4GTQA

Ftase in complex with bms analogue 12
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
315
structure length
315
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type-1
publication title Development of Selective, Potent RabGGTase Inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
total genus 122
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 4gtqA00
4GTQA 3E32A 4MBGA 4GTSA 3Q7AA 1JCQA 3Q79A 3DPYA 2H6HA 4GTTA 1O5MA 1O1TA 1SA5A 3EU5A 3HXCA 3DSVA 1O1SA 3PZ3A 3PZ4A 1TN7A 1D8EA 1QBQA 1TNZA 2ZIRA 2ZISA 1N9AA 2F0YA 4EHMA 3Q73A 4GTOA 1JCRA 3HXDA 3KSQA 3Q7FA 1O1RA 3E34A 1FPPA 3Q75A 3E37A 4GTRA 1X81A 1TNYA 2H6FA 1SA4A 1N94A 4LNGA 3PZ1A 4YDOA 3HXFA 4L9PA 1TN8A 3SFYA 3DSSA 3HXBA 3EUVA 4GTVA 1N4SA 1N4PA 1D8DA 1JCSA 3SFXA 1LD8A 3KSLA 1FT1A 3DSUA 1MZCA 1N4QA 1NL4A 3HXEA 1DCEA 1N4RA 1KZOA 1N95A 2IEJA 3DSWA 3PZ2A 4GTMA 3E33A 1S63A 1TNOA 2H6IA 3DRAA 4LNBA 3C72A 3DSTA 3DSXA 1LD7A 1KZPA 4YDEA 1NI1A 1TN6A 1TNUA 4GTPA 1S64A 3E30A 2H6GA 2BEDA 2R2LA 1LTXA 1TNBA 1FT2A 3Q78A
chains in the Genus database with same CATH superfamily
3E32A 5JJ6A 3ZXSA 4UQZA 4GZ3A 2HE0A 1FVHA 2WXRA 4GA0A 3ZVVA 1O1SA 2UY1B 2YHCA 3ISMC 4XX5A 2B0OE 1K8KG 2F37A 4EECA 4APOA 4RG6A 2WXIA 5AQ9A 4HRNA 4HRMB 3MGBA 3FTZA 3WG7E 1PAQA 2P9NG 1HX8A 4LEUA 3CHRA 1X81A 1Y6IA 5AAOA 1NFIE 1N94A 4V3IA 2V5FA 3S7DA 2ONDA 1OUVA 3QAQA 5AN8A 3NB2A 3CVVA 4HVBA 4GPKA 1N4QA 3NOGD 5KCMA 4GA1A 2PQRA 3SF4A 3SBTB 4I2ZA 2LXMA 2NC9A 3UMVA 4XIFA 1TJFA 3FH8A 1MX4A 3RAUA 2WXPA 3SHFA 2WXGA 4WNFA 1NI1A 2WQ7A 3WXXA 1DVPA 2VGYA 1OWLA 3UIPC 4JPSA 3RRNB 3AG3E 3UT4A 5AQBA 3ZFWA 4LG6A 3UPVA 3CIAA 3Q47B 5HKPA 2WXNA 2P9LG 5G04C 3FU5A 5FQ7A 4JA7A 3FTWA 2Y4TA 4YDYA 4AJWA 2E0IA 2V4LA 1HU3A 1JCRA 4I1OB 1WAO1 3TJPA 1PY1A 5A7DB 3QDNA 3TWUA 3SZ7A 3T5XA 3Q4AB 4AY5A 3FUFA 4GCOA 4MS6A 4DX6D 4Q69A 4GTVA 3FFLA 1E8WA 3PEVB 5E76A 3ZHEB 1UJKA 3G2UA 1ELKA 3HRAA 4ABNA 3U4TA 2XPZA 3KSLA 2QY7A 3PE3A 1YYHA 1AP7A 3EDTB 1UG3A 3JXIA 4J8FA 2RD0A 4UI9K 2KCVA 4EPZA 2X6IA 3Q15A 4AY6A 4IYPA 1X5BA 4GTMA 1Z6TA 4N5CA 2P9UG 3NBNB 5BPPA 2MOWA 2PNNA 3DSXA 5KWDA 5CRVA 5HS0A 1NA0A 3CHMA 4ANVA 3FUEA 1YCSB 1H0AA 4UQYA 2R2LA 5HI7A 2QFCA 5FIOA 1FT2A 3QB2A 4N2SA 3JXJA 4E6HA 4GMJA 3PE4A 2H6HA 4FLHA 3PZ3A 2VSYA 3ML8A 5ENOD 5B1BE 3ZHEA 2GW1A 4DX7D 3LPZA 5KJKA 4BERA 2ZIRA 2XZTG 3B7RL 2XS1A 4BT9A 3GW4A 2JEKA 1EDUA 3QOUA 5AQAA 3U64A 4CEMA 3ZYKA 5E75A 2X3MA 4I6EA 3UKRG 2NSZA 3CR3A 1N0QA 2QC9A 2CHZA 3LVQE 2HYZA 4U8YD 4N39A 3C98A 3D3MA 1S70B 2HO1A 1FVFA 4J0UA 3LJ3A 4B94A 5FZRA 4U0ZA 3URZA 2PQNA 3EHRA 2XHEA 5KJNA 4XI0A 4EZKA 3D9NA 2MHKA 1S63A 1TNOA 5FT9A 3TG4A 4OVVA 4HS2A 3ZIMA 2PZIA 5BW8C 3RSEG 3ESLA 3SNXA 4JC8A 3E30A 5LFAA 3D9IA 1K3ZD 4FHKA 4I43A 4I9CA 2AWIA 3CK7A 4D10C 1BD8A 2JABA 5DBKA 5G04J 4JHJA 4YVQC 2LNIA 2ETCA 1DC2A 2P2CP 1TYQG 1E90A 1IYGA 1OY3D 4O6FA 2M63A 4Q94A 4HOSA 1SA5A 4OYSA 4FHJA 3ASNE 1OWMA 4H7XA 3DWLG 1QBQA 4H7YA 4U7EB 1TEZA 4KVMA 2IFUA 4BX8A 1UN9A 3BQOA 4LNUD 1E7UA 3DPDA 2XGSA 3VTYA 4KVOA 1TNYA 3V31A 4YDOA 4BTBA 3B7TA 4N3AA 3AG4E 3UX4A 2J49A 2BUGA 3ESKA 2WVIA 2FBNA 1DCEA 4LSZE 4A63B 4Z68A 2AVPA 4J8EA 1QZ2A 3PEUB 4FULA 3FEYA 5T4YA 1UW4B 5CMWA 1H2TC 2P9PG 2WMOA 3FU0A 4G26A 4ATZD 3FH7A 1KZPA 4UI9C 3ZNGA 1SQMA 3NQPA 2YQ8A 4YNDA 2QYUA 5AENA 5BNWA 1AWCB 5ITZF 2IONA 2V0PA 3UXGA 1H6OA 1JCQA 3Q79A 3MV3B 3TWSA 3AS4A 3IBEA 4GTTA 2EQXA 2VSNA 3QWVA 1Z3XA 3D9HA 3PZ4A 4K5AB 4WNGA 5AJDA 1N9AA 3PZDA 4NIKA 3W9FA 3ZU7B 3J5QB 4ACLA 4MLPA 5EILA 4Y6CA 1OT8A 2XEVA 3RRUA 4RVBA 4CRWA 2XEHA 2VQ2A 4L7TA 4I6JA 3RKVA 3HXBA 4HXIA 3ZPJA 5G2NA 1U3CA 3AS8A 3AG1E 3LDZA 4O60A 3CVNA 3V79K 3IKOB 4TV3A 4ZHBA 4DPRA 4EBAG 3OXGA 3LY8A 3UUXA 5AJLA 5D0QD 2V4HC 3CHPA 5LOZA 4YDWA 3SD5A 3U66A 2J09A 2YNQA 2WPVA 3PZ2A 4K03A 3E4BA 4C0EA 1DCQA 2VSXE 1EF1C 4J8SA 1SW6A 1ZU2A 1RZ4A 2OCCE 1E96B 4UUCA 3SQVA 2H6GA 4WWOA 2PM7A 4FLBA 2J07A 2FO7A 4GZDA 4JVSA 4ANXA 4GTQA 3D9LA 2DZOA 4W9RA 4O1OA 2DYRE 5FINA 2V8SE 2PM6A 4K0RA 4HB5A 5CHEE 4TRQA 5A6CA 2IO2C 5BV1A 3FDHA 1JUQA 4KT6B 3HHMA 3QK0A 4EZJA 2L0TB 3MV2B 4XE0A 4HORA 1JWFA 4KBQA 3PH0C 4MKTA 4YVOA 4ANWA 1SZAA 2C0MA 3D9MA 1WG0A 4C0MA 5G55A 3FTYA 3QJZA 3ASOE 2J4BA 3IV0A 4GMLA 2DIWA 1H6KA 5KJLA 1VDYA 1FT1A 3DBSA 4DI4A 4HLLA 3TWQA 5C2YA 4C48B 4G23A 3G2TA 3FH5A 5ANRA 3Q9NC 4UI9J 4HBDA 3L82A 3APDA 1NP7A 3CHOA 3I5PA 3FUMA 3J5PA 1S0PA 2WMNA 3NF1A 4BTAA 1JWGA 2HM8A 3FTUA 4ILIA 1NZNA 2R59A 3ZYMA 2OOEA 3SI5A 4JEUA 2V5QC 3D9JA 3MYVA 4F1SA 3S7FA 3APCA 3VLFA 3GZ2A 4CDNA 2WXHA 2P9IG 3CSFA 1EYHA 2XRYA 2Q7FA 4OAVB 1MQSA 3UQ3A 4LUNU 3Q73A 2WXMA 5CECB 3Q7FA 3CVXA 3RIBA 3MA5A 1ZBPA 3B13A 3QC1A 2QZAA 4GU5A 1UOHA 2XENA 2AXUA 3TG5A 3DSSA 4G1TA 3BU8A 5ENRD 2XPYA 3FUIA 5BT1A 1INZA 1N52A 1N4SA 5ANLA 4I9EA 1A5EA 3L22A 1H6PA 1OCCE 4KYOB 3CHQA 4UWHA 5HRYA 3Q9UC 5CEDB 2AXZA 3AU5A 3ZXPA 3CGHA 2GRMA 4AIFA 3N71A 1OWPA 3KEAA 1WM5A 3ML9A 4GTPA 2F8XK 4U96D 2FULA 4AM9A 2AXVA 3FUHA 4IULA 2EIKE 1TNBA 4WWNA 3OAWA 3D9OA 4HFGA 4RG9A 1KPSB 4DI3A 3ABLE 1HF8A 3EU5A 4URKA 5CERB 3EIJA 5JJ7A 4U0SA 1K1AA 1E8YA 3PVLA 3EHQA 3UM3A 1TNZA 3ZEFA 2X6JA 5T8IA 4CDRA 3HIZA 4NURA 3T5VA 3KSQA 2IF4A 3TXMA 3FUDA 4GCNA 3Q75A 5ENNA 1H19A 2GGFA 5CCMA 5BXOA 2J08A 3PRZA 1TN8A 1WDYA 3VTXA 1MHQA 2Y3AA 5EIDA 4APFA 4CGVA 3FTXA 4TXQA 1L5JA 5EYPF 4U04A 5A23A 3LXUX 3S7BA 1N4PA 1D8DA 3NAWA 2I1KA 2XS8A 4LRZA 3UIOC 4XKCA 3U3WA 3CKCA 4JA9A 3UKUG 2EIME 2WXFA 4A1GA 3JUEA 5FQ6A 4GAAA 4BETA 2R02A 3DSWA 4TXPA 4DLOA 4U8HA 4I6GA 5EKQD 3C72A 3ABKE 5LP0A 4N5QA 3P1UA 4PS7A 4M7CA 4HOTA 1S64A 3BEEA 3DEOA 4F7AA 3CVQA 5LCWJ 3ONLA 3P2BA 3HYMB 3PUJA 3S7JA 4XI9A 2OEVA 4A3TA 1A17A 3EHMA 1Q2ZA 4HRLA 4TXRA 1IHGA 1IQUA 1QNFA 4C9BB 5J90A 3DSVA 3I4RB 5FQ8A 3OXFA 4B89A 4GTOA 4FP7A 4ZFHA 5FWQA 1P5QA 4UWGA 3DXMG 1V54E 2UWJG 4TUUA 2ZGGA 4LCTA 1HG2A 2LUHA 1FCHA 1HZ4A 1OCRE 2HR2A 5CCLA 1BI7B 3SFXA 1LD8A 4HOQA 4ILHB 1QYMA 3KS2A 4XKBA 2NXPA 3CK9A 5EYLA 1N95A 4BWRA 2CG3A 4BESA 1SZ9A 3FUJA 4AVXA 5EX0A 2FI7A 2XGMA 4U63A 3CHSA 4ACKA 3CLJA 1OXJA 2ETAA 4N3CA 3FWVA 3QWWA 3ASGA 5JA4D 3R7QA 1TNUA 2LAIA 2EINE 2KC7A 5AYWD 3KAEA 4X8QA 1IKND 2XRZA 1MYOA 3LKUA 4QQIA 3NZUA 1QQEA 5ENSD 5AARA 4DUIA 4A55A 2AJAA 2E2EA 4MBGA 3D9KA 3O4ZA 3TL5A 1LF8A 5AIJA 2I9CA 3LY7A 2MYOA 2CHXA 2ILRA 4BEPA 3C3RA 1UN8A 2GRNB 4RQIA 2XPIA 1O1RA 3AG2E 1FPPA 3T8KA 3I4GA 4J8YA 3ZUVB 3E37A 2L0IA 2BKKB 4LNGA 4KZ0A 2KBXA 3LS8A 5CBOA 3LYAA 5T3RA 4GYOA 4J6IA 1OWOA 1NL4A 4FJZA 1KZOA 3FU6A 2OVBA 4NQ0A 5JJTA 5FQ4A 2A4ZA 3E33A 2IJGX 3C5RA 4JB8P 3TGOA 4DX5D 1XGWA 3ONKA 5M72A 2XQ0A 4GYWA 2FF4A 4ME2A 5ARGA 3TWTA 3IEGA 3MKRA 4I1MA 3KD7A 3TWVA 4N2QA 4U8VD 5KNGA 4F1PA 1W3BA 3C3OA 3UM1A 1LTXA 1HE8A 4FADA 3NZSA 5LX8A 2KCKA 4HI8A 4L23A 4HQDA 2CFZA 3ZKJA 3F6QA 3K9IA 4GB9A 4AEZC 3UT7A 3FEXA 2L6JA 3U9WA 4M3OA 5J08A 2EILE 1BI8B 4Y6WA 5C1DA 3OTNA 3UM2A 3AJIA 3MKQB 4EBAA 4WNEA 3CVWA 5D2MC 3CV0A 1MX6A 5IY5E 4GTRA 3JCKC 3PZ1A 2J8SD 4L9PA 4L1BA 2CFUA 4F53A 5BXUA 5JHAA 3EUVA 3ZYLA 4E85A 1IHBA 3CKBA 3ULQA 3C3QA 3SBSA 4AV7A 1H2VC 3GZ1A 2IY0C 3CEQA 3HXEA 4L2LA 3TWWA 4DX1A 4P29A 4KMOA 3SGHA 5BV0A 3JQ1A 3RU0A 3FTVA 3G2VA 2DBAA 1LD7A 4UWLA 1YA0A 1RW2A 3BUAA 2ZU6B 3ZW3A 4PS8A 4I17A 5CMYA 3MKQA 2FO1E 2WQ6A 3O48A 4JXTA 2R5SA 3Q78A 5ENQD 4WUYA 2GROB 1HXIA 3ASDA 3PS6A 4FC8A 4GTSA 3Q7AA 1U3DA 2Y69E 3CSTA 2B6CA 4KZCA 3HDXA 4BSXA 4J8DA 2NYJA 3PNLB 4CZ2D 2WXLA 3CVUA 2FEZA 4B0ZA 3RJVA 4EHMA 4JEHA 1YMPA 4A1SA 3T9KA 5KBAA 4AOFA 3MJWA 3HXDA 3ZYQA 5LCWC 5FTPA 3L13A 2XCCA 4BY6A 4KXKB 3AU4A 5FZQA 3HVEB 3SFYA 4I1AA 4XEIG 3L6AA 4L2YA 2VJ8A 1TR4A 5HQ8A 2R17C 3FTSA 2XZDG 4BT8A 5ENTD 1U2VG 2UY1A 2OV8A 4LERA 2GRQB 4IN3B 5KNHD 4F3VA 5G05C 3JYSA 2GRLA 2IEJA 5EDSA 3SO8A 2EIJE 2LXLA 2KCLA 3QWPA 3LJNA 3B7SA 4IRUA 4LNBA 3MCXA 2IQCA 4B93B 1N11A 2WB2A 3EJNA 4JHRA 4BSZB 1HS6A 2XGOA 3MX3A 4PDXA 1HO8A 5B1AE 3G2SA 2VTBB 2YHEA 3CQCB 2J9QA 4BFRA 2VGXB 1Z5SC 4NRHB 3HVEA 3D9PA 1H2UA 3NOCD 2IO3C 3FHEA 3KEZA 2L9BA 3R7RA 3IXEA 2I2OA 4UWKA 4GYYA 4RSYA 2AW6A 3MEKA 5ENPD 3CQGB 4JW1A 3TWRA 2ZGDA 2BF0X 2KXPC 5ARFA 2BKGA 4GA2A 2DZNA 2J4DA 1GW6A 4GZ6A 3HG0D 2H6FA 1OCOE 4OVUA 3LEWA 4PS3A 5CEAA 3PNTB 2KM4A 2RKKA 3ABME 2WXOA 3BG0B 2VTBA 3APFA 5EX3A 2CHWA 1E7VA 2X6HA 4CCAA 4PUCA 3FUNA 2VGXA 3EHNA 5DIZA 2WQHA 2GRRB 2LSVA 2BTDA 1OCZE 4JL0A 3MZLB 4O1PA 1XNFA 3DRAA 1D9SA 1K1BA 4R7LA 4GPMA 4G25A 4Q96A 3VLEA 3EU9A 4G24A 5D66A 1E8XA 4HI9A 1E8ZA 1HFAA 3UTMA 4JHKA 2R05A 3B95A 2Y4UA 4K5BA 3R9MA 2WXKA 1KLXA 3TXNA 3DPYA 1N0RA 5D0OD 2WXQA 3GYZA 3HXCA 1OWNA 3LCAA 1IXVA 1B89A 2F0YA 3CK8A 3TAXA 4F6RD 5B3SE 3LVRE 4CT0A 4AP2A 4MRUA 5JMND 1KT0A 3JQ0A 2A5EA 4DRXE 4HOUA 2A5UA 4NACA 4QFVA 4DLQA 4OAUC 3FP3A 2LAHA 3SFZA 1G3NB 1ELWA 1NA3A 5KJMA 5G05J 4K5CA 3V2XA 4U95D 2VYIA 3FY4A 4RLYA 3ULYA 4HLEA 4ANUA 2MRIA 2ETBA 3PUKA 1EPUA 2WXJA 3CVYA 2C2LA 4GZCA 4JZYA 4WNDA 3FU3A 5CRUA 4A3VA 2GRPB 4FA6A 1BPOA 2L6BA 4B8CB 3DSTA 3Q49B 4XZ4A 2KZTB 2X6KA 3RRMB 2P9KG 3FULA 4TUMA 2ZXWE 3PREA 3T8MA 1BLXB 3BG1B 1BU9A 4G8KA 3L17A 2VSOE 1V55E 3GZSA 3RO3A 4CYMD 4I2WA 5EIBE 1ELRA 4J7WA 1O5MA 1O1TA 2XEEA 2F8YA 2Y1LE 3LY9A 3B7UX 5CBNA 2RFMA 5H7PA 4AXHA 1TN7A 1D8EA 2LO6A 1WY6A 3AS5A 2ZISA 3UI2A 4DK5A 2C0LA 2I6HA 3IHVA 2QYJA 4GZ5A 2X38A 2DYSE 2I1JA 3ENEA 3HXFA 2VGEA 3AAAC 3DEPA 3UT8A 3VLDA 2KZTA 3UINC 3ZGQA 3JUIA 3QNKA 3EIQC 2OVFA 1JCSA 2PL2A 1SVXA 4GMRA 1MZCA 1ZB1A 3G2WA 3L9TA 3V30A 3W9GA 3QKYA 2XCBA 1IQRA 5FZSA 1UJJA 2OEWA 2H6IA 3ZRHA 4CDMA 4ATGA 2DVWA 1TN6A 3L16A 1HH8A 3L54A 3UM0A 3ASFA 3ZN3A 3B7BA 4UQXA 4JD2G 4FU3A 1MX2A 3DXKG 2BEDA 4HNAD 3ASHA 1Y8MA 4B8AA 1PC2A 2R03A 2CG2A 4ILGA 3ULEG 1KT1A 1N54A 3RK6A 3FUKA 1TJCA 2RG8A 5BUZA 2IOSA 4G2VA 4G8LA 5AQ7A 2JLBA 4DJAA 4BX9A 3SY2A 4WAFA 3X2QE 3E34A 2X6FA 2Y0BG 2P58C 2DCPA 4EZLA 5FJYA 1SA4A 1JPLA 3OXLA 3IHYA 2YINA 2KATA 1Z3YA 3QARA 3PDNA 2P9SG 4FJYA 3DSUA 4WWPA 2IU1A 1HG5A 1N4RA 3L08A 3CVLA 3RO2A 4DX2A 3TWXA 4U07A 4G11A 2LSUA 2IOLA 3I3NA 4UWFA 3V2OA 2DWZA 3S2AA 2RFAA 3R9AB 3CVPA 4CT4A 4YDEA 4U0UA 4CGWA 1DNPA 3Q5MA 5EN5D 4PH4B 2WM9A 4EQFA 5JHBA 4N3BA 1MJ0A
chains in the Genus database with same CATH topology
4GTQA 3E32A 4MBGA 4GTSA 3Q7AA 1JCQA 3Q79A 3DPYA 2H6HA 4GTTA 1O5MA 1O1TA 1SA5A 3EU5A 3HXCA 3DSVA 1O1SA 3PZ3A 3PZ4A 1TN7A 1D8EA 1QBQA 1TNZA 2ZIRA 2ZISA 1N9AA 2F0YA 4EHMA 3Q73A 4GTOA 1JCRA 3HXDA 3KSQA 3Q7FA 1O1RA 3E34A 1FPPA 3Q75A 3E37A 4GTRA 1X81A 1TNYA 2H6FA 1SA4A 1N94A 4LNGA 3PZ1A 4YDOA 3HXFA 4L9PA 1TN8A 3SFYA 3DSSA 3HXBA 3EUVA 4GTVA 1N4SA 1N4PA 1D8DA 1JCSA 3SFXA 1LD8A 3KSLA 1FT1A 3DSUA 1MZCA 1N4QA 1NL4A 3HXEA 1DCEA 1N4RA 1KZOA 1N95A 2IEJA 3DSWA 3PZ2A 4GTMA 3E33A 1S63A 1TNOA 2H6IA 3DRAA 4LNBA 3C72A 3DSTA 3DSXA 1LD7A 1KZPA 4YDEA 1NI1A 1TN6A 1TNUA 4GTPA 1S64A 3E30A 2H6GA 2BEDA 2R2LA 1LTXA 1TNBA 1FT2A 3Q78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTQ A;  3E32 A;  4MBG A;  4GTS A;  3Q7A A;  1JCQ A;  3Q79 A;  3DPY A;  2H6H A;  4GTT A;  1O5M A;  1O1T A;  1SA5 A;  3EU5 A;  3HXC A;  3DSV A;  1O1S A;  3PZ3 A;  3PZ4 A;  1TN7 A;  1D8E A;  1QBQ A;  1TNZ A;  2ZIR A;  2ZIS A;  1N9A A;  2F0Y A;  4EHM A;  3Q73 A;  4GTO A;  1JCR A;  3HXD A;  3KSQ A;  3Q7F A;  1O1R A;  3E34 A;  1FPP A;  3Q75 A;  3E37 A;  4GTR A;  1X81 A;  1TNY A;  2H6F A;  1SA4 A;  1N94 A;  4LNG A;  3PZ1 A;  4YDO A;  3HXF A;  4L9P A;  1TN8 A;  3SFY A;  3DSS A;  3HXB A;  3EUV A;  4GTV A;  1N4S A;  1N4P A;  1D8D A;  1JCS A;  3SFX A;  1LD8 A;  3KSL A;  1FT1 A;  3DSU A;  1MZC A;  1N4Q A;  1NL4 A;  3HXE A;  1DCE A;  1N4R A;  1KZO A;  1N95 A;  2IEJ A;  3DSW A;  3PZ2 A;  4GTM A;  3E33 A;  1S63 A;  1TNO A;  2H6I A;  3DRA A;  4LNB A;  3C72 A;  3DST A;  3DSX A;  1LD7 A;  1KZP A;  4YDE A;  1NI1 A;  1TN6 A;  1TNU A;  4GTP A;  1S64 A;  3E30 A;  2H6G A;  2BED A;  2R2L A;  1LTX A;  1TNB A;  1FT2 A;  3Q78 A; 
#chains in the Genus database with same CATH topology
 3E32 A;  5JJ6 A;  3ZXS A;  4UQZ A;  4GZ3 A;  2HE0 A;  1FVH A;  2WXR A;  4GA0 A;  3ZVV A;  1O1S A;  2UY1 B;  2YHC A;  3ISM C;  4XX5 A;  2B0O E;  1K8K G;  2F37 A;  4EEC A;  4APO A;  4RG6 A;  2WXI A;  5AQ9 A;  4HRN A;  4HRM B;  3MGB A;  3FTZ A;  3WG7 E;  1PAQ A;  2P9N G;  1HX8 A;  4LEU A;  3CHR A;  1X81 A;  1Y6I A;  5AAO A;  1NFI E;  1N94 A;  4V3I A;  2V5F A;  3S7D A;  2OND A;  1OUV A;  3QAQ A;  5AN8 A;  3NB2 A;  3CVV A;  4HVB A;  4GPK A;  1N4Q A;  3NOG D;  5KCM A;  4GA1 A;  2PQR A;  3SF4 A;  3SBT B;  4I2Z A;  2LXM A;  2NC9 A;  3UMV A;  4XIF A;  1TJF A;  3FH8 A;  1MX4 A;  3RAU A;  2WXP A;  3SHF A;  2WXG A;  4WNF A;  1NI1 A;  2WQ7 A;  3WXX A;  1DVP A;  2VGY A;  1OWL A;  3UIP C;  4JPS A;  3RRN B;  3AG3 E;  3UT4 A;  5AQB A;  3ZFW A;  4LG6 A;  3UPV A;  3CIA A;  3Q47 B;  5HKP A;  2WXN A;  2P9L G;  5G04 C;  3FU5 A;  5FQ7 A;  4JA7 A;  3FTW A;  2Y4T A;  4YDY A;  4AJW A;  2E0I A;  2V4L A;  1HU3 A;  1JCR A;  4I1O B;  1WAO 1;  3TJP A;  1PY1 A;  5A7D B;  3QDN A;  3TWU A;  3SZ7 A;  3T5X A;  3Q4A B;  4AY5 A;  3FUF A;  4GCO A;  4MS6 A;  4DX6 D;  4Q69 A;  4GTV A;  3FFL A;  1E8W A;  3PEV B;  5E76 A;  3ZHE B;  1UJK A;  3G2U A;  1ELK A;  3HRA A;  4ABN A;  3U4T A;  2XPZ A;  3KSL A;  2QY7 A;  3PE3 A;  1YYH A;  1AP7 A;  3EDT B;  1UG3 A;  3JXI A;  4J8F A;  2RD0 A;  4UI9 K;  2KCV A;  4EPZ A;  2X6I A;  3Q15 A;  4AY6 A;  4IYP A;  1X5B A;  4GTM A;  1Z6T A;  4N5C A;  2P9U G;  3NBN B;  5BPP A;  2MOW A;  2PNN A;  3DSX A;  5KWD A;  5CRV A;  5HS0 A;  1NA0 A;  3CHM A;  4ANV A;  3FUE A;  1YCS B;  1H0A A;  4UQY A;  2R2L A;  5HI7 A;  2QFC A;  5FIO A;  1FT2 A;  3QB2 A;  4N2S A;  3JXJ A;  4E6H A;  4GMJ A;  3PE4 A;  2H6H A;  4FLH A;  3PZ3 A;  2VSY A;  3ML8 A;  5ENO D;  5B1B E;  3ZHE A;  2GW1 A;  4DX7 D;  3LPZ A;  5KJK A;  4BER A;  2ZIR A;  2XZT G;  3B7R L;  2XS1 A;  4BT9 A;  3GW4 A;  2JEK A;  1EDU A;  3QOU A;  5AQA A;  3U64 A;  4CEM A;  3ZYK A;  5E75 A;  2X3M A;  4I6E A;  3UKR G;  2NSZ A;  3CR3 A;  1N0Q A;  2QC9 A;  2CHZ A;  3LVQ E;  2HYZ A;  4U8Y D;  4N39 A;  3C98 A;  3D3M A;  1S70 B;  2HO1 A;  1FVF A;  4J0U A;  3LJ3 A;  4B94 A;  5FZR A;  4U0Z A;  3URZ A;  2PQN A;  3EHR A;  2XHE A;  5KJN A;  4XI0 A;  4EZK A;  3D9N A;  2MHK A;  1S63 A;  1TNO A;  5FT9 A;  3TG4 A;  4OVV A;  4HS2 A;  3ZIM A;  2PZI A;  5BW8 C;  3RSE G;  3ESL A;  3SNX A;  4JC8 A;  3E30 A;  5LFA A;  3D9I A;  1K3Z D;  4FHK A;  4I43 A;  4I9C A;  2AWI A;  3CK7 A;  4D10 C;  1BD8 A;  2JAB A;  5DBK A;  5G04 J;  4JHJ A;  4YVQ C;  2LNI A;  2ETC A;  1DC2 A;  2P2C P;  1TYQ G;  1E90 A;  1IYG A;  1OY3 D;  4O6F A;  2M63 A;  4Q94 A;  4HOS A;  1SA5 A;  4OYS A;  4FHJ A;  3ASN E;  1OWM A;  4H7X A;  3DWL G;  1QBQ A;  4H7Y A;  4U7E B;  1TEZ A;  4KVM A;  2IFU A;  4BX8 A;  1UN9 A;  3BQO A;  4LNU D;  1E7U A;  3DPD A;  2XGS A;  3VTY A;  4KVO A;  1TNY A;  3V31 A;  4YDO A;  4BTB A;  3B7T A;  4N3A A;  3AG4 E;  3UX4 A;  2J49 A;  2BUG A;  3ESK A;  2WVI A;  2FBN A;  1DCE A;  4LSZ E;  4A63 B;  4Z68 A;  2AVP A;  4J8E A;  1QZ2 A;  3PEU B;  4FUL A;  3FEY A;  5T4Y A;  1UW4 B;  5CMW A;  1H2T C;  2P9P G;  2WMO A;  3FU0 A;  4G26 A;  4ATZ D;  3FH7 A;  1KZP A;  4UI9 C;  3ZNG A;  1SQM A;  3NQP A;  2YQ8 A;  4YND A;  2QYU A;  5AEN A;  5BNW A;  1AWC B;  5ITZ F;  2ION A;  2V0P A;  3UXG A;  1H6O A;  1JCQ A;  3Q79 A;  3MV3 B;  3TWS A;  3AS4 A;  3IBE A;  4GTT A;  2EQX A;  2VSN A;  3QWV A;  1Z3X A;  3D9H A;  3PZ4 A;  4K5A B;  4WNG A;  5AJD A;  1N9A A;  3PZD A;  4NIK A;  3W9F A;  3ZU7 B;  3J5Q B;  4ACL A;  4MLP A;  5EIL A;  4Y6C A;  1OT8 A;  2XEV A;  3RRU A;  4RVB A;  4CRW A;  2XEH A;  2VQ2 A;  4L7T A;  4I6J A;  3RKV A;  3HXB A;  4HXI A;  3ZPJ A;  5G2N A;  1U3C A;  3AS8 A;  3AG1 E;  3LDZ A;  4O60 A;  3CVN A;  3V79 K;  3IKO B;  4TV3 A;  4ZHB A;  4DPR A;  4EBA G;  3OXG A;  3LY8 A;  3UUX A;  5AJL A;  5D0Q D;  2V4H C;  3CHP A;  5LOZ A;  4YDW A;  3SD5 A;  3U66 A;  2J09 A;  2YNQ A;  2WPV A;  3PZ2 A;  4K03 A;  3E4B A;  4C0E A;  1DCQ A;  2VSX E;  1EF1 C;  4J8S A;  1SW6 A;  1ZU2 A;  1RZ4 A;  2OCC E;  1E96 B;  4UUC A;  3SQV A;  2H6G A;  4WWO A;  2PM7 A;  4FLB A;  2J07 A;  2FO7 A;  4GZD A;  4JVS A;  4ANX A;  4GTQ A;  3D9L A;  2DZO A;  4W9R A;  4O1O A;  2DYR E;  5FIN A;  2V8S E;  2PM6 A;  4K0R A;  4HB5 A;  5CHE E;  4TRQ A;  5A6C A;  2IO2 C;  5BV1 A;  3FDH A;  1JUQ A;  4KT6 B;  3HHM A;  3QK0 A;  4EZJ A;  2L0T B;  3MV2 B;  4XE0 A;  4HOR A;  1JWF A;  4KBQ A;  3PH0 C;  4MKT A;  4YVO A;  4ANW A;  1SZA A;  2C0M A;  3D9M A;  1WG0 A;  4C0M A;  5G55 A;  3FTY A;  3QJZ A;  3ASO E;  2J4B A;  3IV0 A;  4GML A;  2DIW A;  1H6K A;  5KJL A;  1VDY A;  1FT1 A;  3DBS A;  4DI4 A;  4HLL A;  3TWQ A;  5C2Y A;  4C48 B;  4G23 A;  3G2T A;  3FH5 A;  5ANR A;  3Q9N C;  4UI9 J;  4HBD A;  3L82 A;  3APD A;  1NP7 A;  3CHO A;  3I5P A;  3FUM A;  3J5P A;  1S0P A;  2WMN A;  3NF1 A;  4BTA A;  1JWG A;  2HM8 A;  3FTU A;  4ILI A;  1NZN A;  2R59 A;  3ZYM A;  2OOE A;  3SI5 A;  4JEU A;  2V5Q C;  3D9J A;  3MYV A;  4F1S A;  3S7F A;  3APC A;  3VLF A;  3GZ2 A;  4CDN A;  2WXH A;  2P9I G;  3CSF A;  1EYH A;  2XRY A;  2Q7F A;  4OAV B;  1MQS A;  3UQ3 A;  4LUN U;  3Q73 A;  2WXM A;  5CEC B;  3Q7F A;  3CVX A;  3RIB A;  3MA5 A;  1ZBP A;  3B13 A;  3QC1 A;  2QZA A;  4GU5 A;  1UOH A;  2XEN A;  2AXU A;  3TG5 A;  3DSS A;  4G1T A;  3BU8 A;  5ENR D;  2XPY A;  3FUI A;  5BT1 A;  1INZ A;  1N52 A;  1N4S A;  5ANL A;  4I9E A;  1A5E A;  3L22 A;  1H6P A;  1OCC E;  4KYO B;  3CHQ A;  4UWH A;  5HRY A;  3Q9U C;  5CED B;  2AXZ A;  3AU5 A;  3ZXP A;  3CGH A;  2GRM A;  4AIF A;  3N71 A;  1OWP A;  3KEA A;  1WM5 A;  3ML9 A;  4GTP A;  2F8X K;  4U96 D;  2FUL A;  4AM9 A;  2AXV A;  3FUH A;  4IUL A;  2EIK E;  1TNB A;  4WWN A;  3OAW A;  3D9O A;  4HFG A;  4RG9 A;  1KPS B;  4DI3 A;  3ABL E;  1HF8 A;  3EU5 A;  4URK A;  5CER B;  3EIJ A;  5JJ7 A;  4U0S A;  1K1A A;  1E8Y A;  3PVL A;  3EHQ A;  3UM3 A;  1TNZ A;  3ZEF A;  2X6J A;  5T8I A;  4CDR A;  3HIZ A;  4NUR A;  3T5V A;  3KSQ A;  2IF4 A;  3TXM A;  3FUD A;  4GCN A;  3Q75 A;  5ENN A;  1H19 A;  2GGF A;  5CCM A;  5BXO A;  2J08 A;  3PRZ A;  1TN8 A;  1WDY A;  3VTX A;  1MHQ A;  2Y3A A;  5EID A;  4APF A;  4CGV A;  3FTX A;  4TXQ A;  1L5J A;  5EYP F;  4U04 A;  5A23 A;  3LXU X;  3S7B A;  1N4P A;  1D8D A;  3NAW A;  2I1K A;  2XS8 A;  4LRZ A;  3UIO C;  4XKC A;  3U3W A;  3CKC A;  4JA9 A;  3UKU G;  2EIM E;  2WXF A;  4A1G A;  3JUE A;  5FQ6 A;  4GAA A;  4BET A;  2R02 A;  3DSW A;  4TXP A;  4DLO A;  4U8H A;  4I6G A;  5EKQ D;  3C72 A;  3ABK E;  5LP0 A;  4N5Q A;  3P1U A;  4PS7 A;  4M7C A;  4HOT A;  1S64 A;  3BEE A;  3DEO A;  4F7A A;  3CVQ A;  5LCW J;  3ONL A;  3P2B A;  3HYM B;  3PUJ A;  3S7J A;  4XI9 A;  2OEV A;  4A3T A;  1A17 A;  3EHM A;  1Q2Z A;  4HRL A;  4TXR A;  1IHG A;  1IQU A;  1QNF A;  4C9B B;  5J90 A;  3DSV A;  3I4R B;  5FQ8 A;  3OXF A;  4B89 A;  4GTO A;  4FP7 A;  4ZFH A;  5FWQ A;  1P5Q A;  4UWG A;  3DXM G;  1V54 E;  2UWJ G;  4TUU A;  2ZGG A;  4LCT A;  1HG2 A;  2LUH A;  1FCH A;  1HZ4 A;  1OCR E;  2HR2 A;  5CCL A;  1BI7 B;  3SFX A;  1LD8 A;  4HOQ A;  4ILH B;  1QYM A;  3KS2 A;  4XKB A;  2NXP A;  3CK9 A;  5EYL A;  1N95 A;  4BWR A;  2CG3 A;  4BES A;  1SZ9 A;  3FUJ A;  4AVX A;  5EX0 A;  2FI7 A;  2XGM A;  4U63 A;  3CHS A;  4ACK A;  3CLJ A;  1OXJ A;  2ETA A;  4N3C A;  3FWV A;  3QWW A;  3ASG A;  5JA4 D;  3R7Q A;  1TNU A;  2LAI A;  2EIN E;  2KC7 A;  5AYW D;  3KAE A;  4X8Q A;  1IKN D;  2XRZ A;  1MYO A;  3LKU A;  4QQI A;  3NZU A;  1QQE A;  5ENS D;  5AAR A;  4DUI A;  4A55 A;  2AJA A;  2E2E A;  4MBG A;  3D9K A;  3O4Z A;  3TL5 A;  1LF8 A;  5AIJ A;  2I9C A;  3LY7 A;  2MYO A;  2CHX A;  2ILR A;  4BEP A;  3C3R A;  1UN8 A;  2GRN B;  4RQI A;  2XPI A;  1O1R A;  3AG2 E;  1FPP A;  3T8K A;  3I4G A;  4J8Y A;  3ZUV B;  3E37 A;  2L0I A;  2BKK B;  4LNG A;  4KZ0 A;  2KBX A;  3LS8 A;  5CBO A;  3LYA A;  5T3R A;  4GYO A;  4J6I A;  1OWO A;  1NL4 A;  4FJZ A;  1KZO A;  3FU6 A;  2OVB A;  4NQ0 A;  5JJT A;  5FQ4 A;  2A4Z A;  3E33 A;  2IJG X;  3C5R A;  4JB8 P;  3TGO A;  4DX5 D;  1XGW A;  3ONK A;  5M72 A;  2XQ0 A;  4GYW A;  2FF4 A;  4ME2 A;  5ARG A;  3TWT A;  3IEG A;  3MKR A;  4I1M A;  3KD7 A;  3TWV A;  4N2Q A;  4U8V D;  5KNG A;  4F1P A;  1W3B A;  3C3O A;  3UM1 A;  1LTX A;  1HE8 A;  4FAD A;  3NZS A;  5LX8 A;  2KCK A;  4HI8 A;  4L23 A;  4HQD A;  2CFZ A;  3ZKJ A;  3F6Q A;  3K9I A;  4GB9 A;  4AEZ C;  3UT7 A;  3FEX A;  2L6J A;  3U9W A;  4M3O A;  5J08 A;  2EIL E;  1BI8 B;  4Y6W A;  5C1D A;  3OTN A;  3UM2 A;  3AJI A;  3MKQ B;  4EBA A;  4WNE A;  3CVW A;  5D2M C;  3CV0 A;  1MX6 A;  5IY5 E;  4GTR A;  3JCK C;  3PZ1 A;  2J8S D;  4L9P A;  4L1B A;  2CFU A;  4F53 A;  5BXU A;  5JHA A;  3EUV A;  3ZYL A;  4E85 A;  1IHB A;  3CKB A;  3ULQ A;  3C3Q A;  3SBS A;  4AV7 A;  1H2V C;  3GZ1 A;  2IY0 C;  3CEQ A;  3HXE A;  4L2L A;  3TWW A;  4DX1 A;  4P29 A;  4KMO A;  3SGH A;  5BV0 A;  3JQ1 A;  3RU0 A;  3FTV A;  3G2V A;  2DBA A;  1LD7 A;  4UWL A;  1YA0 A;  1RW2 A;  3BUA A;  2ZU6 B;  3ZW3 A;  4PS8 A;  4I17 A;  5CMY A;  3MKQ A;  2FO1 E;  2WQ6 A;  3O48 A;  4JXT A;  2R5S A;  3Q78 A;  5ENQ D;  4WUY A;  2GRO B;  1HXI A;  3ASD A;  3PS6 A;  4FC8 A;  4GTS A;  3Q7A A;  1U3D A;  2Y69 E;  3CST A;  2B6C A;  4KZC A;  3HDX A;  4BSX A;  4J8D A;  2NYJ A;  3PNL B;  4CZ2 D;  2WXL A;  3CVU A;  2FEZ A;  4B0Z A;  3RJV A;  4EHM A;  4JEH A;  1YMP A;  4A1S A;  3T9K A;  5KBA A;  4AOF A;  3MJW A;  3HXD A;  3ZYQ A;  5LCW C;  5FTP A;  3L13 A;  2XCC A;  4BY6 A;  4KXK B;  3AU4 A;  5FZQ A;  3HVE B;  3SFY A;  4I1A A;  4XEI G;  3L6A A;  4L2Y A;  2VJ8 A;  1TR4 A;  5HQ8 A;  2R17 C;  3FTS A;  2XZD G;  4BT8 A;  5ENT D;  1U2V G;  2UY1 A;  2OV8 A;  4LER A;  2GRQ B;  4IN3 B;  5KNH D;  4F3V A;  5G05 C;  3JYS A;  2GRL A;  2IEJ A;  5EDS A;  3SO8 A;  2EIJ E;  2LXL A;  2KCL A;  3QWP A;  3LJN A;  3B7S A;  4IRU A;  4LNB A;  3MCX A;  2IQC A;  4B93 B;  1N11 A;  2WB2 A;  3EJN A;  4JHR A;  4BSZ B;  1HS6 A;  2XGO A;  3MX3 A;  4PDX A;  1HO8 A;  5B1A E;  3G2S A;  2VTB B;  2YHE A;  3CQC B;  2J9Q A;  4BFR A;  2VGX B;  1Z5S C;  4NRH B;  3HVE A;  3D9P A;  1H2U A;  3NOC D;  2IO3 C;  3FHE A;  3KEZ A;  2L9B A;  3R7R A;  3IXE A;  2I2O A;  4UWK A;  4GYY A;  4RSY A;  2AW6 A;  3MEK A;  5ENP D;  3CQG B;  4JW1 A;  3TWR A;  2ZGD A;  2BF0 X;  2KXP C;  5ARF A;  2BKG A;  4GA2 A;  2DZN A;  2J4D A;  1GW6 A;  4GZ6 A;  3HG0 D;  2H6F A;  1OCO E;  4OVU A;  3LEW A;  4PS3 A;  5CEA A;  3PNT B;  2KM4 A;  2RKK A;  3ABM E;  2WXO A;  3BG0 B;  2VTB A;  3APF A;  5EX3 A;  2CHW A;  1E7V A;  2X6H A;  4CCA A;  4PUC A;  3FUN A;  2VGX A;  3EHN A;  5DIZ A;  2WQH A;  2GRR B;  2LSV A;  2BTD A;  1OCZ E;  4JL0 A;  3MZL B;  4O1P A;  1XNF A;  3DRA A;  1D9S A;  1K1B A;  4R7L A;  4GPM A;  4G25 A;  4Q96 A;  3VLE A;  3EU9 A;  4G24 A;  5D66 A;  1E8X A;  4HI9 A;  1E8Z A;  1HFA A;  3UTM A;  4JHK A;  2R05 A;  3B95 A;  2Y4U A;  4K5B A;  3R9M A;  2WXK A;  1KLX A;  3TXN A;  3DPY A;  1N0R A;  5D0O D;  2WXQ A;  3GYZ A;  3HXC A;  1OWN A;  3LCA A;  1IXV A;  1B89 A;  2F0Y A;  3CK8 A;  3TAX A;  4F6R D;  5B3S E;  3LVR E;  4CT0 A;  4AP2 A;  4MRU A;  5JMN D;  1KT0 A;  3JQ0 A;  2A5E A;  4DRX E;  4HOU A;  2A5U A;  4NAC A;  4QFV A;  4DLQ A;  4OAU C;  3FP3 A;  2LAH A;  3SFZ A;  1G3N B;  1ELW A;  1NA3 A;  5KJM A;  5G05 J;  4K5C A;  3V2X A;  4U95 D;  2VYI A;  3FY4 A;  4RLY A;  3ULY A;  4HLE A;  4ANU A;  2MRI A;  2ETB A;  3PUK A;  1EPU A;  2WXJ A;  3CVY A;  2C2L A;  4GZC A;  4JZY A;  4WND A;  3FU3 A;  5CRU A;  4A3V A;  2GRP B;  4FA6 A;  1BPO A;  2L6B A;  4B8C B;  3DST A;  3Q49 B;  4XZ4 A;  2KZT B;  2X6K A;  3RRM B;  2P9K G;  3FUL A;  4TUM A;  2ZXW E;  3PRE A;  3T8M A;  1BLX B;  3BG1 B;  1BU9 A;  4G8K A;  3L17 A;  2VSO E;  1V55 E;  3GZS A;  3RO3 A;  4CYM D;  4I2W A;  5EIB E;  1ELR A;  4J7W A;  1O5M A;  1O1T A;  2XEE A;  2F8Y A;  2Y1L E;  3LY9 A;  3B7U X;  5CBN A;  2RFM A;  5H7P A;  4AXH A;  1TN7 A;  1D8E A;  2LO6 A;  1WY6 A;  3AS5 A;  2ZIS A;  3UI2 A;  4DK5 A;  2C0L A;  2I6H A;  3IHV A;  2QYJ A;  4GZ5 A;  2X38 A;  2DYS E;  2I1J A;  3ENE A;  3HXF A;  2VGE A;  3AAA C;  3DEP A;  3UT8 A;  3VLD A;  2KZT A;  3UIN C;  3ZGQ A;  3JUI A;  3QNK A;  3EIQ C;  2OVF A;  1JCS A;  2PL2 A;  1SVX A;  4GMR A;  1MZC A;  1ZB1 A;  3G2W A;  3L9T A;  3V30 A;  3W9G A;  3QKY A;  2XCB A;  1IQR A;  5FZS A;  1UJJ A;  2OEW A;  2H6I A;  3ZRH A;  4CDM A;  4ATG A;  2DVW A;  1TN6 A;  3L16 A;  1HH8 A;  3L54 A;  3UM0 A;  3ASF A;  3ZN3 A;  3B7B A;  4UQX A;  4JD2 G;  4FU3 A;  1MX2 A;  3DXK G;  2BED A;  4HNA D;  3ASH A;  1Y8M A;  4B8A A;  1PC2 A;  2R03 A;  2CG2 A;  4ILG A;  3ULE G;  1KT1 A;  1N54 A;  3RK6 A;  3FUK A;  1TJC A;  2RG8 A;  5BUZ A;  2IOS A;  4G2V A;  4G8L A;  5AQ7 A;  2JLB A;  4DJA A;  4BX9 A;  3SY2 A;  4WAF A;  3X2Q E;  3E34 A;  2X6F A;  2Y0B G;  2P58 C;  2DCP A;  4EZL A;  5FJY A;  1SA4 A;  1JPL A;  3OXL A;  3IHY A;  2YIN A;  2KAT A;  1Z3Y A;  3QAR A;  3PDN A;  2P9S G;  4FJY A;  3DSU A;  4WWP A;  2IU1 A;  1HG5 A;  1N4R A;  3L08 A;  3CVL A;  3RO2 A;  4DX2 A;  3TWX A;  4U07 A;  4G11 A;  2LSU A;  2IOL A;  3I3N A;  4UWF A;  3V2O A;  2DWZ A;  3S2A A;  2RFA A;  3R9A B;  3CVP A;  4CT4 A;  4YDE A;  4U0U A;  4CGW A;  1DNP A;  3Q5M A;  5EN5 D;  4PH4 B;  2WM9 A;  4EQF A;  5JHB A;  4N3B A;  1MJ0 A; 
#chains in the Genus database with same CATH homology
 4GTQ A;  3E32 A;  4MBG A;  4GTS A;  3Q7A A;  1JCQ A;  3Q79 A;  3DPY A;  2H6H A;  4GTT A;  1O5M A;  1O1T A;  1SA5 A;  3EU5 A;  3HXC A;  3DSV A;  1O1S A;  3PZ3 A;  3PZ4 A;  1TN7 A;  1D8E A;  1QBQ A;  1TNZ A;  2ZIR A;  2ZIS A;  1N9A A;  2F0Y A;  4EHM A;  3Q73 A;  4GTO A;  1JCR A;  3HXD A;  3KSQ A;  3Q7F A;  1O1R A;  3E34 A;  1FPP A;  3Q75 A;  3E37 A;  4GTR A;  1X81 A;  1TNY A;  2H6F A;  1SA4 A;  1N94 A;  4LNG A;  3PZ1 A;  4YDO A;  3HXF A;  4L9P A;  1TN8 A;  3SFY A;  3DSS A;  3HXB A;  3EUV A;  4GTV A;  1N4S A;  1N4P A;  1D8D A;  1JCS A;  3SFX A;  1LD8 A;  3KSL A;  1FT1 A;  3DSU A;  1MZC A;  1N4Q A;  1NL4 A;  3HXE A;  1DCE A;  1N4R A;  1KZO A;  1N95 A;  2IEJ A;  3DSW A;  3PZ2 A;  4GTM A;  3E33 A;  1S63 A;  1TNO A;  2H6I A;  3DRA A;  4LNB A;  3C72 A;  3DST A;  3DSX A;  1LD7 A;  1KZP A;  4YDE A;  1NI1 A;  1TN6 A;  1TNU A;  4GTP A;  1S64 A;  3E30 A;  2H6G A;  2BED A;  2R2L A;  1LTX A;  1TNB A;  1FT2 A;  3Q78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...