4GTQA

Ftase in complex with bms analogue 12
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
315
structure length
315
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Development of Selective, Potent RabGGTase Inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type-1
total genus 122
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 4gtqA00
4L9PA 4GTQA 4GTTA 1N4PA 3Q79A 3Q75A 3HXBA 1X81A 3Q7FA 2BEDA 1D8EA 4GTPA 3E37A 1N9AA 1LTXA 1QBQA 1TNZA 3C72A 1N94A 1FPPA 1LD7A 2ZISA 3EUVA 1O5MA 1D8DA 2R2LA 1KZOA 1N4RA 1N4SA 1DCEA 3E34A 1TN7A 3E32A 3E30A 1NL4A 1FT1A 3HXDA 1S64A 1N4QA 1TN6A 3KSQA 1TNYA 3PZ3A 3DSUA 1N95A 3E33A 3DSXA 2ZIRA 1FT2A 1SA5A 4LNBA 1JCQA 4YDEA 2IEJA 3PZ1A 1TNBA 3Q73A 3HXCA 4MBGA 1KZPA 3SFXA 4GTMA 1O1RA 3DSSA 3PZ2A 4LNGA 3HXFA 3DRAA 3HXEA 2H6GA 1O1TA 1S63A 3EU5A 1NI1A 3PZ4A 1SA4A 2F0YA 3DSWA 1TN8A 4EHMA 4YDOA 3Q78A 1JCRA 3DSTA 3SFYA 1LD8A 3Q7AA 2H6HA 1TNUA 4GTVA 4GTOA 1TNOA 1O1SA 1JCSA 2H6FA 4GTRA 3KSLA 2H6IA 4GTSA 3DSVA 1MZCA 3DPYA
chains in the Genus database with same CATH superfamily
4GTQA 4A55A 3T5VA 2XS8A 5KJKA 1BI8B 3L6AA 3UMVA 3ZU7B 3Q49B 3AG3E 2QYUA 2LNIA 3R7QA 5EX0A 1MX4A 5G05J 4TRQA 1SZAA 4DX1A 2BKGA 5IY5E 2GRQB 4N5CA 2IQCA 2YHCA 4JW1A 3FDHA 5ARFA 2WXFA 1QYMA 3FUNA 4DX7D 1IXVA 4MRUA 4F6RD 2AJAA 1NL4A 1U3DA 2ZGDA 1HE8A 5JA4D 4BTBA 4AP2A 3FTVA 2Y3AA 1IHBA 4GYOA 4Y6CA 3CKBA 3LYAA 5AN8A 4UQXA 1MX2A 4O6FA 4Q69A 4HQDA 2ZGGA 4LNGA 4UI9K 5EX3A 2V4HC 4DX2A 4EZKA 4X8QA 3PZDA 1OT8A 4LG6A 2OCCE 3UQ3A 4DJAA 2I9CA 4IULA 3AS4A 4A3VA 3UT8A 3SFYA 4HS2A 3BG1B 2CHWA 4IN3B 4HRLA 4N39A 1TNUA 2XCCA 4ME2A 4EBAA 4BSXA 3KSLA 2A5UA 2H6IA 3RK6A 2X3MA 3I3NA 4FA6A 2XHEA 5C2YA 3CVUA 3MA5A 2VSYA 3FU0A 4BETA 5KJMA 4JA7A 4WNDA 3CHRA 4UWHA 2XPZA 5AENA 4KT6B 3SGHA 3ZHEB 3GYZA 2KZTA 3CVLA 2CG3A 4N2QA 3E32A 2P9PG 1H2UA 2WXKA 3CHQA 4G24A 5ENTD 2KZTB 3KSQA 2C2LA 4UWGA 1UJKA 4TUMA 4ANWA 4LUNU 3ZGQA 4RVBA 3R7RA 4LNBA 5HQ8A 3ENEA 3HDXA 3MV2B 3C5RA 3AG4E 3L17A 2CHXA 3ULQA 4GPKA 4CT0A 4HI9A 3IBEA 1P5QA 1G3NB 4U0SA 3TWXA 5JMND 4GAAA 4G8KA 4GA2A 5B1AE 5ITZF 5CRUA 4G2VA 5D2MC 3QJZA 3V79K 3PVLA 5CERB 2MRIA 3B7TA 3WG7E 4XI0A 5EIDA 4JC8A 4FHJA 1PAQA 4U96D 4DUIA 2MYOA 2MOWA 3U9WA 4BY6A 3DSVA 2WMNA 2Y4TA 4LSZE 3Q75A 4JEHA 3HXBA 3MKQA 5JJTA 4KBQA 4K0RA 1BD8A 2ETCA 2OEVA 3ABME 4O1OA 1QBQA 3TWVA 3UI2A 3RRMB 2IOSA 3RU0A 5LP0A 3EHQA 4ACKA 4RQIA 3EHMA 2XGMA 2F37A 1JWFA 4ILHB 2NC9A 2J4DA 5AQ9A 1E96B 2C0LA 1K1AA 2PQRA 3UT4A 1N52A 4JPSA 4TXRA 3CVQA 4G25A 3URZA 2WXQA 4OVUA 4JXTA 2RKKA 2QC9A 3RO2A 3EU5A 1SA4A 1N11A 5D0QD 4K5BA 3CVYA 1OY3D 1JPLA 5BUZA 5EIBE 3LPZA 3ZEFA 4C48B 1EYHA 4L23A 4XIFA 3NQPA 4CYMD 2P9LG 4QFVA 2WM9A 2YHEA 3CGHA 3ZYMA 4B8CB 3QK0A 3V2OA 4CGVA 2DZOA 2WVIA 3C98A 4L9PA 4F3VA 3FTWA 3JYSA 3AS5A 4XKBA 4GA0A 5KNHD 4G23A 3KS2A 2FBNA 1N0QA 5AARA 4GMJA 1TNZA 1TJFA 4PH4B 2X6IA 3CEQA 3KD7A 5T3RA 3S7JA 2F8YA 2R59A 3ASDA 1DCQA 3G2SA 2KBXA 5LX8A 2WQ7A 2GGFA 3AG2E 2J8SD 4XZ4A 5J08A 4GYYA 2LAHA 4U8HA 2VSXE 3UM0A 3RIBA 4HOSA 1OCCE 2VTBB 5FJYA 4CGWA 5ENOD 4LCTA 1H6KA 2EIKE 4ZFHA 3AG1E 5FQ4A 5ARGA 1E7VA 4XI9A 3R9AB 3U64A 3ZIMA 3U66A 5D66A 5J90A 4WNGA 3PEVB 4F1PA 2XRZA 4J6IA 3RAUA 3T8KA 2H6HA 4O60A 5ENRD 3NOCD 3CVNA 4O1PA 1TNOA 1IQUA 3IXEA 4L2LA 4GTRA 3ISMC 4BESA 4JHJA 3HVEA 2YQ8A 1TYQG 2HO1A 2RD0A 3ZNGA 1TEZA 1NFIE 2P9NG 3DXKG 3ZVVA 4MKTA 4WUYA 3CK7A 3FFLA 5B1BE 1QQEA 4I17A 3FUDA 2IO2C 5C1DA 1NA0A 3D9MA 1E8WA 2V5QC 3ML9A 4G1TA 3CV0A 3IEGA 3DSXA 3ESLA 2BKKB 2ZIRA 4YNDA 4EQFA 1KLXA 2KCVA 2WXGA 4UWKA 3LY8A 3U4TA 4EBAG 2CFZA 5D0OD 3CK8A 3B7SA 2F0YA 1XNFA 3QNKA 3HVEB 2PM7A 1TN8A 5CCLA 4DK5A 3NF1A 4ANXA 3HG0D 1JCRA 5T8IA 2PL2A 4N3AA 3F6QA 2EQXA 1W3BA 2AXVA 1HF8A 3CQCB 3EHRA 1KT0A 2H6FA 3L08A 3EJNA 4GTTA 2YNQA 1IQRA 1X81A 2Y4UA 3PNLB 2E0IA 3E37A 3D9OA 4UQYA 5DIZA 4BFRA 4HORA 4I2WA 1H6OA 3LY9A 2R05A 3AU4A 2KATA 5CMYA 3CLJA 3IHVA 2DWZA 4U95D 2VSNA 1YA0A 1N4QA 2Q7FA 3KEZA 3UKRG 4AM9A 5M72A 2VSOE 4V3IA 3G2WA 1SA5A 4KXKB 4G8LA 2OVFA 4PS8A 3UKUG 1SW6A 2IEJA 3LJNA 2IY0C 3SNXA 3Q73A 5FT9A 3PUKA 3Q9NC 5ANRA 2GRMA 4GMRA 4U8YD 4LNUD 1HZ4A 4GZDA 2OV8A 3ABLE 3TXNA 2VYIA 3FTXA 2XENA 1S70B 3LVRE 3CSFA 3LCAA 5AIJA 4CDRA 4B0ZA 3LY7A 3Q78A 3E4BA 2XRYA 4FP7A 4N3CA 5G2NA 5AQAA 2A4ZA 2QY7A 2DIWA 4GZ6A 3FUJA 5HRYA 5ENNA 5JJ7A 3ZRHA 4AY5A 2WXNA 3RRNB 3G2TA 2P9UG 1E8YA 4GTPA 5FWQA 3VLFA 3B13A 3X2QE 4E6HA 2AXUA 2P58C 3C72A 3LVQE 1MJ0A 2VQ2A 4I9CA 5FZSA 3SBTB 3JUIA 3VLEA 4HI8A 3SZ7A 3LEWA 3OTNA 3ZFWA 4BWRA 3ZPJA 3V2XA 3DEOA 3FH5A 4Y6WA 3TJPA 4E85A 5EKQD 1FT1A 3WXXA 3ESKA 2A5EA 4AEZC 3S2AA 3MCXA 1DNPA 4M3OA 1QZ2A 2L6JA 1JUQA 4JL0A 2XEVA 3S7FA 1HO8A 4I1AA 4JB8P 4I1OB 1KZPA 2V8SE 3ONLA 3PZ2A 4HLEA 3RO3A 3DRAA 4UWLA 1S63A 3Q5MA 4OYSA 1UJJA 3TXMA 2LXLA 2EILE 2XPYA 3FULA 3QARA 1LD8A 2WXMA 3TGOA 3L16A 3TWQA 1HX8A 4J8SA 2KCLA 3LS8A 3D9IA 5CRVA 3P2BA 4U7EB 3PH0C 4JHKA 3CHMA 4U0UA 4AY6A 4WWPA 4ATGA 2FEZA 2LSUA 4DI4A 2X6KA 4PS3A 4UI9C 1HG5A 2IJGX 3RSEG 5EDSA 2X6JA 2R17C 4NURA 3Q15A 5AQBA 5G55A 2BF0X 1HU3A 3C3QA 2I1JA 4ZHBA 1K3ZD 2LO6A 3BEEA 3EIQC 5KNGA 2WPVA 3P1UA 5KJNA 1WG0A 4OVVA 4ANVA 2FO7A 5FINA 5HI7A 3EIJA 3L22A 5EILA 2XGOA 3HXEA 4EHMA 4NQ0A 3VTXA 1IKND 3DSTA 3BQOA 1Z3XA 2FI7A 2ZU6B 5AQ7A 3DWLG 4HVBA 3MKRA 4DPRA 4NIKA 5FIOA 1NZNA 5LFAA 2OVBA 4J8EA 4AVXA 2WXIA 4G11A 4CDMA 2WXLA 3C3RA 3DXMG 4EZJA 3PS6A 4AXHA 3PE4A 3SQVA 3FUEA 1D8EA 3I4RB 5BPPA 2V5FA 1LTXA 3MYVA 2XQ0A 3ASGA 3ZHEA 2P9IG 3CQGB 3ZN3A 2XZTG 4H7YA 4J0UA 2XCBA 1Y8MA 1JWGA 3QWPA 1OCRE 1H6PA 4EPZA 4GZ3A 2ONDA 4U0ZA 4C0EA 4KVMA 4K5AB 3JXJA 1UW4B 3LKUA 2FF4A 5FTPA 1INZA 3UIPC 3EHNA 4UUCA 3K9IA 4HOTA 3AJIA 2L0IA 3UM1A 2GRPB 4CT4A 3APDA 4U63A 4ILGA 3FP3A 3PZ4A 4G26A 2R03A 2PM6A 3B95A 5G05C 2C0MA 1SVXA 3NAWA 3QWWA 1N54A 3HHMA 4F53A 1LF8A 3T9KA 4HFGA 1L5JA 5JHBA 1OUVA 5G04J 2JLBA 5H7PA 3APCA 4AV7A 2VTBA 4I6GA 4B93B 4WAFA 4BERA 3ZYQA 5BW8C 2XZDG 5KCMA 3ASFA 4K5CA 4WNEA 5AJDA 5BXUA 5EYLA 4JD2G 3DEPA 3PE3A 3L54A 1NA3A 1MX6A 3SD5A 3C3OA 4N5QA 2ZISA 3EUVA 4DX5D 3S7DA 1N0RA 3R9MA 3OXFA 1DCEA 3UM3A 3DBSA 1Z3YA 3CK9A 3AS8A 1RW2A 3CHPA 4XE0A 2L0TB 4HXIA 4C0MA 5G04C 2PQNA 1O1RA 4TXPA 1A5EA 3HXFA 5FQ7A 2H6GA 4FADA 4I1MA 1S0PA 1IHGA 4TV3A 1YMPA 3B7RL 3IV0A 5BNWA 1UOHA 5FZQA 2VGEA 4D10C 3UPVA 5A7DB 3MKQB 3D3MA 3GZ2A 3CVXA 3T8MA 4BSZB 4I6JA 3JXIA 3Q4AB 3CR3A 4FJYA 1H19A 1QNFA 4BX9A 4HOUA 1UN9A 2GROB 4LRZA 1Q2ZA 3MV3B 4JA9A 1BLXB 4P29A 3NZSA 3OXLA 5AAOA 3BG0B 2ILRA 2VJ8A 2J07A 4OAVB 4FLHA 3SF4A 1N9AA 3UIOC 3NB2A 4RG6A 2OEWA 3J5PA 4OAUC 2ETBA 2FULA 3PRZA 4GZ5A 2R2LA 4I9EA 4AJWA 2IFUA 1N4RA 1N4SA 3E34A 2J09A 3E30A 3EDTB 3FH7A 2WQ6A 3ZUVB 4M7CA 3NOGD 2ETAA 2XGSA 4PUCA 3ZYLA 1OWLA 5ANLA 1OXJA 4IYPA 1FVHA 5KWDA 3FY4A 4DX6D 2PNNA 3RJVA 3HXCA 1EPUA 4MBGA 3CVPA 3FU5A 2L6BA 4KZ0A 3UX4A 4GTMA 4F7AA 1V55E 3DSSA 3V30A 1ZB1A 2KXPC 4XKCA 1H2VC 3JQ0A 1NI1A 1BI7B 4GMLA 2RG8A 4NACA 2Y69E 3L82A 4B89A 2DYSE 5ENSD 2EINE 5E76A 3NBNB 2CHZA 4FC8A 4FULA 3ZXPA 3U3WA 1E90A 1U2VG 4JZYA 4EZLA 3RKVA 3I5PA 2WXRA 3MEKA 1ELRA 3ZXSA 1MQSA 2VGXA 3AU5A 4FU3A 2RFMA 3HIZA 1JCSA 1UN8A 5HKPA 2BTDA 3RRUA 1K1BA 2P9SG 1WAO1 3ABKE 4HRMB 3SY2A 1MZCA 2WXPA 3QOUA 2PZIA 5T4YA 4GCNA 3UM2A 4GCOA 2DVWA 3L9TA 2BEDA 1WY6A 4CRWA 4L7TA 4F1SA 2GRRB 3MZLB 3Q47B 4NRHB 5CBNA 4J7WA 1TJCA 3N71A 1N94A 3GZSA 4YDYA 3D9PA 3SBSA 3EU9A 2AVPA 1Z6TA 4C9BB 2R02A 2KC7A 2UWJG 3VTYA 1TN7A 2RFAA 1DC2A 5CEAA 2I6HA 2GRLA 3MGBA 1S64A 1TN6A 3FH8A 2KCKA 4YVQC 2AXZA 5EN5D 3DSUA 1N95A 4L1BA 1A17A 1FT2A 4URKA 3ASOE 5E75A 3QKYA 4YDEA 2BUGA 4CEMA 4LERA 5LOZA 4UQZA 2VGXB 5KBAA 3UXGA 2HR2A 3B7BA 4DI3A 3PREA 1OCZE 4XEIG 3KAEA 2E2EA 1ELWA 1D9SA 1FVFA 4I6EA 4ANUA 1UG3A 4KVOA 4CDNA 3W9GA 3TWSA 3NZUA 3FUHA 5JJ6A 3ASNE 4N2SA 3FU3A 3CVWA 4KZCA 3PDNA 3OXGA 3SHFA 3W9FA 4DRXE 1N4PA 5CMWA 2IO3C 3DPDA 2LAIA 1KT1A 3AAAC 2WXJA 2Y0BG 4YDWA 3V31A 4FJZA 3I4GA 1NP7A 3ZW3A 4R7LA 4YVOA 3CIAA 5ENPD 3JCKC 1MHQA 5AJLA 3TWRA 5B3SE 2I2OA 3D9JA 1H2TC 4ILIA 4GB9A 3T5XA 3FTSA 1E7UA 4ABNA 4MLPA 4A63B 4GZCA 3UTMA 3FUMA 2DCPA 4HOQA 1EDUA 2EIME 3PZ3A 4AIFA 3E33A 5BXOA 2DYRE 2JABA 4MS6A 3PZ1A 1SQMA 3SFXA 3S7BA 4RLYA 2ZXWE 2P9KG 1E8ZA 2XPIA 2UY1B 4B94A 4LEUA 4J8DA 2X38A 4YDOA 4KYOB 3UINC 2M63A 2V4LA 5FQ8A 3FU6A 3D9NA 3FUKA 2LSVA 4JHRA 3ZKJA 4KMOA 2XS1A 2HM8A 3QB2A 3J5QB 4AOFA 4FHKA 3ZYKA 3Q7FA 1PC2A 3TL5A 1TR4A 2AWIA 4WWNA 1BU9A 4B8AA 2DBAA 4HLLA 4GYWA 3KEAA 1V54E 5BV0A 4K03A 1YCSB 5JHAA 3CKCA 1FPPA 1HS6A 1LD7A 4RSYA 1O5MA 5CEDB 4L2YA 3HYMB 3CHOA 3B7UX 1H0AA 1WM5A 3UUXA 4XX5A 2KM4A 4ACLA 1OWMA 2J9QA 1Z5SC 3PUJA 1VDYA 4I2ZA 3FUFA 3LDZA 1HH8A 1TNBA 1WDYA 4JVSA 3D9KA 2MHKA 3DSWA 3GW4A 2WXOA 5KJLA 3LJ3A 3D9HA 1AP7A 3G2UA 3G2VA 4EECA 2LUHA 1ZBPA 4RG9A 2IONA 2WMOA 3Q7AA 5FQ6A 3TWUA 2WB2A 3APFA 5A6CA 5AYWD 2L9BA 4W9RA 4TXQA 5CHEE 4QQIA 4GPMA 3CSTA 4GTSA 5CCMA 4TUUA 3DPYA 3IHYA 3VLDA 2WXHA 3Q79A 2CFUA 3MX3A 1OWPA 4A3TA 2QFCA 3JUEA 3QWVA 4BTAA 3UT7A 4Z68A 5LCWJ 4DLQA 3IKOB 5BV1A 2HYZA 2IF4A 3ULYA 2J49A 2FO1E 2P2CP 3SI5A 3OAWA 3CVVA 1MYOA 3D9LA 1KZOA 2B0OE 2QYJA 3FWVA 4GU5A 1HFAA 1ZU2A 2OOEA 1GW6A 2CG2A 5CECB 4HB5A 3ML8A 4BX8A 3HXDA 2Y1LE 1TNYA 5BT1A 3L13A 1PY1A 1OWNA 1JCQA 3LXUX 4HBDA 2XEHA 3Q9UC 1OWOA 4JEUA 1SZ9A 3HRAA 3JQ1A 2AW6A 1O1TA 3FEXA 3O48A 4U07A 2DZNA 3ONKA 3FUIA 3QDNA 2VGYA 4GA1A 4J8FA 2WQHA 4N3BA 3MJWA 2B6CA 3PEUB 2I1KA 4APFA 2XEEA 3O4ZA 3FTYA 4BT9A 1FCHA 1KPSB 4Q96A 4GTOA 2NSZA 3SFZA 1B89A 2GRNB 3PNTB 4J8YA 1BPOA 3FTUA 2R5SA 4BEPA 3SO8A 2GW1A 4H7XA 2V0PA 1E8XA 4A1GA 3ASHA 1IYGA 5ENQD 3GZ1A 4U04A 4APOA 1OCOE 3CHSA 1ELKA 1K8KG 4FLBA 5DBKA 2F8XK 2J4BA 3FTZA 2J08A 4UWFA 5HS0A 1D8DA 1EF1C 1Y6IA 2JEKA 1DVPA 2YINA 5EYPF 4WWOA 3FEYA 3TG4A 3TG5A 4PDXA 4IRUA 4ATZD 3TWTA 4PS7A 2HE0A 1RZ4A 3TAXA 1YYHA 4CCAA 3ULEG 3BUAA 4HRNA 3QC1A 4U8VD 4Q94A 5CBOA 4WNFA 3QAQA 4HNAD 2X6HA 4I43A 3FHEA 1U3CA 2NXPA 2IOLA 2EIJE 2NYJA 2X6FA 4BT8A 1AWCB 4A1SA 1XGWA 2LXMA 3TWWA 1HXIA 5A23A 4UI9J 5FZRA 1X5BA 1HG2A 4GTVA 2QZAA 1O1SA 3BU8A 2IU1A 5LCWC 2UY1A 4CZ2D 4DLOA
chains in the Genus database with same CATH topology
4L9PA 4GTQA 4GTTA 1N4PA 3Q79A 3Q75A 3HXBA 1X81A 3Q7FA 2BEDA 1D8EA 4GTPA 3E37A 1N9AA 1LTXA 1QBQA 1TNZA 3C72A 1N94A 1FPPA 1LD7A 2ZISA 3EUVA 1O5MA 1D8DA 2R2LA 1KZOA 1N4RA 1N4SA 1DCEA 3E34A 1TN7A 3E32A 3E30A 1NL4A 1FT1A 3HXDA 1S64A 1N4QA 1TN6A 3KSQA 1TNYA 3PZ3A 3DSUA 1N95A 3E33A 3DSXA 2ZIRA 1FT2A 1SA5A 4LNBA 1JCQA 4YDEA 2IEJA 3PZ1A 1TNBA 3Q73A 3HXCA 4MBGA 1KZPA 3SFXA 4GTMA 1O1RA 3DSSA 3PZ2A 4LNGA 3HXFA 3DRAA 3HXEA 2H6GA 1O1TA 1S63A 3EU5A 1NI1A 3PZ4A 1SA4A 2F0YA 3DSWA 1TN8A 4EHMA 4YDOA 3Q78A 1JCRA 3DSTA 3SFYA 1LD8A 3Q7AA 2H6HA 1TNUA 4GTVA 4GTOA 1TNOA 1O1SA 1JCSA 2H6FA 4GTRA 3KSLA 2H6IA 4GTSA 3DSVA 1MZCA 3DPYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L9P A;  4GTQ A;  4GTT A;  1N4P A;  3Q79 A;  3Q75 A;  3HXB A;  1X81 A;  3Q7F A;  2BED A;  1D8E A;  4GTP A;  3E37 A;  1N9A A;  1LTX A;  1QBQ A;  1TNZ A;  3C72 A;  1N94 A;  1FPP A;  1LD7 A;  2ZIS A;  3EUV A;  1O5M A;  1D8D A;  2R2L A;  1KZO A;  1N4R A;  1N4S A;  1DCE A;  3E34 A;  1TN7 A;  3E32 A;  3E30 A;  1NL4 A;  1FT1 A;  3HXD A;  1S64 A;  1N4Q A;  1TN6 A;  3KSQ A;  1TNY A;  3PZ3 A;  3DSU A;  1N95 A;  3E33 A;  3DSX A;  2ZIR A;  1FT2 A;  1SA5 A;  4LNB A;  1JCQ A;  4YDE A;  2IEJ A;  3PZ1 A;  1TNB A;  3Q73 A;  3HXC A;  4MBG A;  1KZP A;  3SFX A;  4GTM A;  1O1R A;  3DSS A;  3PZ2 A;  4LNG A;  3HXF A;  3DRA A;  3HXE A;  2H6G A;  1O1T A;  1S63 A;  3EU5 A;  1NI1 A;  3PZ4 A;  1SA4 A;  2F0Y A;  3DSW A;  1TN8 A;  4EHM A;  4YDO A;  3Q78 A;  1JCR A;  3DST A;  3SFY A;  1LD8 A;  3Q7A A;  2H6H A;  1TNU A;  4GTV A;  4GTO A;  1TNO A;  1O1S A;  1JCS A;  2H6F A;  4GTR A;  3KSL A;  2H6I A;  4GTS A;  3DSV A;  1MZC A;  3DPY A; 
#chains in the Genus database with same CATH topology
 4GTQ A;  4A55 A;  3T5V A;  2XS8 A;  5KJK A;  1BI8 B;  3L6A A;  3UMV A;  3ZU7 B;  3Q49 B;  3AG3 E;  2QYU A;  2LNI A;  3R7Q A;  5EX0 A;  1MX4 A;  5G05 J;  4TRQ A;  1SZA A;  4DX1 A;  2BKG A;  5IY5 E;  2GRQ B;  4N5C A;  2IQC A;  2YHC A;  4JW1 A;  3FDH A;  5ARF A;  2WXF A;  1QYM A;  3FUN A;  4DX7 D;  1IXV A;  4MRU A;  4F6R D;  2AJA A;  1NL4 A;  1U3D A;  2ZGD A;  1HE8 A;  5JA4 D;  4BTB A;  4AP2 A;  3FTV A;  2Y3A A;  1IHB A;  4GYO A;  4Y6C A;  3CKB A;  3LYA A;  5AN8 A;  4UQX A;  1MX2 A;  4O6F A;  4Q69 A;  4HQD A;  2ZGG A;  4LNG A;  4UI9 K;  5EX3 A;  2V4H C;  4DX2 A;  4EZK A;  4X8Q A;  3PZD A;  1OT8 A;  4LG6 A;  2OCC E;  3UQ3 A;  4DJA A;  2I9C A;  4IUL A;  3AS4 A;  4A3V A;  3UT8 A;  3SFY A;  4HS2 A;  3BG1 B;  2CHW A;  4IN3 B;  4HRL A;  4N39 A;  1TNU A;  2XCC A;  4ME2 A;  4EBA A;  4BSX A;  3KSL A;  2A5U A;  2H6I A;  3RK6 A;  2X3M A;  3I3N A;  4FA6 A;  2XHE A;  5C2Y A;  3CVU A;  3MA5 A;  2VSY A;  3FU0 A;  4BET A;  5KJM A;  4JA7 A;  4WND A;  3CHR A;  4UWH A;  2XPZ A;  5AEN A;  4KT6 B;  3SGH A;  3ZHE B;  3GYZ A;  2KZT A;  3CVL A;  2CG3 A;  4N2Q A;  3E32 A;  2P9P G;  1H2U A;  2WXK A;  3CHQ A;  4G24 A;  5ENT D;  2KZT B;  3KSQ A;  2C2L A;  4UWG A;  1UJK A;  4TUM A;  4ANW A;  4LUN U;  3ZGQ A;  4RVB A;  3R7R A;  4LNB A;  5HQ8 A;  3ENE A;  3HDX A;  3MV2 B;  3C5R A;  3AG4 E;  3L17 A;  2CHX A;  3ULQ A;  4GPK A;  4CT0 A;  4HI9 A;  3IBE A;  1P5Q A;  1G3N B;  4U0S A;  3TWX A;  5JMN D;  4GAA A;  4G8K A;  4GA2 A;  5B1A E;  5ITZ F;  5CRU A;  4G2V A;  5D2M C;  3QJZ A;  3V79 K;  3PVL A;  5CER B;  2MRI A;  3B7T A;  3WG7 E;  4XI0 A;  5EID A;  4JC8 A;  4FHJ A;  1PAQ A;  4U96 D;  4DUI A;  2MYO A;  2MOW A;  3U9W A;  4BY6 A;  3DSV A;  2WMN A;  2Y4T A;  4LSZ E;  3Q75 A;  4JEH A;  3HXB A;  3MKQ A;  5JJT A;  4KBQ A;  4K0R A;  1BD8 A;  2ETC A;  2OEV A;  3ABM E;  4O1O A;  1QBQ A;  3TWV A;  3UI2 A;  3RRM B;  2IOS A;  3RU0 A;  5LP0 A;  3EHQ A;  4ACK A;  4RQI A;  3EHM A;  2XGM A;  2F37 A;  1JWF A;  4ILH B;  2NC9 A;  2J4D A;  5AQ9 A;  1E96 B;  2C0L A;  1K1A A;  2PQR A;  3UT4 A;  1N52 A;  4JPS A;  4TXR A;  3CVQ A;  4G25 A;  3URZ A;  2WXQ A;  4OVU A;  4JXT A;  2RKK A;  2QC9 A;  3RO2 A;  3EU5 A;  1SA4 A;  1N11 A;  5D0Q D;  4K5B A;  3CVY A;  1OY3 D;  1JPL A;  5BUZ A;  5EIB E;  3LPZ A;  3ZEF A;  4C48 B;  1EYH A;  4L23 A;  4XIF A;  3NQP A;  4CYM D;  2P9L G;  4QFV A;  2WM9 A;  2YHE A;  3CGH A;  3ZYM A;  4B8C B;  3QK0 A;  3V2O A;  4CGV A;  2DZO A;  2WVI A;  3C98 A;  4L9P A;  4F3V A;  3FTW A;  3JYS A;  3AS5 A;  4XKB A;  4GA0 A;  5KNH D;  4G23 A;  3KS2 A;  2FBN A;  1N0Q A;  5AAR A;  4GMJ A;  1TNZ A;  1TJF A;  4PH4 B;  2X6I A;  3CEQ A;  3KD7 A;  5T3R A;  3S7J A;  2F8Y A;  2R59 A;  3ASD A;  1DCQ A;  3G2S A;  2KBX A;  5LX8 A;  2WQ7 A;  2GGF A;  3AG2 E;  2J8S D;  4XZ4 A;  5J08 A;  4GYY A;  2LAH A;  4U8H A;  2VSX E;  3UM0 A;  3RIB A;  4HOS A;  1OCC E;  2VTB B;  5FJY A;  4CGW A;  5ENO D;  4LCT A;  1H6K A;  2EIK E;  4ZFH A;  3AG1 E;  5FQ4 A;  5ARG A;  1E7V A;  4XI9 A;  3R9A B;  3U64 A;  3ZIM A;  3U66 A;  5D66 A;  5J90 A;  4WNG A;  3PEV B;  4F1P A;  2XRZ A;  4J6I A;  3RAU A;  3T8K A;  2H6H A;  4O60 A;  5ENR D;  3NOC D;  3CVN A;  4O1P A;  1TNO A;  1IQU A;  3IXE A;  4L2L A;  4GTR A;  3ISM C;  4BES A;  4JHJ A;  3HVE A;  2YQ8 A;  1TYQ G;  2HO1 A;  2RD0 A;  3ZNG A;  1TEZ A;  1NFI E;  2P9N G;  3DXK G;  3ZVV A;  4MKT A;  4WUY A;  3CK7 A;  3FFL A;  5B1B E;  1QQE A;  4I17 A;  3FUD A;  2IO2 C;  5C1D A;  1NA0 A;  3D9M A;  1E8W A;  2V5Q C;  3ML9 A;  4G1T A;  3CV0 A;  3IEG A;  3DSX A;  3ESL A;  2BKK B;  2ZIR A;  4YND A;  4EQF A;  1KLX A;  2KCV A;  2WXG A;  4UWK A;  3LY8 A;  3U4T A;  4EBA G;  2CFZ A;  5D0O D;  3CK8 A;  3B7S A;  2F0Y A;  1XNF A;  3QNK A;  3HVE B;  2PM7 A;  1TN8 A;  5CCL A;  4DK5 A;  3NF1 A;  4ANX A;  3HG0 D;  1JCR A;  5T8I A;  2PL2 A;  4N3A A;  3F6Q A;  2EQX A;  1W3B A;  2AXV A;  1HF8 A;  3CQC B;  3EHR A;  1KT0 A;  2H6F A;  3L08 A;  3EJN A;  4GTT A;  2YNQ A;  1IQR A;  1X81 A;  2Y4U A;  3PNL B;  2E0I A;  3E37 A;  3D9O A;  4UQY A;  5DIZ A;  4BFR A;  4HOR A;  4I2W A;  1H6O A;  3LY9 A;  2R05 A;  3AU4 A;  2KAT A;  5CMY A;  3CLJ A;  3IHV A;  2DWZ A;  4U95 D;  2VSN A;  1YA0 A;  1N4Q A;  2Q7F A;  3KEZ A;  3UKR G;  4AM9 A;  5M72 A;  2VSO E;  4V3I A;  3G2W A;  1SA5 A;  4KXK B;  4G8L A;  2OVF A;  4PS8 A;  3UKU G;  1SW6 A;  2IEJ A;  3LJN A;  2IY0 C;  3SNX A;  3Q73 A;  5FT9 A;  3PUK A;  3Q9N C;  5ANR A;  2GRM A;  4GMR A;  4U8Y D;  4LNU D;  1HZ4 A;  4GZD A;  2OV8 A;  3ABL E;  3TXN A;  2VYI A;  3FTX A;  2XEN A;  1S70 B;  3LVR E;  3CSF A;  3LCA A;  5AIJ A;  4CDR A;  4B0Z A;  3LY7 A;  3Q78 A;  3E4B A;  2XRY A;  4FP7 A;  4N3C A;  5G2N A;  5AQA A;  2A4Z A;  2QY7 A;  2DIW A;  4GZ6 A;  3FUJ A;  5HRY A;  5ENN A;  5JJ7 A;  3ZRH A;  4AY5 A;  2WXN A;  3RRN B;  3G2T A;  2P9U G;  1E8Y A;  4GTP A;  5FWQ A;  3VLF A;  3B13 A;  3X2Q E;  4E6H A;  2AXU A;  2P58 C;  3C72 A;  3LVQ E;  1MJ0 A;  2VQ2 A;  4I9C A;  5FZS A;  3SBT B;  3JUI A;  3VLE A;  4HI8 A;  3SZ7 A;  3LEW A;  3OTN A;  3ZFW A;  4BWR A;  3ZPJ A;  3V2X A;  3DEO A;  3FH5 A;  4Y6W A;  3TJP A;  4E85 A;  5EKQ D;  1FT1 A;  3WXX A;  3ESK A;  2A5E A;  4AEZ C;  3S2A A;  3MCX A;  1DNP A;  4M3O A;  1QZ2 A;  2L6J A;  1JUQ A;  4JL0 A;  2XEV A;  3S7F A;  1HO8 A;  4I1A A;  4JB8 P;  4I1O B;  1KZP A;  2V8S E;  3ONL A;  3PZ2 A;  4HLE A;  3RO3 A;  3DRA A;  4UWL A;  1S63 A;  3Q5M A;  4OYS A;  1UJJ A;  3TXM A;  2LXL A;  2EIL E;  2XPY A;  3FUL A;  3QAR A;  1LD8 A;  2WXM A;  3TGO A;  3L16 A;  3TWQ A;  1HX8 A;  4J8S A;  2KCL A;  3LS8 A;  3D9I A;  5CRV A;  3P2B A;  4U7E B;  3PH0 C;  4JHK A;  3CHM A;  4U0U A;  4AY6 A;  4WWP A;  4ATG A;  2FEZ A;  2LSU A;  4DI4 A;  2X6K A;  4PS3 A;  4UI9 C;  1HG5 A;  2IJG X;  3RSE G;  5EDS A;  2X6J A;  2R17 C;  4NUR A;  3Q15 A;  5AQB A;  5G55 A;  2BF0 X;  1HU3 A;  3C3Q A;  2I1J A;  4ZHB A;  1K3Z D;  2LO6 A;  3BEE A;  3EIQ C;  5KNG A;  2WPV A;  3P1U A;  5KJN A;  1WG0 A;  4OVV A;  4ANV A;  2FO7 A;  5FIN A;  5HI7 A;  3EIJ A;  3L22 A;  5EIL A;  2XGO A;  3HXE A;  4EHM A;  4NQ0 A;  3VTX A;  1IKN D;  3DST A;  3BQO A;  1Z3X A;  2FI7 A;  2ZU6 B;  5AQ7 A;  3DWL G;  4HVB A;  3MKR A;  4DPR A;  4NIK A;  5FIO A;  1NZN A;  5LFA A;  2OVB A;  4J8E A;  4AVX A;  2WXI A;  4G11 A;  4CDM A;  2WXL A;  3C3R A;  3DXM G;  4EZJ A;  3PS6 A;  4AXH A;  3PE4 A;  3SQV A;  3FUE A;  1D8E A;  3I4R B;  5BPP A;  2V5F A;  1LTX A;  3MYV A;  2XQ0 A;  3ASG A;  3ZHE A;  2P9I G;  3CQG B;  3ZN3 A;  2XZT G;  4H7Y A;  4J0U A;  2XCB A;  1Y8M A;  1JWG A;  3QWP A;  1OCR E;  1H6P A;  4EPZ A;  4GZ3 A;  2OND A;  4U0Z A;  4C0E A;  4KVM A;  4K5A B;  3JXJ A;  1UW4 B;  3LKU A;  2FF4 A;  5FTP A;  1INZ A;  3UIP C;  3EHN A;  4UUC A;  3K9I A;  4HOT A;  3AJI A;  2L0I A;  3UM1 A;  2GRP B;  4CT4 A;  3APD A;  4U63 A;  4ILG A;  3FP3 A;  3PZ4 A;  4G26 A;  2R03 A;  2PM6 A;  3B95 A;  5G05 C;  2C0M A;  1SVX A;  3NAW A;  3QWW A;  1N54 A;  3HHM A;  4F53 A;  1LF8 A;  3T9K A;  4HFG A;  1L5J A;  5JHB A;  1OUV A;  5G04 J;  2JLB A;  5H7P A;  3APC A;  4AV7 A;  2VTB A;  4I6G A;  4B93 B;  4WAF A;  4BER A;  3ZYQ A;  5BW8 C;  2XZD G;  5KCM A;  3ASF A;  4K5C A;  4WNE A;  5AJD A;  5BXU A;  5EYL A;  4JD2 G;  3DEP A;  3PE3 A;  3L54 A;  1NA3 A;  1MX6 A;  3SD5 A;  3C3O A;  4N5Q A;  2ZIS A;  3EUV A;  4DX5 D;  3S7D A;  1N0R A;  3R9M A;  3OXF A;  1DCE A;  3UM3 A;  3DBS A;  1Z3Y A;  3CK9 A;  3AS8 A;  1RW2 A;  3CHP A;  4XE0 A;  2L0T B;  4HXI A;  4C0M A;  5G04 C;  2PQN A;  1O1R A;  4TXP A;  1A5E A;  3HXF A;  5FQ7 A;  2H6G A;  4FAD A;  4I1M A;  1S0P A;  1IHG A;  4TV3 A;  1YMP A;  3B7R L;  3IV0 A;  5BNW A;  1UOH A;  5FZQ A;  2VGE A;  4D10 C;  3UPV A;  5A7D B;  3MKQ B;  3D3M A;  3GZ2 A;  3CVX A;  3T8M A;  4BSZ B;  4I6J A;  3JXI A;  3Q4A B;  3CR3 A;  4FJY A;  1H19 A;  1QNF A;  4BX9 A;  4HOU A;  1UN9 A;  2GRO B;  4LRZ A;  1Q2Z A;  3MV3 B;  4JA9 A;  1BLX B;  4P29 A;  3NZS A;  3OXL A;  5AAO A;  3BG0 B;  2ILR A;  2VJ8 A;  2J07 A;  4OAV B;  4FLH A;  3SF4 A;  1N9A A;  3UIO C;  3NB2 A;  4RG6 A;  2OEW A;  3J5P A;  4OAU C;  2ETB A;  2FUL A;  3PRZ A;  4GZ5 A;  2R2L A;  4I9E A;  4AJW A;  2IFU A;  1N4R A;  1N4S A;  3E34 A;  2J09 A;  3E30 A;  3EDT B;  3FH7 A;  2WQ6 A;  3ZUV B;  4M7C A;  3NOG D;  2ETA A;  2XGS A;  4PUC A;  3ZYL A;  1OWL A;  5ANL A;  1OXJ A;  4IYP A;  1FVH A;  5KWD A;  3FY4 A;  4DX6 D;  2PNN A;  3RJV A;  3HXC A;  1EPU A;  4MBG A;  3CVP A;  3FU5 A;  2L6B A;  4KZ0 A;  3UX4 A;  4GTM A;  4F7A A;  1V55 E;  3DSS A;  3V30 A;  1ZB1 A;  2KXP C;  4XKC A;  1H2V C;  3JQ0 A;  1NI1 A;  1BI7 B;  4GML A;  2RG8 A;  4NAC A;  2Y69 E;  3L82 A;  4B89 A;  2DYS E;  5ENS D;  2EIN E;  5E76 A;  3NBN B;  2CHZ A;  4FC8 A;  4FUL A;  3ZXP A;  3U3W A;  1E90 A;  1U2V G;  4JZY A;  4EZL A;  3RKV A;  3I5P A;  2WXR A;  3MEK A;  1ELR A;  3ZXS A;  1MQS A;  2VGX A;  3AU5 A;  4FU3 A;  2RFM A;  3HIZ A;  1JCS A;  1UN8 A;  5HKP A;  2BTD A;  3RRU A;  1K1B A;  2P9S G;  1WAO 1;  3ABK E;  4HRM B;  3SY2 A;  1MZC A;  2WXP A;  3QOU A;  2PZI A;  5T4Y A;  4GCN A;  3UM2 A;  4GCO A;  2DVW A;  3L9T A;  2BED A;  1WY6 A;  4CRW A;  4L7T A;  4F1S A;  2GRR B;  3MZL B;  3Q47 B;  4NRH B;  5CBN A;  4J7W A;  1TJC A;  3N71 A;  1N94 A;  3GZS A;  4YDY A;  3D9P A;  3SBS A;  3EU9 A;  2AVP A;  1Z6T A;  4C9B B;  2R02 A;  2KC7 A;  2UWJ G;  3VTY A;  1TN7 A;  2RFA A;  1DC2 A;  5CEA A;  2I6H A;  2GRL A;  3MGB A;  1S64 A;  1TN6 A;  3FH8 A;  2KCK A;  4YVQ C;  2AXZ A;  5EN5 D;  3DSU A;  1N95 A;  4L1B A;  1A17 A;  1FT2 A;  4URK A;  3ASO E;  5E75 A;  3QKY A;  4YDE A;  2BUG A;  4CEM A;  4LER A;  5LOZ A;  4UQZ A;  2VGX B;  5KBA A;  3UXG A;  2HR2 A;  3B7B A;  4DI3 A;  3PRE A;  1OCZ E;  4XEI G;  3KAE A;  2E2E A;  1ELW A;  1D9S A;  1FVF A;  4I6E A;  4ANU A;  1UG3 A;  4KVO A;  4CDN A;  3W9G A;  3TWS A;  3NZU A;  3FUH A;  5JJ6 A;  3ASN E;  4N2S A;  3FU3 A;  3CVW A;  4KZC A;  3PDN A;  3OXG A;  3SHF A;  3W9F A;  4DRX E;  1N4P A;  5CMW A;  2IO3 C;  3DPD A;  2LAI A;  1KT1 A;  3AAA C;  2WXJ A;  2Y0B G;  4YDW A;  3V31 A;  4FJZ A;  3I4G A;  1NP7 A;  3ZW3 A;  4R7L A;  4YVO A;  3CIA A;  5ENP D;  3JCK C;  1MHQ A;  5AJL A;  3TWR A;  5B3S E;  2I2O A;  3D9J A;  1H2T C;  4ILI A;  4GB9 A;  3T5X A;  3FTS A;  1E7U A;  4ABN A;  4MLP A;  4A63 B;  4GZC A;  3UTM A;  3FUM A;  2DCP A;  4HOQ A;  1EDU A;  2EIM E;  3PZ3 A;  4AIF A;  3E33 A;  5BXO A;  2DYR E;  2JAB A;  4MS6 A;  3PZ1 A;  1SQM A;  3SFX A;  3S7B A;  4RLY A;  2ZXW E;  2P9K G;  1E8Z A;  2XPI A;  2UY1 B;  4B94 A;  4LEU A;  4J8D A;  2X38 A;  4YDO A;  4KYO B;  3UIN C;  2M63 A;  2V4L A;  5FQ8 A;  3FU6 A;  3D9N A;  3FUK A;  2LSV A;  4JHR A;  3ZKJ A;  4KMO A;  2XS1 A;  2HM8 A;  3QB2 A;  3J5Q B;  4AOF A;  4FHK A;  3ZYK A;  3Q7F A;  1PC2 A;  3TL5 A;  1TR4 A;  2AWI A;  4WWN A;  1BU9 A;  4B8A A;  2DBA A;  4HLL A;  4GYW A;  3KEA A;  1V54 E;  5BV0 A;  4K03 A;  1YCS B;  5JHA A;  3CKC A;  1FPP A;  1HS6 A;  1LD7 A;  4RSY A;  1O5M A;  5CED B;  4L2Y A;  3HYM B;  3CHO A;  3B7U X;  1H0A A;  1WM5 A;  3UUX A;  4XX5 A;  2KM4 A;  4ACL A;  1OWM A;  2J9Q A;  1Z5S C;  3PUJ A;  1VDY A;  4I2Z A;  3FUF A;  3LDZ A;  1HH8 A;  1TNB A;  1WDY A;  4JVS A;  3D9K A;  2MHK A;  3DSW A;  3GW4 A;  2WXO A;  5KJL A;  3LJ3 A;  3D9H A;  1AP7 A;  3G2U A;  3G2V A;  4EEC A;  2LUH A;  1ZBP A;  4RG9 A;  2ION A;  2WMO A;  3Q7A A;  5FQ6 A;  3TWU A;  2WB2 A;  3APF A;  5A6C A;  5AYW D;  2L9B A;  4W9R A;  4TXQ A;  5CHE E;  4QQI A;  4GPM A;  3CST A;  4GTS A;  5CCM A;  4TUU A;  3DPY A;  3IHY A;  3VLD A;  2WXH A;  3Q79 A;  2CFU A;  3MX3 A;  1OWP A;  4A3T A;  2QFC A;  3JUE A;  3QWV A;  4BTA A;  3UT7 A;  4Z68 A;  5LCW J;  4DLQ A;  3IKO B;  5BV1 A;  2HYZ A;  2IF4 A;  3ULY A;  2J49 A;  2FO1 E;  2P2C P;  3SI5 A;  3OAW A;  3CVV A;  1MYO A;  3D9L A;  1KZO A;  2B0O E;  2QYJ A;  3FWV A;  4GU5 A;  1HFA A;  1ZU2 A;  2OOE A;  1GW6 A;  2CG2 A;  5CEC B;  4HB5 A;  3ML8 A;  4BX8 A;  3HXD A;  2Y1L E;  1TNY A;  5BT1 A;  3L13 A;  1PY1 A;  1OWN A;  1JCQ A;  3LXU X;  4HBD A;  2XEH A;  3Q9U C;  1OWO A;  4JEU A;  1SZ9 A;  3HRA A;  3JQ1 A;  2AW6 A;  1O1T A;  3FEX A;  3O48 A;  4U07 A;  2DZN A;  3ONK A;  3FUI A;  3QDN A;  2VGY A;  4GA1 A;  4J8F A;  2WQH A;  4N3B A;  3MJW A;  2B6C A;  3PEU B;  2I1K A;  4APF A;  2XEE A;  3O4Z A;  3FTY A;  4BT9 A;  1FCH A;  1KPS B;  4Q96 A;  4GTO A;  2NSZ A;  3SFZ A;  1B89 A;  2GRN B;  3PNT B;  4J8Y A;  1BPO A;  3FTU A;  2R5S A;  4BEP A;  3SO8 A;  2GW1 A;  4H7X A;  2V0P A;  1E8X A;  4A1G A;  3ASH A;  1IYG A;  5ENQ D;  3GZ1 A;  4U04 A;  4APO A;  1OCO E;  3CHS A;  1ELK A;  1K8K G;  4FLB A;  5DBK A;  2F8X K;  2J4B A;  3FTZ A;  2J08 A;  4UWF A;  5HS0 A;  1D8D A;  1EF1 C;  1Y6I A;  2JEK A;  1DVP A;  2YIN A;  5EYP F;  4WWO A;  3FEY A;  3TG4 A;  3TG5 A;  4PDX A;  4IRU A;  4ATZ D;  3TWT A;  4PS7 A;  2HE0 A;  1RZ4 A;  3TAX A;  1YYH A;  4CCA A;  3ULE G;  3BUA A;  4HRN A;  3QC1 A;  4U8V D;  4Q94 A;  5CBO A;  4WNF A;  3QAQ A;  4HNA D;  2X6H A;  4I43 A;  3FHE A;  1U3C A;  2NXP A;  2IOL A;  2EIJ E;  2NYJ A;  2X6F A;  4BT8 A;  1AWC B;  4A1S A;  1XGW A;  2LXM A;  3TWW A;  1HXI A;  5A23 A;  4UI9 J;  5FZR A;  1X5B A;  1HG2 A;  4GTV A;  2QZA A;  1O1S A;  3BU8 A;  2IU1 A;  5LCW C;  2UY1 A;  4CZ2 D;  4DLO A; 
#chains in the Genus database with same CATH homology
 4L9P A;  4GTQ A;  4GTT A;  1N4P A;  3Q79 A;  3Q75 A;  3HXB A;  1X81 A;  3Q7F A;  2BED A;  1D8E A;  4GTP A;  3E37 A;  1N9A A;  1LTX A;  1QBQ A;  1TNZ A;  3C72 A;  1N94 A;  1FPP A;  1LD7 A;  2ZIS A;  3EUV A;  1O5M A;  1D8D A;  2R2L A;  1KZO A;  1N4R A;  1N4S A;  1DCE A;  3E34 A;  1TN7 A;  3E32 A;  3E30 A;  1NL4 A;  1FT1 A;  3HXD A;  1S64 A;  1N4Q A;  1TN6 A;  3KSQ A;  1TNY A;  3PZ3 A;  3DSU A;  1N95 A;  3E33 A;  3DSX A;  2ZIR A;  1FT2 A;  1SA5 A;  4LNB A;  1JCQ A;  4YDE A;  2IEJ A;  3PZ1 A;  1TNB A;  3Q73 A;  3HXC A;  4MBG A;  1KZP A;  3SFX A;  4GTM A;  1O1R A;  3DSS A;  3PZ2 A;  4LNG A;  3HXF A;  3DRA A;  3HXE A;  2H6G A;  1O1T A;  1S63 A;  3EU5 A;  1NI1 A;  3PZ4 A;  1SA4 A;  2F0Y A;  3DSW A;  1TN8 A;  4EHM A;  4YDO A;  3Q78 A;  1JCR A;  3DST A;  3SFY A;  1LD8 A;  3Q7A A;  2H6H A;  1TNU A;  4GTV A;  4GTO A;  1TNO A;  1O1S A;  1JCS A;  2H6F A;  4GTR A;  3KSL A;  2H6I A;  4GTS A;  3DSV A;  1MZC A;  3DPY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...