3R9AB

Human alanine-glyoxylate aminotransferase in complex with the tpr domain of human pex5p
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
315
structure length
289
Chain Sequence
QFEEENPLRDHPQPFEEGLRRLQEGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACETLRDWLRYTPAYAHLVDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFGLPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular requirements for peroxisomal targeting of alanine-glyoxylate aminotransferase as an essential determinant in primary hyperoxaluria type 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transport protein
molecule keywords Serine--pyruvate aminotransferase
total genus 116
structure length 289
sequence length 315
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13181 TPR_8 Tetratricopeptide repeat
B PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3r9aB00
2HR2A 2YHCA 4JA9A 5D0QD 3VTXA 4GYOA 3E4BA 2R5SA 4BWRA 2MHKA 3TG4A 4N5CA 3Q4AB 4I9CA 4UI9J 2PQNA 3GZ1A 3FFLA 5BT1A 2Y4TA 4IN3B 3Q47B 5KJLA 3PE3A 2E2EA 4BT9A 2VGXA 3AS5A 4XI0A 4G2VA 1XNFA 2C0LA 3PE4A 5G05C 3SZ7A 3TG5A 5KJNA 4I9EA 4HOTA 3LY7A 3MKRA 3CK8A 3QDNA 2KC7A 2ONDA 4U04A 3GZ2A 3Q5MA 4H7YA 3LYAA 4GZ3A 3ASFA 4U0ZA 4GPKA 2QFCA 4N39A 5FZSA 5FJYA 5CCMA 3S7DA 2XPIA 3MV3B 3R9AB 5A6CA 4GYWA 5KJMA 5G04J 4KYOB 2P58C 4U0UA 4BTAA 4GZ6A 3ESKA 2J9QA 1FCHA 2Y4UA 4N3AA 5G05J 5KJKA 4NQ0A 4UQXA 1ZU2A 2VYIA 3QWVA 3RO3A 4HOQA 2AVPA 4J8EA 2OOEA 3QOUA 3CEQA 4UI9C 3Q49B 3K9IA 5JJ6A 3ZHEA 3FWVA 4UI9K 2VQ2A 2FEZA 2LNIA 4J0UA 4I2WA 4RG9A 3RO2A 5EKQD 3CVLA 3S7BA 1E96B 3SF4A 2C2LA 1NA0A 2XEVA 3ASGA 2VSNA 4G23A 5G04C 2XCBA 5EX3A 2IFUA 2WQHA 2YQ8A 1ZBPA 3AS8A 4YNDA 2JLBA 3ZFWA 5FTPA 1KLXA 4O6FA 5JJ7A 2KCKA 3OXGA 2NC9A 2V5FA 3IEGA 4J8FA 4RG6A 4YVQC 3KD7A 4U0SA 1P5QA 1YA0A 3GW4A 3JYSA 4GA1A 1IHGA 3RU0A 4U07A 5FZQA 2L6JA 3CKBA 5CHEE 5A7DB 4N2SA 1A17A 4A1SA 3BEEA 4BTBA 1WM5A 2PZIA 3OXLA 3TGOA 4KBQA 4GA0A 1HH8A 4I2ZA 4UQZA 3MV2B 2UY1B 4WUYA 4B94A 1QQEA 5AYWD 2VSYA 2XGOA 5JJTA 3RIBA 4GCOA 3LY8A 4GCNA 3UQ3A 4HORA 3EDTB 4KXKB 2VGYA 4W9RA 5ARFA 4JL0A 3UUXA 2BUGA 3QWWA 4I17A 3S7FA 3CVNA 4GYYA 3UPVA 4AY5A 4NRHB 5M72A 3N71A 3CVQA 1Y8MA 3TAXA 5LCWJ 4CDRA 5D0OD 3KS2A 4G24A 2PL2A 2GW1A 3LKUA 2I6HA 3U4TA 1QZ2A 3OXFA 1KT0A 2FO7A 3ASHA 4ME2A 3ZHEB 4AM9A 5CCLA 3LY9A 2LSUA 3CVPA 5HI7A 5BW8C 3ZGQA 3FP3A 3VTYA 4GZ5A 3ZN3A 5LCWC 4LEUA 1HXIA 4WNEA 1HZ4A 3CK7A 4XI9A 4ABNA 3MA5A 2HYZA 4F3VA 5C1DA 2FBNA 3GYZA 3PDNA 2HO1A 4GA2A 1NA3A 3HYMB 4JA7A 4N2QA 4WNDA 4G25A 1NZNA 3QWPA 4N3CA 4N3BA 3LCAA 2PQRA 4YVOA 2KATA 3CKCA 4Y6CA 1TJCA 3Q15A 5ARGA 3URZA 4APOA 1IYGA 5DBKA 4HOUA 4BT8A 2FF4A 5EX0A 3RJVA 5DIZA 2KCVA 3U3WA 3AS4A 2XGSA 1KT1A 2UY1A 4UQYA 2IF4A 4WNGA 3KAEA 3ZPJA 1ELWA 1B89A 2UWJG 3RKVA 2XCCA 4AIFA 4WNFA 2XGMA 4H7XA 3QKYA 4G26A 2KCLA 1OUVA 3WXXA 3S7JA 1W3BA 4EQFA 5HQ8A 3MEKA 4CGVA 4CGWA 2Q7FA 1WAO1 2C0MA 2LSVA 3NF1A 4XIFA 5FZRA 4JHRA 5BNWA 2DBAA 3ASDA 4J8DA 4I1AA 4AY6A 2FI7A 3CK9A 1PC2A 4Y6WA 4HOSA 4G1TA 5FT9A 3LPZA 3CV0A 3ULQA 2WPVA 1ELRA 3O48A 2VGXB
chains in the Genus database with same CATH superfamily
2HR2A 2YHCA 4YDWA 2EIME 4TUUA 3UIOC 1RZ4A 2ZXWE 4Q69A 2VGXA 1JCSA 3TWRA 4GPKA 1DC2A 3L17A 4GYWA 4KYOB 1D8DA 1FCHA 1HF8A 4TXQA 3HXFA 3LVRE 4BEPA 2ZGGA 2GROB 3CHSA 4R7LA 2FEZA 1XGWA 3PUKA 3FTXA 2YQ8A 3T9KA 4UWHA 3Q9NC 1PAQA 2OVBA 3FUFA 1HG5A 4RVBA 1A17A 3ZYKA 4KBQA 4WUYA 2P9PG 3PEVB 2LUHA 3ZUVB 3APFA 3SQVA 2XRZA 4AP2A 3L08A 1QZ2A 4IRUA 3C3RA 4GTMA 3AAAC 5LFAA 4K0RA 1LD7A 3MA5A 4ACKA 3PDNA 2WB2A 3ML8A 3UXGA 3FU0A 3HVEA 4L2LA 2OEWA 2DZNA 4JXTA 4WWNA 4CGVA 3T5VA 3G2SA 3IHVA 5BUZA 1S0PA 3D9IA 3WG7E 1SA5A 1H6OA 1N11A 3DPDA 3O48A 4XEIG 5D0QD 4JVSA 1D8EA 3R7QA 1TNOA 5KJLA 3HVEB 2XENA 3TG5A 3MX3A 4LCTA 3ABLE 2A5EA 3CSFA 4EPZA 3X2QE 2OVFA 4N39A 1N4QA 4XKBA 2F37A 4U7EB 4U0UA 4JHKA 4BX8A 2H6IA 3TWTA 1OWPA 3MYVA 5HRYA 2ZISA 4MS6A 1SA4A 3QB2A 4G8KA 2VTBA 5HKPA 3CHMA 4F1SA 3B7UX 2EQXA 5JJTA 3EDTB 1H6KA 4QFVA 2GRNB 3ZXPA 2XS8A 1OCZE 1JWGA 1HU3A 2EINE 5CMYA 3U9WA 2HO1A 3ASNE 4UWGA 3P2BA 1JCRA 3Q78A 4L1BA 3ULEG 4HOUA 2Y1LE 5KCMA 2UY1A 3FH8A 4L23A 4ZHBA 3GZSA 3KEAA 3T5XA 2MRIA 3FTSA 4D10C 3WXXA 4CYMD 4KMOA 5FQ7A 4IULA 4JHRA 4U8VD 4Y6WA 3LPZA 2DWZA 3L22A 3FFLA 3KSLA 2CHXA 2ZGDA 3V2XA 3QDNA 2JEKA 2J08A 2IU1A 3S7DA 1MX4A 2F8YA 4GMJA 3NQPA 1E7VA 3IHYA 3ZHEA 4RG9A 3SHFA 2RD0A 1BD8A 3DSVA 5T4YA 2WXKA 4U07A 4N2SA 5AQAA 4A1SA 3OXLA 5FIOA 2R17C 2VSYA 1Y6IA 1LTXA 5KBAA 1K1AA 1H2UA 3CVNA 1Z3YA 4U96D 2R03A 4EZJA 2LO6A 2NYJA 1KT0A 3ESLA 5HI7A 1HE8A 2CFUA 3ZGQA 1TNZA 3L9TA 4ANUA 2RFAA 4WNEA 3CK7A 4F3VA 3JUEA 2FBNA 4GU5A 3B7RL 4N3CA 3D9NA 4UWFA 1IKND 4LUNU 4HI9A 1TNUA 3ULYA 1E90A 4CGWA 4JC8A 4O1OA 3NF1A 4DX1A 5CEAA 4GMRA 2OCCE 4FHJA 1PC2A 1OY3D 3CV0A 3FTUA 3TG4A 4LNUD 5BT1A 2PQNA 4A3VA 3UMVA 2KXPC 4GTRA 4U8YD 5G05C 3J5QB 2R2LA 2QFCA 3SFYA 4F1PA 5G04J 3DRAA 1ZU2A 4J8EA 2OOEA 5EN5D 4KVOA 4I6JA 3OTNA 4UI9K 4BETA 4ANXA 1E96B 5ITZF 2P9NG 2VSNA 4CT4A 1LD8A 4PS3A 2IFUA 4TV3A 4RSYA 2L9BA 3HXDA 5FZQA 2F8XK 1FT1A 3PZ1A 1WM5A 5EIBE 2WXFA 3MV2B 1E8YA 3CHPA 3EIQC 2VGYA 4JW1A 2BUGA 3V31A 3ISMC 2EIKE 2P9LG 3UM2A 4FULA 2CG3A 3LS8A 2I2OA 4ACLA 4XX5A 3CSTA 4ABNA 2HYZA 3GYZA 4GA2A 5D66A 4L2YA 3URZA 4HI8A 1BU9A 1ELWA 1B89A 3MGBA 1MYOA 3VLFA 4HFGA 1O1RA 2GRRB 3HXBA 3UT4A 5CBNA 5FT9A 3LJNA 4J6IA 3BU8A 2GGFA 2OV8A 3SBSA 4DLOA 4G2VA 1TNYA 3B7SA 1N95A 1N94A 3ZU7B 1TN6A 2X3MA 1NL4A 2WQ6A 4BX9A 2NXPA 1EYHA 2J9QA 4F6RD 3LJ3A 4HOQA 3FUHA 4OAUC 3QOUA 5JJ6A 2WXHA 3ASGA 2XEVA 4QQIA 5EYPF 4DLQA 3CHOA 3ZYLA 5FTPA 2YNQA 2NC9A 2WXJA 3Q73A 1O5MA 4K03A 5B3SE 3NOGD 5E75A 4BTBA 1K3ZD 4G8LA 3JXIA 1AP7A 3FU6A 2IY0C 4NACA 4W9RA 1OCCE 2DYSE 4EBAG 5ENSD 3FP3A 2IOLA 2ETAA 3ZN3A 3ML9A 3I4GA 2V0PA 5FINA 4CEMA 1BLXB 2WXNA 1Z3XA 3CKCA 5ARGA 2KZTB 4BY6A 3ZW3A 1UW4B 2WMOA 1KZOA 2DZOA 5ENPD 3E34A 3ABME 4AEZC 3C72A 3UI2A 3LXUX 5G2NA 5D2MC 1UG3A 1MX6A 1N54A 2XS1A 4G11A 4UI9J 3E33A 3AG3E 2C0LA 4I9EA 5ANLA 1N4SA 3DBSA 4AJWA 4DK5A 1WDYA 4DJAA 4U0ZA 3PVLA 2IEJA 5AN8A 3TJPA 1QBQA 4GB9A 2XPIA 3MV3B 3HDXA 2WXIA 3JUIA 2H6HA 3DSWA 4FJYA 3SF4A 3ZYMA 4JHJA 1TN8A 2JLBA 2X6HA 3JYSA 2AWIA 4GTQA 2FO1E 1QNFA 1DNPA 3FUEA 5A7DB 3BEEA 4FA6A 2IOSA 3EUVA 1UN8A 1K8KG 4NURA 4KXKB 3FUKA 4ILHB 3CR3A 1UN9A 4CDRA 3CHRA 3EHMA 5J08A 3ZHEB 3FULA 1HZ4A 4DUIA 2F0YA 2RKKA 4GTTA 4MLPA 1BI7B 4DRXE 4WNDA 4APOA 4U63A 4ATGA 2KCVA 4WNFA 3QKYA 1HFAA 1BI8B 3CLJA 3FTWA 3HHMA 2YINA 4EZKA 1BPOA 1HG2A 3Q47B 1FT2A 2E2EA 1AWCB 1PY1A 4I1OB 1JUQA 3ABKE 3EHNA 5ENNA 4GZ6A 5KJKA 3VLEA 3BG1B 2QC9A 3JQ1A 1OCRE 4GZDA 4E85A 3BG0B 4HRMB 4HORA 4AV7A 1FVFA 5HS0A 3QWWA 5FWQA 5M72A 5LCWJ 4G24A 3SO8A 3U4TA 2FO7A 4ME2A 3IBEA 3D9LA 5EIDA 5BXOA 4CZ2D 5LCWC 2I1KA 4JZYA 1MHQA 3T8KA 3HYMB 1TJCA 1HS6A 2NSZA 4HNAD 3EJNA 2XHEA 2XGMA 4GTSA 2WMNA 3DEOA 1GW6A 3V79K 1VDYA 4M3OA 2XQ0A 2KM4A 4FHKA 4AY6A 2AJAA 4B89A 3VTXA 4JA9A 3E4BA 4BWRA 3BUAA 3LEWA 4I9CA 3LVQE 4O1PA 5EILA 2ZU6B 4LG6A 4X8QA 3QK0A 4K5AB 2HE0A 1MQSA 1LF8A 4H7YA 3UIPC 3ONLA 1E7UA 4DPRA 5CCMA 3R9AB 2P58C 3FUIA 3QWVA 3D9MA 4HBDA 5C2YA 3FWVA 3RO2A 3SNXA 3UT7A 2V4HC 1NA0A 3DSSA 4HRNA 4YNDA 2V5FA 1YA0A 4ZFHA 3TXNA 3TGOA 4I2ZA 5LX8A 2XGOA 3ZIMA 3D9JA 2AXUA 5AJLA 3CVQA 3TAXA 1K1BA 1OWOA 2L0IA 2CHWA 4YDOA 1E8WA 4P29A 3I3NA 1MZCA 3TL5A 2R05A 1O1SA 3AG2E 1NA3A 3TWSA 1WG0A 3LCAA 3E37A 5BV1A 3AG4E 4N5QA 1KT1A 1OT8A 1U3CA 2EILE 3ZPJA 4WWPA 4EQFA 4GTVA 3ZEFA 4JB8P 3JCKC 3ASDA 3L16A 4G1TA 1ELRA 1Z6TA 3VLDA 2MHKA 4N5CA 3UKUG 2BTDA 3PNLB 4JEUA 4GMLA 3CK8A 4EBAA 2LAHA 2ONDA 3U64A 2PNNA 1DVPA 3D9KA 5FJYA 1QYMA 5KJMA 4B8AA 2GRQB 1X81A 4HLEA 4GTOA 1YYHA 3NOCD 5EX3A 1RW2A 1EDUA 4GAAA 4M7CA 3OXGA 2DIWA 4U0SA 4GA1A 4AVXA 2QZAA 3FTZA 4GA0A 4FLBA 4O60A 3E32A 3S7FA 3V30A 5D0OD 5IY5E 2AW6A 4PDXA 2PM6A 4AM9A 1TYQG 1FVHA 5ENQD 3L54A 3IV0A 4EECA 3ZYQA 2PQRA 3UT8A 2KATA 3CVXA 3EHQA 4RLYA 3U3WA 3AS4A 3HXCA 5BXUA 1FPPA 3RK6A 4UWKA 2WXMA 4JEHA 1S64A 4XIFA 2DBAA 3HXEA 4DX5D 5CERB 3SFXA 3HRAA 5FQ6A 3B13A 4I43A 3IXEA 1S63A 1E8ZA 4KZCA 3QNKA 2L6BA 4N3AA 3FUDA 3RO3A 2AVPA 3L6AA 4PUCA 3CEQA 4UI9C 4V3IA 2XCBA 3AS8A 1IHBA 1EF1C 3D9PA 3T8MA 4ANWA 3KD7A 4GZCA 5AQ9A 3FU3A 3PRZA 2J09A 3CKBA 1MX2A 5AYWD 4LNGA 3RIBA 3LY8A 2R02A 3PZ2A 3TWXA 3Q9UC 3ZVVA 5ARFA 4I17A 4MRUA 2CFZA 4LSZE 2PM7A 4HQDA 4NIKA 1KZPA 2MOWA 5KNHD 4LRZA 2I6HA 1U2VG 3D9OA 4AXHA 4Q96A 4J8YA 4OVUA 3CVPA 4GZ5A 3CIAA 1H0AA 2V8SE 3R7RA 3Q7AA 4KT6B 5C1DA 4FADA 1NFIE 5DBKA 4BT8A 5EX0A 4GPMA 1H19A 4WNGA 3I5PA 4I6GA 4ANVA 3G2TA 5HQ8A 3MEKA 1UOHA 5B1BE 5AARA 4C48B 2LSVA 5FZRA 1V55E 3QAQA 2KZTA 3FTVA 1IQUA 2FI7A 4HOSA 5ENTD 2A5UA 4Y6CA 3DXKG 2GRMA 3GZ1A 2P9IG 4IN3B 3KEZA 3AS5A 2IQCA 2RFMA 2H6FA 5KJNA 3W9GA 3FUJA 3UM3A 1DCEA 2OEVA 5FZSA 5A6CA 3CQGB 1OXJA 2GRLA 2LXLA 1JCQA 4UQXA 4PH4B 3F6QA 2I1JA 2VGEA 4I2WA 5AAOA 4K5CA 5JJ7A 4DI3A 1EPUA 5LP0A 3IEGA 2FULA 4FLHA 4XZ4A 3MJWA 3MCXA 4C0EA 1HH8A 2XPZA 4J8SA 3UM0A 5CBOA 3RRMB 1Q2ZA 2J4DA 4HRLA 4GYYA 4BERA 3UPVA 1E8XA 2P9SG 1S70B 2ILRA 2PL2A 3LKUA 5EYLA 1TR4A 3PUJA 5JHAA 4HLLA 3C3QA 4N2QA 2WXPA 3FY4A 2QY7A 3DWLG 2KBXA 3CQCB 1N4PA 3RJVA 3NAWA 2DVWA 1DCQA 1OCOE 2IF4A 3D9HA 3S7JA 3FUNA 2J07A 4BFRA 2Q7FA 2EIJE 4L9PA 1NP7A 3SY2A 3UINC 5BNWA 4WWOA 5BPPA 2WXLA 3ULQA 1NI1A 4GYOA 2Y0BG 4F53A 1H2VC 4XE0A 1XNFA 3ONKA 4B0ZA 2X6KA 4DX6D 3LYAA 3AU5A 1JPLA 3C98A 4I1MA 2MYOA 3PZ3A 5KNGA 1Z5SC 5AQ7A 3MZLB 5AIJA 3PREA 1H6PA 4J0UA 2Y3AA 1D9SA 2WQHA 2X38A 2BKGA 1ZB1A 2KCKA 2IJGX 3RU0A 1X5BA 3E30A 4C0MA 3S2AA 3J5PA 4UQZA 4B93B 4KZ0A 4FP7A 3UQ3A 4GCNA 3IKOB 3B95A 4JL0A 5G55A 2CHZA 4XKCA 3SD5A 2GW1A 5CMWA 5H7PA 3G2VA 4TRQA 1HXIA 3RAUA 2P9KG 2WXRA 4YVOA 2H6GA 3FH5A 5DIZA 1OWLA 2XEHA 3CGHA 3RKVA 3JQ0A 2DYRE 4HS2A 4DX2A 3DSTA 3AU4A 2XZDG 1YCSB 4LERA 3EU9A 4TXPA 4TUMA 2Y4TA 3TWWA 3PE3A 2P2CP 3LY7A 2KC7A 4U04A 3GZ2A 5JA4D 2VTBB 3PZ4A 3P1UA 2VYIA 1OWNA 1U3DA 1TJFA 3CHQA 2LNIA 3DSXA 3CVLA 1IXVA 2C2LA 3C3OA 4UWLA 4BSXA 3TWVA 5T3RA 4FU3A 1HX8A 4O6FA 3MKQB 1P5QA 3GW4A 1IHGA 1YMPA 1H2TC 4L7TA 5CHEE 3EIJA 2L0TB 2PZIA 4ATZD 1IQRA 2X6JA 4OVVA 4B94A 4J7WA 1SZAA 3UUXA 3PH0C 3QC1A 5CECB 2BKKB 2WM9A 3CVVA 2CG2A 4JD2G 5ENRD 5BW8C 3L13A 4WAFA 4XI9A 3FHEA 2GRPB 4JA7A 3QWPA 2J8SD 3ASOE 4N3BA 3Q15A 1IYGA 3FEXA 5FQ8A 1G3NB 2AXVA 3KAEA 4URKA 4DX7D 4H7XA 2KCLA 4IYPA 1N4RA 1ELKA 3ZRHA 2X6FA 3UX4A 2ETCA 4I1AA 3LDZA 1TNBA 2WPVA 2J4BA 4U95D 2WXOA 3Q4AB 1N0RA 4PS7A 2BEDA 2P9UG 4BT9A 3SZ7A 4BESA 3SFZA 3UTMA 3PS6A 3SBTB 4LNBA 3Q5MA 4GZ3A 1N9AA 2Y69E 4OYSA 4ILIA 2V4LA 4BTAA 2WXQA 2Y4UA 4EHMA 4NQ0A 2LAIA 1UJKA 5ENOD 3PNTB 1ZBPA 5JMND 5AQBA 3V2OA 2B0OE 4YVQC 4J8FA 4A55A 1KPSB 2XEEA 2B6CA 4JPSA 3TWUA 2VSOE 4GCOA 3JXJA 3SGHA 1SVXA 3N71A 4A1GA 4CDNA 3DEPA 5AJDA 3FEYA 3FUMA 2I9CA 2IO3C 3CVUA 2V5QC 3AJIA 4KVMA 3ZNGA 1INZA 3DSUA 3CVWA 2VJ8A 2WQ7A 3DPYA 3FU5A 3TWQA 5E76A 3Q79A 4UQYA 1N0QA 2XRYA 4G26A 1W3BA 5LOZA 2QYUA 3MKQA 1WAO1 3L82A 3G2UA 4B8CB 3APDA 5KWDA 1O1TA 1TEZA 2VGXB 5EDSA 5FQ4A 2WXGA 3UKRG 2J49A 2A4ZA 4XI0A 3NB2A 4HOTA 2IONA 3ASFA 3B7TA 5CRUA 3NBNB 5A23A 4BSZB 5G05J 3DXMG 4A3TA 3Q49B 3K9IA 2VQ2A 4K5BA 3KSQA 1MJ0A 3S7BA 4FC8A 5G04C 1SZ9A 3ZFWA 4MKTA 1KLXA 4PS8A 3RRNB 4HB5A 4CT0A 2UY1B 4HXIA 4APFA 1QQEA 4F7AA 1SQMA 2QYJA 4AY5A 1L5JA 3B7BA 2R59A 3QARA 5T8IA 3OXFA 1A5EA 4EZLA 3LY9A 1OWMA 5J90A 4LEUA 2XZTG 4FJZA 3U66A 2ZIRA 3D3MA 5BV0A 1NZNA 1UJJA 2DCPA 4A63B 2FF4A 2XGSA 4CRWA 2UWJG 3APCA 4OAVB 3G2WA 3Q7FA 2VSXE 3O4ZA 2BF0X 3SI5A 4AOFA 2R5SA 3ZXSA 4GTPA 2RG8A 3TXMA 1TN7A 3ZKJA 3PE4A 3MKRA 3BQOA 4C9BB 4E6HA 3NZSA 4TXRA 3AG1E 3EU5A 3ESKA 3Q75A 3CVYA 4DI4A 5EKQD 4G23A 3FH7A 1WY6A 3QJZA 4Q94A 3OAWA 5ANRA 4RG6A 4CDMA 4U8HA 4HVBA 3UM1A 5CRVA 2M63A 4MBGA 2L6JA 2ETBA 2AXZA 3RSEG 3EHRA 4CCAA 2X6IA 3R9MA 3HG0D 2XPYA 4YDYA 3ENEA 4UUCA 3W9FA 4NRHB 1Y8MA 5B1AE 3KS2A 4YDEA 2LXMA 3PEUB 2WVIA 4RQIA 5CCLA 3ASHA 3I4RB 2LSUA 3VTYA 4I6EA 3FTYA 1N52A 3FDHA 4G25A 3C5RA 3RRUA 4Z68A 3PZDA 5AENA 4ILGA 2YHEA 3NZUA 5CEDB 1SW6A 2IO2C 4AIFA 2XCCA 2E0IA 2HM8A 1OUVA 1V54E 3HIZA 2JABA 2C0MA 1HO8A 5JHBA 4J8DA 3CK9A 1JWFA
chains in the Genus database with same CATH topology
2HR2A 2YHCA 1Z6TA 4J6IA 4LERA 3VLDA 2MHKA 4TUUA 4N5CA 2Y4TA 2GGFA 2BTDA 2OV8A 3PE3A 3PNLB 3SBSA 4Q69A 2VGXA 4DLOA 4G2VA 4JEUA 4GMLA 3LY7A 3B7SA 3CK8A 4EBAA 2LAHA 2KC7A 2ONDA 4U04A 3GZ2A 3U64A 1DVPA 4GPKA 3D9KA 5FJYA 2X3MA 5KJMA 3L17A 4GYWA 2WQ6A 4KYOB 4BX9A 2VTBB 2NXPA 1EYHA 1FCHA 2J9QA 3P1UA 4B8AA 1HF8A 2VYIA 3LJ3A 4HOQA 3FUHA 1OWNA 3LVRE 1U3DA 3QOUA 4HLEA 1TJFA 3CHQA 5JJ6A 3CHSA 4R7LA 2WXHA 2FEZA 2LNIA 1XGWA 3CVLA 2C2LA 3ASGA 2XEVA 3PUKA 4UWLA 4BSXA 4DLQA 3FTXA 5EX3A 3CHOA 2YQ8A 5T3RA 4GAAA 1EDUA 4FU3A 3ZYLA 1HX8A 4O6FA 5FTPA 2YNQA 4UWHA 3OXGA 2NC9A 1PAQA 2DIWA 2WXJA 2OVBA 3FUFA 1HG5A 3MKQB 1P5QA 4GA1A 3GW4A 4U0SA 4AVXA 1IHGA 1H2TC 4K03A 4L7TA 4RVBA 5CHEE 3FTZA 5E75A 1A17A 3EIJA 3ZYKA 4BTBA 2L0TB 2PZIA 4KBQA 1IQRA 2X6JA 4GA0A 4FLBA 4WUYA 4OVVA 4B94A 3FU6A 3PEVB 1SZAA 4NACA 4W9RA 3UUXA 3APFA 3PH0C 2XRZA 3S7FA 3QC1A 4AP2A 5D0OD 3L08A 2WM9A 4EBAG 2AW6A 1QZ2A 3CVVA 4PDXA 2PM6A 4AM9A 2CG2A 4IRUA 5BW8C 3FP3A 3L13A 2IOLA 3ZN3A 3ML9A 5LFAA 4WAFA 3I4GA 1FVHA 2V0PA 4K0RA 4XI9A 4CEMA 3MA5A 2WXNA 3FHEA 1Z3XA 4ACKA 3L54A 3IV0A 4EECA 3PDNA 2WB2A 4JA7A 3ZYQA 3ML8A 3QWPA 4N3BA 2PQRA 3UT8A 2KATA 3CKCA 5ARGA 3CVXA 3Q15A 1IYGA 2KZTB 3FEXA 5FQ8A 3FU0A 3HVEA 3ZW3A 4BY6A 3U3WA 3AS4A 2AXVA 4L2LA 3KAEA 3RK6A 4URKA 4UWKA 2WXMA 4JXTA 1UW4B 4H7XA 4JEHA 4WWNA 2KCLA 2WMOA 4IYPA 4CGVA 1ELKA 3ZRHA 4AEZC 3T5VA 2X6FA 3G2SA 3IHVA 4XIFA 5BUZA 3UX4A 2DBAA 4I1AA 1S0PA 3LXUX 3D9IA 3LDZA 3DPDA 5G2NA 2WPVA 3O48A 5D0QD 1UG3A 4JVSA 2J4BA 1N54A 3R7QA 5FQ6A 2WXOA 3B13A 3Q4AB 4G11A 4UI9J 4I43A 5KJLA 3HVEB 4PS7A 4BT9A 3SZ7A 3TG5A 2C0LA 3MX3A 3SFZA 4LCTA 4I9EA 5ANLA 3PS6A 3SBTB 1E8ZA 3Q5MA 4GZ3A 3CSFA 3DBSA 4AJWA 4EPZA 4OYSA 4DK5A 4DJAA 4U0ZA 2OVFA 3PVLA 4ILIA 4KZCA 4N39A 3TJPA 3QNKA 4XKBA 2V4LA 2XPIA 3MV3B 4GB9A 3HDXA 4U0UA 2WXIA 4JHKA 3JUIA 2WXQA 4BTAA 2Y4UA 4N3AA 4BX8A 1OWPA 3MYVA 3FUDA 2LAIA 4NQ0A 3RO3A 2AVPA 3L6AA 4PUCA 3CEQA 4UI9C 1UJKA 4MS6A 4FJYA 4V3IA 3QB2A 3SF4A 2XCBA 3ZYMA 3PNTB 4JHJA 1ZBPA 3AS8A 3D9PA 1EF1C 2JLBA 3T8MA 2X6HA 4YVQC 4J8FA 4ANWA 3KD7A 4A55A 2VTBA 3JYSA 2AWIA 4GZCA 1QNFA 3FU3A 3PRZA 1DNPA 2J09A 3CKBA 3FUEA 5A7DB 4JPSA 3BEEA 4FA6A 3CHMA 4F1SA 3B7UX 2EQXA 2VSOE 2IOSA 5AYWD 5JJTA 3RIBA 4GCOA 1UN8A 3LY8A 3SGHA 3ZVVA 4NURA 3EDTB 4KXKB 5ARFA 3FUKA 1H6KA 4I17A 4ILHB 4MRUA 4QFVA 2CFZA 3CR3A 3N71A 2PM7A 1UN9A 4CDRA 2MOWA 3CHRA 4A1GA 4LRZA 4CDNA 2I6HA 1JWGA 1HU3A 3D9OA 4AXHA 3EHMA 3FEYA 5AJDA 3FUMA 2I9CA 4Q96A 3ZHEB 5J08A 4OVUA 3CVPA 3FULA 5CMYA 4GZ5A 3CIAA 3CVUA 4KVMA 1H0AA 2V8SE 1INZA 3R7RA 1HZ4A 3CVWA 3U9WA 4KT6B 2VJ8A 5C1DA 4FADA 4MLPA 2HO1A 4UWGA 4WNDA 2WQ7A 3P2BA 4APOA 4L1BA 4U63A 5DBKA 3FU5A 4HOUA 4ATGA 5E76A 5EX0A 4BT8A 2KCVA 5KCMA 2UY1A 3FH8A 4L23A 1H19A 4UQYA 4WNGA 3I5PA 2XRYA 3GZSA 4I6GA 4ANVA 4WNFA 3T5XA 2MRIA 3FTSA 3QKYA 4G26A 3WXXA 4D10C 1HFAA 1W3BA 4KMOA 5FQ7A 3G2TA 5LOZA 5HQ8A 3MEKA 3CLJA 3MKQA 3FTWA 1WAO1 4IULA 2LSVA 5FZRA 4JHRA 3HHMA 3QAQA 3G2UA 4B8CB 2KZTA 3FTVA 1IQUA 2FI7A 4Y6WA 2YINA 4HOSA 3APDA 3LPZA 4EZKA 2A5UA 4Y6CA 3L22A 1TEZA 2VGXB 2GRMA 1BPOA 1HG2A 5EDSA 5FQ4A 3GZ1A 3FFLA 4IN3B 2WXGA 3Q47B 2E2EA 2J49A 3KEZA 3AS5A 2A4ZA 4XI0A 2IQCA 2CHXA 5KJNA 1PY1A 4HOTA 3QDNA 2JEKA 3FUJA 4I1OB 2IONA 3ASFA 3B7TA 5A23A 5FZSA 2J08A 2IU1A 1JUQA 3S7DA 5A6CA 3CQGB 3EHNA 5ENNA 2GRLA 4GZ6A 5G05J 5KJKA 3VLEA 3BG1B 4GMJA 4UQXA 3NQPA 3JQ1A 4PH4B 4A3TA 2I1JA 1E7VA 3K9IA 3IHYA 3Q49B 3ZHEA 2VQ2A 4GZDA 4I2WA 4RG9A 3S7BA 4E85A 4FC8A 3SHFA 3BG0B 5G04C 2RD0A 1SZ9A 3ZFWA 4MKTA 5JJ7A 5T4YA 1KLXA 4PS8A 4DI3A 1EPUA 5LP0A 4HORA 3IEGA 2FULA 3RRNB 4FLHA 4XZ4A 2WXKA 3MJWA 4U07A 4CT0A 4N2SA 4A1SA 4AV7A 3OXLA 3MCXA 1FVFA 4C0EA 1HH8A 2XPZA 2UY1B 4HXIA 4J8SA 4APFA 1QQEA 4F7AA 2R17C 2VSYA 1Y6IA 1SQMA 3RRMB 2J4DA 3QWWA 1H2UA 3CVNA 4GYYA 5FWQA 4AY5A 1E8XA 1Z3YA 3UPVA 1L5JA 5M72A 5LCWJ 2ILRA 4G24A 2PL2A 3LKUA 3U4TA 4EZJA 2R59A 3QARA 5T8IA 2LO6A 3OXFA 1KT0A 2FO7A 4ME2A 4EZLA 3ESLA 3IBEA 3LY9A 1HE8A 1OWMA 2CFUA 5HI7A 3D9LA 3ZGQA 4ANUA 5J90A 3PUJA 5LCWC 4LEUA 2I1KA 4FJZA 4JZYA 3CK7A 4WNEA 3U66A 4F3VA 1MHQA 2FBNA 3D3MA 5JHAA 4GU5A 3B7RL 3HYMB 4N2QA 5BV0A 2WXPA 1NZNA 4N3CA 3FY4A 2QY7A 1TJCA 3D9NA 3CQCB 1HS6A 1UJJA 2NSZA 2DCPA 2FF4A 4UWFA 3RJVA 2XGSA 4CRWA 4LUNU 2IF4A 3EJNA 2UWJG 2XHEA 1E90A 2XGMA 3APCA 2WMNA 3S7JA 3FUNA 1GW6A 4CGWA 2J07A 4JC8A 4BFRA 1VDYA 2Q7FA 3G2WA 4M3OA 1NP7A 3NF1A 2XQ0A 2KM4A 4FHKA 5BNWA 4AY6A 4WWOA 5BPPA 4FHJA 1PC2A 2VSXE 3O4ZA 4B89A 3CV0A 2WXLA 3ULQA 3FTUA 3VTXA 4JA9A 2BF0X 4GYOA 3E4BA 3SI5A 2R5SA 4AOFA 3TG4A 4BWRA 3LEWA 4I9CA 5BT1A 2PQNA 3ZXSA 4A3VA 4F53A 2RG8A 3LVQE 1H2VC 2ZU6B 4XE0A 3TXMA 3UMVA 1XNFA 5G05C 3PE4A 3QK0A 3ONKA 3MKRA 4B0ZA 1MQSA 4C9BB 2X6KA 1LF8A 4H7YA 3LYAA 3AU5A 4E6HA 1JPLA 3C98A 4I1MA 3NZSA 2QFCA 3ONLA 1E7UA 4DPRA 5CCMA 3R9AB 5G04J 2P58C 3FUIA 3ESKA 3MZLB 5AIJA 1ZU2A 3QWVA 3CVYA 4J8EA 2OOEA 3D9MA 3PREA 4KVOA 4DI4A 4I6JA 3OTNA 3FWVA 4UI9K 5C2YA 4J0UA 3RO2A 3SNXA 4ANXA 5EKQD 3UT7A 1E96B 4G23A 1NA0A 3FH7A 2VSNA 2Y3AA 4CT4A 4PS3A 1WY6A 2IFUA 2WQHA 2X38A 3QJZA 4Q94A 3OAWA 4YNDA 4TV3A 4RSYA 5ANRA 2L9BA 2KCKA 2IJGX 4RG6A 2V5FA 4CDMA 4U8HA 4HVBA 1YA0A 3RU0A 2M63A 1X5BA 5FZQA 2L6JA 3TXNA 2AXZA 1WM5A 2WXFA 3TGOA 4C0MA 3S2AA 4I2ZA 5LX8A 4UQZA 3MV2B 4CCAA 4KZ0A 1E8YA 2X6IA 2XGOA 3CHPA 3ZIMA 2XPYA 4FP7A 3UQ3A 4GCNA 3D9JA 3IKOB 2AXUA 2VGYA 3EIQC 3ENEA 4JL0A 4JW1A 5AJLA 5G55A 2BUGA 2CHZA 4NRHB 3CVQA 1Y8MA 3TAXA 1OWOA 3KS2A 4XKCA 3SD5A 3PEUB 2WVIA 2GW1A 5CMWA 4FULA 2L0IA 2CHWA 5CCLA 2CG3A 3ASHA 3I4RB 3LS8A 2LSUA 1E8WA 3VTYA 2I2OA 4P29A 3G2VA 4ACLA 4I6EA 4TRQA 3I3NA 1HXIA 3TL5A 3FTYA 4XX5A 3CSTA 4ABNA 1N52A 2HYZA 2WXRA 3FDHA 3GYZA 4GA2A 1NA3A 4L2YA 4G25A 4YVOA 3RRUA 3LCAA 3URZA 3PZDA 5BV1A 5AENA 3FH5A 4ILGA 2YHEA 3NZUA 5DIZA 1OWLA 1KT1A 3CGHA 1U3CA 4AIFA 3ZPJA 1ELWA 1B89A 4WWPA 3RKVA 2XCCA 3MGBA 2E0IA 2HM8A 3JQ0A 3VLFA 4HFGA 1OUVA 4EQFA 4HS2A 3HIZA 3UT4A 3ZEFA 2C0MA 3AU4A 1HO8A 3JCKC 5JHBA 3ASDA 4J8DA 3CK9A 3L16A 1JWFA 4G1TA 5FT9A 1ELRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HR2 A;  2YHC A;  4JA9 A;  5D0Q D;  3VTX A;  4GYO A;  3E4B A;  2R5S A;  4BWR A;  2MHK A;  3TG4 A;  4N5C A;  3Q4A B;  4I9C A;  4UI9 J;  2PQN A;  3GZ1 A;  3FFL A;  5BT1 A;  2Y4T A;  4IN3 B;  3Q47 B;  5KJL A;  3PE3 A;  2E2E A;  4BT9 A;  2VGX A;  3AS5 A;  4XI0 A;  4G2V A;  1XNF A;  2C0L A;  3PE4 A;  5G05 C;  3SZ7 A;  3TG5 A;  5KJN A;  4I9E A;  4HOT A;  3LY7 A;  3MKR A;  3CK8 A;  3QDN A;  2KC7 A;  2OND A;  4U04 A;  3GZ2 A;  3Q5M A;  4H7Y A;  3LYA A;  4GZ3 A;  3ASF A;  4U0Z A;  4GPK A;  2QFC A;  4N39 A;  5FZS A;  5FJY A;  5CCM A;  3S7D A;  2XPI A;  3MV3 B;  3R9A B;  5A6C A;  4GYW A;  5KJM A;  5G04 J;  4KYO B;  2P58 C;  4U0U A;  4BTA A;  4GZ6 A;  3ESK A;  2J9Q A;  1FCH A;  2Y4U A;  4N3A A;  5G05 J;  5KJK A;  4NQ0 A;  4UQX A;  1ZU2 A;  2VYI A;  3QWV A;  3RO3 A;  4HOQ A;  2AVP A;  4J8E A;  2OOE A;  3QOU A;  3CEQ A;  4UI9 C;  3Q49 B;  3K9I A;  5JJ6 A;  3ZHE A;  3FWV A;  4UI9 K;  2VQ2 A;  2FEZ A;  2LNI A;  4J0U A;  4I2W A;  4RG9 A;  3RO2 A;  5EKQ D;  3CVL A;  3S7B A;  1E96 B;  3SF4 A;  2C2L A;  1NA0 A;  2XEV A;  3ASG A;  2VSN A;  4G23 A;  5G04 C;  2XCB A;  5EX3 A;  2IFU A;  2WQH A;  2YQ8 A;  1ZBP A;  3AS8 A;  4YND A;  2JLB A;  3ZFW A;  5FTP A;  1KLX A;  4O6F A;  5JJ7 A;  2KCK A;  3OXG A;  2NC9 A;  2V5F A;  3IEG A;  4J8F A;  4RG6 A;  4YVQ C;  3KD7 A;  4U0S A;  1P5Q A;  1YA0 A;  3GW4 A;  3JYS A;  4GA1 A;  1IHG A;  3RU0 A;  4U07 A;  5FZQ A;  2L6J A;  3CKB A;  5CHE E;  5A7D B;  4N2S A;  1A17 A;  4A1S A;  3BEE A;  4BTB A;  1WM5 A;  2PZI A;  3OXL A;  3TGO A;  4KBQ A;  4GA0 A;  1HH8 A;  4I2Z A;  4UQZ A;  3MV2 B;  2UY1 B;  4WUY A;  4B94 A;  1QQE A;  5AYW D;  2VSY A;  2XGO A;  5JJT A;  3RIB A;  4GCO A;  3LY8 A;  4GCN A;  3UQ3 A;  4HOR A;  3EDT B;  4KXK B;  2VGY A;  4W9R A;  5ARF A;  4JL0 A;  3UUX A;  2BUG A;  3QWW A;  4I17 A;  3S7F A;  3CVN A;  4GYY A;  3UPV A;  4AY5 A;  4NRH B;  5M72 A;  3N71 A;  3CVQ A;  1Y8M A;  3TAX A;  5LCW J;  4CDR A;  5D0O D;  3KS2 A;  4G24 A;  2PL2 A;  2GW1 A;  3LKU A;  2I6H A;  3U4T A;  1QZ2 A;  3OXF A;  1KT0 A;  2FO7 A;  3ASH A;  4ME2 A;  3ZHE B;  4AM9 A;  5CCL A;  3LY9 A;  2LSU A;  3CVP A;  5HI7 A;  5BW8 C;  3ZGQ A;  3FP3 A;  3VTY A;  4GZ5 A;  3ZN3 A;  5LCW C;  4LEU A;  1HXI A;  4WNE A;  1HZ4 A;  3CK7 A;  4XI9 A;  4ABN A;  3MA5 A;  2HYZ A;  4F3V A;  5C1D A;  2FBN A;  3GYZ A;  3PDN A;  2HO1 A;  4GA2 A;  1NA3 A;  3HYM B;  4JA7 A;  4N2Q A;  4WND A;  4G25 A;  1NZN A;  3QWP A;  4N3C A;  4N3B A;  3LCA A;  2PQR A;  4YVO A;  2KAT A;  3CKC A;  4Y6C A;  1TJC A;  3Q15 A;  5ARG A;  3URZ A;  4APO A;  1IYG A;  5DBK A;  4HOU A;  4BT8 A;  2FF4 A;  5EX0 A;  3RJV A;  5DIZ A;  2KCV A;  3U3W A;  3AS4 A;  2XGS A;  1KT1 A;  2UY1 A;  4UQY A;  2IF4 A;  4WNG A;  3KAE A;  3ZPJ A;  1ELW A;  1B89 A;  2UWJ G;  3RKV A;  2XCC A;  4AIF A;  4WNF A;  2XGM A;  4H7X A;  3QKY A;  4G26 A;  2KCL A;  1OUV A;  3WXX A;  3S7J A;  1W3B A;  4EQF A;  5HQ8 A;  3MEK A;  4CGV A;  4CGW A;  2Q7F A;  1WAO 1;  2C0M A;  2LSV A;  3NF1 A;  4XIF A;  5FZR A;  4JHR A;  5BNW A;  2DBA A;  3ASD A;  4J8D A;  4I1A A;  4AY6 A;  2FI7 A;  3CK9 A;  1PC2 A;  4Y6W A;  4HOS A;  4G1T A;  5FT9 A;  3LPZ A;  3CV0 A;  3ULQ A;  2WPV A;  1ELR A;  3O48 A;  2VGX B; 
#chains in the Genus database with same CATH topology
 2HR2 A;  2YHC A;  4YDW A;  2EIM E;  4TUU A;  3UIO C;  1RZ4 A;  2ZXW E;  4Q69 A;  2VGX A;  1JCS A;  3TWR A;  4GPK A;  1DC2 A;  3L17 A;  4GYW A;  4KYO B;  1D8D A;  1FCH A;  1HF8 A;  4TXQ A;  3HXF A;  3LVR E;  4BEP A;  2ZGG A;  2GRO B;  3CHS A;  4R7L A;  2FEZ A;  1XGW A;  3PUK A;  3FTX A;  2YQ8 A;  3T9K A;  4UWH A;  3Q9N C;  1PAQ A;  2OVB A;  3FUF A;  1HG5 A;  4RVB A;  1A17 A;  3ZYK A;  4KBQ A;  4WUY A;  2P9P G;  3PEV B;  2LUH A;  3ZUV B;  3APF A;  3SQV A;  2XRZ A;  4AP2 A;  3L08 A;  1QZ2 A;  4IRU A;  3C3R A;  4GTM A;  3AAA C;  5LFA A;  4K0R A;  1LD7 A;  3MA5 A;  4ACK A;  3PDN A;  2WB2 A;  3ML8 A;  3UXG A;  3FU0 A;  3HVE A;  4L2L A;  2OEW A;  2DZN A;  4JXT A;  4WWN A;  4CGV A;  3T5V A;  3G2S A;  3IHV A;  5BUZ A;  1S0P A;  3D9I A;  3WG7 E;  1SA5 A;  1H6O A;  1N11 A;  3DPD A;  3O48 A;  4XEI G;  5D0Q D;  4JVS A;  1D8E A;  3R7Q A;  1TNO A;  5KJL A;  3HVE B;  2XEN A;  3TG5 A;  3MX3 A;  4LCT A;  3ABL E;  2A5E A;  3CSF A;  4EPZ A;  3X2Q E;  2OVF A;  4N39 A;  1N4Q A;  4XKB A;  2F37 A;  4U7E B;  4U0U A;  4JHK A;  4BX8 A;  2H6I A;  3TWT A;  1OWP A;  3MYV A;  5HRY A;  2ZIS A;  4MS6 A;  1SA4 A;  3QB2 A;  4G8K A;  2VTB A;  5HKP A;  3CHM A;  4F1S A;  3B7U X;  2EQX A;  5JJT A;  3EDT B;  1H6K A;  4QFV A;  2GRN B;  3ZXP A;  2XS8 A;  1OCZ E;  1JWG A;  1HU3 A;  2EIN E;  5CMY A;  3U9W A;  2HO1 A;  3ASN E;  4UWG A;  3P2B A;  1JCR A;  3Q78 A;  4L1B A;  3ULE G;  4HOU A;  2Y1L E;  5KCM A;  2UY1 A;  3FH8 A;  4L23 A;  4ZHB A;  3GZS A;  3KEA A;  3T5X A;  2MRI A;  3FTS A;  4D10 C;  3WXX A;  4CYM D;  4KMO A;  5FQ7 A;  4IUL A;  4JHR A;  4U8V D;  4Y6W A;  3LPZ A;  2DWZ A;  3L22 A;  3FFL A;  3KSL A;  2CHX A;  2ZGD A;  3V2X A;  3QDN A;  2JEK A;  2J08 A;  2IU1 A;  3S7D A;  1MX4 A;  2F8Y A;  4GMJ A;  3NQP A;  1E7V A;  3IHY A;  3ZHE A;  4RG9 A;  3SHF A;  2RD0 A;  1BD8 A;  3DSV A;  5T4Y A;  2WXK A;  4U07 A;  4N2S A;  5AQA A;  4A1S A;  3OXL A;  5FIO A;  2R17 C;  2VSY A;  1Y6I A;  1LTX A;  5KBA A;  1K1A A;  1H2U A;  3CVN A;  1Z3Y A;  4U96 D;  2R03 A;  4EZJ A;  2LO6 A;  2NYJ A;  1KT0 A;  3ESL A;  5HI7 A;  1HE8 A;  2CFU A;  3ZGQ A;  1TNZ A;  3L9T A;  4ANU A;  2RFA A;  4WNE A;  3CK7 A;  4F3V A;  3JUE A;  2FBN A;  4GU5 A;  3B7R L;  4N3C A;  3D9N A;  4UWF A;  1IKN D;  4LUN U;  4HI9 A;  1TNU A;  3ULY A;  1E90 A;  4CGW A;  4JC8 A;  4O1O A;  3NF1 A;  4DX1 A;  5CEA A;  4GMR A;  2OCC E;  4FHJ A;  1PC2 A;  1OY3 D;  3CV0 A;  3FTU A;  3TG4 A;  4LNU D;  5BT1 A;  2PQN A;  4A3V A;  3UMV A;  2KXP C;  4GTR A;  4U8Y D;  5G05 C;  3J5Q B;  2R2L A;  2QFC A;  3SFY A;  4F1P A;  5G04 J;  3DRA A;  1ZU2 A;  4J8E A;  2OOE A;  5EN5 D;  4KVO A;  4I6J A;  3OTN A;  4UI9 K;  4BET A;  4ANX A;  1E96 B;  5ITZ F;  2P9N G;  2VSN A;  4CT4 A;  1LD8 A;  4PS3 A;  2IFU A;  4TV3 A;  4RSY A;  2L9B A;  3HXD A;  5FZQ A;  2F8X K;  1FT1 A;  3PZ1 A;  1WM5 A;  5EIB E;  2WXF A;  3MV2 B;  1E8Y A;  3CHP A;  3EIQ C;  2VGY A;  4JW1 A;  2BUG A;  3V31 A;  3ISM C;  2EIK E;  2P9L G;  3UM2 A;  4FUL A;  2CG3 A;  3LS8 A;  2I2O A;  4ACL A;  4XX5 A;  3CST A;  4ABN A;  2HYZ A;  3GYZ A;  4GA2 A;  5D66 A;  4L2Y A;  3URZ A;  4HI8 A;  1BU9 A;  1ELW A;  1B89 A;  3MGB A;  1MYO A;  3VLF A;  4HFG A;  1O1R A;  2GRR B;  3HXB A;  3UT4 A;  5CBN A;  5FT9 A;  3LJN A;  4J6I A;  3BU8 A;  2GGF A;  2OV8 A;  3SBS A;  4DLO A;  4G2V A;  1TNY A;  3B7S A;  1N95 A;  1N94 A;  3ZU7 B;  1TN6 A;  2X3M A;  1NL4 A;  2WQ6 A;  4BX9 A;  2NXP A;  1EYH A;  2J9Q A;  4F6R D;  3LJ3 A;  4HOQ A;  3FUH A;  4OAU C;  3QOU A;  5JJ6 A;  2WXH A;  3ASG A;  2XEV A;  4QQI A;  5EYP F;  4DLQ A;  3CHO A;  3ZYL A;  5FTP A;  2YNQ A;  2NC9 A;  2WXJ A;  3Q73 A;  1O5M A;  4K03 A;  5B3S E;  3NOG D;  5E75 A;  4BTB A;  1K3Z D;  4G8L A;  3JXI A;  1AP7 A;  3FU6 A;  2IY0 C;  4NAC A;  4W9R A;  1OCC E;  2DYS E;  4EBA G;  5ENS D;  3FP3 A;  2IOL A;  2ETA A;  3ZN3 A;  3ML9 A;  3I4G A;  2V0P A;  5FIN A;  4CEM A;  1BLX B;  2WXN A;  1Z3X A;  3CKC A;  5ARG A;  2KZT B;  4BY6 A;  3ZW3 A;  1UW4 B;  2WMO A;  1KZO A;  2DZO A;  5ENP D;  3E34 A;  3ABM E;  4AEZ C;  3C72 A;  3UI2 A;  3LXU X;  5G2N A;  5D2M C;  1UG3 A;  1MX6 A;  1N54 A;  2XS1 A;  4G11 A;  4UI9 J;  3E33 A;  3AG3 E;  2C0L A;  4I9E A;  5ANL A;  1N4S A;  3DBS A;  4AJW A;  4DK5 A;  1WDY A;  4DJA A;  4U0Z A;  3PVL A;  2IEJ A;  5AN8 A;  3TJP A;  1QBQ A;  4GB9 A;  2XPI A;  3MV3 B;  3HDX A;  2WXI A;  3JUI A;  2H6H A;  3DSW A;  4FJY A;  3SF4 A;  3ZYM A;  4JHJ A;  1TN8 A;  2JLB A;  2X6H A;  3JYS A;  2AWI A;  4GTQ A;  2FO1 E;  1QNF A;  1DNP A;  3FUE A;  5A7D B;  3BEE A;  4FA6 A;  2IOS A;  3EUV A;  1UN8 A;  1K8K G;  4NUR A;  4KXK B;  3FUK A;  4ILH B;  3CR3 A;  1UN9 A;  4CDR A;  3CHR A;  3EHM A;  5J08 A;  3ZHE B;  3FUL A;  1HZ4 A;  4DUI A;  2F0Y A;  2RKK A;  4GTT A;  4MLP A;  1BI7 B;  4DRX E;  4WND A;  4APO A;  4U63 A;  4ATG A;  2KCV A;  4WNF A;  3QKY A;  1HFA A;  1BI8 B;  3CLJ A;  3FTW A;  3HHM A;  2YIN A;  4EZK A;  1BPO A;  1HG2 A;  3Q47 B;  1FT2 A;  2E2E A;  1AWC B;  1PY1 A;  4I1O B;  1JUQ A;  3ABK E;  3EHN A;  5ENN A;  4GZ6 A;  5KJK A;  3VLE A;  3BG1 B;  2QC9 A;  3JQ1 A;  1OCR E;  4GZD A;  4E85 A;  3BG0 B;  4HRM B;  4HOR A;  4AV7 A;  1FVF A;  5HS0 A;  3QWW A;  5FWQ A;  5M72 A;  5LCW J;  4G24 A;  3SO8 A;  3U4T A;  2FO7 A;  4ME2 A;  3IBE A;  3D9L A;  5EID A;  5BXO A;  4CZ2 D;  5LCW C;  2I1K A;  4JZY A;  1MHQ A;  3T8K A;  3HYM B;  1TJC A;  1HS6 A;  2NSZ A;  4HNA D;  3EJN A;  2XHE A;  2XGM A;  4GTS A;  2WMN A;  3DEO A;  1GW6 A;  3V79 K;  1VDY A;  4M3O A;  2XQ0 A;  2KM4 A;  4FHK A;  4AY6 A;  2AJA A;  4B89 A;  3VTX A;  4JA9 A;  3E4B A;  4BWR A;  3BUA A;  3LEW A;  4I9C A;  3LVQ E;  4O1P A;  5EIL A;  2ZU6 B;  4LG6 A;  4X8Q A;  3QK0 A;  4K5A B;  2HE0 A;  1MQS A;  1LF8 A;  4H7Y A;  3UIP C;  3ONL A;  1E7U A;  4DPR A;  5CCM A;  3R9A B;  2P58 C;  3FUI A;  3QWV A;  3D9M A;  4HBD A;  5C2Y A;  3FWV A;  3RO2 A;  3SNX A;  3UT7 A;  2V4H C;  1NA0 A;  3DSS A;  4HRN A;  4YND A;  2V5F A;  1YA0 A;  4ZFH A;  3TXN A;  3TGO A;  4I2Z A;  5LX8 A;  2XGO A;  3ZIM A;  3D9J A;  2AXU A;  5AJL A;  3CVQ A;  3TAX A;  1K1B A;  1OWO A;  2L0I A;  2CHW A;  4YDO A;  1E8W A;  4P29 A;  3I3N A;  1MZC A;  3TL5 A;  2R05 A;  1O1S A;  3AG2 E;  1NA3 A;  3TWS A;  1WG0 A;  3LCA A;  3E37 A;  5BV1 A;  3AG4 E;  4N5Q A;  1KT1 A;  1OT8 A;  1U3C A;  2EIL E;  3ZPJ A;  4WWP A;  4EQF A;  4GTV A;  3ZEF A;  4JB8 P;  3JCK C;  3ASD A;  3L16 A;  4G1T A;  1ELR A;  1Z6T A;  3VLD A;  2MHK A;  4N5C A;  3UKU G;  2BTD A;  3PNL B;  4JEU A;  4GML A;  3CK8 A;  4EBA A;  2LAH A;  2OND A;  3U64 A;  2PNN A;  1DVP A;  3D9K A;  5FJY A;  1QYM A;  5KJM A;  4B8A A;  2GRQ B;  1X81 A;  4HLE A;  4GTO A;  1YYH A;  3NOC D;  5EX3 A;  1RW2 A;  1EDU A;  4GAA A;  4M7C A;  3OXG A;  2DIW A;  4U0S A;  4GA1 A;  4AVX A;  2QZA A;  3FTZ A;  4GA0 A;  4FLB A;  4O60 A;  3E32 A;  3S7F A;  3V30 A;  5D0O D;  5IY5 E;  2AW6 A;  4PDX A;  2PM6 A;  4AM9 A;  1TYQ G;  1FVH A;  5ENQ D;  3L54 A;  3IV0 A;  4EEC A;  3ZYQ A;  2PQR A;  3UT8 A;  2KAT A;  3CVX A;  3EHQ A;  4RLY A;  3U3W A;  3AS4 A;  3HXC A;  5BXU A;  1FPP A;  3RK6 A;  4UWK A;  2WXM A;  4JEH A;  1S64 A;  4XIF A;  2DBA A;  3HXE A;  4DX5 D;  5CER B;  3SFX A;  3HRA A;  5FQ6 A;  3B13 A;  4I43 A;  3IXE A;  1S63 A;  1E8Z A;  4KZC A;  3QNK A;  2L6B A;  4N3A A;  3FUD A;  3RO3 A;  2AVP A;  3L6A A;  4PUC A;  3CEQ A;  4UI9 C;  4V3I A;  2XCB A;  3AS8 A;  1IHB A;  1EF1 C;  3D9P A;  3T8M A;  4ANW A;  3KD7 A;  4GZC A;  5AQ9 A;  3FU3 A;  3PRZ A;  2J09 A;  3CKB A;  1MX2 A;  5AYW D;  4LNG A;  3RIB A;  3LY8 A;  2R02 A;  3PZ2 A;  3TWX A;  3Q9U C;  3ZVV A;  5ARF A;  4I17 A;  4MRU A;  2CFZ A;  4LSZ E;  2PM7 A;  4HQD A;  4NIK A;  1KZP A;  2MOW A;  5KNH D;  4LRZ A;  2I6H A;  1U2V G;  3D9O A;  4AXH A;  4Q96 A;  4J8Y A;  4OVU A;  3CVP A;  4GZ5 A;  3CIA A;  1H0A A;  2V8S E;  3R7R A;  3Q7A A;  4KT6 B;  5C1D A;  4FAD A;  1NFI E;  5DBK A;  4BT8 A;  5EX0 A;  4GPM A;  1H19 A;  4WNG A;  3I5P A;  4I6G A;  4ANV A;  3G2T A;  5HQ8 A;  3MEK A;  1UOH A;  5B1B E;  5AAR A;  4C48 B;  2LSV A;  5FZR A;  1V55 E;  3QAQ A;  2KZT A;  3FTV A;  1IQU A;  2FI7 A;  4HOS A;  5ENT D;  2A5U A;  4Y6C A;  3DXK G;  2GRM A;  3GZ1 A;  2P9I G;  4IN3 B;  3KEZ A;  3AS5 A;  2IQC A;  2RFM A;  2H6F A;  5KJN A;  3W9G A;  3FUJ A;  3UM3 A;  1DCE A;  2OEV A;  5FZS A;  5A6C A;  3CQG B;  1OXJ A;  2GRL A;  2LXL A;  1JCQ A;  4UQX A;  4PH4 B;  3F6Q A;  2I1J A;  2VGE A;  4I2W A;  5AAO A;  4K5C A;  5JJ7 A;  4DI3 A;  1EPU A;  5LP0 A;  3IEG A;  2FUL A;  4FLH A;  4XZ4 A;  3MJW A;  3MCX A;  4C0E A;  1HH8 A;  2XPZ A;  4J8S A;  3UM0 A;  5CBO A;  3RRM B;  1Q2Z A;  2J4D A;  4HRL A;  4GYY A;  4BER A;  3UPV A;  1E8X A;  2P9S G;  1S70 B;  2ILR A;  2PL2 A;  3LKU A;  5EYL A;  1TR4 A;  3PUJ A;  5JHA A;  4HLL A;  3C3Q A;  4N2Q A;  2WXP A;  3FY4 A;  2QY7 A;  3DWL G;  2KBX A;  3CQC B;  1N4P A;  3RJV A;  3NAW A;  2DVW A;  1DCQ A;  1OCO E;  2IF4 A;  3D9H A;  3S7J A;  3FUN A;  2J07 A;  4BFR A;  2Q7F A;  2EIJ E;  4L9P A;  1NP7 A;  3SY2 A;  3UIN C;  5BNW A;  4WWO A;  5BPP A;  2WXL A;  3ULQ A;  1NI1 A;  4GYO A;  2Y0B G;  4F53 A;  1H2V C;  4XE0 A;  1XNF A;  3ONK A;  4B0Z A;  2X6K A;  4DX6 D;  3LYA A;  3AU5 A;  1JPL A;  3C98 A;  4I1M A;  2MYO A;  3PZ3 A;  5KNG A;  1Z5S C;  5AQ7 A;  3MZL B;  5AIJ A;  3PRE A;  1H6P A;  4J0U A;  2Y3A A;  1D9S A;  2WQH A;  2X38 A;  2BKG A;  1ZB1 A;  2KCK A;  2IJG X;  3RU0 A;  1X5B A;  3E30 A;  4C0M A;  3S2A A;  3J5P A;  4UQZ A;  4B93 B;  4KZ0 A;  4FP7 A;  3UQ3 A;  4GCN A;  3IKO B;  3B95 A;  4JL0 A;  5G55 A;  2CHZ A;  4XKC A;  3SD5 A;  2GW1 A;  5CMW A;  5H7P A;  3G2V A;  4TRQ A;  1HXI A;  3RAU A;  2P9K G;  2WXR A;  4YVO A;  2H6G A;  3FH5 A;  5DIZ A;  1OWL A;  2XEH A;  3CGH A;  3RKV A;  3JQ0 A;  2DYR E;  4HS2 A;  4DX2 A;  3DST A;  3AU4 A;  2XZD G;  1YCS B;  4LER A;  3EU9 A;  4TXP A;  4TUM A;  2Y4T A;  3TWW A;  3PE3 A;  2P2C P;  3LY7 A;  2KC7 A;  4U04 A;  3GZ2 A;  5JA4 D;  2VTB B;  3PZ4 A;  3P1U A;  2VYI A;  1OWN A;  1U3D A;  1TJF A;  3CHQ A;  2LNI A;  3DSX A;  3CVL A;  1IXV A;  2C2L A;  3C3O A;  4UWL A;  4BSX A;  3TWV A;  5T3R A;  4FU3 A;  1HX8 A;  4O6F A;  3MKQ B;  1P5Q A;  3GW4 A;  1IHG A;  1YMP A;  1H2T C;  4L7T A;  5CHE E;  3EIJ A;  2L0T B;  2PZI A;  4ATZ D;  1IQR A;  2X6J A;  4OVV A;  4B94 A;  4J7W A;  1SZA A;  3UUX A;  3PH0 C;  3QC1 A;  5CEC B;  2BKK B;  2WM9 A;  3CVV A;  2CG2 A;  4JD2 G;  5ENR D;  5BW8 C;  3L13 A;  4WAF A;  4XI9 A;  3FHE A;  2GRP B;  4JA7 A;  3QWP A;  2J8S D;  3ASO E;  4N3B A;  3Q15 A;  1IYG A;  3FEX A;  5FQ8 A;  1G3N B;  2AXV A;  3KAE A;  4URK A;  4DX7 D;  4H7X A;  2KCL A;  4IYP A;  1N4R A;  1ELK A;  3ZRH A;  2X6F A;  3UX4 A;  2ETC A;  4I1A A;  3LDZ A;  1TNB A;  2WPV A;  2J4B A;  4U95 D;  2WXO A;  3Q4A B;  1N0R A;  4PS7 A;  2BED A;  2P9U G;  4BT9 A;  3SZ7 A;  4BES A;  3SFZ A;  3UTM A;  3PS6 A;  3SBT B;  4LNB A;  3Q5M A;  4GZ3 A;  1N9A A;  2Y69 E;  4OYS A;  4ILI A;  2V4L A;  4BTA A;  2WXQ A;  2Y4U A;  4EHM A;  4NQ0 A;  2LAI A;  1UJK A;  5ENO D;  3PNT B;  1ZBP A;  5JMN D;  5AQB A;  3V2O A;  2B0O E;  4YVQ C;  4J8F A;  4A55 A;  1KPS B;  2XEE A;  2B6C A;  4JPS A;  3TWU A;  2VSO E;  4GCO A;  3JXJ A;  3SGH A;  1SVX A;  3N71 A;  4A1G A;  4CDN A;  3DEP A;  5AJD A;  3FEY A;  3FUM A;  2I9C A;  2IO3 C;  3CVU A;  2V5Q C;  3AJI A;  4KVM A;  3ZNG A;  1INZ A;  3DSU A;  3CVW A;  2VJ8 A;  2WQ7 A;  3DPY A;  3FU5 A;  3TWQ A;  5E76 A;  3Q79 A;  4UQY A;  1N0Q A;  2XRY A;  4G26 A;  1W3B A;  5LOZ A;  2QYU A;  3MKQ A;  1WAO 1;  3L82 A;  3G2U A;  4B8C B;  3APD A;  5KWD A;  1O1T A;  1TEZ A;  2VGX B;  5EDS A;  5FQ4 A;  2WXG A;  3UKR G;  2J49 A;  2A4Z A;  4XI0 A;  3NB2 A;  4HOT A;  2ION A;  3ASF A;  3B7T A;  5CRU A;  3NBN B;  5A23 A;  4BSZ B;  5G05 J;  3DXM G;  4A3T A;  3Q49 B;  3K9I A;  2VQ2 A;  4K5B A;  3KSQ A;  1MJ0 A;  3S7B A;  4FC8 A;  5G04 C;  1SZ9 A;  3ZFW A;  4MKT A;  1KLX A;  4PS8 A;  3RRN B;  4HB5 A;  4CT0 A;  2UY1 B;  4HXI A;  4APF A;  1QQE A;  4F7A A;  1SQM A;  2QYJ A;  4AY5 A;  1L5J A;  3B7B A;  2R59 A;  3QAR A;  5T8I A;  3OXF A;  1A5E A;  4EZL A;  3LY9 A;  1OWM A;  5J90 A;  4LEU A;  2XZT G;  4FJZ A;  3U66 A;  2ZIR A;  3D3M A;  5BV0 A;  1NZN A;  1UJJ A;  2DCP A;  4A63 B;  2FF4 A;  2XGS A;  4CRW A;  2UWJ G;  3APC A;  4OAV B;  3G2W A;  3Q7F A;  2VSX E;  3O4Z A;  2BF0 X;  3SI5 A;  4AOF A;  2R5S A;  3ZXS A;  4GTP A;  2RG8 A;  3TXM A;  1TN7 A;  3ZKJ A;  3PE4 A;  3MKR A;  3BQO A;  4C9B B;  4E6H A;  3NZS A;  4TXR A;  3AG1 E;  3EU5 A;  3ESK A;  3Q75 A;  3CVY A;  4DI4 A;  5EKQ D;  4G23 A;  3FH7 A;  1WY6 A;  3QJZ A;  4Q94 A;  3OAW A;  5ANR A;  4RG6 A;  4CDM A;  4U8H A;  4HVB A;  3UM1 A;  5CRV A;  2M63 A;  4MBG A;  2L6J A;  2ETB A;  2AXZ A;  3RSE G;  3EHR A;  4CCA A;  2X6I A;  3R9M A;  3HG0 D;  2XPY A;  4YDY A;  3ENE A;  4UUC A;  3W9F A;  4NRH B;  1Y8M A;  5B1A E;  3KS2 A;  4YDE A;  2LXM A;  3PEU B;  2WVI A;  4RQI A;  5CCL A;  3ASH A;  3I4R B;  2LSU A;  3VTY A;  4I6E A;  3FTY A;  1N52 A;  3FDH A;  4G25 A;  3C5R A;  3RRU A;  4Z68 A;  3PZD A;  5AEN A;  4ILG A;  2YHE A;  3NZU A;  5CED B;  1SW6 A;  2IO2 C;  4AIF A;  2XCC A;  2E0I A;  2HM8 A;  1OUV A;  1V54 E;  3HIZ A;  2JAB A;  2C0M A;  1HO8 A;  5JHB A;  4J8D A;  3CK9 A;  1JWF A; 
#chains in the Genus database with same CATH homology
 2HR2 A;  2YHC A;  1Z6T A;  4J6I A;  4LER A;  3VLD A;  2MHK A;  4TUU A;  4N5C A;  2Y4T A;  2GGF A;  2BTD A;  2OV8 A;  3PE3 A;  3PNL B;  3SBS A;  4Q69 A;  2VGX A;  4DLO A;  4G2V A;  4JEU A;  4GML A;  3LY7 A;  3B7S A;  3CK8 A;  4EBA A;  2LAH A;  2KC7 A;  2OND A;  4U04 A;  3GZ2 A;  3U64 A;  1DVP A;  4GPK A;  3D9K A;  5FJY A;  2X3M A;  5KJM A;  3L17 A;  4GYW A;  2WQ6 A;  4KYO B;  4BX9 A;  2VTB B;  2NXP A;  1EYH A;  1FCH A;  2J9Q A;  3P1U A;  4B8A A;  1HF8 A;  2VYI A;  3LJ3 A;  4HOQ A;  3FUH A;  1OWN A;  3LVR E;  1U3D A;  3QOU A;  4HLE A;  1TJF A;  3CHQ A;  5JJ6 A;  3CHS A;  4R7L A;  2WXH A;  2FEZ A;  2LNI A;  1XGW A;  3CVL A;  2C2L A;  3ASG A;  2XEV A;  3PUK A;  4UWL A;  4BSX A;  4DLQ A;  3FTX A;  5EX3 A;  3CHO A;  2YQ8 A;  5T3R A;  4GAA A;  1EDU A;  4FU3 A;  3ZYL A;  1HX8 A;  4O6F A;  5FTP A;  2YNQ A;  4UWH A;  3OXG A;  2NC9 A;  1PAQ A;  2DIW A;  2WXJ A;  2OVB A;  3FUF A;  1HG5 A;  3MKQ B;  1P5Q A;  4GA1 A;  3GW4 A;  4U0S A;  4AVX A;  1IHG A;  1H2T C;  4K03 A;  4L7T A;  4RVB A;  5CHE E;  3FTZ A;  5E75 A;  1A17 A;  3EIJ A;  3ZYK A;  4BTB A;  2L0T B;  2PZI A;  4KBQ A;  1IQR A;  2X6J A;  4GA0 A;  4FLB A;  4WUY A;  4OVV A;  4B94 A;  3FU6 A;  3PEV B;  1SZA A;  4NAC A;  4W9R A;  3UUX A;  3APF A;  3PH0 C;  2XRZ A;  3S7F A;  3QC1 A;  4AP2 A;  5D0O D;  3L08 A;  2WM9 A;  4EBA G;  2AW6 A;  1QZ2 A;  3CVV A;  4PDX A;  2PM6 A;  4AM9 A;  2CG2 A;  4IRU A;  5BW8 C;  3FP3 A;  3L13 A;  2IOL A;  3ZN3 A;  3ML9 A;  5LFA A;  4WAF A;  3I4G A;  1FVH A;  2V0P A;  4K0R A;  4XI9 A;  4CEM A;  3MA5 A;  2WXN A;  3FHE A;  1Z3X A;  4ACK A;  3L54 A;  3IV0 A;  4EEC A;  3PDN A;  2WB2 A;  4JA7 A;  3ZYQ A;  3ML8 A;  3QWP A;  4N3B A;  2PQR A;  3UT8 A;  2KAT A;  3CKC A;  5ARG A;  3CVX A;  3Q15 A;  1IYG A;  2KZT B;  3FEX A;  5FQ8 A;  3FU0 A;  3HVE A;  3ZW3 A;  4BY6 A;  3U3W A;  3AS4 A;  2AXV A;  4L2L A;  3KAE A;  3RK6 A;  4URK A;  4UWK A;  2WXM A;  4JXT A;  1UW4 B;  4H7X A;  4JEH A;  4WWN A;  2KCL A;  2WMO A;  4IYP A;  4CGV A;  1ELK A;  3ZRH A;  4AEZ C;  3T5V A;  2X6F A;  3G2S A;  3IHV A;  4XIF A;  5BUZ A;  3UX4 A;  2DBA A;  4I1A A;  1S0P A;  3LXU X;  3D9I A;  3LDZ A;  3DPD A;  5G2N A;  2WPV A;  3O48 A;  5D0Q D;  1UG3 A;  4JVS A;  2J4B A;  1N54 A;  3R7Q A;  5FQ6 A;  2WXO A;  3B13 A;  3Q4A B;  4G11 A;  4UI9 J;  4I43 A;  5KJL A;  3HVE B;  4PS7 A;  4BT9 A;  3SZ7 A;  3TG5 A;  2C0L A;  3MX3 A;  3SFZ A;  4LCT A;  4I9E A;  5ANL A;  3PS6 A;  3SBT B;  1E8Z A;  3Q5M A;  4GZ3 A;  3CSF A;  3DBS A;  4AJW A;  4EPZ A;  4OYS A;  4DK5 A;  4DJA A;  4U0Z A;  2OVF A;  3PVL A;  4ILI A;  4KZC A;  4N39 A;  3TJP A;  3QNK A;  4XKB A;  2V4L A;  2XPI A;  3MV3 B;  4GB9 A;  3HDX A;  4U0U A;  2WXI A;  4JHK A;  3JUI A;  2WXQ A;  4BTA A;  2Y4U A;  4N3A A;  4BX8 A;  1OWP A;  3MYV A;  3FUD A;  2LAI A;  4NQ0 A;  3RO3 A;  2AVP A;  3L6A A;  4PUC A;  3CEQ A;  4UI9 C;  1UJK A;  4MS6 A;  4FJY A;  4V3I A;  3QB2 A;  3SF4 A;  2XCB A;  3ZYM A;  3PNT B;  4JHJ A;  1ZBP A;  3AS8 A;  3D9P A;  1EF1 C;  2JLB A;  3T8M A;  2X6H A;  4YVQ C;  4J8F A;  4ANW A;  3KD7 A;  4A55 A;  2VTB A;  3JYS A;  2AWI A;  4GZC A;  1QNF A;  3FU3 A;  3PRZ A;  1DNP A;  2J09 A;  3CKB A;  3FUE A;  5A7D B;  4JPS A;  3BEE A;  4FA6 A;  3CHM A;  4F1S A;  3B7U X;  2EQX A;  2VSO E;  2IOS A;  5AYW D;  5JJT A;  3RIB A;  4GCO A;  1UN8 A;  3LY8 A;  3SGH A;  3ZVV A;  4NUR A;  3EDT B;  4KXK B;  5ARF A;  3FUK A;  1H6K A;  4I17 A;  4ILH B;  4MRU A;  4QFV A;  2CFZ A;  3CR3 A;  3N71 A;  2PM7 A;  1UN9 A;  4CDR A;  2MOW A;  3CHR A;  4A1G A;  4LRZ A;  4CDN A;  2I6H A;  1JWG A;  1HU3 A;  3D9O A;  4AXH A;  3EHM A;  3FEY A;  5AJD A;  3FUM A;  2I9C A;  4Q96 A;  3ZHE B;  5J08 A;  4OVU A;  3CVP A;  3FUL A;  5CMY A;  4GZ5 A;  3CIA A;  3CVU A;  4KVM A;  1H0A A;  2V8S E;  1INZ A;  3R7R A;  1HZ4 A;  3CVW A;  3U9W A;  4KT6 B;  2VJ8 A;  5C1D A;  4FAD A;  4MLP A;  2HO1 A;  4UWG A;  4WND A;  2WQ7 A;  3P2B A;  4APO A;  4L1B A;  4U63 A;  5DBK A;  3FU5 A;  4HOU A;  4ATG A;  5E76 A;  5EX0 A;  4BT8 A;  2KCV A;  5KCM A;  2UY1 A;  3FH8 A;  4L23 A;  1H19 A;  4UQY A;  4WNG A;  3I5P A;  2XRY A;  3GZS A;  4I6G A;  4ANV A;  4WNF A;  3T5X A;  2MRI A;  3FTS A;  3QKY A;  4G26 A;  3WXX A;  4D10 C;  1HFA A;  1W3B A;  4KMO A;  5FQ7 A;  3G2T A;  5LOZ A;  5HQ8 A;  3MEK A;  3CLJ A;  3MKQ A;  3FTW A;  1WAO 1;  4IUL A;  2LSV A;  5FZR A;  4JHR A;  3HHM A;  3QAQ A;  3G2U A;  4B8C B;  2KZT A;  3FTV A;  1IQU A;  2FI7 A;  4Y6W A;  2YIN A;  4HOS A;  3APD A;  3LPZ A;  4EZK A;  2A5U A;  4Y6C A;  3L22 A;  1TEZ A;  2VGX B;  2GRM A;  1BPO A;  1HG2 A;  5EDS A;  5FQ4 A;  3GZ1 A;  3FFL A;  4IN3 B;  2WXG A;  3Q47 B;  2E2E A;  2J49 A;  3KEZ A;  3AS5 A;  2A4Z A;  4XI0 A;  2IQC A;  2CHX A;  5KJN A;  1PY1 A;  4HOT A;  3QDN A;  2JEK A;  3FUJ A;  4I1O B;  2ION A;  3ASF A;  3B7T A;  5A23 A;  5FZS A;  2J08 A;  2IU1 A;  1JUQ A;  3S7D A;  5A6C A;  3CQG B;  3EHN A;  5ENN A;  2GRL A;  4GZ6 A;  5G05 J;  5KJK A;  3VLE A;  3BG1 B;  4GMJ A;  4UQX A;  3NQP A;  3JQ1 A;  4PH4 B;  4A3T A;  2I1J A;  1E7V A;  3K9I A;  3IHY A;  3Q49 B;  3ZHE A;  2VQ2 A;  4GZD A;  4I2W A;  4RG9 A;  3S7B A;  4E85 A;  4FC8 A;  3SHF A;  3BG0 B;  5G04 C;  2RD0 A;  1SZ9 A;  3ZFW A;  4MKT A;  5JJ7 A;  5T4Y A;  1KLX A;  4PS8 A;  4DI3 A;  1EPU A;  5LP0 A;  4HOR A;  3IEG A;  2FUL A;  3RRN B;  4FLH A;  4XZ4 A;  2WXK A;  3MJW A;  4U07 A;  4CT0 A;  4N2S A;  4A1S A;  4AV7 A;  3OXL A;  3MCX A;  1FVF A;  4C0E A;  1HH8 A;  2XPZ A;  2UY1 B;  4HXI A;  4J8S A;  4APF A;  1QQE A;  4F7A A;  2R17 C;  2VSY A;  1Y6I A;  1SQM A;  3RRM B;  2J4D A;  3QWW A;  1H2U A;  3CVN A;  4GYY A;  5FWQ A;  4AY5 A;  1E8X A;  1Z3Y A;  3UPV A;  1L5J A;  5M72 A;  5LCW J;  2ILR A;  4G24 A;  2PL2 A;  3LKU A;  3U4T A;  4EZJ A;  2R59 A;  3QAR A;  5T8I A;  2LO6 A;  3OXF A;  1KT0 A;  2FO7 A;  4ME2 A;  4EZL A;  3ESL A;  3IBE A;  3LY9 A;  1HE8 A;  1OWM A;  2CFU A;  5HI7 A;  3D9L A;  3ZGQ A;  4ANU A;  5J90 A;  3PUJ A;  5LCW C;  4LEU A;  2I1K A;  4FJZ A;  4JZY A;  3CK7 A;  4WNE A;  3U66 A;  4F3V A;  1MHQ A;  2FBN A;  3D3M A;  5JHA A;  4GU5 A;  3B7R L;  3HYM B;  4N2Q A;  5BV0 A;  2WXP A;  1NZN A;  4N3C A;  3FY4 A;  2QY7 A;  1TJC A;  3D9N A;  3CQC B;  1HS6 A;  1UJJ A;  2NSZ A;  2DCP A;  2FF4 A;  4UWF A;  3RJV A;  2XGS A;  4CRW A;  4LUN U;  2IF4 A;  3EJN A;  2UWJ G;  2XHE A;  1E90 A;  2XGM A;  3APC A;  2WMN A;  3S7J A;  3FUN A;  1GW6 A;  4CGW A;  2J07 A;  4JC8 A;  4BFR A;  1VDY A;  2Q7F A;  3G2W A;  4M3O A;  1NP7 A;  3NF1 A;  2XQ0 A;  2KM4 A;  4FHK A;  5BNW A;  4AY6 A;  4WWO A;  5BPP A;  4FHJ A;  1PC2 A;  2VSX E;  3O4Z A;  4B89 A;  3CV0 A;  2WXL A;  3ULQ A;  3FTU A;  3VTX A;  4JA9 A;  2BF0 X;  4GYO A;  3E4B A;  3SI5 A;  2R5S A;  4AOF A;  3TG4 A;  4BWR A;  3LEW A;  4I9C A;  5BT1 A;  2PQN A;  3ZXS A;  4A3V A;  4F53 A;  2RG8 A;  3LVQ E;  1H2V C;  2ZU6 B;  4XE0 A;  3TXM A;  3UMV A;  1XNF A;  5G05 C;  3PE4 A;  3QK0 A;  3ONK A;  3MKR A;  4B0Z A;  1MQS A;  4C9B B;  2X6K A;  1LF8 A;  4H7Y A;  3LYA A;  3AU5 A;  4E6H A;  1JPL A;  3C98 A;  4I1M A;  3NZS A;  2QFC A;  3ONL A;  1E7U A;  4DPR A;  5CCM A;  3R9A B;  5G04 J;  2P58 C;  3FUI A;  3ESK A;  3MZL B;  5AIJ A;  1ZU2 A;  3QWV A;  3CVY A;  4J8E A;  2OOE A;  3D9M A;  3PRE A;  4KVO A;  4DI4 A;  4I6J A;  3OTN A;  3FWV A;  4UI9 K;  5C2Y A;  4J0U A;  3RO2 A;  3SNX A;  4ANX A;  5EKQ D;  3UT7 A;  1E96 B;  4G23 A;  1NA0 A;  3FH7 A;  2VSN A;  2Y3A A;  4CT4 A;  4PS3 A;  1WY6 A;  2IFU A;  2WQH A;  2X38 A;  3QJZ A;  4Q94 A;  3OAW A;  4YND A;  4TV3 A;  4RSY A;  5ANR A;  2L9B A;  2KCK A;  2IJG X;  4RG6 A;  2V5F A;  4CDM A;  4U8H A;  4HVB A;  1YA0 A;  3RU0 A;  2M63 A;  1X5B A;  5FZQ A;  2L6J A;  3TXN A;  2AXZ A;  1WM5 A;  2WXF A;  3TGO A;  4C0M A;  3S2A A;  4I2Z A;  5LX8 A;  4UQZ A;  3MV2 B;  4CCA A;  4KZ0 A;  1E8Y A;  2X6I A;  2XGO A;  3CHP A;  3ZIM A;  2XPY A;  4FP7 A;  3UQ3 A;  4GCN A;  3D9J A;  3IKO B;  2AXU A;  2VGY A;  3EIQ C;  3ENE A;  4JL0 A;  4JW1 A;  5AJL A;  5G55 A;  2BUG A;  2CHZ A;  4NRH B;  3CVQ A;  1Y8M A;  3TAX A;  1OWO A;  3KS2 A;  4XKC A;  3SD5 A;  3PEU B;  2WVI A;  2GW1 A;  5CMW A;  4FUL A;  2L0I A;  2CHW A;  5CCL A;  2CG3 A;  3ASH A;  3I4R B;  3LS8 A;  2LSU A;  1E8W A;  3VTY A;  2I2O A;  4P29 A;  3G2V A;  4ACL A;  4I6E A;  4TRQ A;  3I3N A;  1HXI A;  3TL5 A;  3FTY A;  4XX5 A;  3CST A;  4ABN A;  1N52 A;  2HYZ A;  2WXR A;  3FDH A;  3GYZ A;  4GA2 A;  1NA3 A;  4L2Y A;  4G25 A;  4YVO A;  3RRU A;  3LCA A;  3URZ A;  3PZD A;  5BV1 A;  5AEN A;  3FH5 A;  4ILG A;  2YHE A;  3NZU A;  5DIZ A;  1OWL A;  1KT1 A;  3CGH A;  1U3C A;  4AIF A;  3ZPJ A;  1ELW A;  1B89 A;  4WWP A;  3RKV A;  2XCC A;  3MGB A;  2E0I A;  2HM8 A;  3JQ0 A;  3VLF A;  4HFG A;  1OUV A;  4EQF A;  4HS2 A;  3HIZ A;  3UT4 A;  3ZEF A;  2C0M A;  3AU4 A;  1HO8 A;  3JCK C;  5JHB A;  3ASD A;  4J8D A;  3CK9 A;  3L16 A;  1JWF A;  4G1T A;  5FT9 A;  1ELR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...