA 4GB9A 4HOQA 1MJ0A 2P9SG 3AS8A 4HB5A 2WQ7A 4KBQA 1DVPA 5B1BE 5CRUA 3L82A 5CERB 2VGYA 4PS3A 3MYVA 1ZB1A 5CMYA 5ENOD 2NYJA 1S70B 4ILGA 2MYOA 1MX4A 4EBAG 4N5CA 3LCAA 1JWGA 4RVBA 1YCSB 3C3RA 4CYMD 3UT4A 2RKKA 3RIBA 3GZSA 2V8SE 2CFZA 3DSWA 2FEZA 4WNGA 4LNUD 4MLPA 4K5BA 2XEHA 4N5QA 4RG6A 4ANWA 3QC1A 2J9QA 1H2UA 4HRNA 4KZCA 4JB8P 5AIJA 1L5JA 3AG3E 4ME2A 2QYJA 2DIWA 3TG4A 3B7RL 3D9LA 2A5EA 4HQDA 3CVWA 2J07A 2OVBA 3RO2A 2I9CA 3J5PA 3QB2A 1K8KG 3ZFWA 2XEEA 5BXOA 3D9HA 1K1BA 4DX6D 5CBNA 4W9RA 4J0UA 1TYQG 4DLOA 1BPOA 2OVFA 2WXMA 3UMVA 4BX8A 5A23A 2PM7A 4U0UA 3ABLE 2XCBA 2LO6A 5KNHD 5EILA 1TJFA 3V2OA 3FTVA 1V54E 3LY9A 3OAWA 4YNDA 1H6OA 4AP2A 3JQ0A 2XS1A 3BG1B 1KZPA 2HM8A 4BTBA 3HXFA 4RG9A 3FU0A 5FINA 4U04A 3DPYA 3FUIA 4F1SA 4I2WA 2IONA 4OVUA 3LEWA 4EECA 3P2BA 3PZ4A 1H2VC 4EBAA 2WXOA 3D9MA 4CEMA 3SO8A 4U7EB 4N3AA 3QWPA 2OOEA 3G2UA 3OTNA 4GPMA 4BX9A 5EDSA 4GZ3A 1N52A 3PZ3A 5ENRD 1HU3A 2V5QC 2NXPA 4LCTA 1E7VA 3ML9A 1AP7A 3J5QB 2IFUA 1N4SA 3ABME 1N95A 4FHKA 3VLEA 4LG6A 3TXMA 5JHAA 3B7UX 4HXIA 2XZTG 3D9KA 1QZ2A 3JXIA 3QARA 3FUDA 2HO1A 2WXHA 4G8LA
chains in the Genus database with same CATH topology
2PQNA 4G11A 1KT1A 2KZTB 3Q5MA 3R7QA 5BPPA 3RJVA 3SBTB 2VSOE 3TAXA 2CHXA 4CRWA 5E75A 3L6AA 2GRLA 3ZYQA 2WXRA 4OVVA 4WWNA 4AY5A 4ACLA 2PM6A 5KJLA 2J08A 5FZSA 4APOA 2X6HA 4LRZA 4UI9J 3FH8A 4XZ4A 3D9IA 3JCKC 2I2OA 2XHEA 3FWVA 3CKCA 3S7BA 4ANXA 4AM9A 1IQRA 3JQ1A 5T8IA 3GZ1A 4EZKA 3EDTB 3QNKA 3QK0A 4GU5A 4V3IA 2VTBA 3Q15A 1INZA 4I6JA 3ONKA 4G24A 3G2SA 3FU3A 3CK7A 4WNEA 2LNIA 1ELRA 4I1OB 1H2TC 4KVMA 1DNPA 3FEXA 2FBNA 4JHRA 4JW1A 4UQYA 4CDNA 4XKCA 3O4ZA 3NQPA 3RKVA 4BT8A 5D0QD 1IHGA 2WQ6A 4KZ0A 1QNFA 1FVFA 3HVEA 4PH4B 1NA0A 3WXXA 4ILIA 5HI7A 5JHBA 3LVRE 3VLFA 4EZJA 2Y4TA 5E76A 2MHKA 4AXHA 2PL2A 4WNFA 1PY1A 2ILRA 3S7JA 3N71A 2BF0X 2JLBA 4JHKA 4AEZC 4DJAA 4ANUA 4CCAA 2FO7A 4D10C 3FUFA 2HYZA 2WXGA 3LS8A 3RRNB 4APFA 4AJWA 3CHQA 2FF4A 2AWIA 1UN9A 3QKYA 4L7TA 3ZIMA 1U3CA 3CVPA 4DI3A 2X6IA 3FUNA 3OXFA 4DPRA 3KD7A 3ULQA 4WWOA 3ZRHA 4KMOA 4ATGA 1Z3YA 4MKTA 4CGWA 1IQUA 3OXGA 3L22A 4FC8A 3IEGA 4M3OA 2J4DA 4URKA 3CVUA 4J8SA 2E0IA 3ASHA 3FTSA 2PZIA 2X3MA 1JUQA 3APCA 4FULA 4CDRA 3PNLB 5FWQA 2IOLA 5T4YA 4ABNA 1VDYA 4DLQA 5G04J 2I6HA 2XQ0A 3CIAA 3ZYLA 1N54A 4FHJA 3AS4A 2ZU6B 2WXKA 3I3NA 4A55A 2CFUA 4BY6A 4JEUA 3HIZA 3IHVA 5FZQA 4IRUA 3ZVVA 4BSXA 3GZ2A 3CEQA 1Y6IA 3UT8A 2YHEA 4JVSA 3U4TA 5EX3A 3HDXA 3Q4AB 4P29A 3LYAA 5KJNA 3ENEA 3PS6A 3IHYA 5FZRA 2WB2A 5EKQD 1H0AA 1XNFA 3ZN3A 3ZGQA 2NSZA 4H7XA 1S0PA 3G2WA 5FQ7A 5LX8A 1UN8A 3DBSA 4Q96A 3NZSA 3S7FA 2V4LA 4LEUA 3CKBA 5T3RA 1HS6A 4E6HA 2DCPA 2EQXA 3T5VA 3DPDA 3B13A 3MKRA 3LPZA 2KATA 2WXJA 4IULA 3CVNA 3ZHEB 4PDXA 3SFZA 3VLDA 1ELWA 4FP7A 4L2YA 4A1GA 3CVLA 4B8AA 2KCVA 2XGMA 4NQ0A 4J8FA 2E2EA 4HLEA 3ZHEA 5CMWA 3FUKA 2WPVA 5M72A 3CVVA 4BFRA 1JPLA 3IV0A 1TEZA 4Y6CA 2IU1A 3MA5A 1OUVA 3VTXA 2QY7A 2Q7FA 1MQSA 2L9BA 3D9NA 3NF1A 5G2NA 4YVOA 4FADA 3E4BA 2DBAA 1NZNA 2ONDA 3I4RB 4HORA 2XEVA 2A4ZA 3FTZA 4J8EA 3EIQC 5FTPA 1OWNA 1UG3A 3I5PA 3CVQA 2CHWA 4GPKA 1NP7A 2Y4UA 1UJKA 4U8HA 3Q49B 5C2YA 3TJPA 3TXNA 3C98A 5ARGA 4AY6A 2WM9A 3D9PA 3LDZA 3LXUX 3CSFA 3FHEA 2WMOA 3PE3A 3BG0B 2VSXE 2XPIA 3ZPJA 4A3TA 4F53A 4I9CA 2JEKA 1PAQA 3FUHA 3OXLA 3UPVA 2VSNA 4N3CA 3S2AA 3EJNA 3JUIA 4KXKB 4UQXA 3CK9A 2LAIA 2A5UA 4L2LA 5G55A 2L0IA 4I17A 4Y6WA 3FFLA 2R17C 1OWLA 3U64A 2UY1A 3CK8A 3PEVB 3GYZA 4CT4A 3ONLA 4JA7A 5LFAA 4NRHB 3FY4A 4B94A 4GA1A 2IF4A 2WXPA 3CLJA 3IKOB 4B0ZA 2KZTA 3CQCB 3FH7A 2UY1B 3MEKA 3ZYMA 3MKQA 4U0SA 3FUMA 3U66A 3TGOA 3UQ3A 4ACKA 1B89A 3MX3A 4JHJA 5HQ8A 2LAHA 5G05C 5CCLA 3BEEA 1PC2A 4EPZA 1WAO1 4BWRA 3FULA 4ILHB 3S7DA 3T8MA 2X6KA 2J49A 3I4GA 3IBEA 1EF1C 1KLXA 4J8DA 3FTXA 2YHCA 3CV0A 4I1MA 3APDA 3PZDA 4XE0A 4CDMA 4FLHA 3D9JA 5J90A 2M63A 3LKUA 4EQFA 3QJZA 4UI9K 3MV2B 4AOFA 4GCOA 4C9BB 4N2SA 3CHMA 3KAEA 2XRYA 1E8XA 4FU3A 5BUZA 4HVBA 4KYOB 3EHNA 5D0OD 2YQ8A 3QAQA 5DIZA 4I43A 3GW4A 4UWKA 2WXFA 3CGHA 2LSVA 4HS2A 4J6IA 3UT7A 1HG5A 3R9AB 2VGXA 5JJ6A 2RD0A 1W3BA 2AXZA 1HXIA 3CHSA 2FULA 3FP3A 4YVQC 4JL0A 4WAFA 4AV7A 4I6EA 4BT9A 3KS2A 2AXVA 5EX0A 3JYSA 5A7DB 5LCWJ 2XRZA 3ASGA 4KT6B 4XI0A 5BV1A 2BTDA 1UW4B 5FQ6A 4CT0A 3L54A 1QQEA 3URZA 4O6FA 3QDNA 1WY6A 4GMJA 3CVYA 1IYGA 3LY8A 4GYYA 3HYMB 1LF8A 3D9OA 3MV3B 3ZYKA 4Q69A 3SNXA 3B7SA 1H6KA 3PNTB 4UQZA 4B89A 4OYSA 4DI4A 3HVEB 4GB9A 5BT1A 1GW6A 2X38A 4HOQA 4QFVA 4JEHA 5DBKA 5BV0A 3K9IA 3CVXA 1Z6TA 4GAAA 1OWOA 5KJKA 3AS8A 5A6CA 3CHOA 3MZLB 5BNWA 2KCKA 4KBQA 1DVPA 2CHZA 5FJYA 2WQ7A 1JWFA 4I1AA 4K0RA 2VGYA 3QWWA 2VGXB 3SF4A 4PS3A 3MYVA 3L08A 2V5FA 4JZYA 5CMYA 4ILGA 1OWPA 4WWPA 2WXNA 4EBAG 4N5CA 3QWVA 4FA6A 3LCAA 4JA9A 1JWGA 2VYIA 4RVBA 1H19A 2VQ2A 4N3BA 3G2VA 4KVOA 5AJDA 3RRUA 3UT4A 2WVIA 3ESLA 3RIBA 3GZSA 3PH0C 5LP0A 3CR3A 2NC9A 4GZ5A 2V8SE 2L6JA 4R7LA 1YA0A 2CFZA 2FEZA 1EYHA 4WNGA 4I6GA 1HG2A 4E85A 4MLPA 5CCMA 4MRUA 1MHQA 4NURA 4CGVA 2V0PA 2YNQA 2LSUA 4RG6A 3TG5A 4ANWA 4HOTA 4GA2A 3QC1A 5KCMA 2J9QA 2L0TB 1H2UA 2KCLA 5AJLA 4KZCA 2VSYA 4IN3B 4N2QA 4A3VA 1A17A 4GZDA 5FT9A 4F3VA 5AIJA 4JC8A 4UI9C 3ZW3A 1HX8A 1L5JA 4ME2A 1ZBPA 3EIJA 4GYWA 3PREA 3NZUA 4TRQA 4EZLA 2DIWA 2IQCA 4HOUA 3PE4A 3ESKA 4UWGA 1E8ZA 3TG4A 4U0ZA 3B7RL 4F7AA 4XIFA 3HHMA 2C0LA 2R59A 1E90A 4L23A 4UWFA 2VJ8A 1U3DA 3D9LA 1HH8A 3PRZA 5ANLA 2R5SA 3CVWA 4PS7A 4PS8A 2J07A 2RG8A 2OVBA 3RO2A 2I9CA 3RK6A 5AENA 3ZEFA 4L1BA 4HFGA 4RSYA 4C0EA 3FDHA 3CSTA 4HOSA 3O48A 3QB2A 3ZFWA 4G2VA 2P58C 5FQ8A 4U07A 4UWLA 3MKQB 3G2TA 5G04C 5AYWD 1KT0A 3LJ3A 3SHFA 4K03A 4FJYA 2KM4A 2Y3AA 4NACA 5LOZA 3CQGB 3UX4A 4UWHA 3RU0A 3CHPA 2WXIA 4WNDA 4LUNU 2J4BA 2OV8A 3RRMB 4W9RA 4TV3A 4J0UA 4DLOA 1HO8A 1BPOA 2OVFA 3B7TA 2GGFA 4G23A 2XGSA 1SZ9A 2WXMA 2YINA 2MRIA 3UMVA 1HF8A 3FEYA 4BX8A 3FTYA 4GA0A 1XGWA 1X5BA 3ASDA 5A23A 5ENNA 4PUCA 5FQ4A 4AIFA 2PM7A 4U63A 3R7RA 4BTAA 4U0UA 4AVXA 2FI7A 2XCBA 4GMLA 2LO6A 5CHEE 5KJMA 2VTBB 5BW8C 3FUJA 1TJFA 3UUXA 3FTVA 3LY9A 3OAWA 1TJCA 2HR2A 3FH5A 3PUJA 5J08A 3Q47B 4YNDA 4AP2A 1HFAA 2AVPA 3JQ0A 1WM5A 2WXQA 3U3WA 3T5XA 2J09A 3BG1B 4I2ZA 2X6JA 2C2LA 2HM8A 5G05J 3LY7A 3AS5A 4BTBA 1E7UA 4I9EA 4G26A 4RG9A 3FU0A 5ARFA 4U04A 1FCHA 2AXUA 4GZCA 1E8YA 4JXTA 2QFCA 3FUIA 3MCXA 4N39A 3SGHA 4F1SA 4I2WA 3SBSA 2MOWA 3CHRA 2IONA 3P1UA 4GZ6A 4OVUA 2XGOA 5ANRA 2BUGA 1Z3XA 2GW1A 1SQMA 1E96B 3QOUA 3SZ7A 3LEWA 2IOSA 1EDUA 1OWMA 3ASFA 3FTUA 3MGBA 1EPUA 3VTYA 5JJTA 2AW6A 3FU6A 4XI9A 2GRMA 4EECA 4XX5A 3LVQE 3FUEA 3P2BA 3PUKA 4GCNA 1H2VC 3FTWA 4EBAA 2KC7A 4MS6A 2WXOA 3D9MA 1SZAA 2I1KA 3APFA 4A1SA 3D3MA 4CEMA 1ZU2A 2WXLA 4IYPA 4LERA 2WQHA 3SD5A 1Y8MA 4N3AA 1ELKA 2IJGX 2XCCA 3KEZA 4FLBA 3TL5A 3QWPA 3U9WA 4DK5A 4G25A 4G1TA 2OOEA 4B8CB 2CG2A 3ML8A 4Q94A 3G2UA 3OTNA 3EHMA 4H7YA 4WUYA 4ANVA 4BX9A 4GZ3A 5EDSA 3L16A 1N52A 2X6FA 2WMNA 2PQRA 4JPSA 4XKBA 1HZ4A 1HU3A 3AU5A 3PDNA 1FVHA 2NXPA 2XPZA 3PVLA 4LCTA 1E7VA 3ML9A 3RO3A 5LCWC 3L17A 2IFUA 2XPYA 1E8WA 1UJJA 4FHKA 4GYOA 3AU4A 3VLEA 3L13A 2C0MA 4C0MA 3SI5A 3TXMA 4FJZA 1NA3A 5C1DA 5JHAA 3B7UX 4HXIA 1HE8A 2I1JA 3MJWA 3FU5A 3PEUB 5JJ7A 1P5QA 3D9KA 1QZ2A 2UWJG 3QARA 2CG3A 3FUDA 2HO1A 2WXHA 3ZXSA 4TUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KAT A;  4GA0 A;  2PQN A;  4BT8 A;  3ASD A;  1KT1 A;  3MV3 B;  3Q5M A;  3CVN A;  3ZHE B;  4UQZ A;  3RJV A;  4AIF A;  3UPV A;  3TAX A;  1ELW A;  5BT1 A;  4BTA A;  3CVL A;  4HOQ A;  4U0U A;  5DBK A;  2FI7 A;  2XCB A;  2KCV A;  2XGM A;  3K9I A;  4NQ0 A;  5CHE E;  4AY5 A;  5KJM A;  4J8F A;  5KJK A;  5BW8 C;  2E2E A;  3AS8 A;  5A6C A;  5KJL A;  3ZHE A;  2WPV A;  3UUX A;  4APO A;  2KCK A;  4UI9 J;  5BNW A;  5M72 A;  3LY9 A;  4Y6C A;  1TJC A;  2HR2 A;  4KBQ A;  3MA5 A;  1OUV A;  3FWV A;  4I1A A;  5FJY A;  3CKC A;  3Q47 B;  4YND A;  3VTX A;  2AVP A;  2Q7F A;  1WM5 A;  3S7B A;  3NF1 A;  4YVO A;  4AM9 A;  3U3W A;  2VGY A;  2DBA A;  1NZN A;  2VGX B;  2OND A;  3E4B A;  3QWW A;  4I2Z A;  2XEV A;  3GZ1 A;  4J8E A;  2V5F A;  3SF4 A;  5FTP A;  3EDT B;  3MKR A;  2C2L A;  3CVQ A;  5G05 J;  3LY7 A;  3AS5 A;  4BTB A;  2Y4U A;  3Q15 A;  4GPK A;  3Q49 B;  4I9E A;  4N5C A;  3QWV A;  4G24 A;  3LCA A;  4G26 A;  4JA9 A;  2VYI A;  3CK7 A;  4RG9 A;  4WNE A;  5D0Q D;  5ARG A;  2LNI A;  4U04 A;  1ELR A;  1FCH A;  5ARF A;  2VQ2 A;  4N3B A;  3PE3 A;  2QFC A;  4AY6 A;  2XPI A;  3ZPJ A;  2FBN A;  4JHR A;  4N39 A;  4UQY A;  4I9C A;  4I2W A;  3RIB A;  3OXL A;  2NC9 A;  4GZ6 A;  4GZ5 A;  2L6J A;  1IHG A;  2XGO A;  2VSN A;  4N3C A;  1YA0 A;  2BUG A;  2GW1 A;  3QOU A;  1E96 B;  2FEZ A;  4GYY A;  4KXK B;  3CK9 A;  4UQX A;  3SZ7 A;  4WNG A;  1NA0 A;  3ASF A;  4I17 A;  4Y6W A;  5HI7 A;  3WXX A;  3FFL A;  3VTY A;  5CCM A;  5JJT A;  2Y4T A;  2UY1 A;  4XI9 A;  3CK8 A;  2MHK A;  2PL2 A;  4WNF A;  3GYZ A;  4CGV A;  2LSU A;  4JA7 A;  4RG6 A;  4GCN A;  4NRH B;  3TG5 A;  3S7J A;  4HOT A;  3N71 A;  4GA1 A;  2IF4 A;  2JLB A;  4GA2 A;  4B94 A;  2J9Q A;  2KC7 A;  2FO7 A;  2KCL A;  2UY1 B;  3MEK A;  4U0S A;  2HYZ A;  3UQ3 A;  3TGO A;  1B89 A;  2VSY A;  4IN3 B;  4N2Q A;  5HQ8 A;  4A1S A;  1A17 A;  5FT9 A;  5G05 C;  2FF4 A;  4F3V A;  5CCL A;  3QKY A;  4UI9 C;  3BEE A;  1ZU2 A;  3CVP A;  1PC2 A;  4ME2 A;  1WAO 1;  1ZBP A;  4BWR A;  2WQH A;  3OXF A;  4GYW A;  3S7D A;  1Y8M A;  3KD7 A;  4N3A A;  2XCC A;  4HOU A;  3ULQ A;  3PE4 A;  3ESK A;  1KLX A;  4J8D A;  3TG4 A;  2YHC A;  3QWP A;  3OXG A;  4U0Z A;  4XIF A;  3CV0 A;  2C0L A;  4CGW A;  4G25 A;  3IEG A;  4G1T A;  2OOE A;  1HH8 A;  3ASH A;  3LKU A;  2PZI A;  2R5S A;  4UI9 K;  4EQF A;  4H7Y A;  3MV2 B;  4GCO A;  4WUY A;  4CDR A;  4GZ3 A;  4N2S A;  3RO2 A;  3KAE A;  2PQR A;  3RKV A;  4ABN A;  5G04 J;  2I6H A;  1HZ4 A;  4KYO B;  3PDN A;  4HOS A;  3O48 A;  3RO3 A;  3AS4 A;  2YQ8 A;  5D0O D;  5DIZ A;  2P58 C;  3ZFW A;  5LCW C;  4U07 A;  3GW4 A;  2IFU A;  2LSV A;  5G04 C;  5AYW D;  1KT0 A;  5FZQ A;  3R9A B;  3GZ2 A;  3CEQ A;  2VGX A;  4GYO A;  5JJ6 A;  2C0M A;  3U4T A;  1W3B A;  3Q4A B;  1HXI A;  3FP3 A;  5EX3 A;  3RU0 A;  4WND A;  3LYA A;  4JL0 A;  4YVQ C;  4BT9 A;  5KJN A;  3KS2 A;  1NA3 A;  5FZR A;  4W9R A;  5C1D A;  4HOR A;  5EKQ D;  1XNF A;  5EX0 A;  4J0U A;  3JYS A;  5A7D B;  3ZN3 A;  3ZGQ A;  5LCW J;  5JJ7 A;  4H7X A;  3ASG A;  1P5Q A;  4G23 A;  4XI0 A;  2XGS A;  1QZ2 A;  1QQE A;  3URZ A;  4O6F A;  3QDN A;  3S7F A;  2UWJ G;  4LEU A;  3CKB A;  1IYG A;  4G2V A;  3LY8 A;  2HO1 A;  3HYM B;  3LPZ A;  5FZS A; 
#chains in the Genus database with same CATH topology
 4G11 A;  3E37 A;  3Q5M A;  3TAX A;  5E75 A;  4WWN A;  1K3Z D;  3D9I A;  2I2O A;  2XHE A;  4AM9 A;  3TWT A;  4HNA D;  2F0Y A;  3NOC D;  3QNK A;  1IKN D;  2LXL A;  4I6J A;  5ENQ D;  3G2S A;  3FU3 A;  3CK7 A;  3TWR A;  4BET A;  1OY3 D;  1N0Q A;  1DNP A;  4XKC A;  3TWW A;  3O4Z A;  3NQP A;  3RKV A;  1JCS A;  5D0Q D;  1IHG A;  1QNF A;  5BXU A;  3WXX A;  4ILI A;  5E76 A;  4AXH A;  2PL2 A;  3S7J A;  2JLB A;  4D10 C;  3R9M A;  2XEN A;  4APF A;  2WXG A;  2VGE A;  4AJW A;  4YDW A;  1U3C A;  2B6C A;  4DPR A;  1NI1 A;  4ATG A;  3ZRH A;  4MKT A;  4CGW A;  3CVU A;  5KNG A;  1JUQ A;  1TN6 A;  4JD2 G;  5HS0 A;  5T4Y A;  4ABN A;  1VDY A;  5G04 J;  2XQ0 A;  3CIA A;  1OCC E;  1UOH A;  5B3S E;  5FZQ A;  4BSX A;  3CEQ A;  3Q73 A;  3LYA A;  4HBD A;  5FZR A;  1OXJ A;  5EKQ D;  1H0A A;  1XNF A;  2ETC A;  2R05 A;  3ZN3 A;  1DCE A;  3G2W A;  5FQ7 A;  4TXR A;  3NZS A;  4LEU A;  3CKB A;  2DCP A;  2EQX A;  3T5V A;  4PDX A;  3SFZ A;  3VLD A;  4L2Y A;  2KCV A;  2XGM A;  2E2E A;  1LD7 A;  5CMW A;  3E33 A;  5M72 A;  1TN8 A;  1JPL A;  3T8K A;  3AJI A;  3B7B A;  3VTX A;  4FAD A;  2IO3 C;  2OND A;  3FTZ A;  4J8E A;  3EIQ C;  1OWN A;  3CVQ A;  3TJP A;  3TXN A;  4AY6 A;  3UM2 A;  2WMO A;  4A3T A;  3HXC A;  3OXL A;  4KXK B;  3CK9 A;  5ITZ F;  2LAI A;  4I17 A;  3U64 A;  2UY1 A;  3C3Q A;  5LFA A;  3FY4 A;  4TXP A;  5CEC B;  5CED B;  3MEK A;  5G05 C;  5AQB A;  3BEE A;  2P9L G;  1PC2 A;  4EPZ A;  1WAO 1;  3E30 A;  4BEP A;  3T8M A;  2X6K A;  2J49 A;  3HXE A;  3KSQ A;  1EF1 C;  3KSL A;  3CV0 A;  3APD A;  3C3O A;  5J90 A;  3D9J A;  4EQF A;  2KXP C;  3CHM A;  4DX1 A;  2XRY A;  4FU3 A;  5D0O D;  4I43 A;  3GW4 A;  4UWK A;  2WXF A;  3HRA A;  2RD0 A;  2AXZ A;  1HXI A;  3FP3 A;  2FUL A;  2ETA A;  3JYS A;  3KEA A;  4KT6 B;  3BUA A;  4XI0 A;  2BTD A;  4O1P A;  4CT0 A;  3URZ A;  3QDN A;  1IYG A;  3LY8 A;  3SY2 A;  1LF8 A;  2BKK B;  4OYS A;  3HVE B;  2X38 A;  4JEH A;  5DBK A;  1Z6T A;  1S64 A;  1FT1 A;  3UTM A;  5KWD A;  2CHZ A;  5FJY A;  4XEI G;  3C5R A;  1RZ4 A;  4L9P A;  3QWW A;  2EIM E;  3SF4 A;  1O1R A;  4WWP A;  2WXN A;  1H19 A;  2VQ2 A;  3G2V A;  4KVO A;  5AJD A;  3ESL A;  5LP0 A;  2NC9 A;  2L6J A;  1YA0 A;  4DX2 A;  4I6G A;  1HG2 A;  1MHQ A;  4CGV A;  2LSU A;  4GA2 A;  5AQA A;  5KCM A;  2OCC E;  2L0T B;  4IN3 B;  3Q79 A;  3ZUV B;  2R2L A;  4JC8 A;  3DSS A;  3ZW3 A;  1HX8 A;  2Y0B G;  3EIJ A;  4GYW A;  3PRE A;  3NZU A;  4TRQ A;  4EZL A;  1E8Z A;  4U0Z A;  1E90 A;  2VJ8 A;  1U3D A;  2R5S A;  4PS7 A;  4PS8 A;  5AEN A;  3RK6 A;  1K1A A;  4RSY A;  2B0O E;  3CST A;  2P58 C;  5FQ8 A;  4U07 A;  4UWL A;  3V2X A;  3G2T A;  5AYW D;  1KT0 A;  4K03 A;  2Y3A A;  1BI7 B;  1O1T A;  4WND A;  1HO8 A;  3B7T A;  2GGF A;  4G23 A;  1SZ9 A;  4ZFH A;  2MRI A;  1HF8 A;  5AQ9 A;  3FTY A;  5AAR A;  3Q7A A;  4U63 A;  3HG0 D;  2FI7 A;  5KJM A;  5BW8 C;  2EIK E;  2WXQ A;  4GTO A;  4HI8 A;  3AS5 A;  4I9E A;  4X8Q A;  1FCH A;  2AXU A;  1E8Y A;  2QFC A;  1OCR E;  3MCX A;  4N39 A;  3SBS A;  3L9T A;  1OCZ E;  2BUG A;  1Z3X A;  2GW1 A;  3UIP C;  1EDU A;  1EPU A;  3VTY A;  3FU6 A;  4XI9 A;  4A63 B;  2GRM A;  3LVQ E;  4GCN A;  2KC7 A;  1WDY A;  2R02 A;  4A1S A;  4DUI A;  3D3M A;  1ZU2 A;  2L6B A;  1Y8M A;  1ELK A;  2IJG X;  3KEZ A;  3TL5 A;  4DK5 A;  4G25 A;  3ULY A;  3ML8 A;  4H7Y A;  1TR4 A;  5CBO A;  2PQR A;  3AAA C;  4XKB A;  1YYH A;  3PDN A;  4GMR A;  2XPY A;  3DEP A;  3X2Q E;  3L13 A;  5AAO A;  2P9I G;  3DRA A;  5C1D A;  1HE8 A;  1P5Q A;  3B95 A;  4GTR A;  5FZS A;  2PQN A;  3DWL G;  1KT1 A;  4RLY A;  2KZT B;  3AG4 E;  3SQV A;  5BPP A;  3RJV A;  2PNN A;  4AY5 A;  5KJL A;  1RW2 A;  2J08 A;  2X6H A;  4UI9 J;  3JCK C;  4K5C A;  3FWV A;  3S7B A;  1IQR A;  5T8I A;  3UXG A;  3ASN E;  3EDT B;  2BED A;  3Q15 A;  1INZ A;  4WNE A;  4JW1 A;  4JHR A;  4UQY A;  2WQ6 A;  5EIB E;  4PH4 B;  5JHB A;  3VLF A;  1NFI E;  2ILR A;  4JHK A;  4ANU A;  2ZXW E;  3FUF A;  4CZ2 D;  2QZA A;  2DVW A;  2AWI A;  3ZIM A;  4DI3 A;  3ULQ A;  4KMO A;  1Z3Y A;  3OXG A;  3BQO A;  4EHM A;  2X3M A;  3APC A;  3DEO A;  3PZ2 A;  4O1O A;  4CDR A;  2IOL A;  1SVX A;  4FHJ A;  3AS4 A;  4BSZ B;  2WXK A;  3AG2 E;  3ZVV A;  1FT2 A;  2YHE A;  4JVS A;  5EYP F;  3U4T A;  3PS6 A;  4BES A;  5CRV A;  3EU9 A;  1JCR A;  4OAU C;  4LNG A;  2NSZ A;  4H7X A;  1S0P A;  3DBS A;  5T3R A;  1HS6 A;  2KAT A;  4TXQ A;  2WXJ A;  3ZHE B;  3CVL A;  4DX5 D;  4U95 D;  4HLE A;  2WPV A;  4BFR A;  1TEZ A;  2IU1 A;  3MA5 A;  1OUV A;  1MQS A;  3HXB A;  2DBA A;  3E4B A;  2V4H C;  1NP7 A;  2Y4U A;  3Q49 B;  3C98 A;  3Q9U C;  2ETB A;  3D9P A;  3LXU X;  3FHE A;  2VSX E;  2XPI A;  3ZPJ A;  4I9C A;  3S2A A;  4UQX A;  2A5U A;  4QQI A;  4Y6W A;  3FFL A;  1QBQ A;  3GYZ A;  3ONL A;  4B94 A;  2IF4 A;  3IKO B;  2KZT A;  2UY1 B;  1B89 A;  1N4Q A;  5IY5 E;  2RFM A;  3TWS A;  2P9K G;  4BWR A;  3FUL A;  4ILH B;  4GTP A;  2Y1L E;  4FLH A;  2M63 A;  3QJZ A;  4UI9 K;  3DXK G;  1BI8 B;  4KYO B;  5DIZ A;  2BKG A;  3CGH A;  2LSV A;  4HLL A;  4HS2 A;  3IXE A;  2GRQ B;  2XZD G;  4WAF A;  4AV7 A;  3KS2 A;  1TNB A;  1N94 A;  5EX0 A;  5A7D B;  5LCW J;  5FQ6 A;  3L54 A;  4GMJ A;  3CVY A;  1D8E A;  3MV3 B;  1MX6 A;  4LSZ E;  3SNX A;  4DI4 A;  2EIL E;  5BT1 A;  4QFV A;  1SW6 A;  3CVX A;  2ZGD A;  5A6C A;  3CHO A;  3MZL B;  5BNW A;  1BU9 A;  1JWF A;  1DC2 A;  2VGX B;  4JZY A;  4M7C A;  4N3B A;  3RRU A;  3PH0 C;  4R7L A;  1EYH A;  2H6I A;  4E85 A;  4J8Y A;  3EHQ A;  4NUR A;  1N0R A;  2YNQ A;  3TG5 A;  1AWC B;  2VSY A;  1A17 A;  4GZD A;  4F3V A;  4UI9 C;  3C72 A;  5CEA A;  2IQC A;  4HOU A;  3PE4 A;  3ESK A;  4F7A A;  3HHM A;  2R59 A;  4L23 A;  4UWF A;  5ANL A;  2RG8 A;  3SFX A;  4C0E A;  3FDH A;  4HOS A;  1X81 A;  3O48 A;  3NAW A;  4NIK A;  3MKQ B;  3TWV A;  3EU5 A;  5G04 C;  3LJ3 A;  3SHF A;  2KM4 A;  3CQG B;  5ENS D;  3UX4 A;  2P2C P;  4UWH A;  3RU0 A;  2WXI A;  4LUN U;  2J4B A;  2OV8 A;  3UKU G;  4TV3 A;  2FO1 E;  2XGS A;  2YIN A;  1XGW A;  1X5B A;  1MZC A;  5ENN A;  4AIF A;  4AVX A;  3FUJ A;  3UUX A;  2HR2 A;  1S63 A;  1HFA A;  5JMN D;  3T5X A;  2ZIS A;  2J09 A;  2EIN E;  2X6J A;  1Q2Z A;  5G05 J;  1E7U A;  4K5A B;  5ARF A;  2GRO B;  3SGH A;  4GZ6 A;  5ANR A;  3QOU A;  1SQM A;  1E96 B;  3SZ7 A;  4O60 A;  3MGB A;  5JJT A;  2AW6 A;  3JUE A;  3W9G A;  3PUK A;  3RAU A;  1OT8 A;  3F6Q A;  1MX2 A;  1N11 A;  2I1K A;  3APF A;  4IYP A;  4LER A;  3JXJ A;  4HRL A;  2WQH A;  5HKP A;  4FLB A;  4G1T A;  1V55 E;  3V30 A;  3EHM A;  3L16 A;  4Z68 A;  2WMN A;  1HZ4 A;  3AU5 A;  3PVL A;  3RO3 A;  5LCW C;  4GYO A;  2C0M A;  4C0M A;  2OEV A;  4FJZ A;  2I1J A;  3MJW A;  4F6R D;  4TUU A;  3UM0 A;  3Q75 A;  1OCO E;  3SBT B;  2VSO E;  2CHX A;  2RFA A;  3ZYQ A;  4B93 B;  4OVV A;  3AG1 E;  2PM6 A;  4APO A;  4LRZ A;  3ASO E;  2GRP B;  3QK0 A;  2VTB A;  3V79 K;  2LNI A;  4GTT A;  1H2T C;  2FBN A;  4CDN A;  4BT8 A;  1FVF A;  3HVE A;  4C48 B;  2QYU A;  2MHK A;  1PY1 A;  3UI2 A;  2BF0 X;  2HYZ A;  3LS8 A;  3DXM G;  3QKY A;  2X6I A;  3FUN A;  4WWO A;  2JAB A;  5B1A E;  3L22 A;  4FC8 A;  4M3O A;  2J4D A;  2IO2 C;  2E0I A;  3ASH A;  2PZI A;  4BER A;  4FUL A;  3PNL B;  5FWQ A;  2F37 A;  2ZU6 B;  2HE0 A;  4BY6 A;  3UKR G;  3IHV A;  1LTX A;  4IRU A;  1Y6I A;  3UT8 A;  3V31 A;  5EX3 A;  3Q4A B;  4P29 A;  1O1S A;  5KJN A;  3ENE A;  3ZGQ A;  3ZNG A;  2IEJ A;  1UN8 A;  4Q96 A;  3S7F A;  3ZU7 B;  4E6H A;  3MKR A;  4IUL A;  3CVN A;  1ELW A;  4FP7 A;  4J7W A;  3LJN A;  1G3N B;  3TWQ A;  3ZHE A;  3WG7 E;  3FUK A;  3CVV A;  3IV0 A;  2QY7 A;  2Q7F A;  5D66 A;  2LUH A;  5AN8 A;  2L9B A;  3D9N A;  3NF1 A;  5G2N A;  4YVO A;  1TNU A;  1FPP A;  2XEV A;  1UG3 A;  2CHW A;  4GPK A;  2WM9 A;  3LDZ A;  4F53 A;  3UPV A;  4N3C A;  3RSE G;  1QYM A;  4JA7 A;  4NRH B;  3CLJ A;  4B0Z A;  3MKQ A;  4U8V D;  3TGO A;  2LAH A;  1D8D A;  3S7D A;  3IBE A;  3I4G A;  5JA4 D;  3FTX A;  2YHC A;  2P9N G;  4XE0 A;  3LKU A;  1O5M A;  3MV2 B;  4AOF A;  4F1P A;  4DX7 D;  4C9B B;  4N2S A;  2H6G A;  1E8X A;  5BUZ A;  3EHN A;  3DSU A;  4YDO A;  2DYR E;  2YQ8 A;  3QAQ A;  4J6I A;  1HG5 A;  2P9P G;  2VGX A;  2ZIR A;  1W3B A;  3CHS A;  4YVQ C;  4I6E A;  3T9K A;  2H6H A;  2XRZ A;  1UW4 B;  1QQE A;  4O6F A;  3Q9N C;  1WY6 A;  1A5E A;  4Q69 A;  1H6K A;  1GW6 A;  5BV0 A;  3K9I A;  4GAA A;  1OWO A;  5KJK A;  2F8X K;  3ULE G;  2KCK A;  3TWU A;  2ZGG A;  4I1A A;  3ZXP A;  4K0R A;  1KZO A;  5AQ7 A;  3L08 A;  2V5F A;  4G8K A;  2IY0 C;  1OWP A;  3QWV A;  4FA6 A;  4JA9 A;  2VYI A;  2WVI A;  3BU8 A;  1IXV A;  1LD8 A;  3CR3 A;  1SA5 A;  4GZ5 A;  5EYL A;  5CCM A;  4GTQ A;  4MRU A;  4GTM A;  2V0P A;  4HOT A;  2KCL A;  2H6F A;  5AJL A;  2AJA A;  4N2Q A;  4A3V A;  5FT9 A;  1ZBP A;  5D2M C;  4UWG A;  2GRN B;  4XIF A;  2C0L A;  4HI9 A;  1HH8 A;  3PRZ A;  3ZEF A;  4L1B A;  2F8Y A;  4HFG A;  4FJY A;  4NAC A;  5LOZ A;  3CHP A;  1MYO A;  4MBG A;  3RRM B;  3FEY A;  4GA0 A;  3ASD A;  4PUC A;  5FQ4 A;  3R7R A;  4BTA A;  4GML A;  5CHE E;  2VTB B;  1TJC A;  3FH5 A;  3PUJ A;  5J08 A;  3Q47 B;  1TNZ A;  4RQI A;  2AVP A;  1WM5 A;  3U3W A;  4I2Z A;  2C2L A;  4U96 D;  4DRX E;  3LY7 A;  4G26 A;  3ABK E;  4ZHB A;  4GZC A;  4JXT A;  4UUC A;  2MOW A;  3CHR A;  2J8S D;  3P1U A;  2XGO A;  4GTV A;  2IOS A;  1OWM A;  3ASF A;  3FTU A;  3E34 A;  4XX5 A;  3FUE A;  3FTW A;  3HXD A;  4MS6 A;  4OAV B;  1SZA A;  2WXL A;  3SD5 A;  2XCC A;  1H6P A;  1NL4 A;  3U9W A;  3EUV A;  4B8C B;  2CG2 A;  4Q94 A;  4YDY A;  4WUY A;  4ANV A;  5ENP D;  2X6F A;  2DZO A;  4JPS A;  5H7P A;  3NB2 A;  1BLX B;  1FVH A;  2XPZ A;  3L17 A;  1E8W A;  1UJJ A;  3AU4 A;  1JCQ A;  3SI5 A;  1NA3 A;  3FU5 A;  3PEU B;  5JJ7 A;  2UWJ G;  4G2V A;  2CG3 A;  3ZXS A;  3R7Q A;  4CRW A;  3L6A A;  2GRL A;  2WXR A;  4ACL A;  2LXM A;  3E32 A;  3FH8 A;  4XZ4 A;  3CKC A;  4ANX A;  3PZ1 A;  1N9A A;  2R03 A;  3JQ1 A;  1Z5S C;  4TUM A;  3GZ1 A;  4EZK A;  1BD8 A;  4GU5 A;  4V3I A;  3ONK A;  4G24 A;  1ELR A;  4I1O B;  3EHR A;  4KVM A;  5HRY A;  2QC9 A;  3FEX A;  4KZ0 A;  1NA0 A;  5HI7 A;  3LVR E;  4EZJ A;  2Y4T A;  4WNF A;  3N71 A;  3UM1 A;  4AEZ C;  4DJA A;  3NBN B;  1YMP A;  4CCA A;  2FO7 A;  3RRN B;  3CHQ A;  2FF4 A;  2DWZ A;  3SFY A;  1UN9 A;  4L7T A;  1WG0 A;  3CVP A;  3OXF A;  3KD7 A;  1TNY A;  1IQU A;  3Q78 A;  1U2V G;  3IEG A;  4URK A;  3Q7F A;  4J8S A;  3UIN C;  3FTS A;  4DLQ A;  2I6H A;  3ZYL A;  1N54 A;  4HRM B;  4U8Y D;  1TN7 A;  3I3N A;  2CFU A;  3NOG D;  4A55 A;  4JEU A;  3HIZ A;  2DZN A;  2OEW A;  3GZ2 A;  3W9F A;  3HDX A;  4YDE A;  3IHY A;  2WB2 A;  5ENT D;  5LX8 A;  2V4L A;  3DPD A;  3B13 A;  3LPZ A;  4A1G A;  4B8A A;  3UIO C;  4NQ0 A;  4J8F A;  4Y6C A;  2GRR B;  1NZN A;  3I4R B;  4HOR A;  2A4Z A;  3DSX A;  5FTP A;  3I5P A;  3ZKJ A;  1UJK A;  4U8H A;  5C2Y A;  3DSV A;  5ARG A;  3CSF A;  1N4R A;  3PE3 A;  3BG0 B;  5FIO A;  2P9U G;  2JEK A;  1PAQ A;  3FUH A;  5KBA A;  2VSN A;  3EJN A;  3JUI A;  1DCQ A;  4L2L A;  5G55 A;  2L0I A;  2R17 C;  1OWL A;  3CK8 A;  3PEV B;  4CT4 A;  4GA1 A;  2WXP A;  3CQC B;  3UM3 A;  3FH7 A;  3U66 A;  3ZYM A;  4U0S A;  3FUM A;  3UQ3 A;  2XS8 A;  4ACK A;  3MX3 A;  4JHJ A;  5HQ8 A;  5CCL A;  3DST A;  1SA4 A;  3TWX A;  1D9S A;  4LNB A;  1KLX A;  4J8D A;  1N4P A;  4I1M A;  3PZD A;  4GTS A;  4CDM A;  2EIJ E;  4GCO A;  2KBX A;  3KAE A;  4HVB A;  2Y69 E;  5EN5 D;  3UT7 A;  3R9A B;  5JJ6 A;  4BT9 A;  4JL0 A;  2DYS E;  2AXV A;  1KPS B;  3ASG A;  1IHB A;  5BV1 A;  4ATZ D;  5EID A;  4GYY A;  3HYM B;  3ISM C;  3D9O A;  3ZYK A;  4B89 A;  3B7S A;  3PNT B;  4UQZ A;  1TNO A;  4GB9 A;  4HOQ A;  1MJ0 A;  2P9S G;  3AS8 A;  4HB5 A;  2WQ7 A;  4KBQ A;  1DVP A;  5B1B E;  5CRU A;  3L82 A;  5CER B;  2VGY A;  4PS3 A;  3MYV A;  1ZB1 A;  5CMY A;  5ENO D;  2NYJ A;  1S70 B;  4ILG A;  2MYO A;  1MX4 A;  4EBA G;  4N5C A;  3LCA A;  1JWG A;  4RVB A;  1YCS B;  3C3R A;  4CYM D;  3UT4 A;  2RKK A;  3RIB A;  3GZS A;  2V8S E;  2CFZ A;  3DSW A;  2FEZ A;  4WNG A;  4LNU D;  4MLP A;  4K5B A;  2XEH A;  4N5Q A;  4RG6 A;  4ANW A;  3QC1 A;  2J9Q A;  1H2U A;  4HRN A;  4KZC A;  4JB8 P;  5AIJ A;  1L5J A;  3AG3 E;  4ME2 A;  2QYJ A;  2DIW A;  3TG4 A;  3B7R L;  3D9L A;  2A5E A;  4HQD A;  3CVW A;  2J07 A;  2OVB A;  3RO2 A;  2I9C A;  3J5P A;  3QB2 A;  1K8K G;  3ZFW A;  2XEE A;  5BXO A;  3D9H A;  1K1B A;  4DX6 D;  5CBN A;  4W9R A;  4J0U A;  1TYQ G;  4DLO A;  1BPO A;  2OVF A;  2WXM A;  3UMV A;  4BX8 A;  5A23 A;  2PM7 A;  4U0U A;  3ABL E;  2XCB A;  2LO6 A;  5KNH D;  5EIL A;  1TJF A;  3V2O A;  3FTV A;  1V54 E;  3LY9 A;  3OAW A;  4YND A;  1H6O A;  4AP2 A;  3JQ0 A;  2XS1 A;  3BG1 B;  1KZP A;  2HM8 A;  4BTB A;  3HXF A;  4RG9 A;  3FU0 A;  5FIN A;  4U04 A;  3DPY A;  3FUI A;  4F1S A;  4I2W A;  2ION A;  4OVU A;  3LEW A;  4EEC A;  3P2B A;  3PZ4 A;  1H2V C;  4EBA A;  2WXO A;  3D9M A;  4CEM A;  3SO8 A;  4U7E B;  4N3A A;  3QWP A;  2OOE A;  3G2U A;  3OTN A;  4GPM A;  4BX9 A;  5EDS A;  4GZ3 A;  1N52 A;  3PZ3 A;  5ENR D;  1HU3 A;  2V5Q C;  2NXP A;  4LCT A;  1E7V A;  3ML9 A;  1AP7 A;  3J5Q B;  2IFU A;  1N4S A;  3ABM E;  1N95 A;  4FHK A;  3VLE A;  4LG6 A;  3TXM A;  5JHA A;  3B7U X;  4HXI A;  2XZT G;  3D9K A;  1QZ2 A;  3JXI A;  3QAR A;  3FUD A;  2HO1 A;  2WXH A;  4G8L A; 
#chains in the Genus database with same CATH homology
 2PQN A;  4G11 A;  1KT1 A;  2KZT B;  3Q5M A;  3R7Q A;  5BPP A;  3RJV A;  3SBT B;  2VSO E;  3TAX A;  2CHX A;  4CRW A;  5E75 A;  3L6A A;  2GRL A;  3ZYQ A;  2WXR A;  4OVV A;  4WWN A;  4AY5 A;  4ACL A;  2PM6 A;  5KJL A;  2J08 A;  5FZS A;  4APO A;  2X6H A;  4LRZ A;  4UI9 J;  3FH8 A;  4XZ4 A;  3D9I A;  3JCK C;  2I2O A;  2XHE A;  3FWV A;  3CKC A;  3S7B A;  4ANX A;  4AM9 A;  1IQR A;  3JQ1 A;  5T8I A;  3GZ1 A;  4EZK A;  3EDT B;  3QNK A;  3QK0 A;  4GU5 A;  4V3I A;  2VTB A;  3Q15 A;  1INZ A;  4I6J A;  3ONK A;  4G24 A;  3G2S A;  3FU3 A;  3CK7 A;  4WNE A;  2LNI A;  1ELR A;  4I1O B;  1H2T C;  4KVM A;  1DNP A;  3FEX A;  2FBN A;  4JHR A;  4JW1 A;  4UQY A;  4CDN A;  4XKC A;  3O4Z A;  3NQP A;  3RKV A;  4BT8 A;  5D0Q D;  1IHG A;  2WQ6 A;  4KZ0 A;  1QNF A;  1FVF A;  3HVE A;  4PH4 B;  1NA0 A;  3WXX A;  4ILI A;  5HI7 A;  5JHB A;  3LVR E;  3VLF A;  4EZJ A;  2Y4T A;  5E76 A;  2MHK A;  4AXH A;  2PL2 A;  4WNF A;  1PY1 A;  2ILR A;  3S7J A;  3N71 A;  2BF0 X;  2JLB A;  4JHK A;  4AEZ C;  4DJA A;  4ANU A;  4CCA A;  2FO7 A;  4D10 C;  3FUF A;  2HYZ A;  2WXG A;  3LS8 A;  3RRN B;  4APF A;  4AJW A;  3CHQ A;  2FF4 A;  2AWI A;  1UN9 A;  3QKY A;  4L7T A;  3ZIM A;  1U3C A;  3CVP A;  4DI3 A;  2X6I A;  3FUN A;  3OXF A;  4DPR A;  3KD7 A;  3ULQ A;  4WWO A;  3ZRH A;  4KMO A;  4ATG A;  1Z3Y A;  4MKT A;  4CGW A;  1IQU A;  3OXG A;  3L22 A;  4FC8 A;  3IEG A;  4M3O A;  2J4D A;  4URK A;  3CVU A;  4J8S A;  2E0I A;  3ASH A;  3FTS A;  2PZI A;  2X3M A;  1JUQ A;  3APC A;  4FUL A;  4CDR A;  3PNL B;  5FWQ A;  2IOL A;  5T4Y A;  4ABN A;  1VDY A;  4DLQ A;  5G04 J;  2I6H A;  2XQ0 A;  3CIA A;  3ZYL A;  1N54 A;  4FHJ A;  3AS4 A;  2ZU6 B;  2WXK A;  3I3N A;  4A55 A;  2CFU A;  4BY6 A;  4JEU A;  3HIZ A;  3IHV A;  5FZQ A;  4IRU A;  3ZVV A;  4BSX A;  3GZ2 A;  3CEQ A;  1Y6I A;  3UT8 A;  2YHE A;  4JVS A;  3U4T A;  5EX3 A;  3HDX A;  3Q4A B;  4P29 A;  3LYA A;  5KJN A;  3ENE A;  3PS6 A;  3IHY A;  5FZR A;  2WB2 A;  5EKQ D;  1H0A A;  1XNF A;  3ZN3 A;  3ZGQ A;  2NSZ A;  4H7X A;  1S0P A;  3G2W A;  5FQ7 A;  5LX8 A;  1UN8 A;  3DBS A;  4Q96 A;  3NZS A;  3S7F A;  2V4L A;  4LEU A;  3CKB A;  5T3R A;  1HS6 A;  4E6H A;  2DCP A;  2EQX A;  3T5V A;  3DPD A;  3B13 A;  3MKR A;  3LPZ A;  2KAT A;  2WXJ A;  4IUL A;  3CVN A;  3ZHE B;  4PDX A;  3SFZ A;  3VLD A;  1ELW A;  4FP7 A;  4L2Y A;  4A1G A;  3CVL A;  4B8A A;  2KCV A;  2XGM A;  4NQ0 A;  4J8F A;  2E2E A;  4HLE A;  3ZHE A;  5CMW A;  3FUK A;  2WPV A;  5M72 A;  3CVV A;  4BFR A;  1JPL A;  3IV0 A;  1TEZ A;  4Y6C A;  2IU1 A;  3MA5 A;  1OUV A;  3VTX A;  2QY7 A;  2Q7F A;  1MQS A;  2L9B A;  3D9N A;  3NF1 A;  5G2N A;  4YVO A;  4FAD A;  3E4B A;  2DBA A;  1NZN A;  2OND A;  3I4R B;  4HOR A;  2XEV A;  2A4Z A;  3FTZ A;  4J8E A;  3EIQ C;  5FTP A;  1OWN A;  1UG3 A;  3I5P A;  3CVQ A;  2CHW A;  4GPK A;  1NP7 A;  2Y4U A;  1UJK A;  4U8H A;  3Q49 B;  5C2Y A;  3TJP A;  3TXN A;  3C98 A;  5ARG A;  4AY6 A;  2WM9 A;  3D9P A;  3LDZ A;  3LXU X;  3CSF A;  3FHE A;  2WMO A;  3PE3 A;  3BG0 B;  2VSX E;  2XPI A;  3ZPJ A;  4A3T A;  4F53 A;  4I9C A;  2JEK A;  1PAQ A;  3FUH A;  3OXL A;  3UPV A;  2VSN A;  4N3C A;  3S2A A;  3EJN A;  3JUI A;  4KXK B;  4UQX A;  3CK9 A;  2LAI A;  2A5U A;  4L2L A;  5G55 A;  2L0I A;  4I17 A;  4Y6W A;  3FFL A;  2R17 C;  1OWL A;  3U64 A;  2UY1 A;  3CK8 A;  3PEV B;  3GYZ A;  4CT4 A;  3ONL A;  4JA7 A;  5LFA A;  4NRH B;  3FY4 A;  4B94 A;  4GA1 A;  2IF4 A;  2WXP A;  3CLJ A;  3IKO B;  4B0Z A;  2KZT A;  3CQC B;  3FH7 A;  2UY1 B;  3MEK A;  3ZYM A;  3MKQ A;  4U0S A;  3FUM A;  3U66 A;  3TGO A;  3UQ3 A;  4ACK A;  1B89 A;  3MX3 A;  4JHJ A;  5HQ8 A;  2LAH A;  5G05 C;  5CCL A;  3BEE A;  1PC2 A;  4EPZ A;  1WAO 1;  4BWR A;  3FUL A;  4ILH B;  3S7D A;  3T8M A;  2X6K A;  2J49 A;  3I4G A;  3IBE A;  1EF1 C;  1KLX A;  4J8D A;  3FTX A;  2YHC A;  3CV0 A;  4I1M A;  3APD A;  3PZD A;  4XE0 A;  4CDM A;  4FLH A;  3D9J A;  5J90 A;  2M63 A;  3LKU A;  4EQF A;  3QJZ A;  4UI9 K;  3MV2 B;  4AOF A;  4GCO A;  4C9B B;  4N2S A;  3CHM A;  3KAE A;  2XRY A;  1E8X A;  4FU3 A;  5BUZ A;  4HVB A;  4KYO B;  3EHN A;  5D0O D;  2YQ8 A;  3QAQ A;  5DIZ A;  4I43 A;  3GW4 A;  4UWK A;  2WXF A;  3CGH A;  2LSV A;  4HS2 A;  4J6I A;  3UT7 A;  1HG5 A;  3R9A B;  2VGX A;  5JJ6 A;  2RD0 A;  1W3B A;  2AXZ A;  1HXI A;  3CHS A;  2FUL A;  3FP3 A;  4YVQ C;  4JL0 A;  4WAF A;  4AV7 A;  4I6E A;  4BT9 A;  3KS2 A;  2AXV A;  5EX0 A;  3JYS A;  5A7D B;  5LCW J;  2XRZ A;  3ASG A;  4KT6 B;  4XI0 A;  5BV1 A;  2BTD A;  1UW4 B;  5FQ6 A;  4CT0 A;  3L54 A;  1QQE A;  3URZ A;  4O6F A;  3QDN A;  1WY6 A;  4GMJ A;  3CVY A;  1IYG A;  3LY8 A;  4GYY A;  3HYM B;  1LF8 A;  3D9O A;  3MV3 B;  3ZYK A;  4Q69 A;  3SNX A;  3B7S A;  1H6K A;  3PNT B;  4UQZ A;  4B89 A;  4OYS A;  4DI4 A;  3HVE B;  4GB9 A;  5BT1 A;  1GW6 A;  2X38 A;  4HOQ A;  4QFV A;  4JEH A;  5DBK A;  5BV0 A;  3K9I A;  3CVX A;  1Z6T A;  4GAA A;  1OWO A;  5KJK A;  3AS8 A;  5A6C A;  3CHO A;  3MZL B;  5BNW A;  2KCK A;  4KBQ A;  1DVP A;  2CHZ A;  5FJY A;  2WQ7 A;  1JWF A;  4I1A A;  4K0R A;  2VGY A;  3QWW A;  2VGX B;  3SF4 A;  4PS3 A;  3MYV A;  3L08 A;  2V5F A;  4JZY A;  5CMY A;  4ILG A;  1OWP A;  4WWP A;  2WXN A;  4EBA G;  4N5C A;  3QWV A;  4FA6 A;  3LCA A;  4JA9 A;  1JWG A;  2VYI A;  4RVB A;  1H19 A;  2VQ2 A;  4N3B A;  3G2V A;  4KVO A;  5AJD A;  3RRU A;  3UT4 A;  2WVI A;  3ESL A;  3RIB A;  3GZS A;  3PH0 C;  5LP0 A;  3CR3 A;  2NC9 A;  4GZ5 A;  2V8S E;  2L6J A;  4R7L A;  1YA0 A;  2CFZ A;  2FEZ A;  1EYH A;  4WNG A;  4I6G A;  1HG2 A;  4E85 A;  4MLP A;  5CCM A;  4MRU A;  1MHQ A;  4NUR A;  4CGV A;  2V0P A;  2YNQ A;  2LSU A;  4RG6 A;  3TG5 A;  4ANW A;  4HOT A;  4GA2 A;  3QC1 A;  5KCM A;  2J9Q A;  2L0T B;  1H2U A;  2KCL A;  5AJL A;  4KZC A;  2VSY A;  4IN3 B;  4N2Q A;  4A3V A;  1A17 A;  4GZD A;  5FT9 A;  4F3V A;  5AIJ A;  4JC8 A;  4UI9 C;  3ZW3 A;  1HX8 A;  1L5J A;  4ME2 A;  1ZBP A;  3EIJ A;  4GYW A;  3PRE A;  3NZU A;  4TRQ A;  4EZL A;  2DIW A;  2IQC A;  4HOU A;  3PE4 A;  3ESK A;  4UWG A;  1E8Z A;  3TG4 A;  4U0Z A;  3B7R L;  4F7A A;  4XIF A;  3HHM A;  2C0L A;  2R59 A;  1E90 A;  4L23 A;  4UWF A;  2VJ8 A;  1U3D A;  3D9L A;  1HH8 A;  3PRZ A;  5ANL A;  2R5S A;  3CVW A;  4PS7 A;  4PS8 A;  2J07 A;  2RG8 A;  2OVB A;  3RO2 A;  2I9C A;  3RK6 A;  5AEN A;  3ZEF A;  4L1B A;  4HFG A;  4RSY A;  4C0E A;  3FDH A;  3CST A;  4HOS A;  3O48 A;  3QB2 A;  3ZFW A;  4G2V A;  2P58 C;  5FQ8 A;  4U07 A;  4UWL A;  3MKQ B;  3G2T A;  5G04 C;  5AYW D;  1KT0 A;  3LJ3 A;  3SHF A;  4K03 A;  4FJY A;  2KM4 A;  2Y3A A;  4NAC A;  5LOZ A;  3CQG B;  3UX4 A;  4UWH A;  3RU0 A;  3CHP A;  2WXI A;  4WND A;  4LUN U;  2J4B A;  2OV8 A;  3RRM B;  4W9R A;  4TV3 A;  4J0U A;  4DLO A;  1HO8 A;  1BPO A;  2OVF A;  3B7T A;  2GGF A;  4G23 A;  2XGS A;  1SZ9 A;  2WXM A;  2YIN A;  2MRI A;  3UMV A;  1HF8 A;  3FEY A;  4BX8 A;  3FTY A;  4GA0 A;  1XGW A;  1X5B A;  3ASD A;  5A23 A;  5ENN A;  4PUC A;  5FQ4 A;  4AIF A;  2PM7 A;  4U63 A;  3R7R A;  4BTA A;  4U0U A;  4AVX A;  2FI7 A;  2XCB A;  4GML A;  2LO6 A;  5CHE E;  5KJM A;  2VTB B;  5BW8 C;  3FUJ A;  1TJF A;  3UUX A;  3FTV A;  3LY9 A;  3OAW A;  1TJC A;  2HR2 A;  3FH5 A;  3PUJ A;  5J08 A;  3Q47 B;  4YND A;  4AP2 A;  1HFA A;  2AVP A;  3JQ0 A;  1WM5 A;  2WXQ A;  3U3W A;  3T5X A;  2J09 A;  3BG1 B;  4I2Z A;  2X6J A;  2C2L A;  2HM8 A;  5G05 J;  3LY7 A;  3AS5 A;  4BTB A;  1E7U A;  4I9E A;  4G26 A;  4RG9 A;  3FU0 A;  5ARF A;  4U04 A;  1FCH A;  2AXU A;  4GZC A;  1E8Y A;  4JXT A;  2QFC A;  3FUI A;  3MCX A;  4N39 A;  3SGH A;  4F1S A;  4I2W A;  3SBS A;  2MOW A;  3CHR A;  2ION A;  3P1U A;  4GZ6 A;  4OVU A;  2XGO A;  5ANR A;  2BUG A;  1Z3X A;  2GW1 A;  1SQM A;  1E96 B;  3QOU A;  3SZ7 A;  3LEW A;  2IOS A;  1EDU A;  1OWM A;  3ASF A;  3FTU A;  3MGB A;  1EPU A;  3VTY A;  5JJT A;  2AW6 A;  3FU6 A;  4XI9 A;  2GRM A;  4EEC A;  4XX5 A;  3LVQ E;  3FUE A;  3P2B A;  3PUK A;  4GCN A;  1H2V C;  3FTW A;  4EBA A;  2KC7 A;  4MS6 A;  2WXO A;  3D9M A;  1SZA A;  2I1K A;  3APF A;  4A1S A;  3D3M A;  4CEM A;  1ZU2 A;  2WXL A;  4IYP A;  4LER A;  2WQH A;  3SD5 A;  1Y8M A;  4N3A A;  1ELK A;  2IJG X;  2XCC A;  3KEZ A;  4FLB A;  3TL5 A;  3QWP A;  3U9W A;  4DK5 A;  4G25 A;  4G1T A;  2OOE A;  4B8C B;  2CG2 A;  3ML8 A;  4Q94 A;  3G2U A;  3OTN A;  3EHM A;  4H7Y A;  4WUY A;  4ANV A;  4BX9 A;  4GZ3 A;  5EDS A;  3L16 A;  1N52 A;  2X6F A;  2WMN A;  2PQR A;  4JPS A;  4XKB A;  1HZ4 A;  1HU3 A;  3AU5 A;  3PDN A;  1FVH A;  2NXP A;  2XPZ A;  3PVL A;  4LCT A;  1E7V A;  3ML9 A;  3RO3 A;  5LCW C;  3L17 A;  2IFU A;  2XPY A;  1E8W A;  1UJJ A;  4FHK A;  4GYO A;  3AU4 A;  3VLE A;  3L13 A;  2C0M A;  4C0M A;  3SI5 A;  3TXM A;  4FJZ A;  1NA3 A;  5C1D A;  5JHA A;  3B7U X;  4HXI A;  1HE8 A;  2I1J A;  3MJW A;  3FU5 A;  3PEU B;  5JJ7 A;  1P5Q A;  3D9K A;  1QZ2 A;  2UWJ G;  3QAR A;  2CG3 A;  3FUD A;  2HO1 A;  2WXH A;  3ZXS A;  4TUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...