4GTQA

Ftase in complex with bms analogue 12
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
315
structure length
315
Chain Sequence
b'FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type-1
publication title Development of Selective, Potent RabGGTase Inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
total genus 122
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 4gtqA00
3E37A 1N4SA 2R2LA 1LD7A 3DSWA 4L9PA 4GTOA 1KZPA 1FPPA 4GTTA 3PZ1A 3E30A 3HXFA 1D8EA 1SA4A 3KSQA 2BEDA 2ZIRA 1O1SA 1JCRA 3E34A 1SA5A 1KZOA 1LTXA 1S63A 1N94A 3HXDA 1N4RA 1N4QA 1X81A 1TN7A 2H6FA 3SFXA 1TNOA 3DPYA 4GTPA 1N95A 1MZCA 4MBGA 1FT1A 1JCSA 3DSUA 1D8DA 3KSLA 2H6HA 1O5MA 3Q7FA 3PZ2A 3SFYA 4GTMA 1NL4A 4GTQA 1N4PA 3DRAA 1TNUA 3E32A 1DCEA 1S64A 1NI1A 3PZ4A 3Q79A 3PZ3A 3HXCA 2H6GA 4LNBA 4GTRA 4GTSA 4LNGA 2F0YA 3DSVA 3Q7AA 1QBQA 3DSXA 1N9AA 1O1TA 1TN8A 3EU5A 4GTVA 1TNBA 3Q73A 3E33A 4YDOA 3DSTA 4EHMA 3C72A 3EUVA 3HXBA 2IEJA 3DSSA 1TN6A 3Q75A 2ZISA 1TNZA 1TNYA 1JCQA 2H6IA 1O1RA 4YDEA 1LD8A 1FT2A 3Q78A 3HXEA
chains in the Genus database with same CATH superfamily
3E37A 5ARFA 4TUMA 4TRQA 1W3BA 4G2VA 5BXUA 1UN8A 3SI5A 4O6FA 5ENTD 4KYOB 1H6OA 5C1DA 4OVVA 4J7WA 4U63A 3RU0A 4HOTA 3MV2B 3VLDA 4B8AA 1VDYA 3FUHA 2XGMA 4GA1A 4MBGA 4BT8A 4BX8A 1YA0A 2E0IA 4RQIA 2WXKA 4ANUA 3SGHA 3RJVA 1BPOA 1OWPA 2GW1A 3QOUA 4E85A 1FVHA 3I3NA 3MYVA 3W9GA 3B13A 3TJPA 3PVLA 2XGSA 1Z6TA 3PZ3A 3GW4A 4G26A 1X5BA 5EILA 4AY6A 4DI4A 2VGXA 4MRUA 4AJWA 3KEZA 4B89A 2F8XK 3LY7A 4HOUA 2QFCA 1E8WA 3SHFA 1K3ZD 4I6JA 2I1KA 3ZKJA 5HS0A 2IEJA 1MYOA 1EF1C 4W9RA 4BESA 4U8VD 4LERA 3S7BA 1HZ4A 3SY2A 2NYJA 4U07A 2WMOA 1N4SA 4CT4A 5CRUA 4DX1A 2WXRA 2WXNA 4GTOA 4DRXE 3PZ1A 1HX8A 2NSZA 4PUCA 3E34A 1N94A 4G25A 2AXUA 3T9KA 3LVQE 4K5CA 2VGXB 1AWCB 3X2QE 1EYHA 3SFZA 3CVLA 3HRAA 3ZYMA 4DJAA 1MZCA 5A7DB 3G2UA 4UQZA 1EPUA 3NBNB 3G2WA 1K1BA 3TWXA 3MKRA 4ATZD 1UN9A 3DRAA 1NI1A 1HF8A 1OCRE 1MHQA 2PL2A 2J49A 2QC9A 3CV0A 3T8MA 4LNGA 4U96D 2XPYA 4PH4B 3HYMB 3CK7A 1BI7B 3WXXA 1OWNA 1H6KA 3N71A 4I17A 5AJLA 3ZU7B 2L0IA 2UY1B 2KM4A 3Q47B 4ACLA 1MX2A 4HRNA 5ENPD 1MQSA 4K03A 3ZYQA 5FQ8A 2MRIA 4Q69A 2R2LA 2KBXA 4DLQA 3CVUA 5CCLA 1DVPA 3ZXPA 4HOQA 3AU5A 3ZNGA 2AJAA 1BD8A 3PUJA 3BG0B 2ZIRA 3QWPA 1KPSB 3SZ7A 4AP2A 4HOSA 1P5QA 2VTBA 1RZ4A 4K5AB 2AVPA 4LEUA 3RK6A 2XS1A 5HRYA 1D8DA 4I43A 3Q7FA 3MGBA 2QZAA 4L2YA 3PZ2A 3UT4A 2B0OE 4WNDA 1Y6IA 1OWMA 3B7SA 2WMNA 2LNIA 3EIJA 2IO3C 2Y69E 2KATA 4EZLA 2R59A 4UWFA 3AG1E 4J8SA 3CQCB 2P9SG 1N9AA 1E7VA 3G2VA 2OVFA 4JXTA 3ULYA 3FTZA 3D9OA 3NF1A 3Q15A 4XE0A 1ELRA 4U8HA 1JWGA 3C72A 4Z68A 1L5JA 4U95D 3G2SA 2R03A 3PS6A 2Y3AA 5EX0A 4J0UA 1ZU2A 4YDWA 5AARA 3HXEA 3B7BA 2ZGGA 3ZYKA 1HXIA 2MHKA 3EHNA 1K8KG 4HLLA 1OY3D 3ASDA 2V8SE 2J4BA 5CMWA 1U2VG 1IQUA 4Q96A 4DX2A 3TGOA 4EBAG 4HI9A 4BY6A 4K5BA 4DLOA 4EPZA 4ZFHA 5KJMA 2R17C 5IY5E 4G1TA 3E4BA 1NA0A 4JHKA 2OVBA 1PAQA 3FH7A 3CHRA 2H6HA 2ZXWE 4ZHBA 3L13A 3AS8A 2HYZA 1IYGA 4UI9J 3V79K 4CDMA 4JA9A 4APOA 2AXZA 3AU4A 3I5PA 1EDUA 2V5QC 1UJJA 3FUNA 2H6GA 4F7AA 4I2WA 1HG5A 3B7UX 4J6IA 4PS3A 2L0TB 1QNFA 4LG6A 4HXIA 3NZUA 2AWIA 4XI9A 4CYMD 4Y6CA 4P29A 4F6RD 3HXBA 2F8YA 3FTWA 2J8SD 3AAAC 4KVMA 2X6FA 3AG3E 2FI7A 3CVYA 3RIBA 2RG8A 3QWWA 2FO7A 1SVXA 3DSWA 5ENSD 1Y8MA 3FU6A 2NC9A 4ILIA 3KSQA 5CEAA 1WY6A 4XZ4A 2VGEA 2VSXE 3SBSA 1MX6A 3V2OA 1BU9A 1N4QA 3FH5A 3ZN3A 1UW4B 2XEEA 3MJWA 5KJLA 1OXJA 2KCVA 3TWTA 1E8ZA 3ZRHA 2L9BA 3FY4A 3L17A 3E32A 3UM1A 4O1OA 2WXOA 4KVOA 4B93B 2DWZA 5AQ7A 3SF4A 5BPPA 2X6IA 4GTSA 4AY5A 4WWPA 5EN5D 3CKBA 2WQHA 3IV0A 3UUXA 4BT9A 5LFAA 2HM8A 4HB5A 3ABME 4PS7A 4A3TA 4B0ZA 2R5SA 5FQ6A 2C0LA 3FHEA 3FTSA 2JABA 2EQXA 3FUMA 2EIME 3UM0A 2WXFA 4I2ZA 2PQRA 4AEZC 2IJGX 2KZTB 3VTYA 4EBAA 1PY1A 2B6CA 2DYSE 4MKTA 4UI9C 2IONA 3U3WA 1H2TC 1G3NB 4LCTA 3E30A 4EQFA 1D8EA 3EHQA 1SA4A 4D10C 4WWOA 2Y4UA 2ZU6B 3JCKC 3JQ0A 2PQNA 3Q4AB 3DEPA 3KD7A 2LSUA 2WB2A 4CZ2D 1TNOA 2FF4A 2CHZA 3KS2A 3KEAA 4GU5A 3DSUA 4N3BA 4FA6A 3KSLA 4DX5D 5J90A 3ONLA 2E2EA 2X3MA 1K1AA 4JEUA 5C2YA 2LAIA 1WAO1 3ZVVA 2X6KA 3RAUA 3Q7AA 3V31A 1V55E 1N52A 1XNFA 4J8DA 2ILRA 3IEGA 3T5XA 2KCLA 4BFRA 4GTVA 3BU8A 2FBNA 2VQ2A 2I6HA 3KAEA 5HQ8A 4AM9A 5CEDB 4DPRA 4YDEA 3TXMA 4A1SA 5T4YA 3Q78A 2XZDG 4CCAA 2WPVA 3R9MA 4R7LA 3ABKE 1ZB1A 3CVVA 1KZPA 5EYPF 3PH0C 1HH8A 4PS8A 3HHMA 1SA5A 1Q2ZA 1KZOA 1LTXA 3ZGQA 3DXKG 4FHKA 2A4ZA 4O1PA 3D9NA 3FTXA 1QQEA 1SW6A 4HI8A 2XEVA 4BEPA 1IQRA 1JCSA 2GRPB 5BXOA 4G24A 3HG0D 3O48A 3CHOA 3HVEA 3OTNA 3QARA 4XIFA 2P2CP 3Q79A 3L6AA 3NB2A 4XKBA 1TJCA 1LF8A 3HDXA 3DPDA 2WQ6A 4HRLA 2C0MA 1NZNA 4BTBA 4AXHA 4CEMA 2JEKA 1N0RA 2FEZA 5D2MC 3JUEA 2VYIA 5DBKA 2IO2C 3QDNA 4YVQC 5CHEE 3TWSA 4EHMA 2J9QA 4EZJA 2MYOA 4GA0A 4FU3A 4DX7D 3CVQA 1TNZA 1TNYA 3UQ3A 4G8KA 4QFVA 4J8YA 4MLPA 1V54E 3B7TA 5JJ6A 2WXJA 3CR3A 5FQ7A 3ULEG 4A3VA 4N3CA 1YYHA 3L9TA 2MOWA 2J4DA 3U66A 4H7XA 3OXGA 4JVSA 1TEZA 2WM9A 4I1MA 3FU5A 1N4RA 2DVWA 3DBSA 4ATGA 5FZSA 1X81A 3G2TA 3LJ3A 4O60A 3C5RA 2A5EA 3GYZA 4V3IA 3PNTB 4J8EA 3FUIA 2GRRB 5M72A 2DIWA 3JXJA 5J08A 2KXPC 2OEVA 4TV3A 4GZ5A 4XI0A 4FADA 4IRUA 2PM7A 4B8CB 5E76A 4AIFA 3CQGB 5CBNA 1WDYA 3L22A 3CHMA 1FVFA 2OOEA 3S2AA 1U3CA 3PNLB 4B94A 4OVUA 3SQVA 3NQPA 5EYLA 4FULA 3UT8A 1TNBA 3CLJA 2BKGA 5AJDA 3TG5A 2WXGA 3DSTA 4DK5A 1DC2A 3ASFA 3MKQA 5AIJA 1XGWA 3EHMA 3Q75A 4BETA 2P58C 4A55A 2XPZA 3TWQA 5B1BE 4HVBA 1SZ9A 3PEUB 3R9AB 4GZ3A 3CVXA 3QC1A 4WNGA 2ZGDA 3C3RA 3D9JA 3NAWA 2WVIA 3ZW3A 2VTBB 3L08A 3FUJA 4YDYA 2YQ8A 1A17A 4BERA 5JMND 2IQCA 3TWVA 2XS8A 1S63A 5BT1A 4NACA 1DNPA 3LCAA 2DZNA 4UI9K 2H6FA 4JHRA 2OCCE 1IHGA 4NIKA 3FU3A 3C98A 2XPIA 3RO3A 3UT7A 2WXQA 5CRVA 3UM3A 5KWDA 3Q9UC 1N4PA 3CSTA 4EECA 1S64A 2PZIA 2KC7A 2Y4TA 4WWNA 2PNNA 3BUAA 4I1OB 3TWUA 2OEWA 5CBOA 4QQIA 5B3SE 4LNBA 1SZAA 3PE4A 1HFAA 4IULA 3I4GA 5LCWJ 2YINA 4TXQA 4HS2A 3MEKA 4F3VA 4G8LA 5A6CA 4BX9A 1ELWA 3PUKA 2P9IG 5CECB 2PM6A 2RD0A 5KBAA 1TN6A 1H6PA 4U0ZA 3GZ2A 5CCMA 2HR2A 2I1JA 2CFZA 3LY8A 3APFA 1OCOE 4CGVA 1FPPA 4GTTA 4WNFA 4NQ0A 2AXVA 2J08A 4JA7A 5FZRA 3EU9A 5G55A 3U64A 4X8QA 3EHRA 1U3DA 3CHPA 2DCPA 1BLXB 1D9SA 3UTMA 4ANXA 3FFLA 4TXPA 2P9NG 4U7EB 4E6HA 4F1SA 1NP7A 1TJFA 1A5EA 3JXIA 3S7JA 4FJYA 3ULQA 3JUIA 3ZHEA 3AG2E 3L54A 3RRMB 3PZDA 4XX5A 4GCOA 3IHYA 4DUIA 2WXHA 5JJTA 3CKCA 3QKYA 5KNGA 3ASHA 2QY7A 1UJKA 5JJ7A 4RVBA 3RRNB 1OUVA 4C0EA 3EU5A 4H7YA 4F1PA 5LX8A 4XEIG 2J07A 3D9LA 3Q73A 2P9PG 3CVNA 3U4TA 1H2VC 4JD2G 3FH8A 3CEQA 3ZPJA 1QYMA 4JZYA 2I9CA 5CERB 2Y0BG 3LJNA 2V4LA 1FT2A 3ASNE 3ENEA 1GW6A 2CHXA 2RKKA 3IKOB 2R02A 3ZHEB 5AQBA 4APFA 4GZDA 4L9PA 3FDHA 5AAOA 3HXFA 5AENA 2Q7FA 3MX3A 1PC2A 3APDA 2CFUA 4J8FA 3HXDA 4AVXA 2RFMA 3UI2A 5LCWC 1TYQG 5CMYA 5HKPA 3UIOC 2P9UG 5BW8C 4U04A 3DXMG 3MV3B 2ETAA 2VGYA 5B1AE 1AP7A 4KXKB 4UWGA 4GMLA 4ILGA 1Z3YA 5ANRA 1OT8A 1UOHA 4UQYA 2IFUA 2Y1LE 4GMJA 3QWVA 1SQMA 3QB2A 2EINE 3HXCA 2LO6A 3ZIMA 1H19A 4GTRA 5FQ4A 2ETCA 3DSVA 1TN8A 3FWVA 3ML8A 4GYYA 3UIPC 4PDXA 2FO1E 4KZ0A 3P1UA 3L16A 3CVWA 2XRYA 3MCXA 3C3OA 4M7CA 3SNXA 1KLXA 1JCQA 4I6GA 3R7QA 4Y6WA 3RO2A 2R05A 4GZ6A 4HFGA 2I2OA 2YNQA 5KNHD 3JQ1A 3VLEA 4JHJA 5JA4D 3QAQA 3AG4E 3V2XA 1YMPA 2X6JA 3CK9A 4GPKA 5LP0A 2C2LA 4UQXA 1JWFA 3ZXSA 2BEDA 4JPSA 2WXIA 2EILE 5D0OD 4UUCA 2ETBA 3PE3A 3ZFWA 3LEWA 3UX4A 3GZ1A 3URZA 4C0MA 3IHVA 3SFXA 5FWQA 3CGHA 3ZYLA 3DPYA 2VSOE 1FT1A 5KJKA 1BI8B 2IU1A 1N0QA 3ISMC 3SFYA 3BEEA 4U0SA 2IF4A 3GZSA 2XCBA 4GB9A 1HS6A 3MZLB 4KMOA 4WUYA 5G05J 2FULA 1E8XA 3QK0A 1B89A 3MA5A 2XZTG 2JLBA 1ELKA 3ZUVB 2QYJA 5EKQD 2YHEA 3E33A 4AOFA 2EIKE 3PEVB 4GPMA 4N5CA 1NA3A 4JL0A 1MJ0A 4IYPA 5T8IA 5EIDA 2LAHA 4ILHB 1MX4A 3DSSA 3B95A 2V0PA 2GROB 1Z5SC 3Q9NC 3FEXA 2UY1A 1LD7A 2OV8A 3CK8A 5KCMA 3FTUA 3AS5A 3UKRG 1E8YA 2YHCA 2GRQB 3LPZA 5FTPA 3FEYA 1NFIE 3J5PA 3PRZA 4GAAA 3D9PA 4I9CA 5H7PA 3VLFA 4YNDA 3DWLG 5G04J 1JPLA 3FUKA 4RSYA 2QYUA 3HVEB 1N95A 5FZQA 2L6JA 3DEOA 1IHBA 2LXMA 3LKUA 3L82A 4LNUD 4K0RA 4GTMA 3SD5A 1OCZE 1NL4A 3LYAA 4BTAA 1TNUA 1DCEA 2LSVA 3ML9A 2WXPA 4FLBA 5G2NA 1N54A 3FU0A 4C9BB 3S7FA 4JC8A 3QNKA 4I9EA 3WG7E 3C3QA 3K9IA 4WAFA 4HNAD 2A5UA 5FJYA 2XCCA 2CG2A 4YVOA 4YDOA 1TR4A 3ESLA 4IN3B 3D9IA 3APCA 2XENA 4JW1A 4CGWA 2HE0A 3D9HA 4JB8P 1H0AA 1OCCE 1S70B 1E7UA 2P9LG 3ABLE 3V30A 4URKA 2GRNB 4A1GA 3NOCD 2BKKB 4RLYA 2VJ8A 5BV1A 2WXLA 3FUFA 3EIQC 3OAWA 4GCNA 2UWJG 2BTDA 4U8YD 1HU3A 5G05C 3JYSA 3ONKA 3OXFA 4CDRA 4OAVB 3UINC 2GRMA 3BQOA 1FCHA 2VSNA 5ARGA 4Q94A 4GTPA 4UWHA 2WXMA 1ZBPA 2V5FA 5AN8A 5AQ9A 4GTQA 3UPVA 3D9MA 4BSXA 5ENNA 3S7DA 3UMVA 2J09A 1JUQA 4G23A 2KCKA 2M63A 1KT1A 2BUGA 3PREA 5JHBA 3TL5A 3AJIA 3R7RA 3J5QB 4KZCA 3DSXA 3ESKA 1O1TA 4ABNA 2BF0X 5ENRD 4ANWA 3MKQB 4CT0A 1WM5A 3B7RL 3SBTB 1N11A 4F53A 4GYOA 3TXNA 3RKVA 2F37A 3LDZA 3TWWA 4FHJA 3EUVA 5DIZA 3OXLA 1HO8A 5G04C 2WQ7A 4L23A 5A23A 5BUZA 4G11A 2DYRE 4GYWA 4ME2A 5EDSA 1RW2A 5KJNA 4KBQA 2GGFA 4M3OA 2DBAA 3BG1B 4BWRA 3LVRE 5ANLA 5BV0A 2X38A 5D66A 3IBEA 2IY0C 1O1SA 1JCRA 3FTVA 3CHSA 3VTXA 2P9KG 1DCQA 4CDNA 4HQDA 5FIOA 5AQAA 1TN7A 4U0UA 4N2SA 5ENOD 3RSEG 3P2BA 4NRHB 3EDTB 5ITZF 4GA2A 1O5MA 3UXGA 3PDNA 4N2QA 2XEHA 2X6HA 4FLHA 3IXEA 4N5QA 3I4RB 2V4HC 4EZKA 3CSFA 3ZEFA 5AYWD 4DX6D 3PZ4A 4JEHA 4AV7A 4LUNU 2VSYA 4LSZE 3LXUX 2HO1A 4GMRA 4N39A 2F0YA 3LS8A 1QBQA 3AS4A 4DI3A 1Z3XA 2ONDA 5FINA 4KT6B 2LUHA 4FP7A 2AW6A 3TAXA 3F6QA 1INZA 4RG9A 1IKND 3TG4A 3LY9A 4UWKA 2H6IA 4RG6A 5D0QD 1OWLA 3O4ZA 4TXRA 2NXPA 4HLEA 4WNEA 2EIJE 4L1BA 3T8KA 4OAUC 3QJZA 3CHQA 1S0PA 3UKUG 4A63B 4N3AA 5E75A 1H2UA 3HIZA 4ANVA 3Q5MA 2KZTA 3FULA 3FP3A 3D9KA 1KT0A 4UWLA 4TUUA 1UG3A 4ACKA 1OWOA 2IOLA 2GRLA 4I1AA 4XKCA 2XQ0A 4FC8A 1E96B 4OYSA 5JHAA 3D3MA 4HRMB 5EX3A 4HBDA 2LXLA 3NZSA 3TWRA 2DZOA 2IOSA 4C48B 3W9FA 3FUDA 3T5VA 5BNWA 3CIAA 1HG2A 4I6EA 2XHEA 3Q49B 4GZCA 4L2LA 1YCSB 4MS6A 4LRZA 5LOZA 2XGOA 3UM2A 3FUEA 3ASOE 2XRZA 1HE8A 4HORA 2CHWA 1IXVA 4L7TA 3FTYA 4FJZA 3NOGD 2CG3A 4CRWA 5ENQD 3CVPA 3ASGA 1E90A 4BSZB 3SO8A 2L6BA 3U9WA 2RFAA 3RRUA 5T3RA 1WG0A 5FT9A 2ZISA 5HI7A 1QZ2A 4NURA 1O1RA 3EJNA 1LD8A 5EIBE
chains in the Genus database with same CATH topology
3E37A 1N4SA 2R2LA 1LD7A 3DSWA 4L9PA 4GTOA 1KZPA 1FPPA 4GTTA 3PZ1A 3E30A 3HXFA 1D8EA 1SA4A 3KSQA 2BEDA 2ZIRA 1O1SA 1JCRA 3E34A 1SA5A 1KZOA 1LTXA 1S63A 1N94A 3HXDA 1N4RA 1N4QA 1X81A 1TN7A 2H6FA 3SFXA 1TNOA 3DPYA 4GTPA 1N95A 1MZCA 4MBGA 1FT1A 1JCSA 3DSUA 1D8DA 3KSLA 2H6HA 1O5MA 3Q7FA 3PZ2A 3SFYA 4GTMA 1NL4A 4GTQA 1N4PA 3DRAA 1TNUA 3E32A 1DCEA 1S64A 1NI1A 3PZ4A 3Q79A 3PZ3A 3HXCA 2H6GA 4LNBA 4GTRA 4GTSA 4LNGA 2F0YA 3DSVA 3Q7AA 1QBQA 3DSXA 1N9AA 1O1TA 1TN8A 3EU5A 4GTVA 1TNBA 3Q73A 3E33A 4YDOA 3DSTA 4EHMA 3C72A 3EUVA 3HXBA 2IEJA 3DSSA 1TN6A 3Q75A 2ZISA 1TNZA 1TNYA 1JCQA 2H6IA 1O1RA 4YDEA 1LD8A 1FT2A 3Q78A 3HXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E37 A;  1N4S A;  2R2L A;  1LD7 A;  3DSW A;  4L9P A;  4GTO A;  1KZP A;  1FPP A;  4GTT A;  3PZ1 A;  3E30 A;  3HXF A;  1D8E A;  1SA4 A;  3KSQ A;  2BED A;  2ZIR A;  1O1S A;  1JCR A;  3E34 A;  1SA5 A;  1KZO A;  1LTX A;  1S63 A;  1N94 A;  3HXD A;  1N4R A;  1N4Q A;  1X81 A;  1TN7 A;  2H6F A;  3SFX A;  1TNO A;  3DPY A;  4GTP A;  1N95 A;  1MZC A;  4MBG A;  1FT1 A;  1JCS A;  3DSU A;  1D8D A;  3KSL A;  2H6H A;  1O5M A;  3Q7F A;  3PZ2 A;  3SFY A;  4GTM A;  1NL4 A;  4GTQ A;  1N4P A;  3DRA A;  1TNU A;  3E32 A;  1DCE A;  1S64 A;  1NI1 A;  3PZ4 A;  3Q79 A;  3PZ3 A;  3HXC A;  2H6G A;  4LNB A;  4GTR A;  4GTS A;  4LNG A;  2F0Y A;  3DSV A;  3Q7A A;  1QBQ A;  3DSX A;  1N9A A;  1O1T A;  1TN8 A;  3EU5 A;  4GTV A;  1TNB A;  3Q73 A;  3E33 A;  4YDO A;  3DST A;  4EHM A;  3C72 A;  3EUV A;  3HXB A;  2IEJ A;  3DSS A;  1TN6 A;  3Q75 A;  2ZIS A;  1TNZ A;  1TNY A;  1JCQ A;  2H6I A;  1O1R A;  4YDE A;  1LD8 A;  1FT2 A;  3Q78 A;  3HXE A; 
#chains in the Genus database with same CATH topology
 3E37 A;  5ARF A;  4TUM A;  4TRQ A;  1W3B A;  4G2V A;  5BXU A;  1UN8 A;  3SI5 A;  4O6F A;  5ENT D;  4KYO B;  1H6O A;  5C1D A;  4OVV A;  4J7W A;  4U63 A;  3RU0 A;  4HOT A;  3MV2 B;  3VLD A;  4B8A A;  1VDY A;  3FUH A;  2XGM A;  4GA1 A;  4MBG A;  4BT8 A;  4BX8 A;  1YA0 A;  2E0I A;  4RQI A;  2WXK A;  4ANU A;  3SGH A;  3RJV A;  1BPO A;  1OWP A;  2GW1 A;  3QOU A;  4E85 A;  1FVH A;  3I3N A;  3MYV A;  3W9G A;  3B13 A;  3TJP A;  3PVL A;  2XGS A;  1Z6T A;  3PZ3 A;  3GW4 A;  4G26 A;  1X5B A;  5EIL A;  4AY6 A;  4DI4 A;  2VGX A;  4MRU A;  4AJW A;  3KEZ A;  4B89 A;  2F8X K;  3LY7 A;  4HOU A;  2QFC A;  1E8W A;  3SHF A;  1K3Z D;  4I6J A;  2I1K A;  3ZKJ A;  5HS0 A;  2IEJ A;  1MYO A;  1EF1 C;  4W9R A;  4BES A;  4U8V D;  4LER A;  3S7B A;  1HZ4 A;  3SY2 A;  2NYJ A;  4U07 A;  2WMO A;  1N4S A;  4CT4 A;  5CRU A;  4DX1 A;  2WXR A;  2WXN A;  4GTO A;  4DRX E;  3PZ1 A;  1HX8 A;  2NSZ A;  4PUC A;  3E34 A;  1N94 A;  4G25 A;  2AXU A;  3T9K A;  3LVQ E;  4K5C A;  2VGX B;  1AWC B;  3X2Q E;  1EYH A;  3SFZ A;  3CVL A;  3HRA A;  3ZYM A;  4DJA A;  1MZC A;  5A7D B;  3G2U A;  4UQZ A;  1EPU A;  3NBN B;  3G2W A;  1K1B A;  3TWX A;  3MKR A;  4ATZ D;  1UN9 A;  3DRA A;  1NI1 A;  1HF8 A;  1OCR E;  1MHQ A;  2PL2 A;  2J49 A;  2QC9 A;  3CV0 A;  3T8M A;  4LNG A;  4U96 D;  2XPY A;  4PH4 B;  3HYM B;  3CK7 A;  1BI7 B;  3WXX A;  1OWN A;  1H6K A;  3N71 A;  4I17 A;  5AJL A;  3ZU7 B;  2L0I A;  2UY1 B;  2KM4 A;  3Q47 B;  4ACL A;  1MX2 A;  4HRN A;  5ENP D;  1MQS A;  4K03 A;  3ZYQ A;  5FQ8 A;  2MRI A;  4Q69 A;  2R2L A;  2KBX A;  4DLQ A;  3CVU A;  5CCL A;  1DVP A;  3ZXP A;  4HOQ A;  3AU5 A;  3ZNG A;  2AJA A;  1BD8 A;  3PUJ A;  3BG0 B;  2ZIR A;  3QWP A;  1KPS B;  3SZ7 A;  4AP2 A;  4HOS A;  1P5Q A;  2VTB A;  1RZ4 A;  4K5A B;  2AVP A;  4LEU A;  3RK6 A;  2XS1 A;  5HRY A;  1D8D A;  4I43 A;  3Q7F A;  3MGB A;  2QZA A;  4L2Y A;  3PZ2 A;  3UT4 A;  2B0O E;  4WND A;  1Y6I A;  1OWM A;  3B7S A;  2WMN A;  2LNI A;  3EIJ A;  2IO3 C;  2Y69 E;  2KAT A;  4EZL A;  2R59 A;  4UWF A;  3AG1 E;  4J8S A;  3CQC B;  2P9S G;  1N9A A;  1E7V A;  3G2V A;  2OVF A;  4JXT A;  3ULY A;  3FTZ A;  3D9O A;  3NF1 A;  3Q15 A;  4XE0 A;  1ELR A;  4U8H A;  1JWG A;  3C72 A;  4Z68 A;  1L5J A;  4U95 D;  3G2S A;  2R03 A;  3PS6 A;  2Y3A A;  5EX0 A;  4J0U A;  1ZU2 A;  4YDW A;  5AAR A;  3HXE A;  3B7B A;  2ZGG A;  3ZYK A;  1HXI A;  2MHK A;  3EHN A;  1K8K G;  4HLL A;  1OY3 D;  3ASD A;  2V8S E;  2J4B A;  5CMW A;  1U2V G;  1IQU A;  4Q96 A;  4DX2 A;  3TGO A;  4EBA G;  4HI9 A;  4BY6 A;  4K5B A;  4DLO A;  4EPZ A;  4ZFH A;  5KJM A;  2R17 C;  5IY5 E;  4G1T A;  3E4B A;  1NA0 A;  4JHK A;  2OVB A;  1PAQ A;  3FH7 A;  3CHR A;  2H6H A;  2ZXW E;  4ZHB A;  3L13 A;  3AS8 A;  2HYZ A;  1IYG A;  4UI9 J;  3V79 K;  4CDM A;  4JA9 A;  4APO A;  2AXZ A;  3AU4 A;  3I5P A;  1EDU A;  2V5Q C;  1UJJ A;  3FUN A;  2H6G A;  4F7A A;  4I2W A;  1HG5 A;  3B7U X;  4J6I A;  4PS3 A;  2L0T B;  1QNF A;  4LG6 A;  4HXI A;  3NZU A;  2AWI A;  4XI9 A;  4CYM D;  4Y6C A;  4P29 A;  4F6R D;  3HXB A;  2F8Y A;  3FTW A;  2J8S D;  3AAA C;  4KVM A;  2X6F A;  3AG3 E;  2FI7 A;  3CVY A;  3RIB A;  2RG8 A;  3QWW A;  2FO7 A;  1SVX A;  3DSW A;  5ENS D;  1Y8M A;  3FU6 A;  2NC9 A;  4ILI A;  3KSQ A;  5CEA A;  1WY6 A;  4XZ4 A;  2VGE A;  2VSX E;  3SBS A;  1MX6 A;  3V2O A;  1BU9 A;  1N4Q A;  3FH5 A;  3ZN3 A;  1UW4 B;  2XEE A;  3MJW A;  5KJL A;  1OXJ A;  2KCV A;  3TWT A;  1E8Z A;  3ZRH A;  2L9B A;  3FY4 A;  3L17 A;  3E32 A;  3UM1 A;  4O1O A;  2WXO A;  4KVO A;  4B93 B;  2DWZ A;  5AQ7 A;  3SF4 A;  5BPP A;  2X6I A;  4GTS A;  4AY5 A;  4WWP A;  5EN5 D;  3CKB A;  2WQH A;  3IV0 A;  3UUX A;  4BT9 A;  5LFA A;  2HM8 A;  4HB5 A;  3ABM E;  4PS7 A;  4A3T A;  4B0Z A;  2R5S A;  5FQ6 A;  2C0L A;  3FHE A;  3FTS A;  2JAB A;  2EQX A;  3FUM A;  2EIM E;  3UM0 A;  2WXF A;  4I2Z A;  2PQR A;  4AEZ C;  2IJG X;  2KZT B;  3VTY A;  4EBA A;  1PY1 A;  2B6C A;  2DYS E;  4MKT A;  4UI9 C;  2ION A;  3U3W A;  1H2T C;  1G3N B;  4LCT A;  3E30 A;  4EQF A;  1D8E A;  3EHQ A;  1SA4 A;  4D10 C;  4WWO A;  2Y4U A;  2ZU6 B;  3JCK C;  3JQ0 A;  2PQN A;  3Q4A B;  3DEP A;  3KD7 A;  2LSU A;  2WB2 A;  4CZ2 D;  1TNO A;  2FF4 A;  2CHZ A;  3KS2 A;  3KEA A;  4GU5 A;  3DSU A;  4N3B A;  4FA6 A;  3KSL A;  4DX5 D;  5J90 A;  3ONL A;  2E2E A;  2X3M A;  1K1A A;  4JEU A;  5C2Y A;  2LAI A;  1WAO 1;  3ZVV A;  2X6K A;  3RAU A;  3Q7A A;  3V31 A;  1V55 E;  1N52 A;  1XNF A;  4J8D A;  2ILR A;  3IEG A;  3T5X A;  2KCL A;  4BFR A;  4GTV A;  3BU8 A;  2FBN A;  2VQ2 A;  2I6H A;  3KAE A;  5HQ8 A;  4AM9 A;  5CED B;  4DPR A;  4YDE A;  3TXM A;  4A1S A;  5T4Y A;  3Q78 A;  2XZD G;  4CCA A;  2WPV A;  3R9M A;  4R7L A;  3ABK E;  1ZB1 A;  3CVV A;  1KZP A;  5EYP F;  3PH0 C;  1HH8 A;  4PS8 A;  3HHM A;  1SA5 A;  1Q2Z A;  1KZO A;  1LTX A;  3ZGQ A;  3DXK G;  4FHK A;  2A4Z A;  4O1P A;  3D9N A;  3FTX A;  1QQE A;  1SW6 A;  4HI8 A;  2XEV A;  4BEP A;  1IQR A;  1JCS A;  2GRP B;  5BXO A;  4G24 A;  3HG0 D;  3O48 A;  3CHO A;  3HVE A;  3OTN A;  3QAR A;  4XIF A;  2P2C P;  3Q79 A;  3L6A A;  3NB2 A;  4XKB A;  1TJC A;  1LF8 A;  3HDX A;  3DPD A;  2WQ6 A;  4HRL A;  2C0M A;  1NZN A;  4BTB A;  4AXH A;  4CEM A;  2JEK A;  1N0R A;  2FEZ A;  5D2M C;  3JUE A;  2VYI A;  5DBK A;  2IO2 C;  3QDN A;  4YVQ C;  5CHE E;  3TWS A;  4EHM A;  2J9Q A;  4EZJ A;  2MYO A;  4GA0 A;  4FU3 A;  4DX7 D;  3CVQ A;  1TNZ A;  1TNY A;  3UQ3 A;  4G8K A;  4QFV A;  4J8Y A;  4MLP A;  1V54 E;  3B7T A;  5JJ6 A;  2WXJ A;  3CR3 A;  5FQ7 A;  3ULE G;  4A3V A;  4N3C A;  1YYH A;  3L9T A;  2MOW A;  2J4D A;  3U66 A;  4H7X A;  3OXG A;  4JVS A;  1TEZ A;  2WM9 A;  4I1M A;  3FU5 A;  1N4R A;  2DVW A;  3DBS A;  4ATG A;  5FZS A;  1X81 A;  3G2T A;  3LJ3 A;  4O60 A;  3C5R A;  2A5E A;  3GYZ A;  4V3I A;  3PNT B;  4J8E A;  3FUI A;  2GRR B;  5M72 A;  2DIW A;  3JXJ A;  5J08 A;  2KXP C;  2OEV A;  4TV3 A;  4GZ5 A;  4XI0 A;  4FAD A;  4IRU A;  2PM7 A;  4B8C B;  5E76 A;  4AIF A;  3CQG B;  5CBN A;  1WDY A;  3L22 A;  3CHM A;  1FVF A;  2OOE A;  3S2A A;  1U3C A;  3PNL B;  4B94 A;  4OVU A;  3SQV A;  3NQP A;  5EYL A;  4FUL A;  3UT8 A;  1TNB A;  3CLJ A;  2BKG A;  5AJD A;  3TG5 A;  2WXG A;  3DST A;  4DK5 A;  1DC2 A;  3ASF A;  3MKQ A;  5AIJ A;  1XGW A;  3EHM A;  3Q75 A;  4BET A;  2P58 C;  4A55 A;  2XPZ A;  3TWQ A;  5B1B E;  4HVB A;  1SZ9 A;  3PEU B;  3R9A B;  4GZ3 A;  3CVX A;  3QC1 A;  4WNG A;  2ZGD A;  3C3R A;  3D9J A;  3NAW A;  2WVI A;  3ZW3 A;  2VTB B;  3L08 A;  3FUJ A;  4YDY A;  2YQ8 A;  1A17 A;  4BER A;  5JMN D;  2IQC A;  3TWV A;  2XS8 A;  1S63 A;  5BT1 A;  4NAC A;  1DNP A;  3LCA A;  2DZN A;  4UI9 K;  2H6F A;  4JHR A;  2OCC E;  1IHG A;  4NIK A;  3FU3 A;  3C98 A;  2XPI A;  3RO3 A;  3UT7 A;  2WXQ A;  5CRV A;  3UM3 A;  5KWD A;  3Q9U C;  1N4P A;  3CST A;  4EEC A;  1S64 A;  2PZI A;  2KC7 A;  2Y4T A;  4WWN A;  2PNN A;  3BUA A;  4I1O B;  3TWU A;  2OEW A;  5CBO A;  4QQI A;  5B3S E;  4LNB A;  1SZA A;  3PE4 A;  1HFA A;  4IUL A;  3I4G A;  5LCW J;  2YIN A;  4TXQ A;  4HS2 A;  3MEK A;  4F3V A;  4G8L A;  5A6C A;  4BX9 A;  1ELW A;  3PUK A;  2P9I G;  5CEC B;  2PM6 A;  2RD0 A;  5KBA A;  1TN6 A;  1H6P A;  4U0Z A;  3GZ2 A;  5CCM A;  2HR2 A;  2I1J A;  2CFZ A;  3LY8 A;  3APF A;  1OCO E;  4CGV A;  1FPP A;  4GTT A;  4WNF A;  4NQ0 A;  2AXV A;  2J08 A;  4JA7 A;  5FZR A;  3EU9 A;  5G55 A;  3U64 A;  4X8Q A;  3EHR A;  1U3D A;  3CHP A;  2DCP A;  1BLX B;  1D9S A;  3UTM A;  4ANX A;  3FFL A;  4TXP A;  2P9N G;  4U7E B;  4E6H A;  4F1S A;  1NP7 A;  1TJF A;  1A5E A;  3JXI A;  3S7J A;  4FJY A;  3ULQ A;  3JUI A;  3ZHE A;  3AG2 E;  3L54 A;  3RRM B;  3PZD A;  4XX5 A;  4GCO A;  3IHY A;  4DUI A;  2WXH A;  5JJT A;  3CKC A;  3QKY A;  5KNG A;  3ASH A;  2QY7 A;  1UJK A;  5JJ7 A;  4RVB A;  3RRN B;  1OUV A;  4C0E A;  3EU5 A;  4H7Y A;  4F1P A;  5LX8 A;  4XEI G;  2J07 A;  3D9L A;  3Q73 A;  2P9P G;  3CVN A;  3U4T A;  1H2V C;  4JD2 G;  3FH8 A;  3CEQ A;  3ZPJ A;  1QYM A;  4JZY A;  2I9C A;  5CER B;  2Y0B G;  3LJN A;  2V4L A;  1FT2 A;  3ASN E;  3ENE A;  1GW6 A;  2CHX A;  2RKK A;  3IKO B;  2R02 A;  3ZHE B;  5AQB A;  4APF A;  4GZD A;  4L9P A;  3FDH A;  5AAO A;  3HXF A;  5AEN A;  2Q7F A;  3MX3 A;  1PC2 A;  3APD A;  2CFU A;  4J8F A;  3HXD A;  4AVX A;  2RFM A;  3UI2 A;  5LCW C;  1TYQ G;  5CMY A;  5HKP A;  3UIO C;  2P9U G;  5BW8 C;  4U04 A;  3DXM G;  3MV3 B;  2ETA A;  2VGY A;  5B1A E;  1AP7 A;  4KXK B;  4UWG A;  4GML A;  4ILG A;  1Z3Y A;  5ANR A;  1OT8 A;  1UOH A;  4UQY A;  2IFU A;  2Y1L E;  4GMJ A;  3QWV A;  1SQM A;  3QB2 A;  2EIN E;  3HXC A;  2LO6 A;  3ZIM A;  1H19 A;  4GTR A;  5FQ4 A;  2ETC A;  3DSV A;  1TN8 A;  3FWV A;  3ML8 A;  4GYY A;  3UIP C;  4PDX A;  2FO1 E;  4KZ0 A;  3P1U A;  3L16 A;  3CVW A;  2XRY A;  3MCX A;  3C3O A;  4M7C A;  3SNX A;  1KLX A;  1JCQ A;  4I6G A;  3R7Q A;  4Y6W A;  3RO2 A;  2R05 A;  4GZ6 A;  4HFG A;  2I2O A;  2YNQ A;  5KNH D;  3JQ1 A;  3VLE A;  4JHJ A;  5JA4 D;  3QAQ A;  3AG4 E;  3V2X A;  1YMP A;  2X6J A;  3CK9 A;  4GPK A;  5LP0 A;  2C2L A;  4UQX A;  1JWF A;  3ZXS A;  2BED A;  4JPS A;  2WXI A;  2EIL E;  5D0O D;  4UUC A;  2ETB A;  3PE3 A;  3ZFW A;  3LEW A;  3UX4 A;  3GZ1 A;  3URZ A;  4C0M A;  3IHV A;  3SFX A;  5FWQ A;  3CGH A;  3ZYL A;  3DPY A;  2VSO E;  1FT1 A;  5KJK A;  1BI8 B;  2IU1 A;  1N0Q A;  3ISM C;  3SFY A;  3BEE A;  4U0S A;  2IF4 A;  3GZS A;  2XCB A;  4GB9 A;  1HS6 A;  3MZL B;  4KMO A;  4WUY A;  5G05 J;  2FUL A;  1E8X A;  3QK0 A;  1B89 A;  3MA5 A;  2XZT G;  2JLB A;  1ELK A;  3ZUV B;  2QYJ A;  5EKQ D;  2YHE A;  3E33 A;  4AOF A;  2EIK E;  3PEV B;  4GPM A;  4N5C A;  1NA3 A;  4JL0 A;  1MJ0 A;  4IYP A;  5T8I A;  5EID A;  2LAH A;  4ILH B;  1MX4 A;  3DSS A;  3B95 A;  2V0P A;  2GRO B;  1Z5S C;  3Q9N C;  3FEX A;  2UY1 A;  1LD7 A;  2OV8 A;  3CK8 A;  5KCM A;  3FTU A;  3AS5 A;  3UKR G;  1E8Y A;  2YHC A;  2GRQ B;  3LPZ A;  5FTP A;  3FEY A;  1NFI E;  3J5P A;  3PRZ A;  4GAA A;  3D9P A;  4I9C A;  5H7P A;  3VLF A;  4YND A;  3DWL G;  5G04 J;  1JPL A;  3FUK A;  4RSY A;  2QYU A;  3HVE B;  1N95 A;  5FZQ A;  2L6J A;  3DEO A;  1IHB A;  2LXM A;  3LKU A;  3L82 A;  4LNU D;  4K0R A;  4GTM A;  3SD5 A;  1OCZ E;  1NL4 A;  3LYA A;  4BTA A;  1TNU A;  1DCE A;  2LSV A;  3ML9 A;  2WXP A;  4FLB A;  5G2N A;  1N54 A;  3FU0 A;  4C9B B;  3S7F A;  4JC8 A;  3QNK A;  4I9E A;  3WG7 E;  3C3Q A;  3K9I A;  4WAF A;  4HNA D;  2A5U A;  5FJY A;  2XCC A;  2CG2 A;  4YVO A;  4YDO A;  1TR4 A;  3ESL A;  4IN3 B;  3D9I A;  3APC A;  2XEN A;  4JW1 A;  4CGW A;  2HE0 A;  3D9H A;  4JB8 P;  1H0A A;  1OCC E;  1S70 B;  1E7U A;  2P9L G;  3ABL E;  3V30 A;  4URK A;  2GRN B;  4A1G A;  3NOC D;  2BKK B;  4RLY A;  2VJ8 A;  5BV1 A;  2WXL A;  3FUF A;  3EIQ C;  3OAW A;  4GCN A;  2UWJ G;  2BTD A;  4U8Y D;  1HU3 A;  5G05 C;  3JYS A;  3ONK A;  3OXF A;  4CDR A;  4OAV B;  3UIN C;  2GRM A;  3BQO A;  1FCH A;  2VSN A;  5ARG A;  4Q94 A;  4GTP A;  4UWH A;  2WXM A;  1ZBP A;  2V5F A;  5AN8 A;  5AQ9 A;  4GTQ A;  3UPV A;  3D9M A;  4BSX A;  5ENN A;  3S7D A;  3UMV A;  2J09 A;  1JUQ A;  4G23 A;  2KCK A;  2M63 A;  1KT1 A;  2BUG A;  3PRE A;  5JHB A;  3TL5 A;  3AJI A;  3R7R A;  3J5Q B;  4KZC A;  3DSX A;  3ESK A;  1O1T A;  4ABN A;  2BF0 X;  5ENR D;  4ANW A;  3MKQ B;  4CT0 A;  1WM5 A;  3B7R L;  3SBT B;  1N11 A;  4F53 A;  4GYO A;  3TXN A;  3RKV A;  2F37 A;  3LDZ A;  3TWW A;  4FHJ A;  3EUV A;  5DIZ A;  3OXL A;  1HO8 A;  5G04 C;  2WQ7 A;  4L23 A;  5A23 A;  5BUZ A;  4G11 A;  2DYR E;  4GYW A;  4ME2 A;  5EDS A;  1RW2 A;  5KJN A;  4KBQ A;  2GGF A;  4M3O A;  2DBA A;  3BG1 B;  4BWR A;  3LVR E;  5ANL A;  5BV0 A;  2X38 A;  5D66 A;  3IBE A;  2IY0 C;  1O1S A;  1JCR A;  3FTV A;  3CHS A;  3VTX A;  2P9K G;  1DCQ A;  4CDN A;  4HQD A;  5FIO A;  5AQA A;  1TN7 A;  4U0U A;  4N2S A;  5ENO D;  3RSE G;  3P2B A;  4NRH B;  3EDT B;  5ITZ F;  4GA2 A;  1O5M A;  3UXG A;  3PDN A;  4N2Q A;  2XEH A;  2X6H A;  4FLH A;  3IXE A;  4N5Q A;  3I4R B;  2V4H C;  4EZK A;  3CSF A;  3ZEF A;  5AYW D;  4DX6 D;  3PZ4 A;  4JEH A;  4AV7 A;  4LUN U;  2VSY A;  4LSZ E;  3LXU X;  2HO1 A;  4GMR A;  4N39 A;  2F0Y A;  3LS8 A;  1QBQ A;  3AS4 A;  4DI3 A;  1Z3X A;  2OND A;  5FIN A;  4KT6 B;  2LUH A;  4FP7 A;  2AW6 A;  3TAX A;  3F6Q A;  1INZ A;  4RG9 A;  1IKN D;  3TG4 A;  3LY9 A;  4UWK A;  2H6I A;  4RG6 A;  5D0Q D;  1OWL A;  3O4Z A;  4TXR A;  2NXP A;  4HLE A;  4WNE A;  2EIJ E;  4L1B A;  3T8K A;  4OAU C;  3QJZ A;  3CHQ A;  1S0P A;  3UKU G;  4A63 B;  4N3A A;  5E75 A;  1H2U A;  3HIZ A;  4ANV A;  3Q5M A;  2KZT A;  3FUL A;  3FP3 A;  3D9K A;  1KT0 A;  4UWL A;  4TUU A;  1UG3 A;  4ACK A;  1OWO A;  2IOL A;  2GRL A;  4I1A A;  4XKC A;  2XQ0 A;  4FC8 A;  1E96 B;  4OYS A;  5JHA A;  3D3M A;  4HRM B;  5EX3 A;  4HBD A;  2LXL A;  3NZS A;  3TWR A;  2DZO A;  2IOS A;  4C48 B;  3W9F A;  3FUD A;  3T5V A;  5BNW A;  3CIA A;  1HG2 A;  4I6E A;  2XHE A;  3Q49 B;  4GZC A;  4L2L A;  1YCS B;  4MS6 A;  4LRZ A;  5LOZ A;  2XGO A;  3UM2 A;  3FUE A;  3ASO E;  2XRZ A;  1HE8 A;  4HOR A;  2CHW A;  1IXV A;  4L7T A;  3FTY A;  4FJZ A;  3NOG D;  2CG3 A;  4CRW A;  5ENQ D;  3CVP A;  3ASG A;  1E90 A;  4BSZ B;  3SO8 A;  2L6B A;  3U9W A;  2RFA A;  3RRU A;  5T3R A;  1WG0 A;  5FT9 A;  2ZIS A;  5HI7 A;  1QZ2 A;  4NUR A;  1O1R A;  3EJN A;  1LD8 A;  5EIB E; 
#chains in the Genus database with same CATH homology
 3E37 A;  1N4S A;  2R2L A;  1LD7 A;  3DSW A;  4L9P A;  4GTO A;  1KZP A;  1FPP A;  4GTT A;  3PZ1 A;  3E30 A;  3HXF A;  1D8E A;  1SA4 A;  3KSQ A;  2BED A;  2ZIR A;  1O1S A;  1JCR A;  3E34 A;  1SA5 A;  1KZO A;  1LTX A;  1S63 A;  1N94 A;  3HXD A;  1N4R A;  1N4Q A;  1X81 A;  1TN7 A;  2H6F A;  3SFX A;  1TNO A;  3DPY A;  4GTP A;  1N95 A;  1MZC A;  4MBG A;  1FT1 A;  1JCS A;  3DSU A;  1D8D A;  3KSL A;  2H6H A;  1O5M A;  3Q7F A;  3PZ2 A;  3SFY A;  4GTM A;  1NL4 A;  4GTQ A;  1N4P A;  3DRA A;  1TNU A;  3E32 A;  1DCE A;  1S64 A;  1NI1 A;  3PZ4 A;  3Q79 A;  3PZ3 A;  3HXC A;  2H6G A;  4LNB A;  4GTR A;  4GTS A;  4LNG A;  2F0Y A;  3DSV A;  3Q7A A;  1QBQ A;  3DSX A;  1N9A A;  1O1T A;  1TN8 A;  3EU5 A;  4GTV A;  1TNB A;  3Q73 A;  3E33 A;  4YDO A;  3DST A;  4EHM A;  3C72 A;  3EUV A;  3HXB A;  2IEJ A;  3DSS A;  1TN6 A;  3Q75 A;  2ZIS A;  1TNZ A;  1TNY A;  1JCQ A;  2H6I A;  1O1R A;  4YDE A;  1LD8 A;  1FT2 A;  3Q78 A;  3HXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...