3R9AB

Human alanine-glyoxylate aminotransferase in complex with the tpr domain of human pex5p
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
315
structure length
289
Chain Sequence
QFEEENPLRDHPQPFEEGLRRLQEGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACETLRDWLRYTPAYAHLVDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFGLPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine--pyruvate aminotransferase
publication title Molecular requirements for peroxisomal targeting of alanine-glyoxylate aminotransferase as an essential determinant in primary hyperoxaluria type 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transport protein
total genus 116
structure length 289
sequence length 315
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13181 TPR_8 Tetratricopeptide repeat
B PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3r9aB00
4WNGA 4G25A 4YNDA 3UPVA 2HO1A 1W3BA 3Q5MA 4KYOB 3SZ7A 5DBKA 2YHCA 3GW4A 5CCLA 2HR2A 4W9RA 5FZRA 3RU0A 4U0ZA 2ONDA 4GZ6A 1HXIA 3CK7A 2FO7A 5KJLA 4GYWA 3QWWA 1PC2A 3LY9A 3TGOA 1KLXA 3VTXA 3ASDA 3RO2A 2P58C 4AY6A 1XNFA 1OUVA 2PL2A 3Q4AB 4J8FA 2C0MA 2XGMA 3RO3A 4CDRA 1WAO1 2KC7A 3LYAA 2Y4TA 5FT9A 2KCKA 3ULQA 5LCWC 1FCHA 4G26A 3MEKA 3QDNA 3LCAA 4NQ0A 4GYOA 3IEGA 5FZSA 2LSVA 4JL0A 2J9QA 5JJ7A 1WM5A 4H7YA 2UY1A 4GZ5A 3CVQA 2PQNA 4GCNA 3OXLA 4BT8A 2WPVA 4IN3B 2FEZA 3ZHEB 3MV3B 2NC9A 4N2SA 5G05J 4ME2A 3NF1A 3PE3A 4JHRA 3HYMB 4BT9A 2FI7A 1ZBPA 4U04A 3CK9A 4GA1A 2VSYA 2XGSA 3PDNA 4UQZA 3AS5A 3Q47B 1ELWA 2KCVA 3FP3A 4APOA 3AS8A 4I2WA 4U0UA 2XGOA 1HZ4A 5HI7A 3LPZA 3KS2A 4Y6WA 3S7BA 4H7XA 3RJVA 5BT1A 3S7DA 3MKRA 3CVNA 3E4BA 3PE4A 3GZ2A 4G23A 3CEQA 2KCLA 4HOQA 4XIFA 3K9IA 5BW8C 4BWRA 3QOUA 2HYZA 2VGXB 1E96B 1P5QA 3ESKA 3OXGA 4CGWA 1TJCA 1YA0A 4WNEA 1Y8MA 4J0UA 4YVOA 3ZPJA 2UY1B 2FF4A 2DBAA 2Y4UA 3ZN3A 5G04C 4LEUA 3O48A 4BTAA 3AS4A 2VGYA 4NRHB 2OOEA 3TAXA 1QZ2A 2C0LA 5G04J 3BEEA 4BTBA 3Q49B 5EX0A 3ASFA 5LCWJ 4CGVA 4YVQC 4HOUA 3S7FA 3CVLA 2PQRA 5A7DB 5CHEE 4WNFA 3UQ3A 3ZFWA 5BNWA 3ZGQA 4O6FA 3CKBA 2LSUA 2I6HA 4RG6A 3LY7A 2BUGA 4AIFA 4GYYA 5ARGA 3KD7A 4J8EA 4XI9A 1IYGA 5FJYA 3U4TA 2XCBA 4RG9A 4N2QA 4GA2A 2JLBA 3TG5A 4GCOA 2L6JA 4AM9A 3LY8A 2XCCA 3R9AB 3MA5A 4A1SA 2PZIA 2VSNA 3Q15A 4I9EA 4U07A 4I2ZA 3QWVA 2QFCA 5KJMA 5KJKA 4GZ3A 3QKYA 3TG4A 4B94A 3UUXA 4N3AA 3MV2B 1HH8A 3CK8A 4N3CA 5D0QD 3SF4A 3ZHEA 2YQ8A 5CCMA 3ASHA 4F3VA 2GW1A 1IHGA 4JA9A 5KJNA 4GA0A 1KT1A 3GYZA 2VYIA 4HOSA 3RIBA 3CV0A 2V5FA 4I1AA 4J8DA 5D0OD 5FTPA 2WQHA 3FFLA 3WXXA 2XEVA 4I17A 4N39A 1NZNA 5JJTA 3OXFA 5A6CA 3S7JA 2IF4A 5DIZA 4XI0A 4UI9C 4EQFA 2MHKA 4AY5A 3KAEA 1B89A 5FZQA 4WNDA 5C1DA 2Q7FA 3FWVA 4UI9J 2IFUA 4KXKB 3GZ1A 4I9CA 5EX3A 4G1TA 2VGXA 4G2VA 1NA3A 2UWJG 5M72A 4HORA 4ABNA 1KT0A 3N71A 4WUYA 4UQYA 4HOTA 5AYWD 3LKUA 3RKVA 1ELRA 3URZA 2FBNA 1NA0A 1A17A 5JJ6A 5G05C 5ARFA 2E2EA 4G24A 2C2LA 3VTYA 2R5SA 3QWPA 4JA7A 5HQ8A 2AVPA 3EDTB 3ASGA 4UI9K 2KATA 3JYSA 4UQXA 4U0SA 2XPIA 4Y6CA 2VQ2A 2LNIA 3U3WA 4N5CA 3CVPA 1ZU2A 4GPKA 4N3BA 3CKCA 5EKQD 1QQEA 4KBQA
chains in the Genus database with same CATH superfamily
1OY3D 4G25A 4AJWA 5CMWA 3ASOE 3Q5MA 1L5JA 2CG3A 3QNKA 2XEEA 4M3OA 2HR2A 3FU5A 1TYQG 3RU0A 4K5CA 2E0IA 5CBNA 4O1PA 4GZ6A 2CG2A 2CHXA 1HXIA 1OWOA 3CK7A 4FHKA 2FO7A 3ULYA 3E30A 1UOHA 5LX8A 2P58C 5EILA 5BV0A 3CHRA 3Q4AB 5FWQA 5D2MC 4LCTA 3APFA 3LYAA 4OAVB 1UN9A 5FT9A 2KCKA 5LCWC 4CRWA 1TNZA 3R7RA 1QYMA 1TN6A 3EIQC 4K5AB 4BY6A 2FO1E 3CQCB 3LS8A 3B7UX 3LCAA 4L2LA 2H6IA 4NQ0A 3IEGA 4A55A 4F6RD 3T5XA 3G2VA 3APCA 4TRQA 1N54A 3MGBA 2UY1A 3J5PA 2DYRE 3CVQA 3MJWA 2CHZA 4IN3B 3KSQA 4CCAA 1E8ZA 2RG8A 4N2SA 5G05J 2X6KA 4UUCA 1N11A 5JA4D 1WG0A 3HYMB 4EZKA 1ZBPA 4U04A 4Z68A 2JEKA 4GA1A 3ZU7B 2DYSE 3PDNA 1ELWA 2R03A 4C48B 5AARA 4U0UA 3CVUA 3LPZA 4MKTA 3S7BA 1K1BA 3UM0A 3PNTB 3S7DA 3CR3A 3CVNA 3PH0C 5B1BE 5EYLA 4QFVA 3UT4A 3K9IA 5BW8C 1N4PA 4L23A 3FTSA 4J8YA 4I6JA 3DSUA 4AEZC 4JB8P 1YA0A 1SA5A 4WNEA 5BPPA 4J0UA 1IKND 3FTWA 3MX3A 1K8KG 3ZPJA 2UY1B 2DBAA 5FQ8A 5AQ9A 4FJZA 3ZRHA 3C72A 4BTAA 2R59A 5CEAA 4NRHB 2X6IA 3UTMA 3FUDA 2C0LA 5G04J 3EU9A 4LRZA 1BLXB 3ASFA 5LCWJ 4YVQC 4HLEA 3VLFA 2PQRA 5A7DB 1FT1A 3DXKG 2VJ8A 3E33A 1WDYA 3AU4A 1BI8B 1SA4A 2I1JA 3FH7A 5D66A 3ZGQA 5AENA 2ZGDA 2LSUA 4DI4A 2DZNA 4RG6A 3ZYLA 3LY7A 5LOZA 2BUGA 3UM1A 3BG0B 2PM6A 5ARGA 1DCQA 1O1SA 5KCMA 2XCBA 4GA2A 2JLBA 4FULA 4GCOA 2GRRB 3LY8A 1S0PA 3MA5A 4TUMA 4A1SA 3T8KA 2ZGGA 3Q78A 4LNBA 2V4LA 2IJGX 4GU5A 2WXJA 4CT0A 5JHAA 4I2ZA 4BSXA 5B1AE 4HRMB 4ANXA 2BEDA 5KJKA 3TG4A 3J5QB 3Q73A 5G2NA 2X6JA 3BU8A 5J90A 4N3CA 4IRUA 3SF4A 4Q69A 2ZXWE 3ASHA 1IHGA 4JA9A 2OV8A 2V4HC 3TWSA 4EHMA 4PDXA 2F8YA 3JQ0A 3UKUG 5BXUA 1H6PA 3VLEA 2EILE 3ML8A 2V5FA 1TR4A 2WQHA 1U2VG 3FTVA 2IY0C 1E8YA 2EIME 3FFLA 1BI7B 4LNUD 2P9IG 3CGHA 4CT4A 4N39A 2R2LA 4HXIA 3SI5A 3OXFA 2J07A 1Z3YA 5JHBA 3D3MA 3NQPA 4XI0A 4UI9C 3CLJA 2MHKA 5BXOA 4DX7D 1PY1A 3CVYA 2I1KA 4KXKB 5EX3A 1SZ9A 4HORA 3GZSA 4WUYA 3PZ2A 5AYWD 3OTNA 2BKGA 3E37A 4XZ4A 2LXMA 1TNYA 2WXFA 4HNAD 5JJ6A 4HLLA 1KZPA 2XRZA 4JA7A 5HQ8A 4BEPA 3D9PA 3ASGA 4UI9K 4U63A 4UQXA 3JYSA 2BKKB 2BF0X 3UIOC 2ETCA 1QBQA 3FTUA 5A23A 1N4QA 2LNIA 3DWLG 3LXUX 4HVBA 4GZDA 3U3WA 2ZU6B 5BV1A 5ENPD 3AG1E 2CFZA 3CVPA 3PUKA 4ILIA 1OXJA 1ZU2A 2X6HA 4FLHA 2FI7A 1MX6A 4WNGA 4FC8A 2VSXE 3UPVA 2XPZA 3QB2A 3PEVB 1H6KA 3AG4E 2OCCE 4XX5A 2B0OE 2QZAA 4W9RA 4MS6A 5LFAA 5FZRA 1K3ZD 3DRAA 3UM3A 1E7UA 2ONDA 4GYWA 5T8IA 4KVOA 4CDMA 1N52A 4GZCA 3VTXA 3ASDA 4GTRA 4NIKA 3V31A 4AY6A 1SVXA 3NB2A 2XGMA 3D9IA 2VGEA 4GPMA 3L16A 4ANWA 4CDRA 2Y3AA 1WAO1 3SQVA 2Y4TA 3SD5A 1MJ0A 3ULQA 3O4ZA 1N4SA 4J7WA 1MZCA 4DUIA 1BU9A 3JUEA 2IO3C 4R7LA 1KZOA 4N5QA 1EYHA 4GYOA 3HDXA 4JL0A 3APDA 3NOCD 3TWXA 2WXGA 5JJ7A 4DX1A 4H7YA 2GRLA 1TNBA 3C3QA 3TWUA 4F7AA 4I6EA 4YDWA 1HX8A 3ZYQA 2V0PA 4BT8A 2FEZA 3Q9NC 2NC9A 4L2YA 2WXRA 2MRIA 4JHRA 2V8SE 3CHSA 3CK9A 4P29A 4MBGA 4U8HA 2WXOA 2VSYA 4GTOA 2M63A 1UW4B 4UQZA 3AS5A 3Q47B 4APOA 1NI1A 2NYJA 2EIJE 4JXTA 4AXHA 1HZ4A 5HI7A 5T3RA 2ETBA 4B93B 2Y0BG 2R05A 4G8KA 5BT1A 3CHPA 3T8MA 2WXKA 4UWLA 4DK5A 4U96D 2L9BA 3CEQA 2F37A 2P2CP 3HHMA 2HE0A 4HOQA 3SFYA 2XZDG 3I3NA 4XIFA 3D9OA 3FTXA 4BETA 3RRMB 1ZB1A 4GTSA 3JQ1A 3OXGA 3V2XA 2KZTA 5ENNA 3D9LA 4GTVA 4G11A 4JD2G 3PZ3A 3RK6A 1IHBA 5G04C 3SFXA 4K5BA 5AJLA 4B89A 5FIOA 3O48A 2VGYA 3HXFA 1QZ2A 3PZDA 4UWFA 3ISMC 3HVEA 2AWIA 2DIWA 4CEMA 1AP7A 3MKQA 4BTBA 1JWGA 1H0AA 5CRUA 5CRVA 1FVFA 1O1TA 3C3RA 3T9KA 1HS6A 3UQ3A 3FDHA 4RQIA 3B13A 5ENTD 4HRLA 4O6FA 2LUHA 4JZYA 3CKBA 5C2YA 1JWFA 3FUJA 1YCSB 3TWTA 2WXPA 4GTMA 2H6HA 2I6HA 2P9UG 2LAHA 4AIFA 1BPOA 4GYYA 2QC9A 1H2VC 2GRNB 3G2TA 4XI9A 1BD8A 1D8EA 4WWOA 2AXZA 3DBSA 1E90A 4RG9A 3HRAA 3TG5A 3FU3A 4XE0A 4A3VA 2XCCA 3R9AB 2KZTB 3I5PA 1OWMA 3V2OA 5CERB 2XEHA 4YDYA 2OEWA 1LF8A 3UM2A 1HFAA 2WM9A 5KJMA 2AJAA 2BTDA 4N3AA 3Q9UC 4APFA 3HVEB 3CK8A 2MYOA 2J8SD 3ZHEA 2YQ8A 3MKQB 5CCMA 1K1AA 3PZ4A 4HS2A 3ESLA 2GRMA 2QYUA 5KJNA 1TNOA 3FHEA 3GYZA 2J09A 3FU6A 1UN8A 4BSZB 3ZUVB 1JCQA 3CV0A 2EQXA 5D0OD 5AIJA 1YYHA 4JPSA 1S63A 4K03A 1NZNA 3DSTA 3SGHA 3ABME 3NZSA 3S7JA 2OVBA 4WAFA 5IY5E 4I43A 3JCKC 4CYMD 2XPYA 1B89A 5FZQA 3U9WA 4TXRA 3AG2E 5FQ4A 3PZ1A 3GZ1A 4B8CB 1X81A 4DRXE 3G2WA 2VGXA 2B6CA 4FHJA 1KT0A 3N71A 4UQYA 4HOTA 5EYPF 3LKUA 4GMRA 4JVSA 2F0YA 1DNPA 1E8WA 3EHNA 3URZA 3SBSA 5CMYA 3UT7A 1NA0A 5ENOD 1A17A 1H2UA 4G24A 3VTYA 3QWPA 4URKA 2WXNA 3DEPA 3B95A 2DWZA 4X8QA 3V30A 4DPRA 1JCSA 3UIPC 2GGFA 3QJZA 2P9LG 3AJIA 2RKKA 2IOLA 2V5QC 1NFIE 3FTZA 2I2OA 2P9PG 4HBDA 4U8YD 5EKQD 3UX4A 1QQEA 4KBQA 5ANLA 5KBAA 1WY6A 4RLYA 4YNDA 3X2QE 3JUIA 2HO1A 4KYOB 1MX4A 3SZ7A 2YHCA 4DLOA 3GW4A 4ATZD 5ITZF 4E85A 5CCLA 1HG5A 3TWQA 2NSZA 3HXDA 3T5VA 1UJKA 4C9BB 3R9MA 4YDOA 3UT8A 3QWWA 3TL5A 1DC2A 3LY9A 3TGOA 4J6IA 4FU3A 3RO2A 2IOSA 3NAWA 2PL2A 4EECA 4J8FA 1VDYA 2C0MA 3RO3A 4WWNA 2ILRA 2A5EA 2X3MA 2OVFA 3QAQA 2WB2A 2KC7A 1TJFA 1YMPA 1PAQA 3C98A 2P9NG 2WXMA 3IKOB 4WWPA 3EJNA 3QK0A 1FCHA 1H19A 3D9NA 5EIDA 4LSZE 5AJDA 3EHQA 3SY2A 1A5EA 2LSVA 2EINE 1INZA 4A63B 4JW1A 4GTPA 1H6OA 4F1SA 3V79K 4GZ5A 1H2TC 3LJNA 4L1BA 2PQNA 4GTQA 4GCNA 4GTTA 4K0RA 3FUFA 3ZXSA 4I1MA 3MV3B 2J4DA 4KT6B 3NF1A 3FUNA 3PVLA 4BT9A 2XGSA 3L22A 5AQ7A 4ANUA 1KPSB 3FP3A 3DSVA 1Z6TA 4HFGA 1RZ4A 1SZAA 3RRUA 4I2WA 2WQ7A 2A5UA 2XGOA 2DZOA 3L54A 2QY7A 4Y6WA 4H7XA 2P9SG 4HB5A 4FA6A 3MKRA 5BUZA 1NL4A 3E4BA 5FINA 4AP2A 3PE4A 2KCLA 2IU1A 1TN7A 2KXPC 3IXEA 2LO6A 3L08A 5EN5D 3SHFA 3E32A 3FUIA 3ZKJA 1E96B 2XQ0A 1P5QA 3ESKA 4HI8A 3LJ3A 4EZJA 2FF4A 4G8LA 3ZN3A 3Q75A 3TWWA 3CVXA 3FH5A 2OOEA 2L6BA 2XRYA 4D10C 4KZ0A 3JXIA 3R7QA 3ABKE 3Q49B 4JC8A 5EX0A 2L0IA 4O60A 4B8AA 2YHEA 4HOUA 2XHEA 3S7FA 3TWRA 4BX8A 4JEUA 1HF8A 1DCEA 3QARA 1N0RA 3ZVVA 2L0TB 5CECB 4GMLA 3ZFWA 5BNWA 4ILGA 4YDEA 4DI3A 4CZ2D 4A1GA 4Q96A 4J8EA 3MZLB 3EIJA 4ZHBA 3HXCA 4OAUC 5FJYA 4ACKA 2MOWA 4N2QA 4RSYA 2ETAA 4AM9A 3IBEA 1U3DA 4PH4B 3Q15A 1HO8A 3CVWA 3I4RB 3NOGD 3L82A 3BUAA 3CSFA 4I9EA 3LVQE 3TWVA 1JUQA 3BG1B 4U95D 4EBAG 2QFCA 2Y69E 4B94A 4J8SA 3UUXA 3B7RL 5ENQD 3MV2B 3B7TA 2R17C 2KM4A 3CHMA 3L9TA 5D0QD 3U66A 4IULA 4UWHA 2NXPA 2AXUA 3DSWA 2QYJA 3B7SA 4HQDA 3W9GA 3AAAC 3ZIMA 2VYIA 3E34A 4HOSA 3LVRE 3WG7E 3RIBA 1RW2A 1S64A 1XGWA 3MYVA 4J8DA 5FTPA 4ANVA 4HRNA 1Z3XA 4L7TA 3LEWA 1IQRA 4PS8A 3L6AA 3Q7AA 4BFRA 3HG0D 4I6GA 5AQAA 3SBTB 5JJTA 2IF4A 3CIAA 3FEXA 3RAUA 4EQFA 2WMNA 4AY5A 5LP0A 4KZCA 2WVIA 3KAEA 5C1DA 2LAIA 2Q7FA 3FWVA 2IFUA 2IEJA 3HXEA 4G1TA 3L17A 1TNUA 5E75A 4G2VA 3ULEG 4XKCA 3OAWA 2UWJG 5AAOA 2X6FA 1EPUA 1MHQA 3RKVA 1UJJA 3BQOA 3I4GA 4HI9A 5ARFA 1V55E 2R5SA 1Y6IA 2WXHA 1MYOA 4OYSA 2AVPA 5EIBE 4TUUA 4TXQA 5ENRD 2KATA 3FULA 3D9JA 3D9MA 4U8VD 4JHJA 2VQ2A 4F53A 2CFUA 3TXNA 3PREA 4GAAA 3MCXA 4GPKA 3CKCA 4OVVA 3IHVA 3B7BA 5FQ7A 4LNGA 2A4ZA 1JPLA 1N4RA 1W3BA 3UKRG 3DSSA 1UG3A 5DBKA 2DVWA 3DEOA 3QC1A 3KEZA 3FUMA 1NP7A 3P1UA 3EUVA 3FEYA 4XEIG 1OWLA 1N95A 5FQ6A 4U0ZA 3TXMA 1EF1C 5KJLA 1TEZA 4A3TA 1PC2A 1X5BA 1KLXA 2J08A 1XNFA 1OUVA 2OEVA 2EIKE 4U7EB 4DJAA 2RFAA 1FT2A 5KNGA 5HKPA 2XS1A 3D9HA 3ONKA 3KEAA 5E76A 4G26A 3MEKA 3QDNA 2WQ6A 5FZSA 2J9QA 2IQCA 3ZNGA 5KWDA 1WM5A 1QNFA 1OWPA 4EPZA 1N0QA 4LERA 2IO2C 3EHRA 3OXLA 3Q7FA 5G55A 5AQBA 2WPVA 4NACA 3EHMA 3ZHEB 2AW6A 2XZTG 3UI2A 5JMND 2VTBA 4ME2A 3PE3A 2PNNA 4AVXA 4I1OB 5J08A 2PM7A 2R02A 1OCZE 3ZEFA 5CBOA 3ZW3A 3CQGB 3DXMG 1OCRE 2HM8A 3HXBA 3ABLE 3ASNE 2KCVA 3AS8A 2I9CA 3PS6A 3HIZA 1U3CA 2H6GA 5AN8A 4JHKA 4UWGA 1TN8A 5EDSA 3ML9A 3KS2A 3JXJA 3RJVA 1N94A 2P9KG 3PEUB 2H6FA 3PNLB 3GZ2A 2J4BA 4G23A 3SFZA 4KMOA 3SO8A 1DVPA 3UXGA 1E7VA 3F6QA 4BWRA 3ZYKA 2J49A 3QOUA 3IV0A 2HYZA 2VGXB 2YINA 4CGWA 4E6HA 1TJCA 4DX6D 1Y8MA 3CHQA 1V54E 4YVOA 3FTYA 4AOFA 3U64A 3FUKA 2Y4UA 4EBAA 4PS7A 4LEUA 2JABA 2GRPB 1GW6A 4EZLA 5HS0A 2KBXA 4IYPA 3AS4A 3RSEG 3NBNB 4DLQA 4DX5D 3TAXA 3TJPA 4ZFHA 1HG2A 2VTBB 3BEEA 4BESA 5ANRA 3Q79A 3RRNB 4B0ZA 3DPDA 3ZYMA 3C3OA 4F1PA 4CGVA 1LD8A 3ENEA 3CVLA 3FU0A 1S70B 5CHEE 4WNFA 2IONA 4BERA 2VSOE 1ELKA 2ZIRA 2CHWA 1EDUA 1D9SA 4LG6A 4DX2A 3SNXA 1OT8A 1FVHA 4PS3A 4OVUA 1O5MA 3ONLA 2Y1LE 5KNHD 4JEHA 1D8DA 4V3IA 5T4YA 3L13A 1N9AA 4UWKA 3KD7A 1IYGA 3FUEA 1SW6A 4ACLA 5H7PA 1G3NB 3U4TA 1HE8A 2L6JA 2PZIA 2VSNA 3D9KA 1HU3A 2DCPA 1Q2ZA 2RFMA 4LUNU 3FUHA 4U07A 4C0MA 3CSTA 3QWVA 4GZ3A 3P2BA 1OCOE 3QKYA 2YNQA 2GROB 4FLBA 2RD0A 1LD7A 3G2UA 4XKBA 1HH8A 1OCCE 4RVBA 1OWNA 3DSXA 4F3VA 1IXVA 2GW1A 2XS8A 2GRQB 3S2AA 4Q94A 4GA0A 2F8XK 1KT1A 3LDZA 4MRUA 2FULA 5CEDB 3C5RA 4PUCA 4TXPA 4I1AA 1JCRA 3WXXA 3CHOA 2XEVA 3FY4A 4I17A 4FJYA 3AU5A 4M7CA 4FP7A 5B3SE 3VLDA 5A6CA 4GB9A 5DIZA 4O1OA 1SQMA 4TV3A 4L9PA 3IHYA 2WXQA 4WNDA 3PUJA 2LXLA 3AG3E 3UMVA 4ILHB 4C0EA 4UI9J 2WXLA 5HRYA 4I9CA 1LTXA 3FH8A 4QQIA 1MQSA 5ENSD 3UINC 3DPYA 4GMJA 1NA3A 1AWCB 5M72A 4ABNA 2WXIA 3W9FA 4CDNA 4FADA 1MX2A 4NURA 1ELRA 3KSLA 4BX9A 2FBNA 5G05C 2E2EA 2C2LA 2XENA 3ZXPA 3EDTB 1E8XA 1Z5SC 3NZUA 3PRZA 4U0SA 1IQUA 1FPPA 2XPIA 4Y6CA 4ATGA 4MLPA 3CVVA 3EU5A 2WMOA 2ZISA 2AXVA 1O1RA 2X38A 4N5CA 4N3BA 3G2SA 4AV7A 4KVMA
chains in the Genus database with same CATH topology
5ANLA 4WNGA 2A4ZA 1WY6A 4G25A 4FC8A 2VSXE 4YNDA 4AJWA 3JUIA 3UPVA 1JPLA 2HO1A 1W3BA 5CMWA 2XPZA 3QB2A 3Q5MA 3PEVB 1L5JA 4KYOB 2CG3A 3QNKA 3SZ7A 1UG3A 5DBKA 1H6KA 2YHCA 4M3OA 4DLOA 3GW4A 3QC1A 3KEZA 3FUMA 4E85A 1NP7A 2HR2A 5CCLA 4XX5A 1HG5A 3P1UA 2NSZA 3FU5A 4W9RA 3FEYA 4MS6A 5LFAA 5FZRA 3RU0A 1OWLA 2E0IA 3T5VA 1E7UA 1UJKA 5FQ6A 4U0ZA 2ONDA 4GZ6A 2CG2A 2CHXA 3TXMA 1HXIA 1OWOA 3CK7A 4FHKA 4C9BB 2FO7A 1EF1C 5KJLA 4GYWA 3UT8A 3QWWA 5T8IA 4A3TA 1TEZA 1PC2A 4KVOA 1X5BA 3TL5A 4CDMA 1N52A 3LY9A 4GZCA 3TGOA 4J6IA 4FU3A 1KLXA 3VTXA 3ASDA 3RO2A 2IOSA 2J08A 5LX8A 2P58C 4AY6A 1XNFA 1OUVA 5BV0A 2PL2A 3CHRA 4EECA 3Q4AB 4J8FA 1VDYA 2C0MA 2XGMA 3D9IA 3RO3A 4DJAA 4WWNA 2ILRA 5FWQA 4LCTA 3L16A 2X3MA 4ANWA 4CDRA 2Y3AA 3APFA 1WAO1 2OVFA 3QAQA 2WB2A 2KC7A 1TJFA 2Y4TA 3LYAA 3SD5A 1UN9A 5FT9A 1PAQA 3ONKA 2KCKA 3C98A 3ULQA 2WXMA 3IKOB 4WWPA 3O4ZA 5LCWC 4CRWA 3R7RA 3EJNA 3EIQC 3QK0A 1FCHA 5E76A 1H19A 4G26A 3MEKA 3D9NA 4BY6A 5AJDA 3QDNA 3CQCB 3LS8A 4R7LA 3B7UX 3LCAA 2WQ6A 4L2LA 4NQ0A 1EYHA 4GYOA 3HDXA 3IEGA 5FZSA 4A55A 2LSVA 4JL0A 1INZA 3T5XA 2J9QA 3APDA 2IQCA 4JW1A 3G2VA 2WXGA 5JJ7A 1WM5A 1QNFA 1OWPA 2GRLA 3APCA 1N54A 3MGBA 4H7YA 4TRQA 4F1SA 2UY1A 4GZ5A 4F7AA 4I6EA 4EPZA 3CVQA 4LERA 1HX8A 3ZYQA 1H2TC 4L1BA 2PQNA 3MJWA 2V0PA 4GCNA 3OXLA 5G55A 4K0RA 2CHZA 3FUFA 4BT8A 2WPVA 4IN3B 4NACA 2FEZA 4CCAA 3EHMA 3ZXSA 4I1MA 1E8ZA 3MV3B 2AW6A 2NC9A 2RG8A 2J4DA 4L2YA 3ZHEB 4N2SA 2WXRA 5G05J 4KT6B 4ME2A 2X6KA 2VTBA 3NF1A 3PE3A 2MRIA 4JHRA 4AVXA 4I1OB 3FUNA 5J08A 2V8SE 3PVLA 2PM7A 3HYMB 3CHSA 3ZEFA 4BT9A 4EZKA 3ZW3A 3CQGB 1ZBPA 4U04A 3CK9A 4P29A 4U8HA 2JEKA 2WXOA 4GA1A 2VSYA 2HM8A 2XGSA 3L22A 2M63A 3PDNA 4ANUA 1UW4B 4UQZA 3AS5A 3Q47B 1ELWA 2KCVA 3FP3A 4APOA 3AS8A 2I9CA 4KBQA 3PS6A 1Z6TA 3HIZA 4HFGA 1SZAA 1U3CA 3RRUA 4JHKA 4I2WA 2WQ7A 4U0UA 4UWGA 4JXTA 3CVUA 4AXHA 2A5UA 2XGOA 5EDSA 1HZ4A 5HI7A 5T3RA 3LPZA 4MKTA 3L54A 2QY7A 3ML9A 3KS2A 4Y6WA 3S7BA 4H7XA 3RJVA 4FA6A 5BT1A 3CHPA 3T8MA 3PEUB 3PNTB 3S7DA 3MKRA 3CR3A 3CVNA 5BUZA 2WXKA 3E4BA 4UWLA 3PH0C 4AP2A 3PNLB 3PE4A 4DK5A 3GZ2A 2J4BA 4G23A 3SFZA 2L9BA 4KMOA 3CEQA 4AV7A 2KCLA 1DVPA 2IU1A 3HHMA 1E7VA 4HOQA 4QFVA 3UT4A 3I3NA 2LO6A 3L08A 4XIFA 3K9IA 5BW8C 4BWRA 3ZYKA 3D9OA 3FTXA 3RRMB 2J49A 3QOUA 4L23A 3IV0A 3FTSA 4I6JA 2HYZA 3SHFA 4AEZC 3FUIA 2VGXB 1E96B 2XQ0A 3JQ1A 1P5QA 2YINA 3ESKA 3OXGA 4CGWA 4E6HA 2KZTA 1TJCA 1YA0A 5ENNA 3LJ3A 3D9LA 4EZJA 4WNEA 4G11A 5BPPA 1Y8MA 3CHQA 4J0UA 3FTWA 3MX3A 4YVOA 3FTYA 3ZPJA 2UY1B 3RK6A 2FF4A 2DBAA 4AOFA 3U64A 3FUKA 2Y4UA 3ZN3A 4PS7A 5FQ8A 4EBAA 5G04C 4LEUA 5AJLA 4FJZA 1GW6A 4B89A 4EZLA 3ZRHA 3O48A 4BTAA 2R59A 3AS4A 2VGYA 4IYPA 3CVXA 3FH5A 2OOEA 4NRHB 2XRYA 4D10C 4DLQA 4KZ0A 2X6IA 3TAXA 1QZ2A 3PZDA 3TJPA 4UWFA 3FUDA 2C0LA 5G04J 1HG2A 2VTBB 3HVEA 2AWIA 3BEEA 2DIWA 5ANRA 3RRNB 4B0ZA 4CEMA 3DPDA 4LRZA 3MKQA 3R7QA 3ZYMA 4BTBA 3Q49B 1JWGA 4JC8A 5EX0A 1H0AA 3ASFA 5LCWJ 4CGVA 1FVFA 4YVQC 4HLEA 2L0IA 4B8AA 2YHEA 4HOUA 2XHEA 3S7FA 3ENEA 3CVLA 3VLFA 3FU0A 2PQRA 1HS6A 5A7DB 4BX8A 4JEUA 1HF8A 5CHEE 4WNFA 2IONA 2VJ8A 3UQ3A 5HQ8A 3FDHA 2VSOE 1ELKA 3B13A 3QARA 3AU4A 3ZVVA 2L0TB 2CHWA 2I1JA 4GMLA 1EDUA 3FH7A 3ZFWA 5BNWA 3ZGQA 4O6FA 5AENA 4JZYA 3CKBA 5C2YA 3SNXA 1JWFA 2LSUA 4ILGA 3FUJA 1FVHA 2WXPA 4PS3A 4OVUA 2I6HA 3ONLA 4DI4A 4RG6A 2LAHA 3LY7A 5LOZA 3ZYLA 4DI3A 2BUGA 4AIFA 1BPOA 4GYYA 4JEHA 1H2VC 3BG0B 4V3IA 4A1GA 5T4YA 3L13A 4Q96A 4UWKA 2PM6A 5ARGA 3KD7A 3G2TA 4J8EA 4XI9A 3MZLB 1IYGA 3FUEA 3EIJA 4ACLA 4WWOA 2AXZA 3DBSA 5FJYA 5KCMA 4ACKA 1E90A 2MOWA 2XCBA 4RG9A 3U4TA 4N2QA 4GA2A 2JLBA 3TG5A 3FU3A 4FULA 4XE0A 1HE8A 4GCOA 2L6JA 4RSYA 4A3VA 4AM9A 3IBEA 3LY8A 1S0PA 1U3DA 2XCCA 3R9AB 3MA5A 4A1SA 2KZTB 2PZIA 3I5PA 2VSNA 4PH4B 1OWMA 3D9KA 3Q15A 1HO8A 3CVWA 1HU3A 2V4LA 3I4RB 2DCPA 2IJGX 3CSFA 4GU5A 2WXJA 4I9EA 4CT0A 3LVQE 1LF8A 4LUNU 4U07A 3FUHA 4C0MA 4I2ZA 1JUQA 5JHAA 1HFAA 4BSXA 2WM9A 3BG1B 3CSTA 4EBAG 4ANXA 3QWVA 2QFCA 5KJMA 5KJKA 4GZ3A 3P2BA 2BTDA 3QKYA 3TG4A 4B94A 2YNQA 4J8SA 4FLBA 3UUXA 3B7RL 4N3AA 2RD0A 5G2NA 3MV2B 2X6JA 3B7TA 5J90A 2R17C 3G2UA 3HVEB 2KM4A 4APFA 4XKBA 1HH8A 3CK8A 3CHMA 4IRUA 4N3CA 5D0QD 3SF4A 3ZHEA 4Q69A 2YQ8A 3MKQB 4RVBA 5CCMA 3U66A 1OWNA 4IULA 3ASHA 4UWHA 4F3VA 4HS2A 2GW1A 3ESLA 1IHGA 2GRMA 3S2AA 4JA9A 2NXPA 2OV8A 4Q94A 5KJNA 2AXUA 4GA0A 1KT1A 3B7SA 3LDZA 3FHEA 3GYZA 2J09A 3FU6A 4MRUA 2FULA 1UN8A 4PDXA 3ZIMA 3JQ0A 2VYIA 4HOSA 4PUCA 3LVRE 3VLEA 3RIBA 3CV0A 3ML8A 2EQXA 2V5FA 1XGWA 4I1AA 3MYVA 4J8DA 5D0OD 2WQHA 5FTPA 4ANVA 3FTVA 5AIJA 1E8YA 1Z3XA 3FFLA 4L7TA 3LEWA 1IQRA 4PS8A 3WXXA 3CHOA 3L6AA 2XEVA 4JPSA 4BFRA 3CGHA 4CT4A 3FY4A 4I17A 1NZNA 4K03A 4I6GA 4N39A 3SBTB 5JJTA 4FJYA 4HXIA 3AU5A 3SI5A 4FP7A 3SGHA 3VLDA 3OXFA 5A6CA 3NZSA 2IF4A 3CIAA 4GB9A 5DIZA 3S7JA 2J07A 3FEXA 1SQMA 1Z3YA 2OVBA 5JHBA 3D3MA 4TV3A 3NQPA 4WAFA 4I43A 4XI0A 4UI9C 3CLJA 3JCKC 4EQFA 2WMNA 3IHYA 2XPYA 2MHKA 2WXQA 4AY5A 5LP0A 4KZCA 2WVIA 3KAEA 1B89A 5FZQA 4WNDA 3U9WA 5C1DA 5FQ7A 3PUJA 3UMVA 2LAIA 5FQ4A 1PY1A 4ILHB 4C0EA 2I1KA 3CVYA 2Q7FA 3FWVA 4UI9J 2IFUA 2WXLA 3GZ1A 4I9CA 4KXKB 5EX3A 4G1TA 3FH8A 4B8CB 1MQSA 3L17A 5E75A 3G2WA 4GMJA 1SZ9A 2VGXA 4G2VA 1NA3A 4XKCA 3OAWA 4FHJA 2UWJG 5M72A 4HORA 2X6FA 3GZSA 1KT0A 4ABNA 3N71A 2WXIA 4WUYA 1EPUA 4UQYA 4HOTA 5AYWD 4CDNA 3LKUA 3OTNA 4JVSA 4FADA 1MHQA 3RKVA 1DNPA 1E8WA 4NURA 1ELRA 1UJJA 3EHNA 3URZA 3SBSA 4XZ4A 5CMYA 3I4GA 2FBNA 4BX9A 3UT7A 2WXFA 1NA0A 1A17A 5JJ6A 5G05C 5ARFA 1H2UA 2E2EA 4G24A 2C2LA 3VTYA 2XRZA 2R5SA 1Y6IA 2WXHA 3QWPA 4JA7A 4OYSA 4URKA 2AVPA 3D9PA 3ASGA 3EDTB 4UI9K 4TUUA 4U63A 2WXNA 2KATA 3JYSA 4UQXA 1E8XA 3NZUA 2BF0X 3PRZA 4U0SA 1IQUA 2XPIA 4Y6CA 4ATGA 3FULA 3D9JA 4MLPA 3D9MA 4DPRA 4JHJA 3FTUA 2VQ2A 3CVVA 5A23A 2GGFA 3QJZA 2LNIA 2WMOA 3LXUX 4HVBA 2AXVA 4F53A 4GZDA 2CFUA 2IOLA 2X38A 3U3WA 3TXNA 2ZU6B 3PREA 4GAAA 4N5CA 3FTZA 5BV1A 2I2OA 2CFZA 3CVPA 3MCXA 3PUKA 4ILIA 1ZU2A 4GPKA 4N3BA 3G2SA 3CKCA 5EKQD 4OVVA 3UX4A 2X6HA 3IHVA 4FLHA 1QQEA 2FI7A 4KVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WNG A;  4G25 A;  4YND A;  3UPV A;  2HO1 A;  1W3B A;  3Q5M A;  4KYO B;  3SZ7 A;  5DBK A;  2YHC A;  3GW4 A;  5CCL A;  2HR2 A;  4W9R A;  5FZR A;  3RU0 A;  4U0Z A;  2OND A;  4GZ6 A;  1HXI A;  3CK7 A;  2FO7 A;  5KJL A;  4GYW A;  3QWW A;  1PC2 A;  3LY9 A;  3TGO A;  1KLX A;  3VTX A;  3ASD A;  3RO2 A;  2P58 C;  4AY6 A;  1XNF A;  1OUV A;  2PL2 A;  3Q4A B;  4J8F A;  2C0M A;  2XGM A;  3RO3 A;  4CDR A;  1WAO 1;  2KC7 A;  3LYA A;  2Y4T A;  5FT9 A;  2KCK A;  3ULQ A;  5LCW C;  1FCH A;  4G26 A;  3MEK A;  3QDN A;  3LCA A;  4NQ0 A;  4GYO A;  3IEG A;  5FZS A;  2LSV A;  4JL0 A;  2J9Q A;  5JJ7 A;  1WM5 A;  4H7Y A;  2UY1 A;  4GZ5 A;  3CVQ A;  2PQN A;  4GCN A;  3OXL A;  4BT8 A;  2WPV A;  4IN3 B;  2FEZ A;  3ZHE B;  3MV3 B;  2NC9 A;  4N2S A;  5G05 J;  4ME2 A;  3NF1 A;  3PE3 A;  4JHR A;  3HYM B;  4BT9 A;  2FI7 A;  1ZBP A;  4U04 A;  3CK9 A;  4GA1 A;  2VSY A;  2XGS A;  3PDN A;  4UQZ A;  3AS5 A;  3Q47 B;  1ELW A;  2KCV A;  3FP3 A;  4APO A;  3AS8 A;  4I2W A;  4U0U A;  2XGO A;  1HZ4 A;  5HI7 A;  3LPZ A;  3KS2 A;  4Y6W A;  3S7B A;  4H7X A;  3RJV A;  5BT1 A;  3S7D A;  3MKR A;  3CVN A;  3E4B A;  3PE4 A;  3GZ2 A;  4G23 A;  3CEQ A;  2KCL A;  4HOQ A;  4XIF A;  3K9I A;  5BW8 C;  4BWR A;  3QOU A;  2HYZ A;  2VGX B;  1E96 B;  1P5Q A;  3ESK A;  3OXG A;  4CGW A;  1TJC A;  1YA0 A;  4WNE A;  1Y8M A;  4J0U A;  4YVO A;  3ZPJ A;  2UY1 B;  2FF4 A;  2DBA A;  2Y4U A;  3ZN3 A;  5G04 C;  4LEU A;  3O48 A;  4BTA A;  3AS4 A;  2VGY A;  4NRH B;  2OOE A;  3TAX A;  1QZ2 A;  2C0L A;  5G04 J;  3BEE A;  4BTB A;  3Q49 B;  5EX0 A;  3ASF A;  5LCW J;  4CGV A;  4YVQ C;  4HOU A;  3S7F A;  3CVL A;  2PQR A;  5A7D B;  5CHE E;  4WNF A;  3UQ3 A;  3ZFW A;  5BNW A;  3ZGQ A;  4O6F A;  3CKB A;  2LSU A;  2I6H A;  4RG6 A;  3LY7 A;  2BUG A;  4AIF A;  4GYY A;  5ARG A;  3KD7 A;  4J8E A;  4XI9 A;  1IYG A;  5FJY A;  3U4T A;  2XCB A;  4RG9 A;  4N2Q A;  4GA2 A;  2JLB A;  3TG5 A;  4GCO A;  2L6J A;  4AM9 A;  3LY8 A;  2XCC A;  3R9A B;  3MA5 A;  4A1S A;  2PZI A;  2VSN A;  3Q15 A;  4I9E A;  4U07 A;  4I2Z A;  3QWV A;  2QFC A;  5KJM A;  5KJK A;  4GZ3 A;  3QKY A;  3TG4 A;  4B94 A;  3UUX A;  4N3A A;  3MV2 B;  1HH8 A;  3CK8 A;  4N3C A;  5D0Q D;  3SF4 A;  3ZHE A;  2YQ8 A;  5CCM A;  3ASH A;  4F3V A;  2GW1 A;  1IHG A;  4JA9 A;  5KJN A;  4GA0 A;  1KT1 A;  3GYZ A;  2VYI A;  4HOS A;  3RIB A;  3CV0 A;  2V5F A;  4I1A A;  4J8D A;  5D0O D;  5FTP A;  2WQH A;  3FFL A;  3WXX A;  2XEV A;  4I17 A;  4N39 A;  1NZN A;  5JJT A;  3OXF A;  5A6C A;  3S7J A;  2IF4 A;  5DIZ A;  4XI0 A;  4UI9 C;  4EQF A;  2MHK A;  4AY5 A;  3KAE A;  1B89 A;  5FZQ A;  4WND A;  5C1D A;  2Q7F A;  3FWV A;  4UI9 J;  2IFU A;  4KXK B;  3GZ1 A;  4I9C A;  5EX3 A;  4G1T A;  2VGX A;  4G2V A;  1NA3 A;  2UWJ G;  5M72 A;  4HOR A;  4ABN A;  1KT0 A;  3N71 A;  4WUY A;  4UQY A;  4HOT A;  5AYW D;  3LKU A;  3RKV A;  1ELR A;  3URZ A;  2FBN A;  1NA0 A;  1A17 A;  5JJ6 A;  5G05 C;  5ARF A;  2E2E A;  4G24 A;  2C2L A;  3VTY A;  2R5S A;  3QWP A;  4JA7 A;  5HQ8 A;  2AVP A;  3EDT B;  3ASG A;  4UI9 K;  2KAT A;  3JYS A;  4UQX A;  4U0S A;  2XPI A;  4Y6C A;  2VQ2 A;  2LNI A;  3U3W A;  4N5C A;  3CVP A;  1ZU2 A;  4GPK A;  4N3B A;  3CKC A;  5EKQ D;  1QQE A;  4KBQ A; 
#chains in the Genus database with same CATH topology
 1OY3 D;  4G25 A;  4AJW A;  5CMW A;  3ASO E;  3Q5M A;  1L5J A;  2CG3 A;  3QNK A;  2XEE A;  4M3O A;  2HR2 A;  3FU5 A;  1TYQ G;  3RU0 A;  4K5C A;  2E0I A;  5CBN A;  4O1P A;  4GZ6 A;  2CG2 A;  2CHX A;  1HXI A;  1OWO A;  3CK7 A;  4FHK A;  2FO7 A;  3ULY A;  3E30 A;  1UOH A;  5LX8 A;  2P58 C;  5EIL A;  5BV0 A;  3CHR A;  3Q4A B;  5FWQ A;  5D2M C;  4LCT A;  3APF A;  3LYA A;  4OAV B;  1UN9 A;  5FT9 A;  2KCK A;  5LCW C;  4CRW A;  1TNZ A;  3R7R A;  1QYM A;  1TN6 A;  3EIQ C;  4K5A B;  4BY6 A;  2FO1 E;  3CQC B;  3LS8 A;  3B7U X;  3LCA A;  4L2L A;  2H6I A;  4NQ0 A;  3IEG A;  4A55 A;  4F6R D;  3T5X A;  3G2V A;  3APC A;  4TRQ A;  1N54 A;  3MGB A;  2UY1 A;  3J5P A;  2DYR E;  3CVQ A;  3MJW A;  2CHZ A;  4IN3 B;  3KSQ A;  4CCA A;  1E8Z A;  2RG8 A;  4N2S A;  5G05 J;  2X6K A;  4UUC A;  1N11 A;  5JA4 D;  1WG0 A;  3HYM B;  4EZK A;  1ZBP A;  4U04 A;  4Z68 A;  2JEK A;  4GA1 A;  3ZU7 B;  2DYS E;  3PDN A;  1ELW A;  2R03 A;  4C48 B;  5AAR A;  4U0U A;  3CVU A;  3LPZ A;  4MKT A;  3S7B A;  1K1B A;  3UM0 A;  3PNT B;  3S7D A;  3CR3 A;  3CVN A;  3PH0 C;  5B1B E;  5EYL A;  4QFV A;  3UT4 A;  3K9I A;  5BW8 C;  1N4P A;  4L23 A;  3FTS A;  4J8Y A;  4I6J A;  3DSU A;  4AEZ C;  4JB8 P;  1YA0 A;  1SA5 A;  4WNE A;  5BPP A;  4J0U A;  1IKN D;  3FTW A;  3MX3 A;  1K8K G;  3ZPJ A;  2UY1 B;  2DBA A;  5FQ8 A;  5AQ9 A;  4FJZ A;  3ZRH A;  3C72 A;  4BTA A;  2R59 A;  5CEA A;  4NRH B;  2X6I A;  3UTM A;  3FUD A;  2C0L A;  5G04 J;  3EU9 A;  4LRZ A;  1BLX B;  3ASF A;  5LCW J;  4YVQ C;  4HLE A;  3VLF A;  2PQR A;  5A7D B;  1FT1 A;  3DXK G;  2VJ8 A;  3E33 A;  1WDY A;  3AU4 A;  1BI8 B;  1SA4 A;  2I1J A;  3FH7 A;  5D66 A;  3ZGQ A;  5AEN A;  2ZGD A;  2LSU A;  4DI4 A;  2DZN A;  4RG6 A;  3ZYL A;  3LY7 A;  5LOZ A;  2BUG A;  3UM1 A;  3BG0 B;  2PM6 A;  5ARG A;  1DCQ A;  1O1S A;  5KCM A;  2XCB A;  4GA2 A;  2JLB A;  4FUL A;  4GCO A;  2GRR B;  3LY8 A;  1S0P A;  3MA5 A;  4TUM A;  4A1S A;  3T8K A;  2ZGG A;  3Q78 A;  4LNB A;  2V4L A;  2IJG X;  4GU5 A;  2WXJ A;  4CT0 A;  5JHA A;  4I2Z A;  4BSX A;  5B1A E;  4HRM B;  4ANX A;  2BED A;  5KJK A;  3TG4 A;  3J5Q B;  3Q73 A;  5G2N A;  2X6J A;  3BU8 A;  5J90 A;  4N3C A;  4IRU A;  3SF4 A;  4Q69 A;  2ZXW E;  3ASH A;  1IHG A;  4JA9 A;  2OV8 A;  2V4H C;  3TWS A;  4EHM A;  4PDX A;  2F8Y A;  3JQ0 A;  3UKU G;  5BXU A;  1H6P A;  3VLE A;  2EIL E;  3ML8 A;  2V5F A;  1TR4 A;  2WQH A;  1U2V G;  3FTV A;  2IY0 C;  1E8Y A;  2EIM E;  3FFL A;  1BI7 B;  4LNU D;  2P9I G;  3CGH A;  4CT4 A;  4N39 A;  2R2L A;  4HXI A;  3SI5 A;  3OXF A;  2J07 A;  1Z3Y A;  5JHB A;  3D3M A;  3NQP A;  4XI0 A;  4UI9 C;  3CLJ A;  2MHK A;  5BXO A;  4DX7 D;  1PY1 A;  3CVY A;  2I1K A;  4KXK B;  5EX3 A;  1SZ9 A;  4HOR A;  3GZS A;  4WUY A;  3PZ2 A;  5AYW D;  3OTN A;  2BKG A;  3E37 A;  4XZ4 A;  2LXM A;  1TNY A;  2WXF A;  4HNA D;  5JJ6 A;  4HLL A;  1KZP A;  2XRZ A;  4JA7 A;  5HQ8 A;  4BEP A;  3D9P A;  3ASG A;  4UI9 K;  4U63 A;  4UQX A;  3JYS A;  2BKK B;  2BF0 X;  3UIO C;  2ETC A;  1QBQ A;  3FTU A;  5A23 A;  1N4Q A;  2LNI A;  3DWL G;  3LXU X;  4HVB A;  4GZD A;  3U3W A;  2ZU6 B;  5BV1 A;  5ENP D;  3AG1 E;  2CFZ A;  3CVP A;  3PUK A;  4ILI A;  1OXJ A;  1ZU2 A;  2X6H A;  4FLH A;  2FI7 A;  1MX6 A;  4WNG A;  4FC8 A;  2VSX E;  3UPV A;  2XPZ A;  3QB2 A;  3PEV B;  1H6K A;  3AG4 E;  2OCC E;  4XX5 A;  2B0O E;  2QZA A;  4W9R A;  4MS6 A;  5LFA A;  5FZR A;  1K3Z D;  3DRA A;  3UM3 A;  1E7U A;  2OND A;  4GYW A;  5T8I A;  4KVO A;  4CDM A;  1N52 A;  4GZC A;  3VTX A;  3ASD A;  4GTR A;  4NIK A;  3V31 A;  4AY6 A;  1SVX A;  3NB2 A;  2XGM A;  3D9I A;  2VGE A;  4GPM A;  3L16 A;  4ANW A;  4CDR A;  2Y3A A;  1WAO 1;  3SQV A;  2Y4T A;  3SD5 A;  1MJ0 A;  3ULQ A;  3O4Z A;  1N4S A;  4J7W A;  1MZC A;  4DUI A;  1BU9 A;  3JUE A;  2IO3 C;  4R7L A;  1KZO A;  4N5Q A;  1EYH A;  4GYO A;  3HDX A;  4JL0 A;  3APD A;  3NOC D;  3TWX A;  2WXG A;  5JJ7 A;  4DX1 A;  4H7Y A;  2GRL A;  1TNB A;  3C3Q A;  3TWU A;  4F7A A;  4I6E A;  4YDW A;  1HX8 A;  3ZYQ A;  2V0P A;  4BT8 A;  2FEZ A;  3Q9N C;  2NC9 A;  4L2Y A;  2WXR A;  2MRI A;  4JHR A;  2V8S E;  3CHS A;  3CK9 A;  4P29 A;  4MBG A;  4U8H A;  2WXO A;  2VSY A;  4GTO A;  2M63 A;  1UW4 B;  4UQZ A;  3AS5 A;  3Q47 B;  4APO A;  1NI1 A;  2NYJ A;  2EIJ E;  4JXT A;  4AXH A;  1HZ4 A;  5HI7 A;  5T3R A;  2ETB A;  4B93 B;  2Y0B G;  2R05 A;  4G8K A;  5BT1 A;  3CHP A;  3T8M A;  2WXK A;  4UWL A;  4DK5 A;  4U96 D;  2L9B A;  3CEQ A;  2F37 A;  2P2C P;  3HHM A;  2HE0 A;  4HOQ A;  3SFY A;  2XZD G;  3I3N A;  4XIF A;  3D9O A;  3FTX A;  4BET A;  3RRM B;  1ZB1 A;  4GTS A;  3JQ1 A;  3OXG A;  3V2X A;  2KZT A;  5ENN A;  3D9L A;  4GTV A;  4G11 A;  4JD2 G;  3PZ3 A;  3RK6 A;  1IHB A;  5G04 C;  3SFX A;  4K5B A;  5AJL A;  4B89 A;  5FIO A;  3O48 A;  2VGY A;  3HXF A;  1QZ2 A;  3PZD A;  4UWF A;  3ISM C;  3HVE A;  2AWI A;  2DIW A;  4CEM A;  1AP7 A;  3MKQ A;  4BTB A;  1JWG A;  1H0A A;  5CRU A;  5CRV A;  1FVF A;  1O1T A;  3C3R A;  3T9K A;  1HS6 A;  3UQ3 A;  3FDH A;  4RQI A;  3B13 A;  5ENT D;  4HRL A;  4O6F A;  2LUH A;  4JZY A;  3CKB A;  5C2Y A;  1JWF A;  3FUJ A;  1YCS B;  3TWT A;  2WXP A;  4GTM A;  2H6H A;  2I6H A;  2P9U G;  2LAH A;  4AIF A;  1BPO A;  4GYY A;  2QC9 A;  1H2V C;  2GRN B;  3G2T A;  4XI9 A;  1BD8 A;  1D8E A;  4WWO A;  2AXZ A;  3DBS A;  1E90 A;  4RG9 A;  3HRA A;  3TG5 A;  3FU3 A;  4XE0 A;  4A3V A;  2XCC A;  3R9A B;  2KZT B;  3I5P A;  1OWM A;  3V2O A;  5CER B;  2XEH A;  4YDY A;  2OEW A;  1LF8 A;  3UM2 A;  1HFA A;  2WM9 A;  5KJM A;  2AJA A;  2BTD A;  4N3A A;  3Q9U C;  4APF A;  3HVE B;  3CK8 A;  2MYO A;  2J8S D;  3ZHE A;  2YQ8 A;  3MKQ B;  5CCM A;  1K1A A;  3PZ4 A;  4HS2 A;  3ESL A;  2GRM A;  2QYU A;  5KJN A;  1TNO A;  3FHE A;  3GYZ A;  2J09 A;  3FU6 A;  1UN8 A;  4BSZ B;  3ZUV B;  1JCQ A;  3CV0 A;  2EQX A;  5D0O D;  5AIJ A;  1YYH A;  4JPS A;  1S63 A;  4K03 A;  1NZN A;  3DST A;  3SGH A;  3ABM E;  3NZS A;  3S7J A;  2OVB A;  4WAF A;  5IY5 E;  4I43 A;  3JCK C;  4CYM D;  2XPY A;  1B89 A;  5FZQ A;  3U9W A;  4TXR A;  3AG2 E;  5FQ4 A;  3PZ1 A;  3GZ1 A;  4B8C B;  1X81 A;  4DRX E;  3G2W A;  2VGX A;  2B6C A;  4FHJ A;  1KT0 A;  3N71 A;  4UQY A;  4HOT A;  5EYP F;  3LKU A;  4GMR A;  4JVS A;  2F0Y A;  1DNP A;  1E8W A;  3EHN A;  3URZ A;  3SBS A;  5CMY A;  3UT7 A;  1NA0 A;  5ENO D;  1A17 A;  1H2U A;  4G24 A;  3VTY A;  3QWP A;  4URK A;  2WXN A;  3DEP A;  3B95 A;  2DWZ A;  4X8Q A;  3V30 A;  4DPR A;  1JCS A;  3UIP C;  2GGF A;  3QJZ A;  2P9L G;  3AJI A;  2RKK A;  2IOL A;  2V5Q C;  1NFI E;  3FTZ A;  2I2O A;  2P9P G;  4HBD A;  4U8Y D;  5EKQ D;  3UX4 A;  1QQE A;  4KBQ A;  5ANL A;  5KBA A;  1WY6 A;  4RLY A;  4YND A;  3X2Q E;  3JUI A;  2HO1 A;  4KYO B;  1MX4 A;  3SZ7 A;  2YHC A;  4DLO A;  3GW4 A;  4ATZ D;  5ITZ F;  4E85 A;  5CCL A;  1HG5 A;  3TWQ A;  2NSZ A;  3HXD A;  3T5V A;  1UJK A;  4C9B B;  3R9M A;  4YDO A;  3UT8 A;  3QWW A;  3TL5 A;  1DC2 A;  3LY9 A;  3TGO A;  4J6I A;  4FU3 A;  3RO2 A;  2IOS A;  3NAW A;  2PL2 A;  4EEC A;  4J8F A;  1VDY A;  2C0M A;  3RO3 A;  4WWN A;  2ILR A;  2A5E A;  2X3M A;  2OVF A;  3QAQ A;  2WB2 A;  2KC7 A;  1TJF A;  1YMP A;  1PAQ A;  3C98 A;  2P9N G;  2WXM A;  3IKO B;  4WWP A;  3EJN A;  3QK0 A;  1FCH A;  1H19 A;  3D9N A;  5EID A;  4LSZ E;  5AJD A;  3EHQ A;  3SY2 A;  1A5E A;  2LSV A;  2EIN E;  1INZ A;  4A63 B;  4JW1 A;  4GTP A;  1H6O A;  4F1S A;  3V79 K;  4GZ5 A;  1H2T C;  3LJN A;  4L1B A;  2PQN A;  4GTQ A;  4GCN A;  4GTT A;  4K0R A;  3FUF A;  3ZXS A;  4I1M A;  3MV3 B;  2J4D A;  4KT6 B;  3NF1 A;  3FUN A;  3PVL A;  4BT9 A;  2XGS A;  3L22 A;  5AQ7 A;  4ANU A;  1KPS B;  3FP3 A;  3DSV A;  1Z6T A;  4HFG A;  1RZ4 A;  1SZA A;  3RRU A;  4I2W A;  2WQ7 A;  2A5U A;  2XGO A;  2DZO A;  3L54 A;  2QY7 A;  4Y6W A;  4H7X A;  2P9S G;  4HB5 A;  4FA6 A;  3MKR A;  5BUZ A;  1NL4 A;  3E4B A;  5FIN A;  4AP2 A;  3PE4 A;  2KCL A;  2IU1 A;  1TN7 A;  2KXP C;  3IXE A;  2LO6 A;  3L08 A;  5EN5 D;  3SHF A;  3E32 A;  3FUI A;  3ZKJ A;  1E96 B;  2XQ0 A;  1P5Q A;  3ESK A;  4HI8 A;  3LJ3 A;  4EZJ A;  2FF4 A;  4G8L A;  3ZN3 A;  3Q75 A;  3TWW A;  3CVX A;  3FH5 A;  2OOE A;  2L6B A;  2XRY A;  4D10 C;  4KZ0 A;  3JXI A;  3R7Q A;  3ABK E;  3Q49 B;  4JC8 A;  5EX0 A;  2L0I A;  4O60 A;  4B8A A;  2YHE A;  4HOU A;  2XHE A;  3S7F A;  3TWR A;  4BX8 A;  4JEU A;  1HF8 A;  1DCE A;  3QAR A;  1N0R A;  3ZVV A;  2L0T B;  5CEC B;  4GML A;  3ZFW A;  5BNW A;  4ILG A;  4YDE A;  4DI3 A;  4CZ2 D;  4A1G A;  4Q96 A;  4J8E A;  3MZL B;  3EIJ A;  4ZHB A;  3HXC A;  4OAU C;  5FJY A;  4ACK A;  2MOW A;  4N2Q A;  4RSY A;  2ETA A;  4AM9 A;  3IBE A;  1U3D A;  4PH4 B;  3Q15 A;  1HO8 A;  3CVW A;  3I4R B;  3NOG D;  3L82 A;  3BUA A;  3CSF A;  4I9E A;  3LVQ E;  3TWV A;  1JUQ A;  3BG1 B;  4U95 D;  4EBA G;  2QFC A;  2Y69 E;  4B94 A;  4J8S A;  3UUX A;  3B7R L;  5ENQ D;  3MV2 B;  3B7T A;  2R17 C;  2KM4 A;  3CHM A;  3L9T A;  5D0Q D;  3U66 A;  4IUL A;  4UWH A;  2NXP A;  2AXU A;  3DSW A;  2QYJ A;  3B7S A;  4HQD A;  3W9G A;  3AAA C;  3ZIM A;  2VYI A;  3E34 A;  4HOS A;  3LVR E;  3WG7 E;  3RIB A;  1RW2 A;  1S64 A;  1XGW A;  3MYV A;  4J8D A;  5FTP A;  4ANV A;  4HRN A;  1Z3X A;  4L7T A;  3LEW A;  1IQR A;  4PS8 A;  3L6A A;  3Q7A A;  4BFR A;  3HG0 D;  4I6G A;  5AQA A;  3SBT B;  5JJT A;  2IF4 A;  3CIA A;  3FEX A;  3RAU A;  4EQF A;  2WMN A;  4AY5 A;  5LP0 A;  4KZC A;  2WVI A;  3KAE A;  5C1D A;  2LAI A;  2Q7F A;  3FWV A;  2IFU A;  2IEJ A;  3HXE A;  4G1T A;  3L17 A;  1TNU A;  5E75 A;  4G2V A;  3ULE G;  4XKC A;  3OAW A;  2UWJ G;  5AAO A;  2X6F A;  1EPU A;  1MHQ A;  3RKV A;  1UJJ A;  3BQO A;  3I4G A;  4HI9 A;  5ARF A;  1V55 E;  2R5S A;  1Y6I A;  2WXH A;  1MYO A;  4OYS A;  2AVP A;  5EIB E;  4TUU A;  4TXQ A;  5ENR D;  2KAT A;  3FUL A;  3D9J A;  3D9M A;  4U8V D;  4JHJ A;  2VQ2 A;  4F53 A;  2CFU A;  3TXN A;  3PRE A;  4GAA A;  3MCX A;  4GPK A;  3CKC A;  4OVV A;  3IHV A;  3B7B A;  5FQ7 A;  4LNG A;  2A4Z A;  1JPL A;  1N4R A;  1W3B A;  3UKR G;  3DSS A;  1UG3 A;  5DBK A;  2DVW A;  3DEO A;  3QC1 A;  3KEZ A;  3FUM A;  1NP7 A;  3P1U A;  3EUV A;  3FEY A;  4XEI G;  1OWL A;  1N95 A;  5FQ6 A;  4U0Z A;  3TXM A;  1EF1 C;  5KJL A;  1TEZ A;  4A3T A;  1PC2 A;  1X5B A;  1KLX A;  2J08 A;  1XNF A;  1OUV A;  2OEV A;  2EIK E;  4U7E B;  4DJA A;  2RFA A;  1FT2 A;  5KNG A;  5HKP A;  2XS1 A;  3D9H A;  3ONK A;  3KEA A;  5E76 A;  4G26 A;  3MEK A;  3QDN A;  2WQ6 A;  5FZS A;  2J9Q A;  2IQC A;  3ZNG A;  5KWD A;  1WM5 A;  1QNF A;  1OWP A;  4EPZ A;  1N0Q A;  4LER A;  2IO2 C;  3EHR A;  3OXL A;  3Q7F A;  5G55 A;  5AQB A;  2WPV A;  4NAC A;  3EHM A;  3ZHE B;  2AW6 A;  2XZT G;  3UI2 A;  5JMN D;  2VTB A;  4ME2 A;  3PE3 A;  2PNN A;  4AVX A;  4I1O B;  5J08 A;  2PM7 A;  2R02 A;  1OCZ E;  3ZEF A;  5CBO A;  3ZW3 A;  3CQG B;  3DXM G;  1OCR E;  2HM8 A;  3HXB A;  3ABL E;  3ASN E;  2KCV A;  3AS8 A;  2I9C A;  3PS6 A;  3HIZ A;  1U3C A;  2H6G A;  5AN8 A;  4JHK A;  4UWG A;  1TN8 A;  5EDS A;  3ML9 A;  3KS2 A;  3JXJ A;  3RJV A;  1N94 A;  2P9K G;  3PEU B;  2H6F A;  3PNL B;  3GZ2 A;  2J4B A;  4G23 A;  3SFZ A;  4KMO A;  3SO8 A;  1DVP A;  3UXG A;  1E7V A;  3F6Q A;  4BWR A;  3ZYK A;  2J49 A;  3QOU A;  3IV0 A;  2HYZ A;  2VGX B;  2YIN A;  4CGW A;  4E6H A;  1TJC A;  4DX6 D;  1Y8M A;  3CHQ A;  1V54 E;  4YVO A;  3FTY A;  4AOF A;  3U64 A;  3FUK A;  2Y4U A;  4EBA A;  4PS7 A;  4LEU A;  2JAB A;  2GRP B;  1GW6 A;  4EZL A;  5HS0 A;  2KBX A;  4IYP A;  3AS4 A;  3RSE G;  3NBN B;  4DLQ A;  4DX5 D;  3TAX A;  3TJP A;  4ZFH A;  1HG2 A;  2VTB B;  3BEE A;  4BES A;  5ANR A;  3Q79 A;  3RRN B;  4B0Z A;  3DPD A;  3ZYM A;  3C3O A;  4F1P A;  4CGV A;  1LD8 A;  3ENE A;  3CVL A;  3FU0 A;  1S70 B;  5CHE E;  4WNF A;  2ION A;  4BER A;  2VSO E;  1ELK A;  2ZIR A;  2CHW A;  1EDU A;  1D9S A;  4LG6 A;  4DX2 A;  3SNX A;  1OT8 A;  1FVH A;  4PS3 A;  4OVU A;  1O5M A;  3ONL A;  2Y1L E;  5KNH D;  4JEH A;  1D8D A;  4V3I A;  5T4Y A;  3L13 A;  1N9A A;  4UWK A;  3KD7 A;  1IYG A;  3FUE A;  1SW6 A;  4ACL A;  5H7P A;  1G3N B;  3U4T A;  1HE8 A;  2L6J A;  2PZI A;  2VSN A;  3D9K A;  1HU3 A;  2DCP A;  1Q2Z A;  2RFM A;  4LUN U;  3FUH A;  4U07 A;  4C0M A;  3CST A;  3QWV A;  4GZ3 A;  3P2B A;  1OCO E;  3QKY A;  2YNQ A;  2GRO B;  4FLB A;  2RD0 A;  1LD7 A;  3G2U A;  4XKB A;  1HH8 A;  1OCC E;  4RVB A;  1OWN A;  3DSX A;  4F3V A;  1IXV A;  2GW1 A;  2XS8 A;  2GRQ B;  3S2A A;  4Q94 A;  4GA0 A;  2F8X K;  1KT1 A;  3LDZ A;  4MRU A;  2FUL A;  5CED B;  3C5R A;  4PUC A;  4TXP A;  4I1A A;  1JCR A;  3WXX A;  3CHO A;  2XEV A;  3FY4 A;  4I17 A;  4FJY A;  3AU5 A;  4M7C A;  4FP7 A;  5B3S E;  3VLD A;  5A6C A;  4GB9 A;  5DIZ A;  4O1O A;  1SQM A;  4TV3 A;  4L9P A;  3IHY A;  2WXQ A;  4WND A;  3PUJ A;  2LXL A;  3AG3 E;  3UMV A;  4ILH B;  4C0E A;  4UI9 J;  2WXL A;  5HRY A;  4I9C A;  1LTX A;  3FH8 A;  4QQI A;  1MQS A;  5ENS D;  3UIN C;  3DPY A;  4GMJ A;  1NA3 A;  1AWC B;  5M72 A;  4ABN A;  2WXI A;  3W9F A;  4CDN A;  4FAD A;  1MX2 A;  4NUR A;  1ELR A;  3KSL A;  4BX9 A;  2FBN A;  5G05 C;  2E2E A;  2C2L A;  2XEN A;  3ZXP A;  3EDT B;  1E8X A;  1Z5S C;  3NZU A;  3PRZ A;  4U0S A;  1IQU A;  1FPP A;  2XPI A;  4Y6C A;  4ATG A;  4MLP A;  3CVV A;  3EU5 A;  2WMO A;  2ZIS A;  2AXV A;  1O1R A;  2X38 A;  4N5C A;  4N3B A;  3G2S A;  4AV7 A;  4KVM A; 
#chains in the Genus database with same CATH homology
 5ANL A;  4WNG A;  2A4Z A;  1WY6 A;  4G25 A;  4FC8 A;  2VSX E;  4YND A;  4AJW A;  3JUI A;  3UPV A;  1JPL A;  2HO1 A;  1W3B A;  5CMW A;  2XPZ A;  3QB2 A;  3Q5M A;  3PEV B;  1L5J A;  4KYO B;  2CG3 A;  3QNK A;  3SZ7 A;  1UG3 A;  5DBK A;  1H6K A;  2YHC A;  4M3O A;  4DLO A;  3GW4 A;  3QC1 A;  3KEZ A;  3FUM A;  4E85 A;  1NP7 A;  2HR2 A;  5CCL A;  4XX5 A;  1HG5 A;  3P1U A;  2NSZ A;  3FU5 A;  4W9R A;  3FEY A;  4MS6 A;  5LFA A;  5FZR A;  3RU0 A;  1OWL A;  2E0I A;  3T5V A;  1E7U A;  1UJK A;  5FQ6 A;  4U0Z A;  2OND A;  4GZ6 A;  2CG2 A;  2CHX A;  3TXM A;  1HXI A;  1OWO A;  3CK7 A;  4FHK A;  4C9B B;  2FO7 A;  1EF1 C;  5KJL A;  4GYW A;  3UT8 A;  3QWW A;  5T8I A;  4A3T A;  1TEZ A;  1PC2 A;  4KVO A;  1X5B A;  3TL5 A;  4CDM A;  1N52 A;  3LY9 A;  4GZC A;  3TGO A;  4J6I A;  4FU3 A;  1KLX A;  3VTX A;  3ASD A;  3RO2 A;  2IOS A;  2J08 A;  5LX8 A;  2P58 C;  4AY6 A;  1XNF A;  1OUV A;  5BV0 A;  2PL2 A;  3CHR A;  4EEC A;  3Q4A B;  4J8F A;  1VDY A;  2C0M A;  2XGM A;  3D9I A;  3RO3 A;  4DJA A;  4WWN A;  2ILR A;  5FWQ A;  4LCT A;  3L16 A;  2X3M A;  4ANW A;  4CDR A;  2Y3A A;  3APF A;  1WAO 1;  2OVF A;  3QAQ A;  2WB2 A;  2KC7 A;  1TJF A;  2Y4T A;  3LYA A;  3SD5 A;  1UN9 A;  5FT9 A;  1PAQ A;  3ONK A;  2KCK A;  3C98 A;  3ULQ A;  2WXM A;  3IKO B;  4WWP A;  3O4Z A;  5LCW C;  4CRW A;  3R7R A;  3EJN A;  3EIQ C;  3QK0 A;  1FCH A;  5E76 A;  1H19 A;  4G26 A;  3MEK A;  3D9N A;  4BY6 A;  5AJD A;  3QDN A;  3CQC B;  3LS8 A;  4R7L A;  3B7U X;  3LCA A;  2WQ6 A;  4L2L A;  4NQ0 A;  1EYH A;  4GYO A;  3HDX A;  3IEG A;  5FZS A;  4A55 A;  2LSV A;  4JL0 A;  1INZ A;  3T5X A;  2J9Q A;  3APD A;  2IQC A;  4JW1 A;  3G2V A;  2WXG A;  5JJ7 A;  1WM5 A;  1QNF A;  1OWP A;  2GRL A;  3APC A;  1N54 A;  3MGB A;  4H7Y A;  4TRQ A;  4F1S A;  2UY1 A;  4GZ5 A;  4F7A A;  4I6E A;  4EPZ A;  3CVQ A;  4LER A;  1HX8 A;  3ZYQ A;  1H2T C;  4L1B A;  2PQN A;  3MJW A;  2V0P A;  4GCN A;  3OXL A;  5G55 A;  4K0R A;  2CHZ A;  3FUF A;  4BT8 A;  2WPV A;  4IN3 B;  4NAC A;  2FEZ A;  4CCA A;  3EHM A;  3ZXS A;  4I1M A;  1E8Z A;  3MV3 B;  2AW6 A;  2NC9 A;  2RG8 A;  2J4D A;  4L2Y A;  3ZHE B;  4N2S A;  2WXR A;  5G05 J;  4KT6 B;  4ME2 A;  2X6K A;  2VTB A;  3NF1 A;  3PE3 A;  2MRI A;  4JHR A;  4AVX A;  4I1O B;  3FUN A;  5J08 A;  2V8S E;  3PVL A;  2PM7 A;  3HYM B;  3CHS A;  3ZEF A;  4BT9 A;  4EZK A;  3ZW3 A;  3CQG B;  1ZBP A;  4U04 A;  3CK9 A;  4P29 A;  4U8H A;  2JEK A;  2WXO A;  4GA1 A;  2VSY A;  2HM8 A;  2XGS A;  3L22 A;  2M63 A;  3PDN A;  4ANU A;  1UW4 B;  4UQZ A;  3AS5 A;  3Q47 B;  1ELW A;  2KCV A;  3FP3 A;  4APO A;  3AS8 A;  2I9C A;  4KBQ A;  3PS6 A;  1Z6T A;  3HIZ A;  4HFG A;  1SZA A;  1U3C A;  3RRU A;  4JHK A;  4I2W A;  2WQ7 A;  4U0U A;  4UWG A;  4JXT A;  3CVU A;  4AXH A;  2A5U A;  2XGO A;  5EDS A;  1HZ4 A;  5HI7 A;  5T3R A;  3LPZ A;  4MKT A;  3L54 A;  2QY7 A;  3ML9 A;  3KS2 A;  4Y6W A;  3S7B A;  4H7X A;  3RJV A;  4FA6 A;  5BT1 A;  3CHP A;  3T8M A;  3PEU B;  3PNT B;  3S7D A;  3MKR A;  3CR3 A;  3CVN A;  5BUZ A;  2WXK A;  3E4B A;  4UWL A;  3PH0 C;  4AP2 A;  3PNL B;  3PE4 A;  4DK5 A;  3GZ2 A;  2J4B A;  4G23 A;  3SFZ A;  2L9B A;  4KMO A;  3CEQ A;  4AV7 A;  2KCL A;  1DVP A;  2IU1 A;  3HHM A;  1E7V A;  4HOQ A;  4QFV A;  3UT4 A;  3I3N A;  2LO6 A;  3L08 A;  4XIF A;  3K9I A;  5BW8 C;  4BWR A;  3ZYK A;  3D9O A;  3FTX A;  3RRM B;  2J49 A;  3QOU A;  4L23 A;  3IV0 A;  3FTS A;  4I6J A;  2HYZ A;  3SHF A;  4AEZ C;  3FUI A;  2VGX B;  1E96 B;  2XQ0 A;  3JQ1 A;  1P5Q A;  2YIN A;  3ESK A;  3OXG A;  4CGW A;  4E6H A;  2KZT A;  1TJC A;  1YA0 A;  5ENN A;  3LJ3 A;  3D9L A;  4EZJ A;  4WNE A;  4G11 A;  5BPP A;  1Y8M A;  3CHQ A;  4J0U A;  3FTW A;  3MX3 A;  4YVO A;  3FTY A;  3ZPJ A;  2UY1 B;  3RK6 A;  2FF4 A;  2DBA A;  4AOF A;  3U64 A;  3FUK A;  2Y4U A;  3ZN3 A;  4PS7 A;  5FQ8 A;  4EBA A;  5G04 C;  4LEU A;  5AJL A;  4FJZ A;  1GW6 A;  4B89 A;  4EZL A;  3ZRH A;  3O48 A;  4BTA A;  2R59 A;  3AS4 A;  2VGY A;  4IYP A;  3CVX A;  3FH5 A;  2OOE A;  4NRH B;  2XRY A;  4D10 C;  4DLQ A;  4KZ0 A;  2X6I A;  3TAX A;  1QZ2 A;  3PZD A;  3TJP A;  4UWF A;  3FUD A;  2C0L A;  5G04 J;  1HG2 A;  2VTB B;  3HVE A;  2AWI A;  3BEE A;  2DIW A;  5ANR A;  3RRN B;  4B0Z A;  4CEM A;  3DPD A;  4LRZ A;  3MKQ A;  3R7Q A;  3ZYM A;  4BTB A;  3Q49 B;  1JWG A;  4JC8 A;  5EX0 A;  1H0A A;  3ASF A;  5LCW J;  4CGV A;  1FVF A;  4YVQ C;  4HLE A;  2L0I A;  4B8A A;  2YHE A;  4HOU A;  2XHE A;  3S7F A;  3ENE A;  3CVL A;  3VLF A;  3FU0 A;  2PQR A;  1HS6 A;  5A7D B;  4BX8 A;  4JEU A;  1HF8 A;  5CHE E;  4WNF A;  2ION A;  2VJ8 A;  3UQ3 A;  5HQ8 A;  3FDH A;  2VSO E;  1ELK A;  3B13 A;  3QAR A;  3AU4 A;  3ZVV A;  2L0T B;  2CHW A;  2I1J A;  4GML A;  1EDU A;  3FH7 A;  3ZFW A;  5BNW A;  3ZGQ A;  4O6F A;  5AEN A;  4JZY A;  3CKB A;  5C2Y A;  3SNX A;  1JWF A;  2LSU A;  4ILG A;  3FUJ A;  1FVH A;  2WXP A;  4PS3 A;  4OVU A;  2I6H A;  3ONL A;  4DI4 A;  4RG6 A;  2LAH A;  3LY7 A;  5LOZ A;  3ZYL A;  4DI3 A;  2BUG A;  4AIF A;  1BPO A;  4GYY A;  4JEH A;  1H2V C;  3BG0 B;  4V3I A;  4A1G A;  5T4Y A;  3L13 A;  4Q96 A;  4UWK A;  2PM6 A;  5ARG A;  3KD7 A;  3G2T A;  4J8E A;  4XI9 A;  3MZL B;  1IYG A;  3FUE A;  3EIJ A;  4ACL A;  4WWO A;  2AXZ A;  3DBS A;  5FJY A;  5KCM A;  4ACK A;  1E90 A;  2MOW A;  2XCB A;  4RG9 A;  3U4T A;  4N2Q A;  4GA2 A;  2JLB A;  3TG5 A;  3FU3 A;  4FUL A;  4XE0 A;  1HE8 A;  4GCO A;  2L6J A;  4RSY A;  4A3V A;  4AM9 A;  3IBE A;  3LY8 A;  1S0P A;  1U3D A;  2XCC A;  3R9A B;  3MA5 A;  4A1S A;  2KZT B;  2PZI A;  3I5P A;  2VSN A;  4PH4 B;  1OWM A;  3D9K A;  3Q15 A;  1HO8 A;  3CVW A;  1HU3 A;  2V4L A;  3I4R B;  2DCP A;  2IJG X;  3CSF A;  4GU5 A;  2WXJ A;  4I9E A;  4CT0 A;  3LVQ E;  1LF8 A;  4LUN U;  4U07 A;  3FUH A;  4C0M A;  4I2Z A;  1JUQ A;  5JHA A;  1HFA A;  4BSX A;  2WM9 A;  3BG1 B;  3CST A;  4EBA G;  4ANX A;  3QWV A;  2QFC A;  5KJM A;  5KJK A;  4GZ3 A;  3P2B A;  2BTD A;  3QKY A;  3TG4 A;  4B94 A;  2YNQ A;  4J8S A;  4FLB A;  3UUX A;  3B7R L;  4N3A A;  2RD0 A;  5G2N A;  3MV2 B;  2X6J A;  3B7T A;  5J90 A;  2R17 C;  3G2U A;  3HVE B;  2KM4 A;  4APF A;  4XKB A;  1HH8 A;  3CK8 A;  3CHM A;  4IRU A;  4N3C A;  5D0Q D;  3SF4 A;  3ZHE A;  4Q69 A;  2YQ8 A;  3MKQ B;  4RVB A;  5CCM A;  3U66 A;  1OWN A;  4IUL A;  3ASH A;  4UWH A;  4F3V A;  4HS2 A;  2GW1 A;  3ESL A;  1IHG A;  2GRM A;  3S2A A;  4JA9 A;  2NXP A;  2OV8 A;  4Q94 A;  5KJN A;  2AXU A;  4GA0 A;  1KT1 A;  3B7S A;  3LDZ A;  3FHE A;  3GYZ A;  2J09 A;  3FU6 A;  4MRU A;  2FUL A;  1UN8 A;  4PDX A;  3ZIM A;  3JQ0 A;  2VYI A;  4HOS A;  4PUC A;  3LVR E;  3VLE A;  3RIB A;  3CV0 A;  3ML8 A;  2EQX A;  2V5F A;  1XGW A;  4I1A A;  3MYV A;  4J8D A;  5D0O D;  2WQH A;  5FTP A;  4ANV A;  3FTV A;  5AIJ A;  1E8Y A;  1Z3X A;  3FFL A;  4L7T A;  3LEW A;  1IQR A;  4PS8 A;  3WXX A;  3CHO A;  3L6A A;  2XEV A;  4JPS A;  4BFR A;  3CGH A;  4CT4 A;  3FY4 A;  4I17 A;  1NZN A;  4K03 A;  4I6G A;  4N39 A;  3SBT B;  5JJT A;  4FJY A;  4HXI A;  3AU5 A;  3SI5 A;  4FP7 A;  3SGH A;  3VLD A;  3OXF A;  5A6C A;  3NZS A;  2IF4 A;  3CIA A;  4GB9 A;  5DIZ A;  3S7J A;  2J07 A;  3FEX A;  1SQM A;  1Z3Y A;  2OVB A;  5JHB A;  3D3M A;  4TV3 A;  3NQP A;  4WAF A;  4I43 A;  4XI0 A;  4UI9 C;  3CLJ A;  3JCK C;  4EQF A;  2WMN A;  3IHY A;  2XPY A;  2MHK A;  2WXQ A;  4AY5 A;  5LP0 A;  4KZC A;  2WVI A;  3KAE A;  1B89 A;  5FZQ A;  4WND A;  3U9W A;  5C1D A;  5FQ7 A;  3PUJ A;  3UMV A;  2LAI A;  5FQ4 A;  1PY1 A;  4ILH B;  4C0E A;  2I1K A;  3CVY A;  2Q7F A;  3FWV A;  4UI9 J;  2IFU A;  2WXL A;  3GZ1 A;  4I9C A;  4KXK B;  5EX3 A;  4G1T A;  3FH8 A;  4B8C B;  1MQS A;  3L17 A;  5E75 A;  3G2W A;  4GMJ A;  1SZ9 A;  2VGX A;  4G2V A;  1NA3 A;  4XKC A;  3OAW A;  4FHJ A;  2UWJ G;  5M72 A;  4HOR A;  2X6F A;  3GZS A;  1KT0 A;  4ABN A;  3N71 A;  2WXI A;  4WUY A;  1EPU A;  4UQY A;  4HOT A;  5AYW D;  4CDN A;  3LKU A;  3OTN A;  4JVS A;  4FAD A;  1MHQ A;  3RKV A;  1DNP A;  1E8W A;  4NUR A;  1ELR A;  1UJJ A;  3EHN A;  3URZ A;  3SBS A;  4XZ4 A;  5CMY A;  3I4G A;  2FBN A;  4BX9 A;  3UT7 A;  2WXF A;  1NA0 A;  1A17 A;  5JJ6 A;  5G05 C;  5ARF A;  1H2U A;  2E2E A;  4G24 A;  2C2L A;  3VTY A;  2XRZ A;  2R5S A;  1Y6I A;  2WXH A;  3QWP A;  4JA7 A;  4OYS A;  4URK A;  2AVP A;  3D9P A;  3ASG A;  3EDT B;  4UI9 K;  4TUU A;  4U63 A;  2WXN A;  2KAT A;  3JYS A;  4UQX A;  1E8X A;  3NZU A;  2BF0 X;  3PRZ A;  4U0S A;  1IQU A;  2XPI A;  4Y6C A;  4ATG A;  3FUL A;  3D9J A;  4MLP A;  3D9M A;  4DPR A;  4JHJ A;  3FTU A;  2VQ2 A;  3CVV A;  5A23 A;  2GGF A;  3QJZ A;  2LNI A;  2WMO A;  3LXU X;  4HVB A;  2AXV A;  4F53 A;  4GZD A;  2CFU A;  2IOL A;  2X38 A;  3U3W A;  3TXN A;  2ZU6 B;  3PRE A;  4GAA A;  4N5C A;  3FTZ A;  5BV1 A;  2I2O A;  2CFZ A;  3CVP A;  3MCX A;  3PUK A;  4ILI A;  1ZU2 A;  4GPK A;  4N3B A;  3G2S A;  3CKC A;  5EKQ D;  4OVV A;  3UX4 A;  2X6H A;  3IHV A;  4FLH A;  1QQE A;  2FI7 A;  4KVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...