4GTQA

Ftase in complex with bms analogue 12
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
315
structure length
315
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Development of Selective, Potent RabGGTase Inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type-1
total genus 122
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 4gtqA00
2H6FA 3DSWA 3C72A 1D8DA 3DPYA 1JCQA 4MBGA 1O1SA 1O5MA 3SFYA 3Q79A 1SA5A 3E34A 2BEDA 1S64A 3DSTA 3PZ3A 3Q73A 3DSVA 3PZ4A 1N4SA 3E37A 3KSLA 3DSUA 3Q7FA 4YDOA 4GTOA 4GTMA 1QBQA 3HXFA 1N4QA 1N4RA 1JCSA 1NL4A 1LD8A 3DSSA 3HXEA 4LNGA 4GTVA 2ZIRA 1S63A 1LTXA 2IEJA 3PZ1A 4L9PA 1X81A 2F0YA 4LNBA 4GTQA 3DSXA 3Q78A 4GTTA 1FT1A 3EU5A 3HXCA 4GTPA 2H6IA 4EHMA 4GTRA 3PZ2A 1N94A 2H6GA 4GTSA 1FT2A 3EUVA 1TNYA 1LD7A 1MZCA 4YDEA 3E33A 3Q75A 1O1RA 1DCEA 1TN7A 1N95A 1N9AA 1TNBA 1TNOA 1TNZA 3DRAA 3Q7AA 3SFXA 1NI1A 1D8EA 1O1TA 3E30A 3E32A 1TNUA 1FPPA 1TN6A 2H6HA 1KZOA 1TN8A 1JCRA 3HXDA 1SA4A 2ZISA 3KSQA 1N4PA 2R2LA 1KZPA 3HXBA
chains in the Genus database with same CATH superfamily
3DSWA 3ZKJA 4CDNA 1JWGA 1O1SA 2XPIA 4J6IA 2EQXA 4TRQA 3ASGA 1H19A 1Y8MA 4B89A 1JUQA 5AARA 4J8YA 3ESLA 3SBTB 3UX4A 5AQBA 4G26A 5EYLA 5G04J 4CZ2D 1NL4A 1Z3YA 4I43A 3QNKA 4UWGA 3MV2B 2KCVA 2OEVA 3PS6A 4UWLA 3IKOB 3AG3E 5B1AE 1OXJA 4O1OA 4A3TA 2PZIA 2XGMA 1NZNA 2BF0X 2WXPA 5BV0A 3AJIA 3TWVA 1NI1A 4GCOA 1Z5SC 3L54A 3MGBA 4A55A 3Q9UC 4DX7D 5FQ8A 2GRLA 4WUYA 3ZXPA 3JQ0A 5JJ6A 3L6AA 3SI5A 5CEAA 2WXIA 2CFUA 1IQRA 3ZXSA 4KVMA 2FEZA 5ENPD 1EYHA 5T4YA 2I9CA 4V3IA 4DX6D 4B94A 3VLFA 2HYZA 5LFAA 1U2VG 4DI3A 2E2EA 2FI7A 4QQIA 3Q73A 2MYOA 2YHEA 3UT7A 4YDOA 2WPVA 1E7UA 5H7PA 4GU5A 5B1BE 3AS8A 4I6GA 3F6QA 5CMWA 4H7XA 1LD8A 3SFZA 4G2VA 4BETA 2WMOA 2IOLA 4N3AA 3Q15A 1E8YA 1N54A 5LCWJ 4HBDA 5KCMA 3ZFWA 3PZ2A 4EQFA 3VLEA 4ANVA 3JXJA 3Q49B 3KAEA 4K5AB 3B7SA 3Q75A 4C48B 4XX5A 3ML9A 1TNOA 2IO3C 5CBNA 4HS2A 1XNFA 5A6CA 3AS5A 3AU4A 3MEKA 3ZHEA 3MV3B 3QJZA 2NYJA 2L6BA 3UM3A 4AIFA 3FUIA 1HX8A 4ILIA 4UI9K 2HE0A 2IU1A 4WWOA 2VSOE 2DYRE 4FADA 1EDUA 4XI9A 2J07A 2WMNA 3BU8A 5A7DB 1MX2A 3D9MA 3ULYA 4KZCA 3B7TA 4BERA 2OVBA 4A1GA 3MA5A 4IN3B 3SFYA 4BTAA 3UT4A 3QARA 1K3ZD 2DYSE 2EIKE 4XEIG 3EIQC 5ENOD 4BEPA 2BEDA 5CEDB 2HR2A 3MYVA 3PDNA 3AU5A 3X2QE 3CR3A 3P2BA 1V54E 3RRUA 4GMLA 2V0PA 2KBXA 1WG0A 1N4RA 5KJKA 1H6KA 3PNTB 4JPSA 4CRWA 2X6KA 5FZRA 5EDSA 1HO8A 1S63A 3EHQA 4L9PA 5HQ8A 3T8MA 3L17A 2L6JA 3NQPA 1H6OA 1SZ9A 1XGWA 3RAUA 3R9AB 4E6HA 4I6JA 2MHKA 4MKTA 4RG6A 3ML8A 4UI9C 3ABME 3E33A 1NFIE 4OAUC 4LUNU 3FUNA 1Y6IA 5BXOA 3UPVA 2I6HA 4HOUA 3FUHA 2VTBA 1DCQA 3AG2E 5BXUA 4AY6A 2ZXWE 3CIAA 3UKRG 3Q9NC 3QB2A 5FZQA 2IFUA 3NZUA 3GZ1A 3APDA 4EZLA 2QYUA 3ZYLA 2FBNA 5HKPA 3TGOA 4CEMA 3CVPA 3CVVA 2VGXB 3C72A 4JEUA 4AV7A 2GRNB 3G2SA 5KBAA 4XIFA 3UQ3A 2KCKA 1H2VC 5KJNA 3CGHA 4AEZC 1PY1A 3CK7A 2VSXE 1E7VA 2RKKA 3OXFA 2Y0BG 1KPSB 1QBQA 1SZAA 1JCSA 4HVBA 3JUEA 4AVXA 1YCSB 3P1UA 4G24A 4GTVA 1TJFA 2XEVA 3G2VA 1SVXA 5EILA 4EHMA 5FINA 4ANXA 5BNWA 4IULA 5CCLA 2XZDG 1SW6A 2I1KA 4NRHB 1OWMA 3ONKA 4JA7A 4FJYA 4M7CA 1E8WA 5FZSA 2V4LA 3KEAA 3Q7AA 3D3MA 3QC1A 4F6RD 3CVUA 5ENQD 4RSYA 2X38A 1OCRE 3CKCA 4AJWA 2LO6A 2NC9A 3WXXA 4NQ0A 5LOZA 4RVBA 2F37A 2PL2A 4GMRA 1E8ZA 4M3OA 4O1PA 3ULQA 4L2YA 5G04C 3G2UA 2WXOA 5AQ7A 2WVIA 1DVPA 3IBEA 3FHEA 3TWRA 5G55A 4TV3A 4JEHA 1ELWA 2XS8A 1OWLA 3V2XA 4EPZA 2JEKA 4JVSA 3HDXA 1TR4A 2I1JA 4J7WA 5E76A 4GYOA 1BI7B 2XZTG 3E4BA 3CK8A 3KSLA 4GZ5A 2X6IA 2J09A 5DIZA 3VTXA 3FULA 2WB2A 5ARGA 2L9BA 4YDWA 5FQ4A 4FU3A 5EIBE 4WNFA 1Z6TA 4U8HA 4URKA 3IHVA 3QWWA 4B8AA 4YVQC 3SO8A 4CGVA 2DCPA 3MCXA 3FTXA 2P9UG 2OV8A 1IKND 4N5QA 2VSNA 4OVVA 3ZU7B 4BESA 5JHBA 1FVHA 4B93B 2M63A 3QAQA 5D66A 1H2TC 2QFCA 4CCAA 2QY7A 4MS6A 4MRUA 1MJ0A 3U64A 2XEHA 2XEEA 4DPRA 4HI9A 4A63B 3V31A 1S0PA 2PQRA 4GMJA 2R02A 5CHEE 4GA2A 4E85A 4JD2G 2WXGA 3TWUA 3ASOE 2IJGX 2AXVA 3I4RB 3RK6A 1P5QA 4O60A 2AXUA 2C0LA 1MX4A 4GYYA 3RJVA 3DXKG 3D9OA 3ZYMA 5CCMA 2PM7A 3ONLA 2A4ZA 4WWPA 4ZHBA 3FUDA 1RZ4A 1TYQG 1KLXA 4WNEA 4UI9J 1Z3XA 2V8SE 2IEJA 5KNHD 3KD7A 3FTWA 4GTPA 3APCA 4GYWA 4BSZB 1YA0A 2Y69E 3PE3A 2H6GA 4GZCA 3T8KA 3QWPA 4JXTA 3UIPC 3EJNA 3CVYA 1TNZA 3FP3A 2P9KG 2F8YA 2IY0C 3O48A 3ESKA 1N11A 2WQHA 3UI2A 1ZBPA 3NAWA 3VLDA 4TXRA 3DWLG 2JLBA 3B7UX 5EKQD 3UM1A 1RW2A 3LY9A 4I2WA 1JWFA 2XGOA 2WXQA 1S70B 3PZDA 1N0RA 2OVFA 5AN8A 3UINC 3ENEA 3FUKA 4F7AA 4YDYA 3HVEA 4FLBA 1OCOE 3CV0A 1JCQA 1IQUA 4G23A 2R59A 3JCKC 3E34A 2AJAA 3QOUA 3DEOA 3K9IA 3CVNA 4NIKA 1OT8A 1UOHA 4H7YA 3E37A 1MHQA 4C0EA 3ZNGA 3AG4E 3NF1A 3S7DA 3I3NA 1A17A 1OWPA 1YYHA 2GRPB 3EHMA 5G05J 4GTQA 3DSXA 3PNLB 2R5SA 3EU9A 4U04A 1K1AA 4U7EB 1TEZA 1UJKA 3QK0A 2IO2C 2VQ2A 3AG1E 4Z68A 5BPPA 4BX8A 4U95D 4CDRA 1O1RA 3L13A 4TUUA 1HG2A 3D9NA 4TXPA 3PREA 4LSZE 5ENTD 4RG9A 3JQ1A 5EN5D 4HB5A 4IRUA 4FLHA 2X6FA 3ZN3A 5CERB 5FTPA 2ETCA 1BU9A 2V5FA 3FH7A 3V79K 5ANRA 2MRIA 1SA4A 3LEWA 1IXVA 4OVUA 5AQ9A 3PUKA 2R03A 2P9NG 3UXGA 4MBGA 2BTDA 4FHJA 4C0MA 2XS1A 3CLJA 4NURA 5ENNA 2BUGA 2YHCA 2EIME 4L23A 5CMYA 4WNGA 4FP7A 5LCWC 2IOSA 5C1DA 1AWCB 4HFGA 1UN8A 2RFMA 3ZRHA 3TG4A 2XENA 3HXFA 3Q47B 2F8XK 3HXEA 2R17C 3D9KA 3HIZA 2FULA 4LNBA 1FT1A 5M72A 2NXPA 4HLEA 2H6IA 4UWFA 3UIOC 2JABA 3FUJA 4OYSA 3IV0A 3FTUA 3C3OA 3AS4A 3CSFA 4L2LA 2MOWA 5AAOA 4JB8P 2UWJG 5BV1A 4D10C 2BKKB 2P9PG 4F53A 4OAVB 4GZ3A 3RRNB 2J8SD 3BG0B 4HRMB 2GW1A 5E75A 1OY3D 4K5CA 4ATGA 3ASDA 4BT8A 2KM4A 4NACA 2XCBA 3FH8A 2LXMA 3L9TA 4UQXA 4APFA 3NOGD 5CBOA 2Y4UA 1UW4B 1IYGA 4W9RA 5BT1A 4FHKA 3DPYA 4I1AA 4B8CB 3RIBA 4KBQA 4ACLA 2WXJA 4XKBA 4L1BA 4HXIA 3SF4A 2XCCA 2Y3AA 3DSVA 4HQDA 5AIJA 2IQCA 3UM2A 1V55E 4GAAA 3PEUB 3ISMC 3DPDA 2KZTB 4J8DA 4LNGA 2ONDA 3APFA 4JA9A 4UUCA 1ELKA 2V5QC 2L0IA 2UY1B 4A1SA 1L5JA 5D0QD 4MLPA 2YNQA 2LAIA 1FT2A 2RFAA 1LD7A 3B7RL 3PH0C 3U66A 3PEVB 2KATA 3UTMA 3FWVA 1N9AA 3KEZA 5AJLA 2CFZA 3RKVA 1LF8A 1IHBA 4GPMA 4GZDA 2DZOA 2OCCE 1HU3A 3TG5A 3HYMB 4J8EA 3T9KA 4AM9A 3CVWA 3RU0A 4DLQA 5G2NA 1X5BA 3ASFA 3SY2A 2WM9A 4LERA 4DRXE 1SQMA 5ANLA 5LX8A 3D9HA 2DZNA 2P9LG 5T3RA 1K8KG 3LCAA 3SQVA 4BT9A 3JXIA 4G25A 3LPZA 2ILRA 4UWKA 1N52A 1U3DA 2VSYA 3UUXA 3ZEFA 3BEEA 3L22A 2J4BA 3PZ4A 1KT0A 3CHSA 2ETBA 4Y6WA 4GTMA 3PUJA 4BSXA 3DXMG 5BW8C 4G1TA 3G2TA 2YINA 1X81A 2FF4A 2X3MA 2CHZA 3EHNA 4TXQA 4DK5A 3EUVA 1MZCA 1UN9A 4LG6A 4HORA 1EF1C 3C5RA 3MJWA 2WXHA 3FEYA 1TNBA 4U0ZA 5FJYA 2P58C 5AYWD 3UT8A 4DI4A 5JMND 2AVPA 5AQAA 3VTYA 2EIJE 4CT4A 3HRAA 1K1BA 1HS6A 3IXEA 3MKRA 5HI7A 3V2OA 5D0OD 4CGWA 2VYIA 2NSZA 3ZUVB 4UQZA 3KSQA 3LJNA 4WNDA 4U07A 2ZGDA 4DX1A 3BQOA 2DIWA 1EPUA 1MX6A 3LY8A 1ZB1A 3S7JA 4AP2A 2IF4A 1PAQA 3U3WA 3DEPA 1WM5A 3FUEA 3CQGB 4EZJA 2ETAA 3DSTA 1E8XA 3ZPJA 3T5XA 2LXLA 3IHYA 4K5BA 3W9GA 5FT9A 1FVFA 1BD8A 3DSUA 3Q7FA 1OWOA 3ABLE 3I4GA 3DSSA 3TJPA 4U8VD 4LRZA 3CK9A 4GCNA 4N39A 4ILHB 4XE0A 3HXCA 4CYMD 1N94A 2P9IG 3C3QA 3CHMA 2GRMA 4PS3A 1U3CA 4I1OB 2QYJA 1UJJA 1DCEA 4AXHA 1N95A 3R7QA 5J90A 1H0AA 2AW6A 4P29A 3ZHEB 2IONA 5T8IA 4U0SA 1KT1A 4GA1A 1NP7A 1O1TA 3EHRA 3V30A 4L7TA 2WXFA 3J5QB 4JHJA 4HLLA 4XI0A 3TAXA 4K0RA 1ZU2A 4I2ZA 5CRVA 5EX0A 1HXIA 2VGXA 5FQ7A 2XGSA 4K03A 4KYOB 4U8YD 4DJAA 2VGYA 2GRQB 3ULEG 2H6FA 2GRRB 3ZGQA 1HE8A 2GROB 3CSTA 3FEXA 3Q79A 1H2UA 1SA5A 3L08A 4CT0A 3PZ3A 2PQNA 1YMPA 4N3BA 2J49A 4N5CA 4GPKA 4C9BB 3LJ3A 1IHGA 3OAWA 5ENSD 3D9LA 2LNIA 3FTVA 2KXPC 4Q69A 2LUHA 4HI8A 3SZ7A 3CHOA 2YQ8A 3SGHA 1LTXA 2F0YA 2OOEA 4A3VA 3Q78A 4Y6CA 4WWNA 3EDTB 3RSEG 4GTSA 2AXZA 1JPLA 3LDZA 3CVXA 4I17A 5B3SE 3CEQA 3HHMA 2XPYA 2WQ7A 4LCTA 4JC8A 4HRLA 3SNXA 3E32A 4JZYA 3JUIA 3T5VA 3KS2A 4GB9A 4ANUA 4DX2A 5JHAA 3BUAA 4XZ4A 2CHXA 2UY1A 4I6EA 3LXUX 3UM0A 1TJCA 3OXGA 3D9IA 2R2LA 5FWQA 2DBAA 4LNUD 1KZPA 4JHRA 4B0ZA 4HOQA 4I1MA 4J8FA 3S7FA 5JJTA 1D8DA 2WXRA 2C0MA 1HG5A 3HG0D 3TL5A 1DNPA 5FIOA 1S64A 3D9JA 4X8QA 3ASNE 3CHRA 2XRZA 1HF8A 3SHFA 2FO1E 2KC7A 3B7BA 2AWIA 3PRZA 3SBSA 2XHEA 4AOFA 3R9MA 4GTOA 3QKYA 3UKUG 5AENA 3FH5A 2RG8A 4BX9A 1BI8B 3UMVA 1OCCE 2CG2A 2P2CP 5EYPF 4I9CA 3CHQA 5JJ7A 3B95A 3TWQA 1D9SA 4N2SA 4EBAG 4YDEA 4PS8A 4DLOA 3ZW3A 4BWRA 1WY6A 5JA4D 3PVLA 3GZ2A 3SFXA 5D2MC 4KXKB 2QZAA 4BY6A 3CKBA 4XKCA 2KCLA 2Y1LE 4FJZA 3S2AA 4JL0A 1FPPA 1TN6A 4PH4B 3FDHA 2J08A 2WQ6A 3MZLB 5C2YA 4O6FA 4J0UA 1TN8A 2V4HC 3CHPA 4HRNA 1QZ2A 2WXLA 4ATZD 1DC2A 3NOCD 5J08A 5FQ6A 4ZFHA 4Q96A 2BKGA 3FU5A 3URZA 3J5PA 3GYZA 5AJDA 3RRMB 1AP7A 4U63A 5ITZF 1E90A 2I2OA 3L16A 1NA3A 4JHKA 2ZIRA 3PE4A 4GTTA 3EU5A 5ENRD 2DVWA 5KWDA 3LVRE 2B6CA 4GTRA 3D9PA 4EECA 3ZVVA 5G05C 5HRYA 2FO7A 1QQEA 4GZ6A 2CG3A 3FY4A 4CDMA 1MQSA 2X6HA 5KNGA 3MX3A 1TN7A 1HFAA 1HH8A 1E96B 3ZYKA 2P9SG 2DWZA 5DBKA 3EIJA 2LSVA 2J4DA 3NB2A 1WDYA 1BPOA 2HO1A 4FA6A 4DX5D 5EX3A 2XPZA 5HS0A 2C2LA 1KZOA 3DBSA 4Q94A 4I9EA 3B13A 1JCRA 4HNAD 2XRYA 2X6JA 1PC2A 2E0IA 4AY5A 1HZ4A 4U0UA 2LAHA 3GZSA 1O5MA 5BUZA 3G2WA 4LEUA 4EZKA 4ABNA 3TWWA 1N4SA 3MKQB 3SD5A 4KT6B 5CECB 3FTSA 4UQYA 1N4QA 2R05A 2PM6A 1MYOA 3AAAC 4G8KA 3U9WA 3PZ1A 3LYAA 3FFLA 3TWTA 3TWXA 4F3VA 3CVQA 1Q2ZA 4UWHA 2ZU6B 3CVLA 5LP0A 4WAFA 4R7LA 4APOA 2WXNA 4RQIA 1OWNA 1NA0A 2PNNA 2RD0A 3IEGA 4KVOA 2J9QA 3ZYQA 3DRAA 2LSUA 2OEWA 3ZIMA 3I5PA 3R7RA 4JW1A 4ACKA 1WAO1 3E30A 3N71A 4PDXA 4HOTA 3JYSA 2WXMA 3GW4A 3FTYA 3ABKE 3FU0A 4IYPA 3WG7E 4BTBA 3LVQE 4PS7A 5IY5E 3HXDA 3QWVA 2ZISA 1OUVA 3BG1B 3HVEB 2EINE 4TUMA 3HXBA 4J8SA 4KZ0A 4PUCA 3LY7A 3TXMA 2XQ0A 3RO2A 4N2QA 2CHWA 2A5EA 1BLXB 2VGEA 3O4ZA 3TXNA 4U96D 3FUMA 1VDYA 4HOSA 4ANWA 1INZA 2ZGGA 1N0QA 4KMOA 3CQCB 1GW6A 4RLYA 5KJMA 2VJ8A 2L0TB 2WXKA 2GGFA 1OCZE 3QDNA 2HM8A 3FU6A 4ILGA 4N3CA 2KZTA 3C3RA 1ELRA 1W3BA 3FUFA 3W9FA 3FU3A 2EILE 1TNYA 4FULA 2QC9A 3RO3A 5A23A 3C98A 3LKUA 4EBAA 3NZSA 4F1SA 4GA0A 1QYMA 1QNFA 1D8EA 1G3NB 5EIDA 3OXLA 5CRUA 4YVOA 4F1PA 3MKQA 3L82A 1TNUA 1H6PA 5ARFA 4G8LA 3ASHA 3FTZA 5KJLA 2H6HA 1B89A 2Y4TA 3LS8A 4ME2A 3NBNB 3TWSA 2VTBB 4DUIA 3Q5MA 1A5EA 2Q7FA 2A5UA 4BFRA 3OTNA 4YNDA 3U4TA 1N4PA 4QFVA 3Q4AB 4G11A 2B0OE 4FC8A 1FCHA 1UG3A 3S7BA
chains in the Genus database with same CATH topology
2H6FA 3DSWA 3C72A 1D8DA 3DPYA 1JCQA 4MBGA 1O1SA 1O5MA 3SFYA 3Q79A 1SA5A 3E34A 2BEDA 1S64A 3DSTA 3PZ3A 3Q73A 3DSVA 3PZ4A 1N4SA 3E37A 3KSLA 3DSUA 3Q7FA 4YDOA 4GTOA 4GTMA 1QBQA 3HXFA 1N4QA 1N4RA 1JCSA 1NL4A 1LD8A 3DSSA 3HXEA 4LNGA 4GTVA 2ZIRA 1S63A 1LTXA 2IEJA 3PZ1A 4L9PA 1X81A 2F0YA 4LNBA 4GTQA 3DSXA 3Q78A 4GTTA 1FT1A 3EU5A 3HXCA 4GTPA 2H6IA 4EHMA 4GTRA 3PZ2A 1N94A 2H6GA 4GTSA 1FT2A 3EUVA 1TNYA 1LD7A 1MZCA 4YDEA 3E33A 3Q75A 1O1RA 1DCEA 1TN7A 1N95A 1N9AA 1TNBA 1TNOA 1TNZA 3DRAA 3Q7AA 3SFXA 1NI1A 1D8EA 1O1TA 3E30A 3E32A 1TNUA 1FPPA 1TN6A 2H6HA 1KZOA 1TN8A 1JCRA 3HXDA 1SA4A 2ZISA 3KSQA 1N4PA 2R2LA 1KZPA 3HXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H6F A;  3DSW A;  3C72 A;  1D8D A;  3DPY A;  1JCQ A;  4MBG A;  1O1S A;  1O5M A;  3SFY A;  3Q79 A;  1SA5 A;  3E34 A;  2BED A;  1S64 A;  3DST A;  3PZ3 A;  3Q73 A;  3DSV A;  3PZ4 A;  1N4S A;  3E37 A;  3KSL A;  3DSU A;  3Q7F A;  4YDO A;  4GTO A;  4GTM A;  1QBQ A;  3HXF A;  1N4Q A;  1N4R A;  1JCS A;  1NL4 A;  1LD8 A;  3DSS A;  3HXE A;  4LNG A;  4GTV A;  2ZIR A;  1S63 A;  1LTX A;  2IEJ A;  3PZ1 A;  4L9P A;  1X81 A;  2F0Y A;  4LNB A;  4GTQ A;  3DSX A;  3Q78 A;  4GTT A;  1FT1 A;  3EU5 A;  3HXC A;  4GTP A;  2H6I A;  4EHM A;  4GTR A;  3PZ2 A;  1N94 A;  2H6G A;  4GTS A;  1FT2 A;  3EUV A;  1TNY A;  1LD7 A;  1MZC A;  4YDE A;  3E33 A;  3Q75 A;  1O1R A;  1DCE A;  1TN7 A;  1N95 A;  1N9A A;  1TNB A;  1TNO A;  1TNZ A;  3DRA A;  3Q7A A;  3SFX A;  1NI1 A;  1D8E A;  1O1T A;  3E30 A;  3E32 A;  1TNU A;  1FPP A;  1TN6 A;  2H6H A;  1KZO A;  1TN8 A;  1JCR A;  3HXD A;  1SA4 A;  2ZIS A;  3KSQ A;  1N4P A;  2R2L A;  1KZP A;  3HXB A; 
#chains in the Genus database with same CATH topology
 3DSW A;  3ZKJ A;  4CDN A;  1JWG A;  1O1S A;  2XPI A;  4J6I A;  2EQX A;  4TRQ A;  3ASG A;  1H19 A;  1Y8M A;  4B89 A;  1JUQ A;  5AAR A;  4J8Y A;  3ESL A;  3SBT B;  3UX4 A;  5AQB A;  4G26 A;  5EYL A;  5G04 J;  4CZ2 D;  1NL4 A;  1Z3Y A;  4I43 A;  3QNK A;  4UWG A;  3MV2 B;  2KCV A;  2OEV A;  3PS6 A;  4UWL A;  3IKO B;  3AG3 E;  5B1A E;  1OXJ A;  4O1O A;  4A3T A;  2PZI A;  2XGM A;  1NZN A;  2BF0 X;  2WXP A;  5BV0 A;  3AJI A;  3TWV A;  1NI1 A;  4GCO A;  1Z5S C;  3L54 A;  3MGB A;  4A55 A;  3Q9U C;  4DX7 D;  5FQ8 A;  2GRL A;  4WUY A;  3ZXP A;  3JQ0 A;  5JJ6 A;  3L6A A;  3SI5 A;  5CEA A;  2WXI A;  2CFU A;  1IQR A;  3ZXS A;  4KVM A;  2FEZ A;  5ENP D;  1EYH A;  5T4Y A;  2I9C A;  4V3I A;  4DX6 D;  4B94 A;  3VLF A;  2HYZ A;  5LFA A;  1U2V G;  4DI3 A;  2E2E A;  2FI7 A;  4QQI A;  3Q73 A;  2MYO A;  2YHE A;  3UT7 A;  4YDO A;  2WPV A;  1E7U A;  5H7P A;  4GU5 A;  5B1B E;  3AS8 A;  4I6G A;  3F6Q A;  5CMW A;  4H7X A;  1LD8 A;  3SFZ A;  4G2V A;  4BET A;  2WMO A;  2IOL A;  4N3A A;  3Q15 A;  1E8Y A;  1N54 A;  5LCW J;  4HBD A;  5KCM A;  3ZFW A;  3PZ2 A;  4EQF A;  3VLE A;  4ANV A;  3JXJ A;  3Q49 B;  3KAE A;  4K5A B;  3B7S A;  3Q75 A;  4C48 B;  4XX5 A;  3ML9 A;  1TNO A;  2IO3 C;  5CBN A;  4HS2 A;  1XNF A;  5A6C A;  3AS5 A;  3AU4 A;  3MEK A;  3ZHE A;  3MV3 B;  3QJZ A;  2NYJ A;  2L6B A;  3UM3 A;  4AIF A;  3FUI A;  1HX8 A;  4ILI A;  4UI9 K;  2HE0 A;  2IU1 A;  4WWO A;  2VSO E;  2DYR E;  4FAD A;  1EDU A;  4XI9 A;  2J07 A;  2WMN A;  3BU8 A;  5A7D B;  1MX2 A;  3D9M A;  3ULY A;  4KZC A;  3B7T A;  4BER A;  2OVB A;  4A1G A;  3MA5 A;  4IN3 B;  3SFY A;  4BTA A;  3UT4 A;  3QAR A;  1K3Z D;  2DYS E;  2EIK E;  4XEI G;  3EIQ C;  5ENO D;  4BEP A;  2BED A;  5CED B;  2HR2 A;  3MYV A;  3PDN A;  3AU5 A;  3X2Q E;  3CR3 A;  3P2B A;  1V54 E;  3RRU A;  4GML A;  2V0P A;  2KBX A;  1WG0 A;  1N4R A;  5KJK A;  1H6K A;  3PNT B;  4JPS A;  4CRW A;  2X6K A;  5FZR A;  5EDS A;  1HO8 A;  1S63 A;  3EHQ A;  4L9P A;  5HQ8 A;  3T8M A;  3L17 A;  2L6J A;  3NQP A;  1H6O A;  1SZ9 A;  1XGW A;  3RAU A;  3R9A B;  4E6H A;  4I6J A;  2MHK A;  4MKT A;  4RG6 A;  3ML8 A;  4UI9 C;  3ABM E;  3E33 A;  1NFI E;  4OAU C;  4LUN U;  3FUN A;  1Y6I A;  5BXO A;  3UPV A;  2I6H A;  4HOU A;  3FUH A;  2VTB A;  1DCQ A;  3AG2 E;  5BXU A;  4AY6 A;  2ZXW E;  3CIA A;  3UKR G;  3Q9N C;  3QB2 A;  5FZQ A;  2IFU A;  3NZU A;  3GZ1 A;  3APD A;  4EZL A;  2QYU A;  3ZYL A;  2FBN A;  5HKP A;  3TGO A;  4CEM A;  3CVP A;  3CVV A;  2VGX B;  3C72 A;  4JEU A;  4AV7 A;  2GRN B;  3G2S A;  5KBA A;  4XIF A;  3UQ3 A;  2KCK A;  1H2V C;  5KJN A;  3CGH A;  4AEZ C;  1PY1 A;  3CK7 A;  2VSX E;  1E7V A;  2RKK A;  3OXF A;  2Y0B G;  1KPS B;  1QBQ A;  1SZA A;  1JCS A;  4HVB A;  3JUE A;  4AVX A;  1YCS B;  3P1U A;  4G24 A;  4GTV A;  1TJF A;  2XEV A;  3G2V A;  1SVX A;  5EIL A;  4EHM A;  5FIN A;  4ANX A;  5BNW A;  4IUL A;  5CCL A;  2XZD G;  1SW6 A;  2I1K A;  4NRH B;  1OWM A;  3ONK A;  4JA7 A;  4FJY A;  4M7C A;  1E8W A;  5FZS A;  2V4L A;  3KEA A;  3Q7A A;  3D3M A;  3QC1 A;  4F6R D;  3CVU A;  5ENQ D;  4RSY A;  2X38 A;  1OCR E;  3CKC A;  4AJW A;  2LO6 A;  2NC9 A;  3WXX A;  4NQ0 A;  5LOZ A;  4RVB A;  2F37 A;  2PL2 A;  4GMR A;  1E8Z A;  4M3O A;  4O1P A;  3ULQ A;  4L2Y A;  5G04 C;  3G2U A;  2WXO A;  5AQ7 A;  2WVI A;  1DVP A;  3IBE A;  3FHE A;  3TWR A;  5G55 A;  4TV3 A;  4JEH A;  1ELW A;  2XS8 A;  1OWL A;  3V2X A;  4EPZ A;  2JEK A;  4JVS A;  3HDX A;  1TR4 A;  2I1J A;  4J7W A;  5E76 A;  4GYO A;  1BI7 B;  2XZT G;  3E4B A;  3CK8 A;  3KSL A;  4GZ5 A;  2X6I A;  2J09 A;  5DIZ A;  3VTX A;  3FUL A;  2WB2 A;  5ARG A;  2L9B A;  4YDW A;  5FQ4 A;  4FU3 A;  5EIB E;  4WNF A;  1Z6T A;  4U8H A;  4URK A;  3IHV A;  3QWW A;  4B8A A;  4YVQ C;  3SO8 A;  4CGV A;  2DCP A;  3MCX A;  3FTX A;  2P9U G;  2OV8 A;  1IKN D;  4N5Q A;  2VSN A;  4OVV A;  3ZU7 B;  4BES A;  5JHB A;  1FVH A;  4B93 B;  2M63 A;  3QAQ A;  5D66 A;  1H2T C;  2QFC A;  4CCA A;  2QY7 A;  4MS6 A;  4MRU A;  1MJ0 A;  3U64 A;  2XEH A;  2XEE A;  4DPR A;  4HI9 A;  4A63 B;  3V31 A;  1S0P A;  2PQR A;  4GMJ A;  2R02 A;  5CHE E;  4GA2 A;  4E85 A;  4JD2 G;  2WXG A;  3TWU A;  3ASO E;  2IJG X;  2AXV A;  3I4R B;  3RK6 A;  1P5Q A;  4O60 A;  2AXU A;  2C0L A;  1MX4 A;  4GYY A;  3RJV A;  3DXK G;  3D9O A;  3ZYM A;  5CCM A;  2PM7 A;  3ONL A;  2A4Z A;  4WWP A;  4ZHB A;  3FUD A;  1RZ4 A;  1TYQ G;  1KLX A;  4WNE A;  4UI9 J;  1Z3X A;  2V8S E;  2IEJ A;  5KNH D;  3KD7 A;  3FTW A;  4GTP A;  3APC A;  4GYW A;  4BSZ B;  1YA0 A;  2Y69 E;  3PE3 A;  2H6G A;  4GZC A;  3T8K A;  3QWP A;  4JXT A;  3UIP C;  3EJN A;  3CVY A;  1TNZ A;  3FP3 A;  2P9K G;  2F8Y A;  2IY0 C;  3O48 A;  3ESK A;  1N11 A;  2WQH A;  3UI2 A;  1ZBP A;  3NAW A;  3VLD A;  4TXR A;  3DWL G;  2JLB A;  3B7U X;  5EKQ D;  3UM1 A;  1RW2 A;  3LY9 A;  4I2W A;  1JWF A;  2XGO A;  2WXQ A;  1S70 B;  3PZD A;  1N0R A;  2OVF A;  5AN8 A;  3UIN C;  3ENE A;  3FUK A;  4F7A A;  4YDY A;  3HVE A;  4FLB A;  1OCO E;  3CV0 A;  1JCQ A;  1IQU A;  4G23 A;  2R59 A;  3JCK C;  3E34 A;  2AJA A;  3QOU A;  3DEO A;  3K9I A;  3CVN A;  4NIK A;  1OT8 A;  1UOH A;  4H7Y A;  3E37 A;  1MHQ A;  4C0E A;  3ZNG A;  3AG4 E;  3NF1 A;  3S7D A;  3I3N A;  1A17 A;  1OWP A;  1YYH A;  2GRP B;  3EHM A;  5G05 J;  4GTQ A;  3DSX A;  3PNL B;  2R5S A;  3EU9 A;  4U04 A;  1K1A A;  4U7E B;  1TEZ A;  1UJK A;  3QK0 A;  2IO2 C;  2VQ2 A;  3AG1 E;  4Z68 A;  5BPP A;  4BX8 A;  4U95 D;  4CDR A;  1O1R A;  3L13 A;  4TUU A;  1HG2 A;  3D9N A;  4TXP A;  3PRE A;  4LSZ E;  5ENT D;  4RG9 A;  3JQ1 A;  5EN5 D;  4HB5 A;  4IRU A;  4FLH A;  2X6F A;  3ZN3 A;  5CER B;  5FTP A;  2ETC A;  1BU9 A;  2V5F A;  3FH7 A;  3V79 K;  5ANR A;  2MRI A;  1SA4 A;  3LEW A;  1IXV A;  4OVU A;  5AQ9 A;  3PUK A;  2R03 A;  2P9N G;  3UXG A;  4MBG A;  2BTD A;  4FHJ A;  4C0M A;  2XS1 A;  3CLJ A;  4NUR A;  5ENN A;  2BUG A;  2YHC A;  2EIM E;  4L23 A;  5CMY A;  4WNG A;  4FP7 A;  5LCW C;  2IOS A;  5C1D A;  1AWC B;  4HFG A;  1UN8 A;  2RFM A;  3ZRH A;  3TG4 A;  2XEN A;  3HXF A;  3Q47 B;  2F8X K;  3HXE A;  2R17 C;  3D9K A;  3HIZ A;  2FUL A;  4LNB A;  1FT1 A;  5M72 A;  2NXP A;  4HLE A;  2H6I A;  4UWF A;  3UIO C;  2JAB A;  3FUJ A;  4OYS A;  3IV0 A;  3FTU A;  3C3O A;  3AS4 A;  3CSF A;  4L2L A;  2MOW A;  5AAO A;  4JB8 P;  2UWJ G;  5BV1 A;  4D10 C;  2BKK B;  2P9P G;  4F53 A;  4OAV B;  4GZ3 A;  3RRN B;  2J8S D;  3BG0 B;  4HRM B;  2GW1 A;  5E75 A;  1OY3 D;  4K5C A;  4ATG A;  3ASD A;  4BT8 A;  2KM4 A;  4NAC A;  2XCB A;  3FH8 A;  2LXM A;  3L9T A;  4UQX A;  4APF A;  3NOG D;  5CBO A;  2Y4U A;  1UW4 B;  1IYG A;  4W9R A;  5BT1 A;  4FHK A;  3DPY A;  4I1A A;  4B8C B;  3RIB A;  4KBQ A;  4ACL A;  2WXJ A;  4XKB A;  4L1B A;  4HXI A;  3SF4 A;  2XCC A;  2Y3A A;  3DSV A;  4HQD A;  5AIJ A;  2IQC A;  3UM2 A;  1V55 E;  4GAA A;  3PEU B;  3ISM C;  3DPD A;  2KZT B;  4J8D A;  4LNG A;  2OND A;  3APF A;  4JA9 A;  4UUC A;  1ELK A;  2V5Q C;  2L0I A;  2UY1 B;  4A1S A;  1L5J A;  5D0Q D;  4MLP A;  2YNQ A;  2LAI A;  1FT2 A;  2RFA A;  1LD7 A;  3B7R L;  3PH0 C;  3U66 A;  3PEV B;  2KAT A;  3UTM A;  3FWV A;  1N9A A;  3KEZ A;  5AJL A;  2CFZ A;  3RKV A;  1LF8 A;  1IHB A;  4GPM A;  4GZD A;  2DZO A;  2OCC E;  1HU3 A;  3TG5 A;  3HYM B;  4J8E A;  3T9K A;  4AM9 A;  3CVW A;  3RU0 A;  4DLQ A;  5G2N A;  1X5B A;  3ASF A;  3SY2 A;  2WM9 A;  4LER A;  4DRX E;  1SQM A;  5ANL A;  5LX8 A;  3D9H A;  2DZN A;  2P9L G;  5T3R A;  1K8K G;  3LCA A;  3SQV A;  4BT9 A;  3JXI A;  4G25 A;  3LPZ A;  2ILR A;  4UWK A;  1N52 A;  1U3D A;  2VSY A;  3UUX A;  3ZEF A;  3BEE A;  3L22 A;  2J4B A;  3PZ4 A;  1KT0 A;  3CHS A;  2ETB A;  4Y6W A;  4GTM A;  3PUJ A;  4BSX A;  3DXM G;  5BW8 C;  4G1T A;  3G2T A;  2YIN A;  1X81 A;  2FF4 A;  2X3M A;  2CHZ A;  3EHN A;  4TXQ A;  4DK5 A;  3EUV A;  1MZC A;  1UN9 A;  4LG6 A;  4HOR A;  1EF1 C;  3C5R A;  3MJW A;  2WXH A;  3FEY A;  1TNB A;  4U0Z A;  5FJY A;  2P58 C;  5AYW D;  3UT8 A;  4DI4 A;  5JMN D;  2AVP A;  5AQA A;  3VTY A;  2EIJ E;  4CT4 A;  3HRA A;  1K1B A;  1HS6 A;  3IXE A;  3MKR A;  5HI7 A;  3V2O A;  5D0O D;  4CGW A;  2VYI A;  2NSZ A;  3ZUV B;  4UQZ A;  3KSQ A;  3LJN A;  4WND A;  4U07 A;  2ZGD A;  4DX1 A;  3BQO A;  2DIW A;  1EPU A;  1MX6 A;  3LY8 A;  1ZB1 A;  3S7J A;  4AP2 A;  2IF4 A;  1PAQ A;  3U3W A;  3DEP A;  1WM5 A;  3FUE A;  3CQG B;  4EZJ A;  2ETA A;  3DST A;  1E8X A;  3ZPJ A;  3T5X A;  2LXL A;  3IHY A;  4K5B A;  3W9G A;  5FT9 A;  1FVF A;  1BD8 A;  3DSU A;  3Q7F A;  1OWO A;  3ABL E;  3I4G A;  3DSS A;  3TJP A;  4U8V D;  4LRZ A;  3CK9 A;  4GCN A;  4N39 A;  4ILH B;  4XE0 A;  3HXC A;  4CYM D;  1N94 A;  2P9I G;  3C3Q A;  3CHM A;  2GRM A;  4PS3 A;  1U3C A;  4I1O B;  2QYJ A;  1UJJ A;  1DCE A;  4AXH A;  1N95 A;  3R7Q A;  5J90 A;  1H0A A;  2AW6 A;  4P29 A;  3ZHE B;  2ION A;  5T8I A;  4U0S A;  1KT1 A;  4GA1 A;  1NP7 A;  1O1T A;  3EHR A;  3V30 A;  4L7T A;  2WXF A;  3J5Q B;  4JHJ A;  4HLL A;  4XI0 A;  3TAX A;  4K0R A;  1ZU2 A;  4I2Z A;  5CRV A;  5EX0 A;  1HXI A;  2VGX A;  5FQ7 A;  2XGS A;  4K03 A;  4KYO B;  4U8Y D;  4DJA A;  2VGY A;  2GRQ B;  3ULE G;  2H6F A;  2GRR B;  3ZGQ A;  1HE8 A;  2GRO B;  3CST A;  3FEX A;  3Q79 A;  1H2U A;  1SA5 A;  3L08 A;  4CT0 A;  3PZ3 A;  2PQN A;  1YMP A;  4N3B A;  2J49 A;  4N5C A;  4GPK A;  4C9B B;  3LJ3 A;  1IHG A;  3OAW A;  5ENS D;  3D9L A;  2LNI A;  3FTV A;  2KXP C;  4Q69 A;  2LUH A;  4HI8 A;  3SZ7 A;  3CHO A;  2YQ8 A;  3SGH A;  1LTX A;  2F0Y A;  2OOE A;  4A3V A;  3Q78 A;  4Y6C A;  4WWN A;  3EDT B;  3RSE G;  4GTS A;  2AXZ A;  1JPL A;  3LDZ A;  3CVX A;  4I17 A;  5B3S E;  3CEQ A;  3HHM A;  2XPY A;  2WQ7 A;  4LCT A;  4JC8 A;  4HRL A;  3SNX A;  3E32 A;  4JZY A;  3JUI A;  3T5V A;  3KS2 A;  4GB9 A;  4ANU A;  4DX2 A;  5JHA A;  3BUA A;  4XZ4 A;  2CHX A;  2UY1 A;  4I6E A;  3LXU X;  3UM0 A;  1TJC A;  3OXG A;  3D9I A;  2R2L A;  5FWQ A;  2DBA A;  4LNU D;  1KZP A;  4JHR A;  4B0Z A;  4HOQ A;  4I1M A;  4J8F A;  3S7F A;  5JJT A;  1D8D A;  2WXR A;  2C0M A;  1HG5 A;  3HG0 D;  3TL5 A;  1DNP A;  5FIO A;  1S64 A;  3D9J A;  4X8Q A;  3ASN E;  3CHR A;  2XRZ A;  1HF8 A;  3SHF A;  2FO1 E;  2KC7 A;  3B7B A;  2AWI A;  3PRZ A;  3SBS A;  2XHE A;  4AOF A;  3R9M A;  4GTO A;  3QKY A;  3UKU G;  5AEN A;  3FH5 A;  2RG8 A;  4BX9 A;  1BI8 B;  3UMV A;  1OCC E;  2CG2 A;  2P2C P;  5EYP F;  4I9C A;  3CHQ A;  5JJ7 A;  3B95 A;  3TWQ A;  1D9S A;  4N2S A;  4EBA G;  4YDE A;  4PS8 A;  4DLO A;  3ZW3 A;  4BWR A;  1WY6 A;  5JA4 D;  3PVL A;  3GZ2 A;  3SFX A;  5D2M C;  4KXK B;  2QZA A;  4BY6 A;  3CKB A;  4XKC A;  2KCL A;  2Y1L E;  4FJZ A;  3S2A A;  4JL0 A;  1FPP A;  1TN6 A;  4PH4 B;  3FDH A;  2J08 A;  2WQ6 A;  3MZL B;  5C2Y A;  4O6F A;  4J0U A;  1TN8 A;  2V4H C;  3CHP A;  4HRN A;  1QZ2 A;  2WXL A;  4ATZ D;  1DC2 A;  3NOC D;  5J08 A;  5FQ6 A;  4ZFH A;  4Q96 A;  2BKG A;  3FU5 A;  3URZ A;  3J5P A;  3GYZ A;  5AJD A;  3RRM B;  1AP7 A;  4U63 A;  5ITZ F;  1E90 A;  2I2O A;  3L16 A;  1NA3 A;  4JHK A;  2ZIR A;  3PE4 A;  4GTT A;  3EU5 A;  5ENR D;  2DVW A;  5KWD A;  3LVR E;  2B6C A;  4GTR A;  3D9P A;  4EEC A;  3ZVV A;  5G05 C;  5HRY A;  2FO7 A;  1QQE A;  4GZ6 A;  2CG3 A;  3FY4 A;  4CDM A;  1MQS A;  2X6H A;  5KNG A;  3MX3 A;  1TN7 A;  1HFA A;  1HH8 A;  1E96 B;  3ZYK A;  2P9S G;  2DWZ A;  5DBK A;  3EIJ A;  2LSV A;  2J4D A;  3NB2 A;  1WDY A;  1BPO A;  2HO1 A;  4FA6 A;  4DX5 D;  5EX3 A;  2XPZ A;  5HS0 A;  2C2L A;  1KZO A;  3DBS A;  4Q94 A;  4I9E A;  3B13 A;  1JCR A;  4HNA D;  2XRY A;  2X6J A;  1PC2 A;  2E0I A;  4AY5 A;  1HZ4 A;  4U0U A;  2LAH A;  3GZS A;  1O5M A;  5BUZ A;  3G2W A;  4LEU A;  4EZK A;  4ABN A;  3TWW A;  1N4S A;  3MKQ B;  3SD5 A;  4KT6 B;  5CEC B;  3FTS A;  4UQY A;  1N4Q A;  2R05 A;  2PM6 A;  1MYO A;  3AAA C;  4G8K A;  3U9W A;  3PZ1 A;  3LYA A;  3FFL A;  3TWT A;  3TWX A;  4F3V A;  3CVQ A;  1Q2Z A;  4UWH A;  2ZU6 B;  3CVL A;  5LP0 A;  4WAF A;  4R7L A;  4APO A;  2WXN A;  4RQI A;  1OWN A;  1NA0 A;  2PNN A;  2RD0 A;  3IEG A;  4KVO A;  2J9Q A;  3ZYQ A;  3DRA A;  2LSU A;  2OEW A;  3ZIM A;  3I5P A;  3R7R A;  4JW1 A;  4ACK A;  1WAO 1;  3E30 A;  3N71 A;  4PDX A;  4HOT A;  3JYS A;  2WXM A;  3GW4 A;  3FTY A;  3ABK E;  3FU0 A;  4IYP A;  3WG7 E;  4BTB A;  3LVQ E;  4PS7 A;  5IY5 E;  3HXD A;  3QWV A;  2ZIS A;  1OUV A;  3BG1 B;  3HVE B;  2EIN E;  4TUM A;  3HXB A;  4J8S A;  4KZ0 A;  4PUC A;  3LY7 A;  3TXM A;  2XQ0 A;  3RO2 A;  4N2Q A;  2CHW A;  2A5E A;  1BLX B;  2VGE A;  3O4Z A;  3TXN A;  4U96 D;  3FUM A;  1VDY A;  4HOS A;  4ANW A;  1INZ A;  2ZGG A;  1N0Q A;  4KMO A;  3CQC B;  1GW6 A;  4RLY A;  5KJM A;  2VJ8 A;  2L0T B;  2WXK A;  2GGF A;  1OCZ E;  3QDN A;  2HM8 A;  3FU6 A;  4ILG A;  4N3C A;  2KZT A;  3C3R A;  1ELR A;  1W3B A;  3FUF A;  3W9F A;  3FU3 A;  2EIL E;  1TNY A;  4FUL A;  2QC9 A;  3RO3 A;  5A23 A;  3C98 A;  3LKU A;  4EBA A;  3NZS A;  4F1S A;  4GA0 A;  1QYM A;  1QNF A;  1D8E A;  1G3N B;  5EID A;  3OXL A;  5CRU A;  4YVO A;  4F1P A;  3MKQ A;  3L82 A;  1TNU A;  1H6P A;  5ARF A;  4G8L A;  3ASH A;  3FTZ A;  5KJL A;  2H6H A;  1B89 A;  2Y4T A;  3LS8 A;  4ME2 A;  3NBN B;  3TWS A;  2VTB B;  4DUI A;  3Q5M A;  1A5E A;  2Q7F A;  2A5U A;  4BFR A;  3OTN A;  4YND A;  3U4T A;  1N4P A;  4QFV A;  3Q4A B;  4G11 A;  2B0O E;  4FC8 A;  1FCH A;  1UG3 A;  3S7B A; 
#chains in the Genus database with same CATH homology
 2H6F A;  3DSW A;  3C72 A;  1D8D A;  3DPY A;  1JCQ A;  4MBG A;  1O1S A;  1O5M A;  3SFY A;  3Q79 A;  1SA5 A;  3E34 A;  2BED A;  1S64 A;  3DST A;  3PZ3 A;  3Q73 A;  3DSV A;  3PZ4 A;  1N4S A;  3E37 A;  3KSL A;  3DSU A;  3Q7F A;  4YDO A;  4GTO A;  4GTM A;  1QBQ A;  3HXF A;  1N4Q A;  1N4R A;  1JCS A;  1NL4 A;  1LD8 A;  3DSS A;  3HXE A;  4LNG A;  4GTV A;  2ZIR A;  1S63 A;  1LTX A;  2IEJ A;  3PZ1 A;  4L9P A;  1X81 A;  2F0Y A;  4LNB A;  4GTQ A;  3DSX A;  3Q78 A;  4GTT A;  1FT1 A;  3EU5 A;  3HXC A;  4GTP A;  2H6I A;  4EHM A;  4GTR A;  3PZ2 A;  1N94 A;  2H6G A;  4GTS A;  1FT2 A;  3EUV A;  1TNY A;  1LD7 A;  1MZC A;  4YDE A;  3E33 A;  3Q75 A;  1O1R A;  1DCE A;  1TN7 A;  1N95 A;  1N9A A;  1TNB A;  1TNO A;  1TNZ A;  3DRA A;  3Q7A A;  3SFX A;  1NI1 A;  1D8E A;  1O1T A;  3E30 A;  3E32 A;  1TNU A;  1FPP A;  1TN6 A;  2H6H A;  1KZO A;  1TN8 A;  1JCR A;  3HXD A;  1SA4 A;  2ZIS A;  3KSQ A;  1N4P A;  2R2L A;  1KZP A;  3HXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...