2X3MA

Crystal structure of hypothetical protein orf239 from pyrobaculum spherical virus
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
166
structure length
166
Chain Sequence
TNWADWIMGWRTPNASEKKMEFMYWYTRTYLEEAKDIRPDIADALARGMAGLAFGRTDWVASMLDPQIMRHIYTDPEVARIYSETRDMLRRVSDYYISLTTMELGKVADIIAEAKAKGENPEVVAREIAEAVPRLSPKSLYFNLYYIGRSIGDNYVLEVARVLSKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN ORF239
publication title The Scottish Structural Proteomics Facility: Targets, Methods and Outputs.
pubmed doi rcsb
source organism Pyrobaculum spherical virus
molecule tags Unknown function
total genus 72
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2010-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.670 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2x3mA00
2X3MA
chains in the Genus database with same CATH superfamily
2VSNA 2WXJA 2VYIA 5FQ7A 3ZKJA 3LS8A 2XPYA 3I4GA 3HXEA 5EX0A 3FUMA 4APOA 2WB2A 2AVPA 3ASFA 5D0QD 3QB2A 3UPVA 4NIKA 5JMND 1AWCB 1DC2A 2GW1A 3FU6A 4H7XA 4A55A 3BEEA 1EF1C 2MYOA 3OXGA 1TN8A 1JCSA 3FUEA 2DZOA 3Q73A 3G2SA 3FEYA 4GYOA 2R03A 3PEVB 3SO8A 3MGBA 3UTMA 4DLOA 2XS8A 2E2EA 3DSXA 2KZTB 3LKUA 4HLLA 1N11A 1JUQA 4UI9J 4GYYA 2XEEA 1SA4A 2R05A 1K3ZD 4J8DA 2IEJA 1SA5A 4C9BB 4CYMD 5EN5D 5B3SE 4UWHA 1K8KG 4TXQA 1OCOE 2R59A 3GW4A 4ATGA 1MX6A 4LNBA 2RKKA 1GW6A 3AU5A 1SZ9A 4EHMA 2PL2A 4XIFA 3ZRHA 4I1OB 5KCMA 2KXPC 3ASNE 4HVBA 2IOSA 4XKBA 2OOEA 3UT7A 4Q96A 4M3OA 4BERA 1A17A 1U3DA 4HXIA 3CVLA 3KSQA 3B7RL 5ENTD 2XPZA 3TJPA 2WXHA 4U8HA 3NBNB 1Q2ZA 4QQIA 3B7BA 5BPPA 4ACKA 1NA3A 2WXLA 4M7CA 1FCHA 3ULEG 3W9GA 3EHRA 4LRZA 5EYLA 5JHBA 2DVWA 3BQOA 4I6JA 4HOSA 4F7AA 4J8EA 3U64A 4GTVA 3OXFA 4MBGA 3SZ7A 2WVIA 4YDYA 1JCQA 1N0QA 5AQ9A 4AJWA 3NOCD 4PDXA 1PAQA 3AG2E 4TUUA 1TJCA 4GMLA 2VTBA 4B8CB 1H0AA 2F8XK 3PZ3A 3QDNA 4HBDA 3ZNGA 3CVVA 3DWLG 4GU5A 3IKOB 2WXPA 2I1KA 5FQ8A 2HM8A 2DYRE 3B95A 3DPYA 5ANLA 3ASHA 3Q7FA 5AJDA 3E30A 1UOHA 1L5JA 2I2OA 2XCCA 1EPUA 1TR4A 2WXMA 3OXLA 2J4DA 3LXUX 4WAFA 1D8EA 2ZU6B 2A5EA 2DWZA 1OCZE 3TWTA 4K5BA 4HI8A 4TUMA 4N2SA 2VGYA 4A3TA 3S7DA 5FTPA 3DEPA 1TN7A 3DBSA 2GRNB 3BG0B 1TNYA 1FPPA 3R9AB 3QWWA 3PNTB 4UQYA 4U7EB 5A23A 5LOZA 5G04J 1E7VA 1BU9A 3RIBA 3FFLA 2FI7A 3FUHA 4GCOA 4ZFHA 2MHKA 3CLJA 4ATZD 4I6EA 4FHKA 3O4ZA 3L16A 3RRMB 3DSWA 3D9LA 3FUIA 2BKGA 2MOWA 4JHKA 3ENEA 3CIAA 5CBNA 1TN6A 2P9NG 4A1GA 1IKND 4KBQA 4JEHA 5KWDA 1WAO1 1MYOA 2CHXA 2P58C 4MRUA 4GPKA 1MHQA 3V30A 3D9PA 2UY1B 4F6RD 2R17C 2X3MA 3Q5MA 4AVXA 1HZ4A 4JZYA 5AIJA 1TJFA 1N54A 2A5UA 2EILE 4RG6A 4J8FA 4LERA 4IULA 4IRUA 2Q7FA 3AU4A 4L2YA 3BUAA 1E96B 5KJLA 4R7LA 4CT0A 5JHAA 4I2ZA 1OCCE 4BFRA 2GROB 2VQ2A 3AS4A 1EYHA 1E90A 4FJZA 4I17A 3URZA 3B7SA 3S7JA 5G05J 2AXUA 5CBOA 3C98A 5LFAA 3CK9A 5FZSA 3FTZA 3P1UA 2WXQA 4LSZE 4KMOA 4GPMA 3ABLE 2WMOA 3CV0A 3ZYKA 2J49A 1K1BA 4HB5A 1RW2A 4GB9A 2V0PA 2L9BA 3UIOC 1V55E 4RLYA 2ZGGA 4U0UA 2IY0C 1ZBPA 2C0MA 2E0IA 5ENNA 3UM0A 2X6HA 5G04C 1YYHA 3HXFA 4URKA 2XEVA 3EIQC 4FA6A 4Y6CA 1E7UA 2FO7A 2FULA 3O48A 1Y6IA 2XGSA 3TWWA 3FU0A 3MKQB 4BESA 3D9MA 2H6GA 3K9IA 5AN8A 4WWNA 1BI8B 3CKBA 3E37A 5LP0A 2I6HA 2VGXB 4U0ZA 3Q7AA 5FINA 2GRQB 3D3MA 4O1PA 2P9LG 3D9NA 4U04A 4C48B 4DPRA 3FTSA 4AEZC 2PM7A 1QZ2A 2IONA 3RK6A 4DI3A 3EHQA 3EIJA 4GAAA 3LEWA 3T5XA 3DPDA 5HKPA 3UINC 4QFVA 4I2WA 2Y4TA 3TAXA 3SD5A 2XEHA 3D9KA 2BF0X 5KJMA 4FU3A 3HIZA 1JPLA 4Q69A 3HRAA 1H2UA 4FULA 5HS0A 5KBAA 3MJWA 4KXKB 4GZDA 4I1AA 1X81A 4C0MA 3ZVVA 4U63A 5ENQD 1N0RA 3UI2A 5EDSA 4JA7A 4A3VA 2Y0BG 4BSZB 3LPZA 1XGWA 2VSOE 5J08A 3CK8A 1JCRA 2OEWA 3ZU7B 2HE0A 4K5AB 5CEDB 4GA2A 4DX6D 1YA0A 2XRZA 1A5EA 3HXDA 1WG0A 4NQ0A 4DRXE 1Z3XA 4CDNA 1TNBA 4UWLA 3CHPA 3DXKG 2ZIRA 4ANVA 5D2MC 4TXPA 1TEZA 4HOTA 3TWUA 3CVYA 4JL0A 1B89A 3UMVA 1KT0A 1SQMA 5LCWC 3LY8A 3RKVA 2JLBA 2XQ0A 3G2VA 4GTRA 3EU5A 3C3OA 4LEUA 3PZ2A 4UI9K 4IN3B 3UT8A 2AJAA 2DIWA 5DBKA 3ABME 3CVUA 2BEDA 4PS3A 2PNNA 2AW6A 3SFXA 4XE0A 3ZGQA 4G8LA 1H6KA 3UM2A 3KEAA 1H6PA 3RAUA 4EPZA 1S63A 4DX1A 3QC1A 2RD0A 3DSSA 1K1AA 3FH8A 2YQ8A 3IXEA 4FHJA 1G3NB 4HORA 5AARA 4AXHA 1IQUA 5FZQA 3R7RA 3D9JA 4YDWA 4EQFA 5IY5E 4JB8P 4L2LA 2P9PG 3FUNA 4BT8A 5G55A 1O5MA 3KAEA 1QYMA 1SZAA 1JWGA 3P2BA 2EINE 3NB2A 2VSYA 3CVNA 5JA4D 2Y4UA 4HI9A 3G2UA 1HE8A 3PZ4A 4J6IA 2EIME 2HR2A 3CVXA 3T8KA 1UN8A 2LXLA 1OWMA 1NP7A 4OAVB 4HOQA 2F8YA 1UJJA 2M63A 2VTBB 1INZA 2XHEA 3PUJA 4GYWA 2CFZA 3VTXA 2L6JA 4N39A 4N2QA 4CZ2D 3TL5A 4C0EA 1QQEA 2J08A 3LJ3A 3Q15A 4ZHBA 1KT1A 1MZCA 3LJNA 4RG9A 3L22A 3CKCA 2CHZA 2L0IA 3L6AA 2XGMA 4F1SA 1OCRE 1ELKA 4PUCA 3B7UX 2ETAA 4DX7D 3FU3A 4AIFA 3NOGD 4GZCA 4E6HA 3ESKA 4N5CA 4FLBA 3TWVA 3FUJA 3LCAA 1VDYA 1E8YA 5C1DA 3AAAC 3HVEA 3L54A 3ZIMA 2J9QA 3ESLA 5JJ7A 2V4HC 3SBSA 5T4YA 3KD7A 1TNUA 3HXBA 2LO6A 5AAOA 4Q94A 2B0OE 2CG2A 4A63B 4LUNU 4GA1A 4KYOB 1UN9A 2CHWA 4Z68A 3VTYA 3APFA 1O1TA 4WNDA 3V2OA 3LYAA 2F37A 4GZ6A 2IQCA 2EIKE 2WXGA 4CGVA 3GYZA 4AP2A 4K0RA 1TNOA 3L82A 3SHFA 3QWVA 5H7PA 2MRIA 3U3WA 1RZ4A 5AJLA 3V2XA 3FH5A 5EYPF 1HH8A 3Q4AB 2QYJA 3CEQA 5M72A 3CQGB 3JCKC 4NURA 3UM1A 4FADA 1N4RA 4BTBA 3HG0D 1O1SA 4FJYA 3SNXA 4Y6WA 2XZDG 5FT9A 2V4LA 3CVQA 2C0LA 3PRZA 1X5BA 4EZLA 3Q9NC 3IEGA 2IO3C 2ZGDA 4K5CA 1IHBA 4BWRA 1OXJA 3ABKE 5D0OD 2WXNA 3RSEG 2J8SD 3FH7A 4JHRA 3QARA 4CCAA 3DSVA 5BV0A 4BT9A 3FY4A 4IYPA 1OWOA 3NQPA 4LNUD 4I9CA 5AQ7A 2L6BA 3MV3B 1ZU2A 2ONDA 1FVHA 2DCPA 4BSXA 4HFGA 1BPOA 4MLPA 3C5RA 5JJ6A 2B6CA 2XPIA 1E8WA 1OUVA 3SQVA 1HU3A 1YCSB 3LY7A 3DSTA 3PREA 3FTVA 5CMWA 5CRUA 5A6CA 3BG1B 4YVOA 2XS1A 4KVOA 5A7DB 2JEKA 2KM4A 4AM9A 1Y8MA 3PE4A 2IFUA 1DCQA 2IOLA 2DYSE 4GTTA 3QAQA 4U96D 2EIJE 2YHCA 5AENA 2P9KG 1YMPA 2R2LA 3CHOA 3Q9UC 3ZYMA 4BEPA 3FP3A 1FVFA 1N95A 3SY2A 4UQZA 5G2NA 3NAWA 1TYQG 4FP7A 4JXTA 2J09A 3F6QA 5LCWJ 2DZNA 4N5QA 1U2VG 3CK7A 2XZTG 2BUGA 3LDZA 2HYZA 3FTUA 1H6OA 1SVXA 3J5PA 3FTXA 2WPVA 1S64A 4L7TA 2I1JA 4DLQA 1BD8A 2KCVA 3UKRG 1H2TC 3VLFA 1Z5SC 2XGOA 2IF4A 4DX2A 4EBAA 4DI4A 5ENPD 3I4RB 4WNEA 4UWGA 2WXKA 4I9EA 4O1OA 2H6HA 4W9RA 1Z6TA 2ETBA 3MX3A 2X6FA 2IJGX 1MX4A 3ONLA 4ANUA 4JVSA 3EUVA 3IHYA 3VLEA 2YINA 4OVUA 2WXRA 3FTWA 5LX8A 5ENOD 3FHEA 4DX5D 2LSVA 3LY9A 3ULYA 2WQ6A 3PNLB 1Z3YA 4X8QA 4UWFA 3X2QE 4OVVA 4G2VA 5AQBA 4U8YD 2X6JA 1MX2A 1D9SA 1P5QA 4G24A 4GTMA 3ZHEA 4GTPA 4EBAG 3L9TA 1HS6A 2V5QC 3SFYA 5JJTA 3ZW3A 2IU1A 4N3CA 5BUZA 3PVLA 4G26A 4PS8A 2LNIA 3V31A 2CG3A 2UWJG 3FDHA 2VGEA 1LTXA 2V8SE 3PS6A 2WQ7A 2WM9A 4GZ3A 5FIOA 3PZDA 3TWXA 2BTDA 1LD8A 3CGHA 5BV1A 4MKTA 4CGWA 4GTOA 3IV0A 1H2VC 1UG3A 4J8SA 1IQRA 2HO1A 3AG1E 4GMRA 5KNHD 4U8VD 1S70B 4BTAA 1E8ZA 2RFAA 3D9IA 2JABA 3FEXA 4GZ5A 4L9PA 3ASDA 3TXMA 4GTQA 4F3VA 2BKKB 4P29A 3SFZA 3ZUVB 2WXOA 3JXIA 4JC8A 5EIBE 2YNQA 4G23A 3TWQA 5BW8C 3SI5A 3C3RA 4G11A 3UIPC 3CVWA 4O6FA 2ZXWE 1HF8A 2X38A 3QKYA 4I1MA 4HRMB 3ZYLA 2PM6A 4PS7A 1QNFA 2WQHA 2P9UG 4LCTA 1U3CA 2QFCA 5CHEE 3CSFA 1N94A 3APDA 1IHGA 4I43A 4B94A 2OEVA 1KZOA 3L17A 4HLEA 3E4BA 1MQSA 4B8AA 3Q75A 1DVPA 3UM3A 4XKCA 3ASOE 5ARGA 1N52A 5CECB 3UT4A 1MJ0A 4ANXA 4ILIA 2NSZA 4UUCA 2C2LA 1KPSB 3EHMA 3G2WA 2KCKA 4KVMA 3BU8A 4NRHB 3D9OA 4GA0A 2FEZA 4WUYA 3RRUA 5KNGA 2X6KA 4UWKA 4HS2A 5ARFA 5C2YA 3S7BA 3ONKA 1IYGA 4ME2A 3OAWA 3ZYQA 3E34A 3ZFWA 4YDEA 1W3BA 2XCBA 2Y69E 2LAIA 4YNDA 4TRQA 4G8KA 3MEKA 3UX4A 1NZNA 2AWIA 4EZKA 1HO8A 1N4SA 1PY1A 2GRPB 3W9FA 3TG5A 1E8XA 4JD2G 4ANWA 3AG3E 4XZ4A 4N3BA 3HVEB 3QNKA 3MKRA 4WWOA 4GMJA 4HQDA 2KZTA 1KLXA 3LVRE 3NZUA 3S7FA 4B0ZA 3JUEA 1IXVA 1TNZA 3NF1A 3ZPJA 3WXXA 4WNGA 1DNPA 3KEZA 3RO2A 3QWPA 2GRLA 3FU5A 1HX8A 1KZPA 4HOUA 2F0YA 2DBAA 1HXIA 4B89A 3VLDA 2WXFA 4AOFA 1XNFA 3S2AA 3DSUA 2A4ZA 3UKUG 2YHEA 3MV2B 2EQXA 1BLXB 2H6FA 2LUHA 5BXOA 4GTSA 3SGHA 3TWRA 1DCEA 3FUDA 4J7WA 5CEAA 5DIZA 4CT4A 1UW4B 2ZISA 3MA5A 4XI9A 4B93B 2GRMA 2R5SA 2QZAA 3L08A 3HHMA 5FZRA 4KZ0A 5ITZF 3TGOA 3U66A 3U9WA 2Y3AA 1HFAA 3ASGA 5BNWA 3PEUB 1EDUA 3DRAA 3R9MA 1HG2A 2OV8A 3JQ0A 2Y1LE 5KJKA 3CHSA 2FBNA 3PDNA 1V54E 5EKQD 5T8IA 1N4PA 4L1BA 2LXMA 5T3RA 3TG4A 4DUIA 4UI9C 1OT8A 2I9CA 4JW1A 1LD7A 4AV7A 3CHQA 3CQCB 4CDRA 4HNAD 3OTNA 4AY6A 4YDOA 4KZCA 1O1RA 2R02A 4CDMA 2VJ8A 4OYSA 5CCMA 4JA9A 3UUXA 1SW6A 3AJIA 3R7QA 5D66A 1PC2A 1UJKA 3ISMC 3RO3A 3EHNA 4EECA 3AS5A 3QJZA 4BX8A 3IHVA 2OCCE 4K03A 3GZ2A 1H19A 2XENA 4DK5A 3B7TA 1ELRA 3EJNA 4XEIG 5FQ6A 4BETA 4G25A 5BT1A 3ZXSA 4RVBA 3JQ1A 1ZB1A 1OWNA 1OWPA 4H7YA 4L23A 3AG4E 3DEOA 2NYJA 4U95D 1FT1A 1BI7B 3D9HA 3RJVA 1D8DA 3T5VA 5EIDA 3ML8A 3PH0C 4HRNA 2ETCA 4LG6A 2XRYA 2AXZA 2PZIA 3HDXA 5B1AE 3JXJA 3ML9A 3V79K 4CRWA 1NFIE 2AXVA 2KATA 3CHMA 3CHRA 4JEUA 1N9AA 4YVQC 4EZJA 3J5QB 4CEMA 3L13A 5FQ4A 1NL4A 5E75A 5CERB 1OY3D 2NXPA 3Q78A 3HXCA 3TWSA 4XI0A 1NI1A 3JUIA 4E85A 3T9KA 3N71A 4N3AA 4ACLA 4FC8A 3IBEA 5AYWD 1WM5A 4JHJA 5B1BE 2IO2C 3I5PA 3KS2A 3TXNA 3ZXPA 2QY7A 3I3NA 1HG5A 4V3IA 3MZLB 1AP7A 5CMYA 4RSYA 5ANRA 5HQ8A 4PH4B 3Q49B 3FUKA 4DJAA 2J07A 2UY1A 3HYMB 3FUFA 2X6IA 3GZ1A 3EU9A 2RFMA 3CSTA 3ULQA 2L0TB 5KJNA 4WWPA 4FLHA 2GGFA 3ZEFA 4F53A 5AQAA 1FT2A 4GCNA 1N4QA 4BY6A 5EILA 3UXGA 1WDYA 2H6IA 4F1PA 2P9SG 4ILHB 5FJYA 4ABNA 3SF4A 2KBXA 5E76A 3QK0A 3NZSA 4APFA 4A1SA 3CVPA 2LAHA 2GRRB 1ELWA 5J90A 2PQRA 3GZSA 3RU0A 3QOUA 3PUKA 4JPSA 3ZHEB 4LNGA 3EDTB 4MS6A 4WNFA 2KC7A 3T8MA 3ZN3A 2WXIA 5ENRD 2J4BA 4NACA 5FWQA 3FULA 4ILGA 3PE3A 2ILRA 4HRLA 4U0SA 1NA0A 3G2TA 4AY5A 3CR3A 3LVQE 3DXMG 3Q47B 4J8YA 5HI7A 4TV3A 5HRYA 4OAUC 4G1TA 2P9IG 3E32A 5ENSD 3FWVA 2P2CP 3APCA 5CRVA 1JWFA 4TXRA 4KT6B 3FTYA 3C3QA 3MKQA 2OVBA 3JYSA 3RRNB 1WY6A 3C72A 5BXUA 1OWLA 5CCLA 1S0PA 3E33A 2VGXA 4I6GA 3MYVA 4UQXA 3PZ1A 2QYUA 1QBQA 2OVFA 4D10C 4J0UA 3Q79A 2VSXE 2NC9A 3U4TA 3B13A 4RQIA 2CFUA 2FF4A 4U07A 2KCLA 3MCXA 5G05C 2PQNA 2V5FA 4BX9A 4XX5A 2FO1E 4O60A 3AS8A 5EX3A 2RG8A 1LF8A 2WMNA 3WG7E 3SBTB 2LSUA 3KSLA 3UQ3A 2QC9A
chains in the Genus database with same CATH topology
4URKA 2XEVA 3NF1A 3EIQC 3IEGA 3ZPJA 4FA6A 2VSNA 3WXXA 4WNGA 1DNPA 3KEZA 4BWRA 2WXJA 4Y6CA 2VYIA 5FQ7A 1E7UA 3LS8A 3RO2A 2XPYA 5D0OD 2FO7A 2FULA 3I4GA 3O48A 3QWPA 1Y6IA 3FUMA 5EX0A 2GRLA 2WXNA 3FU5A 4APOA 2XGSA 2WB2A 1HX8A 3FU0A 3MKQB 4HOUA 2AVPA 2DBAA 3D9MA 1HXIA 3FH7A 4B89A 3VLDA 3ASFA 5D0QD 2WXFA 3QB2A 4JHRA 4AOFA 3K9IA 3UPVA 4WWNA 1XNFA 3QARA 4CCAA 3CKBA 3S2AA 5LP0A 2I6HA 2VGXB 2A4ZA 4U0ZA 2YHEA 4BT9A 5BV0A 3FY4A 2GW1A 3FU6A 3MV2B 2EQXA 4IYPA 1OWOA 3NQPA 4H7XA 4A55A 3BEEA 1EF1C 3OXGA 4I9CA 3D3MA 3FUEA 3SGHA 3D9NA 4U04A 3MV3B 1ZU2A 3FUDA 2ONDA 1FVHA 2DCPA 3FTSA 5DIZA 4DPRA 4CT4A 1UW4B 3G2SA 4AEZC 4BSXA 3MA5A 4HFGA 1BPOA 2PM7A 4MLPA 4XI9A 5JJ6A 1QZ2A 2GRMA 2R5SA 2XPIA 1OUVA 1E8WA 1HU3A 2IONA 3LY7A 3FEYA 3RK6A 4DI3A 3PREA 3FTVA 4GYOA 5CMWA 3L08A 5A6CA 3EIJA 3BG1B 3HHMA 4YVOA 5FZRA 4GAAA 3LEWA 3PEVB 4KZ0A 3T5XA 3DPDA 3MGBA 4QFVA 4DLOA 3TGOA 2E2EA 4I2WA 3U66A 3U9WA 2Y3AA 2Y4TA 3TAXA 2KZTB 1HFAA 3LKUA 3ASGA 4KVOA 5A7DB 3SD5A 5BNWA 2JEKA 2KM4A 3PEUB 1EDUA 3D9KA 4AM9A 1Y8MA 1HG2A 2BF0X 5KJMA 2OV8A 3JQ0A 1JUQA 4UI9J 4GYYA 4FU3A 5KJKA 3HIZA 3PE4A 3CHSA 1JPLA 2IFUA 2IOLA 4Q69A 2FBNA 3PDNA 5EKQD 1H2UA 4FULA 5T8IA 4J8DA 4C9BB 4L1BA 5T3RA 3QAQA 3MJWA 4KXKB 3TG4A 4GZDA 4I1AA 4C0MA 4UWHA 2YHCA 5AENA 3ZVVA 4U63A 4UI9C 2R59A 3GW4A 2I9CA 4ATGA 4JW1A 5EDSA 4JA7A 1GW6A 3AU5A 4A3VA 4AV7A 3CHQA 3CQCB 4CDRA 1SZ9A 3CHOA 1XGWA 2PL2A 2VSOE 3LPZA 4AY6A 3OTNA 3ZYMA 4XIFA 3ZRHA 3CK8A 4I1OB 5J08A 5KCMA 3FP3A 1FVFA 4KZCA 4HVBA 2IOSA 4GA2A 4XKBA 2OOEA 3UT7A 4CDMA 4Q96A 4UQZA 2VJ8A 5G2NA 1YA0A 2XRZA 4M3OA 4OYSA 4FP7A 4JXTA 2J09A 5CCMA 4JA9A 3UUXA 4NQ0A 5LCWJ 1A17A 1U3DA 3CK7A 4HXIA 1Z3XA 3R7QA 4CDNA 4UWLA 2BUGA 1PC2A 3CVLA 1UJKA 3LDZA 3CHPA 3EHNA 2HYZA 3RO3A 3B7RL 4ANVA 2XPZA 4EECA 1TEZA 4HOTA 3AS5A 3QJZA 4BX8A 3IHVA 3CVYA 4JL0A 1B89A 3TJPA 3UMVA 3FTUA 1KT0A 2WXHA 1SQMA 3GZ2A 4K03A 3FTXA 4U8HA 2WPVA 1H19A 4L7TA 2I1JA 5LCWC 4DLQA 4DK5A 5BPPA 4ACKA 1NA3A 2WXLA 3LY8A 3RKVA 2JLBA 2XQ0A 1FCHA 3B7TA 3G2VA 1ELRA 3EJNA 4LRZA 5FQ6A 5JHBA 2KCVA 4G25A 1H2TC 5BT1A 4LEUA 3VLFA 4I6JA 4HOSA 3ZXSA 4RVBA 4F7AA 4J8EA 2XGOA 3JQ1A 3U64A 2IF4A 1OWNA 4UI9K 4IN3B 3UT8A 2DIWA 3OXFA 4EBAA 4DI4A 5DBKA 1OWPA 3SZ7A 2WVIA 3I4RB 4WNEA 4UWGA 2WXKA 4H7YA 4L23A 4I9EA 3CVUA 4W9RA 4PS3A 1Z6TA 4AJWA 3RJVA 4PDXA 3MX3A 1PAQA 2X6FA 2IJGX 2AW6A 4TUUA 4XE0A 3T5VA 3ZGQA 3ONLA 3ML8A 3PH0C 1TJCA 4ANUA 4GMLA 1H6KA 2VTBA 4JVSA 3IHYA 3VLEA 4B8CB 4EPZA 1H0AA 2YINA 4OVUA 2WXRA 2XRYA 3FTWA 5LX8A 2AXZA 2PZIA 3HDXA 3FHEA 3QDNA 3QC1A 2LSVA 3LY9A 3ML9A 3CVVA 2RD0A 3FH8A 4CRWA 4GU5A 2YQ8A 2WQ6A 2AXVA 4FHJA 2KATA 3IKOB 3PNLB 3CHMA 2WXPA 1Z3YA 3CHRA 4JEUA 2I1KA 4HORA 4YVQC 4UWFA 2HM8A 5FQ8A 4AXHA 1IQUA 4EZJA 5ANLA 3ASHA 4OVVA 5FZQA 4G2VA 4CEMA 3L13A 3R7RA 5FQ4A 3D9JA 2X6JA 5AJDA 1P5QA 4G24A 5E75A 1L5JA 2I2OA 4EQFA 3ZHEA 2XCCA 2NXPA 4EBAG 1EPUA 4L2LA 4XI0A 2WXMA 3FUNA 4BT8A 3OXLA 2J4DA 3JUIA 3LXUX 4E85A 3N71A 4WAFA 5G55A 1HS6A 4N3AA 2ZU6B 4ACLA 5JJTA 3ZW3A 4FC8A 3IBEA 2IU1A 4N3CA 5AYWD 3KAEA 1WM5A 5BUZA 4JHJA 3PVLA 1SZAA 3I5PA 3KS2A 4G26A 1JWGA 4PS8A 3TXNA 2QY7A 2LNIA 3I3NA 1HG5A 2CG3A 2UWJG 3P2BA 4V3IA 3FDHA 3MZLB 2V8SE 2VSYA 3CVNA 3PS6A 5CMYA 4RSYA 2WQ7A 2WM9A 2Y4UA 4GZ3A 5ANRA 5HQ8A 4N2SA 3PZDA 3Q49B 4PH4B 3FUKA 2VGYA 4A3TA 2BTDA 4DJAA 3S7DA 2J07A 3CGHA 5AIJA 2UY1A 5FTPA 3G2UA 5BV1A 3HYMB 4MKTA 1HE8A 4CGWA 3FUFA 3IV0A 2X6IA 4J6IA 3DBSA 1H2VC 1UG3A 2HR2A 3GZ1A 4J8SA 3CVXA 1IQRA 2HO1A 3CSTA 3BG0B 3ULQA 1UN8A 2L0TB 5KJNA 1OWMA 4WWPA 1NP7A 4FLHA 2GGFA 3R9AB 4HOQA 3ZEFA 4F53A 4BTAA 1E8ZA 1UJJA 3QWWA 2M63A 3PNTB 2VTBB 3D9IA 4GCNA 3FEXA 2XHEA 4GZ5A 4UQYA 4BY6A 1INZA 3PUJA 5A23A 5LOZA 4GYWA 5G04J 2CFZA 3VTXA 3ASDA 3TXMA 1E7VA 4F3VA 3RIBA 3FFLA 2L6JA 2FI7A 3FUHA 4GCOA 4N39A 4P29A 3SFZA 4N2QA 2MHKA 2WXOA 3CLJA 4JC8A 4ILHB 5FJYA 4I6EA 3TL5A 4FHKA 4ABNA 3O4ZA 4C0EA 1QQEA 2J08A 3L16A 2YNQA 3RRMB 3LJ3A 3SF4A 3Q15A 5E76A 1KT1A 4G23A 3QK0A 3NZSA 4APFA 5BW8C 3D9LA 3FUIA 4RG9A 3SI5A 4A1SA 3CVPA 2MOWA 2LAHA 4G11A 4JHKA 1ELWA 3ENEA 5J90A 4O6FA 3CVWA 2PQRA 3GZSA 3RU0A 3CIAA 3L22A 3PUKA 1HF8A 3CKCA 2CHZA 2L0IA 3QOUA 3L6AA 4JPSA 3ZHEB 2X38A 2XGMA 3EDTB 4F1SA 3QKYA 4I1MA 1ELKA 4MS6A 4WNFA 2KC7A 3T8MA 4A1GA 3ZYLA 2PM6A 4PS7A 3ZN3A 2WXIA 4PUCA 3B7UX 2J4BA 4KBQA 4JEHA 4NACA 3FU3A 1QNFA 4AIFA 5FWQA 1WAO1 4GZCA 2WQHA 4LCTA 4E6HA 3FULA 3ESKA 1U3CA 2QFCA 4N5CA 4FLBA 4ILGA 3PE3A 2CHXA 3FUJA 5CHEE 3LCAA 1VDYA 1E8YA 2ILRA 5C1DA 3CSFA 4U0SA 3HVEA 3L54A 3APDA 4I43A 1IHGA 1NA0A 3ZIMA 2J9QA 3ESLA 2P58C 4B94A 5JJ7A 3G2TA 3SBSA 4AY5A 3CR3A 3L17A 5T4YA 4MRUA 3KD7A 4HLEA 4GPKA 3LVQE 1MHQA 2LO6A 3D9PA 3Q47B 2UY1B 4Q94A 2R17C 3E4BA 2X3MA 5HI7A 3Q5MA 4AVXA 1HZ4A 4JZYA 2CG2A 1MQSA 1N54A 1TJFA 2A5UA 4TV3A 4LUNU 4B8AA 1DVPA 4GA1A 4KYOB 4RG6A 1UN9A 2CHWA 4J8FA 4XKCA 4G1TA 5ARGA 1N52A 4LERA 3UT4A 3APFA 4IULA 3VTYA 4IRUA 2Q7FA 3AU4A 4L2YA 4WNDA 4ANXA 1E96B 4ILIA 5KJLA 2NSZA 2C2LA 3FWVA 3LYAA 3APCA 1JWFA 3EHMA 4R7LA 4KT6B 4CT0A 3FTYA 3G2WA 4GZ6A 5JHAA 3MKQA 2IQCA 4I2ZA 2WXGA 2KCKA 4BFRA 2OVBA 4KVMA 4CGVA 3JYSA 3RRNB 1WY6A 4NRHB 3GYZA 4AP2A 3D9OA 2VQ2A 2FEZA 3AS4A 1OWLA 4GA0A 4WUYA 3RRUA 1EYHA 5CCLA 4K0RA 1E90A 1S0PA 2X6KA 4FJZA 4UWKA 2VGXA 3QWVA 4I6GA 3SHFA 3MYVA 4HS2A 4UQXA 2MRIA 3U3WA 5ARFA 5C2YA 3S7BA 3ONKA 4I17A 5AJLA 3URZA 1IYGA 4ME2A 3OAWA 3B7SA 3S7JA 5G05J 3ZYQA 2AXUA 2OVFA 3ZFWA 3FH5A 1W3BA 3C98A 2XCBA 2LAIA 1HH8A 4D10C 5LFAA 3Q4AB 4J0UA 4YNDA 3CEQA 4TRQA 3MEKA 5M72A 3CK9A 5FZSA 3FTZA 3P1UA 2VSXE 3CQGB 3UX4A 2NC9A 3U4TA 2WXQA 1NZNA 2CFUA 2FF4A 3B13A 3JCKC 4KMOA 4U07A 2AWIA 2KCLA 4NURA 4EZKA 3MCXA 1HO8A 1PY1A 2WMOA 3CV0A 3TG5A 3ZYKA 1E8XA 5G05C 2J49A 4FADA 2PQNA 2V5FA 4ANWA 4BX9A 4XX5A 4XZ4A 4BTBA 4N3BA 3HVEB 3QNKA 4GB9A 3MKRA 2V0PA 2L9BA 4GMJA 4WWOA 2KZTA 3AS8A 4FJYA 5EX3A 3SNXA 2RG8A 4U0UA 1KLXA 4Y6WA 1LF8A 3LVRE 2WMNA 1ZBPA 5FT9A 2C0MA 3NZUA 2E0IA 3S7FA 4B0ZA 2V4LA 5ENNA 3SBTB 3CVQA 2LSUA 3UQ3A 2C0LA 3PRZA 2X6HA 5G04C 1X5BA 4EZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X3M A; 
#chains in the Genus database with same CATH topology
 2VSN A;  2WXJ A;  2VYI A;  5FQ7 A;  3ZKJ A;  3LS8 A;  2XPY A;  3I4G A;  3HXE A;  5EX0 A;  3FUM A;  4APO A;  2WB2 A;  2AVP A;  3ASF A;  5D0Q D;  3QB2 A;  3UPV A;  4NIK A;  5JMN D;  1AWC B;  1DC2 A;  2GW1 A;  3FU6 A;  4H7X A;  4A55 A;  3BEE A;  1EF1 C;  2MYO A;  3OXG A;  1TN8 A;  1JCS A;  3FUE A;  2DZO A;  3Q73 A;  3G2S A;  3FEY A;  4GYO A;  2R03 A;  3PEV B;  3SO8 A;  3MGB A;  3UTM A;  4DLO A;  2XS8 A;  2E2E A;  3DSX A;  2KZT B;  3LKU A;  4HLL A;  1N11 A;  1JUQ A;  4UI9 J;  4GYY A;  2XEE A;  1SA4 A;  2R05 A;  1K3Z D;  4J8D A;  2IEJ A;  1SA5 A;  4C9B B;  4CYM D;  5EN5 D;  5B3S E;  4UWH A;  1K8K G;  4TXQ A;  1OCO E;  2R59 A;  3GW4 A;  4ATG A;  1MX6 A;  4LNB A;  2RKK A;  1GW6 A;  3AU5 A;  1SZ9 A;  4EHM A;  2PL2 A;  4XIF A;  3ZRH A;  4I1O B;  5KCM A;  2KXP C;  3ASN E;  4HVB A;  2IOS A;  4XKB A;  2OOE A;  3UT7 A;  4Q96 A;  4M3O A;  4BER A;  1A17 A;  1U3D A;  4HXI A;  3CVL A;  3KSQ A;  3B7R L;  5ENT D;  2XPZ A;  3TJP A;  2WXH A;  4U8H A;  3NBN B;  1Q2Z A;  4QQI A;  3B7B A;  5BPP A;  4ACK A;  1NA3 A;  2WXL A;  4M7C A;  1FCH A;  3ULE G;  3W9G A;  3EHR A;  4LRZ A;  5EYL A;  5JHB A;  2DVW A;  3BQO A;  4I6J A;  4HOS A;  4F7A A;  4J8E A;  3U64 A;  4GTV A;  3OXF A;  4MBG A;  3SZ7 A;  2WVI A;  4YDY A;  1JCQ A;  1N0Q A;  5AQ9 A;  4AJW A;  3NOC D;  4PDX A;  1PAQ A;  3AG2 E;  4TUU A;  1TJC A;  4GML A;  2VTB A;  4B8C B;  1H0A A;  2F8X K;  3PZ3 A;  3QDN A;  4HBD A;  3ZNG A;  3CVV A;  3DWL G;  4GU5 A;  3IKO B;  2WXP A;  2I1K A;  5FQ8 A;  2HM8 A;  2DYR E;  3B95 A;  3DPY A;  5ANL A;  3ASH A;  3Q7F A;  5AJD A;  3E30 A;  1UOH A;  1L5J A;  2I2O A;  2XCC A;  1EPU A;  1TR4 A;  2WXM A;  3OXL A;  2J4D A;  3LXU X;  4WAF A;  1D8E A;  2ZU6 B;  2A5E A;  2DWZ A;  1OCZ E;  3TWT A;  4K5B A;  4HI8 A;  4TUM A;  4N2S A;  2VGY A;  4A3T A;  3S7D A;  5FTP A;  3DEP A;  1TN7 A;  3DBS A;  2GRN B;  3BG0 B;  1TNY A;  1FPP A;  3R9A B;  3QWW A;  3PNT B;  4UQY A;  4U7E B;  5A23 A;  5LOZ A;  5G04 J;  1E7V A;  1BU9 A;  3RIB A;  3FFL A;  2FI7 A;  3FUH A;  4GCO A;  4ZFH A;  2MHK A;  3CLJ A;  4ATZ D;  4I6E A;  4FHK A;  3O4Z A;  3L16 A;  3RRM B;  3DSW A;  3D9L A;  3FUI A;  2BKG A;  2MOW A;  4JHK A;  3ENE A;  3CIA A;  5CBN A;  1TN6 A;  2P9N G;  4A1G A;  1IKN D;  4KBQ A;  4JEH A;  5KWD A;  1WAO 1;  1MYO A;  2CHX A;  2P58 C;  4MRU A;  4GPK A;  1MHQ A;  3V30 A;  3D9P A;  2UY1 B;  4F6R D;  2R17 C;  2X3M A;  3Q5M A;  4AVX A;  1HZ4 A;  4JZY A;  5AIJ A;  1TJF A;  1N54 A;  2A5U A;  2EIL E;  4RG6 A;  4J8F A;  4LER A;  4IUL A;  4IRU A;  2Q7F A;  3AU4 A;  4L2Y A;  3BUA A;  1E96 B;  5KJL A;  4R7L A;  4CT0 A;  5JHA A;  4I2Z A;  1OCC E;  4BFR A;  2GRO B;  2VQ2 A;  3AS4 A;  1EYH A;  1E90 A;  4FJZ A;  4I17 A;  3URZ A;  3B7S A;  3S7J A;  5G05 J;  2AXU A;  5CBO A;  3C98 A;  5LFA A;  3CK9 A;  5FZS A;  3FTZ A;  3P1U A;  2WXQ A;  4LSZ E;  4KMO A;  4GPM A;  3ABL E;  2WMO A;  3CV0 A;  3ZYK A;  2J49 A;  1K1B A;  4HB5 A;  1RW2 A;  4GB9 A;  2V0P A;  2L9B A;  3UIO C;  1V55 E;  4RLY A;  2ZGG A;  4U0U A;  2IY0 C;  1ZBP A;  2C0M A;  2E0I A;  5ENN A;  3UM0 A;  2X6H A;  5G04 C;  1YYH A;  3HXF A;  4URK A;  2XEV A;  3EIQ C;  4FA6 A;  4Y6C A;  1E7U A;  2FO7 A;  2FUL A;  3O48 A;  1Y6I A;  2XGS A;  3TWW A;  3FU0 A;  3MKQ B;  4BES A;  3D9M A;  2H6G A;  3K9I A;  5AN8 A;  4WWN A;  1BI8 B;  3CKB A;  3E37 A;  5LP0 A;  2I6H A;  2VGX B;  4U0Z A;  3Q7A A;  5FIN A;  2GRQ B;  3D3M A;  4O1P A;  2P9L G;  3D9N A;  4U04 A;  4C48 B;  4DPR A;  3FTS A;  4AEZ C;  2PM7 A;  1QZ2 A;  2ION A;  3RK6 A;  4DI3 A;  3EHQ A;  3EIJ A;  4GAA A;  3LEW A;  3T5X A;  3DPD A;  5HKP A;  3UIN C;  4QFV A;  4I2W A;  2Y4T A;  3TAX A;  3SD5 A;  2XEH A;  3D9K A;  2BF0 X;  5KJM A;  4FU3 A;  3HIZ A;  1JPL A;  4Q69 A;  3HRA A;  1H2U A;  4FUL A;  5HS0 A;  5KBA A;  3MJW A;  4KXK B;  4GZD A;  4I1A A;  1X81 A;  4C0M A;  3ZVV A;  4U63 A;  5ENQ D;  1N0R A;  3UI2 A;  5EDS A;  4JA7 A;  4A3V A;  2Y0B G;  4BSZ B;  3LPZ A;  1XGW A;  2VSO E;  5J08 A;  3CK8 A;  1JCR A;  2OEW A;  3ZU7 B;  2HE0 A;  4K5A B;  5CED B;  4GA2 A;  4DX6 D;  1YA0 A;  2XRZ A;  1A5E A;  3HXD A;  1WG0 A;  4NQ0 A;  4DRX E;  1Z3X A;  4CDN A;  1TNB A;  4UWL A;  3CHP A;  3DXK G;  2ZIR A;  4ANV A;  5D2M C;  4TXP A;  1TEZ A;  4HOT A;  3TWU A;  3CVY A;  4JL0 A;  1B89 A;  3UMV A;  1KT0 A;  1SQM A;  5LCW C;  3LY8 A;  3RKV A;  2JLB A;  2XQ0 A;  3G2V A;  4GTR A;  3EU5 A;  3C3O A;  4LEU A;  3PZ2 A;  4UI9 K;  4IN3 B;  3UT8 A;  2AJA A;  2DIW A;  5DBK A;  3ABM E;  3CVU A;  2BED A;  4PS3 A;  2PNN A;  2AW6 A;  3SFX A;  4XE0 A;  3ZGQ A;  4G8L A;  1H6K A;  3UM2 A;  3KEA A;  1H6P A;  3RAU A;  4EPZ A;  1S63 A;  4DX1 A;  3QC1 A;  2RD0 A;  3DSS A;  1K1A A;  3FH8 A;  2YQ8 A;  3IXE A;  4FHJ A;  1G3N B;  4HOR A;  5AAR A;  4AXH A;  1IQU A;  5FZQ A;  3R7R A;  3D9J A;  4YDW A;  4EQF A;  5IY5 E;  4JB8 P;  4L2L A;  2P9P G;  3FUN A;  4BT8 A;  5G55 A;  1O5M A;  3KAE A;  1QYM A;  1SZA A;  1JWG A;  3P2B A;  2EIN E;  3NB2 A;  2VSY A;  3CVN A;  5JA4 D;  2Y4U A;  4HI9 A;  3G2U A;  1HE8 A;  3PZ4 A;  4J6I A;  2EIM E;  2HR2 A;  3CVX A;  3T8K A;  1UN8 A;  2LXL A;  1OWM A;  1NP7 A;  4OAV B;  4HOQ A;  2F8Y A;  1UJJ A;  2M63 A;  2VTB B;  1INZ A;  2XHE A;  3PUJ A;  4GYW A;  2CFZ A;  3VTX A;  2L6J A;  4N39 A;  4N2Q A;  4CZ2 D;  3TL5 A;  4C0E A;  1QQE A;  2J08 A;  3LJ3 A;  3Q15 A;  4ZHB A;  1KT1 A;  1MZC A;  3LJN A;  4RG9 A;  3L22 A;  3CKC A;  2CHZ A;  2L0I A;  3L6A A;  2XGM A;  4F1S A;  1OCR E;  1ELK A;  4PUC A;  3B7U X;  2ETA A;  4DX7 D;  3FU3 A;  4AIF A;  3NOG D;  4GZC A;  4E6H A;  3ESK A;  4N5C A;  4FLB A;  3TWV A;  3FUJ A;  3LCA A;  1VDY A;  1E8Y A;  5C1D A;  3AAA C;  3HVE A;  3L54 A;  3ZIM A;  2J9Q A;  3ESL A;  5JJ7 A;  2V4H C;  3SBS A;  5T4Y A;  3KD7 A;  1TNU A;  3HXB A;  2LO6 A;  5AAO A;  4Q94 A;  2B0O E;  2CG2 A;  4A63 B;  4LUN U;  4GA1 A;  4KYO B;  1UN9 A;  2CHW A;  4Z68 A;  3VTY A;  3APF A;  1O1T A;  4WND A;  3V2O A;  3LYA A;  2F37 A;  4GZ6 A;  2IQC A;  2EIK E;  2WXG A;  4CGV A;  3GYZ A;  4AP2 A;  4K0R A;  1TNO A;  3L82 A;  3SHF A;  3QWV A;  5H7P A;  2MRI A;  3U3W A;  1RZ4 A;  5AJL A;  3V2X A;  3FH5 A;  5EYP F;  1HH8 A;  3Q4A B;  2QYJ A;  3CEQ A;  5M72 A;  3CQG B;  3JCK C;  4NUR A;  3UM1 A;  4FAD A;  1N4R A;  4BTB A;  3HG0 D;  1O1S A;  4FJY A;  3SNX A;  4Y6W A;  2XZD G;  5FT9 A;  2V4L A;  3CVQ A;  2C0L A;  3PRZ A;  1X5B A;  4EZL A;  3Q9N C;  3IEG A;  2IO3 C;  2ZGD A;  4K5C A;  1IHB A;  4BWR A;  1OXJ A;  3ABK E;  5D0O D;  2WXN A;  3RSE G;  2J8S D;  3FH7 A;  4JHR A;  3QAR A;  4CCA A;  3DSV A;  5BV0 A;  4BT9 A;  3FY4 A;  4IYP A;  1OWO A;  3NQP A;  4LNU D;  4I9C A;  5AQ7 A;  2L6B A;  3MV3 B;  1ZU2 A;  2OND A;  1FVH A;  2DCP A;  4BSX A;  4HFG A;  1BPO A;  4MLP A;  3C5R A;  5JJ6 A;  2B6C A;  2XPI A;  1E8W A;  1OUV A;  3SQV A;  1HU3 A;  1YCS B;  3LY7 A;  3DST A;  3PRE A;  3FTV A;  5CMW A;  5CRU A;  5A6C A;  3BG1 B;  4YVO A;  2XS1 A;  4KVO A;  5A7D B;  2JEK A;  2KM4 A;  4AM9 A;  1Y8M A;  3PE4 A;  2IFU A;  1DCQ A;  2IOL A;  2DYS E;  4GTT A;  3QAQ A;  4U96 D;  2EIJ E;  2YHC A;  5AEN A;  2P9K G;  1YMP A;  2R2L A;  3CHO A;  3Q9U C;  3ZYM A;  4BEP A;  3FP3 A;  1FVF A;  1N95 A;  3SY2 A;  4UQZ A;  5G2N A;  3NAW A;  1TYQ G;  4FP7 A;  4JXT A;  2J09 A;  3F6Q A;  5LCW J;  2DZN A;  4N5Q A;  1U2V G;  3CK7 A;  2XZT G;  2BUG A;  3LDZ A;  2HYZ A;  3FTU A;  1H6O A;  1SVX A;  3J5P A;  3FTX A;  2WPV A;  1S64 A;  4L7T A;  2I1J A;  4DLQ A;  1BD8 A;  2KCV A;  3UKR G;  1H2T C;  3VLF A;  1Z5S C;  2XGO A;  2IF4 A;  4DX2 A;  4EBA A;  4DI4 A;  5ENP D;  3I4R B;  4WNE A;  4UWG A;  2WXK A;  4I9E A;  4O1O A;  2H6H A;  4W9R A;  1Z6T A;  2ETB A;  3MX3 A;  2X6F A;  2IJG X;  1MX4 A;  3ONL A;  4ANU A;  4JVS A;  3EUV A;  3IHY A;  3VLE A;  2YIN A;  4OVU A;  2WXR A;  3FTW A;  5LX8 A;  5ENO D;  3FHE A;  4DX5 D;  2LSV A;  3LY9 A;  3ULY A;  2WQ6 A;  3PNL B;  1Z3Y A;  4X8Q A;  4UWF A;  3X2Q E;  4OVV A;  4G2V A;  5AQB A;  4U8Y D;  2X6J A;  1MX2 A;  1D9S A;  1P5Q A;  4G24 A;  4GTM A;  3ZHE A;  4GTP A;  4EBA G;  3L9T A;  1HS6 A;  2V5Q C;  3SFY A;  5JJT A;  3ZW3 A;  2IU1 A;  4N3C A;  5BUZ A;  3PVL A;  4G26 A;  4PS8 A;  2LNI A;  3V31 A;  2CG3 A;  2UWJ G;  3FDH A;  2VGE A;  1LTX A;  2V8S E;  3PS6 A;  2WQ7 A;  2WM9 A;  4GZ3 A;  5FIO A;  3PZD A;  3TWX A;  2BTD A;  1LD8 A;  3CGH A;  5BV1 A;  4MKT A;  4CGW A;  4GTO A;  3IV0 A;  1H2V C;  1UG3 A;  4J8S A;  1IQR A;  2HO1 A;  3AG1 E;  4GMR A;  5KNH D;  4U8V D;  1S70 B;  4BTA A;  1E8Z A;  2RFA A;  3D9I A;  2JAB A;  3FEX A;  4GZ5 A;  4L9P A;  3ASD A;  3TXM A;  4GTQ A;  4F3V A;  2BKK B;  4P29 A;  3SFZ A;  3ZUV B;  2WXO A;  3JXI A;  4JC8 A;  5EIB E;  2YNQ A;  4G23 A;  3TWQ A;  5BW8 C;  3SI5 A;  3C3R A;  4G11 A;  3UIP C;  3CVW A;  4O6F A;  2ZXW E;  1HF8 A;  2X38 A;  3QKY A;  4I1M A;  4HRM B;  3ZYL A;  2PM6 A;  4PS7 A;  1QNF A;  2WQH A;  2P9U G;  4LCT A;  1U3C A;  2QFC A;  5CHE E;  3CSF A;  1N94 A;  3APD A;  1IHG A;  4I43 A;  4B94 A;  2OEV A;  1KZO A;  3L17 A;  4HLE A;  3E4B A;  1MQS A;  4B8A A;  3Q75 A;  1DVP A;  3UM3 A;  4XKC A;  3ASO E;  5ARG A;  1N52 A;  5CEC B;  3UT4 A;  1MJ0 A;  4ANX A;  4ILI A;  2NSZ A;  4UUC A;  2C2L A;  1KPS B;  3EHM A;  3G2W A;  2KCK A;  4KVM A;  3BU8 A;  4NRH B;  3D9O A;  4GA0 A;  2FEZ A;  4WUY A;  3RRU A;  5KNG A;  2X6K A;  4UWK A;  4HS2 A;  5ARF A;  5C2Y A;  3S7B A;  3ONK A;  1IYG A;  4ME2 A;  3OAW A;  3ZYQ A;  3E34 A;  3ZFW A;  4YDE A;  1W3B A;  2XCB A;  2Y69 E;  2LAI A;  4YND A;  4TRQ A;  4G8K A;  3MEK A;  3UX4 A;  1NZN A;  2AWI A;  4EZK A;  1HO8 A;  1N4S A;  1PY1 A;  2GRP B;  3W9F A;  3TG5 A;  1E8X A;  4JD2 G;  4ANW A;  3AG3 E;  4XZ4 A;  4N3B A;  3HVE B;  3QNK A;  3MKR A;  4WWO A;  4GMJ A;  4HQD A;  2KZT A;  1KLX A;  3LVR E;  3NZU A;  3S7F A;  4B0Z A;  3JUE A;  1IXV A;  1TNZ A;  3NF1 A;  3ZPJ A;  3WXX A;  4WNG A;  1DNP A;  3KEZ A;  3RO2 A;  3QWP A;  2GRL A;  3FU5 A;  1HX8 A;  1KZP A;  4HOU A;  2F0Y A;  2DBA A;  1HXI A;  4B89 A;  3VLD A;  2WXF A;  4AOF A;  1XNF A;  3S2A A;  3DSU A;  2A4Z A;  3UKU G;  2YHE A;  3MV2 B;  2EQX A;  1BLX B;  2H6F A;  2LUH A;  5BXO A;  4GTS A;  3SGH A;  3TWR A;  1DCE A;  3FUD A;  4J7W A;  5CEA A;  5DIZ A;  4CT4 A;  1UW4 B;  2ZIS A;  3MA5 A;  4XI9 A;  4B93 B;  2GRM A;  2R5S A;  2QZA A;  3L08 A;  3HHM A;  5FZR A;  4KZ0 A;  5ITZ F;  3TGO A;  3U66 A;  3U9W A;  2Y3A A;  1HFA A;  3ASG A;  5BNW A;  3PEU B;  1EDU A;  3DRA A;  3R9M A;  1HG2 A;  2OV8 A;  3JQ0 A;  2Y1L E;  5KJK A;  3CHS A;  2FBN A;  3PDN A;  1V54 E;  5EKQ D;  5T8I A;  1N4P A;  4L1B A;  2LXM A;  5T3R A;  3TG4 A;  4DUI A;  4UI9 C;  1OT8 A;  2I9C A;  4JW1 A;  1LD7 A;  4AV7 A;  3CHQ A;  3CQC B;  4CDR A;  4HNA D;  3OTN A;  4AY6 A;  4YDO A;  4KZC A;  1O1R A;  2R02 A;  4CDM A;  2VJ8 A;  4OYS A;  5CCM A;  4JA9 A;  3UUX A;  1SW6 A;  3AJI A;  3R7Q A;  5D66 A;  1PC2 A;  1UJK A;  3ISM C;  3RO3 A;  3EHN A;  4EEC A;  3AS5 A;  3QJZ A;  4BX8 A;  3IHV A;  2OCC E;  4K03 A;  3GZ2 A;  1H19 A;  2XEN A;  4DK5 A;  3B7T A;  1ELR A;  3EJN A;  4XEI G;  5FQ6 A;  4BET A;  4G25 A;  5BT1 A;  3ZXS A;  4RVB A;  3JQ1 A;  1ZB1 A;  1OWN A;  1OWP A;  4H7Y A;  4L23 A;  3AG4 E;  3DEO A;  2NYJ A;  4U95 D;  1FT1 A;  1BI7 B;  3D9H A;  3RJV A;  1D8D A;  3T5V A;  5EID A;  3ML8 A;  3PH0 C;  4HRN A;  2ETC A;  4LG6 A;  2XRY A;  2AXZ A;  2PZI A;  3HDX A;  5B1A E;  3JXJ A;  3ML9 A;  3V79 K;  4CRW A;  1NFI E;  2AXV A;  2KAT A;  3CHM A;  3CHR A;  4JEU A;  1N9A A;  4YVQ C;  4EZJ A;  3J5Q B;  4CEM A;  3L13 A;  5FQ4 A;  1NL4 A;  5E75 A;  5CER B;  1OY3 D;  2NXP A;  3Q78 A;  3HXC A;  3TWS A;  4XI0 A;  1NI1 A;  3JUI A;  4E85 A;  3T9K A;  3N71 A;  4N3A A;  4ACL A;  4FC8 A;  3IBE A;  5AYW D;  1WM5 A;  4JHJ A;  5B1B E;  2IO2 C;  3I5P A;  3KS2 A;  3TXN A;  3ZXP A;  2QY7 A;  3I3N A;  1HG5 A;  4V3I A;  3MZL B;  1AP7 A;  5CMY A;  4RSY A;  5ANR A;  5HQ8 A;  4PH4 B;  3Q49 B;  3FUK A;  4DJA A;  2J07 A;  2UY1 A;  3HYM B;  3FUF A;  2X6I A;  3GZ1 A;  3EU9 A;  2RFM A;  3CST A;  3ULQ A;  2L0T B;  5KJN A;  4WWP A;  4FLH A;  2GGF A;  3ZEF A;  4F53 A;  5AQA A;  1FT2 A;  4GCN A;  1N4Q A;  4BY6 A;  5EIL A;  3UXG A;  1WDY A;  2H6I A;  4F1P A;  2P9S G;  4ILH B;  5FJY A;  4ABN A;  3SF4 A;  2KBX A;  5E76 A;  3QK0 A;  3NZS A;  4APF A;  4A1S A;  3CVP A;  2LAH A;  2GRR B;  1ELW A;  5J90 A;  2PQR A;  3GZS A;  3RU0 A;  3QOU A;  3PUK A;  4JPS A;  3ZHE B;  4LNG A;  3EDT B;  4MS6 A;  4WNF A;  2KC7 A;  3T8M A;  3ZN3 A;  2WXI A;  5ENR D;  2J4B A;  4NAC A;  5FWQ A;  3FUL A;  4ILG A;  3PE3 A;  2ILR A;  4HRL A;  4U0S A;  1NA0 A;  3G2T A;  4AY5 A;  3CR3 A;  3LVQ E;  3DXM G;  3Q47 B;  4J8Y A;  5HI7 A;  4TV3 A;  5HRY A;  4OAU C;  4G1T A;  2P9I G;  3E32 A;  5ENS D;  3FWV A;  2P2C P;  3APC A;  5CRV A;  1JWF A;  4TXR A;  4KT6 B;  3FTY A;  3C3Q A;  3MKQ A;  2OVB A;  3JYS A;  3RRN B;  1WY6 A;  3C72 A;  5BXU A;  1OWL A;  5CCL A;  1S0P A;  3E33 A;  2VGX A;  4I6G A;  3MYV A;  4UQX A;  3PZ1 A;  2QYU A;  1QBQ A;  2OVF A;  4D10 C;  4J0U A;  3Q79 A;  2VSX E;  2NC9 A;  3U4T A;  3B13 A;  4RQI A;  2CFU A;  2FF4 A;  4U07 A;  2KCL A;  3MCX A;  5G05 C;  2PQN A;  2V5F A;  4BX9 A;  4XX5 A;  2FO1 E;  4O60 A;  3AS8 A;  5EX3 A;  2RG8 A;  1LF8 A;  2WMN A;  3WG7 E;  3SBT B;  2LSU A;  3KSL A;  3UQ3 A;  2QC9 A; 
#chains in the Genus database with same CATH homology
 4URK A;  2XEV A;  3NF1 A;  3EIQ C;  3IEG A;  3ZPJ A;  4FA6 A;  2VSN A;  3WXX A;  4WNG A;  1DNP A;  3KEZ A;  4BWR A;  2WXJ A;  4Y6C A;  2VYI A;  5FQ7 A;  1E7U A;  3LS8 A;  3RO2 A;  2XPY A;  5D0O D;  2FO7 A;  2FUL A;  3I4G A;  3O48 A;  3QWP A;  1Y6I A;  3FUM A;  5EX0 A;  2GRL A;  2WXN A;  3FU5 A;  4APO A;  2XGS A;  2WB2 A;  1HX8 A;  3FU0 A;  3MKQ B;  4HOU A;  2AVP A;  2DBA A;  3D9M A;  1HXI A;  3FH7 A;  4B89 A;  3VLD A;  3ASF A;  5D0Q D;  2WXF A;  3QB2 A;  4JHR A;  4AOF A;  3K9I A;  3UPV A;  4WWN A;  1XNF A;  3QAR A;  4CCA A;  3CKB A;  3S2A A;  5LP0 A;  2I6H A;  2VGX B;  2A4Z A;  4U0Z A;  2YHE A;  4BT9 A;  5BV0 A;  3FY4 A;  2GW1 A;  3FU6 A;  3MV2 B;  2EQX A;  4IYP A;  1OWO A;  3NQP A;  4H7X A;  4A55 A;  3BEE A;  1EF1 C;  3OXG A;  4I9C A;  3D3M A;  3FUE A;  3SGH A;  3D9N A;  4U04 A;  3MV3 B;  1ZU2 A;  3FUD A;  2OND A;  1FVH A;  2DCP A;  3FTS A;  5DIZ A;  4DPR A;  4CT4 A;  1UW4 B;  3G2S A;  4AEZ C;  4BSX A;  3MA5 A;  4HFG A;  1BPO A;  2PM7 A;  4MLP A;  4XI9 A;  5JJ6 A;  1QZ2 A;  2GRM A;  2R5S A;  2XPI A;  1OUV A;  1E8W A;  1HU3 A;  2ION A;  3LY7 A;  3FEY A;  3RK6 A;  4DI3 A;  3PRE A;  3FTV A;  4GYO A;  5CMW A;  3L08 A;  5A6C A;  3EIJ A;  3BG1 B;  3HHM A;  4YVO A;  5FZR A;  4GAA A;  3LEW A;  3PEV B;  4KZ0 A;  3T5X A;  3DPD A;  3MGB A;  4QFV A;  4DLO A;  3TGO A;  2E2E A;  4I2W A;  3U66 A;  3U9W A;  2Y3A A;  2Y4T A;  3TAX A;  2KZT B;  1HFA A;  3LKU A;  3ASG A;  4KVO A;  5A7D B;  3SD5 A;  5BNW A;  2JEK A;  2KM4 A;  3PEU B;  1EDU A;  3D9K A;  4AM9 A;  1Y8M A;  1HG2 A;  2BF0 X;  5KJM A;  2OV8 A;  3JQ0 A;  1JUQ A;  4UI9 J;  4GYY A;  4FU3 A;  5KJK A;  3HIZ A;  3PE4 A;  3CHS A;  1JPL A;  2IFU A;  2IOL A;  4Q69 A;  2FBN A;  3PDN A;  5EKQ D;  1H2U A;  4FUL A;  5T8I A;  4J8D A;  4C9B B;  4L1B A;  5T3R A;  3QAQ A;  3MJW A;  4KXK B;  3TG4 A;  4GZD A;  4I1A A;  4C0M A;  4UWH A;  2YHC A;  5AEN A;  3ZVV A;  4U63 A;  4UI9 C;  2R59 A;  3GW4 A;  2I9C A;  4ATG A;  4JW1 A;  5EDS A;  4JA7 A;  1GW6 A;  3AU5 A;  4A3V A;  4AV7 A;  3CHQ A;  3CQC B;  4CDR A;  1SZ9 A;  3CHO A;  1XGW A;  2PL2 A;  2VSO E;  3LPZ A;  4AY6 A;  3OTN A;  3ZYM A;  4XIF A;  3ZRH A;  3CK8 A;  4I1O B;  5J08 A;  5KCM A;  3FP3 A;  1FVF A;  4KZC A;  4HVB A;  2IOS A;  4GA2 A;  4XKB A;  2OOE A;  3UT7 A;  4CDM A;  4Q96 A;  4UQZ A;  2VJ8 A;  5G2N A;  1YA0 A;  2XRZ A;  4M3O A;  4OYS A;  4FP7 A;  4JXT A;  2J09 A;  5CCM A;  4JA9 A;  3UUX A;  4NQ0 A;  5LCW J;  1A17 A;  1U3D A;  3CK7 A;  4HXI A;  1Z3X A;  3R7Q A;  4CDN A;  4UWL A;  2BUG A;  1PC2 A;  3CVL A;  1UJK A;  3LDZ A;  3CHP A;  3EHN A;  2HYZ A;  3RO3 A;  3B7R L;  4ANV A;  2XPZ A;  4EEC A;  1TEZ A;  4HOT A;  3AS5 A;  3QJZ A;  4BX8 A;  3IHV A;  3CVY A;  4JL0 A;  1B89 A;  3TJP A;  3UMV A;  3FTU A;  1KT0 A;  2WXH A;  1SQM A;  3GZ2 A;  4K03 A;  3FTX A;  4U8H A;  2WPV A;  1H19 A;  4L7T A;  2I1J A;  5LCW C;  4DLQ A;  4DK5 A;  5BPP A;  4ACK A;  1NA3 A;  2WXL A;  3LY8 A;  3RKV A;  2JLB A;  2XQ0 A;  1FCH A;  3B7T A;  3G2V A;  1ELR A;  3EJN A;  4LRZ A;  5FQ6 A;  5JHB A;  2KCV A;  4G25 A;  1H2T C;  5BT1 A;  4LEU A;  3VLF A;  4I6J A;  4HOS A;  3ZXS A;  4RVB A;  4F7A A;  4J8E A;  2XGO A;  3JQ1 A;  3U64 A;  2IF4 A;  1OWN A;  4UI9 K;  4IN3 B;  3UT8 A;  2DIW A;  3OXF A;  4EBA A;  4DI4 A;  5DBK A;  1OWP A;  3SZ7 A;  2WVI A;  3I4R B;  4WNE A;  4UWG A;  2WXK A;  4H7Y A;  4L23 A;  4I9E A;  3CVU A;  4W9R A;  4PS3 A;  1Z6T A;  4AJW A;  3RJV A;  4PDX A;  3MX3 A;  1PAQ A;  2X6F A;  2IJG X;  2AW6 A;  4TUU A;  4XE0 A;  3T5V A;  3ZGQ A;  3ONL A;  3ML8 A;  3PH0 C;  1TJC A;  4ANU A;  4GML A;  1H6K A;  2VTB A;  4JVS A;  3IHY A;  3VLE A;  4B8C B;  4EPZ A;  1H0A A;  2YIN A;  4OVU A;  2WXR A;  2XRY A;  3FTW A;  5LX8 A;  2AXZ A;  2PZI A;  3HDX A;  3FHE A;  3QDN A;  3QC1 A;  2LSV A;  3LY9 A;  3ML9 A;  3CVV A;  2RD0 A;  3FH8 A;  4CRW A;  4GU5 A;  2YQ8 A;  2WQ6 A;  2AXV A;  4FHJ A;  2KAT A;  3IKO B;  3PNL B;  3CHM A;  2WXP A;  1Z3Y A;  3CHR A;  4JEU A;  2I1K A;  4HOR A;  4YVQ C;  4UWF A;  2HM8 A;  5FQ8 A;  4AXH A;  1IQU A;  4EZJ A;  5ANL A;  3ASH A;  4OVV A;  5FZQ A;  4G2V A;  4CEM A;  3L13 A;  3R7R A;  5FQ4 A;  3D9J A;  2X6J A;  5AJD A;  1P5Q A;  4G24 A;  5E75 A;  1L5J A;  2I2O A;  4EQF A;  3ZHE A;  2XCC A;  2NXP A;  4EBA G;  1EPU A;  4L2L A;  4XI0 A;  2WXM A;  3FUN A;  4BT8 A;  3OXL A;  2J4D A;  3JUI A;  3LXU X;  4E85 A;  3N71 A;  4WAF A;  5G55 A;  1HS6 A;  4N3A A;  2ZU6 B;  4ACL A;  5JJT A;  3ZW3 A;  4FC8 A;  3IBE A;  2IU1 A;  4N3C A;  5AYW D;  3KAE A;  1WM5 A;  5BUZ A;  4JHJ A;  3PVL A;  1SZA A;  3I5P A;  3KS2 A;  4G26 A;  1JWG A;  4PS8 A;  3TXN A;  2QY7 A;  2LNI A;  3I3N A;  1HG5 A;  2CG3 A;  2UWJ G;  3P2B A;  4V3I A;  3FDH A;  3MZL B;  2V8S E;  2VSY A;  3CVN A;  3PS6 A;  5CMY A;  4RSY A;  2WQ7 A;  2WM9 A;  2Y4U A;  4GZ3 A;  5ANR A;  5HQ8 A;  4N2S A;  3PZD A;  3Q49 B;  4PH4 B;  3FUK A;  2VGY A;  4A3T A;  2BTD A;  4DJA A;  3S7D A;  2J07 A;  3CGH A;  5AIJ A;  2UY1 A;  5FTP A;  3G2U A;  5BV1 A;  3HYM B;  4MKT A;  1HE8 A;  4CGW A;  3FUF A;  3IV0 A;  2X6I A;  4J6I A;  3DBS A;  1H2V C;  1UG3 A;  2HR2 A;  3GZ1 A;  4J8S A;  3CVX A;  1IQR A;  2HO1 A;  3CST A;  3BG0 B;  3ULQ A;  1UN8 A;  2L0T B;  5KJN A;  1OWM A;  4WWP A;  1NP7 A;  4FLH A;  2GGF A;  3R9A B;  4HOQ A;  3ZEF A;  4F53 A;  4BTA A;  1E8Z A;  1UJJ A;  3QWW A;  2M63 A;  3PNT B;  2VTB B;  3D9I A;  4GCN A;  3FEX A;  2XHE A;  4GZ5 A;  4UQY A;  4BY6 A;  1INZ A;  3PUJ A;  5A23 A;  5LOZ A;  4GYW A;  5G04 J;  2CFZ A;  3VTX A;  3ASD A;  3TXM A;  1E7V A;  4F3V A;  3RIB A;  3FFL A;  2L6J A;  2FI7 A;  3FUH A;  4GCO A;  4N39 A;  4P29 A;  3SFZ A;  4N2Q A;  2MHK A;  2WXO A;  3CLJ A;  4JC8 A;  4ILH B;  5FJY A;  4I6E A;  3TL5 A;  4FHK A;  4ABN A;  3O4Z A;  4C0E A;  1QQE A;  2J08 A;  3L16 A;  2YNQ A;  3RRM B;  3LJ3 A;  3SF4 A;  3Q15 A;  5E76 A;  1KT1 A;  4G23 A;  3QK0 A;  3NZS A;  4APF A;  5BW8 C;  3D9L A;  3FUI A;  4RG9 A;  3SI5 A;  4A1S A;  3CVP A;  2MOW A;  2LAH A;  4G11 A;  4JHK A;  1ELW A;  3ENE A;  5J90 A;  4O6F A;  3CVW A;  2PQR A;  3GZS A;  3RU0 A;  3CIA A;  3L22 A;  3PUK A;  1HF8 A;  3CKC A;  2CHZ A;  2L0I A;  3QOU A;  3L6A A;  4JPS A;  3ZHE B;  2X38 A;  2XGM A;  3EDT B;  4F1S A;  3QKY A;  4I1M A;  1ELK A;  4MS6 A;  4WNF A;  2KC7 A;  3T8M A;  4A1G A;  3ZYL A;  2PM6 A;  4PS7 A;  3ZN3 A;  2WXI A;  4PUC A;  3B7U X;  2J4B A;  4KBQ A;  4JEH A;  4NAC A;  3FU3 A;  1QNF A;  4AIF A;  5FWQ A;  1WAO 1;  4GZC A;  2WQH A;  4LCT A;  4E6H A;  3FUL A;  3ESK A;  1U3C A;  2QFC A;  4N5C A;  4FLB A;  4ILG A;  3PE3 A;  2CHX A;  3FUJ A;  5CHE E;  3LCA A;  1VDY A;  1E8Y A;  2ILR A;  5C1D A;  3CSF A;  4U0S A;  3HVE A;  3L54 A;  3APD A;  4I43 A;  1IHG A;  1NA0 A;  3ZIM A;  2J9Q A;  3ESL A;  2P58 C;  4B94 A;  5JJ7 A;  3G2T A;  3SBS A;  4AY5 A;  3CR3 A;  3L17 A;  5T4Y A;  4MRU A;  3KD7 A;  4HLE A;  4GPK A;  3LVQ E;  1MHQ A;  2LO6 A;  3D9P A;  3Q47 B;  2UY1 B;  4Q94 A;  2R17 C;  3E4B A;  2X3M A;  5HI7 A;  3Q5M A;  4AVX A;  1HZ4 A;  4JZY A;  2CG2 A;  1MQS A;  1N54 A;  1TJF A;  2A5U A;  4TV3 A;  4LUN U;  4B8A A;  1DVP A;  4GA1 A;  4KYO B;  4RG6 A;  1UN9 A;  2CHW A;  4J8F A;  4XKC A;  4G1T A;  5ARG A;  1N52 A;  4LER A;  3UT4 A;  3APF A;  4IUL A;  3VTY A;  4IRU A;  2Q7F A;  3AU4 A;  4L2Y A;  4WND A;  4ANX A;  1E96 B;  4ILI A;  5KJL A;  2NSZ A;  2C2L A;  3FWV A;  3LYA A;  3APC A;  1JWF A;  3EHM A;  4R7L A;  4KT6 B;  4CT0 A;  3FTY A;  3G2W A;  4GZ6 A;  5JHA A;  3MKQ A;  2IQC A;  4I2Z A;  2WXG A;  2KCK A;  4BFR A;  2OVB A;  4KVM A;  4CGV A;  3JYS A;  3RRN B;  1WY6 A;  4NRH B;  3GYZ A;  4AP2 A;  3D9O A;  2VQ2 A;  2FEZ A;  3AS4 A;  1OWL A;  4GA0 A;  4WUY A;  3RRU A;  1EYH A;  5CCL A;  4K0R A;  1E90 A;  1S0P A;  2X6K A;  4FJZ A;  4UWK A;  2VGX A;  3QWV A;  4I6G A;  3SHF A;  3MYV A;  4HS2 A;  4UQX A;  2MRI A;  3U3W A;  5ARF A;  5C2Y A;  3S7B A;  3ONK A;  4I17 A;  5AJL A;  3URZ A;  1IYG A;  4ME2 A;  3OAW A;  3B7S A;  3S7J A;  5G05 J;  3ZYQ A;  2AXU A;  2OVF A;  3ZFW A;  3FH5 A;  1W3B A;  3C98 A;  2XCB A;  2LAI A;  1HH8 A;  4D10 C;  5LFA A;  3Q4A B;  4J0U A;  4YND A;  3CEQ A;  4TRQ A;  3MEK A;  5M72 A;  3CK9 A;  5FZS A;  3FTZ A;  3P1U A;  2VSX E;  3CQG B;  3UX4 A;  2NC9 A;  3U4T A;  2WXQ A;  1NZN A;  2CFU A;  2FF4 A;  3B13 A;  3JCK C;  4KMO A;  4U07 A;  2AWI A;  2KCL A;  4NUR A;  4EZK A;  3MCX A;  1HO8 A;  1PY1 A;  2WMO A;  3CV0 A;  3TG5 A;  3ZYK A;  1E8X A;  5G05 C;  2J49 A;  4FAD A;  2PQN A;  2V5F A;  4ANW A;  4BX9 A;  4XX5 A;  4XZ4 A;  4BTB A;  4N3B A;  3HVE B;  3QNK A;  4GB9 A;  3MKR A;  2V0P A;  2L9B A;  4GMJ A;  4WWO A;  2KZT A;  3AS8 A;  4FJY A;  5EX3 A;  3SNX A;  2RG8 A;  4U0U A;  1KLX A;  4Y6W A;  1LF8 A;  3LVR E;  2WMN A;  1ZBP A;  5FT9 A;  2C0M A;  3NZU A;  2E0I A;  3S7F A;  4B0Z A;  2V4L A;  5ENN A;  3SBT B;  3CVQ A;  2LSU A;  3UQ3 A;  2C0L A;  3PRZ A;  2X6H A;  5G04 C;  1X5B A;  4EZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...