3CGHA

Crystal structure of a susd homolog (bt_3984) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
507
structure length
507
Chain Sequence
PYEAPDLSADGYALGSAMNNLAGCVVSPDVNTAQFTDCLLGGPLGGYFADSNAGFTETISNFNPKDDWSRVFLKSDKIIPTLYSNLTQVKLVSQNTNDPVPYAIAQVIKVAAMHRVTDAFGPIPYSQIGANGEIATPYDSQEVTYNTFFDELNAAIATLNENSNEQLVPTADYIYKGDVKKWIRFANSLKLRLAIRIAYANPVKAQQMAEEAVNPANGGVIESNADNATWNYFETSQNPIYVATRYNQVQTSDHGGVPCLTGGDTHAAADIICYMNGYKDNRREKFFTKSEWAGQDYVGMRRGIVIPELKTTGHKYSGVNIAPTSPLYWMNAAEVAFLRAEGQAVFNFSMGGTAESFYNQGIRLSFEQWGADGVEDYLKDDVNKPTAYTDPAGTNTYQNALSNITIKWNDSADKEEKQERIIVQKWIANWQLGNEAWADFRRTGYPKLIPVKENKSGGVVDSEKGARRMPYPLDEFVSNKANVEYAIANYLHGADNMATDVWWASKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of BT_3984, a member of the SusD/RagB family of nutrient-binding molecules.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Metal binding protein
molecule keywords SusD homolog
total genus 187
structure length 507
sequence length 507
ec nomenclature
pdb deposition date 2008-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12741 SusD-like Susd and RagB outer membrane lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3cghA00
5FQ6A 5T3RA 3JQ1A 4F53A 3NQPA 3CGHA 3OTNA 3QNKA 4MRUA 3JQ0A 3SNXA 4PUCA 3EHMA 3CKCA 3FDHA 3EJNA 3CK8A 5T4YA 5FQ8A 4F7AA 3CKBA 3P1UA 4Q69A 5LX8A 4L7TA 5FQ7A 5E75A 5J90A 3CK9A 3HDXA 3EHNA 4LERA 5FQ4A 3L22A 5E76A 3IV0A 3I4GA 3MX3A 3JYSA 3LEWA 3KEZA 3GZSA 3SGHA 3MCXA 3MYVA 3CK7A
chains in the Genus database with same CATH superfamily
5FJYA 4EBAA 4MS6A 1TNUA 3TJPA 3NZUA 3HG0D 1OWNA 1QNFA 5E75A 4HI9A 5JMND 5KJLA 2PNNA 5J08A 2WQ6A 4AVXA 3ONLA 5CHEE 2XRZA 4GAAA 2YINA 4HQDA 4JC8A 4YVQC 2XPZA 4P29A 3AG3E 3AG2E 4XKCA 5FQ7A 3FTUA 3MGBA 2CHXA 3DEPA 3TWTA 4WWPA 4U04A 3FY4A 2J08A 3RAUA 3AJIA 3D9OA 3PH0C 3IKOB 2CG2A 4JHKA 3JXJA 1NP7A 1D8EA 1SQMA 3Q5MA 4GU5A 4K5CA 4HI8A 2WVIA 4DLOA 2ZU6B 1N4SA 2Y4TA 3BQOA 4U8VD 1H19A 3LDZA 4AY5A 3NOGD 3U3WA 4RSYA 3HXEA 1E8XA 3CQCB 4FLHA 3UTMA 1S64A 3Q73A 4URKA 5KJNA 5AQ7A 2WXOA 3HVEA 5G05J 3JCKC 1OWMA 5ANRA 3FH7A 4EZJA 3G2UA 1AWCB 2R17C 2WMNA 2R2LA 3MV2B 4G26A 4KT6B 3ZYMA 2XEVA 3Q9NC 2WB2A 5J90A 1YA0A 2LAIA 5ENOD 3PZ2A 4ZFHA 2OOEA 3FUMA 2A5EA 4O1PA 3D9HA 2XGMA 4DLQA 3D9PA 2PZIA 3NBNB 3B13A 4ACLA 4AM9A 4PS8A 2X6IA 4J8FA 4U0UA 5AQBA 5C2YA 2PM7A 2XZTG 2GRNB 2V4HC 2J09A 3DRAA 5G55A 3CVNA 1H6KA 3EHMA 2VGXA 5CBNA 1FVHA 3EU5A 5BPPA 2R03A 2FBNA 3ZFWA 3RIBA 5EX0A 4GTQA 2DVWA 3UINC 2KZTA 4DX2A 3LEWA 5AN8A 2DCPA 3S2AA 1SW6A 2YNQA 4QQIA 2GRQB 4FADA 2MHKA 2DYSE 3UT7A 2V5FA 3BU8A 4DX1A 5FWQA 3FUFA 2ETAA 2Y1LE 3B7BA 4CT0A 3E37A 2L0IA 5FTPA 2KCKA 3GZ2A 4EHMA 2H6HA 1E8YA 4DI3A 5ENTD 4U8YD 3ZUVB 3FTZA 3FTYA 2WXKA 1OCCE 3KSLA 1A5EA 1NA0A 3R7RA 2AXUA 3C5RA 1TN8A 2WQHA 4GPKA 4I1OB 3PE3A 3B7SA 4PS7A 4BX9A 2XENA 3WXXA 2FI7A 2FEZA 5FZQA 3E30A 3LS8A 4YDWA 5HS0A 1JPLA 3SF4A 2VJ8A 1UG3A 5FQ8A 2PM6A 1KZOA 4UWFA 3ISMC 3UM3A 2A5UA 4GMLA 3AS5A 5BT1A 3LKUA 4RG9A 1Y8MA 3VTYA 3PS6A 2Q7FA 4G24A 2IOSA 1FCHA 1OCRE 4JEHA 3DEOA 3MZLB 4CEMA 2P9UG 3ASFA 3V31A 2WXNA 2LAHA 3QJZA 3ABME 3TWXA 4YNDA 3JYSA 4TXRA 3G2VA 2GRRB 3IBEA 4PS3A 2GROB 2LUHA 3EIQC 3FHEA 1JCSA 1UOHA 4L1BA 4RVBA 3NF1A 4GZDA 4CGVA 5AQAA 3PNTB 4GMRA 2DWZA 1N0RA 2KZTB 3RO3A 2LXLA 2WXFA 2ETBA 3UPVA 3QK0A 1TEZA 1UW4B 2R02A 4WNDA 3SZ7A 5HI7A 3HXDA 2PQNA 3ZXSA 2EIJE 2ZGGA 1EPUA 2IJGX 1OT8A 4D10C 1TNOA 3L17A 2OCCE 3VLFA 2XPIA 4IRUA 2I2OA 1EF1C 4B89A 3PNLB 4EZKA 3QKYA 1O1RA 2OV8A 4A1SA 4GZ5A 3UKUG 4BT9A 3EHNA 4LNUD 5E76A 3ASOE 4J7WA 4TV3A 4N5QA 4J8YA 5FINA 5BXOA 2I1JA 3HVEB 3E4BA 5KJMA 4HFGA 3RRUA 1L5JA 3KAEA 5LX8A 2EQXA 4JA7A 4DJAA 1HH8A 3E33A 3S7FA 2QYUA 1U3DA 1NZNA 3IHVA 2OVBA 2NYJA 1IXVA 4UI9J 3NOCD 3IXEA 3LVRE 2BF0X 3CK7A 1YCSB 5EDSA 4H7YA 1QQEA 3CKCA 4RLYA 2IOLA 3G2SA 1O5MA 4L9PA 4H7XA 3E32A 5JHBA 1ZB1A 4B93B 1UN9A 3ZRHA 3DBSA 5AARA 3MX3A 2B0OE 4JB8P 2XS1A 3SBTB 5CBOA 4ATGA 2GW1A 4HLLA 1WY6A 3UXGA 5T4YA 2P9SG 2EIME 3TWVA 4TUUA 4LERA 2B6CA 1KLXA 3ULEG 3EIJA 3D9IA 1HE8A 3ULYA 4LNBA 1U3CA 4I43A 5ENSD 2EINE 4G25A 4RQIA 3FTXA 5JJTA 4KMOA 3W9GA 5AENA 4GA0A 3CVYA 3C72A 5G05C 4UWHA 4HLEA 4M7CA 3DWLG 3ZNGA 1MQSA 2Y0BG 4WNFA 3CQGB 2X6JA 5BW8C 3SI5A 3IHYA 3F6QA 5AQ9A 4LCTA 3LY8A 2VSXE 2EILE 5ARGA 4GCOA 5CCLA 3K9IA 3L16A 4JEUA 1BI7B 5D2MC 4ATZD 3S7DA 2UY1A 3U64A 3JXIA 1WM5A 5LCWJ 3CSFA 4HOQA 4CRWA 3CHSA 3ENEA 4E6HA 5T3RA 5CEDB 1G3NB 1JUQA 3CV0A 1OWLA 3CSTA 5M72A 3B7RL 3S7BA 4L7TA 4ANUA 3I5PA 4G2VA 3OXFA 2LXMA 4BSXA 3QAQA 4XI9A 1K3ZD 3QWWA 4JD2G 3PVLA 3T8KA 3D9NA 3HIZA 3LVQE 4MBGA 1LD8A 2HR2A 5ENQD 4I2WA 2WXPA 2XEEA 3ZYLA 4Q69A 5EIDA 3QOUA 3R7QA 4AIFA 4JZYA 3FU3A 2H6IA 3X2QE 4N39A 3SFXA 4DX6D 1HS6A 5BNWA 3D9KA 1QZ2A 3FTSA 3CVXA 3IEGA 3ZHEA 2P2CP 1E8WA 3KS2A 4LG6A 4EPZA 3FDHA 4F6RD 2VYIA 5KBAA 1D8DA 3P2BA 4CYMD 4N2SA 4HRNA 4K5BA 4U96D 4A1GA 2V4LA 1N11A 3CHMA 2GRLA 1TNYA 2FO7A 4KYOB 4BTAA 3TXMA 4EZLA 4OAUC 4ANXA 1N0QA 3PZ4A 3GZ1A 4Q94A 4M3OA 3EU9A 1E8ZA 4CZ2D 1DC2A 1E7UA 3C3QA 2OEVA 3B7UX 4OAVB 4DX7D 2X38A 3TWQA 2XPYA 4ME2A 1HF8A 3TWRA 4GCNA 4FHJA 1MYOA 3D3MA 3U4TA 4N3AA 2FULA 3CVPA 3PE4A 4AEZC 3QWVA 3LY9A 5ARFA 3ZYKA 2J4DA 3URZA 1NA3A 3DPYA 2XZDG 3HDXA 4WWOA 3ZPJA 2GRMA 5LCWC 2NSZA 3Q75A 5CRVA 3MYVA 5BV0A 4WNGA 4TRQA 2CHZA 4GTSA 1HG5A 1ELWA 3PRZA 3EJNA 3NZSA 3APFA 3FUEA 4HRLA 2QYJA 3HYMB 4GTVA 4N2QA 3J5QB 2AXZA 2XCCA 3SFZA 4L2LA 3DSTA 3SNXA 3W9FA 3PEUB 3ZW3A 4JA9A 3ZHEB 4O6FA 3MV3B 2P58C 4DK5A 3J5PA 4U7EB 1MX2A 1H6OA 2KCLA 3L08A 3Q15A 3JQ1A 3RK6A 5JJ6A 5KCMA 4EBAG 4I9CA 3FH8A 2KM4A 3AS4A 1TN6A 5CEAA 2IY0C 1IHGA 2OVFA 3T9KA 4TXPA 5ANLA 3MA5A 3SFYA 2XEHA 1XNFA 4UWLA 1NFIE 2AXVA 2IF4A 2VGYA 1O1SA 1Z5SC 2RG8A 1SA4A 4C0MA 1N9AA 2L0TB 1B89A 4EQFA 2IQCA 3G2WA 3OXGA 3UI2A 2DIWA 4G8LA 5D66A 3PUKA 3ZU7B 3FEXA 4UWKA 5EYPF 3RRMB 4OVVA 3SD5A 2NC9A 2RKKA 5G2NA 4K5AB 3UM2A 3BUAA 3R9MA 2LO6A 4DRXE 3MCXA 1INZA 2CG3A 3WG7E 4UUCA 4UWGA 4A55A 2XGOA 3EHRA 4HS2A 3UQ3A 5T8IA 2I1KA 3LJ3A 3V79K 3LYAA 3JUIA 1IYGA 2DYRE 4CDNA 2P9LG 4GZ6A 1Q2ZA 1H2TC 3T8MA 4A63B 2VSYA 3SO8A 4AJWA 5D0QD 3VTXA 2WMOA 3DSWA 2WXLA 3KEAA 1LF8A 5B3SE 3OXLA 2XCBA 3I3NA 2AJAA 5HRYA 4UI9C 3CHOA 1BD8A 3D9JA 4KVMA 5ENRD 3FU6A 2J9QA 5JJ7A 5AIJA 5DIZA 3FUJA 3TG4A 3CVVA 3CKBA 3RO2A 3LXUX 3QC1A 3RKVA 2V0PA 5CMWA 1K8KG 2JABA 3Q7AA 4HOUA 2ONDA 4N3BA 4ZHBA 5G04C 3ML8A 4BY6A 2VTBA 3Q4AB 1WDYA 3UM0A 3N71A 2CFUA 1MX4A 3O4ZA 3UMVA 4CCAA 4NRHB 2J4BA 4AV7A 3CVLA 3CHPA 3MKRA 3OTNA 2F0YA 3TAXA 3ESLA 2ZIRA 1SA5A 1XGWA 4XEIG 3FEYA 1DVPA 3ABKE 3AAAC 4F1SA 1O1TA 5AJDA 1N4QA 4Z68A 2F37A 3B7TA 2KATA 4XIFA 4L2YA 2NXPA 4NURA 3S7JA 4GPMA 2A4ZA 3EHQA 2UY1B 1PY1A 3CVQA 4K03A 4DUIA 2R59A 4WAFA 4U8HA 4UQYA 3DPDA 5KNGA 3DXKG 3FTVA 2VSOE 4FC8A 5FQ6A 2WXMA 2XGSA 4G11A 1X5BA 4FJYA 4FULA 2YQ8A 1V55E 3PZ3A 5BV1A 4UI9K 1YYHA 3AG4E 3NQPA 1Z6TA 4GTTA 1BLXB 2KC7A 4Y6WA 4UQXA 4GZ3A 3TGOA 1U2VG 3C3OA 1N95A 3FUIA 4YVOA 4V3IA 4PDXA 2X6FA 5FQ4A 2HO1A 4U0ZA 1TN7A 4FJZA 4JXTA 2C0MA 2C0LA 1IQRA 3ZN3A 5KJKA 2WXRA 1KT1A 3CLJA 4OYSA 5EYLA 2HM8A 3MEKA 1P5QA 2GGFA 1TJFA 1UN8A 4O1OA 3L13A 3TG5A 4JPSA 3U66A 4J8SA 1KPSB 4XX5A 4B8AA 3CVUA 4QFVA 5EKQD 3QDNA 4BERA 2M63A 4F1PA 4IULA 3T5VA 2WM9A 4F7AA 4XZ4A 1KT0A 3ZGQA 3EDTB 3TWWA 3V30A 4B8CB 2IFUA 4AXHA 2MYOA 4ACKA 4EECA 3KD7A 3TWUA 1HG2A 1K1BA 3G2TA 4MKTA 1MX6A 4BESA 4ILHB 2DZOA 1BU9A 3LY7A 2BUGA 4ANVA 3EUVA 3GYZA 4JHRA 3Q47B 1DCQA 4IN3B 2KBXA 4PH4B 4GTRA 1TR4A 2BKGA 2IEJA 2YHEA 1SZAA 2WPVA 3PEVB 3BEEA 1BI8B 4A3VA 2WXIA 4I6JA 4X8QA 1NI1A 1VDYA 5FZRA 3Q78A 2X6HA 2BEDA 5BXUA 4W9RA 4BWRA 2J49A 4HOSA 5DBKA 3SHFA 4ANWA 5IY5E 2DZNA 3TXNA 2P9NG 2P9PG 3FULA 1HZ4A 4GA1A 4BSZB 1PAQA 4U95D 5G04J 4FHKA 2VQ2A 3V2OA 4NACA 5ENNA 3E34A 4UQZA 4C9BB 5B1AE 4HRMB 4NIKA 4J6IA 4F53A 5FT9A 1OCZE 3I4RB 4L23A 1E96B 4BX8A 1DNPA 3CK9A 2VTBB 4APFA 4LSZE 1OY3D 4GMJA 3UUXA 1EDUA 2IO3C 4TUMA 5KWDA 4G23A 4N5CA 2LSUA 3D9MA 1Z3XA 1PC2A 2AW6A 1IQUA 3L82A 4KZCA 1MZCA 4N3CA 3RSEG 1OWPA 2QZAA 1RZ4A 3ZYQA 3UIPC 2WXGA 3IV0A 2OEWA 3T5XA 1MHQA 2F8XK 2QC9A 3CR3A 3FH5A 1RW2A 2MRIA 3TWSA 3Q9UC 3FU5A 2XRYA 4GZCA 5D0OD 1FT2A 4I1MA 4CDMA 5FIOA 4Q96A 3UKRG 1H6PA 3DXMG 5EILA 2HYZA 1D9SA 3HXCA 1BPOA 1YMPA 2FF4A 3DSVA 2MOWA 5FZSA 1JCQA 5CMYA 4J8DA 3ASGA 2VGXB 4HOTA 4WUYA 1E7VA 1H2UA 1TJCA 3SQVA 2AVPA 3MKQB 2UWJG 5EX3A 2R5SA 5EIBE 1FT1A 1TNZA 1GW6A 3FTWA 4RG6A 4KZ0A 1HX8A 4TXQA 1SZ9A 3UX4A 4C0EA 4JHJA 2RFAA 1QYMA 2Y3AA 4F3VA 2PL2A 3NAWA 2I9CA 3ZXPA 2YHCA 1HU3A 3CGHA 4K0RA 1DCEA 1Z3YA 1N4PA 2L6BA 1FVFA 3FUKA 4KXKB 2WXJA 4LUNU 3C98A 5AYWD 5CECB 4GTOA 1KZPA 2LSVA 5CRUA 1S63A 2HE0A 2BTDA 3UT4A 2V5QC 3DSSA 3U9WA 4YDYA 3ESKA 3ASNE 3Q49B 3VLDA 1N52A 4FU3A 4B94A 3FUNA 3CK8A 4IYPA 4I1AA 2RFMA 1E90A 1N54A 5BUZA 1S70B 3ASHA 1Y6IA 3O48A 3UT8A 4GA2A 4ABNA 1ELRA 2JLBA 2CFZA 3MKQA 4BETA 3SGHA 4FA6A 3Q7FA 4FLBA 3JQ0A 4GTMA 4U63A 5HQ8A 3V2XA 3PUJA 4E85A 3UM1A 5CCMA 1W3BA 4ILIA 2PQRA 4CDRA 2Y4UA 5ITZF 3D9LA 1OWOA 3RJVA 4DI4A 3FUHA 3Q79A 2DBAA 4PUCA 1TYQG 2H6FA 3ULQA 3CHRA 3FFLA 4A3TA 3UIOC 4HVBA 3JUEA 3PZDA 1H2VC 3LPZA 4Y6CA 3R9AB 3GZSA 3QWPA 4BEPA 1OCOE 2I6HA 4HB5A 1N4RA 3SY2A 1OUVA 2IU1A 1V54E 1LD7A 5HKPA 1ZBPA 2E0IA 3ML9A 2F8YA 3HRAA 4WNEA 3HXBA 4GTPA 4BTBA 3CVWA 3OAWA 4I2ZA 4JW1A 3NB2A 4HXIA 2C2LA 3CIAA 1ZU2A 4I6EA 2ZISA 3PREA 4DPRA 3ABLE 3TL5A 1IHBA 3VLEA 5KNHD 2BKKB 1HXIA 1TNBA 5A7DB 3FUDA 3AS8A 4BFRA 4HORA 4I9EA 2LNIA 4I17A 4R7LA 3LCAA 2VSNA 1NL4A 4C48B 4J0UA 4KBQA 3AU5A 2RD0A 3FU0A 2WXHA 3QB2A 5LOZA 5AJLA 1LTXA 1MJ0A 3CHQA 3RRNB 2XHEA 2IO2C 5ENPD 1S0PA 1EYHA 3ZKJA 3APCA 3DSUA 2P9IG 3ZEFA 3PDNA 4MLPA 4BT8A 4YDEA 5LFAA 4GYOA 3B95A 2GRPB 1IKND 2XQ0A 1UJJA 1SVXA 3QARA 3LJNA 2R05A 2J8SD 2ETCA 3MJWA 3PZ1A 3BG0B 3ONKA 5C1DA 4NQ0A 1N94A 2X6KA 2Y69E 4MRUA 5A23A 3ASDA 4APOA 4G1TA 1HO8A 3HXFA 2IONA 2VGEA 4OVUA 2AWIA 5JHAA 2KCVA 3L22A 1JCRA 3GW4A 4LNGA 2L6JA 3FP3A 2ZGDA 1UJKA 2CHWA 4I6GA 5B1BE 2EIKE 4HBDA 1H0AA 4LEUA 1FPPA 3AG1E 3L6AA 2H6GA 3AU4A 2XS8A 3APDA 4B0ZA 4O60A 3KSQA 4AOFA 4FP7A 4LRZA 2L9BA 3HHMA 5CERB 1WAO1 2QFCA 4JVSA 4XKBA 1A17A 5AAOA 5A6CA 4GB9A 2FO1E 3CEQA 3C3RA 1AP7A 1K1AA 5LP0A 3ZIMA 3P1UA 2QY7A 4U0SA 3I4GA 4U07A 4XI0A 4XE0A 4ILGA 3BG1B 2JEKA 4YDOA 2ZXWE 4CT4A 4JL0A 3DSXA 4AP2A 1JWFA 5H7PA 4AY6A 4G8KA 2J07A 2V8SE 2X3MA 2E2EA 4GYWA 2ILRA 3RU0A 3L54A 3KEZA 4DX5D 4WWNA 4KVOA 5JA4D 1ELKA 2P9KG 1WG0A 3QNKA 2WQ7A 4CGWA 4HNAD 1HFAA 3ZVVA 3FWVA 1OXJA 2KXPC 3L9TA 1JWGA 2WXQA 3SBSA 1X81A 1QBQA 4J8EA 4GYYA 5EN5D
chains in the Genus database with same CATH topology
3FH5A 1INZA 2CG3A 5FJYA 4EBAA 2MRIA 4MS6A 4UWGA 3TJPA 1U3DA 4A55A 3NZUA 1NZNA 2XGOA 4HS2A 3UQ3A 5T8IA 2I1KA 3LJ3A 3IHVA 3FU5A 1OWNA 2XRYA 4GZCA 5D0OD 2OVBA 3LYAA 3JUIA 1IYGA 1QNFA 4I1MA 5E75A 4CDNA 4CDMA 4Q96A 5KJLA 4UI9J 4GZ6A 2HYZA 1H2TC 3LVRE 2BF0X 1BPOA 3T8MA 2VSYA 5J08A 2FF4A 4AJWA 2WQ6A 2MOWA 5FZSA 5D0QD 3CK7A 4AVXA 3ONLA 3VTXA 5CMYA 2WMOA 4J8DA 5CHEE 2XRZA 3ASGA 2VGXB 4GAAA 4H7YA 5EDSA 2YINA 4JC8A 4WUYA 4HOTA 4YVQC 2XPZA 1QQEA 1E7VA 2IOLA 3CKCA 1H2UA 1TJCA 3G2SA 4P29A 2AVPA 4H7XA 3MKQB 2WXLA 4XKCA 2UWJG 5FQ7A 5JHBA 3FTUA 3MGBA 5EX3A 2R5SA 1LF8A 2CHXA 2XCBA 1UN9A 3OXLA 1GW6A 3DBSA 3I3NA 4WWPA 3FTWA 4RG6A 3FY4A 4U04A 2J08A 4KZ0A 3MX3A 1HX8A 4UI9C 1SZ9A 3CHOA 3UX4A 3D9OA 3PH0C 3IKOB 3SBTB 2CG2A 3D9JA 4KVMA 4C0EA 3FU6A 2J9QA 4JHKA 5JJ7A 5AIJA 1NP7A 4JHJA 4ATGA 1SQMA 5DIZA 3FUJA 2GW1A 3TG4A 1WY6A 5T4YA 3CVVA 3CKBA 3Q5MA 3RO2A 3LXUX 4GU5A 4TUUA 3QC1A 2Y3AA 4LERA 1KLXA 3EIJA 4F3VA 3RKVA 2PL2A 2V0PA 3D9IA 5CMWA 2WVIA 1HE8A 4DLOA 2ZU6B 2Y4TA 2I9CA 1U3CA 2YHCA 1H19A 4I43A 1HU3A 3CGHA 4K0RA 3LDZA 4AY5A 4HOUA 4G25A 2ONDA 4N3BA 3FTXA 4RSYA 5G04C 3U3WA 3ML8A 1E8XA 4BY6A 3Q4AB 4KMOA 5JJTA 1Z3YA 3CQCB 2VTBA 4FLHA 1FVFA 3FUKA 4KXKB 2WXJA 5AENA 4LUNU 4GA0A 4URKA 3C98A 5AYWD 3CVYA 5KJNA 3N71A 2LSVA 2CFUA 3O4ZA 3UMVA 5G05C 4CCAA 2WXOA 4NRHB 2J4BA 4UWHA 3HVEA 4HLEA 4AV7A 2BTDA 5G05J 1MQSA 4WNFA 3JCKC 1OWMA 5ANRA 3U9WA 3CQGB 3FH7A 2X6JA 3UT4A 3G2UA 5BW8C 4EZJA 3SI5A 3IHYA 3ESKA 2R17C 2WMNA 3CVLA 3CHPA 3LY8A 3MKRA 3Q49B 4LCTA 3OTNA 3MV2B 3VLDA 1N52A 4G26A 2VSXE 4KT6B 4FU3A 5CCLA 5ARGA 4GCOA 3TAXA 4B94A 3ZYMA 3ESLA 3FUNA 3CK8A 4IYPA 3K9IA 4I1AA 3L16A 1E90A 4JEUA 1N54A 2XEVA 5BUZA 3ASHA 1XGWA 1Y6IA 2WB2A 3O48A 3S7DA 5J90A 1YA0A 2LAIA 2UY1A 3UT8A 4GA2A 3FEYA 3U64A 2OOEA 1ELRA 3FUMA 4ABNA 1DVPA 2JLBA 1WM5A 2CFZA 3MKQA 5LCWJ 3CSFA 4HOQA 4F1SA 5AJDA 3SGHA 4FA6A 4CRWA 2XGMA 3CHSA 3ENEA 4E6HA 5T3RA 4DLQA 3B7TA 4FLBA 2KATA 1JUQA 3ZRHA 4XIFA 3D9PA 3CV0A 1OWLA 3JQ0A 3CSTA 5M72A 4L2YA 2PZIA 2NXPA 4NURA 3B13A 4U63A 2A4ZA 3S7JA 5HQ8A 2UY1B 4ACLA 4AM9A 3B7RL 1PY1A 3CVQA 3PUJA 3S7BA 4L7TA 4E85A 4ANUA 4PS8A 3I5PA 4G2VA 2R59A 4K03A 1W3BA 5CCMA 3OXFA 4BSXA 3QAQA 4WAFA 4U8HA 2X6IA 4ILIA 4J8FA 2PQRA 4UQYA 4U0UA 5C2YA 4XI9A 2Y4UA 3DPDA 4CDRA 2PM7A 3FTVA 3D9LA 3QWWA 2VSOE 4FC8A 1OWOA 3PVLA 2J09A 5FQ6A 2WXMA 2XGSA 3D9NA 3FUHA 4G11A 3HIZA 3RJVA 4DI4A 3LVQE 5G55A 3CVNA 1H6KA 2DBAA 4PUCA 3EHMA 2HR2A 2VGXA 3ULQA 1FVHA 1X5BA 4I2WA 5BPPA 3CHRA 3FFLA 2WXPA 4A3TA 2FBNA 3ZFWA 4HVBA 3ZYLA 4Q69A 4FJYA 3RIBA 4FULA 3QOUA 3R7QA 4AIFA 2YQ8A 3FU3A 4JZYA 5EX0A 4N39A 1HS6A 3D9KA 3PZDA 5BNWA 1H2VC 5BV1A 4UI9K 2KZTA 1QZ2A 3FTSA 3LPZA 4Y6CA 3LEWA 3R9AB 2DCPA 3GZSA 3S2AA 3QWPA 2I6HA 2YNQA 3CVXA 3IEGA 3ZHEA 3NQPA 1Z6TA 1E8WA 2KC7A 3KS2A 4Y6WA 4EPZA 4UQXA 1OUVA 4GZ3A 2IU1A 3FDHA 2MHKA 4FADA 3TGOA 3UT7A 3FUIA 2V5FA 4YVOA 5FWQA 3FUFA 4V3IA 2VYIA 4PDXA 3P2BA 4N2SA 4CT0A 1ZBPA 2E0IA 2X6FA 5FQ4A 2HO1A 3ML9A 4U0ZA 2L0IA 5FTPA 2KCKA 4WNEA 4FJZA 4JXTA 3GZ2A 4A1GA 1E8YA 2C0MA 4BTBA 2C0LA 1IQRA 2V4LA 3ZN3A 4DI3A 5KJKA 3CVWA 3OAWA 4I2ZA 3CHMA 4JW1A 2GRLA 2FO7A 4KYOB 4BTAA 3TXMA 4EZLA 2WXRA 4HXIA 2C2LA 3FTZA 4ANXA 3CIAA 1KT1A 3CLJA 3FTYA 1ZU2A 4I6EA 4OYSA 2WXKA 3PREA 2HM8A 3GZ1A 3MEKA 4Q94A 4DPRA 1P5QA 1NA0A 3R7RA 3TL5A 2AXUA 2GGFA 4M3OA 3VLEA 2WQHA 1E8ZA 4I1OB 4GPKA 1HXIA 3PE3A 1TJFA 3B7SA 1UN8A 4PS7A 3L13A 1E7UA 3WXXA 5A7DB 2FI7A 3TG5A 3FUDA 4BX9A 2FEZA 4JPSA 3U66A 3B7UX 4J8SA 3AS8A 4BFRA 4XX5A 4B8AA 3CVUA 5FZQA 4HORA 3LS8A 4QFVA 4I9EA 5EKQD 1JPLA 2X38A 3QDNA 3SF4A 2M63A 2VJ8A 4IULA 1UG3A 2LNIA 4I17A 3T5VA 4R7LA 5FQ8A 2WM9A 2PM6A 3LCAA 2VSNA 4XZ4A 2XPYA 4ME2A 4F7AA 1HF8A 1KT0A 4J0UA 4GCNA 3ZGQA 4FHJA 4KBQA 3EDTB 4UWFA 3AU5A 2RD0A 4B8CB 2A5UA 3FU0A 2WXHA 3QB2A 5AJLA 2IFUA 3D3MA 5LOZA 4GMLA 3AS5A 4N3AA 3U4TA 3LKUA 4AXHA 3CHQA 5BT1A 4ACKA 4RG9A 1Y8MA 4EECA 3RRNB 3VTYA 2XHEA 1S0PA 2FULA 3CVPA 3PS6A 3PE4A 1EYHA 2Q7FA 3APCA 3KD7A 4G24A 2IOSA 3QWVA 4AEZC 1FCHA 1HG2A 3LY9A 5ARFA 4JEHA 3ZEFA 3PDNA 2J4DA 3MZLB 4MLPA 3ZYKA 4BT8A 3G2TA 3URZA 4CEMA 3ASFA 4MKTA 5LFAA 4GYOA 4ILHB 1NA3A 2WXNA 2XQ0A 1UJJA 3QARA 3LY7A 2LAHA 2BUGA 3QJZA 4ANVA 3GYZA 3HDXA 4WWOA 3ZPJA 4JHRA 2GRMA 5LCWC 2NSZA 3MJWA 3Q47B 4YNDA 4IN3B 3JYSA 4PH4B 3BG0B 3MYVA 3G2VA 5BV0A 3ONKA 4WNGA 5C1DA 4NQ0A 4TRQA 2CHZA 2YHEA 2X6KA 1SZAA 3IBEA 4MRUA 5A23A 1HG5A 1ELWA 3PRZA 2WPVA 3ASDA 3PEVB 3EJNA 3BEEA 4APOA 3NZSA 4G1TA 1HO8A 3APFA 3FUEA 4A3VA 4PS3A 2WXIA 2IONA 4I6JA 3FHEA 4OVUA 3EIQC 2AWIA 3HYMB 5JHAA 1VDYA 5FZRA 2KCVA 3L22A 4L1BA 4N2QA 3GW4A 2AXZA 2XCCA 4RVBA 3SFZA 3NF1A 2L6JA 4GZDA 4CGVA 3FP3A 1UJKA 2CHWA 3PNTB 2X6HA 4I6GA 4L2LA 2KZTB 3RO3A 4W9RA 4BWRA 2J49A 4HOSA 5DBKA 3SHFA 1H0AA 2WXFA 4LEUA 3SNXA 3L6AA 3PEUB 4ANWA 3ZW3A 3UPVA 4JA9A 3AU4A 3ZHEB 4O6FA 3QK0A 3MV3B 1TEZA 2P58C 3APDA 3TXNA 4B0ZA 1UW4B 4AOFA 4FP7A 4DK5A 4WNDA 3FULA 3SZ7A 4LRZA 1HZ4A 2KCLA 4GA1A 2L9BA 3HHMA 1WAO1 2QFCA 3L08A 1PAQA 4JVSA 3Q15A 3JQ1A 1A17A 4XKBA 3RK6A 5G04J 5A6CA 5HI7A 4GB9A 5JJ6A 2PQNA 5KCMA 3ZXSA 3CEQA 4FHKA 4EBAG 1EPUA 2IJGX 2VQ2A 4I9CA 4D10C 3L17A 3FH8A 5LP0A 3ZIMA 3P1UA 2KM4A 3VLFA 4NACA 2XPIA 4IRUA 2I2OA 3AS4A 1EF1C 5ENNA 2QY7A 1IHGA 2OVFA 4U0SA 3I4GA 4UQZA 4B89A 4C9BB 3PNLB 4U07A 4XI0A 5ANLA 4XE0A 4ILGA 3BG1B 2JEKA 4EZKA 3QKYA 4CT4A 4JL0A 3MA5A 4J6IA 4F53A 4AP2A 4UWLA 1XNFA 2AXVA 1JWFA 2IF4A 2VGYA 5FT9A 4AY6A 2OV8A 4A1SA 3I4RB 4GZ5A 2RG8A 2J07A 4L23A 1E96B 2V8SE 4C0MA 4BT9A 2X3MA 2L0TB 4BX8A 1B89A 2E2EA 1DNPA 4GYWA 2ILRA 3CK9A 3EHNA 2VTBB 4EQFA 3RU0A 4APFA 2IQCA 5E76A 3G2WA 4GMJA 3OXGA 3L54A 3UUXA 1EDUA 3KEZA 4TV3A 2DIWA 4WWNA 4KVOA 4G23A 4N5CA 2I1JA 1ELKA 2LSUA 3HVEB 3E4BA 3D9MA 3PUKA 3QNKA 1Z3XA 1PC2A 2AW6A 3FEXA 5KJMA 2WQ7A 1IQUA 4HFGA 4UWKA 3RRMB 4OVVA 4CGWA 3RRUA 4KZCA 1HFAA 3SD5A 1L5JA 3KAEA 5LX8A 4N3CA 2NC9A 3ZVVA 2EQXA 5G2NA 3FWVA 1OWPA 3ZYQA 4JA7A 1JWGA 2WXQA 2WXGA 4DJAA 3IV0A 1HH8A 3SBSA 2LO6A 4J8EA 4GYYA 3S7FA 3T5XA 1MHQA 3MCXA 3CR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FQ6 A;  5T3R A;  3JQ1 A;  4F53 A;  3NQP A;  3CGH A;  3OTN A;  3QNK A;  4MRU A;  3JQ0 A;  3SNX A;  4PUC A;  3EHM A;  3CKC A;  3FDH A;  3EJN A;  3CK8 A;  5T4Y A;  5FQ8 A;  4F7A A;  3CKB A;  3P1U A;  4Q69 A;  5LX8 A;  4L7T A;  5FQ7 A;  5E75 A;  5J90 A;  3CK9 A;  3HDX A;  3EHN A;  4LER A;  5FQ4 A;  3L22 A;  5E76 A;  3IV0 A;  3I4G A;  3MX3 A;  3JYS A;  3LEW A;  3KEZ A;  3GZS A;  3SGH A;  3MCX A;  3MYV A;  3CK7 A; 
#chains in the Genus database with same CATH topology
 5FJY A;  4EBA A;  4MS6 A;  1TNU A;  3TJP A;  3NZU A;  3HG0 D;  1OWN A;  1QNF A;  5E75 A;  4HI9 A;  5JMN D;  5KJL A;  2PNN A;  5J08 A;  2WQ6 A;  4AVX A;  3ONL A;  5CHE E;  2XRZ A;  4GAA A;  2YIN A;  4HQD A;  4JC8 A;  4YVQ C;  2XPZ A;  4P29 A;  3AG3 E;  3AG2 E;  4XKC A;  5FQ7 A;  3FTU A;  3MGB A;  2CHX A;  3DEP A;  3TWT A;  4WWP A;  4U04 A;  3FY4 A;  2J08 A;  3RAU A;  3AJI A;  3D9O A;  3PH0 C;  3IKO B;  2CG2 A;  4JHK A;  3JXJ A;  1NP7 A;  1D8E A;  1SQM A;  3Q5M A;  4GU5 A;  4K5C A;  4HI8 A;  2WVI A;  4DLO A;  2ZU6 B;  1N4S A;  2Y4T A;  3BQO A;  4U8V D;  1H19 A;  3LDZ A;  4AY5 A;  3NOG D;  3U3W A;  4RSY A;  3HXE A;  1E8X A;  3CQC B;  4FLH A;  3UTM A;  1S64 A;  3Q73 A;  4URK A;  5KJN A;  5AQ7 A;  2WXO A;  3HVE A;  5G05 J;  3JCK C;  1OWM A;  5ANR A;  3FH7 A;  4EZJ A;  3G2U A;  1AWC B;  2R17 C;  2WMN A;  2R2L A;  3MV2 B;  4G26 A;  4KT6 B;  3ZYM A;  2XEV A;  3Q9N C;  2WB2 A;  5J90 A;  1YA0 A;  2LAI A;  5ENO D;  3PZ2 A;  4ZFH A;  2OOE A;  3FUM A;  2A5E A;  4O1P A;  3D9H A;  2XGM A;  4DLQ A;  3D9P A;  2PZI A;  3NBN B;  3B13 A;  4ACL A;  4AM9 A;  4PS8 A;  2X6I A;  4J8F A;  4U0U A;  5AQB A;  5C2Y A;  2PM7 A;  2XZT G;  2GRN B;  2V4H C;  2J09 A;  3DRA A;  5G55 A;  3CVN A;  1H6K A;  3EHM A;  2VGX A;  5CBN A;  1FVH A;  3EU5 A;  5BPP A;  2R03 A;  2FBN A;  3ZFW A;  3RIB A;  5EX0 A;  4GTQ A;  2DVW A;  3UIN C;  2KZT A;  4DX2 A;  3LEW A;  5AN8 A;  2DCP A;  3S2A A;  1SW6 A;  2YNQ A;  4QQI A;  2GRQ B;  4FAD A;  2MHK A;  2DYS E;  3UT7 A;  2V5F A;  3BU8 A;  4DX1 A;  5FWQ A;  3FUF A;  2ETA A;  2Y1L E;  3B7B A;  4CT0 A;  3E37 A;  2L0I A;  5FTP A;  2KCK A;  3GZ2 A;  4EHM A;  2H6H A;  1E8Y A;  4DI3 A;  5ENT D;  4U8Y D;  3ZUV B;  3FTZ A;  3FTY A;  2WXK A;  1OCC E;  3KSL A;  1A5E A;  1NA0 A;  3R7R A;  2AXU A;  3C5R A;  1TN8 A;  2WQH A;  4GPK A;  4I1O B;  3PE3 A;  3B7S A;  4PS7 A;  4BX9 A;  2XEN A;  3WXX A;  2FI7 A;  2FEZ A;  5FZQ A;  3E30 A;  3LS8 A;  4YDW A;  5HS0 A;  1JPL A;  3SF4 A;  2VJ8 A;  1UG3 A;  5FQ8 A;  2PM6 A;  1KZO A;  4UWF A;  3ISM C;  3UM3 A;  2A5U A;  4GML A;  3AS5 A;  5BT1 A;  3LKU A;  4RG9 A;  1Y8M A;  3VTY A;  3PS6 A;  2Q7F A;  4G24 A;  2IOS A;  1FCH A;  1OCR E;  4JEH A;  3DEO A;  3MZL B;  4CEM A;  2P9U G;  3ASF A;  3V31 A;  2WXN A;  2LAH A;  3QJZ A;  3ABM E;  3TWX A;  4YND A;  3JYS A;  4TXR A;  3G2V A;  2GRR B;  3IBE A;  4PS3 A;  2GRO B;  2LUH A;  3EIQ C;  3FHE A;  1JCS A;  1UOH A;  4L1B A;  4RVB A;  3NF1 A;  4GZD A;  4CGV A;  5AQA A;  3PNT B;  4GMR A;  2DWZ A;  1N0R A;  2KZT B;  3RO3 A;  2LXL A;  2WXF A;  2ETB A;  3UPV A;  3QK0 A;  1TEZ A;  1UW4 B;  2R02 A;  4WND A;  3SZ7 A;  5HI7 A;  3HXD A;  2PQN A;  3ZXS A;  2EIJ E;  2ZGG A;  1EPU A;  2IJG X;  1OT8 A;  4D10 C;  1TNO A;  3L17 A;  2OCC E;  3VLF A;  2XPI A;  4IRU A;  2I2O A;  1EF1 C;  4B89 A;  3PNL B;  4EZK A;  3QKY A;  1O1R A;  2OV8 A;  4A1S A;  4GZ5 A;  3UKU G;  4BT9 A;  3EHN A;  4LNU D;  5E76 A;  3ASO E;  4J7W A;  4TV3 A;  4N5Q A;  4J8Y A;  5FIN A;  5BXO A;  2I1J A;  3HVE B;  3E4B A;  5KJM A;  4HFG A;  3RRU A;  1L5J A;  3KAE A;  5LX8 A;  2EQX A;  4JA7 A;  4DJA A;  1HH8 A;  3E33 A;  3S7F A;  2QYU A;  1U3D A;  1NZN A;  3IHV A;  2OVB A;  2NYJ A;  1IXV A;  4UI9 J;  3NOC D;  3IXE A;  3LVR E;  2BF0 X;  3CK7 A;  1YCS B;  5EDS A;  4H7Y A;  1QQE A;  3CKC A;  4RLY A;  2IOL A;  3G2S A;  1O5M A;  4L9P A;  4H7X A;  3E32 A;  5JHB A;  1ZB1 A;  4B93 B;  1UN9 A;  3ZRH A;  3DBS A;  5AAR A;  3MX3 A;  2B0O E;  4JB8 P;  2XS1 A;  3SBT B;  5CBO A;  4ATG A;  2GW1 A;  4HLL A;  1WY6 A;  3UXG A;  5T4Y A;  2P9S G;  2EIM E;  3TWV A;  4TUU A;  4LER A;  2B6C A;  1KLX A;  3ULE G;  3EIJ A;  3D9I A;  1HE8 A;  3ULY A;  4LNB A;  1U3C A;  4I43 A;  5ENS D;  2EIN E;  4G25 A;  4RQI A;  3FTX A;  5JJT A;  4KMO A;  3W9G A;  5AEN A;  4GA0 A;  3CVY A;  3C72 A;  5G05 C;  4UWH A;  4HLE A;  4M7C A;  3DWL G;  3ZNG A;  1MQS A;  2Y0B G;  4WNF A;  3CQG B;  2X6J A;  5BW8 C;  3SI5 A;  3IHY A;  3F6Q A;  5AQ9 A;  4LCT A;  3LY8 A;  2VSX E;  2EIL E;  5ARG A;  4GCO A;  5CCL A;  3K9I A;  3L16 A;  4JEU A;  1BI7 B;  5D2M C;  4ATZ D;  3S7D A;  2UY1 A;  3U64 A;  3JXI A;  1WM5 A;  5LCW J;  3CSF A;  4HOQ A;  4CRW A;  3CHS A;  3ENE A;  4E6H A;  5T3R A;  5CED B;  1G3N B;  1JUQ A;  3CV0 A;  1OWL A;  3CST A;  5M72 A;  3B7R L;  3S7B A;  4L7T A;  4ANU A;  3I5P A;  4G2V A;  3OXF A;  2LXM A;  4BSX A;  3QAQ A;  4XI9 A;  1K3Z D;  3QWW A;  4JD2 G;  3PVL A;  3T8K A;  3D9N A;  3HIZ A;  3LVQ E;  4MBG A;  1LD8 A;  2HR2 A;  5ENQ D;  4I2W A;  2WXP A;  2XEE A;  3ZYL A;  4Q69 A;  5EID A;  3QOU A;  3R7Q A;  4AIF A;  4JZY A;  3FU3 A;  2H6I A;  3X2Q E;  4N39 A;  3SFX A;  4DX6 D;  1HS6 A;  5BNW A;  3D9K A;  1QZ2 A;  3FTS A;  3CVX A;  3IEG A;  3ZHE A;  2P2C P;  1E8W A;  3KS2 A;  4LG6 A;  4EPZ A;  3FDH A;  4F6R D;  2VYI A;  5KBA A;  1D8D A;  3P2B A;  4CYM D;  4N2S A;  4HRN A;  4K5B A;  4U96 D;  4A1G A;  2V4L A;  1N11 A;  3CHM A;  2GRL A;  1TNY A;  2FO7 A;  4KYO B;  4BTA A;  3TXM A;  4EZL A;  4OAU C;  4ANX A;  1N0Q A;  3PZ4 A;  3GZ1 A;  4Q94 A;  4M3O A;  3EU9 A;  1E8Z A;  4CZ2 D;  1DC2 A;  1E7U A;  3C3Q A;  2OEV A;  3B7U X;  4OAV B;  4DX7 D;  2X38 A;  3TWQ A;  2XPY A;  4ME2 A;  1HF8 A;  3TWR A;  4GCN A;  4FHJ A;  1MYO A;  3D3M A;  3U4T A;  4N3A A;  2FUL A;  3CVP A;  3PE4 A;  4AEZ C;  3QWV A;  3LY9 A;  5ARF A;  3ZYK A;  2J4D A;  3URZ A;  1NA3 A;  3DPY A;  2XZD G;  3HDX A;  4WWO A;  3ZPJ A;  2GRM A;  5LCW C;  2NSZ A;  3Q75 A;  5CRV A;  3MYV A;  5BV0 A;  4WNG A;  4TRQ A;  2CHZ A;  4GTS A;  1HG5 A;  1ELW A;  3PRZ A;  3EJN A;  3NZS A;  3APF A;  3FUE A;  4HRL A;  2QYJ A;  3HYM B;  4GTV A;  4N2Q A;  3J5Q B;  2AXZ A;  2XCC A;  3SFZ A;  4L2L A;  3DST A;  3SNX A;  3W9F A;  3PEU B;  3ZW3 A;  4JA9 A;  3ZHE B;  4O6F A;  3MV3 B;  2P58 C;  4DK5 A;  3J5P A;  4U7E B;  1MX2 A;  1H6O A;  2KCL A;  3L08 A;  3Q15 A;  3JQ1 A;  3RK6 A;  5JJ6 A;  5KCM A;  4EBA G;  4I9C A;  3FH8 A;  2KM4 A;  3AS4 A;  1TN6 A;  5CEA A;  2IY0 C;  1IHG A;  2OVF A;  3T9K A;  4TXP A;  5ANL A;  3MA5 A;  3SFY A;  2XEH A;  1XNF A;  4UWL A;  1NFI E;  2AXV A;  2IF4 A;  2VGY A;  1O1S A;  1Z5S C;  2RG8 A;  1SA4 A;  4C0M A;  1N9A A;  2L0T B;  1B89 A;  4EQF A;  2IQC A;  3G2W A;  3OXG A;  3UI2 A;  2DIW A;  4G8L A;  5D66 A;  3PUK A;  3ZU7 B;  3FEX A;  4UWK A;  5EYP F;  3RRM B;  4OVV A;  3SD5 A;  2NC9 A;  2RKK A;  5G2N A;  4K5A B;  3UM2 A;  3BUA A;  3R9M A;  2LO6 A;  4DRX E;  3MCX A;  1INZ A;  2CG3 A;  3WG7 E;  4UUC A;  4UWG A;  4A55 A;  2XGO A;  3EHR A;  4HS2 A;  3UQ3 A;  5T8I A;  2I1K A;  3LJ3 A;  3V79 K;  3LYA A;  3JUI A;  1IYG A;  2DYR E;  4CDN A;  2P9L G;  4GZ6 A;  1Q2Z A;  1H2T C;  3T8M A;  4A63 B;  2VSY A;  3SO8 A;  4AJW A;  5D0Q D;  3VTX A;  2WMO A;  3DSW A;  2WXL A;  3KEA A;  1LF8 A;  5B3S E;  3OXL A;  2XCB A;  3I3N A;  2AJA A;  5HRY A;  4UI9 C;  3CHO A;  1BD8 A;  3D9J A;  4KVM A;  5ENR D;  3FU6 A;  2J9Q A;  5JJ7 A;  5AIJ A;  5DIZ A;  3FUJ A;  3TG4 A;  3CVV A;  3CKB A;  3RO2 A;  3LXU X;  3QC1 A;  3RKV A;  2V0P A;  5CMW A;  1K8K G;  2JAB A;  3Q7A A;  4HOU A;  2OND A;  4N3B A;  4ZHB A;  5G04 C;  3ML8 A;  4BY6 A;  2VTB A;  3Q4A B;  1WDY A;  3UM0 A;  3N71 A;  2CFU A;  1MX4 A;  3O4Z A;  3UMV A;  4CCA A;  4NRH B;  2J4B A;  4AV7 A;  3CVL A;  3CHP A;  3MKR A;  3OTN A;  2F0Y A;  3TAX A;  3ESL A;  2ZIR A;  1SA5 A;  1XGW A;  4XEI G;  3FEY A;  1DVP A;  3ABK E;  3AAA C;  4F1S A;  1O1T A;  5AJD A;  1N4Q A;  4Z68 A;  2F37 A;  3B7T A;  2KAT A;  4XIF A;  4L2Y A;  2NXP A;  4NUR A;  3S7J A;  4GPM A;  2A4Z A;  3EHQ A;  2UY1 B;  1PY1 A;  3CVQ A;  4K03 A;  4DUI A;  2R59 A;  4WAF A;  4U8H A;  4UQY A;  3DPD A;  5KNG A;  3DXK G;  3FTV A;  2VSO E;  4FC8 A;  5FQ6 A;  2WXM A;  2XGS A;  4G11 A;  1X5B A;  4FJY A;  4FUL A;  2YQ8 A;  1V55 E;  3PZ3 A;  5BV1 A;  4UI9 K;  1YYH A;  3AG4 E;  3NQP A;  1Z6T A;  4GTT A;  1BLX B;  2KC7 A;  4Y6W A;  4UQX A;  4GZ3 A;  3TGO A;  1U2V G;  3C3O A;  1N95 A;  3FUI A;  4YVO A;  4V3I A;  4PDX A;  2X6F A;  5FQ4 A;  2HO1 A;  4U0Z A;  1TN7 A;  4FJZ A;  4JXT A;  2C0M A;  2C0L A;  1IQR A;  3ZN3 A;  5KJK A;  2WXR A;  1KT1 A;  3CLJ A;  4OYS A;  5EYL A;  2HM8 A;  3MEK A;  1P5Q A;  2GGF A;  1TJF A;  1UN8 A;  4O1O A;  3L13 A;  3TG5 A;  4JPS A;  3U66 A;  4J8S A;  1KPS B;  4XX5 A;  4B8A A;  3CVU A;  4QFV A;  5EKQ D;  3QDN A;  4BER A;  2M63 A;  4F1P A;  4IUL A;  3T5V A;  2WM9 A;  4F7A A;  4XZ4 A;  1KT0 A;  3ZGQ A;  3EDT B;  3TWW A;  3V30 A;  4B8C B;  2IFU A;  4AXH A;  2MYO A;  4ACK A;  4EEC A;  3KD7 A;  3TWU A;  1HG2 A;  1K1B A;  3G2T A;  4MKT A;  1MX6 A;  4BES A;  4ILH B;  2DZO A;  1BU9 A;  3LY7 A;  2BUG A;  4ANV A;  3EUV A;  3GYZ A;  4JHR A;  3Q47 B;  1DCQ A;  4IN3 B;  2KBX A;  4PH4 B;  4GTR A;  1TR4 A;  2BKG A;  2IEJ A;  2YHE A;  1SZA A;  2WPV A;  3PEV B;  3BEE A;  1BI8 B;  4A3V A;  2WXI A;  4I6J A;  4X8Q A;  1NI1 A;  1VDY A;  5FZR A;  3Q78 A;  2X6H A;  2BED A;  5BXU A;  4W9R A;  4BWR A;  2J49 A;  4HOS A;  5DBK A;  3SHF A;  4ANW A;  5IY5 E;  2DZN A;  3TXN A;  2P9N G;  2P9P G;  3FUL A;  1HZ4 A;  4GA1 A;  4BSZ B;  1PAQ A;  4U95 D;  5G04 J;  4FHK A;  2VQ2 A;  3V2O A;  4NAC A;  5ENN A;  3E34 A;  4UQZ A;  4C9B B;  5B1A E;  4HRM B;  4NIK A;  4J6I A;  4F53 A;  5FT9 A;  1OCZ E;  3I4R B;  4L23 A;  1E96 B;  4BX8 A;  1DNP A;  3CK9 A;  2VTB B;  4APF A;  4LSZ E;  1OY3 D;  4GMJ A;  3UUX A;  1EDU A;  2IO3 C;  4TUM A;  5KWD A;  4G23 A;  4N5C A;  2LSU A;  3D9M A;  1Z3X A;  1PC2 A;  2AW6 A;  1IQU A;  3L82 A;  4KZC A;  1MZC A;  4N3C A;  3RSE G;  1OWP A;  2QZA A;  1RZ4 A;  3ZYQ A;  3UIP C;  2WXG A;  3IV0 A;  2OEW A;  3T5X A;  1MHQ A;  2F8X K;  2QC9 A;  3CR3 A;  3FH5 A;  1RW2 A;  2MRI A;  3TWS A;  3Q9U C;  3FU5 A;  2XRY A;  4GZC A;  5D0O D;  1FT2 A;  4I1M A;  4CDM A;  5FIO A;  4Q96 A;  3UKR G;  1H6P A;  3DXM G;  5EIL A;  2HYZ A;  1D9S A;  3HXC A;  1BPO A;  1YMP A;  2FF4 A;  3DSV A;  2MOW A;  5FZS A;  1JCQ A;  5CMY A;  4J8D A;  3ASG A;  2VGX B;  4HOT A;  4WUY A;  1E7V A;  1H2U A;  1TJC A;  3SQV A;  2AVP A;  3MKQ B;  2UWJ G;  5EX3 A;  2R5S A;  5EIB E;  1FT1 A;  1TNZ A;  1GW6 A;  3FTW A;  4RG6 A;  4KZ0 A;  1HX8 A;  4TXQ A;  1SZ9 A;  3UX4 A;  4C0E A;  4JHJ A;  2RFA A;  1QYM A;  2Y3A A;  4F3V A;  2PL2 A;  3NAW A;  2I9C A;  3ZXP A;  2YHC A;  1HU3 A;  3CGH A;  4K0R A;  1DCE A;  1Z3Y A;  1N4P A;  2L6B A;  1FVF A;  3FUK A;  4KXK B;  2WXJ A;  4LUN U;  3C98 A;  5AYW D;  5CEC B;  4GTO A;  1KZP A;  2LSV A;  5CRU A;  1S63 A;  2HE0 A;  2BTD A;  3UT4 A;  2V5Q C;  3DSS A;  3U9W A;  4YDY A;  3ESK A;  3ASN E;  3Q49 B;  3VLD A;  1N52 A;  4FU3 A;  4B94 A;  3FUN A;  3CK8 A;  4IYP A;  4I1A A;  2RFM A;  1E90 A;  1N54 A;  5BUZ A;  1S70 B;  3ASH A;  1Y6I A;  3O48 A;  3UT8 A;  4GA2 A;  4ABN A;  1ELR A;  2JLB A;  2CFZ A;  3MKQ A;  4BET A;  3SGH A;  4FA6 A;  3Q7F A;  4FLB A;  3JQ0 A;  4GTM A;  4U63 A;  5HQ8 A;  3V2X A;  3PUJ A;  4E85 A;  3UM1 A;  5CCM A;  1W3B A;  4ILI A;  2PQR A;  4CDR A;  2Y4U A;  5ITZ F;  3D9L A;  1OWO A;  3RJV A;  4DI4 A;  3FUH A;  3Q79 A;  2DBA A;  4PUC A;  1TYQ G;  2H6F A;  3ULQ A;  3CHR A;  3FFL A;  4A3T A;  3UIO C;  4HVB A;  3JUE A;  3PZD A;  1H2V C;  3LPZ A;  4Y6C A;  3R9A B;  3GZS A;  3QWP A;  4BEP A;  1OCO E;  2I6H A;  4HB5 A;  1N4R A;  3SY2 A;  1OUV A;  2IU1 A;  1V54 E;  1LD7 A;  5HKP A;  1ZBP A;  2E0I A;  3ML9 A;  2F8Y A;  3HRA A;  4WNE A;  3HXB A;  4GTP A;  4BTB A;  3CVW A;  3OAW A;  4I2Z A;  4JW1 A;  3NB2 A;  4HXI A;  2C2L A;  3CIA A;  1ZU2 A;  4I6E A;  2ZIS A;  3PRE A;  4DPR A;  3ABL E;  3TL5 A;  1IHB A;  3VLE A;  5KNH D;  2BKK B;  1HXI A;  1TNB A;  5A7D B;  3FUD A;  3AS8 A;  4BFR A;  4HOR A;  4I9E A;  2LNI A;  4I17 A;  4R7L A;  3LCA A;  2VSN A;  1NL4 A;  4C48 B;  4J0U A;  4KBQ A;  3AU5 A;  2RD0 A;  3FU0 A;  2WXH A;  3QB2 A;  5LOZ A;  5AJL A;  1LTX A;  1MJ0 A;  3CHQ A;  3RRN B;  2XHE A;  2IO2 C;  5ENP D;  1S0P A;  1EYH A;  3ZKJ A;  3APC A;  3DSU A;  2P9I G;  3ZEF A;  3PDN A;  4MLP A;  4BT8 A;  4YDE A;  5LFA A;  4GYO A;  3B95 A;  2GRP B;  1IKN D;  2XQ0 A;  1UJJ A;  1SVX A;  3QAR A;  3LJN A;  2R05 A;  2J8S D;  2ETC A;  3MJW A;  3PZ1 A;  3BG0 B;  3ONK A;  5C1D A;  4NQ0 A;  1N94 A;  2X6K A;  2Y69 E;  4MRU A;  5A23 A;  3ASD A;  4APO A;  4G1T A;  1HO8 A;  3HXF A;  2ION A;  2VGE A;  4OVU A;  2AWI A;  5JHA A;  2KCV A;  3L22 A;  1JCR A;  3GW4 A;  4LNG A;  2L6J A;  3FP3 A;  2ZGD A;  1UJK A;  2CHW A;  4I6G A;  5B1B E;  2EIK E;  4HBD A;  1H0A A;  4LEU A;  1FPP A;  3AG1 E;  3L6A A;  2H6G A;  3AU4 A;  2XS8 A;  3APD A;  4B0Z A;  4O60 A;  3KSQ A;  4AOF A;  4FP7 A;  4LRZ A;  2L9B A;  3HHM A;  5CER B;  1WAO 1;  2QFC A;  4JVS A;  4XKB A;  1A17 A;  5AAO A;  5A6C A;  4GB9 A;  2FO1 E;  3CEQ A;  3C3R A;  1AP7 A;  1K1A A;  5LP0 A;  3ZIM A;  3P1U A;  2QY7 A;  4U0S A;  3I4G A;  4U07 A;  4XI0 A;  4XE0 A;  4ILG A;  3BG1 B;  2JEK A;  4YDO A;  2ZXW E;  4CT4 A;  4JL0 A;  3DSX A;  4AP2 A;  1JWF A;  5H7P A;  4AY6 A;  4G8K A;  2J07 A;  2V8S E;  2X3M A;  2E2E A;  4GYW A;  2ILR A;  3RU0 A;  3L54 A;  3KEZ A;  4DX5 D;  4WWN A;  4KVO A;  5JA4 D;  1ELK A;  2P9K G;  1WG0 A;  3QNK A;  2WQ7 A;  4CGW A;  4HNA D;  1HFA A;  3ZVV A;  3FWV A;  1OXJ A;  2KXP C;  3L9T A;  1JWG A;  2WXQ A;  3SBS A;  1X81 A;  1QBQ A;  4J8E A;  4GYY A;  5EN5 D; 
#chains in the Genus database with same CATH homology
 3FH5 A;  1INZ A;  2CG3 A;  5FJY A;  4EBA A;  2MRI A;  4MS6 A;  4UWG A;  3TJP A;  1U3D A;  4A55 A;  3NZU A;  1NZN A;  2XGO A;  4HS2 A;  3UQ3 A;  5T8I A;  2I1K A;  3LJ3 A;  3IHV A;  3FU5 A;  1OWN A;  2XRY A;  4GZC A;  5D0O D;  2OVB A;  3LYA A;  3JUI A;  1IYG A;  1QNF A;  4I1M A;  5E75 A;  4CDN A;  4CDM A;  4Q96 A;  5KJL A;  4UI9 J;  4GZ6 A;  2HYZ A;  1H2T C;  3LVR E;  2BF0 X;  1BPO A;  3T8M A;  2VSY A;  5J08 A;  2FF4 A;  4AJW A;  2WQ6 A;  2MOW A;  5FZS A;  5D0Q D;  3CK7 A;  4AVX A;  3ONL A;  3VTX A;  5CMY A;  2WMO A;  4J8D A;  5CHE E;  2XRZ A;  3ASG A;  2VGX B;  4GAA A;  4H7Y A;  5EDS A;  2YIN A;  4JC8 A;  4WUY A;  4HOT A;  4YVQ C;  2XPZ A;  1QQE A;  1E7V A;  2IOL A;  3CKC A;  1H2U A;  1TJC A;  3G2S A;  4P29 A;  2AVP A;  4H7X A;  3MKQ B;  2WXL A;  4XKC A;  2UWJ G;  5FQ7 A;  5JHB A;  3FTU A;  3MGB A;  5EX3 A;  2R5S A;  1LF8 A;  2CHX A;  2XCB A;  1UN9 A;  3OXL A;  1GW6 A;  3DBS A;  3I3N A;  4WWP A;  3FTW A;  4RG6 A;  3FY4 A;  4U04 A;  2J08 A;  4KZ0 A;  3MX3 A;  1HX8 A;  4UI9 C;  1SZ9 A;  3CHO A;  3UX4 A;  3D9O A;  3PH0 C;  3IKO B;  3SBT B;  2CG2 A;  3D9J A;  4KVM A;  4C0E A;  3FU6 A;  2J9Q A;  4JHK A;  5JJ7 A;  5AIJ A;  1NP7 A;  4JHJ A;  4ATG A;  1SQM A;  5DIZ A;  3FUJ A;  2GW1 A;  3TG4 A;  1WY6 A;  5T4Y A;  3CVV A;  3CKB A;  3Q5M A;  3RO2 A;  3LXU X;  4GU5 A;  4TUU A;  3QC1 A;  2Y3A A;  4LER A;  1KLX A;  3EIJ A;  4F3V A;  3RKV A;  2PL2 A;  2V0P A;  3D9I A;  5CMW A;  2WVI A;  1HE8 A;  4DLO A;  2ZU6 B;  2Y4T A;  2I9C A;  1U3C A;  2YHC A;  1H19 A;  4I43 A;  1HU3 A;  3CGH A;  4K0R A;  3LDZ A;  4AY5 A;  4HOU A;  4G25 A;  2OND A;  4N3B A;  3FTX A;  4RSY A;  5G04 C;  3U3W A;  3ML8 A;  1E8X A;  4BY6 A;  3Q4A B;  4KMO A;  5JJT A;  1Z3Y A;  3CQC B;  2VTB A;  4FLH A;  1FVF A;  3FUK A;  4KXK B;  2WXJ A;  5AEN A;  4LUN U;  4GA0 A;  4URK A;  3C98 A;  5AYW D;  3CVY A;  5KJN A;  3N71 A;  2LSV A;  2CFU A;  3O4Z A;  3UMV A;  5G05 C;  4CCA A;  2WXO A;  4NRH B;  2J4B A;  4UWH A;  3HVE A;  4HLE A;  4AV7 A;  2BTD A;  5G05 J;  1MQS A;  4WNF A;  3JCK C;  1OWM A;  5ANR A;  3U9W A;  3CQG B;  3FH7 A;  2X6J A;  3UT4 A;  3G2U A;  5BW8 C;  4EZJ A;  3SI5 A;  3IHY A;  3ESK A;  2R17 C;  2WMN A;  3CVL A;  3CHP A;  3LY8 A;  3MKR A;  3Q49 B;  4LCT A;  3OTN A;  3MV2 B;  3VLD A;  1N52 A;  4G26 A;  2VSX E;  4KT6 B;  4FU3 A;  5CCL A;  5ARG A;  4GCO A;  3TAX A;  4B94 A;  3ZYM A;  3ESL A;  3FUN A;  3CK8 A;  4IYP A;  3K9I A;  4I1A A;  3L16 A;  1E90 A;  4JEU A;  1N54 A;  2XEV A;  5BUZ A;  3ASH A;  1XGW A;  1Y6I A;  2WB2 A;  3O48 A;  3S7D A;  5J90 A;  1YA0 A;  2LAI A;  2UY1 A;  3UT8 A;  4GA2 A;  3FEY A;  3U64 A;  2OOE A;  1ELR A;  3FUM A;  4ABN A;  1DVP A;  2JLB A;  1WM5 A;  2CFZ A;  3MKQ A;  5LCW J;  3CSF A;  4HOQ A;  4F1S A;  5AJD A;  3SGH A;  4FA6 A;  4CRW A;  2XGM A;  3CHS A;  3ENE A;  4E6H A;  5T3R A;  4DLQ A;  3B7T A;  4FLB A;  2KAT A;  1JUQ A;  3ZRH A;  4XIF A;  3D9P A;  3CV0 A;  1OWL A;  3JQ0 A;  3CST A;  5M72 A;  4L2Y A;  2PZI A;  2NXP A;  4NUR A;  3B13 A;  4U63 A;  2A4Z A;  3S7J A;  5HQ8 A;  2UY1 B;  4ACL A;  4AM9 A;  3B7R L;  1PY1 A;  3CVQ A;  3PUJ A;  3S7B A;  4L7T A;  4E85 A;  4ANU A;  4PS8 A;  3I5P A;  4G2V A;  2R59 A;  4K03 A;  1W3B A;  5CCM A;  3OXF A;  4BSX A;  3QAQ A;  4WAF A;  4U8H A;  2X6I A;  4ILI A;  4J8F A;  2PQR A;  4UQY A;  4U0U A;  5C2Y A;  4XI9 A;  2Y4U A;  3DPD A;  4CDR A;  2PM7 A;  3FTV A;  3D9L A;  3QWW A;  2VSO E;  4FC8 A;  1OWO A;  3PVL A;  2J09 A;  5FQ6 A;  2WXM A;  2XGS A;  3D9N A;  3FUH A;  4G11 A;  3HIZ A;  3RJV A;  4DI4 A;  3LVQ E;  5G55 A;  3CVN A;  1H6K A;  2DBA A;  4PUC A;  3EHM A;  2HR2 A;  2VGX A;  3ULQ A;  1FVH A;  1X5B A;  4I2W A;  5BPP A;  3CHR A;  3FFL A;  2WXP A;  4A3T A;  2FBN A;  3ZFW A;  4HVB A;  3ZYL A;  4Q69 A;  4FJY A;  3RIB A;  4FUL A;  3QOU A;  3R7Q A;  4AIF A;  2YQ8 A;  3FU3 A;  4JZY A;  5EX0 A;  4N39 A;  1HS6 A;  3D9K A;  3PZD A;  5BNW A;  1H2V C;  5BV1 A;  4UI9 K;  2KZT A;  1QZ2 A;  3FTS A;  3LPZ A;  4Y6C A;  3LEW A;  3R9A B;  2DCP A;  3GZS A;  3S2A A;  3QWP A;  2I6H A;  2YNQ A;  3CVX A;  3IEG A;  3ZHE A;  3NQP A;  1Z6T A;  1E8W A;  2KC7 A;  3KS2 A;  4Y6W A;  4EPZ A;  4UQX A;  1OUV A;  4GZ3 A;  2IU1 A;  3FDH A;  2MHK A;  4FAD A;  3TGO A;  3UT7 A;  3FUI A;  2V5F A;  4YVO A;  5FWQ A;  3FUF A;  4V3I A;  2VYI A;  4PDX A;  3P2B A;  4N2S A;  4CT0 A;  1ZBP A;  2E0I A;  2X6F A;  5FQ4 A;  2HO1 A;  3ML9 A;  4U0Z A;  2L0I A;  5FTP A;  2KCK A;  4WNE A;  4FJZ A;  4JXT A;  3GZ2 A;  4A1G A;  1E8Y A;  2C0M A;  4BTB A;  2C0L A;  1IQR A;  2V4L A;  3ZN3 A;  4DI3 A;  5KJK A;  3CVW A;  3OAW A;  4I2Z A;  3CHM A;  4JW1 A;  2GRL A;  2FO7 A;  4KYO B;  4BTA A;  3TXM A;  4EZL A;  2WXR A;  4HXI A;  2C2L A;  3FTZ A;  4ANX A;  3CIA A;  1KT1 A;  3CLJ A;  3FTY A;  1ZU2 A;  4I6E A;  4OYS A;  2WXK A;  3PRE A;  2HM8 A;  3GZ1 A;  3MEK A;  4Q94 A;  4DPR A;  1P5Q A;  1NA0 A;  3R7R A;  3TL5 A;  2AXU A;  2GGF A;  4M3O A;  3VLE A;  2WQH A;  1E8Z A;  4I1O B;  4GPK A;  1HXI A;  3PE3 A;  1TJF A;  3B7S A;  1UN8 A;  4PS7 A;  3L13 A;  1E7U A;  3WXX A;  5A7D B;  2FI7 A;  3TG5 A;  3FUD A;  4BX9 A;  2FEZ A;  4JPS A;  3U66 A;  3B7U X;  4J8S A;  3AS8 A;  4BFR A;  4XX5 A;  4B8A A;  3CVU A;  5FZQ A;  4HOR A;  3LS8 A;  4QFV A;  4I9E A;  5EKQ D;  1JPL A;  2X38 A;  3QDN A;  3SF4 A;  2M63 A;  2VJ8 A;  4IUL A;  1UG3 A;  2LNI A;  4I17 A;  3T5V A;  4R7L A;  5FQ8 A;  2WM9 A;  2PM6 A;  3LCA A;  2VSN A;  4XZ4 A;  2XPY A;  4ME2 A;  4F7A A;  1HF8 A;  1KT0 A;  4J0U A;  4GCN A;  3ZGQ A;  4FHJ A;  4KBQ A;  3EDT B;  4UWF A;  3AU5 A;  2RD0 A;  4B8C B;  2A5U A;  3FU0 A;  2WXH A;  3QB2 A;  5AJL A;  2IFU A;  3D3M A;  5LOZ A;  4GML A;  3AS5 A;  4N3A A;  3U4T A;  3LKU A;  4AXH A;  3CHQ A;  5BT1 A;  4ACK A;  4RG9 A;  1Y8M A;  4EEC A;  3RRN B;  3VTY A;  2XHE A;  1S0P A;  2FUL A;  3CVP A;  3PS6 A;  3PE4 A;  1EYH A;  2Q7F A;  3APC A;  3KD7 A;  4G24 A;  2IOS A;  3QWV A;  4AEZ C;  1FCH A;  1HG2 A;  3LY9 A;  5ARF A;  4JEH A;  3ZEF A;  3PDN A;  2J4D A;  3MZL B;  4MLP A;  3ZYK A;  4BT8 A;  3G2T A;  3URZ A;  4CEM A;  3ASF A;  4MKT A;  5LFA A;  4GYO A;  4ILH B;  1NA3 A;  2WXN A;  2XQ0 A;  1UJJ A;  3QAR A;  3LY7 A;  2LAH A;  2BUG A;  3QJZ A;  4ANV A;  3GYZ A;  3HDX A;  4WWO A;  3ZPJ A;  4JHR A;  2GRM A;  5LCW C;  2NSZ A;  3MJW A;  3Q47 B;  4YND A;  4IN3 B;  3JYS A;  4PH4 B;  3BG0 B;  3MYV A;  3G2V A;  5BV0 A;  3ONK A;  4WNG A;  5C1D A;  4NQ0 A;  4TRQ A;  2CHZ A;  2YHE A;  2X6K A;  1SZA A;  3IBE A;  4MRU A;  5A23 A;  1HG5 A;  1ELW A;  3PRZ A;  2WPV A;  3ASD A;  3PEV B;  3EJN A;  3BEE A;  4APO A;  3NZS A;  4G1T A;  1HO8 A;  3APF A;  3FUE A;  4A3V A;  4PS3 A;  2WXI A;  2ION A;  4I6J A;  3FHE A;  4OVU A;  3EIQ C;  2AWI A;  3HYM B;  5JHA A;  1VDY A;  5FZR A;  2KCV A;  3L22 A;  4L1B A;  4N2Q A;  3GW4 A;  2AXZ A;  2XCC A;  4RVB A;  3SFZ A;  3NF1 A;  2L6J A;  4GZD A;  4CGV A;  3FP3 A;  1UJK A;  2CHW A;  3PNT B;  2X6H A;  4I6G A;  4L2L A;  2KZT B;  3RO3 A;  4W9R A;  4BWR A;  2J49 A;  4HOS A;  5DBK A;  3SHF A;  1H0A A;  2WXF A;  4LEU A;  3SNX A;  3L6A A;  3PEU B;  4ANW A;  3ZW3 A;  3UPV A;  4JA9 A;  3AU4 A;  3ZHE B;  4O6F A;  3QK0 A;  3MV3 B;  1TEZ A;  2P58 C;  3APD A;  3TXN A;  4B0Z A;  1UW4 B;  4AOF A;  4FP7 A;  4DK5 A;  4WND A;  3FUL A;  3SZ7 A;  4LRZ A;  1HZ4 A;  2KCL A;  4GA1 A;  2L9B A;  3HHM A;  1WAO 1;  2QFC A;  3L08 A;  1PAQ A;  4JVS A;  3Q15 A;  3JQ1 A;  1A17 A;  4XKB A;  3RK6 A;  5G04 J;  5A6C A;  5HI7 A;  4GB9 A;  5JJ6 A;  2PQN A;  5KCM A;  3ZXS A;  3CEQ A;  4FHK A;  4EBA G;  1EPU A;  2IJG X;  2VQ2 A;  4I9C A;  4D10 C;  3L17 A;  3FH8 A;  5LP0 A;  3ZIM A;  3P1U A;  2KM4 A;  3VLF A;  4NAC A;  2XPI A;  4IRU A;  2I2O A;  3AS4 A;  1EF1 C;  5ENN A;  2QY7 A;  1IHG A;  2OVF A;  4U0S A;  3I4G A;  4UQZ A;  4B89 A;  4C9B B;  3PNL B;  4U07 A;  4XI0 A;  5ANL A;  4XE0 A;  4ILG A;  3BG1 B;  2JEK A;  4EZK A;  3QKY A;  4CT4 A;  4JL0 A;  3MA5 A;  4J6I A;  4F53 A;  4AP2 A;  4UWL A;  1XNF A;  2AXV A;  1JWF A;  2IF4 A;  2VGY A;  5FT9 A;  4AY6 A;  2OV8 A;  4A1S A;  3I4R B;  4GZ5 A;  2RG8 A;  2J07 A;  4L23 A;  1E96 B;  2V8S E;  4C0M A;  4BT9 A;  2X3M A;  2L0T B;  4BX8 A;  1B89 A;  2E2E A;  1DNP A;  4GYW A;  2ILR A;  3CK9 A;  3EHN A;  2VTB B;  4EQF A;  3RU0 A;  4APF A;  2IQC A;  5E76 A;  3G2W A;  4GMJ A;  3OXG A;  3L54 A;  3UUX A;  1EDU A;  3KEZ A;  4TV3 A;  2DIW A;  4WWN A;  4KVO A;  4G23 A;  4N5C A;  2I1J A;  1ELK A;  2LSU A;  3HVE B;  3E4B A;  3D9M A;  3PUK A;  3QNK A;  1Z3X A;  1PC2 A;  2AW6 A;  3FEX A;  5KJM A;  2WQ7 A;  1IQU A;  4HFG A;  4UWK A;  3RRM B;  4OVV A;  4CGW A;  3RRU A;  4KZC A;  1HFA A;  3SD5 A;  1L5J A;  3KAE A;  5LX8 A;  4N3C A;  2NC9 A;  3ZVV A;  2EQX A;  5G2N A;  3FWV A;  1OWP A;  3ZYQ A;  4JA7 A;  1JWG A;  2WXQ A;  2WXG A;  4DJA A;  3IV0 A;  1HH8 A;  3SBS A;  2LO6 A;  4J8E A;  4GYY A;  3S7F A;  3T5X A;  1MHQ A;  3MCX A;  3CR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...