2X3MA

Crystal structure of hypothetical protein orf239 from pyrobaculum spherical virus
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
166
structure length
166
Chain Sequence
TNWADWIMGWRTPNASEKKMEFMYWYTRTYLEEAKDIRPDIADALARGMAGLAFGRTDWVASMLDPQIMRHIYTDPEVARIYSETRDMLRRVSDYYISLTTMELGKVADIIAEAKAKGENPEVVAREIAEAVPRLSPKSLYFNLYYIGRSIGDNYVLEVARVLSKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords HYPOTHETICAL PROTEIN ORF239
publication title The Scottish Structural Proteomics Facility: Targets, Methods and Outputs.
pubmed doi rcsb
source organism Pyrobaculum spherical virus
total genus 72
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2010-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.670 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2x3mA00
2X3MA
chains in the Genus database with same CATH superfamily
1QYMA 3B7TA 2OV8A 4JA9A 5FQ4A 1L5JA 2C2LA 4HOTA 3S7FA 4DX1A 3Q78A 1AP7A 2LXMA 4UWGA 4CGWA 1LTXA 4C9BB 3SBSA 4GAAA 2WQ7A 2XZTG 2A4ZA 2WPVA 2X6JA 4ABNA 4PS7A 5BT1A 2FO7A 4XEIG 3PEUB 4U8YD 5ENQD 1Y6IA 3C98A 4UI9C 5KBAA 5FINA 2B0OE 2EILE 4IRUA 4QQIA 3C3RA 2QYUA 1VDYA 1H2TC 3S7DA 3SD5A 2LAIA 3LEWA 3MKQA 3FDHA 5B1AE 1E7VA 3EIJA 4UQXA 1X81A 3DSVA 2X6FA 2BUGA 3FTWA 3B7SA 5J90A 4GCOA 2J8SD 2XRZA 4DJAA 4AM9A 4CGVA 4XIFA 3EUVA 2WXRA 4G1TA 4RG6A 1OCOE 5T8IA 4FJYA 4QFVA 5EYPF 1E8WA 3CSTA 4PS8A 4FJZA 2QYJA 5JMND 2L0TB 3D9PA 3GZ1A 1OUVA 3WXXA 3BEEA 2R5SA 4GTMA 4CDMA 3HXDA 3Q47B 4TRQA 2BKKB 3RRUA 2CG2A 2R02A 4NACA 4URKA 1N52A 4K03A 1XNFA 4JHRA 2P9KG 1BD8A 3SF4A 4N2QA 2PQRA 3FTZA 4GZDA 3S7BA 4MS6A 4GA0A 2UY1B 2JLBA 1S63A 3WG7E 5CBNA 1OXJA 1HS6A 2WMNA 4BFRA 2V8SE 3D9JA 3QWWA 5KNHD 1N95A 2XEVA 1HH8A 2XPYA 1SA5A 3PE3A 1DCEA 1YMPA 2J07A 4J6IA 4FLHA 2KBXA 3ESLA 3KS2A 2QFCA 2IOLA 3QJZA 1TJCA 4LNGA 1ZBPA 2HM8A 3C3QA 1Z6TA 1JWGA 3ZPJA 2CHXA 2WM9A 3CEQA 1WDYA 3CVNA 5EN5D 3ZVVA 1ELWA 1G3NB 3KSLA 4JD2G 4UWHA 2P9NG 5HS0A 2GRMA 3NZSA 3MV2B 5AQBA 4FULA 1SVXA 4BERA 4NIKA 3CHRA 3APCA 3L9TA 2V0PA 2ZXWE 2V5QC 3G2TA 5AN8A 4PUCA 3GW4A 3ZFWA 1D9SA 1IHGA 5BV1A 4HRLA 3T5XA 3NOCD 2XS1A 3DEPA 5CHEE 4PH4B 1INZA 2AXVA 4MRUA 3TWRA 2HR2A 3BUAA 1B89A 2V5FA 3T8MA 1IXVA 2J4DA 3CVQA 1MX6A 4A63B 1SQMA 3LY9A 3LY8A 4KZ0A 4IN3B 3I4RB 1OCZE 3NZUA 3HVEB 5ENRD 1ZB1A 1MZCA 2L6BA 3BQOA 5FTPA 3NB2A 2NYJA 2V4HC 2WXOA 4GPMA 2HO1A 4OVVA 3UUXA 1TNYA 4G23A 1QBQA 3RJVA 3I4GA 2GRPB 2VTBB 1QQEA 1NA3A 4WNFA 2AXZA 3TXMA 1KPSB 1H6PA 4NURA 2L9BA 4U8VD 3NF1A 3QARA 2GGFA 4OVUA 2VSNA 3ENEA 4A1GA 3B95A 4XE0A 4Q69A 3FEXA 4GZCA 4J8SA 3G2VA 1S70B 5KJKA 1U2VG 4NQ0A 2Y69E 3S2AA 4PDXA 1YCSB 4F1SA 4C48B 3OXLA 1MJ0A 4E6HA 4PS3A 5T4YA 4TUMA 3CK8A 3MKRA 4E85A 3OAWA 5ANRA 3UM0A 1DVPA 3ABME 4LCTA 2XPIA 1S64A 3TXNA 1DCQA 1JUQA 4GTPA 2I2OA 3SFYA 2P58C 4I1MA 3Q9NC 1FT1A 2DCPA 5EX3A 5FT9A 2J4BA 5AENA 4C0EA 4B8AA 2UY1A 3JXIA 3ML9A 3QWPA 2WQHA 4AVXA 3C72A 3ZGQA 3SI5A 4K5CA 3P2BA 2EIKE 5JA4D 4LEUA 4Y6WA 3LVRE 2ZGGA 2X6KA 2P9UG 4F3VA 3LY7A 4J8EA 3ZUVB 1JCSA 5A23A 3U9WA 4XKCA 3EHMA 5ENPD 2YNQA 4GCNA 2FF4A 3B7UX 1HO8A 1S0PA 1UJKA 5AJLA 4HRMB 1KZOA 2OEWA 4EZKA 1NA0A 2VQ2A 5KJMA 3ZYKA 5CEDB 3PEVB 2L6JA 3TG5A 4F6RD 4D10C 1OWLA 4TXRA 2I6HA 2ZU6B 3B13A 4GYOA 4CT4A 3ZYQA 2FO1E 4HRNA 3MX3A 3CVLA 4JW1A 3NOGD 4ANUA 3UI2A 3R7QA 4WWOA 2VGYA 3ZN3A 3FUMA 2LXLA 4JB8P 4BSXA 1JWFA 3ESKA 5BW8C 4HOSA 2WXNA 1K1BA 2LUHA 2ILRA 5DIZA 2RKKA 2XPZA 5FZRA 5ARGA 4TXQA 4XX5A 4YDWA 3CHOA 1TNOA 3NBNB 1WY6A 2ETBA 3CIAA 3PUKA 3HVEA 1A17A 1W3BA 4KT6B 4UI9K 4CDRA 4EPZA 3UQ3A 2VTBA 2XGMA 4CCAA 4V3IA 1HE8A 2H6HA 5J08A 3J5PA 4GB9A 2DWZA 2A5EA 4I1OB 3IHYA 3ZXPA 3FU6A 4KVOA 4BY6A 2AXUA 2IJGX 5G05C 4EBAA 4GZ6A 4BWRA 4AY5A 4RSYA 4L9PA 3Q49B 4WNGA 4DI3A 1ELKA 2XEHA 5KWDA 4LNUD 4HQDA 2GW1A 2Y4TA 3EDTB 3ASNE 1SW6A 4UWKA 4FA6A 4YVOA 3SZ7A 2CFUA 4ACKA 4EHMA 2HE0A 4U95D 3IEGA 2AVPA 3D9KA 3Q7FA 3F6QA 3ZW3A 2OEVA 4TXPA 4AEZC 1H0AA 2PL2A 2AWIA 1O5MA 2C0LA 3LVQE 5EDSA 2J09A 2WQ6A 4JL0A 3DPYA 3FUHA 3RSEG 3FUIA 3ASFA 2GRRB 4C0MA 4Y6CA 3ZEFA 4AXHA 2F8XK 2VSOE 3R9MA 2KCVA 1ZU2A 2J08A 1FVHA 5KJLA 4U63A 2J9QA 4MLPA 4JHJA 3SBTB 5AYWD 2KXPC 4O6FA 1EF1C 3QC1A 3RU0A 4X8QA 2Y4UA 3E33A 4DI4A 4M7CA 3MV3B 1DC2A 4Z68A 1A5EA 4ATGA 3RO2A 1BI8B 2X6HA 4CT0A 3IXEA 3ZNGA 3D3MA 3O48A 3I5PA 4G26A 1OWOA 3UPVA 3IV0A 4N39A 4RG9A 1FVFA 1EYHA 2FEZA 3FU0A 1Z3XA 4TUUA 2IU1A 5G2NA 3ONLA 5DBKA 2FI7A 4BTAA 1E8ZA 4O60A 3TG4A 1OT8A 3FU5A 3UM2A 2XENA 4JA7A 1IQRA 4BTBA 3LS8A 3UT8A 2MHKA 3SGHA 4ZHBA 4UQYA 5FQ7A 2VGXB 5CCMA 5ENNA 3U4TA 4WNEA 4BT9A 2R2LA 1OWNA 4G11A 3L17A 3P1UA 4W9RA 5E76A 3ABKE 2MYOA 4J7WA 1N54A 3TWUA 3UKUG 5FQ8A 1HXIA 3JQ0A 4AP2A 3SO8A 3CVWA 5AJDA 5JHAA 3LCAA 2IF4A 3X2QE 4I17A 2PQNA 1TNBA 4F7AA 1H2UA 3AG1E 4M3OA 2PM7A 3PE4A 4U7EB 1O1RA 1U3DA 4APFA 1N0RA 3CHQA 2CFZA 4GZ5A 3SQVA 4FU3A 3RRMB 1QZ2A 3FH7A 4ANVA 5HI7A 2CHZA 1HF8A 2BEDA 4ME2A 1UG3A 4B94A 1SZ9A 4U04A 5D66A 5KCMA 3OXFA 3FTXA 2IFUA 3RKVA 5JJTA 3L08A 1OWMA 3ZHEA 2M63A 4ZFHA 4DX5D 3D9IA 4Q96A 1PAQA 1HX8A 3EU9A 3MYVA 3UT4A 4YNDA 5A6CA 2ZIRA 2DZOA 4UQZA 2IONA 2ZGDA 3UINC 4L23A 3DEOA 2WXPA 3ML8A 4ILGA 3DWLG 2MRIA 3MCXA 3B7RL 4U07A 3HG0D 4WUYA 5C2YA 3TWQA 1UN9A 5D0OD 3PREA 3GZSA 2XCCA 1OCCE 1AWCB 3EU5A 2WVIA 5ENTD 4L7TA 4HOUA 1NI1A 3KAEA 3FH5A 2KCKA 3D9HA 2P2CP 2AJAA 2R03A 3CHMA 4EECA 4LERA 2FULA 3APDA 5LP0A 3AU4A 4ANWA 3Q9UC 3ZXSA 4I6GA 1P5QA 2WB2A 4GMRA 2XCBA 2DBAA 4J8FA 3ASHA 4L2YA 5G05J 2LSVA 1NL4A 3Q4AB 2WXJA 4ACLA 4G8LA 3LJ3A 1OCRE 2RG8A 2GRNB 3AJIA 3CKCA 4KVMA 1KT0A 2X6IA 3ZYMA 4WWNA 3GYZA 2DYSE 4UUCA 3Q15A 4DLQA 2X3MA 1LF8A 4YVQC 2KZTB 3BG1B 1HFAA 3U64A 2PNNA 4CEMA 4JEUA 2XGOA 5CMYA 1H2VC 5BPPA 1TR4A 3G2UA 5CCLA 2VGXA 2P9SG 4AV7A 4ILHB 4AY6A 2WXHA 2Y0BG 4KZCA 2RFAA 3VLEA 5B1BE 3EHNA 4B8CB 3CQCB 5G55A 1LD8A 2DZNA 1E90A 3PNTB 4XZ4A 4GZ3A 4GA1A 4F1PA 1HU3A 3CHSA 4OAUC 5EYLA 3JYSA 3EHQA 4GA2A 3AS4A 4LSZE 4CDNA 4L1BA 5CBOA 5CEAA 5BXUA 5JHBA 4EZJA 4JXTA 3FTUA 1RW2A 2JABA 3KEAA 3EJNA 3TJPA 5KNGA 5M72A 3E30A 3CK7A 4B89A 4DUIA 2YHEA 3JXJA 1JPLA 3FUFA 2YQ8A 5BXOA 5LOZA 4N5QA 4HLEA 2IQCA 5AAOA 5IY5E 4JHKA 1OWPA 4K5BA 2CHWA 1N11A 1TNUA 2OOEA 4GMLA 4DX7D 3BU8A 2LAHA 3J5QB 2NC9A 4WNDA 2A5UA 1E8XA 4R7LA 5CECB 4DX6D 4BX9A 2E2EA 5D0QD 1KLXA 1BLXB 2OVBA 1HZ4A 2VSYA 2XZDG 4J8DA 1FCHA 2NXPA 3FWVA 3E34A 4XKBA 1HG5A 4LRZA 3V2OA 4HI8A 4UWFA 1SA4A 3Q5MA 5FZSA 3AU5A 1IHBA 4LG6A 1WM5A 3TWWA 2J49A 4RQIA 3JUEA 4U0ZA 1HG2A 4CRWA 3FTSA 3VTXA 3L6AA 3CVXA 3UTMA 4A3VA 2F37A 5FJYA 1QNFA 3VLDA 1RZ4A 5EIBE 1NP7A 2I9CA 2H6FA 4I43A 4H7YA 3UXGA 4G24A 5FZQA 4BX8A 3HRAA 3SNXA 2OCCE 3TL5A 5B3SE 4I2WA 1BI7B 4GTOA 3RRNB 3V2XA 2GRLA 1ELRA 1IQUA 1X5BA 3ZRHA 1UN8A 3PNLB 3CVUA 3DXKG 2WXLA 3T8KA 2E0IA 1FPPA 3EIQC 4J8YA 3DSSA 1BU9A 2KZTA 2P9LG 4DLOA 1N4SA 2C0MA 2WMOA 1DNPA 3DPDA 3HXBA 2R05A 3QOUA 1KT1A 1Z3YA 1U3CA 4TV3A 4I1AA 2X38A 5AQ9A 2WXGA 1V55E 3D9NA 2DVWA 3T9KA 3FUDA 4RLYA 2R59A 5EX0A 3UX4A 2WXKA 2WXQA 3PZDA 1MX2A 3FY4A 3E37A 1N9AA 3Q75A 5LCWJ 3U66A 4A1SA 3ASOE 3RIBA 4U96D 3HHMA 3FFLA 4JVSA 3IKOB 3MEKA 3CKBA 1E96B 3FH8A 2B6CA 3D9OA 3HXEA 4FHKA 4FC8A 3LJNA 2Y1LE 4I6EA 3LPZA 5EIDA 5H7PA 4MBGA 5LFAA 1H19A 3CVPA 4NRHB 5AIJA 4KBQA 2EQXA 3QKYA 3FUNA 3ULEG 3TWTA 4J0UA 3V31A 2H6GA 5AQ7A 5HKPA 1K1AA 4XI0A 4U8HA 4G25A 3FUKA 3CVVA 1E7UA 3TGOA 4HOQA 3SFZA 3PVLA 3KEZA 3Q79A 5EILA 3S7JA 2QY7A 2IO2C 2ETCA 5G04C 4IULA 2H6IA 2XS8A 3D9MA 3PZ4A 2EIME 4JZYA 3CGHA 2WXMA 3R9AB 1Z5SC 2GROB 3ULQA 4N3BA 2BKGA 2Q7FA 3JQ1A 1E8YA 2P9PG 3DSUA 5ITZF 2BF0X 3FU3A 1Y8MA 3E4BA 3UM1A 3GZ2A 5AQAA 2IO3C 3L22A 1UOHA 1TEZA 3FULA 4DX2A 4BETA 1N0QA 4O1OA 1NZNA 4YDEA 2VGEA 2EINE 1TYQG 4GTRA 4N3CA 4P29A 5KJNA 3O4ZA 3MGBA 2YINA 5CRVA 4A3TA 1NFIE 3SHFA 2WXFA 1IKND 3SFXA 1MHQA 3C5RA 2VYIA 1D8EA 3MZLB 2ZISA 3T5VA 4KYOB 2KATA 5ENSD 3JCKC 4FLBA 5AARA 5CMWA 4LNBA 4DRXE 2ETAA 1UJJA 4CYMD 2KM4A 1TJFA 4HXIA 3ASGA 3AS5A 2XGSA 3UKRG 1PC2A 3DSXA 2UWJG 3APFA 3HYMB 4MKTA 4EQFA 3K9IA 4I9CA 3LDZA 3ZKJA 3DXMG 4U0UA 4JEHA 3NAWA 5HQ8A 5LCWC 2EIJE 4GYWA 2PZIA 4OAVB 3B7BA 3L82A 3CV0A 2CG3A 4HLLA 3HXCA 1O1SA 3TWVA 3CQGB 1N4PA 1D8DA 4GTSA 4FHJA 5D2MC 2XRYA 3SY2A 3ZIMA 4FP7A 1PY1A 5ENOD 2KCLA 4GMJA 4CZ2D 3PS6A 2WXIA 4KXKB 1IYGA 5T3RA 2OVFA 3FUJA 5FQ6A 3FTYA 1JCRA 4N3AA 4O1PA 4K0RA 2IEJA 5BNWA 4AOFA 2XQ0A 4HS2A 1GW6A 1H6KA 1N4RA 2I1KA 3DRAA 3ULYA 1SZAA 4ATZD 2VJ8A 3FP3A 2RFMA 4GTTA 3CK9A 2VSXE 4XI9A 3PH0C 4RVBA 3N71A 3OTNA 1TN8A 2LNIA 2LSUA 3CLJA 3QB2A 2QZAA 3UT7A 3AG2E 2L0IA 3TWXA 1K3ZD 2ONDA 4K5AB 4BEPA 2DYRE 3AG4E 3D9LA 4KMOA 3RK6A 3JUIA 3PZ3A 4F53A 4BT8A 4APOA 5E75A 4I6JA 1OY3D 4H7XA 4GTQA 3C3OA 3UIOC 4GTVA 3U3WA 1TN7A 4B0ZA 2I1JA 3FTVA 4FADA 4HORA 3L54A 1LD7A 5EKQD 3CVYA 2DIWA 3LKUA 4UWLA 4I9EA 4IYPA 4GU5A 1MYOA 3ISMC 4DK5A 4LUNU 3VLFA 2P9IG 3L13A 3QWVA 1KZPA 1K8KG 4JC8A 2XEEA 2V4LA 4B93B 2FBNA 2RD0A 3MKQB 1V54E 3HIZA 2XHEA 1FT2A 3HXFA 3PZ2A 4UI9J 4HVBA 3UM3A 1BPOA 3LYAA 3I3NA 3TAXA 2F8YA 1WG0A 5FWQA 4EBAG 3PUJA 4U0SA 4GPKA 3MA5A 4YDOA 2IOSA 2BTDA 5JJ7A 4ILIA 2LO6A 5ARFA 3UMVA 1TNZA 4N5CA 3Q73A 3QDNA 1TN6A 3CSFA 4HNAD 1YYHA 3VTYA 4GYYA 3IBEA 3W9GA 4BESA 2HYZA 4ANXA 4N2SA 3V30A 3AS8A 1N4QA 5A7DB 2Y3AA 4AJWA 3L16A 4Q94A 2QC9A 3FUEA 3W9FA 5CERB 5FIOA 4WAFA 4BSZB 3V79K 3BG0B 5G04J 3QK0A 1UW4B 4HB5A 3OXGA 4HI9A 3RO3A 1YA0A 4AIFA 5HRYA 4HBDA 3ABLE 4OYSA 2MOWA 4G2VA 1EPUA 3QAQA 4HFGA 4L2LA 3Q7AA 2JEKA 5ANLA 4G8KA 5LX8A 3PDNA 3HDXA 5JJ6A 4DPRA 3FHEA 2NSZA 2R17C 5BV0A 1WAO1 4A55A 3ZYLA 3E32A 2AW6A 1MX4A 3EHRA 3KD7A 3ONKA 3G2SA 3URZA 3KSQA 3DSTA 3PZ1A 1N94A 3CHPA 2KC7A 3UIPC 1Q2ZA 1MQSA 3ASDA 4I2ZA 2GRQB 3FEYA 5C1DA 3DBSA 2IY0C 1H6OA 3R7RA 3NQPA 3QNKA 3AG3E 1JCQA 4YDYA 1XGWA 4JPSA 3TWSA 2PM6A 5CRUA 2F0YA 3ZHEB 1EDUA 2YHCA 3CR3A 3IHVA 3DSWA 3LXUX 3MJWA 1O1TA 4WWPA 3PRZA 3AAAC 3G2WA 5BUZA 3RAUA 4EZLA 3ZU7B
chains in the Genus database with same CATH topology
1OWLA 3B7TA 1TEZA 2I6HA 3FULA 2OV8A 4JA9A 2ZU6B 3CHMA 3B13A 2FULA 4LERA 4GYOA 5FQ4A 3APDA 4EECA 5LP0A 3AU4A 4ANWA 1L5JA 3ZXSA 2C2LA 4I6GA 4CT4A 1P5QA 2WB2A 3ZYQA 4HOTA 3S7FA 1NZNA 4UWGA 3MX3A 2XCBA 3CVLA 4JW1A 2DBAA 4CGWA 4N3CA 4P29A 5KJNA 4ANUA 4J8FA 3R7QA 4WWOA 3O4ZA 3ASHA 3SBSA 4C9BB 4GAAA 4L2YA 3MGBA 2VGYA 2YINA 5G05J 2A4ZA 2LSVA 3FUMA 3ZN3A 2WQ7A 2WPVA 2X6JA 3Q4AB 4A3TA 4ABNA 4PS7A 2WXJA 4ACLA 4BSXA 3LJ3A 3SHFA 5BT1A 2FO7A 1JWFA 2WXFA 3PEUB 2RG8A 1MHQA 3ESKA 1Y6IA 3C98A 5BW8C 4HOSA 4UI9C 2VYIA 2WXNA 3CKCA 4KVMA 4IRUA 2ILRA 1KT0A 3MZLB 2X6IA 5DIZA 3ZYMA 1VDYA 2XPZA 4WWNA 3GYZA 1H2TC 3S7DA 3SD5A 3T5VA 4KYOB 5ARGA 2KATA 2LAIA 3Q15A 5FZRA 4DLQA 2X3MA 1LF8A 3LEWA 4YVQC 4XX5A 2KZTB 3FDHA 3MKQA 3BG1B 1HFAA 3JCKC 4FLBA 1E7VA 3CHOA 3U64A 4CEMA 4JEUA 5CMWA 3EIJA 2XGOA 4UQXA 5CMYA 1H2VC 5BPPA 1WY6A 3G2UA 5CCLA 2VGXA 3CIAA 3PUKA 4AV7A 2X6FA 1UJJA 2BUGA 3HVEA 3FTWA 2KM4A 3B7SA 4ILHB 4AY6A 1TJFA 4HXIA 5J90A 3ASGA 2WXHA 1A17A 3AS5A 4GCOA 4KZCA 2XGSA 2XRZA 4DJAA 3VLEA 3EHNA 4AM9A 1W3BA 4B8CB 4CGVA 4KT6B 4XIFA 3CQCB 5G55A 1PC2A 4UI9K 4CDRA 4EPZA 2UWJG 3APFA 3UQ3A 3HYMB 2WXRA 4MKTA 2VTBA 4G1TA 4EQFA 2XGMA 4CCAA 3K9IA 4V3IA 4RG6A 4I9CA 1HE8A 3LDZA 5J08A 4GB9A 4I1OB 1E90A 3IHYA 3PNTB 3FU6A 4KVOA 4XZ4A 4GZ3A 4GA1A 4U0UA 5T8IA 4FJYA 4JEHA 4QFVA 4BY6A 5HQ8A 5LCWC 1E8WA 2AXUA 2IJGX 2PZIA 3CSTA 4GYWA 4PS8A 1HU3A 4GZ6A 5G05C 4FJZA 4EBAA 3CHSA 4BWRA 3CV0A 2L0TB 4AY5A 4RSYA 2CG3A 3JYSA 3D9PA 3Q49B 4GA2A 3AS4A 4WNGA 4CDNA 4L1BA 4DI3A 1ELKA 3CQGB 3GZ1A 1OUVA 4FHJA 2GW1A 2Y4TA 3BEEA 3EDTB 3WXXA 2XRYA 4UWKA 4FA6A 4YVOA 5JHBA 3SZ7A 2R5SA 2CFUA 4EZJA 4ACKA 4JXTA 3ZIMA 3FTUA 4FP7A 1PY1A 4CDMA 2KCLA 4GMJA 3PS6A 3Q47B 4TRQA 3IEGA 2WXIA 3EJNA 2AVPA 3D9KA 3TJPA 4KXKB 1IYGA 5T3RA 5M72A 2OVFA 3RRUA 2CG2A 3CK7A 4NACA 4B89A 3FUJA 4URKA 1N52A 5FQ6A 2YHEA 1JPLA 3ZW3A 4K03A 1XNFA 3FUFA 3FTYA 2YQ8A 4JHRA 4N3AA 5LOZA 4AEZC 1H0AA 2PL2A 4K0RA 5BNWA 2AWIA 4HLEA 2IQCA 2C0LA 3LVQE 3SF4A 4N2QA 4JHKA 5EDSA 2PQRA 1OWPA 3FTZA 2CHWA 4GZDA 2J09A 4MS6A 3S7BA 4AOFA 2WQ6A 2XQ0A 4GA0A 4HS2A 4JL0A 3FUHA 1GW6A 2OOEA 3FUIA 1H6KA 3ASFA 2UY1B 4GMLA 2I1KA 2JLBA 4C0MA 1SZAA 4Y6CA 1HS6A 2VJ8A 3ZEFA 2WMNA 4AXHA 4BFRA 2V8SE 2VSOE 3D9JA 2LAHA 3FP3A 3CVUA 2NC9A 4WNDA 2A5UA 2KCVA 3QWWA 3CK9A 2XEVA 2VSXE 1ZU2A 3PH0C 4XI9A 2J08A 1E8XA 4R7LA 4RVBA 1FVHA 3N71A 1HH8A 3OTNA 4U63A 2J9QA 2LNIA 4BX9A 5KJLA 4MLPA 2E2EA 4JHJA 5D0QD 2XPYA 1KLXA 2LSUA 3SBTB 3CLJA 5AYWD 3QB2A 3PE3A 2J07A 2OVBA 4J6IA 1HZ4A 4FLHA 1EF1C 4O6FA 2VSYA 3UT7A 4J8DA 3QC1A 1FCHA 2NXPA 2L0IA 3FWVA 3ESLA 3KS2A 3RU0A 2QFCA 2IOLA 2ONDA 1TJCA 3QJZA 1ZBPA 2HM8A 2Y4UA 1Z6TA 1JWGA 4XKBA 1HG5A 4LRZA 4DI4A 3D9LA 4KMOA 3MV3B 4UWFA 2CHXA 3RK6A 3ZPJA 2WM9A 3Q5MA 5FZSA 3JUIA 4F53A 4BT8A 4APOA 4ATGA 3CEQA 3CVNA 5E75A 3AU5A 3RO2A 3ZVVA 4I6JA 1ELWA 1WM5A 2X6HA 4H7XA 2J49A 4CT0A 4UWHA 3U3WA 4B0ZA 2I1JA 4U0ZA 3D3MA 3FTVA 3O48A 3I5PA 4G26A 1HG2A 4CRWA 3FTSA 3VTXA 2GRMA 3L6AA 3NZSA 3CVXA 3MV2B 1OWOA 4A3VA 4FADA 4FULA 3UPVA 3IV0A 5FJYA 4N39A 4RG9A 4HORA 1FVFA 3CHRA 3L54A 1EYHA 1QNFA 2FEZA 3FU0A 3VLDA 3APCA 1Z3XA 4TUUA 2IU1A 5G2NA 2V0PA 5EKQD 3CVYA 3ONLA 2DIWA 5DBKA 1NP7A 2FI7A 3G2TA 4BTAA 2I9CA 3LKUA 4I43A 4H7YA 4PUCA 3GW4A 1E8ZA 4UWLA 3ZFWA 4I9EA 4IYPA 4GU5A 3TG4A 1IHGA 5BV1A 4DK5A 3FU5A 4G24A 4LUNU 5FZQA 3VLFA 3L13A 4BX8A 3QWVA 3T5XA 4JA7A 4JC8A 5CHEE 3SNXA 2V4LA 4PH4B 1IQRA 3TL5A 1INZA 4I2WA 4BTBA 3LS8A 3UT8A 2AXVA 3RRNB 4MRUA 2FBNA 2RD0A 3MKQB 3HIZA 2GRLA 2HR2A 2XHEA 2MHKA 1ELRA 4UI9J 4HVBA 1IQUA 1X5BA 1B89A 2V5FA 3SGHA 3T8MA 3CVQA 2J4DA 3ZRHA 1SQMA 1UN8A 1BPOA 3LY8A 3LY9A 3PNLB 4KZ0A 4UQYA 4IN3B 5FQ7A 2VGXB 3I4RB 3LYAA 3I3NA 3NZUA 3TAXA 5CCMA 5FWQA 3HVEB 2WXLA 4EBAG 3PUJA 2E0IA 4U0SA 4GPKA 5ENNA 5FTPA 3U4TA 4WNEA 3MA5A 4BT9A 1OWNA 3EIQC 4G11A 3L17A 3P1UA 4W9RA 2IOSA 2WXOA 2BTDA 5JJ7A 5E76A 4ILIA 2HO1A 2KZTA 4OVVA 2LO6A 3UUXA 4DLOA 4G23A 5ARFA 2C0MA 3UMVA 4N5CA 3RJVA 2WMOA 1DNPA 3DPDA 1N54A 3I4GA 3QDNA 1QQEA 3QOUA 2VTBB 1NA3A 4WNFA 1KT1A 5FQ8A 1Z3YA 1HXIA 3CSFA 3JQ0A 1U3CA 4TV3A 4AP2A 3CVWA 5AJDA 2AXZA 4I1AA 2X38A 3VTYA 3TXMA 4GYYA 3IBEA 2WXGA 3D9NA 5JHAA 3LCAA 4NURA 2IF4A 4I17A 4ANXA 2HYZA 2PQNA 4N2SA 2L9BA 3FUDA 3NF1A 3QARA 3AS8A 5A7DB 2R59A 5EX0A 2Y3AA 3UX4A 4AJWA 2WXKA 2GGFA 2WXQA 3PZDA 2VSNA 4OVUA 4F7AA 3ENEA 4A1GA 1H2UA 3L16A 4Q94A 3FY4A 3FUEA 4XE0A 4M3OA 3FEXA 2PM7A 4Q69A 3PE4A 4WAFA 4GZCA 3BG0B 4J8SA 5LCWJ 3U66A 5G04J 3QK0A 1U3DA 3G2VA 4A1SA 4APFA 1UW4B 3RIBA 3CHQA 5KJKA 4NQ0A 2CFZA 4GZ5A 3HHMA 4PDXA 3S2AA 3FFLA 4JVSA 3OXGA 3IKOB 4F1SA 3RO3A 4FU3A 1YA0A 3MEKA 3RRMB 1QZ2A 3CKBA 3OXLA 1E96B 4E6HA 3FH8A 3D9OA 3FH7A 4PS3A 5T4YA 3CK8A 4AIFA 4ANVA 4FHKA 5HI7A 2CHZA 3MKRA 4E85A 3OAWA 1HF8A 4FC8A 4ME2A 4OYSA 1UG3A 2MOWA 4G2VA 5ANRA 4I6EA 4B94A 1EPUA 1SZ9A 3LPZA 4U04A 1DVPA 3QAQA 4HFGA 4LCTA 5KCMA 3OXFA 3FTXA 2IFUA 2XPIA 3RKVA 4L2LA 3L08A 5JJTA 1OWMA 5LFAA 3TXNA 3ZHEA 2M63A 1H19A 3CVPA 3D9IA 4Q96A 1JUQA 4NRHB 5AIJA 4KBQA 2EQXA 3QKYA 2JEKA 3FUNA 1PAQA 5ANLA 1HX8A 5LX8A 3PDNA 2I2OA 4J0UA 2P58C 3HDXA 4I1MA 5JJ6A 3MYVA 2DCPA 4DPRA 3FHEA 4XI0A 5EX3A 2NSZA 2R17C 3UT4A 5BV0A 4YNDA 4U8HA 1WAO1 5FT9A 4A55A 4G25A 2J4BA 3ZYLA 5A6CA 5AENA 4C0EA 3FUKA 2AW6A 4B8AA 3CVVA 4UQZA 2UY1A 1E7UA 3TGOA 4HOQA 3SFZA 2IONA 3ML9A 3KD7A 4L23A 3PVLA 3KEZA 3QWPA 3ONKA 2WQHA 2WXPA 3G2SA 4AVXA 3ML8A 3S7JA 4ILGA 3SI5A 3URZA 3ZGQA 2QY7A 3P2BA 2MRIA 5G04C 4LEUA 3MCXA 4Y6WA 4IULA 3CHPA 2KC7A 3LVRE 3B7RL 4U07A 4WUYA 3D9MA 2X6KA 1MQSA 3ASDA 4I2ZA 5C2YA 4F3VA 3LY7A 4J8EA 3FEYA 4JZYA 5C1DA 3DBSA 1UN9A 5D0OD 3PREA 5A23A 3CGHA 2WXMA 3R9AB 3GZSA 4XKCA 3U9WA 2XCCA 3EHMA 2YNQA 4GCNA 3R7RA 2FF4A 3B7UX 3ULQA 3NQPA 3QNKA 1HO8A 1S0PA 1UJKA 4N3BA 2WVIA 5AJLA 2Q7FA 3JQ1A 1XGWA 1E8YA 2BF0X 3FU3A 4JPSA 4EZKA 2PM6A 1Y8MA 3ZHEB 1EDUA 1NA0A 2YHCA 3CR3A 3E4BA 3IHVA 3LXUX 3MJWA 2VQ2A 4L7TA 5KJMA 4WWPA 3PRZA 3G2WA 3ZYKA 4HOUA 5BUZA 3GZ2A 3KAEA 3FH5A 2KCKA 4EZLA 3PEVB 2L6JA 3TG5A 4D10C 3L22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X3M A; 
#chains in the Genus database with same CATH topology
 1QYM A;  3B7T A;  2OV8 A;  4JA9 A;  5FQ4 A;  1L5J A;  2C2L A;  4HOT A;  3S7F A;  4DX1 A;  3Q78 A;  1AP7 A;  2LXM A;  4UWG A;  4CGW A;  1LTX A;  4C9B B;  3SBS A;  4GAA A;  2WQ7 A;  2XZT G;  2A4Z A;  2WPV A;  2X6J A;  4ABN A;  4PS7 A;  5BT1 A;  2FO7 A;  4XEI G;  3PEU B;  4U8Y D;  5ENQ D;  1Y6I A;  3C98 A;  4UI9 C;  5KBA A;  5FIN A;  2B0O E;  2EIL E;  4IRU A;  4QQI A;  3C3R A;  2QYU A;  1VDY A;  1H2T C;  3S7D A;  3SD5 A;  2LAI A;  3LEW A;  3MKQ A;  3FDH A;  5B1A E;  1E7V A;  3EIJ A;  4UQX A;  1X81 A;  3DSV A;  2X6F A;  2BUG A;  3FTW A;  3B7S A;  5J90 A;  4GCO A;  2J8S D;  2XRZ A;  4DJA A;  4AM9 A;  4CGV A;  4XIF A;  3EUV A;  2WXR A;  4G1T A;  4RG6 A;  1OCO E;  5T8I A;  4FJY A;  4QFV A;  5EYP F;  1E8W A;  3CST A;  4PS8 A;  4FJZ A;  2QYJ A;  5JMN D;  2L0T B;  3D9P A;  3GZ1 A;  1OUV A;  3WXX A;  3BEE A;  2R5S A;  4GTM A;  4CDM A;  3HXD A;  3Q47 B;  4TRQ A;  2BKK B;  3RRU A;  2CG2 A;  2R02 A;  4NAC A;  4URK A;  1N52 A;  4K03 A;  1XNF A;  4JHR A;  2P9K G;  1BD8 A;  3SF4 A;  4N2Q A;  2PQR A;  3FTZ A;  4GZD A;  3S7B A;  4MS6 A;  4GA0 A;  2UY1 B;  2JLB A;  1S63 A;  3WG7 E;  5CBN A;  1OXJ A;  1HS6 A;  2WMN A;  4BFR A;  2V8S E;  3D9J A;  3QWW A;  5KNH D;  1N95 A;  2XEV A;  1HH8 A;  2XPY A;  1SA5 A;  3PE3 A;  1DCE A;  1YMP A;  2J07 A;  4J6I A;  4FLH A;  2KBX A;  3ESL A;  3KS2 A;  2QFC A;  2IOL A;  3QJZ A;  1TJC A;  4LNG A;  1ZBP A;  2HM8 A;  3C3Q A;  1Z6T A;  1JWG A;  3ZPJ A;  2CHX A;  2WM9 A;  3CEQ A;  1WDY A;  3CVN A;  5EN5 D;  3ZVV A;  1ELW A;  1G3N B;  3KSL A;  4JD2 G;  4UWH A;  2P9N G;  5HS0 A;  2GRM A;  3NZS A;  3MV2 B;  5AQB A;  4FUL A;  1SVX A;  4BER A;  4NIK A;  3CHR A;  3APC A;  3L9T A;  2V0P A;  2ZXW E;  2V5Q C;  3G2T A;  5AN8 A;  4PUC A;  3GW4 A;  3ZFW A;  1D9S A;  1IHG A;  5BV1 A;  4HRL A;  3T5X A;  3NOC D;  2XS1 A;  3DEP A;  5CHE E;  4PH4 B;  1INZ A;  2AXV A;  4MRU A;  3TWR A;  2HR2 A;  3BUA A;  1B89 A;  2V5F A;  3T8M A;  1IXV A;  2J4D A;  3CVQ A;  1MX6 A;  4A63 B;  1SQM A;  3LY9 A;  3LY8 A;  4KZ0 A;  4IN3 B;  3I4R B;  1OCZ E;  3NZU A;  3HVE B;  5ENR D;  1ZB1 A;  1MZC A;  2L6B A;  3BQO A;  5FTP A;  3NB2 A;  2NYJ A;  2V4H C;  2WXO A;  4GPM A;  2HO1 A;  4OVV A;  3UUX A;  1TNY A;  4G23 A;  1QBQ A;  3RJV A;  3I4G A;  2GRP B;  2VTB B;  1QQE A;  1NA3 A;  4WNF A;  2AXZ A;  3TXM A;  1KPS B;  1H6P A;  4NUR A;  2L9B A;  4U8V D;  3NF1 A;  3QAR A;  2GGF A;  4OVU A;  2VSN A;  3ENE A;  4A1G A;  3B95 A;  4XE0 A;  4Q69 A;  3FEX A;  4GZC A;  4J8S A;  3G2V A;  1S70 B;  5KJK A;  1U2V G;  4NQ0 A;  2Y69 E;  3S2A A;  4PDX A;  1YCS B;  4F1S A;  4C48 B;  3OXL A;  1MJ0 A;  4E6H A;  4PS3 A;  5T4Y A;  4TUM A;  3CK8 A;  3MKR A;  4E85 A;  3OAW A;  5ANR A;  3UM0 A;  1DVP A;  3ABM E;  4LCT A;  2XPI A;  1S64 A;  3TXN A;  1DCQ A;  1JUQ A;  4GTP A;  2I2O A;  3SFY A;  2P58 C;  4I1M A;  3Q9N C;  1FT1 A;  2DCP A;  5EX3 A;  5FT9 A;  2J4B A;  5AEN A;  4C0E A;  4B8A A;  2UY1 A;  3JXI A;  3ML9 A;  3QWP A;  2WQH A;  4AVX A;  3C72 A;  3ZGQ A;  3SI5 A;  4K5C A;  3P2B A;  2EIK E;  5JA4 D;  4LEU A;  4Y6W A;  3LVR E;  2ZGG A;  2X6K A;  2P9U G;  4F3V A;  3LY7 A;  4J8E A;  3ZUV B;  1JCS A;  5A23 A;  3U9W A;  4XKC A;  3EHM A;  5ENP D;  2YNQ A;  4GCN A;  2FF4 A;  3B7U X;  1HO8 A;  1S0P A;  1UJK A;  5AJL A;  4HRM B;  1KZO A;  2OEW A;  4EZK A;  1NA0 A;  2VQ2 A;  5KJM A;  3ZYK A;  5CED B;  3PEV B;  2L6J A;  3TG5 A;  4F6R D;  4D10 C;  1OWL A;  4TXR A;  2I6H A;  2ZU6 B;  3B13 A;  4GYO A;  4CT4 A;  3ZYQ A;  2FO1 E;  4HRN A;  3MX3 A;  3CVL A;  4JW1 A;  3NOG D;  4ANU A;  3UI2 A;  3R7Q A;  4WWO A;  2VGY A;  3ZN3 A;  3FUM A;  2LXL A;  4JB8 P;  4BSX A;  1JWF A;  3ESK A;  5BW8 C;  4HOS A;  2WXN A;  1K1B A;  2LUH A;  2ILR A;  5DIZ A;  2RKK A;  2XPZ A;  5FZR A;  5ARG A;  4TXQ A;  4XX5 A;  4YDW A;  3CHO A;  1TNO A;  3NBN B;  1WY6 A;  2ETB A;  3CIA A;  3PUK A;  3HVE A;  1A17 A;  1W3B A;  4KT6 B;  4UI9 K;  4CDR A;  4EPZ A;  3UQ3 A;  2VTB A;  2XGM A;  4CCA A;  4V3I A;  1HE8 A;  2H6H A;  5J08 A;  3J5P A;  4GB9 A;  2DWZ A;  2A5E A;  4I1O B;  3IHY A;  3ZXP A;  3FU6 A;  4KVO A;  4BY6 A;  2AXU A;  2IJG X;  5G05 C;  4EBA A;  4GZ6 A;  4BWR A;  4AY5 A;  4RSY A;  4L9P A;  3Q49 B;  4WNG A;  4DI3 A;  1ELK A;  2XEH A;  5KWD A;  4LNU D;  4HQD A;  2GW1 A;  2Y4T A;  3EDT B;  3ASN E;  1SW6 A;  4UWK A;  4FA6 A;  4YVO A;  3SZ7 A;  2CFU A;  4ACK A;  4EHM A;  2HE0 A;  4U95 D;  3IEG A;  2AVP A;  3D9K A;  3Q7F A;  3F6Q A;  3ZW3 A;  2OEV A;  4TXP A;  4AEZ C;  1H0A A;  2PL2 A;  2AWI A;  1O5M A;  2C0L A;  3LVQ E;  5EDS A;  2J09 A;  2WQ6 A;  4JL0 A;  3DPY A;  3FUH A;  3RSE G;  3FUI A;  3ASF A;  2GRR B;  4C0M A;  4Y6C A;  3ZEF A;  4AXH A;  2F8X K;  2VSO E;  3R9M A;  2KCV A;  1ZU2 A;  2J08 A;  1FVH A;  5KJL A;  4U63 A;  2J9Q A;  4MLP A;  4JHJ A;  3SBT B;  5AYW D;  2KXP C;  4O6F A;  1EF1 C;  3QC1 A;  3RU0 A;  4X8Q A;  2Y4U A;  3E33 A;  4DI4 A;  4M7C A;  3MV3 B;  1DC2 A;  4Z68 A;  1A5E A;  4ATG A;  3RO2 A;  1BI8 B;  2X6H A;  4CT0 A;  3IXE A;  3ZNG A;  3D3M A;  3O48 A;  3I5P A;  4G26 A;  1OWO A;  3UPV A;  3IV0 A;  4N39 A;  4RG9 A;  1FVF A;  1EYH A;  2FEZ A;  3FU0 A;  1Z3X A;  4TUU A;  2IU1 A;  5G2N A;  3ONL A;  5DBK A;  2FI7 A;  4BTA A;  1E8Z A;  4O60 A;  3TG4 A;  1OT8 A;  3FU5 A;  3UM2 A;  2XEN A;  4JA7 A;  1IQR A;  4BTB A;  3LS8 A;  3UT8 A;  2MHK A;  3SGH A;  4ZHB A;  4UQY A;  5FQ7 A;  2VGX B;  5CCM A;  5ENN A;  3U4T A;  4WNE A;  4BT9 A;  2R2L A;  1OWN A;  4G11 A;  3L17 A;  3P1U A;  4W9R A;  5E76 A;  3ABK E;  2MYO A;  4J7W A;  1N54 A;  3TWU A;  3UKU G;  5FQ8 A;  1HXI A;  3JQ0 A;  4AP2 A;  3SO8 A;  3CVW A;  5AJD A;  5JHA A;  3LCA A;  2IF4 A;  3X2Q E;  4I17 A;  2PQN A;  1TNB A;  4F7A A;  1H2U A;  3AG1 E;  4M3O A;  2PM7 A;  3PE4 A;  4U7E B;  1O1R A;  1U3D A;  4APF A;  1N0R A;  3CHQ A;  2CFZ A;  4GZ5 A;  3SQV A;  4FU3 A;  3RRM B;  1QZ2 A;  3FH7 A;  4ANV A;  5HI7 A;  2CHZ A;  1HF8 A;  2BED A;  4ME2 A;  1UG3 A;  4B94 A;  1SZ9 A;  4U04 A;  5D66 A;  5KCM A;  3OXF A;  3FTX A;  2IFU A;  3RKV A;  5JJT A;  3L08 A;  1OWM A;  3ZHE A;  2M63 A;  4ZFH A;  4DX5 D;  3D9I A;  4Q96 A;  1PAQ A;  1HX8 A;  3EU9 A;  3MYV A;  3UT4 A;  4YND A;  5A6C A;  2ZIR A;  2DZO A;  4UQZ A;  2ION A;  2ZGD A;  3UIN C;  4L23 A;  3DEO A;  2WXP A;  3ML8 A;  4ILG A;  3DWL G;  2MRI A;  3MCX A;  3B7R L;  4U07 A;  3HG0 D;  4WUY A;  5C2Y A;  3TWQ A;  1UN9 A;  5D0O D;  3PRE A;  3GZS A;  2XCC A;  1OCC E;  1AWC B;  3EU5 A;  2WVI A;  5ENT D;  4L7T A;  4HOU A;  1NI1 A;  3KAE A;  3FH5 A;  2KCK A;  3D9H A;  2P2C P;  2AJA A;  2R03 A;  3CHM A;  4EEC A;  4LER A;  2FUL A;  3APD A;  5LP0 A;  3AU4 A;  4ANW A;  3Q9U C;  3ZXS A;  4I6G A;  1P5Q A;  2WB2 A;  4GMR A;  2XCB A;  2DBA A;  4J8F A;  3ASH A;  4L2Y A;  5G05 J;  2LSV A;  1NL4 A;  3Q4A B;  2WXJ A;  4ACL A;  4G8L A;  3LJ3 A;  1OCR E;  2RG8 A;  2GRN B;  3AJI A;  3CKC A;  4KVM A;  1KT0 A;  2X6I A;  3ZYM A;  4WWN A;  3GYZ A;  2DYS E;  4UUC A;  3Q15 A;  4DLQ A;  2X3M A;  1LF8 A;  4YVQ C;  2KZT B;  3BG1 B;  1HFA A;  3U64 A;  2PNN A;  4CEM A;  4JEU A;  2XGO A;  5CMY A;  1H2V C;  5BPP A;  1TR4 A;  3G2U A;  5CCL A;  2VGX A;  2P9S G;  4AV7 A;  4ILH B;  4AY6 A;  2WXH A;  2Y0B G;  4KZC A;  2RFA A;  3VLE A;  5B1B E;  3EHN A;  4B8C B;  3CQC B;  5G55 A;  1LD8 A;  2DZN A;  1E90 A;  3PNT B;  4XZ4 A;  4GZ3 A;  4GA1 A;  4F1P A;  1HU3 A;  3CHS A;  4OAU C;  5EYL A;  3JYS A;  3EHQ A;  4GA2 A;  3AS4 A;  4LSZ E;  4CDN A;  4L1B A;  5CBO A;  5CEA A;  5BXU A;  5JHB A;  4EZJ A;  4JXT A;  3FTU A;  1RW2 A;  2JAB A;  3KEA A;  3EJN A;  3TJP A;  5KNG A;  5M72 A;  3E30 A;  3CK7 A;  4B89 A;  4DUI A;  2YHE A;  3JXJ A;  1JPL A;  3FUF A;  2YQ8 A;  5BXO A;  5LOZ A;  4N5Q A;  4HLE A;  2IQC A;  5AAO A;  5IY5 E;  4JHK A;  1OWP A;  4K5B A;  2CHW A;  1N11 A;  1TNU A;  2OOE A;  4GML A;  4DX7 D;  3BU8 A;  2LAH A;  3J5Q B;  2NC9 A;  4WND A;  2A5U A;  1E8X A;  4R7L A;  5CEC B;  4DX6 D;  4BX9 A;  2E2E A;  5D0Q D;  1KLX A;  1BLX B;  2OVB A;  1HZ4 A;  2VSY A;  2XZD G;  4J8D A;  1FCH A;  2NXP A;  3FWV A;  3E34 A;  4XKB A;  1HG5 A;  4LRZ A;  3V2O A;  4HI8 A;  4UWF A;  1SA4 A;  3Q5M A;  5FZS A;  3AU5 A;  1IHB A;  4LG6 A;  1WM5 A;  3TWW A;  2J49 A;  4RQI A;  3JUE A;  4U0Z A;  1HG2 A;  4CRW A;  3FTS A;  3VTX A;  3L6A A;  3CVX A;  3UTM A;  4A3V A;  2F37 A;  5FJY A;  1QNF A;  3VLD A;  1RZ4 A;  5EIB E;  1NP7 A;  2I9C A;  2H6F A;  4I43 A;  4H7Y A;  3UXG A;  4G24 A;  5FZQ A;  4BX8 A;  3HRA A;  3SNX A;  2OCC E;  3TL5 A;  5B3S E;  4I2W A;  1BI7 B;  4GTO A;  3RRN B;  3V2X A;  2GRL A;  1ELR A;  1IQU A;  1X5B A;  3ZRH A;  1UN8 A;  3PNL B;  3CVU A;  3DXK G;  2WXL A;  3T8K A;  2E0I A;  1FPP A;  3EIQ C;  4J8Y A;  3DSS A;  1BU9 A;  2KZT A;  2P9L G;  4DLO A;  1N4S A;  2C0M A;  2WMO A;  1DNP A;  3DPD A;  3HXB A;  2R05 A;  3QOU A;  1KT1 A;  1Z3Y A;  1U3C A;  4TV3 A;  4I1A A;  2X38 A;  5AQ9 A;  2WXG A;  1V55 E;  3D9N A;  2DVW A;  3T9K A;  3FUD A;  4RLY A;  2R59 A;  5EX0 A;  3UX4 A;  2WXK A;  2WXQ A;  3PZD A;  1MX2 A;  3FY4 A;  3E37 A;  1N9A A;  3Q75 A;  5LCW J;  3U66 A;  4A1S A;  3ASO E;  3RIB A;  4U96 D;  3HHM A;  3FFL A;  4JVS A;  3IKO B;  3MEK A;  3CKB A;  1E96 B;  3FH8 A;  2B6C A;  3D9O A;  3HXE A;  4FHK A;  4FC8 A;  3LJN A;  2Y1L E;  4I6E A;  3LPZ A;  5EID A;  5H7P A;  4MBG A;  5LFA A;  1H19 A;  3CVP A;  4NRH B;  5AIJ A;  4KBQ A;  2EQX A;  3QKY A;  3FUN A;  3ULE G;  3TWT A;  4J0U A;  3V31 A;  2H6G A;  5AQ7 A;  5HKP A;  1K1A A;  4XI0 A;  4U8H A;  4G25 A;  3FUK A;  3CVV A;  1E7U A;  3TGO A;  4HOQ A;  3SFZ A;  3PVL A;  3KEZ A;  3Q79 A;  5EIL A;  3S7J A;  2QY7 A;  2IO2 C;  2ETC A;  5G04 C;  4IUL A;  2H6I A;  2XS8 A;  3D9M A;  3PZ4 A;  2EIM E;  4JZY A;  3CGH A;  2WXM A;  3R9A B;  1Z5S C;  2GRO B;  3ULQ A;  4N3B A;  2BKG A;  2Q7F A;  3JQ1 A;  1E8Y A;  2P9P G;  3DSU A;  5ITZ F;  2BF0 X;  3FU3 A;  1Y8M A;  3E4B A;  3UM1 A;  3GZ2 A;  5AQA A;  2IO3 C;  3L22 A;  1UOH A;  1TEZ A;  3FUL A;  4DX2 A;  4BET A;  1N0Q A;  4O1O A;  1NZN A;  4YDE A;  2VGE A;  2EIN E;  1TYQ G;  4GTR A;  4N3C A;  4P29 A;  5KJN A;  3O4Z A;  3MGB A;  2YIN A;  5CRV A;  4A3T A;  1NFI E;  3SHF A;  2WXF A;  1IKN D;  3SFX A;  1MHQ A;  3C5R A;  2VYI A;  1D8E A;  3MZL B;  2ZIS A;  3T5V A;  4KYO B;  2KAT A;  5ENS D;  3JCK C;  4FLB A;  5AAR A;  5CMW A;  4LNB A;  4DRX E;  2ETA A;  1UJJ A;  4CYM D;  2KM4 A;  1TJF A;  4HXI A;  3ASG A;  3AS5 A;  2XGS A;  3UKR G;  1PC2 A;  3DSX A;  2UWJ G;  3APF A;  3HYM B;  4MKT A;  4EQF A;  3K9I A;  4I9C A;  3LDZ A;  3ZKJ A;  3DXM G;  4U0U A;  4JEH A;  3NAW A;  5HQ8 A;  5LCW C;  2EIJ E;  4GYW A;  2PZI A;  4OAV B;  3B7B A;  3L82 A;  3CV0 A;  2CG3 A;  4HLL A;  3HXC A;  1O1S A;  3TWV A;  3CQG B;  1N4P A;  1D8D A;  4GTS A;  4FHJ A;  5D2M C;  2XRY A;  3SY2 A;  3ZIM A;  4FP7 A;  1PY1 A;  5ENO D;  2KCL A;  4GMJ A;  4CZ2 D;  3PS6 A;  2WXI A;  4KXK B;  1IYG A;  5T3R A;  2OVF A;  3FUJ A;  5FQ6 A;  3FTY A;  1JCR A;  4N3A A;  4O1P A;  4K0R A;  2IEJ A;  5BNW A;  4AOF A;  2XQ0 A;  4HS2 A;  1GW6 A;  1H6K A;  1N4R A;  2I1K A;  3DRA A;  3ULY A;  1SZA A;  4ATZ D;  2VJ8 A;  3FP3 A;  2RFM A;  4GTT A;  3CK9 A;  2VSX E;  4XI9 A;  3PH0 C;  4RVB A;  3N71 A;  3OTN A;  1TN8 A;  2LNI A;  2LSU A;  3CLJ A;  3QB2 A;  2QZA A;  3UT7 A;  3AG2 E;  2L0I A;  3TWX A;  1K3Z D;  2OND A;  4K5A B;  4BEP A;  2DYR E;  3AG4 E;  3D9L A;  4KMO A;  3RK6 A;  3JUI A;  3PZ3 A;  4F53 A;  4BT8 A;  4APO A;  5E75 A;  4I6J A;  1OY3 D;  4H7X A;  4GTQ A;  3C3O A;  3UIO C;  4GTV A;  3U3W A;  1TN7 A;  4B0Z A;  2I1J A;  3FTV A;  4FAD A;  4HOR A;  3L54 A;  1LD7 A;  5EKQ D;  3CVY A;  2DIW A;  3LKU A;  4UWL A;  4I9E A;  4IYP A;  4GU5 A;  1MYO A;  3ISM C;  4DK5 A;  4LUN U;  3VLF A;  2P9I G;  3L13 A;  3QWV A;  1KZP A;  1K8K G;  4JC8 A;  2XEE A;  2V4L A;  4B93 B;  2FBN A;  2RD0 A;  3MKQ B;  1V54 E;  3HIZ A;  2XHE A;  1FT2 A;  3HXF A;  3PZ2 A;  4UI9 J;  4HVB A;  3UM3 A;  1BPO A;  3LYA A;  3I3N A;  3TAX A;  2F8Y A;  1WG0 A;  5FWQ A;  4EBA G;  3PUJ A;  4U0S A;  4GPK A;  3MA5 A;  4YDO A;  2IOS A;  2BTD A;  5JJ7 A;  4ILI A;  2LO6 A;  5ARF A;  3UMV A;  1TNZ A;  4N5C A;  3Q73 A;  3QDN A;  1TN6 A;  3CSF A;  4HNA D;  1YYH A;  3VTY A;  4GYY A;  3IBE A;  3W9G A;  4BES A;  2HYZ A;  4ANX A;  4N2S A;  3V30 A;  3AS8 A;  1N4Q A;  5A7D B;  2Y3A A;  4AJW A;  3L16 A;  4Q94 A;  2QC9 A;  3FUE A;  3W9F A;  5CER B;  5FIO A;  4WAF A;  4BSZ B;  3V79 K;  3BG0 B;  5G04 J;  3QK0 A;  1UW4 B;  4HB5 A;  3OXG A;  4HI9 A;  3RO3 A;  1YA0 A;  4AIF A;  5HRY A;  4HBD A;  3ABL E;  4OYS A;  2MOW A;  4G2V A;  1EPU A;  3QAQ A;  4HFG A;  4L2L A;  3Q7A A;  2JEK A;  5ANL A;  4G8K A;  5LX8 A;  3PDN A;  3HDX A;  5JJ6 A;  4DPR A;  3FHE A;  2NSZ A;  2R17 C;  5BV0 A;  1WAO 1;  4A55 A;  3ZYL A;  3E32 A;  2AW6 A;  1MX4 A;  3EHR A;  3KD7 A;  3ONK A;  3G2S A;  3URZ A;  3KSQ A;  3DST A;  3PZ1 A;  1N94 A;  3CHP A;  2KC7 A;  3UIP C;  1Q2Z A;  1MQS A;  3ASD A;  4I2Z A;  2GRQ B;  3FEY A;  5C1D A;  3DBS A;  2IY0 C;  1H6O A;  3R7R A;  3NQP A;  3QNK A;  3AG3 E;  1JCQ A;  4YDY A;  1XGW A;  4JPS A;  3TWS A;  2PM6 A;  5CRU A;  2F0Y A;  3ZHE B;  1EDU A;  2YHC A;  3CR3 A;  3IHV A;  3DSW A;  3LXU X;  3MJW A;  1O1T A;  4WWP A;  3PRZ A;  3AAA C;  3G2W A;  5BUZ A;  3RAU A;  4EZL A;  3ZU7 B; 
#chains in the Genus database with same CATH homology
 1OWL A;  3B7T A;  1TEZ A;  2I6H A;  3FUL A;  2OV8 A;  4JA9 A;  2ZU6 B;  3CHM A;  3B13 A;  2FUL A;  4LER A;  4GYO A;  5FQ4 A;  3APD A;  4EEC A;  5LP0 A;  3AU4 A;  4ANW A;  1L5J A;  3ZXS A;  2C2L A;  4I6G A;  4CT4 A;  1P5Q A;  2WB2 A;  3ZYQ A;  4HOT A;  3S7F A;  1NZN A;  4UWG A;  3MX3 A;  2XCB A;  3CVL A;  4JW1 A;  2DBA A;  4CGW A;  4N3C A;  4P29 A;  5KJN A;  4ANU A;  4J8F A;  3R7Q A;  4WWO A;  3O4Z A;  3ASH A;  3SBS A;  4C9B B;  4GAA A;  4L2Y A;  3MGB A;  2VGY A;  2YIN A;  5G05 J;  2A4Z A;  2LSV A;  3FUM A;  3ZN3 A;  2WQ7 A;  2WPV A;  2X6J A;  3Q4A B;  4A3T A;  4ABN A;  4PS7 A;  2WXJ A;  4ACL A;  4BSX A;  3LJ3 A;  3SHF A;  5BT1 A;  2FO7 A;  1JWF A;  2WXF A;  3PEU B;  2RG8 A;  1MHQ A;  3ESK A;  1Y6I A;  3C98 A;  5BW8 C;  4HOS A;  4UI9 C;  2VYI A;  2WXN A;  3CKC A;  4KVM A;  4IRU A;  2ILR A;  1KT0 A;  3MZL B;  2X6I A;  5DIZ A;  3ZYM A;  1VDY A;  2XPZ A;  4WWN A;  3GYZ A;  1H2T C;  3S7D A;  3SD5 A;  3T5V A;  4KYO B;  5ARG A;  2KAT A;  2LAI A;  3Q15 A;  5FZR A;  4DLQ A;  2X3M A;  1LF8 A;  3LEW A;  4YVQ C;  4XX5 A;  2KZT B;  3FDH A;  3MKQ A;  3BG1 B;  1HFA A;  3JCK C;  4FLB A;  1E7V A;  3CHO A;  3U64 A;  4CEM A;  4JEU A;  5CMW A;  3EIJ A;  2XGO A;  4UQX A;  5CMY A;  1H2V C;  5BPP A;  1WY6 A;  3G2U A;  5CCL A;  2VGX A;  3CIA A;  3PUK A;  4AV7 A;  2X6F A;  1UJJ A;  2BUG A;  3HVE A;  3FTW A;  2KM4 A;  3B7S A;  4ILH B;  4AY6 A;  1TJF A;  4HXI A;  5J90 A;  3ASG A;  2WXH A;  1A17 A;  3AS5 A;  4GCO A;  4KZC A;  2XGS A;  2XRZ A;  4DJA A;  3VLE A;  3EHN A;  4AM9 A;  1W3B A;  4B8C B;  4CGV A;  4KT6 B;  4XIF A;  3CQC B;  5G55 A;  1PC2 A;  4UI9 K;  4CDR A;  4EPZ A;  2UWJ G;  3APF A;  3UQ3 A;  3HYM B;  2WXR A;  4MKT A;  2VTB A;  4G1T A;  4EQF A;  2XGM A;  4CCA A;  3K9I A;  4V3I A;  4RG6 A;  4I9C A;  1HE8 A;  3LDZ A;  5J08 A;  4GB9 A;  4I1O B;  1E90 A;  3IHY A;  3PNT B;  3FU6 A;  4KVO A;  4XZ4 A;  4GZ3 A;  4GA1 A;  4U0U A;  5T8I A;  4FJY A;  4JEH A;  4QFV A;  4BY6 A;  5HQ8 A;  5LCW C;  1E8W A;  2AXU A;  2IJG X;  2PZI A;  3CST A;  4GYW A;  4PS8 A;  1HU3 A;  4GZ6 A;  5G05 C;  4FJZ A;  4EBA A;  3CHS A;  4BWR A;  3CV0 A;  2L0T B;  4AY5 A;  4RSY A;  2CG3 A;  3JYS A;  3D9P A;  3Q49 B;  4GA2 A;  3AS4 A;  4WNG A;  4CDN A;  4L1B A;  4DI3 A;  1ELK A;  3CQG B;  3GZ1 A;  1OUV A;  4FHJ A;  2GW1 A;  2Y4T A;  3BEE A;  3EDT B;  3WXX A;  2XRY A;  4UWK A;  4FA6 A;  4YVO A;  5JHB A;  3SZ7 A;  2R5S A;  2CFU A;  4EZJ A;  4ACK A;  4JXT A;  3ZIM A;  3FTU A;  4FP7 A;  1PY1 A;  4CDM A;  2KCL A;  4GMJ A;  3PS6 A;  3Q47 B;  4TRQ A;  3IEG A;  2WXI A;  3EJN A;  2AVP A;  3D9K A;  3TJP A;  4KXK B;  1IYG A;  5T3R A;  5M72 A;  2OVF A;  3RRU A;  2CG2 A;  3CK7 A;  4NAC A;  4B89 A;  3FUJ A;  4URK A;  1N52 A;  5FQ6 A;  2YHE A;  1JPL A;  3ZW3 A;  4K03 A;  1XNF A;  3FUF A;  3FTY A;  2YQ8 A;  4JHR A;  4N3A A;  5LOZ A;  4AEZ C;  1H0A A;  2PL2 A;  4K0R A;  5BNW A;  2AWI A;  4HLE A;  2IQC A;  2C0L A;  3LVQ E;  3SF4 A;  4N2Q A;  4JHK A;  5EDS A;  2PQR A;  1OWP A;  3FTZ A;  2CHW A;  4GZD A;  2J09 A;  4MS6 A;  3S7B A;  4AOF A;  2WQ6 A;  2XQ0 A;  4GA0 A;  4HS2 A;  4JL0 A;  3FUH A;  1GW6 A;  2OOE A;  3FUI A;  1H6K A;  3ASF A;  2UY1 B;  4GML A;  2I1K A;  2JLB A;  4C0M A;  1SZA A;  4Y6C A;  1HS6 A;  2VJ8 A;  3ZEF A;  2WMN A;  4AXH A;  4BFR A;  2V8S E;  2VSO E;  3D9J A;  2LAH A;  3FP3 A;  3CVU A;  2NC9 A;  4WND A;  2A5U A;  2KCV A;  3QWW A;  3CK9 A;  2XEV A;  2VSX E;  1ZU2 A;  3PH0 C;  4XI9 A;  2J08 A;  1E8X A;  4R7L A;  4RVB A;  1FVH A;  3N71 A;  1HH8 A;  3OTN A;  4U63 A;  2J9Q A;  2LNI A;  4BX9 A;  5KJL A;  4MLP A;  2E2E A;  4JHJ A;  5D0Q D;  2XPY A;  1KLX A;  2LSU A;  3SBT B;  3CLJ A;  5AYW D;  3QB2 A;  3PE3 A;  2J07 A;  2OVB A;  4J6I A;  1HZ4 A;  4FLH A;  1EF1 C;  4O6F A;  2VSY A;  3UT7 A;  4J8D A;  3QC1 A;  1FCH A;  2NXP A;  2L0I A;  3FWV A;  3ESL A;  3KS2 A;  3RU0 A;  2QFC A;  2IOL A;  2OND A;  1TJC A;  3QJZ A;  1ZBP A;  2HM8 A;  2Y4U A;  1Z6T A;  1JWG A;  4XKB A;  1HG5 A;  4LRZ A;  4DI4 A;  3D9L A;  4KMO A;  3MV3 B;  4UWF A;  2CHX A;  3RK6 A;  3ZPJ A;  2WM9 A;  3Q5M A;  5FZS A;  3JUI A;  4F53 A;  4BT8 A;  4APO A;  4ATG A;  3CEQ A;  3CVN A;  5E75 A;  3AU5 A;  3RO2 A;  3ZVV A;  4I6J A;  1ELW A;  1WM5 A;  2X6H A;  4H7X A;  2J49 A;  4CT0 A;  4UWH A;  3U3W A;  4B0Z A;  2I1J A;  4U0Z A;  3D3M A;  3FTV A;  3O48 A;  3I5P A;  4G26 A;  1HG2 A;  4CRW A;  3FTS A;  3VTX A;  2GRM A;  3L6A A;  3NZS A;  3CVX A;  3MV2 B;  1OWO A;  4A3V A;  4FAD A;  4FUL A;  3UPV A;  3IV0 A;  5FJY A;  4N39 A;  4RG9 A;  4HOR A;  1FVF A;  3CHR A;  3L54 A;  1EYH A;  1QNF A;  2FEZ A;  3FU0 A;  3VLD A;  3APC A;  1Z3X A;  4TUU A;  2IU1 A;  5G2N A;  2V0P A;  5EKQ D;  3CVY A;  3ONL A;  2DIW A;  5DBK A;  1NP7 A;  2FI7 A;  3G2T A;  4BTA A;  2I9C A;  3LKU A;  4I43 A;  4H7Y A;  4PUC A;  3GW4 A;  1E8Z A;  4UWL A;  3ZFW A;  4I9E A;  4IYP A;  4GU5 A;  3TG4 A;  1IHG A;  5BV1 A;  4DK5 A;  3FU5 A;  4G24 A;  4LUN U;  5FZQ A;  3VLF A;  3L13 A;  4BX8 A;  3QWV A;  3T5X A;  4JA7 A;  4JC8 A;  5CHE E;  3SNX A;  2V4L A;  4PH4 B;  1IQR A;  3TL5 A;  1INZ A;  4I2W A;  4BTB A;  3LS8 A;  3UT8 A;  2AXV A;  3RRN B;  4MRU A;  2FBN A;  2RD0 A;  3MKQ B;  3HIZ A;  2GRL A;  2HR2 A;  2XHE A;  2MHK A;  1ELR A;  4UI9 J;  4HVB A;  1IQU A;  1X5B A;  1B89 A;  2V5F A;  3SGH A;  3T8M A;  3CVQ A;  2J4D A;  3ZRH A;  1SQM A;  1UN8 A;  1BPO A;  3LY8 A;  3LY9 A;  3PNL B;  4KZ0 A;  4UQY A;  4IN3 B;  5FQ7 A;  2VGX B;  3I4R B;  3LYA A;  3I3N A;  3NZU A;  3TAX A;  5CCM A;  5FWQ A;  3HVE B;  2WXL A;  4EBA G;  3PUJ A;  2E0I A;  4U0S A;  4GPK A;  5ENN A;  5FTP A;  3U4T A;  4WNE A;  3MA5 A;  4BT9 A;  1OWN A;  3EIQ C;  4G11 A;  3L17 A;  3P1U A;  4W9R A;  2IOS A;  2WXO A;  2BTD A;  5JJ7 A;  5E76 A;  4ILI A;  2HO1 A;  2KZT A;  4OVV A;  2LO6 A;  3UUX A;  4DLO A;  4G23 A;  5ARF A;  2C0M A;  3UMV A;  4N5C A;  3RJV A;  2WMO A;  1DNP A;  3DPD A;  1N54 A;  3I4G A;  3QDN A;  1QQE A;  3QOU A;  2VTB B;  1NA3 A;  4WNF A;  1KT1 A;  5FQ8 A;  1Z3Y A;  1HXI A;  3CSF A;  3JQ0 A;  1U3C A;  4TV3 A;  4AP2 A;  3CVW A;  5AJD A;  2AXZ A;  4I1A A;  2X38 A;  3VTY A;  3TXM A;  4GYY A;  3IBE A;  2WXG A;  3D9N A;  5JHA A;  3LCA A;  4NUR A;  2IF4 A;  4I17 A;  4ANX A;  2HYZ A;  2PQN A;  4N2S A;  2L9B A;  3FUD A;  3NF1 A;  3QAR A;  3AS8 A;  5A7D B;  2R59 A;  5EX0 A;  2Y3A A;  3UX4 A;  4AJW A;  2WXK A;  2GGF A;  2WXQ A;  3PZD A;  2VSN A;  4OVU A;  4F7A A;  3ENE A;  4A1G A;  1H2U A;  3L16 A;  4Q94 A;  3FY4 A;  3FUE A;  4XE0 A;  4M3O A;  3FEX A;  2PM7 A;  4Q69 A;  3PE4 A;  4WAF A;  4GZC A;  3BG0 B;  4J8S A;  5LCW J;  3U66 A;  5G04 J;  3QK0 A;  1U3D A;  3G2V A;  4A1S A;  4APF A;  1UW4 B;  3RIB A;  3CHQ A;  5KJK A;  4NQ0 A;  2CFZ A;  4GZ5 A;  3HHM A;  4PDX A;  3S2A A;  3FFL A;  4JVS A;  3OXG A;  3IKO B;  4F1S A;  3RO3 A;  4FU3 A;  1YA0 A;  3MEK A;  3RRM B;  1QZ2 A;  3CKB A;  3OXL A;  1E96 B;  4E6H A;  3FH8 A;  3D9O A;  3FH7 A;  4PS3 A;  5T4Y A;  3CK8 A;  4AIF A;  4ANV A;  4FHK A;  5HI7 A;  2CHZ A;  3MKR A;  4E85 A;  3OAW A;  1HF8 A;  4FC8 A;  4ME2 A;  4OYS A;  1UG3 A;  2MOW A;  4G2V A;  5ANR A;  4I6E A;  4B94 A;  1EPU A;  1SZ9 A;  3LPZ A;  4U04 A;  1DVP A;  3QAQ A;  4HFG A;  4LCT A;  5KCM A;  3OXF A;  3FTX A;  2IFU A;  2XPI A;  3RKV A;  4L2L A;  3L08 A;  5JJT A;  1OWM A;  5LFA A;  3TXN A;  3ZHE A;  2M63 A;  1H19 A;  3CVP A;  3D9I A;  4Q96 A;  1JUQ A;  4NRH B;  5AIJ A;  4KBQ A;  2EQX A;  3QKY A;  2JEK A;  3FUN A;  1PAQ A;  5ANL A;  1HX8 A;  5LX8 A;  3PDN A;  2I2O A;  4J0U A;  2P58 C;  3HDX A;  4I1M A;  5JJ6 A;  3MYV A;  2DCP A;  4DPR A;  3FHE A;  4XI0 A;  5EX3 A;  2NSZ A;  2R17 C;  3UT4 A;  5BV0 A;  4YND A;  4U8H A;  1WAO 1;  5FT9 A;  4A55 A;  4G25 A;  2J4B A;  3ZYL A;  5A6C A;  5AEN A;  4C0E A;  3FUK A;  2AW6 A;  4B8A A;  3CVV A;  4UQZ A;  2UY1 A;  1E7U A;  3TGO A;  4HOQ A;  3SFZ A;  2ION A;  3ML9 A;  3KD7 A;  4L23 A;  3PVL A;  3KEZ A;  3QWP A;  3ONK A;  2WQH A;  2WXP A;  3G2S A;  4AVX A;  3ML8 A;  3S7J A;  4ILG A;  3SI5 A;  3URZ A;  3ZGQ A;  2QY7 A;  3P2B A;  2MRI A;  5G04 C;  4LEU A;  3MCX A;  4Y6W A;  4IUL A;  3CHP A;  2KC7 A;  3LVR E;  3B7R L;  4U07 A;  4WUY A;  3D9M A;  2X6K A;  1MQS A;  3ASD A;  4I2Z A;  5C2Y A;  4F3V A;  3LY7 A;  4J8E A;  3FEY A;  4JZY A;  5C1D A;  3DBS A;  1UN9 A;  5D0O D;  3PRE A;  5A23 A;  3CGH A;  2WXM A;  3R9A B;  3GZS A;  4XKC A;  3U9W A;  2XCC A;  3EHM A;  2YNQ A;  4GCN A;  3R7R A;  2FF4 A;  3B7U X;  3ULQ A;  3NQP A;  3QNK A;  1HO8 A;  1S0P A;  1UJK A;  4N3B A;  2WVI A;  5AJL A;  2Q7F A;  3JQ1 A;  1XGW A;  1E8Y A;  2BF0 X;  3FU3 A;  4JPS A;  4EZK A;  2PM6 A;  1Y8M A;  3ZHE B;  1EDU A;  1NA0 A;  2YHC A;  3CR3 A;  3E4B A;  3IHV A;  3LXU X;  3MJW A;  2VQ2 A;  4L7T A;  5KJM A;  4WWP A;  3PRZ A;  3G2W A;  3ZYK A;  4HOU A;  5BUZ A;  3GZ2 A;  3KAE A;  3FH5 A;  2KCK A;  4EZL A;  3PEV B;  2L6J A;  3TG5 A;  4D10 C;  3L22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...