3R9AB

Human alanine-glyoxylate aminotransferase in complex with the tpr domain of human pex5p
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
315
structure length
289
Chain Sequence
QFEEENPLRDHPQPFEEGLRRLQEGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACETLRDWLRYTPAYAHLVDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFGLPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine--pyruvate aminotransferase
publication title Molecular requirements for peroxisomal targeting of alanine-glyoxylate aminotransferase as an essential determinant in primary hyperoxaluria type 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transport protein
total genus 116
structure length 289
sequence length 315
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13181 TPR_8 Tetratricopeptide repeat
B PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3r9aB00
4J8DA 4N2QA 3E4BA 5BW8C 1NZNA 2AVPA 3PE3A 4N39A 2HYZA 4HORA 3HYMB 3AS5A 3TG4A 4ME2A 3RU0A 3ZN3A 2HR2A 5DIZA 3OXLA 2KATA 5A6CA 4GA0A 3ZHEA 2WQHA 5FT9A 2XGSA 5KJMA 5FJYA 3CKBA 3FFLA 4B94A 2WPVA 2OOEA 5LCWJ 5G05C 3SF4A 5EKQD 4I9EA 5JJ6A 4N3AA 1E96B 3ASFA 3CK9A 3NF1A 4G2VA 1ZU2A 1HXIA 5G04J 3QOUA 3UUXA 4CGWA 3S7DA 4UI9K 3LPZA 2I6HA 3S7FA 2PL2A 2PZIA 3ULQA 2VSYA 4AM9A 2NC9A 4APOA 4XIFA 5FZRA 5JJTA 2JLBA 3LKUA 3S7BA 2DBAA 5M72A 4BT8A 1WM5A 4G1TA 4Y6CA 2FF4A 4HOUA 1NA3A 1P5QA 3TGOA 4WNDA 3S7JA 3MV2B 3FP3A 3TG5A 3Q5MA 4HOTA 4CDRA 1YA0A 1IHGA 4NQ0A 3VTXA 3OXFA 3ZPJA 3Q49B 4O6FA 3ASGA 3MV3B 4N2SA 3QDNA 2Y4UA 5EX0A 3Q4AB 2UY1A 4YNDA 2YHCA 2IFUA 2LSUA 3AS8A 4GZ3A 3R9AB 4AY6A 5C1DA 5HI7A 3CK8A 3ESKA 5DBKA 2E2EA 4KBQA 4UI9C 4IN3B 3ASDA 3LYAA 1ELWA 4AY5A 2V5FA 3WXXA 4AIFA 4W9RA 1QQEA 2VQ2A 4GCNA 3RO3A 4ABNA 1WAO1 2FI7A 3FWVA 3GW4A 3U4TA 5CCLA 5AYWD 2LSVA 2XGOA 3IEGA 2VGXB 4N3BA 1B89A 5FZSA 2L6JA 4F3VA 3CVLA 5LCWC 3EDTB 3PE4A 2XGMA 4U0SA 1PC2A 2XPIA 5JJ7A 4GA1A 3KAEA 4KYOB 3CKCA 5G04C 2XCBA 5KJLA 4XI0A 2GW1A 1QZ2A 3CK7A 3OXGA 4J8FA 3GYZA 4GYYA 5KJNA 4GPKA 3LY9A 5CCMA 2KC7A 4I9CA 3GZ1A 5FTPA 3CVQA 4GYWA 3KS2A 2J9QA 4XI9A 2VYIA 2KCVA 1XNFA 4Y6WA 5HQ8A 3MEKA 2LNIA 4G25A 1FCHA 3GZ2A 3ASHA 4GCOA 3ZHEB 3JYSA 5ARGA 3AS4A 3RJVA 3BEEA 4JHRA 3MA5A 2UWJG 2ONDA 3URZA 4YVQC 4BT9A 4U0ZA 1HZ4A 1ZBPA 3CEQA 3N71A 3LY7A 2FO7A 4WNEA 3KD7A 3CVPA 2PQRA 4RG6A 5BT1A 2VSNA 3PDNA 3UPVA 2P58C 5EX3A 4I1AA 3VTYA 2C0LA 4KXKB 2KCLA 3LCAA 4YVOA 4N5CA 3SZ7A 2IF4A 2Y4TA 4N3CA 3CV0A 4U07A 2KCKA 3Q47B 4NRHB 5G05J 4JA9A 2MHKA 4BWRA 4EQFA 4UQYA 4UQXA 1NA0A 4G24A 3TAXA 3QWPA 3QWVA 4GA2A 4WNGA 4I2WA 1OUVA 4J8EA 2C0MA 5CHEE 4BTAA 3K9IA 4CGVA 5BNWA 3ZGQA 4H7XA 4I2ZA 2VGYA 2FEZA 3QWWA 3ZFWA 4I17A 1IYGA 2BUGA 4HOQA 4HOSA 4G26A 4RG9A 1TJCA 2UY1B 3QKYA 2XEVA 5D0QD 1KT0A 2YQ8A 1W3BA 1A17A 2Q7FA 1Y8MA 3RO2A 3O48A 3LY8A 4A1SA 4JL0A 3Q15A 2XCCA 3RKVA 1HH8A 4UQZA 2HO1A 4GZ6A 4WNFA 2PQNA 2QFCA 5A7DB 5D0OD 2C2LA 5KJKA 4G23A 2VGXA 1KLXA 4J0UA 4BTBA 1ELRA 4LEUA 4GYOA 4U04A 2FBNA 4WUYA 3MKRA 5FZQA 1KT1A 3CVNA 4JA7A 3RIBA 2R5SA 3UQ3A 4UI9J 4GZ5A 4U0UA 4H7YA 5ARFA 3U3WA
chains in the Genus database with same CATH superfamily
2KBXA 3FTSA 3AS5A 1H0AA 1KZOA 4ME2A 3EHNA 1TN7A 3B13A 2JEKA 1MX6A 5CERB 1OWLA 3RRUA 4P29A 3CVVA 5A6CA 2BTDA 4GA0A 5FT9A 2X6FA 5CEAA 5KJMA 4DI4A 5FJYA 2J8SD 3FFLA 3LJNA 4B94A 4EZJA 3JXJA 2V5QC 2XS8A 5G05C 1S0PA 3KSLA 4BY6A 4HQDA 3D9IA 3B7BA 5T3RA 2YNQA 2P9NG 2OV8A 4MRUA 5JJ6A 1E96B 3ZRHA 3CK9A 4G2VA 2DIWA 4JEUA 4DJAA 3UUXA 4LNUD 3OTNA 1SZAA 1MZCA 4DX1A 1HX8A 2AXVA 3ZIMA 4GMRA 4XEIG 4BESA 4Q69A 2PL2A 3ULQA 3ZNGA 3P1UA 3RRMB 4L7TA 3DSTA 4F1SA 3SGHA 1IQUA 4DX6D 3HIZA 3CVWA 2QY7A 3UM2A 3MCXA 4GAAA 1WM5A 2FF4A 4C9BB 3IKOB 2DYSE 4WWPA 1Q2ZA 4HXIA 3TGOA 1NI1A 4AXHA 4MKTA 2ETCA 3FP3A 4HOTA 4ZFHA 4CDRA 1NFIE 3EUVA 1N9AA 2B6CA 3VTXA 3NOCD 4PS3A 4M7CA 1DVPA 4ZHBA 1X81A 2XPZA 5T8IA 1N11A 3LVRE 3I4RB 4Q94A 3SNXA 3CVXA 1YCSB 3PUKA 2IFUA 3QB2A 4V3IA 3FTXA 3NZUA 3UIOC 1TN6A 3C72A 3L16A 2FO1E 1KZPA 3LYAA 1X5BA 2GGFA 2V5FA 1BI7B 4DRXE 4ILIA 1S63A 1NL4A 4GCNA 3RO3A 5CECB 4ABNA 3LS8A 3FWVA 3GW4A 4I6GA 3B7UX 3V30A 1O1TA 1IHBA 3Q7AA 2V4HC 3NAWA 1B89A 3TXNA 1A5EA 3IHYA 1HG2A 4HFGA 5LCWC 1YMPA 3EDTB 2V4LA 4FJZA 1RZ4A 2R02A 2CHZA 3PZ4A 3KAEA 3MKQB 2XHEA 4KVMA 2XCBA 1Z3YA 1S64A 3CIAA 1QZ2A 3CK7A 1MQSA 4J8FA 1N94A 2QZAA 3FTZA 4DX2A 3DSXA 1OCOE 2LO6A 4B89A 4O1OA 4LNBA 1WY6A 3DRAA 2R17C 2J9QA 5D66A 3FU0A 3J5PA 3LEWA 4Y6WA 5HQ8A 2VJ8A 1O1SA 3SI5A 4JVSA 2GRLA 4CEMA 4GCOA 4LRZA 2OEWA 3DSUA 5T4YA 4GU5A 3TWRA 3BEEA 3ESLA 5CRVA 3JQ0A 3L22A 2ONDA 3URZA 3FH8A 3D9NA 3ZYKA 1LD7A 4YVQC 3E30A 1OXJA 4BT9A 2RD0A 3LVQE 4B0ZA 3N71A 3TWQA 2L9BA 4GTOA 4J8SA 5AQ9A 3KD7A 3CVPA 3FUKA 3B7SA 3L17A 3R9MA 3NQPA 3UPVA 2P58C 5EX3A 4I1AA 4KXKB 3FTYA 3JUIA 4YVOA 3ZXSA 3QK0A 3I5PA 3Q75A 3UINC 3F6QA 3CV0A 4XX5A 3AG4E 1AP7A 1N95A 1TNYA 5G05J 2CHWA 4UQYA 4LNGA 3J5QB 2WXLA 4WNGA 3TWUA 4U8HA 5ENTD 4NURA 1U3CA 5CHEE 4BTAA 3SFYA 3TWVA 3D9OA 3DXMG 5KWDA 4I2ZA 2VGYA 2FEZA 3QWWA 4HVBA 4F53A 3QJZA 1SVXA 1H6PA 4RG9A 3QKYA 2IEJA 5D0QD 3LDZA 1A17A 3AU4A 3WG7E 3O48A 3EHMA 3BQOA 2AWIA 5KBAA 3RKVA 5J08A 2HO1A 2QFCA 5KJKA 2VGXA 4J0UA 3ZYLA 1ELRA 4L1BA 4LEUA 3T5XA 1UN9A 2FULA 2CHXA 5FQ4A 4C0EA 2L0TB 1QNFA 5JHBA 2WXFA 4F7AA 1SQMA 2EINE 4ANXA 1LF8A 1N54A 4GTSA 4JA7A 3CVNA 1INZA 2ZXWE 4TV3A 3E37A 2WB2A 3QNKA 3MX3A 3ZUVB 1E7VA 3UQ3A 4H7YA 3TJPA 3U3WA 4N2QA 3E4BA 5BW8C 4ANWA 2RG8A 5AJLA 2EQXA 4HORA 3ASNE 2DCPA 3PZ3A 3TG4A 2V0PA 5JHAA 3UXGA 3OXLA 3D9PA 1MJ0A 3ZXPA 3ZHEA 2WQHA 2LXLA 5KNHD 5AQAA 2XGSA 3CKBA 4UUCA 2WPVA 5LCWJ 4I6JA 4DPRA 3LXUX 3B95A 1V54E 3BU8A 3AG3E 3BUAA 2WXRA 1N4RA 1TNUA 4GTRA 1HXIA 3QOUA 3ONKA 2WMOA 4FHKA 2NXPA 3C3QA 3PEVB 1OWPA 3S7DA 2GRQB 2YINA 2I6HA 3RK6A 3U64A 4U95D 1QYMA 3G2WA 2LAIA 4R7LA 5JJTA 2JLBA 2GRNB 2BKGA 1AWCB 3DWLG 2DBAA 5M72A 4L2YA 4BT8A 4HRMB 4B93B 4Y6CA 2R05A 2GRRB 5JMND 3S7JA 3EU9A 3PH0C 1D9SA 5CMYA 3CVYA 4ACLA 3TG5A 4O60A 1MX4A 3EHQA 3FUIA 3G2UA 3Q49B 1BPOA 1MYOA 3QDNA 2Y4UA 5EX0A 4NIKA 2MRIA 5CBOA 2YHCA 3B7RL 5BV0A 1FT1A 2R2LA 2LSUA 3L54A 4I1MA 4JHKA 5DBKA 1EDUA 4UI9C 2WXJA 4IN3B 1BLXB 4IRUA 3E33A 3SO8A 2ZGDA 1ELWA 4MBGA 2H6IA 2J4DA 4W9RA 4L2LA 4FU3A 2DZNA 1SA4A 2XENA 5C2YA 5AYWD 1Y6IA 4FHJA 2XGOA 4JB8P 4GTQA 3T8MA 4DI3A 1SA5A 2F37A 4Q96A 1UW4B 4N3BA 5AQ7A 3PZ2A 3FHEA 4HRNA 1D8DA 2IOSA 4U0SA 3QARA 5JJ7A 4ANUA 1K8KG 4KYOB 2XEHA 3EIQC 2GW1A 3UT8A 4J6IA 2RKKA 1OT8A 1PY1A 5AN8A 4TXRA 3BG0B 3TWTA 4GPKA 3LY9A 3Q73A 5FTPA 4JPSA 1H2UA 3FH5A 1K1BA 5HRYA 1IXVA 1FCHA 3JYSA 3DBSA 3AS4A 4LG6A 4DX7D 3RJVA 4X8QA 2OVBA 4URKA 4U63A 4YDOA 1D8EA 1O5MA 3C3OA 5ENRD 2P2CP 4U0ZA 3VLEA 4CRWA 3IV0A 1OCZE 5EIBE 3R7RA 5E75A 4WNEA 3DPDA 4BFRA 2NYJA 4RG6A 2OCCE 2Y3AA 4JZYA 3TWWA 3VTYA 2KCLA 1TEZA 3P2BA 2WXPA 2X6KA 4GMJA 4ATGA 3PEUB 2KZTB 2XQ0A 2KCKA 3KEZA 1TJFA 4JA9A 2A4ZA 3BG1B 4EQFA 4IULA 4MS6A 4UQXA 4G24A 3TAXA 3FU3A 3LJ3A 3QWPA 3QWVA 2IJGX 5CRUA 4C48B 3UM1A 4UWFA 3FEYA 3APDA 4GB9A 3PRZA 3OAWA 2C0MA 3NOGD 1ELKA 3K9IA 3ZYQA 4HLLA 1WDYA 4CGVA 2P9UG 5AQBA 2EIJE 3DSSA 3Q9UC 4H7XA 4HBDA 3ZFWA 3R7QA 2LXMA 4I17A 4PDXA 5LX8A 4G8LA 4U96D 2UY1B 2XEVA 3D9HA 1N4SA 2YQ8A 4A1GA 2EIKE 4UWHA 4PS8A 1Y8MA 2I9CA 3RO2A 3SHFA 3S2AA 2XS1A 2KZTA 3LY8A 1WG0A 4GTTA 1YYHA 3E34A 3Q15A 2WQ6A 1Z6TA 4FP7A 4AJWA 3CLJA 3G2SA 2CG2A 2PQNA 3CHQA 5LOZA 2H6FA 2C2LA 2WXOA 2QYUA 5FIOA 2WQ7A 3HXEA 4FJYA 2FBNA 4I6EA 1UOHA 3MKQA 2EILE 1KT1A 2JABA 3L82A 3RIBA 4BEPA 5G55A 1OWNA 4UI9J 1E90A 3SFZA 4APFA 3ENEA 2Y0BG 4J8DA 1MX2A 4CDMA 3CHOA 3JQ1A 3HYMB 3W9GA 2H6GA 1K3ZD 3L08A 4EPZA 4J7WA 3JXIA 3RU0A 3ZN3A 2HR2A 3EU5A 1U2VG 2PM7A 4ATZD 5J90A 4K5AB 2E0IA 3DEOA 3HXFA 1HE8A 4FADA 1H6OA 4TXQA 2P9PG 5ENQD 3T9KA 3D3MA 2VGEA 3FUNA 3RAUA 2OOEA 3SF4A 5EKQD 3DSVA 3HRAA 2VTBB 1IKND 4AOFA 4I9EA 4DLOA 3PZDA 4N3AA 1SW6A 3ASFA 3MJWA 4OAUC 2X6IA 4XKBA 2L6BA 1U3DA 3AJIA 4EBAG 4CGWA 3G2VA 2WXNA 2J4BA 4L23A 3FU5A 1H2TC 4UI9K 3ULYA 3LPZA 2I2OA 2I1KA 2PZIA 4APOA 3V31A 4DLQA 3V79K 4HI8A 4K03A 1IQRA 3LKUA 2J49A 3G2TA 4CT4A 1O1RA 3AU5A 4HOUA 1DCEA 2HM8A 3PS6A 5E76A 3FTVA 5BXOA 3MV2B 4XZ4A 2X6HA 3QC1A 1YA0A 1IHGA 1HO8A 3OXFA 4K5CA 4O6FA 1PAQA 3MV3B 1K1AA 3Q4AB 3CHSA 3ABME 4A55A 1TNOA 4QQIA 3ABKE 3UTMA 4EZLA 4WWOA 1SZ9A 3FEXA 1JUQA 4GZ3A 4K5BA 2CG3A 2BF0X 5C1DA 1UG3A 5HI7A 3SY2A 1EPUA 3CHMA 5ANRA 3SFXA 4KBQA 3UX4A 2WXQA 4KZ0A 2ETBA 3UT4A 3JCKC 1H2VC 3PUJA 4AY5A 1DCQA 2ZGGA 2XRYA 3WXXA 2KM4A 2IO2C 4AIFA 4HRLA 4EECA 2B0OE 1XGWA 2FI7A 3B7TA 3U4TA 2L0IA 2GRPB 3DPYA 4BERA 4JEHA 3RRNB 1OCRE 5FZSA 3Q7FA 1HFAA 2L6JA 2F0YA 3L6AA 3DEPA 3CVLA 3CHRA 3CQGB 2DWZA 2Y69E 3ZKJA 3PE4A 1FVHA 2XGMA 5FWQA 3CKCA 5G04C 4GTVA 4I1OB 4PH4B 4XI0A 5ANLA 3FULA 5FQ7A 3AG1E 5EN5D 3ULEG 4DK5A 3OXGA 3NZSA 2WXKA 4Z68A 3GYZA 4PS7A 3APFA 3IBEA 4GPMA 1N52A 5CCMA 2KC7A 4I9CA 3ASOE 2J08A 2WM9A 2CFZA 5LFAA 4ACKA 1H19A 4NACA 1UN8A 2VYIA 2KCVA 3E32A 4JXTA 1L5JA 3T5VA 3MEKA 3GZ2A 3ASHA 3ZW3A 2IONA 3TL5A 1ZB1A 2A5EA 3MA5A 5ENNA 5FQ8A 2UWJG 3FU6A 3ISMC 2ZIRA 4GZCA 1FVFA 4KZCA 1HZ4A 2P9KG 1ZBPA 5EILA 1N0RA 1JPLA 3UKUG 5IY5E 2FO7A 2AJAA 4CZ2D 2VSNA 3PDNA 4QFVA 3I3NA 4PUCA 2C0LA 5HKPA 2RFAA 4CT0A 2WXMA 4C0MA 3SZ7A 4N3CA 3FUHA 1E8ZA 4U8YD 4JHJA 5CEDB 4KVOA 2EIME 3SBSA 2MHKA 4EBAA 2AW6A 5JA4D 4ANVA 3FH7A 4DX5D 2ILRA 4GA2A 1JCSA 2R59A 3EIJA 4I2WA 1RW2A 4TUMA 1OUVA 4J8EA 3TWSA 2KXPC 2AXUA 3CR3A 4GMLA 3ZGQA 3X2QE 1S70B 4EZKA 2P9SG 4HOQA 4HOSA 4G26A 1TJCA 2Y1LE 1KT0A 5EIDA 4BX9A 2XRZA 1W3BA 2V8SE 3ZVVA 4JW1A 2CFUA 1BU9A 4XKCA 5ITZF 4A1SA 4JL0A 2XCCA 4J8YA 3HXDA 4OAVB 4ILGA 4OVUA 2WXIA 4WWNA 5A7DB 5AJDA 3TWXA 5AENA 4G8KA 4JC8A 2PNNA 1HG5A 5ENOD 4BTBA 3T8KA 2X6JA 4GYOA 2ZU6B 4U04A 3CQCB 2WVIA 4BX8A 3CGHA 3MKRA 3MYVA 3ZEFA 5FZQA 3L9TA 4OVVA 5B1BE 2QYJA 5B3SE 2R5SA 2RFMA 4M3OA 1LD8A 3FDHA 4GZ5A 5KCMA 3CSTA 1JWGA 2X38A 2I1JA 1OWMA 1NZNA 2AVPA 3PE3A 2R03A 4N39A 2HYZA 4DUIA 2ZISA 4XE0A 5CBNA 1EF1C 4BSXA 3V2OA 1GW6A 3UKRG 2XPYA 5DIZA 1TN8A 4F1PA 2VSXE 3PNLB 2KATA 3DXKG 4FLHA 2YHEA 3FUDA 4MLPA 5FINA 5AAOA 1KPSB 3EHRA 4BETA 3FUEA 1BI8B 3SQVA 5EYPF 2DZOA 3HVEB 3NF1A 3CHPA 1OWOA 1ZU2A 5G04J 1E7UA 3ONLA 3FUFA 3U9WA 2DYRE 1N4QA 2HE0A 4HNAD 4JD2G 4U7EB 3S7FA 3APCA 1V55E 2VSYA 2ETAA 1JWFA 4AM9A 2NC9A 4XIFA 5FZRA 2XEEA 2J09A 3KSQA 4N5QA 4RVBA 1HU3A 3ML9A 3S7BA 4YDYA 2BEDA 3AG2E 4G1TA 1NA3A 1P5QA 3HXCA 4RQIA 2WMNA 3MZLB 1E8WA 3MGBA 4WNDA 5EYLA 5A23A 3HXBA 1UJJA 3Q5MA 3HVEA 4NQ0A 3O4ZA 1Z3XA 3ZPJA 4L9PA 3ASGA 2H6HA 4EHMA 4N2SA 5BXUA 4HS2A 2UY1A 2DVWA 4YNDA 3ZU7B 1DNPA 4LERA 3C98A 3FY4A 3AS8A 3R9AB 4AY6A 3CVUA 1FT2A 3W9FA 4CYMD 3CK8A 3ESKA 3UMVA 4AV7A 2E2EA 5CMWA 3AAAC 3ABLE 4LSZE 3ASDA 4FLBA 2OVFA 1OY3D 3VLDA 4CDNA 1QQEA 2VQ2A 3JUEA 1WAO1 2IY0C 2IO3C 2IU1A 4AP2A 5CCLA 3QAQA 2LSVA 5BV1A 4I43A 2GRMA 3D9KA 3IEGA 2A5UA 3GZSA 2VSOE 2X3MA 1HF8A 4UWKA 1N0QA 2VGXB 2MYOA 2MOWA 5ENPD 3EJNA 4F6RD 5BPPA 4F3VA 3HG0D 3UT7A 4IYPA 1PC2A 2XPIA 2IQCA 4GA1A 3D9MA 4E6HA 2AXZA 5KJLA 1QBQA 4FA6A 5H7PA 5AIJA 4B8CB 5EDSA 4FC8A 4GYYA 5KJNA 4OYSA 3UM0A 3Q79A 3GZ1A 4ILHB 4RLYA 3FTUA 3CVQA 1UJKA 4GYWA 2VTBA 3KS2A 4RSYA 4A3TA 4XI9A 5AARA 1XNFA 2OEVA 3NBNB 3NB2A 3HHMA 2LNIA 4G25A 1EYHA 1TNZA 4LUNU 3ZHEB 3UIPC 5ARGA 4U8VD 2XZTG 3I4GA 1Z5SC 3PZ1A 4JHRA 5FQ6A 3CSFA 3D9JA 3CEQA 5D2MC 4HLEA 1TR4A 3LY7A 1JCRA 2PQRA 5BT1A 3FUMA 5ENSD 1N4PA 3Q78A 3LCAA 3C5RA 4TXPA 4N5CA 2IF4A 2Y4TA 3DSWA 1TNBA 4U07A 4K0RA 2M63A 1HS6A 3SBTB 3Q47B 4NRHB 1H6KA 4BWRA 5BUZA 1NA0A 5G2NA 1FPPA 2J07A 1E8XA 3Q9NC 1G3NB 2P9IG 1BD8A 2LUHA 5BNWA 3UM3A 4B8AA 4GTPA 5B1AE 4WAFA 1IYGA 2BUGA 4D10C 4HI9A 1DC2A 4LCTA 2Q7FA 4TRQA 2BKKB 3FTWA 4A3VA 4GTMA 3ZYMA 3SD5A 4TUUA 3D9LA 3VLFA 1OCCE 3UI2A 1HH8A 1JCQA 4UQZA 4G11A 3TXMA 4AEZC 4GZDA 3PNTB 4GZ6A 3RSEG 4WNFA 1NP7A 3C3RA 2GROB 2XZDG 5LP0A 5D0OD 2QC9A 4G23A 1E8YA 2IOLA 2NSZA 1KLXA 3IXEA 2WXGA 3V2XA 2PM6A 4FULA 2P9LG 3IHVA 4WUYA 4O1PA 4CCAA 2F8YA 5KNGA 3KEAA 3FUJA 3L13A 1TYQG 4YDEA 1VDYA 2WXHA 2LAHA 1LTXA 4AVXA 1MHQA 4HB5A 2F8XK 4YDWA 3U66A 4BSZB 4UWLA 4UWGA 4E85A 4KT6B 3HDXA 3ML8A 3PVLA 4A63B 5HS0A 4U0UA 5ARFA 3PREA 4KMOA
chains in the Genus database with same CATH topology
3CSTA 3ENEA 1JWGA 2X38A 2I1JA 4J8DA 4N2QA 3E4BA 1OWMA 5BW8C 1NZNA 2AVPA 4ANWA 2RG8A 5AJLA 3PE3A 4CDMA 2EQXA 3FTSA 4N39A 2HYZA 3CHOA 3JQ1A 3HYMB 4HORA 2DCPA 4XE0A 3AS5A 1EF1C 3TG4A 3L08A 1H0AA 4BSXA 2V0PA 4EPZA 4ME2A 1GW6A 3EHNA 3RU0A 3ZN3A 2HR2A 5JHAA 2PM7A 2XPYA 3B13A 5DIZA 5J90A 3OXLA 2JEKA 2E0IA 3D9PA 1OWLA 2VSXE 3PNLB 2KATA 3RRUA 4P29A 3CVVA 5A6CA 2BTDA 1HE8A 4GA0A 3ZHEA 4FADA 4FLHA 2WQHA 5FT9A 2YHEA 3FUDA 2X6FA 2XGSA 5KJMA 4DI4A 4MLPA 5FJYA 3CKBA 3FFLA 3D3MA 4B94A 3FUNA 4EZJA 2WPVA 2OOEA 5LCWJ 4I6JA 5G05C 1S0PA 3SF4A 5EKQD 4BY6A 4DPRA 3FUEA 3D9IA 5T3RA 4AOFA 2VTBB 3LXUX 2YNQA 4I9EA 2OV8A 4MRUA 5JJ6A 4DLOA 3PZDA 4N3AA 1E96B 3ASFA 3ZRHA 3CK9A 3HVEB 2WXRA 3NF1A 4G2VA 3MJWA 3CHPA 1OWOA 1HXIA 1ZU2A 2X6IA 5G04J 2DIWA 4JEUA 1E7UA 3ONLA 3FUFA 3QOUA 4XKBA 3U9WA 3ONKA 2WMOA 4FHKA 2NXPA 4DJAA 3UUXA 1U3DA 3OTNA 4EBAG 3PEVB 1OWPA 1SZAA 3G2VA 2WXNA 2J4BA 4CGWA 3S7DA 4L23A 3FU5A 2YINA 1H2TC 1HX8A 4UI9K 2AXVA 3LPZA 3ZIMA 2I2OA 2I6HA 3S7FA 4Q69A 2I1KA 3APCA 2PL2A 3RK6A 2PZIA 3U64A 3ULQA 2VSYA 3P1UA 1JWFA 3RRMB 3G2WA 2LAIA 4L7TA 2NC9A 4R7LA 4AM9A 4APOA 4XIFA 5FZRA 3SGHA 4F1SA 4DLQA 2J09A 4K03A 1IQUA 4RVBA 5JJTA 2JLBA 1HU3A 3HIZA 1IQRA 3ML9A 3LKUA 2J49A 3CVWA 3S7BA 2QY7A 3G2TA 2DBAA 3MCXA 5M72A 4GAAA 4L2YA 4BT8A 4CT4A 1WM5A 4G1TA 4Y6CA 2FF4A 3AU5A 4HOUA 1NA3A 2HM8A 1P5QA 4C9BB 3PS6A 3IKOB 2WMNA 3MZLB 4WWPA 4HXIA 5E76A 3FTVA 1E8WA 3TGOA 3MGBA 4WNDA 4AXHA 3S7JA 3PH0C 4MKTA 3MV2B 5A23A 4XZ4A 5CMYA 3CVYA 3FP3A 1UJJA 4ACLA 3TG5A 3Q5MA 2X6HA 3U3WA 4HOTA 3QC1A 4CDRA 1YA0A 3HVEA 1IHGA 1HO8A 4NQ0A 3FUIA 3O4ZA 1Z3XA 3VTXA 3OXFA 3ZPJA 3G2UA 3Q49B 4O6FA 1BPOA 3ASGA 4PS3A 1DVPA 1PAQA 3MV3B 4N2SA 3QDNA 2Y4UA 5EX0A 3Q4AB 4HS2A 3CHSA 2XPZA 2UY1A 2MRIA 5T8IA 4A55A 3LVRE 3I4RB 4Q94A 3SNXA 3CVXA 4YNDA 2YHCA 3PUKA 4EZLA 4WWOA 2IFUA 1DNPA 3B7RL 4LERA 5BV0A 3C98A 2LSUA 3FY4A 3AS8A 1SZ9A 3FEXA 1JUQA 3QB2A 4GZ3A 3R9AB 3CVUA 4AY6A 3L54A 4V3IA 2CG3A 2BF0X 5C1DA 1UG3A 5HI7A 3FTXA 4I1MA 3NZUA 3CK8A 3ESKA 3UMVA 4JHKA 3L16A 4AV7A 5DBKA 1EPUA 2E2EA 3CHMA 5ANRA 5CMWA 1EDUA 4KBQA 3UX4A 4UI9C 2WXJA 4IN3B 3ASDA 4FLBA 4IRUA 2WXQA 3LYAA 4KZ0A 1X5BA 2OVFA 1ELWA 2GGFA 3UT4A 3JCKC 3VLDA 1H2VC 3PUJA 4AY5A 2XRYA 2V5FA 4CDNA 3WXXA 2KM4A 2J4DA 4AIFA 4ILIA 4W9RA 1QQEA 2VQ2A 4EECA 4GCNA 3RO3A 4L2LA 4ABNA 3LS8A 4FU3A 1WAO1 1XGWA 2FI7A 3FWVA 3B7TA 3GW4A 2IU1A 4I6GA 3B7UX 3U4TA 2L0IA 4AP2A 5CCLA 5C2YA 3QAQA 5AYWD 2LSVA 5BV1A 1Y6IA 4JEHA 4I43A 2GRMA 4FHJA 2XGOA 3D9KA 3IEGA 3RRNB 2A5UA 3GZSA 2VSOE 3T8MA 4DI3A 2X3MA 1HF8A 4UWKA 2VGXB 2MOWA 4Q96A 1UW4B 4N3BA 1B89A 3EJNA 5FZSA 1HFAA 3TXNA 2L6JA 3FHEA 5BPPA 3L6AA 3IHYA 3CVLA 4F3VA 1HG2A 4HFGA 5LCWC 3CHRA 3CQGB 2IOSA 3EDTB 2V4LA 3PE4A 3UT7A 1FVHA 2XGMA 4FJZA 4IYPA 4U0SA 1PC2A 2XPIA 3QARA 5FWQA 5JJ7A 2CHZA 4ANUA 2IQCA 4GA1A 3KAEA 3MKQB 4KYOB 2XHEA 3CKCA 4KVMA 3EIQC 5G04C 3D9MA 2XCBA 4I1OB 2AXZA 4PH4B 4E6HA 1Z3YA 5KJLA 4XI0A 5ANLA 3FULA 5FQ7A 2GW1A 3CIAA 3UT8A 1QZ2A 3CK7A 4FA6A 4J6IA 4DK5A 3OXGA 1MQSA 3NZSA 1PY1A 4J8FA 2WXKA 5AIJA 4B8CB 3GYZA 4FC8A 5EDSA 4GYYA 3FTZA 5KJNA 3BG0B 4PS7A 4GPKA 3APFA 3LY9A 3IBEA 1N52A 4OYSA 5CCMA 2KC7A 2LO6A 4B89A 4I9CA 4ILHB 3GZ1A 1WY6A 2J08A 2WM9A 2CFZA 5FTPA 3FTUA 4JPSA 2R17C 5LFAA 3CVQA 4ACKA 1H19A 1H2UA 1UJKA 3FH5A 4GYWA 4NACA 2VTBA 1UN8A 3KS2A 2J9QA 4RSYA 4XI9A 4A3TA 2VYIA 2KCVA 3FU0A 4JXTA 3LEWA 1XNFA 4Y6WA 1L5JA 5HQ8A 2VJ8A 3HHMA 3MEKA 2LNIA 3T5VA 4G25A 1EYHA 3SI5A 4JVSA 1FCHA 2GRLA 3ASHA 3GZ2A 4GCOA 4LUNU 3JYSA 4LRZA 3DBSA 3ZHEB 3ZW3A 5ARGA 5T4YA 4GU5A 3AS4A 3RJVA 3BEEA 2IONA 3I4GA 3TL5A 3ESLA 3JQ0A 4JHRA 2OVBA 4URKA 3L22A 4U63A 3MA5A 5ENNA 5FQ8A 2UWJG 2ONDA 3FU6A 3URZA 3FH8A 3D9NA 4GZCA 3ZYKA 1FVFA 4YVQC 5FQ6A 4BT9A 4U0ZA 3VLEA 4KZCA 1HZ4A 2RD0A 1ZBPA 3D9JA 3CEQA 3CSFA 3LVQE 3N71A 4B0ZA 3IV0A 4CRWA 2L9BA 1JPLA 4HLEA 4J8SA 3LY7A 2FO7A 3R7RA 5E75A 4WNEA 3KD7A 3DPDA 3CVPA 4BFRA 2PQRA 3FUKA 4RG6A 2Y3AA 3B7SA 5BT1A 3L17A 2VSNA 3FUMA 3PDNA 4QFVA 3NQPA 3UPVA 2P58C 4JZYA 4I1AA 3I3NA 5EX3A 3VTYA 4PUCA 2C0LA 4KXKB 3FTYA 2KCLA 3LCAA 3JUIA 4YVOA 1TEZA 3ZXSA 3QK0A 3P2BA 4N5CA 2WXPA 4CT0A 2X6KA 2WXMA 3I5PA 4C0MA 4GMJA 3SZ7A 2IF4A 4ATGA 2Y4TA 3PEUB 2KZTB 4N3CA 3CV0A 4U07A 4XX5A 4K0RA 3FUHA 2XQ0A 1E8ZA 2KCKA 2M63A 1HS6A 4JHJA 3SBTB 3KEZA 3Q47B 1TJFA 4NRHB 4JA9A 4KVOA 5G05J 2A4ZA 3BG1B 3SBSA 1H6KA 2MHKA 4BWRA 4EBAA 4EQFA 4IULA 2CHWA 4UQYA 5BUZA 2AW6A 4MS6A 4UQXA 1NA0A 4G24A 3TAXA 3FU3A 4ANVA 3FH7A 3LJ3A 3QWPA 3QWVA 2ILRA 2IJGX 4GA2A 5G2NA 2R59A 2WXLA 4WNGA 4UWFA 2J07A 4U8HA 1E8XA 3EIJA 4I2WA 3FEYA 3APDA 4NURA 1OUVA 4J8EA 4GB9A 3PRZA 1U3CA 3OAWA 2C0MA 2AXUA 5CHEE 4BTAA 1ELKA 3K9IA 3ZYQA 3CR3A 4GMLA 3D9OA 3SFZA 4CGVA 5BNWA 4B8AA 3ZGQA 4WAFA 4H7XA 4I2ZA 2VGYA 2FEZA 3QWWA 3ZFWA 3R7QA 4HVBA 4F53A 3QJZA 4I17A 4PDXA 2BUGA 5LX8A 4EZKA 1IYGA 4HOQA 4HOSA 4G26A 4RG9A 1TJCA 2UY1B 3QKYA 2XEVA 4D10C 5D0QD 1KT0A 4LCTA 3LDZA 2YQ8A 4BX9A 2XRZA 1W3BA 4A1GA 1A17A 2Q7FA 2V8SE 3AU4A 4TRQA 4UWHA 4PS8A 1Y8MA 2I9CA 3RO2A 3ZVVA 4JW1A 3O48A 3EHMA 2CFUA 3S2AA 3FTWA 3SHFA 2KZTA 3LY8A 4A3VA 4CEMA 3ZYMA 4XKCA 4A1SA 4JL0A 3SD5A 4TUUA 3D9LA 3Q15A 2WQ6A 2XCCA 3VLFA 2AWIA 1Z6TA 3RKVA 1HH8A 5J08A 4FP7A 4UQZA 4G11A 2HO1A 3TXMA 4AJWA 4AEZC 4GZDA 3CLJA 3PNTB 4GZ6A 4WNFA 3G2SA 2CG2A 1NP7A 2PQNA 3CHQA 4ILGA 4OVUA 5LOZA 2QFCA 2WXIA 5LP0A 4WWNA 5A7DB 5D0OD 5AJDA 2C2LA 2WXOA 5AENA 5KJKA 4G23A 1E8YA 2IOLA 2VGXA 4JC8A 1HG5A 1KLXA 2NSZA 4J0UA 3ZYLA 4BTBA 1ELRA 4L1BA 4LEUA 3T5XA 1UN9A 2FULA 2CHXA 2WXGA 2WQ7A 2PM6A 2X6JA 5FQ4A 4FJYA 4GYOA 2ZU6B 4C0EA 4FULA 4U04A 3CQCB 2L0TB 1QNFA 2FBNA 3IHVA 2WXFA 2WVIA 4WUYA 4BX8A 1SQMA 3CGHA 4F7AA 4ANXA 5JHBA 3MKRA 4CCAA 3MYVA 1LF8A 4I6EA 1N54A 3ZEFA 5FZQA 3FUJA 3MKQA 1KT1A 3CVNA 3L13A 4JA7A 1INZA 1VDYA 4TV3A 2WXHA 4OVVA 2LAHA 2WB2A 4AVXA 1MHQA 3QNKA 3U66A 4UWLA 4UWGA 3MX3A 3RIBA 4E85A 4KT6B 3HDXA 3ML8A 3PVLA 5G55A 2R5SA 4M3OA 1OWNA 1E7VA 3UQ3A 4UI9J 3FDHA 1E90A 4GZ5A 4U0UA 4H7YA 5ARFA 5KCMA 3TJPA 3PREA 4KMOA 4APFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8D A;  4N2Q A;  3E4B A;  5BW8 C;  1NZN A;  2AVP A;  3PE3 A;  4N39 A;  2HYZ A;  4HOR A;  3HYM B;  3AS5 A;  3TG4 A;  4ME2 A;  3RU0 A;  3ZN3 A;  2HR2 A;  5DIZ A;  3OXL A;  2KAT A;  5A6C A;  4GA0 A;  3ZHE A;  2WQH A;  5FT9 A;  2XGS A;  5KJM A;  5FJY A;  3CKB A;  3FFL A;  4B94 A;  2WPV A;  2OOE A;  5LCW J;  5G05 C;  3SF4 A;  5EKQ D;  4I9E A;  5JJ6 A;  4N3A A;  1E96 B;  3ASF A;  3CK9 A;  3NF1 A;  4G2V A;  1ZU2 A;  1HXI A;  5G04 J;  3QOU A;  3UUX A;  4CGW A;  3S7D A;  4UI9 K;  3LPZ A;  2I6H A;  3S7F A;  2PL2 A;  2PZI A;  3ULQ A;  2VSY A;  4AM9 A;  2NC9 A;  4APO A;  4XIF A;  5FZR A;  5JJT A;  2JLB A;  3LKU A;  3S7B A;  2DBA A;  5M72 A;  4BT8 A;  1WM5 A;  4G1T A;  4Y6C A;  2FF4 A;  4HOU A;  1NA3 A;  1P5Q A;  3TGO A;  4WND A;  3S7J A;  3MV2 B;  3FP3 A;  3TG5 A;  3Q5M A;  4HOT A;  4CDR A;  1YA0 A;  1IHG A;  4NQ0 A;  3VTX A;  3OXF A;  3ZPJ A;  3Q49 B;  4O6F A;  3ASG A;  3MV3 B;  4N2S A;  3QDN A;  2Y4U A;  5EX0 A;  3Q4A B;  2UY1 A;  4YND A;  2YHC A;  2IFU A;  2LSU A;  3AS8 A;  4GZ3 A;  3R9A B;  4AY6 A;  5C1D A;  5HI7 A;  3CK8 A;  3ESK A;  5DBK A;  2E2E A;  4KBQ A;  4UI9 C;  4IN3 B;  3ASD A;  3LYA A;  1ELW A;  4AY5 A;  2V5F A;  3WXX A;  4AIF A;  4W9R A;  1QQE A;  2VQ2 A;  4GCN A;  3RO3 A;  4ABN A;  1WAO 1;  2FI7 A;  3FWV A;  3GW4 A;  3U4T A;  5CCL A;  5AYW D;  2LSV A;  2XGO A;  3IEG A;  2VGX B;  4N3B A;  1B89 A;  5FZS A;  2L6J A;  4F3V A;  3CVL A;  5LCW C;  3EDT B;  3PE4 A;  2XGM A;  4U0S A;  1PC2 A;  2XPI A;  5JJ7 A;  4GA1 A;  3KAE A;  4KYO B;  3CKC A;  5G04 C;  2XCB A;  5KJL A;  4XI0 A;  2GW1 A;  1QZ2 A;  3CK7 A;  3OXG A;  4J8F A;  3GYZ A;  4GYY A;  5KJN A;  4GPK A;  3LY9 A;  5CCM A;  2KC7 A;  4I9C A;  3GZ1 A;  5FTP A;  3CVQ A;  4GYW A;  3KS2 A;  2J9Q A;  4XI9 A;  2VYI A;  2KCV A;  1XNF A;  4Y6W A;  5HQ8 A;  3MEK A;  2LNI A;  4G25 A;  1FCH A;  3GZ2 A;  3ASH A;  4GCO A;  3ZHE B;  3JYS A;  5ARG A;  3AS4 A;  3RJV A;  3BEE A;  4JHR A;  3MA5 A;  2UWJ G;  2OND A;  3URZ A;  4YVQ C;  4BT9 A;  4U0Z A;  1HZ4 A;  1ZBP A;  3CEQ A;  3N71 A;  3LY7 A;  2FO7 A;  4WNE A;  3KD7 A;  3CVP A;  2PQR A;  4RG6 A;  5BT1 A;  2VSN A;  3PDN A;  3UPV A;  2P58 C;  5EX3 A;  4I1A A;  3VTY A;  2C0L A;  4KXK B;  2KCL A;  3LCA A;  4YVO A;  4N5C A;  3SZ7 A;  2IF4 A;  2Y4T A;  4N3C A;  3CV0 A;  4U07 A;  2KCK A;  3Q47 B;  4NRH B;  5G05 J;  4JA9 A;  2MHK A;  4BWR A;  4EQF A;  4UQY A;  4UQX A;  1NA0 A;  4G24 A;  3TAX A;  3QWP A;  3QWV A;  4GA2 A;  4WNG A;  4I2W A;  1OUV A;  4J8E A;  2C0M A;  5CHE E;  4BTA A;  3K9I A;  4CGV A;  5BNW A;  3ZGQ A;  4H7X A;  4I2Z A;  2VGY A;  2FEZ A;  3QWW A;  3ZFW A;  4I17 A;  1IYG A;  2BUG A;  4HOQ A;  4HOS A;  4G26 A;  4RG9 A;  1TJC A;  2UY1 B;  3QKY A;  2XEV A;  5D0Q D;  1KT0 A;  2YQ8 A;  1W3B A;  1A17 A;  2Q7F A;  1Y8M A;  3RO2 A;  3O48 A;  3LY8 A;  4A1S A;  4JL0 A;  3Q15 A;  2XCC A;  3RKV A;  1HH8 A;  4UQZ A;  2HO1 A;  4GZ6 A;  4WNF A;  2PQN A;  2QFC A;  5A7D B;  5D0O D;  2C2L A;  5KJK A;  4G23 A;  2VGX A;  1KLX A;  4J0U A;  4BTB A;  1ELR A;  4LEU A;  4GYO A;  4U04 A;  2FBN A;  4WUY A;  3MKR A;  5FZQ A;  1KT1 A;  3CVN A;  4JA7 A;  3RIB A;  2R5S A;  3UQ3 A;  4UI9 J;  4GZ5 A;  4U0U A;  4H7Y A;  5ARF A;  3U3W A; 
#chains in the Genus database with same CATH topology
 2KBX A;  3FTS A;  3AS5 A;  1H0A A;  1KZO A;  4ME2 A;  3EHN A;  1TN7 A;  3B13 A;  2JEK A;  1MX6 A;  5CER B;  1OWL A;  3RRU A;  4P29 A;  3CVV A;  5A6C A;  2BTD A;  4GA0 A;  5FT9 A;  2X6F A;  5CEA A;  5KJM A;  4DI4 A;  5FJY A;  2J8S D;  3FFL A;  3LJN A;  4B94 A;  4EZJ A;  3JXJ A;  2V5Q C;  2XS8 A;  5G05 C;  1S0P A;  3KSL A;  4BY6 A;  4HQD A;  3D9I A;  3B7B A;  5T3R A;  2YNQ A;  2P9N G;  2OV8 A;  4MRU A;  5JJ6 A;  1E96 B;  3ZRH A;  3CK9 A;  4G2V A;  2DIW A;  4JEU A;  4DJA A;  3UUX A;  4LNU D;  3OTN A;  1SZA A;  1MZC A;  4DX1 A;  1HX8 A;  2AXV A;  3ZIM A;  4GMR A;  4XEI G;  4BES A;  4Q69 A;  2PL2 A;  3ULQ A;  3ZNG A;  3P1U A;  3RRM B;  4L7T A;  3DST A;  4F1S A;  3SGH A;  1IQU A;  4DX6 D;  3HIZ A;  3CVW A;  2QY7 A;  3UM2 A;  3MCX A;  4GAA A;  1WM5 A;  2FF4 A;  4C9B B;  3IKO B;  2DYS E;  4WWP A;  1Q2Z A;  4HXI A;  3TGO A;  1NI1 A;  4AXH A;  4MKT A;  2ETC A;  3FP3 A;  4HOT A;  4ZFH A;  4CDR A;  1NFI E;  3EUV A;  1N9A A;  2B6C A;  3VTX A;  3NOC D;  4PS3 A;  4M7C A;  1DVP A;  4ZHB A;  1X81 A;  2XPZ A;  5T8I A;  1N11 A;  3LVR E;  3I4R B;  4Q94 A;  3SNX A;  3CVX A;  1YCS B;  3PUK A;  2IFU A;  3QB2 A;  4V3I A;  3FTX A;  3NZU A;  3UIO C;  1TN6 A;  3C72 A;  3L16 A;  2FO1 E;  1KZP A;  3LYA A;  1X5B A;  2GGF A;  2V5F A;  1BI7 B;  4DRX E;  4ILI A;  1S63 A;  1NL4 A;  4GCN A;  3RO3 A;  5CEC B;  4ABN A;  3LS8 A;  3FWV A;  3GW4 A;  4I6G A;  3B7U X;  3V30 A;  1O1T A;  1IHB A;  3Q7A A;  2V4H C;  3NAW A;  1B89 A;  3TXN A;  1A5E A;  3IHY A;  1HG2 A;  4HFG A;  5LCW C;  1YMP A;  3EDT B;  2V4L A;  4FJZ A;  1RZ4 A;  2R02 A;  2CHZ A;  3PZ4 A;  3KAE A;  3MKQ B;  2XHE A;  4KVM A;  2XCB A;  1Z3Y A;  1S64 A;  3CIA A;  1QZ2 A;  3CK7 A;  1MQS A;  4J8F A;  1N94 A;  2QZA A;  3FTZ A;  4DX2 A;  3DSX A;  1OCO E;  2LO6 A;  4B89 A;  4O1O A;  4LNB A;  1WY6 A;  3DRA A;  2R17 C;  2J9Q A;  5D66 A;  3FU0 A;  3J5P A;  3LEW A;  4Y6W A;  5HQ8 A;  2VJ8 A;  1O1S A;  3SI5 A;  4JVS A;  2GRL A;  4CEM A;  4GCO A;  4LRZ A;  2OEW A;  3DSU A;  5T4Y A;  4GU5 A;  3TWR A;  3BEE A;  3ESL A;  5CRV A;  3JQ0 A;  3L22 A;  2OND A;  3URZ A;  3FH8 A;  3D9N A;  3ZYK A;  1LD7 A;  4YVQ C;  3E30 A;  1OXJ A;  4BT9 A;  2RD0 A;  3LVQ E;  4B0Z A;  3N71 A;  3TWQ A;  2L9B A;  4GTO A;  4J8S A;  5AQ9 A;  3KD7 A;  3CVP A;  3FUK A;  3B7S A;  3L17 A;  3R9M A;  3NQP A;  3UPV A;  2P58 C;  5EX3 A;  4I1A A;  4KXK B;  3FTY A;  3JUI A;  4YVO A;  3ZXS A;  3QK0 A;  3I5P A;  3Q75 A;  3UIN C;  3F6Q A;  3CV0 A;  4XX5 A;  3AG4 E;  1AP7 A;  1N95 A;  1TNY A;  5G05 J;  2CHW A;  4UQY A;  4LNG A;  3J5Q B;  2WXL A;  4WNG A;  3TWU A;  4U8H A;  5ENT D;  4NUR A;  1U3C A;  5CHE E;  4BTA A;  3SFY A;  3TWV A;  3D9O A;  3DXM G;  5KWD A;  4I2Z A;  2VGY A;  2FEZ A;  3QWW A;  4HVB A;  4F53 A;  3QJZ A;  1SVX A;  1H6P A;  4RG9 A;  3QKY A;  2IEJ A;  5D0Q D;  3LDZ A;  1A17 A;  3AU4 A;  3WG7 E;  3O48 A;  3EHM A;  3BQO A;  2AWI A;  5KBA A;  3RKV A;  5J08 A;  2HO1 A;  2QFC A;  5KJK A;  2VGX A;  4J0U A;  3ZYL A;  1ELR A;  4L1B A;  4LEU A;  3T5X A;  1UN9 A;  2FUL A;  2CHX A;  5FQ4 A;  4C0E A;  2L0T B;  1QNF A;  5JHB A;  2WXF A;  4F7A A;  1SQM A;  2EIN E;  4ANX A;  1LF8 A;  1N54 A;  4GTS A;  4JA7 A;  3CVN A;  1INZ A;  2ZXW E;  4TV3 A;  3E37 A;  2WB2 A;  3QNK A;  3MX3 A;  3ZUV B;  1E7V A;  3UQ3 A;  4H7Y A;  3TJP A;  3U3W A;  4N2Q A;  3E4B A;  5BW8 C;  4ANW A;  2RG8 A;  5AJL A;  2EQX A;  4HOR A;  3ASN E;  2DCP A;  3PZ3 A;  3TG4 A;  2V0P A;  5JHA A;  3UXG A;  3OXL A;  3D9P A;  1MJ0 A;  3ZXP A;  3ZHE A;  2WQH A;  2LXL A;  5KNH D;  5AQA A;  2XGS A;  3CKB A;  4UUC A;  2WPV A;  5LCW J;  4I6J A;  4DPR A;  3LXU X;  3B95 A;  1V54 E;  3BU8 A;  3AG3 E;  3BUA A;  2WXR A;  1N4R A;  1TNU A;  4GTR A;  1HXI A;  3QOU A;  3ONK A;  2WMO A;  4FHK A;  2NXP A;  3C3Q A;  3PEV B;  1OWP A;  3S7D A;  2GRQ B;  2YIN A;  2I6H A;  3RK6 A;  3U64 A;  4U95 D;  1QYM A;  3G2W A;  2LAI A;  4R7L A;  5JJT A;  2JLB A;  2GRN B;  2BKG A;  1AWC B;  3DWL G;  2DBA A;  5M72 A;  4L2Y A;  4BT8 A;  4HRM B;  4B93 B;  4Y6C A;  2R05 A;  2GRR B;  5JMN D;  3S7J A;  3EU9 A;  3PH0 C;  1D9S A;  5CMY A;  3CVY A;  4ACL A;  3TG5 A;  4O60 A;  1MX4 A;  3EHQ A;  3FUI A;  3G2U A;  3Q49 B;  1BPO A;  1MYO A;  3QDN A;  2Y4U A;  5EX0 A;  4NIK A;  2MRI A;  5CBO A;  2YHC A;  3B7R L;  5BV0 A;  1FT1 A;  2R2L A;  2LSU A;  3L54 A;  4I1M A;  4JHK A;  5DBK A;  1EDU A;  4UI9 C;  2WXJ A;  4IN3 B;  1BLX B;  4IRU A;  3E33 A;  3SO8 A;  2ZGD A;  1ELW A;  4MBG A;  2H6I A;  2J4D A;  4W9R A;  4L2L A;  4FU3 A;  2DZN A;  1SA4 A;  2XEN A;  5C2Y A;  5AYW D;  1Y6I A;  4FHJ A;  2XGO A;  4JB8 P;  4GTQ A;  3T8M A;  4DI3 A;  1SA5 A;  2F37 A;  4Q96 A;  1UW4 B;  4N3B A;  5AQ7 A;  3PZ2 A;  3FHE A;  4HRN A;  1D8D A;  2IOS A;  4U0S A;  3QAR A;  5JJ7 A;  4ANU A;  1K8K G;  4KYO B;  2XEH A;  3EIQ C;  2GW1 A;  3UT8 A;  4J6I A;  2RKK A;  1OT8 A;  1PY1 A;  5AN8 A;  4TXR A;  3BG0 B;  3TWT A;  4GPK A;  3LY9 A;  3Q73 A;  5FTP A;  4JPS A;  1H2U A;  3FH5 A;  1K1B A;  5HRY A;  1IXV A;  1FCH A;  3JYS A;  3DBS A;  3AS4 A;  4LG6 A;  4DX7 D;  3RJV A;  4X8Q A;  2OVB A;  4URK A;  4U63 A;  4YDO A;  1D8E A;  1O5M A;  3C3O A;  5ENR D;  2P2C P;  4U0Z A;  3VLE A;  4CRW A;  3IV0 A;  1OCZ E;  5EIB E;  3R7R A;  5E75 A;  4WNE A;  3DPD A;  4BFR A;  2NYJ A;  4RG6 A;  2OCC E;  2Y3A A;  4JZY A;  3TWW A;  3VTY A;  2KCL A;  1TEZ A;  3P2B A;  2WXP A;  2X6K A;  4GMJ A;  4ATG A;  3PEU B;  2KZT B;  2XQ0 A;  2KCK A;  3KEZ A;  1TJF A;  4JA9 A;  2A4Z A;  3BG1 B;  4EQF A;  4IUL A;  4MS6 A;  4UQX A;  4G24 A;  3TAX A;  3FU3 A;  3LJ3 A;  3QWP A;  3QWV A;  2IJG X;  5CRU A;  4C48 B;  3UM1 A;  4UWF A;  3FEY A;  3APD A;  4GB9 A;  3PRZ A;  3OAW A;  2C0M A;  3NOG D;  1ELK A;  3K9I A;  3ZYQ A;  4HLL A;  1WDY A;  4CGV A;  2P9U G;  5AQB A;  2EIJ E;  3DSS A;  3Q9U C;  4H7X A;  4HBD A;  3ZFW A;  3R7Q A;  2LXM A;  4I17 A;  4PDX A;  5LX8 A;  4G8L A;  4U96 D;  2UY1 B;  2XEV A;  3D9H A;  1N4S A;  2YQ8 A;  4A1G A;  2EIK E;  4UWH A;  4PS8 A;  1Y8M A;  2I9C A;  3RO2 A;  3SHF A;  3S2A A;  2XS1 A;  2KZT A;  3LY8 A;  1WG0 A;  4GTT A;  1YYH A;  3E34 A;  3Q15 A;  2WQ6 A;  1Z6T A;  4FP7 A;  4AJW A;  3CLJ A;  3G2S A;  2CG2 A;  2PQN A;  3CHQ A;  5LOZ A;  2H6F A;  2C2L A;  2WXO A;  2QYU A;  5FIO A;  2WQ7 A;  3HXE A;  4FJY A;  2FBN A;  4I6E A;  1UOH A;  3MKQ A;  2EIL E;  1KT1 A;  2JAB A;  3L82 A;  3RIB A;  4BEP A;  5G55 A;  1OWN A;  4UI9 J;  1E90 A;  3SFZ A;  4APF A;  3ENE A;  2Y0B G;  4J8D A;  1MX2 A;  4CDM A;  3CHO A;  3JQ1 A;  3HYM B;  3W9G A;  2H6G A;  1K3Z D;  3L08 A;  4EPZ A;  4J7W A;  3JXI A;  3RU0 A;  3ZN3 A;  2HR2 A;  3EU5 A;  1U2V G;  2PM7 A;  4ATZ D;  5J90 A;  4K5A B;  2E0I A;  3DEO A;  3HXF A;  1HE8 A;  4FAD A;  1H6O A;  4TXQ A;  2P9P G;  5ENQ D;  3T9K A;  3D3M A;  2VGE A;  3FUN A;  3RAU A;  2OOE A;  3SF4 A;  5EKQ D;  3DSV A;  3HRA A;  2VTB B;  1IKN D;  4AOF A;  4I9E A;  4DLO A;  3PZD A;  4N3A A;  1SW6 A;  3ASF A;  3MJW A;  4OAU C;  2X6I A;  4XKB A;  2L6B A;  1U3D A;  3AJI A;  4EBA G;  4CGW A;  3G2V A;  2WXN A;  2J4B A;  4L23 A;  3FU5 A;  1H2T C;  4UI9 K;  3ULY A;  3LPZ A;  2I2O A;  2I1K A;  2PZI A;  4APO A;  3V31 A;  4DLQ A;  3V79 K;  4HI8 A;  4K03 A;  1IQR A;  3LKU A;  2J49 A;  3G2T A;  4CT4 A;  1O1R A;  3AU5 A;  4HOU A;  1DCE A;  2HM8 A;  3PS6 A;  5E76 A;  3FTV A;  5BXO A;  3MV2 B;  4XZ4 A;  2X6H A;  3QC1 A;  1YA0 A;  1IHG A;  1HO8 A;  3OXF A;  4K5C A;  4O6F A;  1PAQ A;  3MV3 B;  1K1A A;  3Q4A B;  3CHS A;  3ABM E;  4A55 A;  1TNO A;  4QQI A;  3ABK E;  3UTM A;  4EZL A;  4WWO A;  1SZ9 A;  3FEX A;  1JUQ A;  4GZ3 A;  4K5B A;  2CG3 A;  2BF0 X;  5C1D A;  1UG3 A;  5HI7 A;  3SY2 A;  1EPU A;  3CHM A;  5ANR A;  3SFX A;  4KBQ A;  3UX4 A;  2WXQ A;  4KZ0 A;  2ETB A;  3UT4 A;  3JCK C;  1H2V C;  3PUJ A;  4AY5 A;  1DCQ A;  2ZGG A;  2XRY A;  3WXX A;  2KM4 A;  2IO2 C;  4AIF A;  4HRL A;  4EEC A;  2B0O E;  1XGW A;  2FI7 A;  3B7T A;  3U4T A;  2L0I A;  2GRP B;  3DPY A;  4BER A;  4JEH A;  3RRN B;  1OCR E;  5FZS A;  3Q7F A;  1HFA A;  2L6J A;  2F0Y A;  3L6A A;  3DEP A;  3CVL A;  3CHR A;  3CQG B;  2DWZ A;  2Y69 E;  3ZKJ A;  3PE4 A;  1FVH A;  2XGM A;  5FWQ A;  3CKC A;  5G04 C;  4GTV A;  4I1O B;  4PH4 B;  4XI0 A;  5ANL A;  3FUL A;  5FQ7 A;  3AG1 E;  5EN5 D;  3ULE G;  4DK5 A;  3OXG A;  3NZS A;  2WXK A;  4Z68 A;  3GYZ A;  4PS7 A;  3APF A;  3IBE A;  4GPM A;  1N52 A;  5CCM A;  2KC7 A;  4I9C A;  3ASO E;  2J08 A;  2WM9 A;  2CFZ A;  5LFA A;  4ACK A;  1H19 A;  4NAC A;  1UN8 A;  2VYI A;  2KCV A;  3E32 A;  4JXT A;  1L5J A;  3T5V A;  3MEK A;  3GZ2 A;  3ASH A;  3ZW3 A;  2ION A;  3TL5 A;  1ZB1 A;  2A5E A;  3MA5 A;  5ENN A;  5FQ8 A;  2UWJ G;  3FU6 A;  3ISM C;  2ZIR A;  4GZC A;  1FVF A;  4KZC A;  1HZ4 A;  2P9K G;  1ZBP A;  5EIL A;  1N0R A;  1JPL A;  3UKU G;  5IY5 E;  2FO7 A;  2AJA A;  4CZ2 D;  2VSN A;  3PDN A;  4QFV A;  3I3N A;  4PUC A;  2C0L A;  5HKP A;  2RFA A;  4CT0 A;  2WXM A;  4C0M A;  3SZ7 A;  4N3C A;  3FUH A;  1E8Z A;  4U8Y D;  4JHJ A;  5CED B;  4KVO A;  2EIM E;  3SBS A;  2MHK A;  4EBA A;  2AW6 A;  5JA4 D;  4ANV A;  3FH7 A;  4DX5 D;  2ILR A;  4GA2 A;  1JCS A;  2R59 A;  3EIJ A;  4I2W A;  1RW2 A;  4TUM A;  1OUV A;  4J8E A;  3TWS A;  2KXP C;  2AXU A;  3CR3 A;  4GML A;  3ZGQ A;  3X2Q E;  1S70 B;  4EZK A;  2P9S G;  4HOQ A;  4HOS A;  4G26 A;  1TJC A;  2Y1L E;  1KT0 A;  5EID A;  4BX9 A;  2XRZ A;  1W3B A;  2V8S E;  3ZVV A;  4JW1 A;  2CFU A;  1BU9 A;  4XKC A;  5ITZ F;  4A1S A;  4JL0 A;  2XCC A;  4J8Y A;  3HXD A;  4OAV B;  4ILG A;  4OVU A;  2WXI A;  4WWN A;  5A7D B;  5AJD A;  3TWX A;  5AEN A;  4G8K A;  4JC8 A;  2PNN A;  1HG5 A;  5ENO D;  4BTB A;  3T8K A;  2X6J A;  4GYO A;  2ZU6 B;  4U04 A;  3CQC B;  2WVI A;  4BX8 A;  3CGH A;  3MKR A;  3MYV A;  3ZEF A;  5FZQ A;  3L9T A;  4OVV A;  5B1B E;  2QYJ A;  5B3S E;  2R5S A;  2RFM A;  4M3O A;  1LD8 A;  3FDH A;  4GZ5 A;  5KCM A;  3CST A;  1JWG A;  2X38 A;  2I1J A;  1OWM A;  1NZN A;  2AVP A;  3PE3 A;  2R03 A;  4N39 A;  2HYZ A;  4DUI A;  2ZIS A;  4XE0 A;  5CBN A;  1EF1 C;  4BSX A;  3V2O A;  1GW6 A;  3UKR G;  2XPY A;  5DIZ A;  1TN8 A;  4F1P A;  2VSX E;  3PNL B;  2KAT A;  3DXK G;  4FLH A;  2YHE A;  3FUD A;  4MLP A;  5FIN A;  5AAO A;  1KPS B;  3EHR A;  4BET A;  3FUE A;  1BI8 B;  3SQV A;  5EYP F;  2DZO A;  3HVE B;  3NF1 A;  3CHP A;  1OWO A;  1ZU2 A;  5G04 J;  1E7U A;  3ONL A;  3FUF A;  3U9W A;  2DYR E;  1N4Q A;  2HE0 A;  4HNA D;  4JD2 G;  4U7E B;  3S7F A;  3APC A;  1V55 E;  2VSY A;  2ETA A;  1JWF A;  4AM9 A;  2NC9 A;  4XIF A;  5FZR A;  2XEE A;  2J09 A;  3KSQ A;  4N5Q A;  4RVB A;  1HU3 A;  3ML9 A;  3S7B A;  4YDY A;  2BED A;  3AG2 E;  4G1T A;  1NA3 A;  1P5Q A;  3HXC A;  4RQI A;  2WMN A;  3MZL B;  1E8W A;  3MGB A;  4WND A;  5EYL A;  5A23 A;  3HXB A;  1UJJ A;  3Q5M A;  3HVE A;  4NQ0 A;  3O4Z A;  1Z3X A;  3ZPJ A;  4L9P A;  3ASG A;  2H6H A;  4EHM A;  4N2S A;  5BXU A;  4HS2 A;  2UY1 A;  2DVW A;  4YND A;  3ZU7 B;  1DNP A;  4LER A;  3C98 A;  3FY4 A;  3AS8 A;  3R9A B;  4AY6 A;  3CVU A;  1FT2 A;  3W9F A;  4CYM D;  3CK8 A;  3ESK A;  3UMV A;  4AV7 A;  2E2E A;  5CMW A;  3AAA C;  3ABL E;  4LSZ E;  3ASD A;  4FLB A;  2OVF A;  1OY3 D;  3VLD A;  4CDN A;  1QQE A;  2VQ2 A;  3JUE A;  1WAO 1;  2IY0 C;  2IO3 C;  2IU1 A;  4AP2 A;  5CCL A;  3QAQ A;  2LSV A;  5BV1 A;  4I43 A;  2GRM A;  3D9K A;  3IEG A;  2A5U A;  3GZS A;  2VSO E;  2X3M A;  1HF8 A;  4UWK A;  1N0Q A;  2VGX B;  2MYO A;  2MOW A;  5ENP D;  3EJN A;  4F6R D;  5BPP A;  4F3V A;  3HG0 D;  3UT7 A;  4IYP A;  1PC2 A;  2XPI A;  2IQC A;  4GA1 A;  3D9M A;  4E6H A;  2AXZ A;  5KJL A;  1QBQ A;  4FA6 A;  5H7P A;  5AIJ A;  4B8C B;  5EDS A;  4FC8 A;  4GYY A;  5KJN A;  4OYS A;  3UM0 A;  3Q79 A;  3GZ1 A;  4ILH B;  4RLY A;  3FTU A;  3CVQ A;  1UJK A;  4GYW A;  2VTB A;  3KS2 A;  4RSY A;  4A3T A;  4XI9 A;  5AAR A;  1XNF A;  2OEV A;  3NBN B;  3NB2 A;  3HHM A;  2LNI A;  4G25 A;  1EYH A;  1TNZ A;  4LUN U;  3ZHE B;  3UIP C;  5ARG A;  4U8V D;  2XZT G;  3I4G A;  1Z5S C;  3PZ1 A;  4JHR A;  5FQ6 A;  3CSF A;  3D9J A;  3CEQ A;  5D2M C;  4HLE A;  1TR4 A;  3LY7 A;  1JCR A;  2PQR A;  5BT1 A;  3FUM A;  5ENS D;  1N4P A;  3Q78 A;  3LCA A;  3C5R A;  4TXP A;  4N5C A;  2IF4 A;  2Y4T A;  3DSW A;  1TNB A;  4U07 A;  4K0R A;  2M63 A;  1HS6 A;  3SBT B;  3Q47 B;  4NRH B;  1H6K A;  4BWR A;  5BUZ A;  1NA0 A;  5G2N A;  1FPP A;  2J07 A;  1E8X A;  3Q9N C;  1G3N B;  2P9I G;  1BD8 A;  2LUH A;  5BNW A;  3UM3 A;  4B8A A;  4GTP A;  5B1A E;  4WAF A;  1IYG A;  2BUG A;  4D10 C;  4HI9 A;  1DC2 A;  4LCT A;  2Q7F A;  4TRQ A;  2BKK B;  3FTW A;  4A3V A;  4GTM A;  3ZYM A;  3SD5 A;  4TUU A;  3D9L A;  3VLF A;  1OCC E;  3UI2 A;  1HH8 A;  1JCQ A;  4UQZ A;  4G11 A;  3TXM A;  4AEZ C;  4GZD A;  3PNT B;  4GZ6 A;  3RSE G;  4WNF A;  1NP7 A;  3C3R A;  2GRO B;  2XZD G;  5LP0 A;  5D0O D;  2QC9 A;  4G23 A;  1E8Y A;  2IOL A;  2NSZ A;  1KLX A;  3IXE A;  2WXG A;  3V2X A;  2PM6 A;  4FUL A;  2P9L G;  3IHV A;  4WUY A;  4O1P A;  4CCA A;  2F8Y A;  5KNG A;  3KEA A;  3FUJ A;  3L13 A;  1TYQ G;  4YDE A;  1VDY A;  2WXH A;  2LAH A;  1LTX A;  4AVX A;  1MHQ A;  4HB5 A;  2F8X K;  4YDW A;  3U66 A;  4BSZ B;  4UWL A;  4UWG A;  4E85 A;  4KT6 B;  3HDX A;  3ML8 A;  3PVL A;  4A63 B;  5HS0 A;  4U0U A;  5ARF A;  3PRE A;  4KMO A; 
#chains in the Genus database with same CATH homology
 3CST A;  3ENE A;  1JWG A;  2X38 A;  2I1J A;  4J8D A;  4N2Q A;  3E4B A;  1OWM A;  5BW8 C;  1NZN A;  2AVP A;  4ANW A;  2RG8 A;  5AJL A;  3PE3 A;  4CDM A;  2EQX A;  3FTS A;  4N39 A;  2HYZ A;  3CHO A;  3JQ1 A;  3HYM B;  4HOR A;  2DCP A;  4XE0 A;  3AS5 A;  1EF1 C;  3TG4 A;  3L08 A;  1H0A A;  4BSX A;  2V0P A;  4EPZ A;  4ME2 A;  1GW6 A;  3EHN A;  3RU0 A;  3ZN3 A;  2HR2 A;  5JHA A;  2PM7 A;  2XPY A;  3B13 A;  5DIZ A;  5J90 A;  3OXL A;  2JEK A;  2E0I A;  3D9P A;  1OWL A;  2VSX E;  3PNL B;  2KAT A;  3RRU A;  4P29 A;  3CVV A;  5A6C A;  2BTD A;  1HE8 A;  4GA0 A;  3ZHE A;  4FAD A;  4FLH A;  2WQH A;  5FT9 A;  2YHE A;  3FUD A;  2X6F A;  2XGS A;  5KJM A;  4DI4 A;  4MLP A;  5FJY A;  3CKB A;  3FFL A;  3D3M A;  4B94 A;  3FUN A;  4EZJ A;  2WPV A;  2OOE A;  5LCW J;  4I6J A;  5G05 C;  1S0P A;  3SF4 A;  5EKQ D;  4BY6 A;  4DPR A;  3FUE A;  3D9I A;  5T3R A;  4AOF A;  2VTB B;  3LXU X;  2YNQ A;  4I9E A;  2OV8 A;  4MRU A;  5JJ6 A;  4DLO A;  3PZD A;  4N3A A;  1E96 B;  3ASF A;  3ZRH A;  3CK9 A;  3HVE B;  2WXR A;  3NF1 A;  4G2V A;  3MJW A;  3CHP A;  1OWO A;  1HXI A;  1ZU2 A;  2X6I A;  5G04 J;  2DIW A;  4JEU A;  1E7U A;  3ONL A;  3FUF A;  3QOU A;  4XKB A;  3U9W A;  3ONK A;  2WMO A;  4FHK A;  2NXP A;  4DJA A;  3UUX A;  1U3D A;  3OTN A;  4EBA G;  3PEV B;  1OWP A;  1SZA A;  3G2V A;  2WXN A;  2J4B A;  4CGW A;  3S7D A;  4L23 A;  3FU5 A;  2YIN A;  1H2T C;  1HX8 A;  4UI9 K;  2AXV A;  3LPZ A;  3ZIM A;  2I2O A;  2I6H A;  3S7F A;  4Q69 A;  2I1K A;  3APC A;  2PL2 A;  3RK6 A;  2PZI A;  3U64 A;  3ULQ A;  2VSY A;  3P1U A;  1JWF A;  3RRM B;  3G2W A;  2LAI A;  4L7T A;  2NC9 A;  4R7L A;  4AM9 A;  4APO A;  4XIF A;  5FZR A;  3SGH A;  4F1S A;  4DLQ A;  2J09 A;  4K03 A;  1IQU A;  4RVB A;  5JJT A;  2JLB A;  1HU3 A;  3HIZ A;  1IQR A;  3ML9 A;  3LKU A;  2J49 A;  3CVW A;  3S7B A;  2QY7 A;  3G2T A;  2DBA A;  3MCX A;  5M72 A;  4GAA A;  4L2Y A;  4BT8 A;  4CT4 A;  1WM5 A;  4G1T A;  4Y6C A;  2FF4 A;  3AU5 A;  4HOU A;  1NA3 A;  2HM8 A;  1P5Q A;  4C9B B;  3PS6 A;  3IKO B;  2WMN A;  3MZL B;  4WWP A;  4HXI A;  5E76 A;  3FTV A;  1E8W A;  3TGO A;  3MGB A;  4WND A;  4AXH A;  3S7J A;  3PH0 C;  4MKT A;  3MV2 B;  5A23 A;  4XZ4 A;  5CMY A;  3CVY A;  3FP3 A;  1UJJ A;  4ACL A;  3TG5 A;  3Q5M A;  2X6H A;  3U3W A;  4HOT A;  3QC1 A;  4CDR A;  1YA0 A;  3HVE A;  1IHG A;  1HO8 A;  4NQ0 A;  3FUI A;  3O4Z A;  1Z3X A;  3VTX A;  3OXF A;  3ZPJ A;  3G2U A;  3Q49 B;  4O6F A;  1BPO A;  3ASG A;  4PS3 A;  1DVP A;  1PAQ A;  3MV3 B;  4N2S A;  3QDN A;  2Y4U A;  5EX0 A;  3Q4A B;  4HS2 A;  3CHS A;  2XPZ A;  2UY1 A;  2MRI A;  5T8I A;  4A55 A;  3LVR E;  3I4R B;  4Q94 A;  3SNX A;  3CVX A;  4YND A;  2YHC A;  3PUK A;  4EZL A;  4WWO A;  2IFU A;  1DNP A;  3B7R L;  4LER A;  5BV0 A;  3C98 A;  2LSU A;  3FY4 A;  3AS8 A;  1SZ9 A;  3FEX A;  1JUQ A;  3QB2 A;  4GZ3 A;  3R9A B;  3CVU A;  4AY6 A;  3L54 A;  4V3I A;  2CG3 A;  2BF0 X;  5C1D A;  1UG3 A;  5HI7 A;  3FTX A;  4I1M A;  3NZU A;  3CK8 A;  3ESK A;  3UMV A;  4JHK A;  3L16 A;  4AV7 A;  5DBK A;  1EPU A;  2E2E A;  3CHM A;  5ANR A;  5CMW A;  1EDU A;  4KBQ A;  3UX4 A;  4UI9 C;  2WXJ A;  4IN3 B;  3ASD A;  4FLB A;  4IRU A;  2WXQ A;  3LYA A;  4KZ0 A;  1X5B A;  2OVF A;  1ELW A;  2GGF A;  3UT4 A;  3JCK C;  3VLD A;  1H2V C;  3PUJ A;  4AY5 A;  2XRY A;  2V5F A;  4CDN A;  3WXX A;  2KM4 A;  2J4D A;  4AIF A;  4ILI A;  4W9R A;  1QQE A;  2VQ2 A;  4EEC A;  4GCN A;  3RO3 A;  4L2L A;  4ABN A;  3LS8 A;  4FU3 A;  1WAO 1;  1XGW A;  2FI7 A;  3FWV A;  3B7T A;  3GW4 A;  2IU1 A;  4I6G A;  3B7U X;  3U4T A;  2L0I A;  4AP2 A;  5CCL A;  5C2Y A;  3QAQ A;  5AYW D;  2LSV A;  5BV1 A;  1Y6I A;  4JEH A;  4I43 A;  2GRM A;  4FHJ A;  2XGO A;  3D9K A;  3IEG A;  3RRN B;  2A5U A;  3GZS A;  2VSO E;  3T8M A;  4DI3 A;  2X3M A;  1HF8 A;  4UWK A;  2VGX B;  2MOW A;  4Q96 A;  1UW4 B;  4N3B A;  1B89 A;  3EJN A;  5FZS A;  1HFA A;  3TXN A;  2L6J A;  3FHE A;  5BPP A;  3L6A A;  3IHY A;  3CVL A;  4F3V A;  1HG2 A;  4HFG A;  5LCW C;  3CHR A;  3CQG B;  2IOS A;  3EDT B;  2V4L A;  3PE4 A;  3UT7 A;  1FVH A;  2XGM A;  4FJZ A;  4IYP A;  4U0S A;  1PC2 A;  2XPI A;  3QAR A;  5FWQ A;  5JJ7 A;  2CHZ A;  4ANU A;  2IQC A;  4GA1 A;  3KAE A;  3MKQ B;  4KYO B;  2XHE A;  3CKC A;  4KVM A;  3EIQ C;  5G04 C;  3D9M A;  2XCB A;  4I1O B;  2AXZ A;  4PH4 B;  4E6H A;  1Z3Y A;  5KJL A;  4XI0 A;  5ANL A;  3FUL A;  5FQ7 A;  2GW1 A;  3CIA A;  3UT8 A;  1QZ2 A;  3CK7 A;  4FA6 A;  4J6I A;  4DK5 A;  3OXG A;  1MQS A;  3NZS A;  1PY1 A;  4J8F A;  2WXK A;  5AIJ A;  4B8C B;  3GYZ A;  4FC8 A;  5EDS A;  4GYY A;  3FTZ A;  5KJN A;  3BG0 B;  4PS7 A;  4GPK A;  3APF A;  3LY9 A;  3IBE A;  1N52 A;  4OYS A;  5CCM A;  2KC7 A;  2LO6 A;  4B89 A;  4I9C A;  4ILH B;  3GZ1 A;  1WY6 A;  2J08 A;  2WM9 A;  2CFZ A;  5FTP A;  3FTU A;  4JPS A;  2R17 C;  5LFA A;  3CVQ A;  4ACK A;  1H19 A;  1H2U A;  1UJK A;  3FH5 A;  4GYW A;  4NAC A;  2VTB A;  1UN8 A;  3KS2 A;  2J9Q A;  4RSY A;  4XI9 A;  4A3T A;  2VYI A;  2KCV A;  3FU0 A;  4JXT A;  3LEW A;  1XNF A;  4Y6W A;  1L5J A;  5HQ8 A;  2VJ8 A;  3HHM A;  3MEK A;  2LNI A;  3T5V A;  4G25 A;  1EYH A;  3SI5 A;  4JVS A;  1FCH A;  2GRL A;  3ASH A;  3GZ2 A;  4GCO A;  4LUN U;  3JYS A;  4LRZ A;  3DBS A;  3ZHE B;  3ZW3 A;  5ARG A;  5T4Y A;  4GU5 A;  3AS4 A;  3RJV A;  3BEE A;  2ION A;  3I4G A;  3TL5 A;  3ESL A;  3JQ0 A;  4JHR A;  2OVB A;  4URK A;  3L22 A;  4U63 A;  3MA5 A;  5ENN A;  5FQ8 A;  2UWJ G;  2OND A;  3FU6 A;  3URZ A;  3FH8 A;  3D9N A;  4GZC A;  3ZYK A;  1FVF A;  4YVQ C;  5FQ6 A;  4BT9 A;  4U0Z A;  3VLE A;  4KZC A;  1HZ4 A;  2RD0 A;  1ZBP A;  3D9J A;  3CEQ A;  3CSF A;  3LVQ E;  3N71 A;  4B0Z A;  3IV0 A;  4CRW A;  2L9B A;  1JPL A;  4HLE A;  4J8S A;  3LY7 A;  2FO7 A;  3R7R A;  5E75 A;  4WNE A;  3KD7 A;  3DPD A;  3CVP A;  4BFR A;  2PQR A;  3FUK A;  4RG6 A;  2Y3A A;  3B7S A;  5BT1 A;  3L17 A;  2VSN A;  3FUM A;  3PDN A;  4QFV A;  3NQP A;  3UPV A;  2P58 C;  4JZY A;  4I1A A;  3I3N A;  5EX3 A;  3VTY A;  4PUC A;  2C0L A;  4KXK B;  3FTY A;  2KCL A;  3LCA A;  3JUI A;  4YVO A;  1TEZ A;  3ZXS A;  3QK0 A;  3P2B A;  4N5C A;  2WXP A;  4CT0 A;  2X6K A;  2WXM A;  3I5P A;  4C0M A;  4GMJ A;  3SZ7 A;  2IF4 A;  4ATG A;  2Y4T A;  3PEU B;  2KZT B;  4N3C A;  3CV0 A;  4U07 A;  4XX5 A;  4K0R A;  3FUH A;  2XQ0 A;  1E8Z A;  2KCK A;  2M63 A;  1HS6 A;  4JHJ A;  3SBT B;  3KEZ A;  3Q47 B;  1TJF A;  4NRH B;  4JA9 A;  4KVO A;  5G05 J;  2A4Z A;  3BG1 B;  3SBS A;  1H6K A;  2MHK A;  4BWR A;  4EBA A;  4EQF A;  4IUL A;  2CHW A;  4UQY A;  5BUZ A;  2AW6 A;  4MS6 A;  4UQX A;  1NA0 A;  4G24 A;  3TAX A;  3FU3 A;  4ANV A;  3FH7 A;  3LJ3 A;  3QWP A;  3QWV A;  2ILR A;  2IJG X;  4GA2 A;  5G2N A;  2R59 A;  2WXL A;  4WNG A;  4UWF A;  2J07 A;  4U8H A;  1E8X A;  3EIJ A;  4I2W A;  3FEY A;  3APD A;  4NUR A;  1OUV A;  4J8E A;  4GB9 A;  3PRZ A;  1U3C A;  3OAW A;  2C0M A;  2AXU A;  5CHE E;  4BTA A;  1ELK A;  3K9I A;  3ZYQ A;  3CR3 A;  4GML A;  3D9O A;  3SFZ A;  4CGV A;  5BNW A;  4B8A A;  3ZGQ A;  4WAF A;  4H7X A;  4I2Z A;  2VGY A;  2FEZ A;  3QWW A;  3ZFW A;  3R7Q A;  4HVB A;  4F53 A;  3QJZ A;  4I17 A;  4PDX A;  2BUG A;  5LX8 A;  4EZK A;  1IYG A;  4HOQ A;  4HOS A;  4G26 A;  4RG9 A;  1TJC A;  2UY1 B;  3QKY A;  2XEV A;  4D10 C;  5D0Q D;  1KT0 A;  4LCT A;  3LDZ A;  2YQ8 A;  4BX9 A;  2XRZ A;  1W3B A;  4A1G A;  1A17 A;  2Q7F A;  2V8S E;  3AU4 A;  4TRQ A;  4UWH A;  4PS8 A;  1Y8M A;  2I9C A;  3RO2 A;  3ZVV A;  4JW1 A;  3O48 A;  3EHM A;  2CFU A;  3S2A A;  3FTW A;  3SHF A;  2KZT A;  3LY8 A;  4A3V A;  4CEM A;  3ZYM A;  4XKC A;  4A1S A;  4JL0 A;  3SD5 A;  4TUU A;  3D9L A;  3Q15 A;  2WQ6 A;  2XCC A;  3VLF A;  2AWI A;  1Z6T A;  3RKV A;  1HH8 A;  5J08 A;  4FP7 A;  4UQZ A;  4G11 A;  2HO1 A;  3TXM A;  4AJW A;  4AEZ C;  4GZD A;  3CLJ A;  3PNT B;  4GZ6 A;  4WNF A;  3G2S A;  2CG2 A;  1NP7 A;  2PQN A;  3CHQ A;  4ILG A;  4OVU A;  5LOZ A;  2QFC A;  2WXI A;  5LP0 A;  4WWN A;  5A7D B;  5D0O D;  5AJD A;  2C2L A;  2WXO A;  5AEN A;  5KJK A;  4G23 A;  1E8Y A;  2IOL A;  2VGX A;  4JC8 A;  1HG5 A;  1KLX A;  2NSZ A;  4J0U A;  3ZYL A;  4BTB A;  1ELR A;  4L1B A;  4LEU A;  3T5X A;  1UN9 A;  2FUL A;  2CHX A;  2WXG A;  2WQ7 A;  2PM6 A;  2X6J A;  5FQ4 A;  4FJY A;  4GYO A;  2ZU6 B;  4C0E A;  4FUL A;  4U04 A;  3CQC B;  2L0T B;  1QNF A;  2FBN A;  3IHV A;  2WXF A;  2WVI A;  4WUY A;  4BX8 A;  1SQM A;  3CGH A;  4F7A A;  4ANX A;  5JHB A;  3MKR A;  4CCA A;  3MYV A;  1LF8 A;  4I6E A;  1N54 A;  3ZEF A;  5FZQ A;  3FUJ A;  3MKQ A;  1KT1 A;  3CVN A;  3L13 A;  4JA7 A;  1INZ A;  1VDY A;  4TV3 A;  2WXH A;  4OVV A;  2LAH A;  2WB2 A;  4AVX A;  1MHQ A;  3QNK A;  3U66 A;  4UWL A;  4UWG A;  3MX3 A;  3RIB A;  4E85 A;  4KT6 B;  3HDX A;  3ML8 A;  3PVL A;  5G55 A;  2R5S A;  4M3O A;  1OWN A;  1E7V A;  3UQ3 A;  4UI9 J;  3FDH A;  1E90 A;  4GZ5 A;  4U0U A;  4H7Y A;  5ARF A;  5KCM A;  3TJP A;  3PRE A;  4KMO A;  4APF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...