3CGHA

Crystal structure of a susd homolog (bt_3984) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
507
structure length
507
Chain Sequence
b'PYEAPDLSADGYALGSAMNNLAGCVVSPDVNTAQFTDCLLGGPLGGYFADSNAGFTETISNFNPKDDWSRVFLKSDKIIPTLYSNLTQVKLVSQNTNDPVPYAIAQVIKVAAMHRVTDAFGPIPYSQIGANGEIATPYDSQEVTYNTFFDELNAAIATLNENSNEQLVPTADYIYKGDVKKWIRFANSLKLRLAIRIAYANPVKAQQMAEEAVNPANGGVIESNADNATWNYFETSQNPIYVATRYNQVQTSDHGGVPCLTGGDTHAAADIICYMNGYKDNRREKFFTKSEWAGQDYVGMRRGIVIPELKTTGHKYSGVNIAPTSPLYWMNAAEVAFLRAEGQAVFNFSMGGTAESFYNQGIRLSFEQWGADGVEDYLKDDVNKPTAYTDPAGTNTYQNALSNITIKWNDSADKEEKQERIIVQKWIANWQLGNEAWADFRRTGYPKLIPVKENKSGGVVDSEKGARRMPYPLDEFVSNKANVEYAIANYLHGADNMATDVWWASKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SusD homolog
publication title Structure of BT_3984, a member of the SusD/RagB family of nutrient-binding molecules.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Metal binding protein
total genus 187
structure length 507
sequence length 507
ec nomenclature
pdb deposition date 2008-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12741 SusD-like Susd and RagB outer membrane lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3cghA00
5T4YA 3EHNA 3JQ0A 5LX8A 4Q69A 3EJNA 3JYSA 3LEWA 5T3RA 3SGHA 3KEZA 3L22A 3EHMA 3QNKA 3OTNA 3CKCA 4LERA 5FQ8A 5FQ6A 3CK8A 3CKBA 3CK7A 3GZSA 5E75A 5E76A 5J90A 4F53A 3IV0A 3CGHA 4L7TA 3MCXA 3SNXA 3JQ1A 3MYVA 4PUCA 4F7AA 3P1UA 3HDXA 3CK9A 3FDHA 4MRUA 3NQPA 5FQ7A 3I4GA 5FQ4A 3MX3A
chains in the Genus database with same CATH superfamily
4CEMA 3SD5A 3FUIA 4UWKA 2Y0BG 3RK6A 3UXGA 1S64A 2DZOA 5CBOA 4URKA 3LVQE 2XPZA 1BD8A 1U2VG 4J7WA 3EHQA 4HOUA 2AXUA 3D9MA 3FU6A 2E2EA 1Z6TA 2XS8A 2IJGX 5FZRA 4GTTA 1N4QA 2A5UA 3KSLA 2OOEA 3QB2A 3ULYA 1SA4A 5G04J 3S7JA 1IQRA 4XI9A 1OWPA 3CKCA 1SVXA 4G1TA 2WXNA 2L0IA 3TWQA 3W9GA 4ILGA 2XGOA 3UT7A 1DC2A 4JEUA 2J9QA 2VSYA 3LVRE 2QFCA 3MV2B 3VTYA 2C0LA 3UPVA 3Q78A 1OCCE 3U9WA 2R05A 3MKQA 4YVQC 3TG4A 2F0YA 5DIZA 2P9UG 4CRWA 3ZYQA 4GTQA 2H6IA 4UWLA 3QDNA 3AJIA 1MX6A 3FY4A 5FIOA 5G55A 5AN8A 4BT9A 3DPDA 4GCOA 3AG4E 4GTVA 1RW2A 3Q47B 4HRNA 5D66A 5ENTD 2UY1B 2ZGGA 4UWHA 3ASGA 4UI9J 5FTPA 4WNEA 4DPRA 2J08A 5JHAA 3CVUA 2OCCE 1K3ZD 3SZ7A 5ENRD 3I5PA 4A55A 3D9LA 4HBDA 3L6AA 1GW6A 4GCNA 5JHBA 2L9BA 3NOGD 5D0QD 3OXFA 4X8QA 4QFVA 4UWGA 3C3OA 4PS8A 2IF4A 2I6HA 3CQGB 4GZDA 2XS1A 4RQIA 2FEZA 3BG1B 3CHSA 2DYRE 1S70B 2F37A 5ENOD 1WDYA 2L0TB 3FTYA 4GYOA 5BT1A 4BETA 4G11A 2A4ZA 3EHMA 1Z3XA 2IO3C 4L9PA 4M7CA 4K5AB 2BTDA 4CDMA 4I9EA 5CCMA 5AIJA 4D10C 4N2SA 2LXMA 2VSOE 1D9SA 1XNFA 2J4DA 3KD7A 4I1AA 3SO8A 4ANXA 4DUIA 2GRMA 3GZ1A 3IEGA 3PZ2A 3SFYA 2XQ0A 3F6QA 4YDOA 2ILRA 3DRAA 2XZDG 1TNUA 3S7DA 5CCLA 1PY1A 3CVQA 1KZOA 3ULQA 2DYSE 2OEWA 3L22A 3QOUA 4GZCA 4LERA 5H7PA 5FQ8A 3D9NA 3GZSA 2IOSA 3URZA 1LF8A 2GGFA 3MCXA 3RRNB 4WWPA 5BV0A 4YDWA 5CEAA 4LG6A 4MBGA 3TWWA 4XKBA 4FLBA 3TJPA 3EHRA 4RLYA 2OV8A 1N95A 3B13A 5EN5D 1IHBA 3Q5MA 5CEDB 3CVWA 2VGYA 3W9FA 5ENNA 3V2XA 2R03A 2J07A 4UI9K 3NAWA 1TJCA 2IFUA 3AS5A 3AG3E 3ZYLA 1NL4A 2EIKE 1UG3A 2GRLA 4DX5D 3KEZA 2ZXWE 4C48B 1INZA 2IOLA 3SBTB 2X38A 4XIFA 1PC2A 4CT0A 3DSSA 4I9CA 4XX5A 1LD8A 3TWUA 1PAQA 3DEPA 4A1GA 2KXPC 2RFAA 5T4YA 4G25A 1ZB1A 3KSQA 2WXHA 1QQEA 4IN3B 5FT9A 3L82A 4GMRA 1G3NB 1YMPA 4DRXE 2NC9A 3QWWA 4UQXA 3GW4A 4EQFA 3ZN3A 3V30A 2KC7A 3FTUA 5LX8A 3ISMC 5EYPF 3WG7E 3FH5A 1H6OA 2EINE 3FEYA 4DLOA 3DBSA 3G2TA 3ZHEA 3ZYKA 4CCAA 1FCHA 3Q9NC 1AWCB 2EIME 1YA0A 3UIOC 3SGHA 4L2LA 2GW1A 2WM9A 1SZ9A 4BWRA 3CHRA 1V54E 3CGHA 4FP7A 1N0QA 5EYLA 5D0OD 1MX2A 3FU3A 3LYAA 4B8AA 4AM9A 5B3SE 5AYWD 3NZSA 3SFXA 2PQNA 3QAQA 2X6JA 1DVPA 2J09A 4C9BB 2OVBA 1BLXB 2DZNA 3BG0B 3MEKA 4GAAA 3ULEG 4Q69A 2P9NG 3NZUA 4L23A 4B89A 2WXRA 2YNQA 2DBAA 3I3NA 4ATGA 1HS6A 3PDNA 4FADA 2DVWA 4O60A 1RZ4A 2YHCA 4G8LA 2WXQA 3C98A 3ONLA 5JJ6A 5ENQD 3EIJA 2KATA 3Q7FA 2VSNA 4CGWA 3JXJA 3PEVB 2VTBA 4HB5A 5G04C 3RAUA 4HS2A 5CMYA 2XCCA 4HLEA 3G2SA 4N5CA 3C5RA 4JXTA 2IONA 3VLEA 3CV0A 3E34A 4ACLA 1EF1C 3D9KA 4JC8A 3PNLB 1N4PA 4ILIA 3CK8A 4RVBA 4YDYA 4YVOA 2B6CA 4GYYA 1TJFA 3CVLA 2P9LG 4IRUA 2AW6A 5ARGA 3QC1A 4PUCA 1OCRE 4F1SA 4NRHB 5AQBA 3CVXA 3CVVA 3VTXA 3R9MA 4EZKA 2R2LA 4GU5A 5AQ9A 4XZ4A 4N3BA 4FA6A 3ABKE 1IQUA 4U96D 1IHGA 2E0IA 3MJWA 3SBSA 4EBAA 1ELKA 1HF8A 4BEPA 4HI9A 2XEHA 3DWLG 4UI9C 4GTPA 3BQOA 1O1TA 1NZNA 2LUHA 3SF4A 3ZW3A 5EDSA 3T5XA 5KJKA 4YNDA 3B7SA 4BT8A 3J5QB 5KJNA 3FU0A 4U8YD 2CHXA 2LNIA 1MZCA 4R7LA 2UY1A 3ASNE 3Q7AA 5G05J 2XPIA 2OEVA 3LS8A 1IYGA 4BERA 5KNHD 4DX6D 1K1BA 1ELWA 4IULA 4YDEA 2X6HA 2J4BA 1E8WA 4A63B 3HXFA 3DEOA 5D2MC 2IY0C 4JA9A 4GZ5A 3Q9UC 3PE4A 4I6JA 4J8YA 3HVEB 3QKYA 2JABA 4I2ZA 2Y69E 4DX2A 3E32A 3T9KA 4OYSA 1N94A 2PQRA 4ZFHA 1HG2A 3RJVA 2I1JA 4AXHA 2CHWA 4LNGA 1HX8A 3I4RB 4Y6CA 3WXXA 2HYZA 4WAFA 4BSZB 2KM4A 3CVPA 3NF1A 3UT4A 2OVFA 4EZJA 3V2OA 3KS2A 2GRNB 3T5VA 4KXKB 1OCZE 1E8XA 3IHYA 5A7DB 3R9AB 3UM1A 3DSWA 3SQVA 1JPLA 4F1PA 1TN6A 3TGOA 2V0PA 3KAEA 2FBNA 5KJLA 4GPMA 4H7YA 3MV3B 3QARA 2LXLA 3PZDA 3CIAA 1KT0A 5KBAA 1MX4A 1LTXA 4B93B 2BKGA 4F53A 1UN9A 5LOZA 3B7RL 1E8YA 5FINA 2V8SE 3ZIMA 1NA3A 2VQ2A 1S0PA 2WVIA 4OVVA 1E7UA 3ZVVA 4RG9A 2ONDA 3PZ4A 4GTRA 3MYVA 4CT4A 5T8IA 1KZPA 5AARA 1O5MA 3VLDA 5KCMA 1FVHA 3FULA 1TNYA 1EYHA 4U04A 4GA1A 4B8CB 3L08A 3FH8A 1HFAA 3FUMA 5ANLA 3FUFA 3L13A 2ETBA 1WM5A 1NI1A 2LO6A 2YHEA 2GROB 4KBQA 2X3MA 3EUVA 5FQ7A 1JUQA 3APFA 4LRZA 4ANUA 4KMOA 1H2VC 1BI8B 3UM3A 2NXPA 2EIJE 2I1KA 3DSVA 2GRQB 3SNXA 3UKRG 5EX0A 5J08A 3JCKC 5AENA 1HH8A 3UI2A 4WNGA 1EPUA 4DI3A 2KCKA 1AP7A 2WXFA 3G2UA 2H6FA 2WPVA 1QYMA 3DSTA 3UUXA 1N52A 4I6GA 2R02A 5HRYA 3O4ZA 3LJNA 2H6GA 4U95D 2ZU6B 3EU5A 4C0EA 2ZIRA 4AOFA 2AJAA 3IHVA 3TXMA 2EILE 3FTVA 4BX9A 1OT8A 4BFRA 4TUMA 4DK5A 3ZU7B 4OAVB 4FHJA 2X6KA 2MYOA 4AP2A 4WNDA 1TR4A 5AQ7A 2WXMA 5IY5E 2L6BA 5LCWJ 2I2OA 4AV7A 3MA5A 2HE0A 4AJWA 4BY6A 3MZLB 4DJAA 3ZKJA 3EHNA 4V3IA 4AY5A 5B1BE 3TG5A 5BV1A 3UT8A 3SI5A 4K03A 4TXQA 1TNBA 3S7BA 3IV0A 4DI4A 1K1AA 1EDUA 1VDYA 2V4LA 5KNGA 2XRZA 3OAWA 3HG0D 3ML9A 3EJNA 2DCPA 5HI7A 4I1OB 2RFMA 4KVOA 1A17A 4LNUD 4MS6A 3L54A 3AG2E 4PDXA 5DBKA 4WUYA 4K5CA 3LKUA 4U07A 3FEXA 1OUVA 2Y3AA 4PH4B 2LAIA 1A5EA 3U4TA 1MHQA 3HRAA 4JPSA 4MKTA 1P5QA 3LY9A 1K8KG 3ZEFA 3TWSA 3RSEG 4KVMA 2X6FA 4JL0A 1HXIA 2PZIA 3ZGQA 3LJ3A 1IXVA 4OVUA 1N4RA 2GRPB 3Q4AB 3V31A 1OY3D 4ILHB 4CGVA 2XRYA 1FT2A 2HO1A 1O1RA 1TYQG 3C72A 4GB9A 2AWIA 3HDXA 3FTXA 2WXGA 1MQSA 3QK0A 3AAAC 4UQYA 4HFGA 1BU9A 2BF0X 4BTAA 1YYHA 4JHJA 5T3RA 3LCAA 3FU5A 4NACA 4BESA 1UOHA 3DSXA 1Z5SC 1HU3A 2VGEA 3CHMA 4AY6A 4UQZA 5G05C 4UUCA 2ZISA 4I2WA 3D9JA 2XGMA 3V79K 3TWTA 4U63A 1HZ4A 3JUIA 2WXKA 2YQ8A 2QYUA 3L16A 4PS3A 2WXLA 4MLPA 4FU3A 5LP0A 5BPPA 3PZ1A 2J8SD 2AXZA 1D8EA 3TWVA 5E75A 4APOA 5HS0A 3P2BA 1H6PA 3HVEA 5ENSD 3FH7A 4KT6B 3Q49B 2BKKB 4J8FA 3ESKA 2MRIA 3ABLE 4HOSA 2P9SG 4HLLA 4AVXA 3ZNGA 5JJ7A 2DWZA 5JJTA 3B7UX 5JMND 4XE0A 1H2UA 4FC8A 3R7QA 1H6KA 4APFA 2MOWA 3FUJA 4EBAG 5CECB 5EKQD 5ARFA 1JCSA 4HQDA 3JXIA 1N54A 1WAO1 1KLXA 3EIQC 4HI8A 3CK7A 3S7FA 2YINA 4DX1A 2I9CA 2Y4UA 4J8SA 3APCA 2VJ8A 1OXJA 2HR2A 5ANRA 2WQHA 1QZ2A 2L6JA 4GMJA 1FVFA 4N3CA 2CFUA 4GMLA 1N0RA 5CRUA 3T8KA 2WQ6A 2WB2A 3Q75A 4J8DA 3UMVA 2C0MA 3UTMA 1BI7B 3BUAA 4GZ6A 2NSZA 2PM7A 1L5JA 2P2CP 4O1PA 5A23A 1ZBPA 1SQMA 3CK9A 3ASOE 3E4BA 4FJZA 3FTSA 1TN7A 2FO7A 1X5BA 2VGXB 3OTNA 3CSFA 4HOTA 3PS6A 2AXVA 2FULA 1Y8MA 3D9OA 1BPOA 3RRUA 3CHPA 3D9IA 1WG0A 1OWNA 4XEIG 2P9PG 1FPPA 2JEKA 3T8MA 1W3BA 2P9KG 3FFLA 4EECA 2FF4A 3U64A 2IEJA 2LSUA 2QZAA 2LSVA 3N71A 5JA4D 3AS4A 3PREA 3P1UA 2VTBB 4BSXA 3PUJA 2Y1LE 3U3WA 4O6FA 4LNBA 2MHKA 2RKKA 2B0OE 4U8VD 2DIWA 3LXUX 3UINC 2XEEA 2IQCA 1JWFA 3LY7A 4CDNA 4WWNA 3FDHA 3AU5A 3I4GA 3PZ3A 2Y4TA 1UJKA 1JCQA 1MJ0A 1D8DA 3RRMB 2BUGA 3S2AA 2RG8A 3ZXPA 1H2TC 4ANVA 5BNWA 1JWGA 5HKPA 4MRUA 4GTSA 5LCWC 3C3RA 4N2QA 4AEZC 3AG1E 5B1AE 2KZTB 4XKCA 3CR3A 3L9TA 3IXEA 4Z68A 1TEZA 1Z3YA 2IO2C 2WMNA 5C2YA 5E76A 4CDRA 5ITZF 4K5BA 3SHFA 1U3DA 5CHEE 4GTOA 1U3CA 3JQ0A 5BXOA 4P29A 2X6IA 3LPZA 4G23A 4XI0A 3ZUVB 4B94A 2PL2A 5G2NA 5EILA 4N5QA 3BEEA 4G26A 1N9AA 4FHKA 3UKUG 3QWPA 4Y6WA 1N4SA 1MYOA 1HO8A 4PS7A 4C0MA 3ZPJA 1H0AA 2XENA 4TRQA 4U0SA 1HE8A 3CEQA 2PNNA 4DX7D 3QWVA 3NOCD 4E85A 3EDTB 1LD7A 3FUHA 3CHOA 2XGSA 2M63A 1O1SA 3ONKA 3RO2A 3ZYMA 2UWJG 2H6HA 4Q96A 4LUNU 5BXUA 4JHKA 1WY6A 1V55E 3LEWA 1OWOA 3OXGA 3ASHA 3R7RA 4WWOA 4TXRA 4GTMA 3ML8A 1E7VA 3C3QA 4N3AA 1SZAA 3JQ1A 1ELRA 2VYIA 4HXIA 3DSUA 3DPYA 1DCEA 4J8EA 3PRZA 2VSXE 3TAXA 3NB2A 3RIBA 3TWXA 3HXCA 3MGBA 4I6EA 4EHMA 2XZTG 5HQ8A 5J90A 4L1BA 4HVBA 4I17A 5FZSA 4I1MA 3JUEA 2NYJA 3QNKA 3MKQB 4N39A 1UN8A 4U0ZA 3NBNB 4JB8P 3EU9A 5FZQA 3NQPA 3PNTB 3MX3A 4KZ0A 2FI7A 3D9HA 4B0ZA 1B89A 4BTBA 5AQAA 1Y6IA 3E37A 3HXDA 2V5QC 3PUKA 4L7TA 5LFAA 1E96B 1S63A 4J6IA 3UM2A 4AIFA 3B7BA 3MKRA 2HM8A 4G2VA 3AS8A 4HRLA 3TXNA 3GZ2A 5KWDA 1OWMA 2QC9A 4JVSA 4U0UA 4EZLA 4O1OA 1UW4B 3CVYA 3RO3A 4HNAD 5FJYA 3Q73A 2AVPA 3DXKG 2WXJA 1HG5A 3HIZA 2P9IG 1QNFA 5BW8C 1NFIE 2CFZA 2F8XK 3LY8A 3ASDA 3ASFA 2WXOA 4M3OA 2F8YA 5CMWA 4IYPA 3FUNA 2GRRB 3DXMG 1OWLA 4KYOB 4LCTA 4U8HA 4EPZA 3IKOB 3ABME 3B95A 5M72A 3CSTA 5KJMA 3HXBA 2R5SA 3J5PA 3APDA 4G24A 2BEDA 1JCRA 2ZGDA 1XGWA 1TN8A 4L2YA 4JHRA 1TNZA 3CHQA 3CKBA 2JLBA 1IKND 3O48A 4A1SA 2A5EA 4FULA 3PVLA 4ACKA 4JD2G 3KEAA 1SW6A 4A3VA 3GYZA 4K0RA 1H19A 1DNPA 1KPSB 3FWVA 4TXPA 4OAUC 5AJDA 2KCLA 4J0UA 3FUEA 2ETAA 3HXEA 4RSYA 2WXPA 3U66A 3HYMB 3SY2A 4JEHA 5EIDA 4CYMD 4GZ3A 5FQ6A 3ZXSA 1X81A 1KT1A 3ENEA 1YCSB 2VGXA 5AJLA 2CHZA 3Q15A 3D3MA 4I43A 1NA0A 4UWFA 4ABNA 3UQ3A 2EQXA 2Q7FA 2RD0A 3D9PA 2QYJA 2QY7A 1SA5A 4ATZD 4FLHA 2C2LA 3PE3A 2V5FA 3ZRHA 3UM0A 3FP3A 4U7EB 3FUDA 4GPKA 1Q2ZA 3G2VA 4QQIA 2XPYA 2CG3A 4DLQA 4JA7A 3K9IA 4LEUA 3CVNA 3FTZA 4WNFA 3UIPC 1DCQA 2PM6A 4NIKA 3FUKA 1FT1A 3RU0A 3TL5A 2V4HC 4F7AA 2WMOA 1E90A 1E8ZA 2WQ7A 2R17C 4G8KA 4HOQA 3CQCB 4GA0A 4Q94A 2IU1A 5A6CA 2XCBA 3FTWA 3ZHEB 3AU4A 4ZHBA 3PH0C 4F6RD 2J49A 4FJYA 3ZFWA 3IBEA 1UJJA 4GA2A 4CZ2D 3L17A 3LDZA 5CERB 4ME2A 5EX3A 3UX4A 1ZU2A 2KZTA 5ENPD 1QBQA 4W9RA 4A3TA 4HORA 5AAOA 2KCVA 3X2QE 3Q79A 4NQ0A 1NP7A 4JW1A 3E30A 4JZYA 1N11A 4HRMB 2LAHA 3SFZA 4GYWA 4KZCA 4BX8A 2KBXA 3G2WA 2XHEA 1TNOA 3PEUB 3BU8A 2WXIA 2ETCA 4ANWA 4F3VA 5FWQA 3VLFA 4E6HA 3HHMA 3QJZA 4TV3A 1OCOE 2R59A 2P58C 3JYSA 4H7XA 4RG6A 2CG2A 3E33A 3RKVA 3CLJA 3OXLA 5BUZA 4TUUA 5EIBE 2FO1E 3TWRA 5CBNA 2XEVA 5CRVA 3B7TA 5C1DA 3FHEA 4LSZE 5FQ4A 3ESLA 4NURA
chains in the Genus database with same CATH topology
2KATA 3LKUA 4JHKA 1WY6A 2VSNA 3FEXA 4U07A 1OUVA 3LEWA 1OWOA 3PEVB 4CEMA 2Y3AA 3OXGA 3SD5A 3FUIA 3ASHA 4UWKA 3RK6A 4PH4B 2VTBA 3R7RA 4URKA 5G04C 3LVQE 2XPZA 4HS2A 4WWOA 2LAIA 5CMYA 2XCCA 3ML8A 3U4TA 1E7VA 4HLEA 3G2SA 1MHQA 4HOUA 4JPSA 4N5CA 4MKTA 1P5QA 2AXUA 3D9MA 4JXTA 3FU6A 4N3AA 2IONA 2E2EA 1SZAA 3JQ1A 3VLEA 1Z6TA 1ELRA 2IJGX 5FZRA 3CV0A 2VYIA 4HXIA 2A5UA 4ACLA 1EF1C 2OOEA 3D9KA 3LY9A 4JC8A 3PNLB 4J8EA 3QB2A 2VSXE 3PRZA 3TAXA 5G04J 3S7JA 4ILIA 1IQRA 4XI9A 3RIBA 3ZEFA 3MGBA 4I6EA 1OWPA 3CKCA 4G1TA 2WXNA 2L0IA 3CK8A 4KVMA 2X6FA 4JL0A 1HXIA 4RVBA 4YVOA 5HQ8A 5J90A 4GYYA 1TJFA 2PZIA 4ILGA 3CVLA 3ZGQA 2XGOA 4L1BA 4IRUA 2AW6A 5ARGA 3QC1A 4PUCA 3ESLA 3UT7A 4HVBA 4F1SA 4NRHB 4I17A 3LJ3A 4JEUA 5FZSA 3CVXA 3CVVA 4I1MA 2J9QA 2VSYA 3LVRE 4OVUA 2QFCA 3MV2B 3VTXA 3VTYA 4EZKA 2C0LA 3UPVA 3QNKA 3Q4AB 3MKQB 4GU5A 4ILHB 4CGVA 2XRYA 4N39A 1UN8A 4U0ZA 2HO1A 3U9WA 4XZ4A 4N3BA 4FA6A 3MKQA 4YVQC 3TG4A 5DIZA 1IQUA 4GB9A 4CRWA 1IHGA 2AWIA 3HDXA 2E0IA 3MJWA 3FTXA 5FZQA 3ZYQA 2WXGA 3NQPA 1MQSA 3PNTB 3QK0A 3MX3A 4KZ0A 3SBSA 4EBAA 4UQYA 2FI7A 1ELKA 4UWLA 3QDNA 4HFGA 2BF0X 4BTAA 3FY4A 4JHJA 4CGWA 4B0ZA 5T3RA 3LCAA 1HF8A 3FU5A 5G55A 1B89A 4NACA 4BTBA 4UI9C 4BT9A 1Y6IA 3DPDA 4GCOA 3PUKA 1HU3A 3CHMA 4AY6A 4L7TA 5LFAA 1E96B 1NZNA 4J6IA 3Q47B 3SF4A 3ZW3A 4UQZA 5G05C 4AIFA 5EDSA 4I2WA 3MKRA 3D9JA 2XGMA 3T5XA 5KJKA 4YNDA 3B7SA 2HM8A 4G2VA 4BT8A 2UY1B 4UWHA 3ASGA 3AS8A 5KJNA 3FU0A 3TXNA 2CHXA 3GZ2A 2LNIA 4UI9J 5FTPA 4WNEA 4U63A 4R7LA 2UY1A 1HZ4A 1OWMA 4DPRA 3JUIA 2WXKA 2J08A 2YQ8A 5G05J 5JHAA 3CVUA 4JVSA 3L16A 4U0UA 2XPIA 4EZLA 3LS8A 4PS3A 1IYGA 3SZ7A 1UW4B 1ELWA 2WXLA 4IULA 3CVYA 3I5PA 4A55A 4MLPA 2X6HA 2J4BA 3D9LA 3RO3A 4FU3A 1E8WA 3L6AA 1GW6A 4GCNA 4JA9A 4GZ5A 5JHBA 5FJYA 5LP0A 5BPPA 2L9BA 5D0QD 2AVPA 3OXFA 4QFVA 4UWGA 2AXZA 2WXJA 4PS8A 1HG5A 3HIZA 2IF4A 2I6HA 3PE4A 1QNFA 4I6JA 3CQGB 4GZDA 5BW8C 2CFZA 3HVEB 5E75A 3QKYA 2FEZA 4I2ZA 3LY8A 3ASDA 3BG1B 3CHSA 4APOA 3ASFA 3P2BA 3HVEA 2WXOA 4M3OA 3FH7A 4KT6B 5CMWA 3Q49B 4IYPA 2L0TB 3FTYA 4GYOA 5BT1A 4J8FA 3ESKA 4OYSA 3FUNA 4G11A 2MRIA 4HOSA 2PQRA 4AVXA 2A4ZA 3EHMA 1OWLA 4KYOB 4LCTA 4U8HA 5JJ7A 1Z3XA 4EPZA 3IKOB 5JJTA 1HG2A 2BTDA 3RJVA 2I1JA 3B7UX 4CDMA 4AXHA 4I9EA 5CCMA 4XE0A 1H2UA 5AIJA 2CHWA 4FC8A 4D10C 3R7QA 5M72A 3CSTA 1HX8A 3I4RB 5KJMA 1H6KA 4Y6CA 4APFA 4N2SA 2MOWA 3FUJA 2VSOE 3WXXA 4EBAG 2HYZA 5EKQD 5ARFA 4WAFA 1XNFA 2J4DA 2R5SA 3APDA 4G24A 3KD7A 1N54A 1WAO1 1KLXA 1XGWA 2KM4A 3EIQC 4I1AA 4L2YA 3CVPA 4JHRA 3NF1A 3UT4A 4ANXA 2OVFA 3CHQA 3CK7A 3CKBA 3S7FA 2JLBA 2YINA 4EZJA 3KS2A 2GRMA 3GZ1A 3IEGA 3O48A 4A1SA 3T5VA 4KXKB 4FULA 1E8XA 2I9CA 2Y4UA 3PVLA 4ACKA 3IHYA 2XQ0A 4J8SA 5A7DB 3R9AB 3APCA 1JPLA 2VJ8A 3S7DA 4A3VA 2HR2A 5ANRA 2WQHA 1PY1A 3CVQA 2L6JA 1QZ2A 5CCLA 4GMJA 3ULQA 3TGOA 2V0PA 3KAEA 1FVFA 3GYZA 4N3CA 2FBNA 4K0RA 2CFUA 3L22A 3QOUA 5KJLA 4GMLA 4GZCA 4LERA 5FQ8A 2WQ6A 1H19A 3D9NA 2WB2A 3GZSA 4H7YA 1DNPA 4J8DA 3UMVA 2C0MA 2IOSA 3FWVA 3MV3B 3URZA 3QARA 1LF8A 4GZ6A 5AJDA 2GGFA 3PZDA 3CIAA 2NSZA 3MCXA 2PM7A 2KCLA 4WWPA 1L5JA 3RRNB 5BV0A 1KT0A 3FUEA 4J0UA 4RSYA 1ZBPA 1SQMA 3CK9A 4FJZA 3E4BA 5A23A 4F53A 1UN9A 2WXPA 5LOZA 3FTSA 4XKBA 4FLBA 3TJPA 3U66A 3B7RL 1E8YA 3HYMB 2OV8A 4JEHA 2FO7A 1X5BA 2VGXB 3OTNA 2V8SE 3CSFA 4GZ3A 3B13A 5FQ6A 1NA3A 2VQ2A 1S0PA 3ZIMA 2WVIA 4Q96A 3ZXSA 4HOTA 3PS6A 2AXVA 4OVVA 1E7UA 3Q5MA 3ZVVA 2FULA 1KT1A 3ENEA 3CVWA 4RG9A 2VGXA 2VGYA 1Y8MA 3D9OA 5AJLA 1BPOA 5ENNA 2CHZA 3Q15A 2ONDA 3D3MA 4I43A 3MYVA 1NA0A 3RRUA 4CT4A 5T8IA 2J07A 4UWFA 4UI9K 3CHPA 3D9IA 4ABNA 1TJCA 2IFUA 3UQ3A 3AS5A 3VLDA 2EQXA 2Q7FA 1OWNA 2RD0A 5KCMA 3D9PA 3ZYLA 1UG3A 2GRLA 1FVHA 2QY7A 2JEKA 3FULA 3KEZA 1EYHA 3T8MA 4U04A 4GA1A 4B8CB 1W3BA 1INZA 2IOLA 3FFLA 4FLHA 3SBTB 2X38A 4XIFA 2C2LA 3L08A 3FH8A 4EECA 1PC2A 1HFAA 3FUMA 4CT0A 3PE3A 2FF4A 3U64A 2V5FA 4I9CA 4XX5A 5ANLA 3FUFA 3L13A 1WM5A 2LSUA 1PAQA 3ZRHA 2LO6A 2LSVA 3FP3A 3N71A 2YHEA 3AS4A 3FUDA 4KBQA 3PREA 3P1UA 2X3MA 4A1GA 5FQ7A 4BSXA 2VTBB 4GPKA 3PUJA 1JUQA 3U3WA 3G2VA 4O6FA 2XPYA 5T4YA 3APFA 4G25A 4LRZA 2CG3A 2WXHA 4DLQA 1QQEA 4ANUA 4KMOA 1H2VC 4JA7A 3K9IA 4LEUA 4IN3B 3CVNA 2NXPA 3FTZA 4WNFA 5FT9A 2MHKA 2I1KA 2DIWA 3LXUX 2PM6A 3FUKA 2NC9A 3SNXA 2IQCA 3QWWA 5EX0A 4UQXA 3GW4A 3RU0A 3TL5A 3ZN3A 1JWFA 3LY7A 4EQFA 4CDNA 4F7AA 5J08A 2WMOA 1E90A 3JCKC 4WWNA 3FDHA 1E8ZA 3AU5A 3I4GA 2WQ7A 2R17C 2KC7A 5AENA 2Y4TA 3FTUA 1HH8A 4WNGA 5LX8A 1UJKA 1EPUA 4DI3A 2KCKA 4HOQA 3CQCB 2WXFA 4GA0A 3G2UA 3FH5A 4Q94A 2IU1A 5A6CA 2XCBA 3FTWA 3ZHEB 3AU4A 2BUGA 3RRMB 2WPVA 3PH0C 3S2AA 2RG8A 3FEYA 4DLOA 3UUXA 1N52A 4I6GA 2J49A 1H2TC 4ANVA 3DBSA 5BNWA 3G2TA 1JWGA 3ZHEA 3O4ZA 4FJYA 3ZFWA 3IBEA 3ZYKA 4NURA 4CCAA 1UJJA 4MRUA 1FCHA 2ZU6B 4C0EA 5LCWC 4N2QA 4AOFA 1YA0A 4AEZC 2KZTB 3IHVA 3TXMA 4XKCA 4GA2A 3SGHA 3CR3A 3L17A 4L2LA 3LDZA 3FTVA 4BX9A 1TEZA 1Z3YA 4ME2A 4BFRA 2GW1A 2WM9A 1SZ9A 4BWRA 5EX3A 2WMNA 3UX4A 4DK5A 4FHJA 1ZU2A 5C2YA 2X6KA 2KZTA 5E76A 4AP2A 4CDRA 4WNDA 3CHRA 4W9RA 3CGHA 2WXMA 4FP7A 4A3TA 3SHFA 5LCWJ 1U3DA 5D0OD 2I2OA 4AV7A 3FU3A 3MA5A 4HORA 3LYAA 2KCVA 4B8AA 4NQ0A 1NP7A 5CHEE 4AJWA 3MZLB 4BY6A 4DJAA 4JW1A 1U3CA 3EHNA 4JZYA 3JQ0A 4V3IA 4AM9A 4P29A 4AY5A 3SFZA 2LAHA 2X6IA 3LPZA 4G23A 3TG5A 4XI0A 5BV1A 4B94A 4GYWA 5AYWD 3UT8A 3NZSA 4KZCA 2PQNA 4K03A 3SI5A 2PL2A 4BX8A 3QAQA 5G2NA 2X6JA 1DVPA 2J09A 3G2WA 3S7BA 3BEEA 4G26A 2XHEA 3PEUB 3IV0A 4C9BB 2WXIA 4FHKA 3QWPA 4ANWA 4DI4A 4Y6WA 4F3VA 1EDUA 1HO8A 2OVBA 5FWQA 1VDYA 2V4LA 3VLFA 4PS7A 4C0MA 3BG0B 3MEKA 4E6HA 2XRZA 4GAAA 3HHMA 3OAWA 3QJZA 4TV3A 3ZPJA 4Q69A 1H0AA 3ML9A 2R59A 2P58C 3EJNA 2DCPA 3JYSA 4H7XA 4TRQA 4RG6A 4U0SA 3NZUA 5HI7A 4L23A 4B89A 1HE8A 2CG2A 2WXRA 3CEQA 4I1OB 2YNQA 3CLJA 3RKVA 2DBAA 3I3NA 4ATGA 3OXLA 1HS6A 3PDNA 1A17A 4KVOA 3QWVA 4FADA 4E85A 5BUZA 3EDTB 4TUUA 2YHCA 3FUHA 3CHOA 2XGSA 4MS6A 2XEVA 3L54A 3B7TA 2M63A 4PDXA 5DBKA 5C1DA 2WXQA 4WUYA 3ONKA 3FHEA 3RO2A 3C98A 3ONLA 5JJ6A 3ZYMA 2UWJG 5FQ4A 2ILRA 3EIJA 4LUNU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5T4Y A;  3EHN A;  3JQ0 A;  5LX8 A;  4Q69 A;  3EJN A;  3JYS A;  3LEW A;  5T3R A;  3SGH A;  3KEZ A;  3L22 A;  3EHM A;  3QNK A;  3OTN A;  3CKC A;  4LER A;  5FQ8 A;  5FQ6 A;  3CK8 A;  3CKB A;  3CK7 A;  3GZS A;  5E75 A;  5E76 A;  5J90 A;  4F53 A;  3IV0 A;  3CGH A;  4L7T A;  3MCX A;  3SNX A;  3JQ1 A;  3MYV A;  4PUC A;  4F7A A;  3P1U A;  3HDX A;  3CK9 A;  3FDH A;  4MRU A;  3NQP A;  5FQ7 A;  3I4G A;  5FQ4 A;  3MX3 A; 
#chains in the Genus database with same CATH topology
 4CEM A;  3SD5 A;  3FUI A;  4UWK A;  2Y0B G;  3RK6 A;  3UXG A;  1S64 A;  2DZO A;  5CBO A;  4URK A;  3LVQ E;  2XPZ A;  1BD8 A;  1U2V G;  4J7W A;  3EHQ A;  4HOU A;  2AXU A;  3D9M A;  3FU6 A;  2E2E A;  1Z6T A;  2XS8 A;  2IJG X;  5FZR A;  4GTT A;  1N4Q A;  2A5U A;  3KSL A;  2OOE A;  3QB2 A;  3ULY A;  1SA4 A;  5G04 J;  3S7J A;  1IQR A;  4XI9 A;  1OWP A;  3CKC A;  1SVX A;  4G1T A;  2WXN A;  2L0I A;  3TWQ A;  3W9G A;  4ILG A;  2XGO A;  3UT7 A;  1DC2 A;  4JEU A;  2J9Q A;  2VSY A;  3LVR E;  2QFC A;  3MV2 B;  3VTY A;  2C0L A;  3UPV A;  3Q78 A;  1OCC E;  3U9W A;  2R05 A;  3MKQ A;  4YVQ C;  3TG4 A;  2F0Y A;  5DIZ A;  2P9U G;  4CRW A;  3ZYQ A;  4GTQ A;  2H6I A;  4UWL A;  3QDN A;  3AJI A;  1MX6 A;  3FY4 A;  5FIO A;  5G55 A;  5AN8 A;  4BT9 A;  3DPD A;  4GCO A;  3AG4 E;  4GTV A;  1RW2 A;  3Q47 B;  4HRN A;  5D66 A;  5ENT D;  2UY1 B;  2ZGG A;  4UWH A;  3ASG A;  4UI9 J;  5FTP A;  4WNE A;  4DPR A;  2J08 A;  5JHA A;  3CVU A;  2OCC E;  1K3Z D;  3SZ7 A;  5ENR D;  3I5P A;  4A55 A;  3D9L A;  4HBD A;  3L6A A;  1GW6 A;  4GCN A;  5JHB A;  2L9B A;  3NOG D;  5D0Q D;  3OXF A;  4X8Q A;  4QFV A;  4UWG A;  3C3O A;  4PS8 A;  2IF4 A;  2I6H A;  3CQG B;  4GZD A;  2XS1 A;  4RQI A;  2FEZ A;  3BG1 B;  3CHS A;  2DYR E;  1S70 B;  2F37 A;  5ENO D;  1WDY A;  2L0T B;  3FTY A;  4GYO A;  5BT1 A;  4BET A;  4G11 A;  2A4Z A;  3EHM A;  1Z3X A;  2IO3 C;  4L9P A;  4M7C A;  4K5A B;  2BTD A;  4CDM A;  4I9E A;  5CCM A;  5AIJ A;  4D10 C;  4N2S A;  2LXM A;  2VSO E;  1D9S A;  1XNF A;  2J4D A;  3KD7 A;  4I1A A;  3SO8 A;  4ANX A;  4DUI A;  2GRM A;  3GZ1 A;  3IEG A;  3PZ2 A;  3SFY A;  2XQ0 A;  3F6Q A;  4YDO A;  2ILR A;  3DRA A;  2XZD G;  1TNU A;  3S7D A;  5CCL A;  1PY1 A;  3CVQ A;  1KZO A;  3ULQ A;  2DYS E;  2OEW A;  3L22 A;  3QOU A;  4GZC A;  4LER A;  5H7P A;  5FQ8 A;  3D9N A;  3GZS A;  2IOS A;  3URZ A;  1LF8 A;  2GGF A;  3MCX A;  3RRN B;  4WWP A;  5BV0 A;  4YDW A;  5CEA A;  4LG6 A;  4MBG A;  3TWW A;  4XKB A;  4FLB A;  3TJP A;  3EHR A;  4RLY A;  2OV8 A;  1N95 A;  3B13 A;  5EN5 D;  1IHB A;  3Q5M A;  5CED B;  3CVW A;  2VGY A;  3W9F A;  5ENN A;  3V2X A;  2R03 A;  2J07 A;  4UI9 K;  3NAW A;  1TJC A;  2IFU A;  3AS5 A;  3AG3 E;  3ZYL A;  1NL4 A;  2EIK E;  1UG3 A;  2GRL A;  4DX5 D;  3KEZ A;  2ZXW E;  4C48 B;  1INZ A;  2IOL A;  3SBT B;  2X38 A;  4XIF A;  1PC2 A;  4CT0 A;  3DSS A;  4I9C A;  4XX5 A;  1LD8 A;  3TWU A;  1PAQ A;  3DEP A;  4A1G A;  2KXP C;  2RFA A;  5T4Y A;  4G25 A;  1ZB1 A;  3KSQ A;  2WXH A;  1QQE A;  4IN3 B;  5FT9 A;  3L82 A;  4GMR A;  1G3N B;  1YMP A;  4DRX E;  2NC9 A;  3QWW A;  4UQX A;  3GW4 A;  4EQF A;  3ZN3 A;  3V30 A;  2KC7 A;  3FTU A;  5LX8 A;  3ISM C;  5EYP F;  3WG7 E;  3FH5 A;  1H6O A;  2EIN E;  3FEY A;  4DLO A;  3DBS A;  3G2T A;  3ZHE A;  3ZYK A;  4CCA A;  1FCH A;  3Q9N C;  1AWC B;  2EIM E;  1YA0 A;  3UIO C;  3SGH A;  4L2L A;  2GW1 A;  2WM9 A;  1SZ9 A;  4BWR A;  3CHR A;  1V54 E;  3CGH A;  4FP7 A;  1N0Q A;  5EYL A;  5D0O D;  1MX2 A;  3FU3 A;  3LYA A;  4B8A A;  4AM9 A;  5B3S E;  5AYW D;  3NZS A;  3SFX A;  2PQN A;  3QAQ A;  2X6J A;  1DVP A;  2J09 A;  4C9B B;  2OVB A;  1BLX B;  2DZN A;  3BG0 B;  3MEK A;  4GAA A;  3ULE G;  4Q69 A;  2P9N G;  3NZU A;  4L23 A;  4B89 A;  2WXR A;  2YNQ A;  2DBA A;  3I3N A;  4ATG A;  1HS6 A;  3PDN A;  4FAD A;  2DVW A;  4O60 A;  1RZ4 A;  2YHC A;  4G8L A;  2WXQ A;  3C98 A;  3ONL A;  5JJ6 A;  5ENQ D;  3EIJ A;  2KAT A;  3Q7F A;  2VSN A;  4CGW A;  3JXJ A;  3PEV B;  2VTB A;  4HB5 A;  5G04 C;  3RAU A;  4HS2 A;  5CMY A;  2XCC A;  4HLE A;  3G2S A;  4N5C A;  3C5R A;  4JXT A;  2ION A;  3VLE A;  3CV0 A;  3E34 A;  4ACL A;  1EF1 C;  3D9K A;  4JC8 A;  3PNL B;  1N4P A;  4ILI A;  3CK8 A;  4RVB A;  4YDY A;  4YVO A;  2B6C A;  4GYY A;  1TJF A;  3CVL A;  2P9L G;  4IRU A;  2AW6 A;  5ARG A;  3QC1 A;  4PUC A;  1OCR E;  4F1S A;  4NRH B;  5AQB A;  3CVX A;  3CVV A;  3VTX A;  3R9M A;  4EZK A;  2R2L A;  4GU5 A;  5AQ9 A;  4XZ4 A;  4N3B A;  4FA6 A;  3ABK E;  1IQU A;  4U96 D;  1IHG A;  2E0I A;  3MJW A;  3SBS A;  4EBA A;  1ELK A;  1HF8 A;  4BEP A;  4HI9 A;  2XEH A;  3DWL G;  4UI9 C;  4GTP A;  3BQO A;  1O1T A;  1NZN A;  2LUH A;  3SF4 A;  3ZW3 A;  5EDS A;  3T5X A;  5KJK A;  4YND A;  3B7S A;  4BT8 A;  3J5Q B;  5KJN A;  3FU0 A;  4U8Y D;  2CHX A;  2LNI A;  1MZC A;  4R7L A;  2UY1 A;  3ASN E;  3Q7A A;  5G05 J;  2XPI A;  2OEV A;  3LS8 A;  1IYG A;  4BER A;  5KNH D;  4DX6 D;  1K1B A;  1ELW A;  4IUL A;  4YDE A;  2X6H A;  2J4B A;  1E8W A;  4A63 B;  3HXF A;  3DEO A;  5D2M C;  2IY0 C;  4JA9 A;  4GZ5 A;  3Q9U C;  3PE4 A;  4I6J A;  4J8Y A;  3HVE B;  3QKY A;  2JAB A;  4I2Z A;  2Y69 E;  4DX2 A;  3E32 A;  3T9K A;  4OYS A;  1N94 A;  2PQR A;  4ZFH A;  1HG2 A;  3RJV A;  2I1J A;  4AXH A;  2CHW A;  4LNG A;  1HX8 A;  3I4R B;  4Y6C A;  3WXX A;  2HYZ A;  4WAF A;  4BSZ B;  2KM4 A;  3CVP A;  3NF1 A;  3UT4 A;  2OVF A;  4EZJ A;  3V2O A;  3KS2 A;  2GRN B;  3T5V A;  4KXK B;  1OCZ E;  1E8X A;  3IHY A;  5A7D B;  3R9A B;  3UM1 A;  3DSW A;  3SQV A;  1JPL A;  4F1P A;  1TN6 A;  3TGO A;  2V0P A;  3KAE A;  2FBN A;  5KJL A;  4GPM A;  4H7Y A;  3MV3 B;  3QAR A;  2LXL A;  3PZD A;  3CIA A;  1KT0 A;  5KBA A;  1MX4 A;  1LTX A;  4B93 B;  2BKG A;  4F53 A;  1UN9 A;  5LOZ A;  3B7R L;  1E8Y A;  5FIN A;  2V8S E;  3ZIM A;  1NA3 A;  2VQ2 A;  1S0P A;  2WVI A;  4OVV A;  1E7U A;  3ZVV A;  4RG9 A;  2OND A;  3PZ4 A;  4GTR A;  3MYV A;  4CT4 A;  5T8I A;  1KZP A;  5AAR A;  1O5M A;  3VLD A;  5KCM A;  1FVH A;  3FUL A;  1TNY A;  1EYH A;  4U04 A;  4GA1 A;  4B8C B;  3L08 A;  3FH8 A;  1HFA A;  3FUM A;  5ANL A;  3FUF A;  3L13 A;  2ETB A;  1WM5 A;  1NI1 A;  2LO6 A;  2YHE A;  2GRO B;  4KBQ A;  2X3M A;  3EUV A;  5FQ7 A;  1JUQ A;  3APF A;  4LRZ A;  4ANU A;  4KMO A;  1H2V C;  1BI8 B;  3UM3 A;  2NXP A;  2EIJ E;  2I1K A;  3DSV A;  2GRQ B;  3SNX A;  3UKR G;  5EX0 A;  5J08 A;  3JCK C;  5AEN A;  1HH8 A;  3UI2 A;  4WNG A;  1EPU A;  4DI3 A;  2KCK A;  1AP7 A;  2WXF A;  3G2U A;  2H6F A;  2WPV A;  1QYM A;  3DST A;  3UUX A;  1N52 A;  4I6G A;  2R02 A;  5HRY A;  3O4Z A;  3LJN A;  2H6G A;  4U95 D;  2ZU6 B;  3EU5 A;  4C0E A;  2ZIR A;  4AOF A;  2AJA A;  3IHV A;  3TXM A;  2EIL E;  3FTV A;  4BX9 A;  1OT8 A;  4BFR A;  4TUM A;  4DK5 A;  3ZU7 B;  4OAV B;  4FHJ A;  2X6K A;  2MYO A;  4AP2 A;  4WND A;  1TR4 A;  5AQ7 A;  2WXM A;  5IY5 E;  2L6B A;  5LCW J;  2I2O A;  4AV7 A;  3MA5 A;  2HE0 A;  4AJW A;  4BY6 A;  3MZL B;  4DJA A;  3ZKJ A;  3EHN A;  4V3I A;  4AY5 A;  5B1B E;  3TG5 A;  5BV1 A;  3UT8 A;  3SI5 A;  4K03 A;  4TXQ A;  1TNB A;  3S7B A;  3IV0 A;  4DI4 A;  1K1A A;  1EDU A;  1VDY A;  2V4L A;  5KNG A;  2XRZ A;  3OAW A;  3HG0 D;  3ML9 A;  3EJN A;  2DCP A;  5HI7 A;  4I1O B;  2RFM A;  4KVO A;  1A17 A;  4LNU D;  4MS6 A;  3L54 A;  3AG2 E;  4PDX A;  5DBK A;  4WUY A;  4K5C A;  3LKU A;  4U07 A;  3FEX A;  1OUV A;  2Y3A A;  4PH4 B;  2LAI A;  1A5E A;  3U4T A;  1MHQ A;  3HRA A;  4JPS A;  4MKT A;  1P5Q A;  3LY9 A;  1K8K G;  3ZEF A;  3TWS A;  3RSE G;  4KVM A;  2X6F A;  4JL0 A;  1HXI A;  2PZI A;  3ZGQ A;  3LJ3 A;  1IXV A;  4OVU A;  1N4R A;  2GRP B;  3Q4A B;  3V31 A;  1OY3 D;  4ILH B;  4CGV A;  2XRY A;  1FT2 A;  2HO1 A;  1O1R A;  1TYQ G;  3C72 A;  4GB9 A;  2AWI A;  3HDX A;  3FTX A;  2WXG A;  1MQS A;  3QK0 A;  3AAA C;  4UQY A;  4HFG A;  1BU9 A;  2BF0 X;  4BTA A;  1YYH A;  4JHJ A;  5T3R A;  3LCA A;  3FU5 A;  4NAC A;  4BES A;  1UOH A;  3DSX A;  1Z5S C;  1HU3 A;  2VGE A;  3CHM A;  4AY6 A;  4UQZ A;  5G05 C;  4UUC A;  2ZIS A;  4I2W A;  3D9J A;  2XGM A;  3V79 K;  3TWT A;  4U63 A;  1HZ4 A;  3JUI A;  2WXK A;  2YQ8 A;  2QYU A;  3L16 A;  4PS3 A;  2WXL A;  4MLP A;  4FU3 A;  5LP0 A;  5BPP A;  3PZ1 A;  2J8S D;  2AXZ A;  1D8E A;  3TWV A;  5E75 A;  4APO A;  5HS0 A;  3P2B A;  1H6P A;  3HVE A;  5ENS D;  3FH7 A;  4KT6 B;  3Q49 B;  2BKK B;  4J8F A;  3ESK A;  2MRI A;  3ABL E;  4HOS A;  2P9S G;  4HLL A;  4AVX A;  3ZNG A;  5JJ7 A;  2DWZ A;  5JJT A;  3B7U X;  5JMN D;  4XE0 A;  1H2U A;  4FC8 A;  3R7Q A;  1H6K A;  4APF A;  2MOW A;  3FUJ A;  4EBA G;  5CEC B;  5EKQ D;  5ARF A;  1JCS A;  4HQD A;  3JXI A;  1N54 A;  1WAO 1;  1KLX A;  3EIQ C;  4HI8 A;  3CK7 A;  3S7F A;  2YIN A;  4DX1 A;  2I9C A;  2Y4U A;  4J8S A;  3APC A;  2VJ8 A;  1OXJ A;  2HR2 A;  5ANR A;  2WQH A;  1QZ2 A;  2L6J A;  4GMJ A;  1FVF A;  4N3C A;  2CFU A;  4GML A;  1N0R A;  5CRU A;  3T8K A;  2WQ6 A;  2WB2 A;  3Q75 A;  4J8D A;  3UMV A;  2C0M A;  3UTM A;  1BI7 B;  3BUA A;  4GZ6 A;  2NSZ A;  2PM7 A;  1L5J A;  2P2C P;  4O1P A;  5A23 A;  1ZBP A;  1SQM A;  3CK9 A;  3ASO E;  3E4B A;  4FJZ A;  3FTS A;  1TN7 A;  2FO7 A;  1X5B A;  2VGX B;  3OTN A;  3CSF A;  4HOT A;  3PS6 A;  2AXV A;  2FUL A;  1Y8M A;  3D9O A;  1BPO A;  3RRU A;  3CHP A;  3D9I A;  1WG0 A;  1OWN A;  4XEI G;  2P9P G;  1FPP A;  2JEK A;  3T8M A;  1W3B A;  2P9K G;  3FFL A;  4EEC A;  2FF4 A;  3U64 A;  2IEJ A;  2LSU A;  2QZA A;  2LSV A;  3N71 A;  5JA4 D;  3AS4 A;  3PRE A;  3P1U A;  2VTB B;  4BSX A;  3PUJ A;  2Y1L E;  3U3W A;  4O6F A;  4LNB A;  2MHK A;  2RKK A;  2B0O E;  4U8V D;  2DIW A;  3LXU X;  3UIN C;  2XEE A;  2IQC A;  1JWF A;  3LY7 A;  4CDN A;  4WWN A;  3FDH A;  3AU5 A;  3I4G A;  3PZ3 A;  2Y4T A;  1UJK A;  1JCQ A;  1MJ0 A;  1D8D A;  3RRM B;  2BUG A;  3S2A A;  2RG8 A;  3ZXP A;  1H2T C;  4ANV A;  5BNW A;  1JWG A;  5HKP A;  4MRU A;  4GTS A;  5LCW C;  3C3R A;  4N2Q A;  4AEZ C;  3AG1 E;  5B1A E;  2KZT B;  4XKC A;  3CR3 A;  3L9T A;  3IXE A;  4Z68 A;  1TEZ A;  1Z3Y A;  2IO2 C;  2WMN A;  5C2Y A;  5E76 A;  4CDR A;  5ITZ F;  4K5B A;  3SHF A;  1U3D A;  5CHE E;  4GTO A;  1U3C A;  3JQ0 A;  5BXO A;  4P29 A;  2X6I A;  3LPZ A;  4G23 A;  4XI0 A;  3ZUV B;  4B94 A;  2PL2 A;  5G2N A;  5EIL A;  4N5Q A;  3BEE A;  4G26 A;  1N9A A;  4FHK A;  3UKU G;  3QWP A;  4Y6W A;  1N4S A;  1MYO A;  1HO8 A;  4PS7 A;  4C0M A;  3ZPJ A;  1H0A A;  2XEN A;  4TRQ A;  4U0S A;  1HE8 A;  3CEQ A;  2PNN A;  4DX7 D;  3QWV A;  3NOC D;  4E85 A;  3EDT B;  1LD7 A;  3FUH A;  3CHO A;  2XGS A;  2M63 A;  1O1S A;  3ONK A;  3RO2 A;  3ZYM A;  2UWJ G;  2H6H A;  4Q96 A;  4LUN U;  5BXU A;  4JHK A;  1WY6 A;  1V55 E;  3LEW A;  1OWO A;  3OXG A;  3ASH A;  3R7R A;  4WWO A;  4TXR A;  4GTM A;  3ML8 A;  1E7V A;  3C3Q A;  4N3A A;  1SZA A;  3JQ1 A;  1ELR A;  2VYI A;  4HXI A;  3DSU A;  3DPY A;  1DCE A;  4J8E A;  3PRZ A;  2VSX E;  3TAX A;  3NB2 A;  3RIB A;  3TWX A;  3HXC A;  3MGB A;  4I6E A;  4EHM A;  2XZT G;  5HQ8 A;  5J90 A;  4L1B A;  4HVB A;  4I17 A;  5FZS A;  4I1M A;  3JUE A;  2NYJ A;  3QNK A;  3MKQ B;  4N39 A;  1UN8 A;  4U0Z A;  3NBN B;  4JB8 P;  3EU9 A;  5FZQ A;  3NQP A;  3PNT B;  3MX3 A;  4KZ0 A;  2FI7 A;  3D9H A;  4B0Z A;  1B89 A;  4BTB A;  5AQA A;  1Y6I A;  3E37 A;  3HXD A;  2V5Q C;  3PUK A;  4L7T A;  5LFA A;  1E96 B;  1S63 A;  4J6I A;  3UM2 A;  4AIF A;  3B7B A;  3MKR A;  2HM8 A;  4G2V A;  3AS8 A;  4HRL A;  3TXN A;  3GZ2 A;  5KWD A;  1OWM A;  2QC9 A;  4JVS A;  4U0U A;  4EZL A;  4O1O A;  1UW4 B;  3CVY A;  3RO3 A;  4HNA D;  5FJY A;  3Q73 A;  2AVP A;  3DXK G;  2WXJ A;  1HG5 A;  3HIZ A;  2P9I G;  1QNF A;  5BW8 C;  1NFI E;  2CFZ A;  2F8X K;  3LY8 A;  3ASD A;  3ASF A;  2WXO A;  4M3O A;  2F8Y A;  5CMW A;  4IYP A;  3FUN A;  2GRR B;  3DXM G;  1OWL A;  4KYO B;  4LCT A;  4U8H A;  4EPZ A;  3IKO B;  3ABM E;  3B95 A;  5M72 A;  3CST A;  5KJM A;  3HXB A;  2R5S A;  3J5P A;  3APD A;  4G24 A;  2BED A;  1JCR A;  2ZGD A;  1XGW A;  1TN8 A;  4L2Y A;  4JHR A;  1TNZ A;  3CHQ A;  3CKB A;  2JLB A;  1IKN D;  3O48 A;  4A1S A;  2A5E A;  4FUL A;  3PVL A;  4ACK A;  4JD2 G;  3KEA A;  1SW6 A;  4A3V A;  3GYZ A;  4K0R A;  1H19 A;  1DNP A;  1KPS B;  3FWV A;  4TXP A;  4OAU C;  5AJD A;  2KCL A;  4J0U A;  3FUE A;  2ETA A;  3HXE A;  4RSY A;  2WXP A;  3U66 A;  3HYM B;  3SY2 A;  4JEH A;  5EID A;  4CYM D;  4GZ3 A;  5FQ6 A;  3ZXS A;  1X81 A;  1KT1 A;  3ENE A;  1YCS B;  2VGX A;  5AJL A;  2CHZ A;  3Q15 A;  3D3M A;  4I43 A;  1NA0 A;  4UWF A;  4ABN A;  3UQ3 A;  2EQX A;  2Q7F A;  2RD0 A;  3D9P A;  2QYJ A;  2QY7 A;  1SA5 A;  4ATZ D;  4FLH A;  2C2L A;  3PE3 A;  2V5F A;  3ZRH A;  3UM0 A;  3FP3 A;  4U7E B;  3FUD A;  4GPK A;  1Q2Z A;  3G2V A;  4QQI A;  2XPY A;  2CG3 A;  4DLQ A;  4JA7 A;  3K9I A;  4LEU A;  3CVN A;  3FTZ A;  4WNF A;  3UIP C;  1DCQ A;  2PM6 A;  4NIK A;  3FUK A;  1FT1 A;  3RU0 A;  3TL5 A;  2V4H C;  4F7A A;  2WMO A;  1E90 A;  1E8Z A;  2WQ7 A;  2R17 C;  4G8K A;  4HOQ A;  3CQC B;  4GA0 A;  4Q94 A;  2IU1 A;  5A6C A;  2XCB A;  3FTW A;  3ZHE B;  3AU4 A;  4ZHB A;  3PH0 C;  4F6R D;  2J49 A;  4FJY A;  3ZFW A;  3IBE A;  1UJJ A;  4GA2 A;  4CZ2 D;  3L17 A;  3LDZ A;  5CER B;  4ME2 A;  5EX3 A;  3UX4 A;  1ZU2 A;  2KZT A;  5ENP D;  1QBQ A;  4W9R A;  4A3T A;  4HOR A;  5AAO A;  2KCV A;  3X2Q E;  3Q79 A;  4NQ0 A;  1NP7 A;  4JW1 A;  3E30 A;  4JZY A;  1N11 A;  4HRM B;  2LAH A;  3SFZ A;  4GYW A;  4KZC A;  4BX8 A;  2KBX A;  3G2W A;  2XHE A;  1TNO A;  3PEU B;  3BU8 A;  2WXI A;  2ETC A;  4ANW A;  4F3V A;  5FWQ A;  3VLF A;  4E6H A;  3HHM A;  3QJZ A;  4TV3 A;  1OCO E;  2R59 A;  2P58 C;  3JYS A;  4H7X A;  4RG6 A;  2CG2 A;  3E33 A;  3RKV A;  3CLJ A;  3OXL A;  5BUZ A;  4TUU A;  5EIB E;  2FO1 E;  3TWR A;  5CBN A;  2XEV A;  5CRV A;  3B7T A;  5C1D A;  3FHE A;  4LSZ E;  5FQ4 A;  3ESL A;  4NUR A; 
#chains in the Genus database with same CATH homology
 2KAT A;  3LKU A;  4JHK A;  1WY6 A;  2VSN A;  3FEX A;  4U07 A;  1OUV A;  3LEW A;  1OWO A;  3PEV B;  4CEM A;  2Y3A A;  3OXG A;  3SD5 A;  3FUI A;  3ASH A;  4UWK A;  3RK6 A;  4PH4 B;  2VTB A;  3R7R A;  4URK A;  5G04 C;  3LVQ E;  2XPZ A;  4HS2 A;  4WWO A;  2LAI A;  5CMY A;  2XCC A;  3ML8 A;  3U4T A;  1E7V A;  4HLE A;  3G2S A;  1MHQ A;  4HOU A;  4JPS A;  4N5C A;  4MKT A;  1P5Q A;  2AXU A;  3D9M A;  4JXT A;  3FU6 A;  4N3A A;  2ION A;  2E2E A;  1SZA A;  3JQ1 A;  3VLE A;  1Z6T A;  1ELR A;  2IJG X;  5FZR A;  3CV0 A;  2VYI A;  4HXI A;  2A5U A;  4ACL A;  1EF1 C;  2OOE A;  3D9K A;  3LY9 A;  4JC8 A;  3PNL B;  4J8E A;  3QB2 A;  2VSX E;  3PRZ A;  3TAX A;  5G04 J;  3S7J A;  4ILI A;  1IQR A;  4XI9 A;  3RIB A;  3ZEF A;  3MGB A;  4I6E A;  1OWP A;  3CKC A;  4G1T A;  2WXN A;  2L0I A;  3CK8 A;  4KVM A;  2X6F A;  4JL0 A;  1HXI A;  4RVB A;  4YVO A;  5HQ8 A;  5J90 A;  4GYY A;  1TJF A;  2PZI A;  4ILG A;  3CVL A;  3ZGQ A;  2XGO A;  4L1B A;  4IRU A;  2AW6 A;  5ARG A;  3QC1 A;  4PUC A;  3ESL A;  3UT7 A;  4HVB A;  4F1S A;  4NRH B;  4I17 A;  3LJ3 A;  4JEU A;  5FZS A;  3CVX A;  3CVV A;  4I1M A;  2J9Q A;  2VSY A;  3LVR E;  4OVU A;  2QFC A;  3MV2 B;  3VTX A;  3VTY A;  4EZK A;  2C0L A;  3UPV A;  3QNK A;  3Q4A B;  3MKQ B;  4GU5 A;  4ILH B;  4CGV A;  2XRY A;  4N39 A;  1UN8 A;  4U0Z A;  2HO1 A;  3U9W A;  4XZ4 A;  4N3B A;  4FA6 A;  3MKQ A;  4YVQ C;  3TG4 A;  5DIZ A;  1IQU A;  4GB9 A;  4CRW A;  1IHG A;  2AWI A;  3HDX A;  2E0I A;  3MJW A;  3FTX A;  5FZQ A;  3ZYQ A;  2WXG A;  3NQP A;  1MQS A;  3PNT B;  3QK0 A;  3MX3 A;  4KZ0 A;  3SBS A;  4EBA A;  4UQY A;  2FI7 A;  1ELK A;  4UWL A;  3QDN A;  4HFG A;  2BF0 X;  4BTA A;  3FY4 A;  4JHJ A;  4CGW A;  4B0Z A;  5T3R A;  3LCA A;  1HF8 A;  3FU5 A;  5G55 A;  1B89 A;  4NAC A;  4BTB A;  4UI9 C;  4BT9 A;  1Y6I A;  3DPD A;  4GCO A;  3PUK A;  1HU3 A;  3CHM A;  4AY6 A;  4L7T A;  5LFA A;  1E96 B;  1NZN A;  4J6I A;  3Q47 B;  3SF4 A;  3ZW3 A;  4UQZ A;  5G05 C;  4AIF A;  5EDS A;  4I2W A;  3MKR A;  3D9J A;  2XGM A;  3T5X A;  5KJK A;  4YND A;  3B7S A;  2HM8 A;  4G2V A;  4BT8 A;  2UY1 B;  4UWH A;  3ASG A;  3AS8 A;  5KJN A;  3FU0 A;  3TXN A;  2CHX A;  3GZ2 A;  2LNI A;  4UI9 J;  5FTP A;  4WNE A;  4U63 A;  4R7L A;  2UY1 A;  1HZ4 A;  1OWM A;  4DPR A;  3JUI A;  2WXK A;  2J08 A;  2YQ8 A;  5G05 J;  5JHA A;  3CVU A;  4JVS A;  3L16 A;  4U0U A;  2XPI A;  4EZL A;  3LS8 A;  4PS3 A;  1IYG A;  3SZ7 A;  1UW4 B;  1ELW A;  2WXL A;  4IUL A;  3CVY A;  3I5P A;  4A55 A;  4MLP A;  2X6H A;  2J4B A;  3D9L A;  3RO3 A;  4FU3 A;  1E8W A;  3L6A A;  1GW6 A;  4GCN A;  4JA9 A;  4GZ5 A;  5JHB A;  5FJY A;  5LP0 A;  5BPP A;  2L9B A;  5D0Q D;  2AVP A;  3OXF A;  4QFV A;  4UWG A;  2AXZ A;  2WXJ A;  4PS8 A;  1HG5 A;  3HIZ A;  2IF4 A;  2I6H A;  3PE4 A;  1QNF A;  4I6J A;  3CQG B;  4GZD A;  5BW8 C;  2CFZ A;  3HVE B;  5E75 A;  3QKY A;  2FEZ A;  4I2Z A;  3LY8 A;  3ASD A;  3BG1 B;  3CHS A;  4APO A;  3ASF A;  3P2B A;  3HVE A;  2WXO A;  4M3O A;  3FH7 A;  4KT6 B;  5CMW A;  3Q49 B;  4IYP A;  2L0T B;  3FTY A;  4GYO A;  5BT1 A;  4J8F A;  3ESK A;  4OYS A;  3FUN A;  4G11 A;  2MRI A;  4HOS A;  2PQR A;  4AVX A;  2A4Z A;  3EHM A;  1OWL A;  4KYO B;  4LCT A;  4U8H A;  5JJ7 A;  1Z3X A;  4EPZ A;  3IKO B;  5JJT A;  1HG2 A;  2BTD A;  3RJV A;  2I1J A;  3B7U X;  4CDM A;  4AXH A;  4I9E A;  5CCM A;  4XE0 A;  1H2U A;  5AIJ A;  2CHW A;  4FC8 A;  4D10 C;  3R7Q A;  5M72 A;  3CST A;  1HX8 A;  3I4R B;  5KJM A;  1H6K A;  4Y6C A;  4APF A;  4N2S A;  2MOW A;  3FUJ A;  2VSO E;  3WXX A;  4EBA G;  2HYZ A;  5EKQ D;  5ARF A;  4WAF A;  1XNF A;  2J4D A;  2R5S A;  3APD A;  4G24 A;  3KD7 A;  1N54 A;  1WAO 1;  1KLX A;  1XGW A;  2KM4 A;  3EIQ C;  4I1A A;  4L2Y A;  3CVP A;  4JHR A;  3NF1 A;  3UT4 A;  4ANX A;  2OVF A;  3CHQ A;  3CK7 A;  3CKB A;  3S7F A;  2JLB A;  2YIN A;  4EZJ A;  3KS2 A;  2GRM A;  3GZ1 A;  3IEG A;  3O48 A;  4A1S A;  3T5V A;  4KXK B;  4FUL A;  1E8X A;  2I9C A;  2Y4U A;  3PVL A;  4ACK A;  3IHY A;  2XQ0 A;  4J8S A;  5A7D B;  3R9A B;  3APC A;  1JPL A;  2VJ8 A;  3S7D A;  4A3V A;  2HR2 A;  5ANR A;  2WQH A;  1PY1 A;  3CVQ A;  2L6J A;  1QZ2 A;  5CCL A;  4GMJ A;  3ULQ A;  3TGO A;  2V0P A;  3KAE A;  1FVF A;  3GYZ A;  4N3C A;  2FBN A;  4K0R A;  2CFU A;  3L22 A;  3QOU A;  5KJL A;  4GML A;  4GZC A;  4LER A;  5FQ8 A;  2WQ6 A;  1H19 A;  3D9N A;  2WB2 A;  3GZS A;  4H7Y A;  1DNP A;  4J8D A;  3UMV A;  2C0M A;  2IOS A;  3FWV A;  3MV3 B;  3URZ A;  3QAR A;  1LF8 A;  4GZ6 A;  5AJD A;  2GGF A;  3PZD A;  3CIA A;  2NSZ A;  3MCX A;  2PM7 A;  2KCL A;  4WWP A;  1L5J A;  3RRN B;  5BV0 A;  1KT0 A;  3FUE A;  4J0U A;  4RSY A;  1ZBP A;  1SQM A;  3CK9 A;  4FJZ A;  3E4B A;  5A23 A;  4F53 A;  1UN9 A;  2WXP A;  5LOZ A;  3FTS A;  4XKB A;  4FLB A;  3TJP A;  3U66 A;  3B7R L;  1E8Y A;  3HYM B;  2OV8 A;  4JEH A;  2FO7 A;  1X5B A;  2VGX B;  3OTN A;  2V8S E;  3CSF A;  4GZ3 A;  3B13 A;  5FQ6 A;  1NA3 A;  2VQ2 A;  1S0P A;  3ZIM A;  2WVI A;  4Q96 A;  3ZXS A;  4HOT A;  3PS6 A;  2AXV A;  4OVV A;  1E7U A;  3Q5M A;  3ZVV A;  2FUL A;  1KT1 A;  3ENE A;  3CVW A;  4RG9 A;  2VGX A;  2VGY A;  1Y8M A;  3D9O A;  5AJL A;  1BPO A;  5ENN A;  2CHZ A;  3Q15 A;  2OND A;  3D3M A;  4I43 A;  3MYV A;  1NA0 A;  3RRU A;  4CT4 A;  5T8I A;  2J07 A;  4UWF A;  4UI9 K;  3CHP A;  3D9I A;  4ABN A;  1TJC A;  2IFU A;  3UQ3 A;  3AS5 A;  3VLD A;  2EQX A;  2Q7F A;  1OWN A;  2RD0 A;  5KCM A;  3D9P A;  3ZYL A;  1UG3 A;  2GRL A;  1FVH A;  2QY7 A;  2JEK A;  3FUL A;  3KEZ A;  1EYH A;  3T8M A;  4U04 A;  4GA1 A;  4B8C B;  1W3B A;  1INZ A;  2IOL A;  3FFL A;  4FLH A;  3SBT B;  2X38 A;  4XIF A;  2C2L A;  3L08 A;  3FH8 A;  4EEC A;  1PC2 A;  1HFA A;  3FUM A;  4CT0 A;  3PE3 A;  2FF4 A;  3U64 A;  2V5F A;  4I9C A;  4XX5 A;  5ANL A;  3FUF A;  3L13 A;  1WM5 A;  2LSU A;  1PAQ A;  3ZRH A;  2LO6 A;  2LSV A;  3FP3 A;  3N71 A;  2YHE A;  3AS4 A;  3FUD A;  4KBQ A;  3PRE A;  3P1U A;  2X3M A;  4A1G A;  5FQ7 A;  4BSX A;  2VTB B;  4GPK A;  3PUJ A;  1JUQ A;  3U3W A;  3G2V A;  4O6F A;  2XPY A;  5T4Y A;  3APF A;  4G25 A;  4LRZ A;  2CG3 A;  2WXH A;  4DLQ A;  1QQE A;  4ANU A;  4KMO A;  1H2V C;  4JA7 A;  3K9I A;  4LEU A;  4IN3 B;  3CVN A;  2NXP A;  3FTZ A;  4WNF A;  5FT9 A;  2MHK A;  2I1K A;  2DIW A;  3LXU X;  2PM6 A;  3FUK A;  2NC9 A;  3SNX A;  2IQC A;  3QWW A;  5EX0 A;  4UQX A;  3GW4 A;  3RU0 A;  3TL5 A;  3ZN3 A;  1JWF A;  3LY7 A;  4EQF A;  4CDN A;  4F7A A;  5J08 A;  2WMO A;  1E90 A;  3JCK C;  4WWN A;  3FDH A;  1E8Z A;  3AU5 A;  3I4G A;  2WQ7 A;  2R17 C;  2KC7 A;  5AEN A;  2Y4T A;  3FTU A;  1HH8 A;  4WNG A;  5LX8 A;  1UJK A;  1EPU A;  4DI3 A;  2KCK A;  4HOQ A;  3CQC B;  2WXF A;  4GA0 A;  3G2U A;  3FH5 A;  4Q94 A;  2IU1 A;  5A6C A;  2XCB A;  3FTW A;  3ZHE B;  3AU4 A;  2BUG A;  3RRM B;  2WPV A;  3PH0 C;  3S2A A;  2RG8 A;  3FEY A;  4DLO A;  3UUX A;  1N52 A;  4I6G A;  2J49 A;  1H2T C;  4ANV A;  3DBS A;  5BNW A;  3G2T A;  1JWG A;  3ZHE A;  3O4Z A;  4FJY A;  3ZFW A;  3IBE A;  3ZYK A;  4NUR A;  4CCA A;  1UJJ A;  4MRU A;  1FCH A;  2ZU6 B;  4C0E A;  5LCW C;  4N2Q A;  4AOF A;  1YA0 A;  4AEZ C;  2KZT B;  3IHV A;  3TXM A;  4XKC A;  4GA2 A;  3SGH A;  3CR3 A;  3L17 A;  4L2L A;  3LDZ A;  3FTV A;  4BX9 A;  1TEZ A;  1Z3Y A;  4ME2 A;  4BFR A;  2GW1 A;  2WM9 A;  1SZ9 A;  4BWR A;  5EX3 A;  2WMN A;  3UX4 A;  4DK5 A;  4FHJ A;  1ZU2 A;  5C2Y A;  2X6K A;  2KZT A;  5E76 A;  4AP2 A;  4CDR A;  4WND A;  3CHR A;  4W9R A;  3CGH A;  2WXM A;  4FP7 A;  4A3T A;  3SHF A;  5LCW J;  1U3D A;  5D0O D;  2I2O A;  4AV7 A;  3FU3 A;  3MA5 A;  4HOR A;  3LYA A;  2KCV A;  4B8A A;  4NQ0 A;  1NP7 A;  5CHE E;  4AJW A;  3MZL B;  4BY6 A;  4DJA A;  4JW1 A;  1U3C A;  3EHN A;  4JZY A;  3JQ0 A;  4V3I A;  4AM9 A;  4P29 A;  4AY5 A;  3SFZ A;  2LAH A;  2X6I A;  3LPZ A;  4G23 A;  3TG5 A;  4XI0 A;  5BV1 A;  4B94 A;  4GYW A;  5AYW D;  3UT8 A;  3NZS A;  4KZC A;  2PQN A;  4K03 A;  3SI5 A;  2PL2 A;  4BX8 A;  3QAQ A;  5G2N A;  2X6J A;  1DVP A;  2J09 A;  3G2W A;  3S7B A;  3BEE A;  4G26 A;  2XHE A;  3PEU B;  3IV0 A;  4C9B B;  2WXI A;  4FHK A;  3QWP A;  4ANW A;  4DI4 A;  4Y6W A;  4F3V A;  1EDU A;  1HO8 A;  2OVB A;  5FWQ A;  1VDY A;  2V4L A;  3VLF A;  4PS7 A;  4C0M A;  3BG0 B;  3MEK A;  4E6H A;  2XRZ A;  4GAA A;  3HHM A;  3OAW A;  3QJZ A;  4TV3 A;  3ZPJ A;  4Q69 A;  1H0A A;  3ML9 A;  2R59 A;  2P58 C;  3EJN A;  2DCP A;  3JYS A;  4H7X A;  4TRQ A;  4RG6 A;  4U0S A;  3NZU A;  5HI7 A;  4L23 A;  4B89 A;  1HE8 A;  2CG2 A;  2WXR A;  3CEQ A;  4I1O B;  2YNQ A;  3CLJ A;  3RKV A;  2DBA A;  3I3N A;  4ATG A;  3OXL A;  1HS6 A;  3PDN A;  1A17 A;  4KVO A;  3QWV A;  4FAD A;  4E85 A;  5BUZ A;  3EDT B;  4TUU A;  2YHC A;  3FUH A;  3CHO A;  2XGS A;  4MS6 A;  2XEV A;  3L54 A;  3B7T A;  2M63 A;  4PDX A;  5DBK A;  5C1D A;  2WXQ A;  4WUY A;  3ONK A;  3FHE A;  3RO2 A;  3C98 A;  3ONL A;  5JJ6 A;  3ZYM A;  2UWJ G;  5FQ4 A;  2ILR A;  3EIJ A;  4LUN U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...