3R9AB

Human alanine-glyoxylate aminotransferase in complex with the tpr domain of human pex5p
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
315
structure length
289
Chain Sequence
QFEEENPLRDHPQPFEEGLRRLQEGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACETLRDWLRYTPAYAHLVDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFGLPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transport protein
molecule keywords Serine--pyruvate aminotransferase
publication title Molecular requirements for peroxisomal targeting of alanine-glyoxylate aminotransferase as an essential determinant in primary hyperoxaluria type 1
pubmed doi rcsb
source organism Homo sapiens
total genus 116
structure length 289
sequence length 315
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13181 TPR_8 Tetratricopeptide repeat
B PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3r9aB00
2LSVA 5G04C 3WXXA 3PDNA 3MV2B 3QOUA 3RIBA 2BUGA 2UY1B 1WM5A 3U3WA 3CV0A 1IYGA 3GW4A 4KBQA 3QWWA 3SZ7A 3CVQA 3ZN3A 4AY6A 2DBAA 5CHEE 4GZ3A 3ASHA 1IHGA 5DIZA 3AS4A 3Q15A 2YHCA 4G1TA 3KS2A 4JL0A 1ZU2A 4BT8A 3OXGA 3O48A 1KT0A 2FO7A 4HORA 2C2LA 3UPVA 1WAO1 1OUVA 3AS5A 2HR2A 2KCVA 4UQYA 4J0UA 3KAEA 4JHRA 3RO3A 4BWRA 3URZA 4WUYA 4N3BA 2PZIA 4AM9A 2AVPA 3UQ3A 3GZ1A 3PE4A 4KYOB 3S7JA 2Y4UA 4I2ZA 3Q4AB 3PE3A 3QKYA 4B94A 4CGWA 5G05C 5BW8C 4HOSA 5LCWC 4Y6CA 3CVPA 3ZGQA 2FI7A 3BEEA 2WQHA 3CVNA 4ME2A 2C0LA 4AY5A 5ARGA 4UI9J 2C0MA 4J8DA 4JA7A 1ZBPA 5G04J 5BT1A 4I2WA 2ONDA 5FJYA 1PC2A 2GW1A 2KATA 1W3BA 5JJ6A 4UQZA 3MA5A 3R9AB 3Q49B 3OXLA 4GCNA 4KXKB 5ARFA 4EQFA 3TG4A 2XCBA 4UI9C 5KJNA 3ULQA 2FBNA 4N2SA 2PQRA 1E96B 5JJTA 2XEVA 2VSNA 2XPIA 2MHKA 4J8EA 3ASFA 4F3VA 3ZFWA 4W9RA 5FZQA 4YVOA 4U0SA 2PQNA 1KT1A 3QDNA 4G2VA 4BTBA 3S7DA 2XGMA 4WNEA 3S7FA 3CK7A 5KJMA 3JYSA 1Y8MA 4G25A 3RKVA 4J8FA 3GZ2A 5G05J 4G26A 5CCMA 3MV3B 5LCWJ 3RO2A 5EX3A 2XGOA 4JA9A 3MKRA 5M72A 4ABNA 2V5FA 3LY9A 5D0OD 4GA0A 4N3AA 4UQXA 4WNFA 2I6HA 4O6FA 1B89A 1HXIA 3VTXA 4G23A 5HQ8A 2LSUA 1ELRA 4I1AA 3E4BA 5FZRA 4I17A 3CKBA 5A7DB 4U0ZA 2VSYA 3VTYA 5EX0A 4Y6WA 1YA0A 3CEQA 4XI0A 5FZSA 4N5CA 4U0UA 3ASGA 2KC7A 3RJVA 4XIFA 3CK8A 3TG5A 3ESKA 3AS8A 2VYIA 4GZ5A 3MEKA 4HOTA 5D0QD 3SF4A 3KD7A 2PL2A 3FP3A 4GYOA 2YQ8A 1NA3A 3ZPJA 3LKUA 2KCKA 4U04A 2XGSA 2Q7FA 5C1DA 2L6JA 2HO1A 2R5SA 2KCLA 4N3CA 4I9CA 4H7YA 3FFLA 5KJKA 4H7XA 5EKQD 3FWVA 3GYZA 3LY7A 4GPKA 1ELWA 3LPZA 2WPVA 3IEGA 4N39A 3CK9A 1KLXA 4APOA 4N2QA 2XCCA 5AYWD 2LNIA 4GZ6A 4BTAA 4GYWA 2VGXA 4GA1A 4GYYA 2VQ2A 1HH8A 4RG9A 3HYMB 3ASDA 4GA2A 4HOQA 3ZHEA 3QWPA 4HOUA 3K9IA 4RG6A 4XI9A 2E2EA 2P58C 1FCHA 1QZ2A 5CCLA 2QFCA 3QWVA 3CVLA 3Q5MA 2IF4A 2UY1A 1NZNA 1P5QA 2IFUA 5KJLA 4G24A 1NA0A 5FTPA 5JJ7A 3LY8A 5BNWA 3U4TA 3N71A 1XNFA 3RU0A 3EDTB 1QQEA 4WNGA 2HYZA 3LCAA 2VGYA 2VGXB 4I9EA 3NF1A 4NRHB 3OXFA 4AIFA 2JLBA 5HI7A 4YNDA 3LYAA 3CKCA 4U07A 2Y4TA 3S7BA 3UUXA 5A6CA 3ZHEB 2UWJG 4LEUA 4CGVA 1TJCA 2J9QA 4UI9K 5DBKA 4A1SA 4BT9A 4CDRA 5FT9A 2FF4A 3Q47B 1HZ4A 3TGOA 2FEZA 4YVQC 4WNDA 2OOEA 3TAXA 4GCOA 1A17A 2NC9A 4NQ0A 4IN3B
chains in the Genus database with same CATH superfamily
2LSVA 5G04C 5J90A 3QOUA 3RIBA 2PM6A 1Z3XA 1WM5A 4GZCA 3CV0A 3GW4A 4KBQA 3QWWA 3FHEA 2ZU6B 4PS7A 2RKKA 3ZN3A 4AY6A 3D9JA 4NURA 2A5EA 2CHXA 3ASHA 4ILHB 1HU3A 5ENRD 2CFZA 1FT2A 4JL0A 1KPSB 1ZU2A 4HORA 2C2LA 3V2OA 3CHRA 3UPVA 1WAO1 3SI5A 4CDMA 2AJAA 3URZA 3R7QA 2H6GA 4N3BA 5T4YA 4AM9A 3GZ1A 3PE4A 4KYOB 2EIME 3S7JA 4I2ZA 3Q4AB 4Q69A 3PE3A 3FUHA 2OEVA 2XS8A 2X6HA 3RRUA 3CVPA 3ZU7B 2J07A 3ZXPA 3BEEA 2LAHA 1HS6A 1O1TA 4DLQA 3CVNA 3R7RA 3BQOA 4AY5A 4B8CB 2JEKA 4JZYA 4AXHA 4QFVA 1MHQA 2J4BA 1A5EA 3ZKJA 2XEEA 3HVEA 2GRQB 2ONDA 4Z68A 5AENA 4GZDA 2VTBA 4UQZA 3SY2A 4FADA 1JWGA 5FQ7A 4DX5D 3Q49B 3PZ2A 2P9SG 4KXKB 3CHMA 2WXHA 1N4PA 4KMOA 3TG4A 2DZNA 5AQBA 2OV8A 1E8YA 3PH0C 1MX4A 3ULQA 2XRYA 4ATZD 4ZHBA 2P9NG 1Z6TA 2XEVA 3IV0A 3FU6A 2AXUA 4U8VD 4FLHA 1E8WA 1NL4A 1UJKA 2F37A 2MHKA 3SHFA 4F3VA 2YHEA 3NOCD 4YVOA 4U8YD 1N0RA 3QARA 1D9SA 3TXNA 5AJLA 3DPDA 3QDNA 5CERB 1WDYA 2L0TB 4CRWA 2NXPA 3S7DA 4WNEA 3CK7A 4L9PA 3Q75A 5EYLA 1D8DA 4G25A 3RKVA 5BV0A 4O1PA 3ABLE 2X6IA 5CCMA 2WB2A 3FUMA 3UI2A 5EX3A 2DWZA 1EDUA 2QYJA 2R05A 5M72A 2FO1E 3FH7A 4ILIA 2BEDA 3HVEB 5D0OD 4FHKA 3DEOA 2VTBB 3FUDA 4FU3A 4GAAA 4N3AA 3PRZA 3OTNA 2AXVA 4G23A 5JHAA 3ONKA 4RSYA 4I1AA 4QQIA 4G11A 4CCAA 3APDA 4I17A 3CKBA 4IYPA 3DSTA 3VTYA 1V54E 4J8YA 2F8XK 3CEQA 4XI0A 2KC7A 3CK8A 3TG5A 2VYIA 4GZ5A 1FVHA 3P1UA 5D0QD 1TNZA 3KD7A 3AG2E 2BTDA 2WXLA 4FHJA 2PM7A 5C1DA 2IONA 1FPPA 2L6JA 3BU8A 5KCMA 4C9BB 3SFZA 3EHQA 1DC2A 3FFLA 4MKTA 3ZUVB 3SNXA 3BG1B 4GTOA 4X8QA 3LPZA 2WMOA 4EHMA 2WPVA 1OCRE 3ZIMA 3ML9A 1OCCE 2DVWA 3CVXA 4GTPA 3ESLA 5FIOA 2XCCA 1TNYA 4TXPA 2XEHA 3LS8A 3DXKG 3ZW3A 1N9AA 3PNTB 3APFA 3QC1A 1X5BA 2WMNA 3DWLG 4ACKA 2GRRB 1FT1A 4V3IA 5CECB 3Q78A 3FUNA 5G2NA 3B13A 5EYPF 3C72A 3UM1A 3UIOC 1OY3D 3FU3A 3P2BA 4B93B 3D3MA 4GB9A 2E2EA 2P58C 3LVQE 2WXFA 5CRUA 1TNOA 2J09A 4LNBA 3IXEA 3CVLA 2IF4A 2EIKE 2UY1A 2IO2C 1P5QA 3ONLA 1S63A 1NA0A 5EILA 5FTPA 1VDYA 3VLFA 1INZA 5JJ7A 4TXQA 2Y3AA 4UUCA 2R02A 2XENA 2X6FA 3U4TA 3RU0A 1QQEA 4HLLA 2CFUA 2EILE 4XZ4A 3HG0D 3LCAA 4HI9A 5AAOA 3L6AA 3NF1A 1E7VA 2Y4TA 3T5XA 1OWPA 5HKPA 3DSWA 2KM4A 3EIJA 4JHKA 1TJCA 5BV1A 2I2OA 1S70B 5DBKA 3V2XA 4CDNA 2DIWA 4R7LA 2FF4A 3Q47B 5LFAA 1HZ4A 4OAUC 2FEZA 4WNDA 4DK5A 4GTSA 3TAXA 4GCOA 1IQRA 3PDNA 3MV2B 5KBAA 4A63B 2BUGA 2UY1B 2J49A 1BPOA 3FDHA 1IYGA 1IKND 3SZ7A 1JPLA 3CVQA 2P9PG 4BX8A 3CGHA 4C48B 3RRMB 3MJWA 2QZAA 3RK6A 5EIDA 1IHGA 2V5QC 2Y1LE 2XPYA 4JD2G 2WXOA 5A23A 2YHCA 4I43A 2Y69E 3KS2A 3PZ1A 3OXGA 1OWNA 1KT0A 2FO7A 4EBAA 1JWFA 2KXPC 1OUVA 2CHZA 3AS5A 4C0EA 4AV7A 4B0ZA 1XGWA 4J6IA 2LO6A 3KAEA 3JUIA 4LCTA 2XZDG 3JQ1A 1X81A 3J5PA 4EECA 2PZIA 4AEZC 2AVPA 1N94A 3FH5A 3I4RB 5E75A 5CBNA 3SQVA 5G05C 3TWQA 4HOSA 3U9WA 2RFMA 2I9CA 3ZGQA 4DPRA 2FI7A 4F7AA 3NAWA 4XKCA 3TXMA 5FQ6A 3NBNB 3PEVB 2J4DA 3FEYA 3ULYA 3E37A 3S2AA 4DI4A 5G04J 4LUNU 1WY6A 3JXIA 3UM3A 5HS0A 4DX1A 2KATA 4L2YA 1O1RA 1TN7A 5KNGA 1IXVA 1WG0A 3TWUA 3D9HA 3OXLA 1K3ZD 5ARFA 4EQFA 1OXJA 5ENQD 2XCBA 2GGFA 5ENPD 4HI8A 2WXNA 3DEPA 2GRMA 4GTTA 3FTSA 3B7SA 3CHSA 3UX4A 3CVVA 3FTWA 2XPIA 4A3TA 3CSFA 3G2TA 1UG3A 4BEPA 1H6PA 3LJNA 4CT4A 1IQUA 2OVFA 4E85A 1KT1A 2GROB 3TWXA 4F6RD 3HXCA 1DVPA 2P2CP 2WVIA 4BERA 3MX3A 2XGMA 3HXDA 5KJMA 3CHOA 3JYSA 3FU5A 3AG3E 3QJZA 1BD8A 3GZ2A 3V31A 1L5JA 1QNFA 3MV3B 2L6BA 4JA9A 4ABNA 2V5FA 4U96D 3SFYA 4UQXA 4O6FA 3G2WA 3QK0A 1B89A 3D9LA 4U7EB 3VTXA 2F0YA 1ELRA 2XZTG 3FTYA 5FZRA 3TWWA 3VLEA 1NI1A 4BSXA 1JUQA 2OVBA 1RZ4A 4XEIG 4GTQA 3ULEG 4HQDA 3ZXSA 1YA0A 3ZRHA 1DCQA 5FZSA 2X6KA 4XIFA 1N4QA 1N95A 4WWOA 3AS8A 3UM0A 3CLJA 3HHMA 2QYUA 3MEKA 2M63A 2RFAA 3LJ3A 1BU9A 2CHWA 3ZPJA 3APCA 4GPMA 2KCKA 4K0RA 4U04A 1SZ9A 4TUMA 5AARA 3U64A 4PUCA 2KCLA 1N4RA 2OEWA 3MKQA 4H7YA 5AJDA 4DI3A 3ABME 4BX9A 5EKQD 3ZYMA 2WQ6A 3CHPA 1YYHA 4K5BA 1SQMA 1ELWA 3NQPA 1Y6IA 4HRNA 5AQ7A 3ASOE 3IEGA 4N39A 2ILRA 1KLXA 4PH4B 1Z5SC 5KWDA 2VGXA 4GMLA 4BY6A 3ISMC 2WXJA 2P9UG 2GRPB 3ASDA 4I6EA 3CQGB 3RSEG 3SBTB 2L9BA 3LVRE 1TN6A 2CG2A 3T5VA 5FQ4A 3FTZA 4RG6A 4DJAA 2VJ8A 3B7TA 4M3OA 3UXGA 1QZ2A 5CCLA 2PNNA 4OVVA 4LNUD 2B0OE 3TWTA 3U66A 3EHRA 1DNPA 1NZNA 4IRUA 2IFUA 5KJLA 1H2UA 3UIPC 2H6HA 1OT8A 2WM9A 1TNUA 1ZB1A 3MKQB 2VSOE 5AN8A 1TYQG 2XPZA 1DCEA 3LY8A 3N71A 3CSTA 4UWLA 2P9IG 3EDTB 3DRAA 4GTRA 4HBDA 5CEAA 5EDSA 5JA4D 1O5MA 2H6FA 3BG0B 2XS1A 4XE0A 1H6KA 3EU5A 2IJGX 2VGYA 3B7BA 2VGXB 2NYJA 3C3QA 4I6JA 4NRHB 2JLBA 5HI7A 3LYAA 3CKCA 2V4HC 3DXMG 2R17C 3KEAA 4WWPA 3PZDA 4OAVB 3Q9NC 3EJNA 4UI9K 4KZ0A 4RLYA 4EBAG 4HLEA 2HE0A 2IQCA 3UKUG 2OOEA 2IU1A 3AU5A 4JHJA 2NC9A 3V79K 3TWSA 4IN3B 4DX6D 4TRQA 1TN8A 1OWOA 3WXXA 4BSZB 2ETAA 3CQCB 2DBAA 3LDZA 4GZ3A 4L23A 5E76A 4IULA 4JXTA 5C2YA 3EHMA 3C5RA 1N0QA 3O48A 1TNBA 1N52A 2IEJA 1S64A 2KCVA 4UQYA 4RQIA 3B95A 5JMND 4CEMA 3DSSA 4J0UA 3DSVA 1K8KG 3RO3A 4BWRA 2A5UA 2QY7A 4FA6A 4WUYA 5FINA 4C0MA 3LEWA 3C3RA 3UQ3A 1MJ0A 1MX2A 2Y4UA 4JPSA 4AVXA 5CMWA 4O1OA 3CVYA 5LCWC 3JQ0A 3Q9UC 4MRUA 1HG2A 4DUIA 2WQHA 2HM8A 1H0AA 4ME2A 3DBSA 2C0LA 4UI9J 3JCKC 5BUZA 4A1GA 3FUFA 3FH8A 5BT1A 4I2WA 1U2VG 1PC2A 2GW1A 1W3BA 4HVBA 5JHBA 1MQSA 1SZAA 5CMYA 5ANRA 4GCNA 1SW6A 5EN5D 4EZJA 3SGHA 4UI9C 3GZSA 4YDYA 4YDWA 3L17A 5KJNA 5ENNA 4N2SA 4BFRA 1JCRA 2PQRA 4J8SA 5JJTA 1TR4A 3FUEA 2VSNA 4EPZA 5H7PA 4U63A 2PQNA 1BI7B 3L08A 4RVBA 3RRNB 3QAQA 3FEXA 1LD8A 4EZKA 4AJWA 1UW4B 4F1SA 4BTBA 3S7FA 3ZYQA 3UINC 1Y8MA 4LNGA 5BXOA 5G05J 1K1AA 2ETCA 3PZ3A 5B1AE 4AOFA 3RO2A 1E8XA 3E30A 3I4GA 4JC8A 1Z3YA 4B8AA 3LY9A 4F1PA 1EPUA 1UOHA 4GA0A 4WNFA 2I6HA 4U95D 4MS6A 3FTUA 1HXIA 3AG4E 5HQ8A 1D8EA 2LSUA 4WWNA 3E4BA 3FTVA 2P9KG 5AQ9A 3T8KA 4U0ZA 3B7UX 1H6OA 3AU4A 4BETA 2DYRE 5EX0A 4JEUA 3CVWA 5CEDB 3ZNGA 3ZYKA 2P9LG 2GRLA 1RW2A 4U0UA 1HX8A 5CRVA 3PNLB 1YMPA 2AXZA 1OWMA 2H6IA 3PREA 2PL2A 3FP3A 4GYOA 3T8MA 2XHEA 3SFXA 1NA3A 2QC9A 3W9FA 1MZCA 1MX6A 3ABKE 2XQ0A 4I1OB 3JXJA 2V0PA 4TV3A 4L1BA 1ELKA 3Q79A 5KJKA 4H7XA 2DZOA 4FJZA 3QNKA 5CBOA 3FWVA 1KZPA 3LY7A 4ANVA 2XRZA 2WXQA 3IHYA 3BUAA 4K03A 3NZSA 2BF0X 4K5AB 5ITZF 4JVSA 3FUIA 5FWQA 3CK9A 1TJFA 4APOA 4CZ2D 2L0IA 4N2QA 2LNIA 3VLDA 4MLPA 3NB2A 4G8KA 4GYWA 4GA1A 4OYSA 3ASNE 1QYMA 3HDXA 4HOQA 4HS2A 4NACA 3ZHEA 2WXMA 2Y0BG 4HXIA 3QWPA 1U3DA 4GTMA 1H19A 3FUJA 3HXEA 1UN9A 3KEZA 2IY0C 3FY4A 4XI9A 4DLOA 3G2VA 2IOSA 1FCHA 3G2UA 3HIZA 4N5QA 3LXUX 4J7WA 3CR3A 2QFCA 1HFAA 3Q5MA 4ANWA 3Q7AA 3MCXA 4HB5A 1BLXB 4G24A 1N11A 1SVXA 5ENTD 2DYSE 4PS8A 4LSZE 4JEHA 4YDEA 4ATGA 5BNWA 4HRMB 3UT8A 2LAIA 4WNGA 2HYZA 4HNAD 1LD7A 4I9EA 3OXFA 4A55A 4YNDA 4U07A 1UJJA 3S7BA 2KBXA 5A6CA 3ZHEB 5T8IA 4ACLA 2WXKA 4LEUA 4CGVA 3DSUA 5EIBE 4A1SA 1E90A 4BT9A 5FT9A 1PAQA 3ZVVA 5BXUA 1EYHA 3L82A 4Q96A 4PDXA 3UT4A 3ML8A 1A17A 3HXFA 4NQ0A 2I1JA 3UM2A 4GTVA 3TWVA 3L16A 4MBGA 4HRLA 3U3WA 4FULA 4L2LA 1N54A 3Q73A 4OVUA 5ANLA 3F6QA 3EHNA 1OCZE 1H2VC 5CHEE 4GU5A 4I1MA 2X6JA 3SBSA 4LERA 5DIZA 3AS4A 3TWRA 2ZIRA 3Q15A 4G1TA 1K1BA 1G3NB 4I6GA 3TL5A 4DX7D 4BT8A 2GRNB 2ZGGA 1LF8A 2NSZA 2HR2A 3E34A 5AQAA 2LXMA 3C98A 5B1BE 4JHRA 3QB2A 1H2TC 3UT7A 3PUKA 3R9MA 3D9KA 1SA5A 2WXPA 4KT6B 2LXLA 2VGEA 3AJIA 2FULA 3CIAA 3QKYA 4B94A 4CGWA 5BW8C 4TXRA 1S0PA 4Y6CA 3RAUA 4UWHA 1PY1A 1MYOA 4TUUA 1EF1C 4EZLA 2WXIA 5ARGA 2IO3C 2C0MA 4J8DA 4JA7A 1ZBPA 1FVFA 5FJYA 3E32A 2EIJE 4KZCA 2BKKB 2WQ7A 5JJ6A 3MA5A 3R9AB 3UMVA 5BPPA 1HF8A 3PS6A 4ILGA 1O1SA 2RD0A 4LRZA 2FBNA 1E96B 3EUVA 4G8LA 3EIQC 3PEUB 4Q94A 4CYMD 3J5QB 1JCQA 4J8EA 3ASFA 3ZFWA 2R59A 3L9TA 1IHBA 4W9RA 5FZQA 2J8SD 4U8HA 4U0SA 1NFIE 2KZTA 1QBQA 1HG5A 2YNQA 1LTXA 4UWFA 4YDOA 4G2VA 4B89A 1E8ZA 3HRAA 3DSXA 2WXRA 2RG8A 4JB8P 2MRIA 4J8FA 5HRYA 3SO8A 4DX2A 4F53A 4G26A 4URKA 5LCWJ 2ETBA 2XGOA 5D66A 3D9PA 3CVUA 3MKRA 3D9NA 3IHVA 2I1KA 1UN8A 5FQ8A 4M7CA 3KSLA 4NIKA 3CHQA 3NOGD 3PUJA 2A4ZA 3D9OA 2EQXA 2MYOA 3FULA 4AP2A 4UWGA 2IOLA 5A7DB 4HFGA 3E33A 2VSYA 3HXBA 3I5PA 4Y6WA 2ZGDA 2R2LA 4LG6A 4N5CA 3ASGA 3RJVA 3NZUA 3PVLA 4JW1A 5ENOD 4PS3A 3D9MA 2OCCE 3ESKA 3L22A 1HO8A 2KZTB 3C3OA 3X2QE 4HOTA 3SF4A 5B3SE 3MGBA 4KVOA 2YQ8A 2V8SE 4GMJA 3ZYLA 1HE8A 2E0IA 3LKUA 4BESA 2XGSA 3FTXA 2Q7FA 5LP0A 4D10C 1SA4A 3IBEA 2HO1A 2R5SA 2LUHA 3UTMA 4CT0A 5LOZA 4N3CA 4I9CA 3ZEFA 3Q7FA 1U3CA 2BKGA 3ENEA 3FUKA 3GYZA 4O60A 4GPKA 4E6HA 4KVMA 3DPYA 3IKOB 1OWLA 4WAFA 4GMRA 3JUEA 5AYWD 4P29A 4GZ6A 2R03A 4BTAA 1NP7A 1AP7A 4GYYA 2VQ2A 4XKBA 3AAAC 1HH8A 2CG3A 5ENSD 4RG9A 3HYMB 2MOWA 4GA2A 2AW6A 1E7UA 4ZFHA 5J08A 3MZLB 4HOUA 3W9GA 3K9IA 1KZOA 3KSQA 3V30A 2ZISA 2AWIA 5KNHD 5D2MC 3O4ZA 2YINA 3PZ4A 3FU0A 3L13A 4XX5A 3QWVA 2B6CA 3I3NA 4L7TA 4FJYA 2V4LA 2DCPA 2VSXE 1GW6A 1TEZA 3MYVA 2F8YA 1Q2ZA 2ZXWE 2JABA 2WXGA 4DRXE 1XNFA 1JCSA 4APFA 2X3MA 5G55A 1YCSB 3T9KA 1AWCB 3WG7E 3AG1E 4FP7A 5IY5E 4AIFA 5LX8A 5T3RA 3UUXA 2EINE 3L54A 2UWJG 5AIJA 4A3VA 2J08A 4ANUA 3G2SA 2J9QA 4K5CA 4CDRA 4ANXA 3TJPA 3EU9A 3TGOA 4YVQC 3D9IA 1N4SA 1V55E 3UKRG 1OCOE 1BI8B 4UWKA 2X38A 3OAWA 4FC8A 3SD5A 3B7RL 4FLBA
chains in the Genus database with same CATH topology
1OWOA 2LSVA 5G04C 5J90A 2I1JA 3WXXA 3PDNA 3MV2B 3QOUA 3RIBA 2PM6A 3L16A 2BUGA 2UY1B 1Z3XA 1WM5A 2J49A 4GZCA 3U3WA 3CV0A 1BPOA 3FDHA 4FULA 1IYGA 3GW4A 4KBQA 4L2LA 1N54A 3QWWA 3SZ7A 4OVUA 1JPLA 3CVQA 4BX8A 3CGHA 5ANLA 3FHEA 3RRMB 2ZU6B 4PS7A 3MJWA 3EHNA 3CQCB 1H2VC 3ZN3A 4AY6A 3D9JA 2DBAA 4NURA 5CHEE 2CHXA 4GU5A 3LDZA 4GZ3A 3RK6A 3ASHA 4I1MA 2X6JA 4L23A 1IHGA 3SBSA 4LERA 5DIZA 3AS4A 2XPYA 4ILHB 5E76A 1HU3A 4IULA 3Q15A 2WXOA 4JXTA 2CFZA 5A23A 2YHCA 5C2YA 4G1TA 4I43A 3EHMA 3KS2A 4I6GA 3TL5A 4JL0A 1ZU2A 4BT8A 3OXGA 3O48A 1OWNA 1KT0A 2FO7A 4HORA 2C2LA 4EBAA 1JWFA 3UPVA 1LF8A 3CHRA 1WAO1 3SI5A 1OUVA 2CHZA 4CDMA 2NSZA 3AS5A 4C0EA 1N52A 2HR2A 4AV7A 4B0ZA 1XGWA 2KCVA 4UQYA 4J6IA 2LO6A 4CEMA 4J0UA 3C98A 3KAEA 4JHRA 3JUIA 3QB2A 4LCTA 3RO3A 4BWRA 3URZA 2A5UA 2QY7A 1H2TC 3UT7A 3JQ1A 3R7QA 3PUKA 3D9KA 4FA6A 4EECA 4WUYA 4N3BA 5T4YA 2PZIA 4AM9A 4AEZC 4C0MA 3LEWA 2AVPA 2WXPA 3UQ3A 3GZ1A 4KT6B 3PE4A 4KYOB 3S7JA 2Y4UA 4I2ZA 3FH5A 3Q4AB 4JPSA 3I4RB 5E75A 2FULA 4Q69A 4AVXA 3CIAA 3PE3A 3QKYA 4B94A 5CMWA 5G05C 4CGWA 3CVYA 5BW8C 3FUHA 4HOSA 5LCWC 1S0PA 4Y6CA 2X6HA 3U9WA 3RRUA 3JQ0A 3CVPA 2I9CA 4UWHA 3ZGQA 1PY1A 4DPRA 4TUUA 2FI7A 4MRUA 2J07A 1HG2A 4F7AA 3BEEA 2LAHA 1HS6A 2WQHA 2HM8A 4DLQA 1H0AA 3CVNA 1EF1C 4ME2A 3DBSA 4XKCA 2C0LA 3R7RA 2WXIA 5FQ6A 3TXMA 4EZLA 4AY5A 4UI9J 5ARGA 4B8CB 2C0MA 4J8DA 2JEKA 4JZYA 4AXHA 3PEVB 2J4DA 3FEYA 4JA7A 1ZBPA 3JCKC 3S2AA 5BUZA 4QFVA 1MHQA 2J4BA 4A1GA 4DI4A 5G04J 3FUFA 3FH8A 5BT1A 3HVEA 1FVFA 2ONDA 4I2WA 4LUNU 1WY6A 1PC2A 5FJYA 5AENA 2GW1A 2KATA 4L2YA 4GZDA 4KZCA 2VTBA 2WQ7A 1W3BA 5JJ6A 4UQZA 3MA5A 4HVBA 4FADA 1JWGA 5FQ7A 3R9AB 5JHBA 1MQSA 1SZAA 5CMYA 5ANRA 3Q49B 3UMVA 3OXLA 4GCNA 4KXKB 3CHMA 2WXHA 4KMOA 1HF8A 3PS6A 5ARFA 4EQFA 5BPPA 4ILGA 3TG4A 2XCBA 4EZJA 2GGFA 3SGHA 4UI9C 2OV8A 1E8YA 3GZSA 3PH0C 3L17A 2WXNA 5ENNA 5KJNA 2RD0A 4LRZA 3ULQA 2FBNA 2XRYA 4BFRA 4N2SA 2PQRA 4J8SA 1E96B 1Z6TA 2GRMA 5JJTA 3FTSA 3B7SA 3CHSA 2XEVA 3FUEA 3IV0A 3FU6A 2AXUA 2VSNA 3EIQC 3PEUB 4Q94A 3UX4A 4EPZA 4FLHA 1E8WA 3CVVA 3FTWA 2XPIA 1UJKA 4A3TA 3CSFA 2MHKA 3SHFA 4J8EA 4U63A 3G2TA 3ASFA 4F3VA 3ZFWA 2R59A 1UG3A 4W9RA 5FZQA 2YHEA 4YVOA 4U8HA 4U0SA 2PQNA 3L08A 2KZTA 3QARA 4RVBA 1HG5A 2YNQA 3TXNA 3RRNB 4UWFA 4CT4A 1IQUA 2OVFA 3QAQA 3FEXA 4E85A 1KT1A 4EZKA 5AJLA 3DPDA 3QDNA 4G2VA 4AJWA 4B89A 1E8ZA 1DVPA 2L0TB 4CRWA 1UW4B 2NXPA 4F1SA 4BTBA 2WVIA 3MX3A 2WXRA 3S7DA 2XGMA 4WNEA 3S7FA 2RG8A 3CK7A 5KJMA 3ZYQA 3CHOA 3JYSA 3FU5A 1Y8MA 2MRIA 4G25A 3RKVA 3QJZA 4J8FA 3GZ2A 5BV0A 5G05J 4F53A 1L5JA 2X6IA 1QNFA 4G26A 5CCMA 3MV3B 4URKA 5LCWJ 2WB2A 3FUMA 4AOFA 3RO2A 5EX3A 2XGOA 1EDUA 1E8XA 3D9PA 3CVUA 4JA9A 3I4GA 4JC8A 1Z3YA 3MKRA 5M72A 3FH7A 3D9NA 4ILIA 3HVEB 3IHVA 4ABNA 2I1KA 2V5FA 3LY9A 5D0OD 4B8AA 4FHKA 2VTBB 1UN8A 3FUDA 4FU3A 1EPUA 4GAAA 4GA0A 4N3AA 4UQXA 5FQ8A 4WNFA 3PRZA 2I6HA 3G2WA 3OTNA 4MS6A 4O6FA 3QK0A 1B89A 3CHQA 3D9LA 2AXVA 1HXIA 3FTUA 2A4ZA 3PUJA 4G23A 3VTXA 5JHAA 3D9OA 5HQ8A 2EQXA 2LSUA 3ONKA 1ELRA 3FTYA 4WWNA 4RSYA 4I1AA 3FULA 3E4BA 5FZRA 3FTVA 3VLEA 4AP2A 4G11A 4UWGA 4CCAA 3APDA 4I17A 3CKBA 2IOLA 4IYPA 5A7DB 4U0ZA 4HFGA 3B7UX 2VSYA 4BSXA 3VTYA 1JUQA 3I5PA 2OVBA 3AU4A 5EX0A 4JEUA 4Y6WA 3CVWA 3ZYKA 3ZXSA 1YA0A 3CEQA 3ZRHA 4XI0A 2GRLA 5FZSA 4N5CA 4U0UA 3ASGA 2KC7A 2X6KA 1HX8A 3RJVA 4XIFA 3NZUA 3PVLA 3PNLB 4JW1A 3CK8A 3TG5A 4PS3A 3D9MA 2AXZA 3ESKA 3L22A 4WWOA 1HO8A 3AS8A 1OWMA 2KZTB 3CLJA 2VYIA 3HHMA 3PREA 4GZ5A 1FVHA 3MEKA 2M63A 4HOTA 3P1UA 5D0QD 3SF4A 3KD7A 2PL2A 3FP3A 4GYOA 3MGBA 3LJ3A 3T8MA 4KVOA 2YQ8A 2XHEA 2V8SE 4GMJA 3ZYLA 1NA3A 2CHWA 2BTDA 1HE8A 2E0IA 3APCA 3ZPJA 2WXLA 3LKUA 4FHJA 2KCKA 2PM7A 2XGSA 4K0RA 4U04A 2XQ0A 3FTXA 2Q7FA 4I1OB 5LP0A 5C1DA 2IONA 4D10C 1SZ9A 2L6JA 3IBEA 2HO1A 2R5SA 5KCMA 2V0PA 4C9BB 3U64A 4CT0A 4TV3A 4L1BA 5LOZA 4PUCA 2KCLA 3SFZA 4N3CA 1ELKA 4I9CA 4H7YA 3MKQA 5AJDA 3FFLA 4MKTA 4BX9A 4DI3A 4H7XA 5EKQD 3ZYMA 5KJKA 3ZEFA 4FJZA 3QNKA 3CHPA 2WQ6A 3SNXA 3BG1B 1U3CA 3FWVA 3ENEA 3FUKA 3GYZA 3LY7A 4ANVA 4GPKA 2XRZA 4E6HA 4KVMA 2WXQA 1SQMA 3IHYA 1ELWA 3LPZA 4K03A 2WMOA 3IKOB 3NQPA 1Y6IA 3NZSA 2WPVA 1OWLA 2BF0X 3IEGA 4WAFA 4JVSA 3ZIMA 4N39A 3FUIA 3ML9A 2ILRA 5FWQA 3CK9A 1KLXA 1TJFA 4PH4B 4APOA 2L0IA 3CVXA 3ESLA 4N2QA 2XCCA 5AYWD 4P29A 2LNIA 4GZ6A 3VLDA 4BTAA 4MLPA 1NP7A 4GYWA 4DK5A 2VGXA 4GA1A 4GMLA 4BY6A 3LS8A 4OYSA 3ZW3A 4GYYA 2VQ2A 4XKBA 3PNTB 1HH8A 2CG3A 3APFA 4RG9A 2WXJA 3QC1A 3HYMB 2MOWA 3ASDA 4GA2A 3HDXA 1X5BA 2WMNA 4HS2A 4HOQA 4NACA 3ZHEA 4ACKA 2AW6A 4V3IA 3FUNA 4I6EA 5G2NA 3CQGB 1E7UA 2WXMA 3B13A 3SBTB 4HXIA 5J08A 3QWPA 1U3DA 3MZLB 4HOUA 1H19A 2L9BA 3LVRE 3FUJA 3K9IA 2CG2A 3FU3A 3T5VA 5FQ4A 3P2BA 3FTZA 1UN9A 3KEZA 4RG6A 3FY4A 4DJAA 2VJ8A 3D3MA 4GB9A 4XI9A 2E2EA 4DLOA 2P58C 3G2VA 2IOSA 1FCHA 2WXFA 3B7TA 3G2UA 3LVQE 4M3OA 2AWIA 2J09A 3HIZA 3LXUX 1QZ2A 3O4ZA 5CCLA 3CR3A 2YINA 2QFCA 3FU0A 3L13A 4OVVA 4XX5A 1HFAA 3QWVA 3CVLA 3Q5MA 2IF4A 3I3NA 2UY1A 4L7TA 4ANWA 3U66A 3MCXA 4IRUA 1DNPA 1NZNA 4FJYA 1P5QA 3ONLA 2IFUA 2V4LA 2DCPA 5KJLA 1H2UA 2VSXE 4G24A 1GW6A 1TEZA 1NA0A 2WM9A 3MKQB 2VSOE 5FTPA 3MYVA 1VDYA 3VLFA 1INZA 5JJ7A 2XPZA 2Y3AA 4PS8A 4JEHA 2X6FA 3LY8A 4ATGA 2WXGA 3U4TA 3N71A 5BNWA 3CSTA 4UWLA 1XNFA 3RU0A 3UT8A 2LAIA 3EDTB 1QQEA 2X3MA 4APFA 5G55A 4WNGA 2CFUA 5EDSA 4XZ4A 2HYZA 3BG0B 3LCAA 4XE0A 1H6KA 2IJGX 2VGYA 2VGXB 3L6AA 4I9EA 3NF1A 4FP7A 4I6JA 4NRHB 3OXFA 4A55A 4AIFA 2JLBA 4YNDA 5HI7A 3LYAA 1E7VA 3CKCA 4U07A 2Y4TA 1UJJA 3S7BA 2R17C 3T5XA 5LX8A 5T3RA 3UUXA 1OWPA 3L54A 5A6CA 3ZHEB 2KM4A 4WWPA 2UWJG 3EIJA 3PZDA 5T8IA 4ACLA 5AIJA 2WXKA 4LEUA 4A3VA 4CGVA 2J08A 4JHKA 3G2SA 3EJNA 1TJCA 4ANUA 2J9QA 5BV1A 2I2OA 4UI9K 5DBKA 4CDNA 2DIWA 4A1SA 1E90A 4R7LA 4BT9A 5FT9A 2FF4A 4ANXA 4CDRA 3Q47B 4KZ0A 1HZ4A 5LFAA 1PAQA 3TJPA 3ZVVA 4EBAG 3TGOA 2FEZA 4HLEA 2IQCA 4YVQC 3D9IA 1EYHA 4WNDA 2OOEA 4PDXA 4Q96A 4UWKA 2X38A 2IU1A 3UT4A 3ML8A 3TAXA 3OAWA 1A17A 3AU5A 4GCOA 4JHJA 2NC9A 4FC8A 3SD5A 4NQ0A 3B7RL 1IQRA 4IN3B 4FLBA 4TRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LSV A;  5G04 C;  3WXX A;  3PDN A;  3MV2 B;  3QOU A;  3RIB A;  2BUG A;  2UY1 B;  1WM5 A;  3U3W A;  3CV0 A;  1IYG A;  3GW4 A;  4KBQ A;  3QWW A;  3SZ7 A;  3CVQ A;  3ZN3 A;  4AY6 A;  2DBA A;  5CHE E;  4GZ3 A;  3ASH A;  1IHG A;  5DIZ A;  3AS4 A;  3Q15 A;  2YHC A;  4G1T A;  3KS2 A;  4JL0 A;  1ZU2 A;  4BT8 A;  3OXG A;  3O48 A;  1KT0 A;  2FO7 A;  4HOR A;  2C2L A;  3UPV A;  1WAO 1;  1OUV A;  3AS5 A;  2HR2 A;  2KCV A;  4UQY A;  4J0U A;  3KAE A;  4JHR A;  3RO3 A;  4BWR A;  3URZ A;  4WUY A;  4N3B A;  2PZI A;  4AM9 A;  2AVP A;  3UQ3 A;  3GZ1 A;  3PE4 A;  4KYO B;  3S7J A;  2Y4U A;  4I2Z A;  3Q4A B;  3PE3 A;  3QKY A;  4B94 A;  4CGW A;  5G05 C;  5BW8 C;  4HOS A;  5LCW C;  4Y6C A;  3CVP A;  3ZGQ A;  2FI7 A;  3BEE A;  2WQH A;  3CVN A;  4ME2 A;  2C0L A;  4AY5 A;  5ARG A;  4UI9 J;  2C0M A;  4J8D A;  4JA7 A;  1ZBP A;  5G04 J;  5BT1 A;  4I2W A;  2OND A;  5FJY A;  1PC2 A;  2GW1 A;  2KAT A;  1W3B A;  5JJ6 A;  4UQZ A;  3MA5 A;  3R9A B;  3Q49 B;  3OXL A;  4GCN A;  4KXK B;  5ARF A;  4EQF A;  3TG4 A;  2XCB A;  4UI9 C;  5KJN A;  3ULQ A;  2FBN A;  4N2S A;  2PQR A;  1E96 B;  5JJT A;  2XEV A;  2VSN A;  2XPI A;  2MHK A;  4J8E A;  3ASF A;  4F3V A;  3ZFW A;  4W9R A;  5FZQ A;  4YVO A;  4U0S A;  2PQN A;  1KT1 A;  3QDN A;  4G2V A;  4BTB A;  3S7D A;  2XGM A;  4WNE A;  3S7F A;  3CK7 A;  5KJM A;  3JYS A;  1Y8M A;  4G25 A;  3RKV A;  4J8F A;  3GZ2 A;  5G05 J;  4G26 A;  5CCM A;  3MV3 B;  5LCW J;  3RO2 A;  5EX3 A;  2XGO A;  4JA9 A;  3MKR A;  5M72 A;  4ABN A;  2V5F A;  3LY9 A;  5D0O D;  4GA0 A;  4N3A A;  4UQX A;  4WNF A;  2I6H A;  4O6F A;  1B89 A;  1HXI A;  3VTX A;  4G23 A;  5HQ8 A;  2LSU A;  1ELR A;  4I1A A;  3E4B A;  5FZR A;  4I17 A;  3CKB A;  5A7D B;  4U0Z A;  2VSY A;  3VTY A;  5EX0 A;  4Y6W A;  1YA0 A;  3CEQ A;  4XI0 A;  5FZS A;  4N5C A;  4U0U A;  3ASG A;  2KC7 A;  3RJV A;  4XIF A;  3CK8 A;  3TG5 A;  3ESK A;  3AS8 A;  2VYI A;  4GZ5 A;  3MEK A;  4HOT A;  5D0Q D;  3SF4 A;  3KD7 A;  2PL2 A;  3FP3 A;  4GYO A;  2YQ8 A;  1NA3 A;  3ZPJ A;  3LKU A;  2KCK A;  4U04 A;  2XGS A;  2Q7F A;  5C1D A;  2L6J A;  2HO1 A;  2R5S A;  2KCL A;  4N3C A;  4I9C A;  4H7Y A;  3FFL A;  5KJK A;  4H7X A;  5EKQ D;  3FWV A;  3GYZ A;  3LY7 A;  4GPK A;  1ELW A;  3LPZ A;  2WPV A;  3IEG A;  4N39 A;  3CK9 A;  1KLX A;  4APO A;  4N2Q A;  2XCC A;  5AYW D;  2LNI A;  4GZ6 A;  4BTA A;  4GYW A;  2VGX A;  4GA1 A;  4GYY A;  2VQ2 A;  1HH8 A;  4RG9 A;  3HYM B;  3ASD A;  4GA2 A;  4HOQ A;  3ZHE A;  3QWP A;  4HOU A;  3K9I A;  4RG6 A;  4XI9 A;  2E2E A;  2P58 C;  1FCH A;  1QZ2 A;  5CCL A;  2QFC A;  3QWV A;  3CVL A;  3Q5M A;  2IF4 A;  2UY1 A;  1NZN A;  1P5Q A;  2IFU A;  5KJL A;  4G24 A;  1NA0 A;  5FTP A;  5JJ7 A;  3LY8 A;  5BNW A;  3U4T A;  3N71 A;  1XNF A;  3RU0 A;  3EDT B;  1QQE A;  4WNG A;  2HYZ A;  3LCA A;  2VGY A;  2VGX B;  4I9E A;  3NF1 A;  4NRH B;  3OXF A;  4AIF A;  2JLB A;  5HI7 A;  4YND A;  3LYA A;  3CKC A;  4U07 A;  2Y4T A;  3S7B A;  3UUX A;  5A6C A;  3ZHE B;  2UWJ G;  4LEU A;  4CGV A;  1TJC A;  2J9Q A;  4UI9 K;  5DBK A;  4A1S A;  4BT9 A;  4CDR A;  5FT9 A;  2FF4 A;  3Q47 B;  1HZ4 A;  3TGO A;  2FEZ A;  4YVQ C;  4WND A;  2OOE A;  3TAX A;  4GCO A;  1A17 A;  2NC9 A;  4NQ0 A;  4IN3 B; 
#chains in the Genus database with same CATH topology
 2LSV A;  5G04 C;  5J90 A;  3QOU A;  3RIB A;  2PM6 A;  1Z3X A;  1WM5 A;  4GZC A;  3CV0 A;  3GW4 A;  4KBQ A;  3QWW A;  3FHE A;  2ZU6 B;  4PS7 A;  2RKK A;  3ZN3 A;  4AY6 A;  3D9J A;  4NUR A;  2A5E A;  2CHX A;  3ASH A;  4ILH B;  1HU3 A;  5ENR D;  2CFZ A;  1FT2 A;  4JL0 A;  1KPS B;  1ZU2 A;  4HOR A;  2C2L A;  3V2O A;  3CHR A;  3UPV A;  1WAO 1;  3SI5 A;  4CDM A;  2AJA A;  3URZ A;  3R7Q A;  2H6G A;  4N3B A;  5T4Y A;  4AM9 A;  3GZ1 A;  3PE4 A;  4KYO B;  2EIM E;  3S7J A;  4I2Z A;  3Q4A B;  4Q69 A;  3PE3 A;  3FUH A;  2OEV A;  2XS8 A;  2X6H A;  3RRU A;  3CVP A;  3ZU7 B;  2J07 A;  3ZXP A;  3BEE A;  2LAH A;  1HS6 A;  1O1T A;  4DLQ A;  3CVN A;  3R7R A;  3BQO A;  4AY5 A;  4B8C B;  2JEK A;  4JZY A;  4AXH A;  4QFV A;  1MHQ A;  2J4B A;  1A5E A;  3ZKJ A;  2XEE A;  3HVE A;  2GRQ B;  2OND A;  4Z68 A;  5AEN A;  4GZD A;  2VTB A;  4UQZ A;  3SY2 A;  4FAD A;  1JWG A;  5FQ7 A;  4DX5 D;  3Q49 B;  3PZ2 A;  2P9S G;  4KXK B;  3CHM A;  2WXH A;  1N4P A;  4KMO A;  3TG4 A;  2DZN A;  5AQB A;  2OV8 A;  1E8Y A;  3PH0 C;  1MX4 A;  3ULQ A;  2XRY A;  4ATZ D;  4ZHB A;  2P9N G;  1Z6T A;  2XEV A;  3IV0 A;  3FU6 A;  2AXU A;  4U8V D;  4FLH A;  1E8W A;  1NL4 A;  1UJK A;  2F37 A;  2MHK A;  3SHF A;  4F3V A;  2YHE A;  3NOC D;  4YVO A;  4U8Y D;  1N0R A;  3QAR A;  1D9S A;  3TXN A;  5AJL A;  3DPD A;  3QDN A;  5CER B;  1WDY A;  2L0T B;  4CRW A;  2NXP A;  3S7D A;  4WNE A;  3CK7 A;  4L9P A;  3Q75 A;  5EYL A;  1D8D A;  4G25 A;  3RKV A;  5BV0 A;  4O1P A;  3ABL E;  2X6I A;  5CCM A;  2WB2 A;  3FUM A;  3UI2 A;  5EX3 A;  2DWZ A;  1EDU A;  2QYJ A;  2R05 A;  5M72 A;  2FO1 E;  3FH7 A;  4ILI A;  2BED A;  3HVE B;  5D0O D;  4FHK A;  3DEO A;  2VTB B;  3FUD A;  4FU3 A;  4GAA A;  4N3A A;  3PRZ A;  3OTN A;  2AXV A;  4G23 A;  5JHA A;  3ONK A;  4RSY A;  4I1A A;  4QQI A;  4G11 A;  4CCA A;  3APD A;  4I17 A;  3CKB A;  4IYP A;  3DST A;  3VTY A;  1V54 E;  4J8Y A;  2F8X K;  3CEQ A;  4XI0 A;  2KC7 A;  3CK8 A;  3TG5 A;  2VYI A;  4GZ5 A;  1FVH A;  3P1U A;  5D0Q D;  1TNZ A;  3KD7 A;  3AG2 E;  2BTD A;  2WXL A;  4FHJ A;  2PM7 A;  5C1D A;  2ION A;  1FPP A;  2L6J A;  3BU8 A;  5KCM A;  4C9B B;  3SFZ A;  3EHQ A;  1DC2 A;  3FFL A;  4MKT A;  3ZUV B;  3SNX A;  3BG1 B;  4GTO A;  4X8Q A;  3LPZ A;  2WMO A;  4EHM A;  2WPV A;  1OCR E;  3ZIM A;  3ML9 A;  1OCC E;  2DVW A;  3CVX A;  4GTP A;  3ESL A;  5FIO A;  2XCC A;  1TNY A;  4TXP A;  2XEH A;  3LS8 A;  3DXK G;  3ZW3 A;  1N9A A;  3PNT B;  3APF A;  3QC1 A;  1X5B A;  2WMN A;  3DWL G;  4ACK A;  2GRR B;  1FT1 A;  4V3I A;  5CEC B;  3Q78 A;  3FUN A;  5G2N A;  3B13 A;  5EYP F;  3C72 A;  3UM1 A;  3UIO C;  1OY3 D;  3FU3 A;  3P2B A;  4B93 B;  3D3M A;  4GB9 A;  2E2E A;  2P58 C;  3LVQ E;  2WXF A;  5CRU A;  1TNO A;  2J09 A;  4LNB A;  3IXE A;  3CVL A;  2IF4 A;  2EIK E;  2UY1 A;  2IO2 C;  1P5Q A;  3ONL A;  1S63 A;  1NA0 A;  5EIL A;  5FTP A;  1VDY A;  3VLF A;  1INZ A;  5JJ7 A;  4TXQ A;  2Y3A A;  4UUC A;  2R02 A;  2XEN A;  2X6F A;  3U4T A;  3RU0 A;  1QQE A;  4HLL A;  2CFU A;  2EIL E;  4XZ4 A;  3HG0 D;  3LCA A;  4HI9 A;  5AAO A;  3L6A A;  3NF1 A;  1E7V A;  2Y4T A;  3T5X A;  1OWP A;  5HKP A;  3DSW A;  2KM4 A;  3EIJ A;  4JHK A;  1TJC A;  5BV1 A;  2I2O A;  1S70 B;  5DBK A;  3V2X A;  4CDN A;  2DIW A;  4R7L A;  2FF4 A;  3Q47 B;  5LFA A;  1HZ4 A;  4OAU C;  2FEZ A;  4WND A;  4DK5 A;  4GTS A;  3TAX A;  4GCO A;  1IQR A;  3PDN A;  3MV2 B;  5KBA A;  4A63 B;  2BUG A;  2UY1 B;  2J49 A;  1BPO A;  3FDH A;  1IYG A;  1IKN D;  3SZ7 A;  1JPL A;  3CVQ A;  2P9P G;  4BX8 A;  3CGH A;  4C48 B;  3RRM B;  3MJW A;  2QZA A;  3RK6 A;  5EID A;  1IHG A;  2V5Q C;  2Y1L E;  2XPY A;  4JD2 G;  2WXO A;  5A23 A;  2YHC A;  4I43 A;  2Y69 E;  3KS2 A;  3PZ1 A;  3OXG A;  1OWN A;  1KT0 A;  2FO7 A;  4EBA A;  1JWF A;  2KXP C;  1OUV A;  2CHZ A;  3AS5 A;  4C0E A;  4AV7 A;  4B0Z A;  1XGW A;  4J6I A;  2LO6 A;  3KAE A;  3JUI A;  4LCT A;  2XZD G;  3JQ1 A;  1X81 A;  3J5P A;  4EEC A;  2PZI A;  4AEZ C;  2AVP A;  1N94 A;  3FH5 A;  3I4R B;  5E75 A;  5CBN A;  3SQV A;  5G05 C;  3TWQ A;  4HOS A;  3U9W A;  2RFM A;  2I9C A;  3ZGQ A;  4DPR A;  2FI7 A;  4F7A A;  3NAW A;  4XKC A;  3TXM A;  5FQ6 A;  3NBN B;  3PEV B;  2J4D A;  3FEY A;  3ULY A;  3E37 A;  3S2A A;  4DI4 A;  5G04 J;  4LUN U;  1WY6 A;  3JXI A;  3UM3 A;  5HS0 A;  4DX1 A;  2KAT A;  4L2Y A;  1O1R A;  1TN7 A;  5KNG A;  1IXV A;  1WG0 A;  3TWU A;  3D9H A;  3OXL A;  1K3Z D;  5ARF A;  4EQF A;  1OXJ A;  5ENQ D;  2XCB A;  2GGF A;  5ENP D;  4HI8 A;  2WXN A;  3DEP A;  2GRM A;  4GTT A;  3FTS A;  3B7S A;  3CHS A;  3UX4 A;  3CVV A;  3FTW A;  2XPI A;  4A3T A;  3CSF A;  3G2T A;  1UG3 A;  4BEP A;  1H6P A;  3LJN A;  4CT4 A;  1IQU A;  2OVF A;  4E85 A;  1KT1 A;  2GRO B;  3TWX A;  4F6R D;  3HXC A;  1DVP A;  2P2C P;  2WVI A;  4BER A;  3MX3 A;  2XGM A;  3HXD A;  5KJM A;  3CHO A;  3JYS A;  3FU5 A;  3AG3 E;  3QJZ A;  1BD8 A;  3GZ2 A;  3V31 A;  1L5J A;  1QNF A;  3MV3 B;  2L6B A;  4JA9 A;  4ABN A;  2V5F A;  4U96 D;  3SFY A;  4UQX A;  4O6F A;  3G2W A;  3QK0 A;  1B89 A;  3D9L A;  4U7E B;  3VTX A;  2F0Y A;  1ELR A;  2XZT G;  3FTY A;  5FZR A;  3TWW A;  3VLE A;  1NI1 A;  4BSX A;  1JUQ A;  2OVB A;  1RZ4 A;  4XEI G;  4GTQ A;  3ULE G;  4HQD A;  3ZXS A;  1YA0 A;  3ZRH A;  1DCQ A;  5FZS A;  2X6K A;  4XIF A;  1N4Q A;  1N95 A;  4WWO A;  3AS8 A;  3UM0 A;  3CLJ A;  3HHM A;  2QYU A;  3MEK A;  2M63 A;  2RFA A;  3LJ3 A;  1BU9 A;  2CHW A;  3ZPJ A;  3APC A;  4GPM A;  2KCK A;  4K0R A;  4U04 A;  1SZ9 A;  4TUM A;  5AAR A;  3U64 A;  4PUC A;  2KCL A;  1N4R A;  2OEW A;  3MKQ A;  4H7Y A;  5AJD A;  4DI3 A;  3ABM E;  4BX9 A;  5EKQ D;  3ZYM A;  2WQ6 A;  3CHP A;  1YYH A;  4K5B A;  1SQM A;  1ELW A;  3NQP A;  1Y6I A;  4HRN A;  5AQ7 A;  3ASO E;  3IEG A;  4N39 A;  2ILR A;  1KLX A;  4PH4 B;  1Z5S C;  5KWD A;  2VGX A;  4GML A;  4BY6 A;  3ISM C;  2WXJ A;  2P9U G;  2GRP B;  3ASD A;  4I6E A;  3CQG B;  3RSE G;  3SBT B;  2L9B A;  3LVR E;  1TN6 A;  2CG2 A;  3T5V A;  5FQ4 A;  3FTZ A;  4RG6 A;  4DJA A;  2VJ8 A;  3B7T A;  4M3O A;  3UXG A;  1QZ2 A;  5CCL A;  2PNN A;  4OVV A;  4LNU D;  2B0O E;  3TWT A;  3U66 A;  3EHR A;  1DNP A;  1NZN A;  4IRU A;  2IFU A;  5KJL A;  1H2U A;  3UIP C;  2H6H A;  1OT8 A;  2WM9 A;  1TNU A;  1ZB1 A;  3MKQ B;  2VSO E;  5AN8 A;  1TYQ G;  2XPZ A;  1DCE A;  3LY8 A;  3N71 A;  3CST A;  4UWL A;  2P9I G;  3EDT B;  3DRA A;  4GTR A;  4HBD A;  5CEA A;  5EDS A;  5JA4 D;  1O5M A;  2H6F A;  3BG0 B;  2XS1 A;  4XE0 A;  1H6K A;  3EU5 A;  2IJG X;  2VGY A;  3B7B A;  2VGX B;  2NYJ A;  3C3Q A;  4I6J A;  4NRH B;  2JLB A;  5HI7 A;  3LYA A;  3CKC A;  2V4H C;  3DXM G;  2R17 C;  3KEA A;  4WWP A;  3PZD A;  4OAV B;  3Q9N C;  3EJN A;  4UI9 K;  4KZ0 A;  4RLY A;  4EBA G;  4HLE A;  2HE0 A;  2IQC A;  3UKU G;  2OOE A;  2IU1 A;  3AU5 A;  4JHJ A;  2NC9 A;  3V79 K;  3TWS A;  4IN3 B;  4DX6 D;  4TRQ A;  1TN8 A;  1OWO A;  3WXX A;  4BSZ B;  2ETA A;  3CQC B;  2DBA A;  3LDZ A;  4GZ3 A;  4L23 A;  5E76 A;  4IUL A;  4JXT A;  5C2Y A;  3EHM A;  3C5R A;  1N0Q A;  3O48 A;  1TNB A;  1N52 A;  2IEJ A;  1S64 A;  2KCV A;  4UQY A;  4RQI A;  3B95 A;  5JMN D;  4CEM A;  3DSS A;  4J0U A;  3DSV A;  1K8K G;  3RO3 A;  4BWR A;  2A5U A;  2QY7 A;  4FA6 A;  4WUY A;  5FIN A;  4C0M A;  3LEW A;  3C3R A;  3UQ3 A;  1MJ0 A;  1MX2 A;  2Y4U A;  4JPS A;  4AVX A;  5CMW A;  4O1O A;  3CVY A;  5LCW C;  3JQ0 A;  3Q9U C;  4MRU A;  1HG2 A;  4DUI A;  2WQH A;  2HM8 A;  1H0A A;  4ME2 A;  3DBS A;  2C0L A;  4UI9 J;  3JCK C;  5BUZ A;  4A1G A;  3FUF A;  3FH8 A;  5BT1 A;  4I2W A;  1U2V G;  1PC2 A;  2GW1 A;  1W3B A;  4HVB A;  5JHB A;  1MQS A;  1SZA A;  5CMY A;  5ANR A;  4GCN A;  1SW6 A;  5EN5 D;  4EZJ A;  3SGH A;  4UI9 C;  3GZS A;  4YDY A;  4YDW A;  3L17 A;  5KJN A;  5ENN A;  4N2S A;  4BFR A;  1JCR A;  2PQR A;  4J8S A;  5JJT A;  1TR4 A;  3FUE A;  2VSN A;  4EPZ A;  5H7P A;  4U63 A;  2PQN A;  1BI7 B;  3L08 A;  4RVB A;  3RRN B;  3QAQ A;  3FEX A;  1LD8 A;  4EZK A;  4AJW A;  1UW4 B;  4F1S A;  4BTB A;  3S7F A;  3ZYQ A;  3UIN C;  1Y8M A;  4LNG A;  5BXO A;  5G05 J;  1K1A A;  2ETC A;  3PZ3 A;  5B1A E;  4AOF A;  3RO2 A;  1E8X A;  3E30 A;  3I4G A;  4JC8 A;  1Z3Y A;  4B8A A;  3LY9 A;  4F1P A;  1EPU A;  1UOH A;  4GA0 A;  4WNF A;  2I6H A;  4U95 D;  4MS6 A;  3FTU A;  1HXI A;  3AG4 E;  5HQ8 A;  1D8E A;  2LSU A;  4WWN A;  3E4B A;  3FTV A;  2P9K G;  5AQ9 A;  3T8K A;  4U0Z A;  3B7U X;  1H6O A;  3AU4 A;  4BET A;  2DYR E;  5EX0 A;  4JEU A;  3CVW A;  5CED B;  3ZNG A;  3ZYK A;  2P9L G;  2GRL A;  1RW2 A;  4U0U A;  1HX8 A;  5CRV A;  3PNL B;  1YMP A;  2AXZ A;  1OWM A;  2H6I A;  3PRE A;  2PL2 A;  3FP3 A;  4GYO A;  3T8M A;  2XHE A;  3SFX A;  1NA3 A;  2QC9 A;  3W9F A;  1MZC A;  1MX6 A;  3ABK E;  2XQ0 A;  4I1O B;  3JXJ A;  2V0P A;  4TV3 A;  4L1B A;  1ELK A;  3Q79 A;  5KJK A;  4H7X A;  2DZO A;  4FJZ A;  3QNK A;  5CBO A;  3FWV A;  1KZP A;  3LY7 A;  4ANV A;  2XRZ A;  2WXQ A;  3IHY A;  3BUA A;  4K03 A;  3NZS A;  2BF0 X;  4K5A B;  5ITZ F;  4JVS A;  3FUI A;  5FWQ A;  3CK9 A;  1TJF A;  4APO A;  4CZ2 D;  2L0I A;  4N2Q A;  2LNI A;  3VLD A;  4MLP A;  3NB2 A;  4G8K A;  4GYW A;  4GA1 A;  4OYS A;  3ASN E;  1QYM A;  3HDX A;  4HOQ A;  4HS2 A;  4NAC A;  3ZHE A;  2WXM A;  2Y0B G;  4HXI A;  3QWP A;  1U3D A;  4GTM A;  1H19 A;  3FUJ A;  3HXE A;  1UN9 A;  3KEZ A;  2IY0 C;  3FY4 A;  4XI9 A;  4DLO A;  3G2V A;  2IOS A;  1FCH A;  3G2U A;  3HIZ A;  4N5Q A;  3LXU X;  4J7W A;  3CR3 A;  2QFC A;  1HFA A;  3Q5M A;  4ANW A;  3Q7A A;  3MCX A;  4HB5 A;  1BLX B;  4G24 A;  1N11 A;  1SVX A;  5ENT D;  2DYS E;  4PS8 A;  4LSZ E;  4JEH A;  4YDE A;  4ATG A;  5BNW A;  4HRM B;  3UT8 A;  2LAI A;  4WNG A;  2HYZ A;  4HNA D;  1LD7 A;  4I9E A;  3OXF A;  4A55 A;  4YND A;  4U07 A;  1UJJ A;  3S7B A;  2KBX A;  5A6C A;  3ZHE B;  5T8I A;  4ACL A;  2WXK A;  4LEU A;  4CGV A;  3DSU A;  5EIB E;  4A1S A;  1E90 A;  4BT9 A;  5FT9 A;  1PAQ A;  3ZVV A;  5BXU A;  1EYH A;  3L82 A;  4Q96 A;  4PDX A;  3UT4 A;  3ML8 A;  1A17 A;  3HXF A;  4NQ0 A;  2I1J A;  3UM2 A;  4GTV A;  3TWV A;  3L16 A;  4MBG A;  4HRL A;  3U3W A;  4FUL A;  4L2L A;  1N54 A;  3Q73 A;  4OVU A;  5ANL A;  3F6Q A;  3EHN A;  1OCZ E;  1H2V C;  5CHE E;  4GU5 A;  4I1M A;  2X6J A;  3SBS A;  4LER A;  5DIZ A;  3AS4 A;  3TWR A;  2ZIR A;  3Q15 A;  4G1T A;  1K1B A;  1G3N B;  4I6G A;  3TL5 A;  4DX7 D;  4BT8 A;  2GRN B;  2ZGG A;  1LF8 A;  2NSZ A;  2HR2 A;  3E34 A;  5AQA A;  2LXM A;  3C98 A;  5B1B E;  4JHR A;  3QB2 A;  1H2T C;  3UT7 A;  3PUK A;  3R9M A;  3D9K A;  1SA5 A;  2WXP A;  4KT6 B;  2LXL A;  2VGE A;  3AJI A;  2FUL A;  3CIA A;  3QKY A;  4B94 A;  4CGW A;  5BW8 C;  4TXR A;  1S0P A;  4Y6C A;  3RAU A;  4UWH A;  1PY1 A;  1MYO A;  4TUU A;  1EF1 C;  4EZL A;  2WXI A;  5ARG A;  2IO3 C;  2C0M A;  4J8D A;  4JA7 A;  1ZBP A;  1FVF A;  5FJY A;  3E32 A;  2EIJ E;  4KZC A;  2BKK B;  2WQ7 A;  5JJ6 A;  3MA5 A;  3R9A B;  3UMV A;  5BPP A;  1HF8 A;  3PS6 A;  4ILG A;  1O1S A;  2RD0 A;  4LRZ A;  2FBN A;  1E96 B;  3EUV A;  4G8L A;  3EIQ C;  3PEU B;  4Q94 A;  4CYM D;  3J5Q B;  1JCQ A;  4J8E A;  3ASF A;  3ZFW A;  2R59 A;  3L9T A;  1IHB A;  4W9R A;  5FZQ A;  2J8S D;  4U8H A;  4U0S A;  1NFI E;  2KZT A;  1QBQ A;  1HG5 A;  2YNQ A;  1LTX A;  4UWF A;  4YDO A;  4G2V A;  4B89 A;  1E8Z A;  3HRA A;  3DSX A;  2WXR A;  2RG8 A;  4JB8 P;  2MRI A;  4J8F A;  5HRY A;  3SO8 A;  4DX2 A;  4F53 A;  4G26 A;  4URK A;  5LCW J;  2ETB A;  2XGO A;  5D66 A;  3D9P A;  3CVU A;  3MKR A;  3D9N A;  3IHV A;  2I1K A;  1UN8 A;  5FQ8 A;  4M7C A;  3KSL A;  4NIK A;  3CHQ A;  3NOG D;  3PUJ A;  2A4Z A;  3D9O A;  2EQX A;  2MYO A;  3FUL A;  4AP2 A;  4UWG A;  2IOL A;  5A7D B;  4HFG A;  3E33 A;  2VSY A;  3HXB A;  3I5P A;  4Y6W A;  2ZGD A;  2R2L A;  4LG6 A;  4N5C A;  3ASG A;  3RJV A;  3NZU A;  3PVL A;  4JW1 A;  5ENO D;  4PS3 A;  3D9M A;  2OCC E;  3ESK A;  3L22 A;  1HO8 A;  2KZT B;  3C3O A;  3X2Q E;  4HOT A;  3SF4 A;  5B3S E;  3MGB A;  4KVO A;  2YQ8 A;  2V8S E;  4GMJ A;  3ZYL A;  1HE8 A;  2E0I A;  3LKU A;  4BES A;  2XGS A;  3FTX A;  2Q7F A;  5LP0 A;  4D10 C;  1SA4 A;  3IBE A;  2HO1 A;  2R5S A;  2LUH A;  3UTM A;  4CT0 A;  5LOZ A;  4N3C A;  4I9C A;  3ZEF A;  3Q7F A;  1U3C A;  2BKG A;  3ENE A;  3FUK A;  3GYZ A;  4O60 A;  4GPK A;  4E6H A;  4KVM A;  3DPY A;  3IKO B;  1OWL A;  4WAF A;  4GMR A;  3JUE A;  5AYW D;  4P29 A;  4GZ6 A;  2R03 A;  4BTA A;  1NP7 A;  1AP7 A;  4GYY A;  2VQ2 A;  4XKB A;  3AAA C;  1HH8 A;  2CG3 A;  5ENS D;  4RG9 A;  3HYM B;  2MOW A;  4GA2 A;  2AW6 A;  1E7U A;  4ZFH A;  5J08 A;  3MZL B;  4HOU A;  3W9G A;  3K9I A;  1KZO A;  3KSQ A;  3V30 A;  2ZIS A;  2AWI A;  5KNH D;  5D2M C;  3O4Z A;  2YIN A;  3PZ4 A;  3FU0 A;  3L13 A;  4XX5 A;  3QWV A;  2B6C A;  3I3N A;  4L7T A;  4FJY A;  2V4L A;  2DCP A;  2VSX E;  1GW6 A;  1TEZ A;  3MYV A;  2F8Y A;  1Q2Z A;  2ZXW E;  2JAB A;  2WXG A;  4DRX E;  1XNF A;  1JCS A;  4APF A;  2X3M A;  5G55 A;  1YCS B;  3T9K A;  1AWC B;  3WG7 E;  3AG1 E;  4FP7 A;  5IY5 E;  4AIF A;  5LX8 A;  5T3R A;  3UUX A;  2EIN E;  3L54 A;  2UWJ G;  5AIJ A;  4A3V A;  2J08 A;  4ANU A;  3G2S A;  2J9Q A;  4K5C A;  4CDR A;  4ANX A;  3TJP A;  3EU9 A;  3TGO A;  4YVQ C;  3D9I A;  1N4S A;  1V55 E;  3UKR G;  1OCO E;  1BI8 B;  4UWK A;  2X38 A;  3OAW A;  4FC8 A;  3SD5 A;  3B7R L;  4FLB A; 
#chains in the Genus database with same CATH homology
 1OWO A;  2LSV A;  5G04 C;  5J90 A;  2I1J A;  3WXX A;  3PDN A;  3MV2 B;  3QOU A;  3RIB A;  2PM6 A;  3L16 A;  2BUG A;  2UY1 B;  1Z3X A;  1WM5 A;  2J49 A;  4GZC A;  3U3W A;  3CV0 A;  1BPO A;  3FDH A;  4FUL A;  1IYG A;  3GW4 A;  4KBQ A;  4L2L A;  1N54 A;  3QWW A;  3SZ7 A;  4OVU A;  1JPL A;  3CVQ A;  4BX8 A;  3CGH A;  5ANL A;  3FHE A;  3RRM B;  2ZU6 B;  4PS7 A;  3MJW A;  3EHN A;  3CQC B;  1H2V C;  3ZN3 A;  4AY6 A;  3D9J A;  2DBA A;  4NUR A;  5CHE E;  2CHX A;  4GU5 A;  3LDZ A;  4GZ3 A;  3RK6 A;  3ASH A;  4I1M A;  2X6J A;  4L23 A;  1IHG A;  3SBS A;  4LER A;  5DIZ A;  3AS4 A;  2XPY A;  4ILH B;  5E76 A;  1HU3 A;  4IUL A;  3Q15 A;  2WXO A;  4JXT A;  2CFZ A;  5A23 A;  2YHC A;  5C2Y A;  4G1T A;  4I43 A;  3EHM A;  3KS2 A;  4I6G A;  3TL5 A;  4JL0 A;  1ZU2 A;  4BT8 A;  3OXG A;  3O48 A;  1OWN A;  1KT0 A;  2FO7 A;  4HOR A;  2C2L A;  4EBA A;  1JWF A;  3UPV A;  1LF8 A;  3CHR A;  1WAO 1;  3SI5 A;  1OUV A;  2CHZ A;  4CDM A;  2NSZ A;  3AS5 A;  4C0E A;  1N52 A;  2HR2 A;  4AV7 A;  4B0Z A;  1XGW A;  2KCV A;  4UQY A;  4J6I A;  2LO6 A;  4CEM A;  4J0U A;  3C98 A;  3KAE A;  4JHR A;  3JUI A;  3QB2 A;  4LCT A;  3RO3 A;  4BWR A;  3URZ A;  2A5U A;  2QY7 A;  1H2T C;  3UT7 A;  3JQ1 A;  3R7Q A;  3PUK A;  3D9K A;  4FA6 A;  4EEC A;  4WUY A;  4N3B A;  5T4Y A;  2PZI A;  4AM9 A;  4AEZ C;  4C0M A;  3LEW A;  2AVP A;  2WXP A;  3UQ3 A;  3GZ1 A;  4KT6 B;  3PE4 A;  4KYO B;  3S7J A;  2Y4U A;  4I2Z A;  3FH5 A;  3Q4A B;  4JPS A;  3I4R B;  5E75 A;  2FUL A;  4Q69 A;  4AVX A;  3CIA A;  3PE3 A;  3QKY A;  4B94 A;  5CMW A;  5G05 C;  4CGW A;  3CVY A;  5BW8 C;  3FUH A;  4HOS A;  5LCW C;  1S0P A;  4Y6C A;  2X6H A;  3U9W A;  3RRU A;  3JQ0 A;  3CVP A;  2I9C A;  4UWH A;  3ZGQ A;  1PY1 A;  4DPR A;  4TUU A;  2FI7 A;  4MRU A;  2J07 A;  1HG2 A;  4F7A A;  3BEE A;  2LAH A;  1HS6 A;  2WQH A;  2HM8 A;  4DLQ A;  1H0A A;  3CVN A;  1EF1 C;  4ME2 A;  3DBS A;  4XKC A;  2C0L A;  3R7R A;  2WXI A;  5FQ6 A;  3TXM A;  4EZL A;  4AY5 A;  4UI9 J;  5ARG A;  4B8C B;  2C0M A;  4J8D A;  2JEK A;  4JZY A;  4AXH A;  3PEV B;  2J4D A;  3FEY A;  4JA7 A;  1ZBP A;  3JCK C;  3S2A A;  5BUZ A;  4QFV A;  1MHQ A;  2J4B A;  4A1G A;  4DI4 A;  5G04 J;  3FUF A;  3FH8 A;  5BT1 A;  3HVE A;  1FVF A;  2OND A;  4I2W A;  4LUN U;  1WY6 A;  1PC2 A;  5FJY A;  5AEN A;  2GW1 A;  2KAT A;  4L2Y A;  4GZD A;  4KZC A;  2VTB A;  2WQ7 A;  1W3B A;  5JJ6 A;  4UQZ A;  3MA5 A;  4HVB A;  4FAD A;  1JWG A;  5FQ7 A;  3R9A B;  5JHB A;  1MQS A;  1SZA A;  5CMY A;  5ANR A;  3Q49 B;  3UMV A;  3OXL A;  4GCN A;  4KXK B;  3CHM A;  2WXH A;  4KMO A;  1HF8 A;  3PS6 A;  5ARF A;  4EQF A;  5BPP A;  4ILG A;  3TG4 A;  2XCB A;  4EZJ A;  2GGF A;  3SGH A;  4UI9 C;  2OV8 A;  1E8Y A;  3GZS A;  3PH0 C;  3L17 A;  2WXN A;  5ENN A;  5KJN A;  2RD0 A;  4LRZ A;  3ULQ A;  2FBN A;  2XRY A;  4BFR A;  4N2S A;  2PQR A;  4J8S A;  1E96 B;  1Z6T A;  2GRM A;  5JJT A;  3FTS A;  3B7S A;  3CHS A;  2XEV A;  3FUE A;  3IV0 A;  3FU6 A;  2AXU A;  2VSN A;  3EIQ C;  3PEU B;  4Q94 A;  3UX4 A;  4EPZ A;  4FLH A;  1E8W A;  3CVV A;  3FTW A;  2XPI A;  1UJK A;  4A3T A;  3CSF A;  2MHK A;  3SHF A;  4J8E A;  4U63 A;  3G2T A;  3ASF A;  4F3V A;  3ZFW A;  2R59 A;  1UG3 A;  4W9R A;  5FZQ A;  2YHE A;  4YVO A;  4U8H A;  4U0S A;  2PQN A;  3L08 A;  2KZT A;  3QAR A;  4RVB A;  1HG5 A;  2YNQ A;  3TXN A;  3RRN B;  4UWF A;  4CT4 A;  1IQU A;  2OVF A;  3QAQ A;  3FEX A;  4E85 A;  1KT1 A;  4EZK A;  5AJL A;  3DPD A;  3QDN A;  4G2V A;  4AJW A;  4B89 A;  1E8Z A;  1DVP A;  2L0T B;  4CRW A;  1UW4 B;  2NXP A;  4F1S A;  4BTB A;  2WVI A;  3MX3 A;  2WXR A;  3S7D A;  2XGM A;  4WNE A;  3S7F A;  2RG8 A;  3CK7 A;  5KJM A;  3ZYQ A;  3CHO A;  3JYS A;  3FU5 A;  1Y8M A;  2MRI A;  4G25 A;  3RKV A;  3QJZ A;  4J8F A;  3GZ2 A;  5BV0 A;  5G05 J;  4F53 A;  1L5J A;  2X6I A;  1QNF A;  4G26 A;  5CCM A;  3MV3 B;  4URK A;  5LCW J;  2WB2 A;  3FUM A;  4AOF A;  3RO2 A;  5EX3 A;  2XGO A;  1EDU A;  1E8X A;  3D9P A;  3CVU A;  4JA9 A;  3I4G A;  4JC8 A;  1Z3Y A;  3MKR A;  5M72 A;  3FH7 A;  3D9N A;  4ILI A;  3HVE B;  3IHV A;  4ABN A;  2I1K A;  2V5F A;  3LY9 A;  5D0O D;  4B8A A;  4FHK A;  2VTB B;  1UN8 A;  3FUD A;  4FU3 A;  1EPU A;  4GAA A;  4GA0 A;  4N3A A;  4UQX A;  5FQ8 A;  4WNF A;  3PRZ A;  2I6H A;  3G2W A;  3OTN A;  4MS6 A;  4O6F A;  3QK0 A;  1B89 A;  3CHQ A;  3D9L A;  2AXV A;  1HXI A;  3FTU A;  2A4Z A;  3PUJ A;  4G23 A;  3VTX A;  5JHA A;  3D9O A;  5HQ8 A;  2EQX A;  2LSU A;  3ONK A;  1ELR A;  3FTY A;  4WWN A;  4RSY A;  4I1A A;  3FUL A;  3E4B A;  5FZR A;  3FTV A;  3VLE A;  4AP2 A;  4G11 A;  4UWG A;  4CCA A;  3APD A;  4I17 A;  3CKB A;  2IOL A;  4IYP A;  5A7D B;  4U0Z A;  4HFG A;  3B7U X;  2VSY A;  4BSX A;  3VTY A;  1JUQ A;  3I5P A;  2OVB A;  3AU4 A;  5EX0 A;  4JEU A;  4Y6W A;  3CVW A;  3ZYK A;  3ZXS A;  1YA0 A;  3CEQ A;  3ZRH A;  4XI0 A;  2GRL A;  5FZS A;  4N5C A;  4U0U A;  3ASG A;  2KC7 A;  2X6K A;  1HX8 A;  3RJV A;  4XIF A;  3NZU A;  3PVL A;  3PNL B;  4JW1 A;  3CK8 A;  3TG5 A;  4PS3 A;  3D9M A;  2AXZ A;  3ESK A;  3L22 A;  4WWO A;  1HO8 A;  3AS8 A;  1OWM A;  2KZT B;  3CLJ A;  2VYI A;  3HHM A;  3PRE A;  4GZ5 A;  1FVH A;  3MEK A;  2M63 A;  4HOT A;  3P1U A;  5D0Q D;  3SF4 A;  3KD7 A;  2PL2 A;  3FP3 A;  4GYO A;  3MGB A;  3LJ3 A;  3T8M A;  4KVO A;  2YQ8 A;  2XHE A;  2V8S E;  4GMJ A;  3ZYL A;  1NA3 A;  2CHW A;  2BTD A;  1HE8 A;  2E0I A;  3APC A;  3ZPJ A;  2WXL A;  3LKU A;  4FHJ A;  2KCK A;  2PM7 A;  2XGS A;  4K0R A;  4U04 A;  2XQ0 A;  3FTX A;  2Q7F A;  4I1O B;  5LP0 A;  5C1D A;  2ION A;  4D10 C;  1SZ9 A;  2L6J A;  3IBE A;  2HO1 A;  2R5S A;  5KCM A;  2V0P A;  4C9B B;  3U64 A;  4CT0 A;  4TV3 A;  4L1B A;  5LOZ A;  4PUC A;  2KCL A;  3SFZ A;  4N3C A;  1ELK A;  4I9C A;  4H7Y A;  3MKQ A;  5AJD A;  3FFL A;  4MKT A;  4BX9 A;  4DI3 A;  4H7X A;  5EKQ D;  3ZYM A;  5KJK A;  3ZEF A;  4FJZ A;  3QNK A;  3CHP A;  2WQ6 A;  3SNX A;  3BG1 B;  1U3C A;  3FWV A;  3ENE A;  3FUK A;  3GYZ A;  3LY7 A;  4ANV A;  4GPK A;  2XRZ A;  4E6H A;  4KVM A;  2WXQ A;  1SQM A;  3IHY A;  1ELW A;  3LPZ A;  4K03 A;  2WMO A;  3IKO B;  3NQP A;  1Y6I A;  3NZS A;  2WPV A;  1OWL A;  2BF0 X;  3IEG A;  4WAF A;  4JVS A;  3ZIM A;  4N39 A;  3FUI A;  3ML9 A;  2ILR A;  5FWQ A;  3CK9 A;  1KLX A;  1TJF A;  4PH4 B;  4APO A;  2L0I A;  3CVX A;  3ESL A;  4N2Q A;  2XCC A;  5AYW D;  4P29 A;  2LNI A;  4GZ6 A;  3VLD A;  4BTA A;  4MLP A;  1NP7 A;  4GYW A;  4DK5 A;  2VGX A;  4GA1 A;  4GML A;  4BY6 A;  3LS8 A;  4OYS A;  3ZW3 A;  4GYY A;  2VQ2 A;  4XKB A;  3PNT B;  1HH8 A;  2CG3 A;  3APF A;  4RG9 A;  2WXJ A;  3QC1 A;  3HYM B;  2MOW A;  3ASD A;  4GA2 A;  3HDX A;  1X5B A;  2WMN A;  4HS2 A;  4HOQ A;  4NAC A;  3ZHE A;  4ACK A;  2AW6 A;  4V3I A;  3FUN A;  4I6E A;  5G2N A;  3CQG B;  1E7U A;  2WXM A;  3B13 A;  3SBT B;  4HXI A;  5J08 A;  3QWP A;  1U3D A;  3MZL B;  4HOU A;  1H19 A;  2L9B A;  3LVR E;  3FUJ A;  3K9I A;  2CG2 A;  3FU3 A;  3T5V A;  5FQ4 A;  3P2B A;  3FTZ A;  1UN9 A;  3KEZ A;  4RG6 A;  3FY4 A;  4DJA A;  2VJ8 A;  3D3M A;  4GB9 A;  4XI9 A;  2E2E A;  4DLO A;  2P58 C;  3G2V A;  2IOS A;  1FCH A;  2WXF A;  3B7T A;  3G2U A;  3LVQ E;  4M3O A;  2AWI A;  2J09 A;  3HIZ A;  3LXU X;  1QZ2 A;  3O4Z A;  5CCL A;  3CR3 A;  2YIN A;  2QFC A;  3FU0 A;  3L13 A;  4OVV A;  4XX5 A;  1HFA A;  3QWV A;  3CVL A;  3Q5M A;  2IF4 A;  3I3N A;  2UY1 A;  4L7T A;  4ANW A;  3U66 A;  3MCX A;  4IRU A;  1DNP A;  1NZN A;  4FJY A;  1P5Q A;  3ONL A;  2IFU A;  2V4L A;  2DCP A;  5KJL A;  1H2U A;  2VSX E;  4G24 A;  1GW6 A;  1TEZ A;  1NA0 A;  2WM9 A;  3MKQ B;  2VSO E;  5FTP A;  3MYV A;  1VDY A;  3VLF A;  1INZ A;  5JJ7 A;  2XPZ A;  2Y3A A;  4PS8 A;  4JEH A;  2X6F A;  3LY8 A;  4ATG A;  2WXG A;  3U4T A;  3N71 A;  5BNW A;  3CST A;  4UWL A;  1XNF A;  3RU0 A;  3UT8 A;  2LAI A;  3EDT B;  1QQE A;  2X3M A;  4APF A;  5G55 A;  4WNG A;  2CFU A;  5EDS A;  4XZ4 A;  2HYZ A;  3BG0 B;  3LCA A;  4XE0 A;  1H6K A;  2IJG X;  2VGY A;  2VGX B;  3L6A A;  4I9E A;  3NF1 A;  4FP7 A;  4I6J A;  4NRH B;  3OXF A;  4A55 A;  4AIF A;  2JLB A;  4YND A;  5HI7 A;  3LYA A;  1E7V A;  3CKC A;  4U07 A;  2Y4T A;  1UJJ A;  3S7B A;  2R17 C;  3T5X A;  5LX8 A;  5T3R A;  3UUX A;  1OWP A;  3L54 A;  5A6C A;  3ZHE B;  2KM4 A;  4WWP A;  2UWJ G;  3EIJ A;  3PZD A;  5T8I A;  4ACL A;  5AIJ A;  2WXK A;  4LEU A;  4A3V A;  4CGV A;  2J08 A;  4JHK A;  3G2S A;  3EJN A;  1TJC A;  4ANU A;  2J9Q A;  5BV1 A;  2I2O A;  4UI9 K;  5DBK A;  4CDN A;  2DIW A;  4A1S A;  1E90 A;  4R7L A;  4BT9 A;  5FT9 A;  2FF4 A;  4ANX A;  4CDR A;  3Q47 B;  4KZ0 A;  1HZ4 A;  5LFA A;  1PAQ A;  3TJP A;  3ZVV A;  4EBA G;  3TGO A;  2FEZ A;  4HLE A;  2IQC A;  4YVQ C;  3D9I A;  1EYH A;  4WND A;  2OOE A;  4PDX A;  4Q96 A;  4UWK A;  2X38 A;  2IU1 A;  3UT4 A;  3ML8 A;  3TAX A;  3OAW A;  1A17 A;  3AU5 A;  4GCO A;  4JHJ A;  2NC9 A;  4FC8 A;  3SD5 A;  4NQ0 A;  3B7R L;  1IQR A;  4IN3 B;  4FLB A;  4TRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...