3CGHA

Crystal structure of a susd homolog (bt_3984) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
507
structure length
507
Chain Sequence
PYEAPDLSADGYALGSAMNNLAGCVVSPDVNTAQFTDCLLGGPLGGYFADSNAGFTETISNFNPKDDWSRVFLKSDKIIPTLYSNLTQVKLVSQNTNDPVPYAIAQVIKVAAMHRVTDAFGPIPYSQIGANGEIATPYDSQEVTYNTFFDELNAAIATLNENSNEQLVPTADYIYKGDVKKWIRFANSLKLRLAIRIAYANPVKAQQMAEEAVNPANGGVIESNADNATWNYFETSQNPIYVATRYNQVQTSDHGGVPCLTGGDTHAAADIICYMNGYKDNRREKFFTKSEWAGQDYVGMRRGIVIPELKTTGHKYSGVNIAPTSPLYWMNAAEVAFLRAEGQAVFNFSMGGTAESFYNQGIRLSFEQWGADGVEDYLKDDVNKPTAYTDPAGTNTYQNALSNITIKWNDSADKEEKQERIIVQKWIANWQLGNEAWADFRRTGYPKLIPVKENKSGGVVDSEKGARRMPYPLDEFVSNKANVEYAIANYLHGADNMATDVWWASKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SusD homolog
publication title Structure of BT_3984, a member of the SusD/RagB family of nutrient-binding molecules.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Metal binding protein
total genus 187
structure length 507
sequence length 507
ec nomenclature
pdb deposition date 2008-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12741 SusD-like Susd and RagB outer membrane lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3cghA00
3JQ1A 3CK7A 5J90A 3QNKA 3CGHA 3KEZA 4Q69A 4LERA 5FQ6A 3EJNA 5E76A 5FQ8A 5LX8A 3CK8A 3CK9A 5T4YA 3MX3A 3FDHA 5E75A 5FQ4A 3IV0A 3JYSA 3OTNA 5T3RA 3GZSA 3L22A 4F7AA 3HDXA 3P1UA 3NQPA 5FQ7A 3I4GA 3SGHA 4F53A 3EHNA 3LEWA 3MCXA 4MRUA 3SNXA 3CKBA 4PUCA 3MYVA 4L7TA 3CKCA 3EHMA 3JQ0A
chains in the Genus database with same CATH superfamily
1X5BA 3KEZA 4LSZE 1S0PA 4ILHB 3D9NA 2H6FA 5A23A 3HXCA 3MJWA 1H6PA 5FWQA 4GTOA 2P9IG 2MOWA 2Y1LE 3I4GA 3V2OA 2BKKB 4JB8P 3QKYA 4HOUA 2BF0X 4RG9A 2CHZA 1YCSB 4DRXE 3L9TA 4FJYA 2I1KA 2F8YA 4RSYA 4NRHB 2IEJA 2P9SG 4J8FA 4GTPA 2P58C 3FU0A 3I4RB 4BY6A 3CVUA 4BTAA 2ZXWE 3X2QE 3AJIA 1H6KA 4UWGA 3U9WA 2I1JA 1KPSB 5G55A 4IRUA 1U3CA 3RKVA 4DX1A 3AG1E 3J5QB 1PC2A 3L82A 2J08A 5CCMA 1K1AA 3Q9NC 5FQ7A 1E90A 4FLBA 3NAWA 1TNUA 2IO2C 4RG6A 1IXVA 2Y0BG 3LEWA 2P9LG 3QNKA 4LERA 2YHCA 5JJ7A 5LX8A 4WUYA 4L23A 2OCCE 3TL5A 1SW6A 1D9SA 3FTUA 3IBEA 3Q15A 4K0RA 3NOGD 4URKA 4CGWA 4L1BA 3VLEA 5FZQA 1TYQG 4XEIG 3UT4A 4GTQA 4GZ6A 4B94A 1S63A 4WNFA 1AWCB 3UINC 3IXEA 4GYOA 1H0AA 4I6JA 1V54E 3SGHA 3MCXA 2HR2A 2MHKA 2EINE 3RAUA 2ZGDA 4PDXA 3BQOA 4N5CA 5C2YA 4ANUA 2JEKA 4JW1A 4KBQA 2WXRA 1X81A 1N9AA 2GRMA 4QFVA 5A7DB 1E8XA 3KSLA 2X6HA 3RK6A 4U96D 4JHKA 4TUUA 3EIJA 2QZAA 2VGXB 1GW6A 4TXPA 1PY1A 3B7UX 3SZ7A 3D9HA 1TJCA 3O48A 4N5QA 1Z6TA 2WMNA 3LJNA 4B8AA 4JPSA 3FUJA 5ENOD 3CHSA 4CDRA 5CEAA 3C5RA 4GTSA 4DI3A 4H7XA 4C0EA 5EKQD 3ZIMA 3FH7A 2P2CP 5AAOA 3E32A 3FUIA 3Q47B 3HVEA 2HO1A 4BT9A 1BI8B 2CFZA 3ZYKA 4HRLA 2GW1A 2YNQA 3CK7A 2H6IA 4G8LA 4G8KA 3UM2A 3BUAA 2WXPA 3FTZA 3L22A 4YVQC 3B7RL 4JZYA 1TJFA 3I3NA 4GCNA 4KMOA 2V4HC 5BNWA 3G2SA 1HO8A 3LY9A 4XKBA 4UI9C 1XNFA 3FULA 3DSVA 1DCEA 3V79K 3CQGB 3ZXPA 4EBAG 1B89A 1OWPA 1FT1A 3ZGQA 4I1MA 1MX6A 4L9PA 1H2VC 3E33A 3D9OA 2Y4TA 2V4LA 4WNDA 1OCCE 3EHQA 5HRYA 3LJ3A 2DVWA 3NBNB 1MX2A 5EX3A 3FH8A 2RG8A 1OXJA 3FDHA 1WG0A 3B7TA 2EQXA 5CRUA 4IULA 2RD0A 2WQ7A 5JHAA 1UJJA 2FI7A 1U2VG 1VDYA 3ASGA 4JA9A 4U0ZA 2XGSA 3L6AA 3G2WA 2QFCA 1K3ZD 4OYSA 4EBAA 4JA7A 3QK0A 3UIPC 3APDA 2YINA 1OCRE 1HXIA 3MA5A 2L6BA 3QB2A 3JQ0A 3HYMB 3UIOC 3D9JA 4QQIA 4BX8A 5ARFA 3Q5MA 3TAXA 3QJZA 3LS8A 3TWQA 4AM9A 2GRRB 3DBSA 3GW4A 2B6CA 3R7QA 3NB2A 3LYAA 3EHNA 3T5XA 2FO7A 4AJWA 1NA0A 4BWRA 2DIWA 2EIME 2ZIRA 3AS5A 5FQ8A 3CK8A 2XRZA 1NZNA 3PZ4A 5ENRD 4BSZB 1S70B 2WXLA 3ABME 2C0LA 2E2EA 3LXUX 3MV3B 4FA6A 1Y8MA 4A1SA 3UT8A 2AXUA 4A63B 3E34A 1ELRA 3T8MA 2A5EA 4AOFA 2ETAA 4DX6D 2VSOE 2VGEA 3C3OA 3EUVA 5DBKA 3Q78A 3CSTA 2XS8A 1QBQA 4K03A 1BPOA 3EIQC 3TXMA 3LVQE 3ASNE 2XGOA 4O6FA 2F37A 3UXGA 5G2NA 3URZA 3SFYA 2BUGA 4PS8A 3CHMA 4GTMA 4A3TA 5ANLA 3DWLG 1YA0A 4CCAA 4XI9A 1MJ0A 4HXIA 3N71A 1YYHA 3RJVA 3D9MA 4C48B 4FLHA 4I2WA 1LTXA 3DRAA 4U8VD 4DI4A 4U04A 3SF4A 3OAWA 4CT0A 4TXQA 3UUXA 1A17A 3P2BA 4JVSA 3C98A 3BEEA 3PDNA 2XEVA 5KNGA 3KS2A 5J90A 2VTBB 3SHFA 3NZUA 4JEHA 2IOSA 2DZNA 4R7LA 3ABLE 1SZ9A 5ANRA 1WAO1 3IV0A 5FJYA 2QC9A 4GZDA 2CHXA 3HDXA 2A5UA 3Q9UC 2ZISA 2JLBA 3FU5A 3SNXA 5LCWJ 3PEUB 3APFA 4J8YA 4ILGA 2DWZA 2UY1A 4Q69A 4HRMB 3CVLA 5FQ6A 2LSUA 4WNEA 1SA5A 1EYHA 1LD7A 3CIAA 3CEQA 4KVOA 2Y3AA 4TUMA 5FZSA 4DJAA 3PZDA 4JD2G 4UWHA 2NYJA 1U3DA 3CVYA 4M7CA 4ABNA 4EQFA 1HS6A 4JC8A 4I9EA 4UWFA 1O1TA 2WQ6A 3AAAC 1HF8A 1N52A 3FWVA 2J8SD 1FVFA 5JMND 4UQXA 1D8DA 4GTRA 3F6QA 2I6HA 2XS1A 3ZYQA 4HOQA 4U8YD 1KZPA 3SD5A 3R7RA 3EU5A 2EIJE 2AJAA 2AW6A 2J4DA 4W9RA 2VSNA 5AARA 4AVXA 2P9KG 3FTVA 2X6FA 4GYWA 2WM9A 2NSZA 3JQ1A 2WXNA 2R03A 2J9QA 4HLEA 5ENSD 3HVEB 2KZTA 2XHEA 1NA3A 3IKOB 4G23A 4UWKA 3VTYA 5B3SE 5LP0A 4GZ5A 3ZKJA 4BERA 5AENA 5KJNA 4J8DA 2XCCA 4GTTA 1DC2A 3SFZA 3FEXA 5CECB 3UKRG 2LSVA 3HRAA 3MV2B 4ZFHA 3CV0A 2V8SE 3ZYMA 1V55E 4GU5A 5C1DA 3D3MA 4XIFA 2XEHA 4WNGA 1IHBA 4LG6A 4AP2A 5BPPA 5T3RA 3Q79A 3HXDA 4UWLA 2ZGGA 5CEDB 2DBAA 4A3VA 3TWRA 1SZAA 4XE0A 5ENQD 2V0PA 4CZ2D 2WXMA 1NI1A 3DXMG 1RZ4A 5KJKA 2I2OA 4B93B 2OV8A 1D8EA 3LCAA 3D9LA 4KYOB 2OEWA 3MKQA 1E8YA 3MZLB 3ZHEA 3EHMA 3CVVA 3APCA 2IONA 3ENEA 3UT7A 2XCBA 1OT8A 3RO3A 4I1AA 5FIOA 2OVFA 4I9CA 1TN6A 5G04J 4FADA 3FUNA 1OWLA 4KVMA 3FH5A 2KBXA 5T8IA 5BT1A 2WB2A 1Z3YA 4MS6A 1XGWA 3V30A 4JXTA 4J8EA 1TEZA 4FJZA 2Y4UA 5HQ8A 4IYPA 3DXKG 1N54A 2WXGA 2XZDG 2X6IA 1TNZA 1L5JA 1AP7A 3G2TA 1Q2ZA 1IHGA 4J6IA 3S7JA 2C0MA 4O1OA 3L13A 2EIKE 3ZPJA 1BD8A 1H2UA 3LKUA 3PEVB 4FU3A 3QC1A 2HM8A 3JXJA 3Q49B 1JCQA 4C0MA 1JWFA 2P9PG 5LOZA 5KWDA 4O60A 3EDTB 4APOA 5JHBA 4FHJA 4D10C 3ULQA 1HG5A 3Q75A 4CEMA 1FPPA 3L16A 1FT2A 2WXHA 4HFGA 5AIJA 1TR4A 1IYGA 3ZU7B 4N3CA 4UUCA 3FEYA 3TG5A 1N0RA 3EHRA 1OWMA 2AWIA 5CMWA 2F8XK 3VLFA 3O4ZA 3B7BA 5JA4D 1BLXB 3FUKA 3L17A 2IFUA 2F0YA 4F6RD 2VYIA 1ZB1A 2R02A 3C72A 1UN8A 1H2TC 2FBNA 3SI5A 1JCRA 4L2YA 3UM0A 4MBGA 4BT8A 3Q4AB 4BX9A 1N95A 3BG0B 1P5QA 4L7TA 4YDEA 2ONDA 3QDNA 3PNTB 2GRNB 4HRNA 4NIKA 1K1BA 4Z68A 4KT6B 3CHQA 4GYYA 1SQMA 3CVWA 1BU9A 3GZSA 2WXOA 3MKRA 4MLPA 5LCWC 3PH0C 3FUHA 3QWWA 2CG2A 5A6CA 4DX2A 4OAVB 3IHYA 2CFUA 3BG1B 2KM4A 5HS0A 5AN8A 4YDYA 4ATGA 3ESKA 5EIBE 3ZXSA 4U95D 3TG4A 3ASOE 4LUNU 3OTNA 2L0IA 5H7PA 4TXRA 2LAHA 2EILE 1IKND 1O5MA 1ZBPA 1Z3XA 3R9MA 2ILRA 3DSUA 4FHKA 1IQRA 4J8SA 3PE4A 3WG7E 1E8ZA 2Q7FA 2XPYA 3MX3A 5KJLA 3J5PA 2WVIA 3T8KA 3T9KA 3JCKC 4EZLA 3L08A 3PNLB 2DCPA 4GA2A 4BEPA 2HYZA 4HLLA 4AY5A 1S64A 3VLDA 3PVLA 2CG3A 3CGHA 5EILA 4F7AA 5J08A 4V3IA 2I9CA 3TWSA 3E4BA 2GRLA 5E75A 2KZTB 3Q73A 1A5EA 5BXUA 3K9IA 4PS3A 2OOEA 4WAFA 4AXHA 5AYWD 4JEUA 5AJDA 1W3BA 1N4SA 3ASHA 4EZKA 2XEEA 2J49A 5B1BE 3B95A 4G24A 3U4TA 2AXVA 3AS4A 3DSXA 3UPVA 3G2UA 4X8QA 1IQUA 4IN3B 4UI9K 3SO8A 2PQNA 4ILIA 4OAUC 2LO6A 4I6GA 1MYOA 4I17A 3D9KA 4GPKA 2FEZA 3ULEG 1HZ4A 4BESA 3D9IA 2VQ2A 3L54A 3S7BA 1LD8A 4NURA 4UI9J 2AXZA 1OUVA 1UOHA 1MQSA 5BV0A 5M72A 2DZOA 3ASDA 2FF4A 3JYSA 3MKQB 1TN8A 3LVRE 2L9BA 4A1GA 3SQVA 3ZHEB 4B8CB 3CVNA 4CDMA 2X6KA 3FP3A 4ANVA 2C2LA 3AG2E 3TWVA 3KSQA 4GTVA 3Q7AA 4YVOA 2H6GA 2YQ8A 4MRUA 5CCLA 3ZNGA 3LY8A 2XENA 3AU4A 5G05J 5KCMA 2R17C 1EDUA 4LRZA 4HOSA 2IO3C 2R5SA 4LNGA 1TNYA 3PUJA 2KATA 1UW4B 4AIFA 1SVXA 5CHEE 1HFAA 5D0QD 4G25A 3BU8A 1O1SA 3UX4A 3CKCA 5CERB 3FTSA 3DEOA 3U64A 4FP7A 1JWGA 3CK9A 3CSFA 3ML8A 1JPLA 2NC9A 3DSSA 3UQ3A 3GYZA 1Y6IA 3DPDA 4GMJA 2VSYA 4ME2A 2IU1A 3CKBA 4PUCA 2L0TB 5AQ7A 5ITZF 5D0OD 4I43A 4L2LA 4DK5A 1ZU2A 4U0UA 4N3BA 4RLYA 5BUZA 3AG3E 3IHVA 2LXLA 3JUEA 5EDSA 3AS8A 3ONKA 4TV3A 5ARGA 3ULYA 4Y6CA 1HU3A 1INZA 1WY6A 3RIBA 1MX4A 1OCOE 3MGBA 3QOUA 3FY4A 2XGMA 3B13A 1NFIE 5LFAA 2OVBA 1NL4A 1ELWA 3ZVVA 4K5CA 1WM5A 4HOTA 2QYJA 2ETBA 1JCSA 3NQPA 1PAQA 3DSWA 2PNNA 1UG3A 4JHRA 2GROB 1EPUA 4A55A 3AG4E 4F1PA 3I5PA 3LPZA 3FUFA 3R9AB 3SFXA 1OWOA 4F3VA 1MZCA 4JHJA 4EZJA 2FULA 2PM6A 2ETCA 4AY6A 4U07A 3HIZA 4ANXA 2KCVA 5JJ6A 3RSEG 4DLOA 5EX0A 2UWJG 1N4RA 2MRIA 3UM1A 3C3QA 3DPYA 3ML9A 5E76A 3NZSA 3IEGA 2J07A 1KT0A 1HH8A 1QYMA 2QY7A 1E8WA 3G2VA 4LEUA 1MHQA 3TWXA 3B7SA 2BEDA 4G26A 4GPMA 2XPZA 2VTBA 3U3WA 4TRQA 2M63A 4GB9A 3UTMA 4DX5D 2GRPB 2XPIA 4H7YA 4KZCA 3UKUG 4DPRA 2B0OE 4G11A 3C3RA 1RW2A 4WWOA 3UM3A 4DX7D 3JUIA 3DEPA 4G1TA 3FTWA 4HI8A 2BKGA 3QWPA 3PS6A 2KXPC 4E6HA 2LNIA 4I1OB 3CQCB 5FQ4A 3HG0D 2IOLA 4HORA 4G2VA 2AVPA 4RQIA 3LDZA 5D2MC 2BTDA 1HE8A 4GZ3A 3TGOA 2XRYA 3MYVA 4J0UA 4YNDA 5AJLA 3HXEA 1YMPA 4WWNA 4ACLA 2WQHA 3PUKA 5AQ9A 2LXMA 3PZ3A 3RO2A 2LAIA 4UQYA 3PZ1A 2KCLA 3CHPA 2DYRE 3D9PA 4HVBA 2HE0A 3ZRHA 3W9FA 5CRVA 4YDWA 4NACA 3CVPA 4I6EA 4B0ZA 2X3MA 4Q94A 3E37A 4WWPA 3CR3A 3MEKA 3KAEA 4OVVA 3ESLA 3OXFA 3AU5A 4EECA 1HG2A 4N39A 4U0SA 3PRZA 5DIZA 3JXIA 3TJPA 2YHEA 2WXIA 4K5AB 4LNBA 5CBOA 4M3OA 3SBTB 3OXLA 2QYUA 2PL2A 3NOCD 5EIDA 1E7VA 2P9NG 4XX5A 2RFMA 3PE3A 4UQZA 2RFAA 4BFRA 5KJMA 4ACKA 2WXFA 5FZRA 1TNBA 3QWVA 1DCQA 5CBNA 5KNHD 3HXBA 2WXQA 3KEAA 4HBDA 3RRUA 3ZEFA 1BI7B 2A4ZA 2WXJA 4BETA 3TXNA 3PREA 2PQRA 3UMVA 1N11A 3CVQA 4BTBA 4CYMD 1TN7A 1FVHA 2J09A 3ONLA 1DNPA 3FTYA 5HKPA 3ISMC 3V2XA 3CLJA 1ELKA 3ZFWA 4AV7A 4XKCA 2IJGX 5B1AE 4K5BA 3FU6A 2E0IA 4U63A 5HI7A 4LNUD 2P9UG 5JJTA 2FO1E 3ABKE 3QARA 3FUMA 1UN9A 3OXGA 5ENNA 4ATZD 4B89A 1LF8A 3DSTA 1Z5SC 2UY1B 3ZW3A 2WMOA 1OY3D 1H6OA 4BSXA 3RU0A 2DYSE 5ENTD 2KC7A 3T5VA 3P1UA 3FU3A 2JABA 4FULA 2R59A 4GAAA 2IQCA 4AEZC 5EN5D 2LUHA 5G05C 3TWUA 3Q7FA 4HQDA 1K8KG 5ENPD 1E7UA 1O1RA 4APFA 3E30A 1N0QA 3ASFA 2X38A 4LCTA 4HNAD 2VJ8A 5FTPA 1FCHA 5BW8C 3SBSA 4YDOA 5EYPF 3FUDA 3VTXA 4C9BB 3NF1A 3GZ2A 4CRWA 2WXKA 4XZ4A 1QQEA 2RKKA 3KD7A 4JL0A 5FINA 1OWNA 3QAQA 4U8HA 4CDNA 2PM7A 1HX8A 4U7EB 4GA1A 1WDYA 4HS2A 1JUQA 2VGXA 4Q96A 4GA0A 4EHMA 1N94A 3V31A 1UJKA 3FUEA 3CVXA 3ZUVB 1H19A 3PZ2A 2L6JA 4J7WA 4N2SA 2H6HA 2J4BA 3EJNA 2MYOA 4GMRA 5T4YA 2VGYA 4N2QA 4XI0A 4OVUA 2CHWA 1KZOA 3TWTA 2NXPA 4PH4B 1TNOA 3FHEA 1SA4A 5D66A 4GMLA 3SY2A 3HHMA 5KBAA 2IF4A 4O1PA 3UI2A 2V5QC 3CHOA 1E96B 2WPVA 4CT4A 4DLQA 2R05A 5EYLA 3S7DA 3CHRA 1N4PA 4NQ0A 2VSXE 4RVBA 3GZ1A 1KLXA 4HI9A 5AQAA 4KXKB 1OCZE 3FFLA 5AQBA 5IY5E 4F53A 4GCOA 2KCKA 2X6JA 2XQ0A 3LY7A 2ZU6B 3EU9A 1DVPA 4ZHBA 3W9GA 3TWWA 2IY0C 1EF1C 4KZ0A 5G04C 4DUIA 3S7FA 4CGVA 3ZYLA 1N4QA 4PS7A 3ZN3A 1G3NB 4ANWA 2R2LA 1KT1A 2GGFA 4GZCA 3HXFA 4I2ZA 4MKTA 2Y69E 5FT9A 4P29A 3FTXA 2XZTG 4FC8A 1QZ2A 4F1SA 4Y6WA 2OEVA 4HB5A 4N3AA 2V5FA 3WXXA 4EPZA 3U66A 5CMYA 3RRNB 4E85A 3S2AA 5BXOA 2GRQB 1QNFA 1NP7A 2PZIA 3RRMB 5BV1A
chains in the Genus database with same CATH topology
2XGOA 3QWPA 4O6FA 3PS6A 1X5BA 3KEZA 5G2NA 4E6HA 4KT6B 3URZA 2LNIA 1S0PA 2BUGA 3CHQA 4I1OB 3CQCB 4PS8A 3CHMA 4GYYA 5FQ4A 4A3TA 4ILHB 3D9NA 5ANLA 2IOLA 5A23A 1SQMA 3CVWA 3GZSA 4HORA 3MJWA 4G2VA 5FWQA 2AVPA 2WXOA 3MKRA 2MOWA 1YA0A 3I4GA 4MLPA 4CCAA 5LCWC 3LDZA 3PH0C 3FUHA 3QWWA 4XI9A 2BTDA 1HE8A 2CG2A 4HXIA 3QKYA 3N71A 4HOUA 4GZ3A 3RJVA 2BF0X 2XRYA 4RG9A 5A6CA 2CHZA 3D9MA 3MYVA 3TGOA 4J0UA 4YNDA 4FLHA 3QDNA 4FJYA 2I1KA 5AJLA 3IHYA 2CFUA 4I2WA 4WWNA 4ACLA 3BG1B 2KM4A 2WQHA 4RSYA 3PUKA 4NRHB 4ATGA 3ESKA 3RO2A 3ZXSA 2LAIA 4J8FA 4UQYA 2P58C 3TG4A 4DI4A 4U04A 4LUNU 2KCLA 3CHPA 3FU0A 3SF4A 3I4RB 3OAWA 3OTNA 2L0IA 4BY6A 3CVUA 4CT0A 3D9PA 4BTAA 4HVBA 3ZRHA 2LAHA 3UUXA 1A17A 1H6KA 3P2BA 4NACA 3CVPA 4JVSA 4I6EA 4UWGA 2X3MA 3C98A 3BEEA 4Q94A 3U9WA 4B0ZA 2I1JA 4WWPA 3CR3A 3MEKA 1ZBPA 3KAEA 3PDNA 2XEVA 4OVVA 5G55A 4IRUA 1Z3XA 3ESLA 2ILRA 3OXFA 3KS2A 5J90A 2VTBB 4FHKA 3SHFA 1IQRA 1U3CA 4J8SA 3RKVA 3NZUA 3PE4A 4JEHA 3AU5A 2IOSA 1E8ZA 2Q7FA 1HG2A 4EECA 4N39A 4U0SA 3PRZA 4R7LA 2XPYA 1PC2A 2YHEA 3MX3A 5DIZA 3TJPA 2J08A 1SZ9A 2WXIA 5ANRA 5KJLA 5CCMA 1WAO1 3IV0A 5FJYA 2WVIA 4M3OA 4GZDA 2CHXA 3HDXA 2A5UA 3SBTB 3OXLA 5FQ7A 1E90A 3JCKC 2PL2A 4EZLA 3L08A 2JLBA 4FLBA 3FU5A 3PNLB 2DCPA 4GA2A 3SNXA 5LCWJ 2HYZA 4RG6A 3PEUB 4AY5A 3APFA 3LEWA 4ILGA 1E7VA 4XX5A 3VLDA 3PE3A 3PVLA 4UQZA 3QNKA 2CG3A 2UY1A 3CGHA 4BFRA 4LERA 4Q69A 3CVLA 2YHCA 5FQ6A 2LSUA 5JJ7A 5LX8A 4WUYA 4WNEA 4L23A 5KJMA 4ACKA 1EYHA 2WXFA 5FZRA 4F7AA 3CIAA 3CEQA 3QWVA 3TL5A 5J08A 4KVOA 2WXQA 2I9CA 4V3IA 2Y3AA 3FTUA 3E4BA 3IBEA 3Q15A 5FZSA 3RRUA 4K0RA 3ZEFA 4DJAA 2A4ZA 3PZDA 2WXJA 4URKA 4CGWA 2GRLA 4UWHA 3TXNA 3PREA 1U3DA 2PQRA 4L1BA 5E75A 2KZTB 3UMVA 3VLEA 3CVYA 3CVQA 4ABNA 4EQFA 1HS6A 4JC8A 4BTBA 4I9EA 4UWFA 1FVHA 5FZQA 2WQ6A 2J09A 3K9IA 1HF8A 2OOEA 1N52A 3FWVA 1DNPA 3ONLA 4PS3A 3FTYA 3UT4A 1FVFA 4WAFA 4GZ6A 4AXHA 3CLJA 4B94A 1ELKA 5AYWD 4UQXA 3ZFWA 4JEUA 5AJDA 1W3BA 4AV7A 4XKCA 4WNFA 2I6HA 2IJGX 3ZYQA 4HOQA 3ASHA 4EZKA 4GYOA 2J49A 3FU6A 1H0AA 2E0IA 4U63A 5HI7A 3R7RA 3SD5A 5JJTA 3QARA 4I6JA 2AW6A 2J4DA 3FUMA 4G24A 1UN9A 4W9RA 3OXGA 2VSNA 3SGHA 3U4TA 3MCXA 4AVXA 2AXVA 3AS4A 5ENNA 2HR2A 2MHKA 3FTVA 3UPVA 2X6FA 3G2UA 4GYWA 4B89A 1IQUA 2WM9A 1LF8A 2NSZA 4IN3B 4PDXA 4N5CA 5C2YA 2UY1B 3JQ1A 4ANUA 4UI9K 2WXNA 3ZW3A 2JEKA 2J9QA 2PQNA 4ILIA 2WMOA 4HLEA 2LO6A 4I6GA 4JW1A 4I17A 3D9KA 4KBQA 2WXRA 4BSXA 4GPKA 3RU0A 2FEZA 3HVEB 2KC7A 3T5VA 1HZ4A 2KZTA 2XHEA 3P1UA 2GRMA 3FU3A 1NA3A 4FULA 3IKOB 2R59A 3D9IA 2VQ2A 4QFVA 5A7DB 1E8XA 4GAAA 3L54A 4G23A 3S7BA 2IQCA 2X6HA 4UWKA 3RK6A 4AEZC 3VTYA 4NURA 5LP0A 4JHKA 4GZ5A 4TUUA 4UI9J 2AXZA 1OUVA 3EIJA 5AENA 5G05C 5KJNA 1MQSA 2VGXB 1GW6A 1E7UA 4APFA 4J8DA 5BV0A 2XCCA 5M72A 1PY1A 3SFZA 3FEXA 3ASFA 3ASDA 2FF4A 3B7UX 3JYSA 3MKQB 3SZ7A 2X38A 3LVRE 4LCTA 1TJCA 2L9BA 3O48A 4A1GA 2VJ8A 5FTPA 2LSVA 1FCHA 5BW8C 3SBSA 2XRZA 1Z6TA 3MV2B 2WMNA 3ZHEB 3FUDA 4B8AA 4B8CB 4JPSA 3CVNA 3FUJA 3CV0A 2V8SE 3ZYMA 4CDMA 3VTXA 2X6KA 3CHSA 4C9BB 4CDRA 4GU5A 3FP3A 4DI3A 3NF1A 5C1DA 4ANVA 2C2LA 3GZ2A 3D3MA 4H7XA 4XIFA 4C0EA 5EKQD 4CRWA 4WNGA 2WXKA 4XZ4A 4YVOA 4AP2A 3FH7A 3ZIMA 1QQEA 5BPPA 5T3RA 3KD7A 3FUIA 3Q47B 4JL0A 3HVEA 2HO1A 4UWLA 4BT9A 2YQ8A 4MRUA 5CCLA 2DBAA 4A3VA 2CFZA 1OWNA 1SZAA 3ZYKA 3QAQA 4XE0A 4U8HA 2V0PA 3LY8A 2GW1A 3AU4A 4CDNA 2YNQA 2PM7A 3CK7A 1HX8A 2WXMA 5G05J 5KCMA 4GA1A 2R17C 4HS2A 1JUQA 5KJKA 2I2OA 1EDUA 2VGXA 4Q96A 4LRZA 2OV8A 4HOSA 4GA0A 2R5SA 2WXPA 3PUJA 2KATA 3FTZA 3LCAA 3L22A 1UW4B 4YVQC 3B7RL 1UJKA 3D9LA 4JZYA 3FUEA 4KYOB 4AIFA 1TJFA 3MKQA 3I3NA 3CVXA 5CHEE 1HFAA 4GCNA 5D0QD 4G25A 4KMOA 1H19A 3UX4A 1E8YA 5BNWA 3G2SA 3MZLB 1HO8A 3CKCA 3EHMA 2L6JA 3LY9A 4XKBA 4UI9C 3APCA 1XNFA 3ZHEA 3CVVA 3FTSA 3FULA 4N2SA 3U64A 2IONA 4FP7A 3ENEA 3UT7A 2J4BA 2XCBA 3EJNA 1JWGA 3CQGB 3RO3A 4EBAG 3CK9A 3CSFA 5T4YA 2VGYA 4N2QA 3ML8A 1JPLA 2NC9A 4XI0A 1B89A 4OVUA 1OWPA 2CHWA 4I1AA 4I1MA 3UQ3A 3GYZA 3ZGQA 2OVFA 4I9CA 1H2VC 1Y6IA 3D9OA 3DPDA 2NXPA 4GMJA 3FUNA 2Y4TA 5G04J 2VSYA 4FADA 4ME2A 1OWLA 4KVMA 3FH5A 4PH4B 2IU1A 3CKBA 4PUCA 2V4LA 5T8IA 5BT1A 2WB2A 2L0TB 3FHEA 1Z3YA 4GMLA 4WNDA 3HHMA 5D0OD 4I43A 2IF4A 4L2LA 4DK5A 1ZU2A 4U0UA 3LJ3A 4N3BA 4MS6A 5BUZA 1XGWA 3IHVA 4JXTA 3CHOA 1E96B 5EX3A 3FH8A 2RG8A 4J8EA 5EDSA 1TEZA 4FJZA 2Y4UA 3FDHA 2WPVA 5HQ8A 3AS8A 3ONKA 4CT4A 3B7TA 4DLQA 2EQXA 4TV3A 5ARGA 4IYPA 1N54A 2WXGA 4Y6CA 4IULA 2RD0A 3S7DA 2WQ7A 1HU3A 1INZA 1WY6A 2X6IA 5JHAA 1UJJA 2FI7A 3RIBA 1L5JA 3CHRA 1VDYA 4NQ0A 3MGBA 3ASGA 3QOUA 3FY4A 4JA9A 4U0ZA 2XGSA 2VSXE 3G2TA 4RVBA 2XGMA 3B13A 3L6AA 3G2WA 3GZ1A 5LFAA 1IHGA 1KLXA 2QFCA 2OVBA 1ELWA 4J6IA 3S7JA 4OYSA 4EBAA 4KXKB 4JA7A 3QK0A 3ZVVA 4HOTA 1WM5A 2C0MA 3APDA 3L13A 3ZPJA 3FFLA 3NQPA 1PAQA 1H2UA 2YINA 3LKUA 4F53A 1UG3A 1HXIA 4JHRA 3MA5A 4A55A 1EPUA 3PEVB 2KCKA 4GCOA 4FU3A 3I5PA 3LPZA 3QB2A 3QC1A 3FUFA 2HM8A 2X6JA 2XQ0A 3HYMB 3JQ0A 3R9AB 3Q49B 3D9JA 3LY7A 4BX8A 5ARFA 2ZU6B 3Q5MA 1DVPA 3TAXA 1OWOA 4C0MA 4F3VA 4JHJA 1JWFA 3QJZA 1EF1C 3LS8A 4EZJA 5LOZA 2FULA 4KZ0A 2PM6A 4AM9A 3EDTB 3DBSA 4APOA 3GW4A 5G04C 4AY6A 5JHBA 3R7QA 4FHJA 3LYAA 4D10C 3ULQA 3EHNA 1HG5A 2FO7A 4U07A 3S7FA 3T5XA 4CEMA 3HIZA 4AJWA 3L16A 4ANXA 4CGVA 2KCVA 1NA0A 2WXHA 4HFGA 4BWRA 5AIJA 1IYGA 5JJ6A 2DIWA 4DLOA 4N3CA 2UWJG 5EX0A 3ZYLA 2MRIA 3AS5A 3FEYA 3TG5A 4PS7A 5E76A 5FQ8A 3ML9A 1OWMA 2AWIA 3CK8A 5CMWA 3NZSA 1NZNA 2J07A 1KT0A 3IEGA 3VLFA 3O4ZA 3ZN3A 1HH8A 2WXLA 4ANWA 2QY7A 1E8WA 1KT1A 2C0LA 2E2EA 3LXUX 3MV3B 2GGFA 3G2VA 4GZCA 4FA6A 1Y8MA 4I2ZA 4LEUA 1MHQA 4MKTA 4A1SA 3UT8A 3B7SA 5FT9A 2AXUA 4P29A 3FTXA 3FUKA 3L17A 2IFUA 1ELRA 2VYIA 4FC8A 4G26A 3T8MA 1QZ2A 1UN8A 4F1SA 4AOFA 1H2TC 2XPZA 4Y6WA 4N3AA 2VTBA 2V5FA 3WXXA 2FBNA 3U3WA 3SI5A 2VSOE 4EPZA 4TRQA 2M63A 4GB9A 4L2YA 3U66A 5CMYA 5DBKA 3RRNB 4BT8A 2XPIA 4E85A 3S2AA 3Q4AB 4H7YA 4KZCA 3CSTA 4DPRA 4G11A 4K03A 1QNFA 1BPOA 1NP7A 4BX9A 3BG0B 1P5QA 2PZIA 3EIQC 4WWOA 3TXMA 3LVQE 3RRMB 5BV1A 3JUIA 4L7TA 4G1TA 3FTWA 2ONDA 3PNTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JQ1 A;  3CK7 A;  5J90 A;  3QNK A;  3CGH A;  3KEZ A;  4Q69 A;  4LER A;  5FQ6 A;  3EJN A;  5E76 A;  5FQ8 A;  5LX8 A;  3CK8 A;  3CK9 A;  5T4Y A;  3MX3 A;  3FDH A;  5E75 A;  5FQ4 A;  3IV0 A;  3JYS A;  3OTN A;  5T3R A;  3GZS A;  3L22 A;  4F7A A;  3HDX A;  3P1U A;  3NQP A;  5FQ7 A;  3I4G A;  3SGH A;  4F53 A;  3EHN A;  3LEW A;  3MCX A;  4MRU A;  3SNX A;  3CKB A;  4PUC A;  3MYV A;  4L7T A;  3CKC A;  3EHM A;  3JQ0 A; 
#chains in the Genus database with same CATH topology
 1X5B A;  3KEZ A;  4LSZ E;  1S0P A;  4ILH B;  3D9N A;  2H6F A;  5A23 A;  3HXC A;  3MJW A;  1H6P A;  5FWQ A;  4GTO A;  2P9I G;  2MOW A;  2Y1L E;  3I4G A;  3V2O A;  2BKK B;  4JB8 P;  3QKY A;  4HOU A;  2BF0 X;  4RG9 A;  2CHZ A;  1YCS B;  4DRX E;  3L9T A;  4FJY A;  2I1K A;  2F8Y A;  4RSY A;  4NRH B;  2IEJ A;  2P9S G;  4J8F A;  4GTP A;  2P58 C;  3FU0 A;  3I4R B;  4BY6 A;  3CVU A;  4BTA A;  2ZXW E;  3X2Q E;  3AJI A;  1H6K A;  4UWG A;  3U9W A;  2I1J A;  1KPS B;  5G55 A;  4IRU A;  1U3C A;  3RKV A;  4DX1 A;  3AG1 E;  3J5Q B;  1PC2 A;  3L82 A;  2J08 A;  5CCM A;  1K1A A;  3Q9N C;  5FQ7 A;  1E90 A;  4FLB A;  3NAW A;  1TNU A;  2IO2 C;  4RG6 A;  1IXV A;  2Y0B G;  3LEW A;  2P9L G;  3QNK A;  4LER A;  2YHC A;  5JJ7 A;  5LX8 A;  4WUY A;  4L23 A;  2OCC E;  3TL5 A;  1SW6 A;  1D9S A;  3FTU A;  3IBE A;  3Q15 A;  4K0R A;  3NOG D;  4URK A;  4CGW A;  4L1B A;  3VLE A;  5FZQ A;  1TYQ G;  4XEI G;  3UT4 A;  4GTQ A;  4GZ6 A;  4B94 A;  1S63 A;  4WNF A;  1AWC B;  3UIN C;  3IXE A;  4GYO A;  1H0A A;  4I6J A;  1V54 E;  3SGH A;  3MCX A;  2HR2 A;  2MHK A;  2EIN E;  3RAU A;  2ZGD A;  4PDX A;  3BQO A;  4N5C A;  5C2Y A;  4ANU A;  2JEK A;  4JW1 A;  4KBQ A;  2WXR A;  1X81 A;  1N9A A;  2GRM A;  4QFV A;  5A7D B;  1E8X A;  3KSL A;  2X6H A;  3RK6 A;  4U96 D;  4JHK A;  4TUU A;  3EIJ A;  2QZA A;  2VGX B;  1GW6 A;  4TXP A;  1PY1 A;  3B7U X;  3SZ7 A;  3D9H A;  1TJC A;  3O48 A;  4N5Q A;  1Z6T A;  2WMN A;  3LJN A;  4B8A A;  4JPS A;  3FUJ A;  5ENO D;  3CHS A;  4CDR A;  5CEA A;  3C5R A;  4GTS A;  4DI3 A;  4H7X A;  4C0E A;  5EKQ D;  3ZIM A;  3FH7 A;  2P2C P;  5AAO A;  3E32 A;  3FUI A;  3Q47 B;  3HVE A;  2HO1 A;  4BT9 A;  1BI8 B;  2CFZ A;  3ZYK A;  4HRL A;  2GW1 A;  2YNQ A;  3CK7 A;  2H6I A;  4G8L A;  4G8K A;  3UM2 A;  3BUA A;  2WXP A;  3FTZ A;  3L22 A;  4YVQ C;  3B7R L;  4JZY A;  1TJF A;  3I3N A;  4GCN A;  4KMO A;  2V4H C;  5BNW A;  3G2S A;  1HO8 A;  3LY9 A;  4XKB A;  4UI9 C;  1XNF A;  3FUL A;  3DSV A;  1DCE A;  3V79 K;  3CQG B;  3ZXP A;  4EBA G;  1B89 A;  1OWP A;  1FT1 A;  3ZGQ A;  4I1M A;  1MX6 A;  4L9P A;  1H2V C;  3E33 A;  3D9O A;  2Y4T A;  2V4L A;  4WND A;  1OCC E;  3EHQ A;  5HRY A;  3LJ3 A;  2DVW A;  3NBN B;  1MX2 A;  5EX3 A;  3FH8 A;  2RG8 A;  1OXJ A;  3FDH A;  1WG0 A;  3B7T A;  2EQX A;  5CRU A;  4IUL A;  2RD0 A;  2WQ7 A;  5JHA A;  1UJJ A;  2FI7 A;  1U2V G;  1VDY A;  3ASG A;  4JA9 A;  4U0Z A;  2XGS A;  3L6A A;  3G2W A;  2QFC A;  1K3Z D;  4OYS A;  4EBA A;  4JA7 A;  3QK0 A;  3UIP C;  3APD A;  2YIN A;  1OCR E;  1HXI A;  3MA5 A;  2L6B A;  3QB2 A;  3JQ0 A;  3HYM B;  3UIO C;  3D9J A;  4QQI A;  4BX8 A;  5ARF A;  3Q5M A;  3TAX A;  3QJZ A;  3LS8 A;  3TWQ A;  4AM9 A;  2GRR B;  3DBS A;  3GW4 A;  2B6C A;  3R7Q A;  3NB2 A;  3LYA A;  3EHN A;  3T5X A;  2FO7 A;  4AJW A;  1NA0 A;  4BWR A;  2DIW A;  2EIM E;  2ZIR A;  3AS5 A;  5FQ8 A;  3CK8 A;  2XRZ A;  1NZN A;  3PZ4 A;  5ENR D;  4BSZ B;  1S70 B;  2WXL A;  3ABM E;  2C0L A;  2E2E A;  3LXU X;  3MV3 B;  4FA6 A;  1Y8M A;  4A1S A;  3UT8 A;  2AXU A;  4A63 B;  3E34 A;  1ELR A;  3T8M A;  2A5E A;  4AOF A;  2ETA A;  4DX6 D;  2VSO E;  2VGE A;  3C3O A;  3EUV A;  5DBK A;  3Q78 A;  3CST A;  2XS8 A;  1QBQ A;  4K03 A;  1BPO A;  3EIQ C;  3TXM A;  3LVQ E;  3ASN E;  2XGO A;  4O6F A;  2F37 A;  3UXG A;  5G2N A;  3URZ A;  3SFY A;  2BUG A;  4PS8 A;  3CHM A;  4GTM A;  4A3T A;  5ANL A;  3DWL G;  1YA0 A;  4CCA A;  4XI9 A;  1MJ0 A;  4HXI A;  3N71 A;  1YYH A;  3RJV A;  3D9M A;  4C48 B;  4FLH A;  4I2W A;  1LTX A;  3DRA A;  4U8V D;  4DI4 A;  4U04 A;  3SF4 A;  3OAW A;  4CT0 A;  4TXQ A;  3UUX A;  1A17 A;  3P2B A;  4JVS A;  3C98 A;  3BEE A;  3PDN A;  2XEV A;  5KNG A;  3KS2 A;  5J90 A;  2VTB B;  3SHF A;  3NZU A;  4JEH A;  2IOS A;  2DZN A;  4R7L A;  3ABL E;  1SZ9 A;  5ANR A;  1WAO 1;  3IV0 A;  5FJY A;  2QC9 A;  4GZD A;  2CHX A;  3HDX A;  2A5U A;  3Q9U C;  2ZIS A;  2JLB A;  3FU5 A;  3SNX A;  5LCW J;  3PEU B;  3APF A;  4J8Y A;  4ILG A;  2DWZ A;  2UY1 A;  4Q69 A;  4HRM B;  3CVL A;  5FQ6 A;  2LSU A;  4WNE A;  1SA5 A;  1EYH A;  1LD7 A;  3CIA A;  3CEQ A;  4KVO A;  2Y3A A;  4TUM A;  5FZS A;  4DJA A;  3PZD A;  4JD2 G;  4UWH A;  2NYJ A;  1U3D A;  3CVY A;  4M7C A;  4ABN A;  4EQF A;  1HS6 A;  4JC8 A;  4I9E A;  4UWF A;  1O1T A;  2WQ6 A;  3AAA C;  1HF8 A;  1N52 A;  3FWV A;  2J8S D;  1FVF A;  5JMN D;  4UQX A;  1D8D A;  4GTR A;  3F6Q A;  2I6H A;  2XS1 A;  3ZYQ A;  4HOQ A;  4U8Y D;  1KZP A;  3SD5 A;  3R7R A;  3EU5 A;  2EIJ E;  2AJA A;  2AW6 A;  2J4D A;  4W9R A;  2VSN A;  5AAR A;  4AVX A;  2P9K G;  3FTV A;  2X6F A;  4GYW A;  2WM9 A;  2NSZ A;  3JQ1 A;  2WXN A;  2R03 A;  2J9Q A;  4HLE A;  5ENS D;  3HVE B;  2KZT A;  2XHE A;  1NA3 A;  3IKO B;  4G23 A;  4UWK A;  3VTY A;  5B3S E;  5LP0 A;  4GZ5 A;  3ZKJ A;  4BER A;  5AEN A;  5KJN A;  4J8D A;  2XCC A;  4GTT A;  1DC2 A;  3SFZ A;  3FEX A;  5CEC B;  3UKR G;  2LSV A;  3HRA A;  3MV2 B;  4ZFH A;  3CV0 A;  2V8S E;  3ZYM A;  1V55 E;  4GU5 A;  5C1D A;  3D3M A;  4XIF A;  2XEH A;  4WNG A;  1IHB A;  4LG6 A;  4AP2 A;  5BPP A;  5T3R A;  3Q79 A;  3HXD A;  4UWL A;  2ZGG A;  5CED B;  2DBA A;  4A3V A;  3TWR A;  1SZA A;  4XE0 A;  5ENQ D;  2V0P A;  4CZ2 D;  2WXM A;  1NI1 A;  3DXM G;  1RZ4 A;  5KJK A;  2I2O A;  4B93 B;  2OV8 A;  1D8E A;  3LCA A;  3D9L A;  4KYO B;  2OEW A;  3MKQ A;  1E8Y A;  3MZL B;  3ZHE A;  3EHM A;  3CVV A;  3APC A;  2ION A;  3ENE A;  3UT7 A;  2XCB A;  1OT8 A;  3RO3 A;  4I1A A;  5FIO A;  2OVF A;  4I9C A;  1TN6 A;  5G04 J;  4FAD A;  3FUN A;  1OWL A;  4KVM A;  3FH5 A;  2KBX A;  5T8I A;  5BT1 A;  2WB2 A;  1Z3Y A;  4MS6 A;  1XGW A;  3V30 A;  4JXT A;  4J8E A;  1TEZ A;  4FJZ A;  2Y4U A;  5HQ8 A;  4IYP A;  3DXK G;  1N54 A;  2WXG A;  2XZD G;  2X6I A;  1TNZ A;  1L5J A;  1AP7 A;  3G2T A;  1Q2Z A;  1IHG A;  4J6I A;  3S7J A;  2C0M A;  4O1O A;  3L13 A;  2EIK E;  3ZPJ A;  1BD8 A;  1H2U A;  3LKU A;  3PEV B;  4FU3 A;  3QC1 A;  2HM8 A;  3JXJ A;  3Q49 B;  1JCQ A;  4C0M A;  1JWF A;  2P9P G;  5LOZ A;  5KWD A;  4O60 A;  3EDT B;  4APO A;  5JHB A;  4FHJ A;  4D10 C;  3ULQ A;  1HG5 A;  3Q75 A;  4CEM A;  1FPP A;  3L16 A;  1FT2 A;  2WXH A;  4HFG A;  5AIJ A;  1TR4 A;  1IYG A;  3ZU7 B;  4N3C A;  4UUC A;  3FEY A;  3TG5 A;  1N0R A;  3EHR A;  1OWM A;  2AWI A;  5CMW A;  2F8X K;  3VLF A;  3O4Z A;  3B7B A;  5JA4 D;  1BLX B;  3FUK A;  3L17 A;  2IFU A;  2F0Y A;  4F6R D;  2VYI A;  1ZB1 A;  2R02 A;  3C72 A;  1UN8 A;  1H2T C;  2FBN A;  3SI5 A;  1JCR A;  4L2Y A;  3UM0 A;  4MBG A;  4BT8 A;  3Q4A B;  4BX9 A;  1N95 A;  3BG0 B;  1P5Q A;  4L7T A;  4YDE A;  2OND A;  3QDN A;  3PNT B;  2GRN B;  4HRN A;  4NIK A;  1K1B A;  4Z68 A;  4KT6 B;  3CHQ A;  4GYY A;  1SQM A;  3CVW A;  1BU9 A;  3GZS A;  2WXO A;  3MKR A;  4MLP A;  5LCW C;  3PH0 C;  3FUH A;  3QWW A;  2CG2 A;  5A6C A;  4DX2 A;  4OAV B;  3IHY A;  2CFU A;  3BG1 B;  2KM4 A;  5HS0 A;  5AN8 A;  4YDY A;  4ATG A;  3ESK A;  5EIB E;  3ZXS A;  4U95 D;  3TG4 A;  3ASO E;  4LUN U;  3OTN A;  2L0I A;  5H7P A;  4TXR A;  2LAH A;  2EIL E;  1IKN D;  1O5M A;  1ZBP A;  1Z3X A;  3R9M A;  2ILR A;  3DSU A;  4FHK A;  1IQR A;  4J8S A;  3PE4 A;  3WG7 E;  1E8Z A;  2Q7F A;  2XPY A;  3MX3 A;  5KJL A;  3J5P A;  2WVI A;  3T8K A;  3T9K A;  3JCK C;  4EZL A;  3L08 A;  3PNL B;  2DCP A;  4GA2 A;  4BEP A;  2HYZ A;  4HLL A;  4AY5 A;  1S64 A;  3VLD A;  3PVL A;  2CG3 A;  3CGH A;  5EIL A;  4F7A A;  5J08 A;  4V3I A;  2I9C A;  3TWS A;  3E4B A;  2GRL A;  5E75 A;  2KZT B;  3Q73 A;  1A5E A;  5BXU A;  3K9I A;  4PS3 A;  2OOE A;  4WAF A;  4AXH A;  5AYW D;  4JEU A;  5AJD A;  1W3B A;  1N4S A;  3ASH A;  4EZK A;  2XEE A;  2J49 A;  5B1B E;  3B95 A;  4G24 A;  3U4T A;  2AXV A;  3AS4 A;  3DSX A;  3UPV A;  3G2U A;  4X8Q A;  1IQU A;  4IN3 B;  4UI9 K;  3SO8 A;  2PQN A;  4ILI A;  4OAU C;  2LO6 A;  4I6G A;  1MYO A;  4I17 A;  3D9K A;  4GPK A;  2FEZ A;  3ULE G;  1HZ4 A;  4BES A;  3D9I A;  2VQ2 A;  3L54 A;  3S7B A;  1LD8 A;  4NUR A;  4UI9 J;  2AXZ A;  1OUV A;  1UOH A;  1MQS A;  5BV0 A;  5M72 A;  2DZO A;  3ASD A;  2FF4 A;  3JYS A;  3MKQ B;  1TN8 A;  3LVR E;  2L9B A;  4A1G A;  3SQV A;  3ZHE B;  4B8C B;  3CVN A;  4CDM A;  2X6K A;  3FP3 A;  4ANV A;  2C2L A;  3AG2 E;  3TWV A;  3KSQ A;  4GTV A;  3Q7A A;  4YVO A;  2H6G A;  2YQ8 A;  4MRU A;  5CCL A;  3ZNG A;  3LY8 A;  2XEN A;  3AU4 A;  5G05 J;  5KCM A;  2R17 C;  1EDU A;  4LRZ A;  4HOS A;  2IO3 C;  2R5S A;  4LNG A;  1TNY A;  3PUJ A;  2KAT A;  1UW4 B;  4AIF A;  1SVX A;  5CHE E;  1HFA A;  5D0Q D;  4G25 A;  3BU8 A;  1O1S A;  3UX4 A;  3CKC A;  5CER B;  3FTS A;  3DEO A;  3U64 A;  4FP7 A;  1JWG A;  3CK9 A;  3CSF A;  3ML8 A;  1JPL A;  2NC9 A;  3DSS A;  3UQ3 A;  3GYZ A;  1Y6I A;  3DPD A;  4GMJ A;  2VSY A;  4ME2 A;  2IU1 A;  3CKB A;  4PUC A;  2L0T B;  5AQ7 A;  5ITZ F;  5D0O D;  4I43 A;  4L2L A;  4DK5 A;  1ZU2 A;  4U0U A;  4N3B A;  4RLY A;  5BUZ A;  3AG3 E;  3IHV A;  2LXL A;  3JUE A;  5EDS A;  3AS8 A;  3ONK A;  4TV3 A;  5ARG A;  3ULY A;  4Y6C A;  1HU3 A;  1INZ A;  1WY6 A;  3RIB A;  1MX4 A;  1OCO E;  3MGB A;  3QOU A;  3FY4 A;  2XGM A;  3B13 A;  1NFI E;  5LFA A;  2OVB A;  1NL4 A;  1ELW A;  3ZVV A;  4K5C A;  1WM5 A;  4HOT A;  2QYJ A;  2ETB A;  1JCS A;  3NQP A;  1PAQ A;  3DSW A;  2PNN A;  1UG3 A;  4JHR A;  2GRO B;  1EPU A;  4A55 A;  3AG4 E;  4F1P A;  3I5P A;  3LPZ A;  3FUF A;  3R9A B;  3SFX A;  1OWO A;  4F3V A;  1MZC A;  4JHJ A;  4EZJ A;  2FUL A;  2PM6 A;  2ETC A;  4AY6 A;  4U07 A;  3HIZ A;  4ANX A;  2KCV A;  5JJ6 A;  3RSE G;  4DLO A;  5EX0 A;  2UWJ G;  1N4R A;  2MRI A;  3UM1 A;  3C3Q A;  3DPY A;  3ML9 A;  5E76 A;  3NZS A;  3IEG A;  2J07 A;  1KT0 A;  1HH8 A;  1QYM A;  2QY7 A;  1E8W A;  3G2V A;  4LEU A;  1MHQ A;  3TWX A;  3B7S A;  2BED A;  4G26 A;  4GPM A;  2XPZ A;  2VTB A;  3U3W A;  4TRQ A;  2M63 A;  4GB9 A;  3UTM A;  4DX5 D;  2GRP B;  2XPI A;  4H7Y A;  4KZC A;  3UKU G;  4DPR A;  2B0O E;  4G11 A;  3C3R A;  1RW2 A;  4WWO A;  3UM3 A;  4DX7 D;  3JUI A;  3DEP A;  4G1T A;  3FTW A;  4HI8 A;  2BKG A;  3QWP A;  3PS6 A;  2KXP C;  4E6H A;  2LNI A;  4I1O B;  3CQC B;  5FQ4 A;  3HG0 D;  2IOL A;  4HOR A;  4G2V A;  2AVP A;  4RQI A;  3LDZ A;  5D2M C;  2BTD A;  1HE8 A;  4GZ3 A;  3TGO A;  2XRY A;  3MYV A;  4J0U A;  4YND A;  5AJL A;  3HXE A;  1YMP A;  4WWN A;  4ACL A;  2WQH A;  3PUK A;  5AQ9 A;  2LXM A;  3PZ3 A;  3RO2 A;  2LAI A;  4UQY A;  3PZ1 A;  2KCL A;  3CHP A;  2DYR E;  3D9P A;  4HVB A;  2HE0 A;  3ZRH A;  3W9F A;  5CRV A;  4YDW A;  4NAC A;  3CVP A;  4I6E A;  4B0Z A;  2X3M A;  4Q94 A;  3E37 A;  4WWP A;  3CR3 A;  3MEK A;  3KAE A;  4OVV A;  3ESL A;  3OXF A;  3AU5 A;  4EEC A;  1HG2 A;  4N39 A;  4U0S A;  3PRZ A;  5DIZ A;  3JXI A;  3TJP A;  2YHE A;  2WXI A;  4K5A B;  4LNB A;  5CBO A;  4M3O A;  3SBT B;  3OXL A;  2QYU A;  2PL2 A;  3NOC D;  5EID A;  1E7V A;  2P9N G;  4XX5 A;  2RFM A;  3PE3 A;  4UQZ A;  2RFA A;  4BFR A;  5KJM A;  4ACK A;  2WXF A;  5FZR A;  1TNB A;  3QWV A;  1DCQ A;  5CBN A;  5KNH D;  3HXB A;  2WXQ A;  3KEA A;  4HBD A;  3RRU A;  3ZEF A;  1BI7 B;  2A4Z A;  2WXJ A;  4BET A;  3TXN A;  3PRE A;  2PQR A;  3UMV A;  1N11 A;  3CVQ A;  4BTB A;  4CYM D;  1TN7 A;  1FVH A;  2J09 A;  3ONL A;  1DNP A;  3FTY A;  5HKP A;  3ISM C;  3V2X A;  3CLJ A;  1ELK A;  3ZFW A;  4AV7 A;  4XKC A;  2IJG X;  5B1A E;  4K5B A;  3FU6 A;  2E0I A;  4U63 A;  5HI7 A;  4LNU D;  2P9U G;  5JJT A;  2FO1 E;  3ABK E;  3QAR A;  3FUM A;  1UN9 A;  3OXG A;  5ENN A;  4ATZ D;  4B89 A;  1LF8 A;  3DST A;  1Z5S C;  2UY1 B;  3ZW3 A;  2WMO A;  1OY3 D;  1H6O A;  4BSX A;  3RU0 A;  2DYS E;  5ENT D;  2KC7 A;  3T5V A;  3P1U A;  3FU3 A;  2JAB A;  4FUL A;  2R59 A;  4GAA A;  2IQC A;  4AEZ C;  5EN5 D;  2LUH A;  5G05 C;  3TWU A;  3Q7F A;  4HQD A;  1K8K G;  5ENP D;  1E7U A;  1O1R A;  4APF A;  3E30 A;  1N0Q A;  3ASF A;  2X38 A;  4LCT A;  4HNA D;  2VJ8 A;  5FTP A;  1FCH A;  5BW8 C;  3SBS A;  4YDO A;  5EYP F;  3FUD A;  3VTX A;  4C9B B;  3NF1 A;  3GZ2 A;  4CRW A;  2WXK A;  4XZ4 A;  1QQE A;  2RKK A;  3KD7 A;  4JL0 A;  5FIN A;  1OWN A;  3QAQ A;  4U8H A;  4CDN A;  2PM7 A;  1HX8 A;  4U7E B;  4GA1 A;  1WDY A;  4HS2 A;  1JUQ A;  2VGX A;  4Q96 A;  4GA0 A;  4EHM A;  1N94 A;  3V31 A;  1UJK A;  3FUE A;  3CVX A;  3ZUV B;  1H19 A;  3PZ2 A;  2L6J A;  4J7W A;  4N2S A;  2H6H A;  2J4B A;  3EJN A;  2MYO A;  4GMR A;  5T4Y A;  2VGY A;  4N2Q A;  4XI0 A;  4OVU A;  2CHW A;  1KZO A;  3TWT A;  2NXP A;  4PH4 B;  1TNO A;  3FHE A;  1SA4 A;  5D66 A;  4GML A;  3SY2 A;  3HHM A;  5KBA A;  2IF4 A;  4O1P A;  3UI2 A;  2V5Q C;  3CHO A;  1E96 B;  2WPV A;  4CT4 A;  4DLQ A;  2R05 A;  5EYL A;  3S7D A;  3CHR A;  1N4P A;  4NQ0 A;  2VSX E;  4RVB A;  3GZ1 A;  1KLX A;  4HI9 A;  5AQA A;  4KXK B;  1OCZ E;  3FFL A;  5AQB A;  5IY5 E;  4F53 A;  4GCO A;  2KCK A;  2X6J A;  2XQ0 A;  3LY7 A;  2ZU6 B;  3EU9 A;  1DVP A;  4ZHB A;  3W9G A;  3TWW A;  2IY0 C;  1EF1 C;  4KZ0 A;  5G04 C;  4DUI A;  3S7F A;  4CGV A;  3ZYL A;  1N4Q A;  4PS7 A;  3ZN3 A;  1G3N B;  4ANW A;  2R2L A;  1KT1 A;  2GGF A;  4GZC A;  3HXF A;  4I2Z A;  4MKT A;  2Y69 E;  5FT9 A;  4P29 A;  3FTX A;  2XZT G;  4FC8 A;  1QZ2 A;  4F1S A;  4Y6W A;  2OEV A;  4HB5 A;  4N3A A;  2V5F A;  3WXX A;  4EPZ A;  3U66 A;  5CMY A;  3RRN B;  4E85 A;  3S2A A;  5BXO A;  2GRQ B;  1QNF A;  1NP7 A;  2PZI A;  3RRM B;  5BV1 A; 
#chains in the Genus database with same CATH homology
 2XGO A;  3QWP A;  4O6F A;  3PS6 A;  1X5B A;  3KEZ A;  5G2N A;  4E6H A;  4KT6 B;  3URZ A;  2LNI A;  1S0P A;  2BUG A;  3CHQ A;  4I1O B;  3CQC B;  4PS8 A;  3CHM A;  4GYY A;  5FQ4 A;  4A3T A;  4ILH B;  3D9N A;  5ANL A;  2IOL A;  5A23 A;  1SQM A;  3CVW A;  3GZS A;  4HOR A;  3MJW A;  4G2V A;  5FWQ A;  2AVP A;  2WXO A;  3MKR A;  2MOW A;  1YA0 A;  3I4G A;  4MLP A;  4CCA A;  5LCW C;  3LDZ A;  3PH0 C;  3FUH A;  3QWW A;  4XI9 A;  2BTD A;  1HE8 A;  2CG2 A;  4HXI A;  3QKY A;  3N71 A;  4HOU A;  4GZ3 A;  3RJV A;  2BF0 X;  2XRY A;  4RG9 A;  5A6C A;  2CHZ A;  3D9M A;  3MYV A;  3TGO A;  4J0U A;  4YND A;  4FLH A;  3QDN A;  4FJY A;  2I1K A;  5AJL A;  3IHY A;  2CFU A;  4I2W A;  4WWN A;  4ACL A;  3BG1 B;  2KM4 A;  2WQH A;  4RSY A;  3PUK A;  4NRH B;  4ATG A;  3ESK A;  3RO2 A;  3ZXS A;  2LAI A;  4J8F A;  4UQY A;  2P58 C;  3TG4 A;  4DI4 A;  4U04 A;  4LUN U;  2KCL A;  3CHP A;  3FU0 A;  3SF4 A;  3I4R B;  3OAW A;  3OTN A;  2L0I A;  4BY6 A;  3CVU A;  4CT0 A;  3D9P A;  4BTA A;  4HVB A;  3ZRH A;  2LAH A;  3UUX A;  1A17 A;  1H6K A;  3P2B A;  4NAC A;  3CVP A;  4JVS A;  4I6E A;  4UWG A;  2X3M A;  3C98 A;  3BEE A;  4Q94 A;  3U9W A;  4B0Z A;  2I1J A;  4WWP A;  3CR3 A;  3MEK A;  1ZBP A;  3KAE A;  3PDN A;  2XEV A;  4OVV A;  5G55 A;  4IRU A;  1Z3X A;  3ESL A;  2ILR A;  3OXF A;  3KS2 A;  5J90 A;  2VTB B;  4FHK A;  3SHF A;  1IQR A;  1U3C A;  4J8S A;  3RKV A;  3NZU A;  3PE4 A;  4JEH A;  3AU5 A;  2IOS A;  1E8Z A;  2Q7F A;  1HG2 A;  4EEC A;  4N39 A;  4U0S A;  3PRZ A;  4R7L A;  2XPY A;  1PC2 A;  2YHE A;  3MX3 A;  5DIZ A;  3TJP A;  2J08 A;  1SZ9 A;  2WXI A;  5ANR A;  5KJL A;  5CCM A;  1WAO 1;  3IV0 A;  5FJY A;  2WVI A;  4M3O A;  4GZD A;  2CHX A;  3HDX A;  2A5U A;  3SBT B;  3OXL A;  5FQ7 A;  1E90 A;  3JCK C;  2PL2 A;  4EZL A;  3L08 A;  2JLB A;  4FLB A;  3FU5 A;  3PNL B;  2DCP A;  4GA2 A;  3SNX A;  5LCW J;  2HYZ A;  4RG6 A;  3PEU B;  4AY5 A;  3APF A;  3LEW A;  4ILG A;  1E7V A;  4XX5 A;  3VLD A;  3PE3 A;  3PVL A;  4UQZ A;  3QNK A;  2CG3 A;  2UY1 A;  3CGH A;  4BFR A;  4LER A;  4Q69 A;  3CVL A;  2YHC A;  5FQ6 A;  2LSU A;  5JJ7 A;  5LX8 A;  4WUY A;  4WNE A;  4L23 A;  5KJM A;  4ACK A;  1EYH A;  2WXF A;  5FZR A;  4F7A A;  3CIA A;  3CEQ A;  3QWV A;  3TL5 A;  5J08 A;  4KVO A;  2WXQ A;  2I9C A;  4V3I A;  2Y3A A;  3FTU A;  3E4B A;  3IBE A;  3Q15 A;  5FZS A;  3RRU A;  4K0R A;  3ZEF A;  4DJA A;  2A4Z A;  3PZD A;  2WXJ A;  4URK A;  4CGW A;  2GRL A;  4UWH A;  3TXN A;  3PRE A;  1U3D A;  2PQR A;  4L1B A;  5E75 A;  2KZT B;  3UMV A;  3VLE A;  3CVY A;  3CVQ A;  4ABN A;  4EQF A;  1HS6 A;  4JC8 A;  4BTB A;  4I9E A;  4UWF A;  1FVH A;  5FZQ A;  2WQ6 A;  2J09 A;  3K9I A;  1HF8 A;  2OOE A;  1N52 A;  3FWV A;  1DNP A;  3ONL A;  4PS3 A;  3FTY A;  3UT4 A;  1FVF A;  4WAF A;  4GZ6 A;  4AXH A;  3CLJ A;  4B94 A;  1ELK A;  5AYW D;  4UQX A;  3ZFW A;  4JEU A;  5AJD A;  1W3B A;  4AV7 A;  4XKC A;  4WNF A;  2I6H A;  2IJG X;  3ZYQ A;  4HOQ A;  3ASH A;  4EZK A;  4GYO A;  2J49 A;  3FU6 A;  1H0A A;  2E0I A;  4U63 A;  5HI7 A;  3R7R A;  3SD5 A;  5JJT A;  3QAR A;  4I6J A;  2AW6 A;  2J4D A;  3FUM A;  4G24 A;  1UN9 A;  4W9R A;  3OXG A;  2VSN A;  3SGH A;  3U4T A;  3MCX A;  4AVX A;  2AXV A;  3AS4 A;  5ENN A;  2HR2 A;  2MHK A;  3FTV A;  3UPV A;  2X6F A;  3G2U A;  4GYW A;  4B89 A;  1IQU A;  2WM9 A;  1LF8 A;  2NSZ A;  4IN3 B;  4PDX A;  4N5C A;  5C2Y A;  2UY1 B;  3JQ1 A;  4ANU A;  4UI9 K;  2WXN A;  3ZW3 A;  2JEK A;  2J9Q A;  2PQN A;  4ILI A;  2WMO A;  4HLE A;  2LO6 A;  4I6G A;  4JW1 A;  4I17 A;  3D9K A;  4KBQ A;  2WXR A;  4BSX A;  4GPK A;  3RU0 A;  2FEZ A;  3HVE B;  2KC7 A;  3T5V A;  1HZ4 A;  2KZT A;  2XHE A;  3P1U A;  2GRM A;  3FU3 A;  1NA3 A;  4FUL A;  3IKO B;  2R59 A;  3D9I A;  2VQ2 A;  4QFV A;  5A7D B;  1E8X A;  4GAA A;  3L54 A;  4G23 A;  3S7B A;  2IQC A;  2X6H A;  4UWK A;  3RK6 A;  4AEZ C;  3VTY A;  4NUR A;  5LP0 A;  4JHK A;  4GZ5 A;  4TUU A;  4UI9 J;  2AXZ A;  1OUV A;  3EIJ A;  5AEN A;  5G05 C;  5KJN A;  1MQS A;  2VGX B;  1GW6 A;  1E7U A;  4APF A;  4J8D A;  5BV0 A;  2XCC A;  5M72 A;  1PY1 A;  3SFZ A;  3FEX A;  3ASF A;  3ASD A;  2FF4 A;  3B7U X;  3JYS A;  3MKQ B;  3SZ7 A;  2X38 A;  3LVR E;  4LCT A;  1TJC A;  2L9B A;  3O48 A;  4A1G A;  2VJ8 A;  5FTP A;  2LSV A;  1FCH A;  5BW8 C;  3SBS A;  2XRZ A;  1Z6T A;  3MV2 B;  2WMN A;  3ZHE B;  3FUD A;  4B8A A;  4B8C B;  4JPS A;  3CVN A;  3FUJ A;  3CV0 A;  2V8S E;  3ZYM A;  4CDM A;  3VTX A;  2X6K A;  3CHS A;  4C9B B;  4CDR A;  4GU5 A;  3FP3 A;  4DI3 A;  3NF1 A;  5C1D A;  4ANV A;  2C2L A;  3GZ2 A;  3D3M A;  4H7X A;  4XIF A;  4C0E A;  5EKQ D;  4CRW A;  4WNG A;  2WXK A;  4XZ4 A;  4YVO A;  4AP2 A;  3FH7 A;  3ZIM A;  1QQE A;  5BPP A;  5T3R A;  3KD7 A;  3FUI A;  3Q47 B;  4JL0 A;  3HVE A;  2HO1 A;  4UWL A;  4BT9 A;  2YQ8 A;  4MRU A;  5CCL A;  2DBA A;  4A3V A;  2CFZ A;  1OWN A;  1SZA A;  3ZYK A;  3QAQ A;  4XE0 A;  4U8H A;  2V0P A;  3LY8 A;  2GW1 A;  3AU4 A;  4CDN A;  2YNQ A;  2PM7 A;  3CK7 A;  1HX8 A;  2WXM A;  5G05 J;  5KCM A;  4GA1 A;  2R17 C;  4HS2 A;  1JUQ A;  5KJK A;  2I2O A;  1EDU A;  2VGX A;  4Q96 A;  4LRZ A;  2OV8 A;  4HOS A;  4GA0 A;  2R5S A;  2WXP A;  3PUJ A;  2KAT A;  3FTZ A;  3LCA A;  3L22 A;  1UW4 B;  4YVQ C;  3B7R L;  1UJK A;  3D9L A;  4JZY A;  3FUE A;  4KYO B;  4AIF A;  1TJF A;  3MKQ A;  3I3N A;  3CVX A;  5CHE E;  1HFA A;  4GCN A;  5D0Q D;  4G25 A;  4KMO A;  1H19 A;  3UX4 A;  1E8Y A;  5BNW A;  3G2S A;  3MZL B;  1HO8 A;  3CKC A;  3EHM A;  2L6J A;  3LY9 A;  4XKB A;  4UI9 C;  3APC A;  1XNF A;  3ZHE A;  3CVV A;  3FTS A;  3FUL A;  4N2S A;  3U64 A;  2ION A;  4FP7 A;  3ENE A;  3UT7 A;  2J4B A;  2XCB A;  3EJN A;  1JWG A;  3CQG B;  3RO3 A;  4EBA G;  3CK9 A;  3CSF A;  5T4Y A;  2VGY A;  4N2Q A;  3ML8 A;  1JPL A;  2NC9 A;  4XI0 A;  1B89 A;  4OVU A;  1OWP A;  2CHW A;  4I1A A;  4I1M A;  3UQ3 A;  3GYZ A;  3ZGQ A;  2OVF A;  4I9C A;  1H2V C;  1Y6I A;  3D9O A;  3DPD A;  2NXP A;  4GMJ A;  3FUN A;  2Y4T A;  5G04 J;  2VSY A;  4FAD A;  4ME2 A;  1OWL A;  4KVM A;  3FH5 A;  4PH4 B;  2IU1 A;  3CKB A;  4PUC A;  2V4L A;  5T8I A;  5BT1 A;  2WB2 A;  2L0T B;  3FHE A;  1Z3Y A;  4GML A;  4WND A;  3HHM A;  5D0O D;  4I43 A;  2IF4 A;  4L2L A;  4DK5 A;  1ZU2 A;  4U0U A;  3LJ3 A;  4N3B A;  4MS6 A;  5BUZ A;  1XGW A;  3IHV A;  4JXT A;  3CHO A;  1E96 B;  5EX3 A;  3FH8 A;  2RG8 A;  4J8E A;  5EDS A;  1TEZ A;  4FJZ A;  2Y4U A;  3FDH A;  2WPV A;  5HQ8 A;  3AS8 A;  3ONK A;  4CT4 A;  3B7T A;  4DLQ A;  2EQX A;  4TV3 A;  5ARG A;  4IYP A;  1N54 A;  2WXG A;  4Y6C A;  4IUL A;  2RD0 A;  3S7D A;  2WQ7 A;  1HU3 A;  1INZ A;  1WY6 A;  2X6I A;  5JHA A;  1UJJ A;  2FI7 A;  3RIB A;  1L5J A;  3CHR A;  1VDY A;  4NQ0 A;  3MGB A;  3ASG A;  3QOU A;  3FY4 A;  4JA9 A;  4U0Z A;  2XGS A;  2VSX E;  3G2T A;  4RVB A;  2XGM A;  3B13 A;  3L6A A;  3G2W A;  3GZ1 A;  5LFA A;  1IHG A;  1KLX A;  2QFC A;  2OVB A;  1ELW A;  4J6I A;  3S7J A;  4OYS A;  4EBA A;  4KXK B;  4JA7 A;  3QK0 A;  3ZVV A;  4HOT A;  1WM5 A;  2C0M A;  3APD A;  3L13 A;  3ZPJ A;  3FFL A;  3NQP A;  1PAQ A;  1H2U A;  2YIN A;  3LKU A;  4F53 A;  1UG3 A;  1HXI A;  4JHR A;  3MA5 A;  4A55 A;  1EPU A;  3PEV B;  2KCK A;  4GCO A;  4FU3 A;  3I5P A;  3LPZ A;  3QB2 A;  3QC1 A;  3FUF A;  2HM8 A;  2X6J A;  2XQ0 A;  3HYM B;  3JQ0 A;  3R9A B;  3Q49 B;  3D9J A;  3LY7 A;  4BX8 A;  5ARF A;  2ZU6 B;  3Q5M A;  1DVP A;  3TAX A;  1OWO A;  4C0M A;  4F3V A;  4JHJ A;  1JWF A;  3QJZ A;  1EF1 C;  3LS8 A;  4EZJ A;  5LOZ A;  2FUL A;  4KZ0 A;  2PM6 A;  4AM9 A;  3EDT B;  3DBS A;  4APO A;  3GW4 A;  5G04 C;  4AY6 A;  5JHB A;  3R7Q A;  4FHJ A;  3LYA A;  4D10 C;  3ULQ A;  3EHN A;  1HG5 A;  2FO7 A;  4U07 A;  3S7F A;  3T5X A;  4CEM A;  3HIZ A;  4AJW A;  3L16 A;  4ANX A;  4CGV A;  2KCV A;  1NA0 A;  2WXH A;  4HFG A;  4BWR A;  5AIJ A;  1IYG A;  5JJ6 A;  2DIW A;  4DLO A;  4N3C A;  2UWJ G;  5EX0 A;  3ZYL A;  2MRI A;  3AS5 A;  3FEY A;  3TG5 A;  4PS7 A;  5E76 A;  5FQ8 A;  3ML9 A;  1OWM A;  2AWI A;  3CK8 A;  5CMW A;  3NZS A;  1NZN A;  2J07 A;  1KT0 A;  3IEG A;  3VLF A;  3O4Z A;  3ZN3 A;  1HH8 A;  2WXL A;  4ANW A;  2QY7 A;  1E8W A;  1KT1 A;  2C0L A;  2E2E A;  3LXU X;  3MV3 B;  2GGF A;  3G2V A;  4GZC A;  4FA6 A;  1Y8M A;  4I2Z A;  4LEU A;  1MHQ A;  4MKT A;  4A1S A;  3UT8 A;  3B7S A;  5FT9 A;  2AXU A;  4P29 A;  3FTX A;  3FUK A;  3L17 A;  2IFU A;  1ELR A;  2VYI A;  4FC8 A;  4G26 A;  3T8M A;  1QZ2 A;  1UN8 A;  4F1S A;  4AOF A;  1H2T C;  2XPZ A;  4Y6W A;  4N3A A;  2VTB A;  2V5F A;  3WXX A;  2FBN A;  3U3W A;  3SI5 A;  2VSO E;  4EPZ A;  4TRQ A;  2M63 A;  4GB9 A;  4L2Y A;  3U66 A;  5CMY A;  5DBK A;  3RRN B;  4BT8 A;  2XPI A;  4E85 A;  3S2A A;  3Q4A B;  4H7Y A;  4KZC A;  3CST A;  4DPR A;  4G11 A;  4K03 A;  1QNF A;  1BPO A;  1NP7 A;  4BX9 A;  3BG0 B;  1P5Q A;  2PZI A;  3EIQ C;  4WWO A;  3TXM A;  3LVQ E;  3RRM B;  5BV1 A;  3JUI A;  4L7T A;  4G1T A;  3FTW A;  2OND A;  3PNT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...