3CGHA

Crystal structure of a susd homolog (bt_3984) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
507
structure length
507
Chain Sequence
PYEAPDLSADGYALGSAMNNLAGCVVSPDVNTAQFTDCLLGGPLGGYFADSNAGFTETISNFNPKDDWSRVFLKSDKIIPTLYSNLTQVKLVSQNTNDPVPYAIAQVIKVAAMHRVTDAFGPIPYSQIGANGEIATPYDSQEVTYNTFFDELNAAIATLNENSNEQLVPTADYIYKGDVKKWIRFANSLKLRLAIRIAYANPVKAQQMAEEAVNPANGGVIESNADNATWNYFETSQNPIYVATRYNQVQTSDHGGVPCLTGGDTHAAADIICYMNGYKDNRREKFFTKSEWAGQDYVGMRRGIVIPELKTTGHKYSGVNIAPTSPLYWMNAAEVAFLRAEGQAVFNFSMGGTAESFYNQGIRLSFEQWGADGVEDYLKDDVNKPTAYTDPAGTNTYQNALSNITIKWNDSADKEEKQERIIVQKWIANWQLGNEAWADFRRTGYPKLIPVKENKSGGVVDSEKGARRMPYPLDEFVSNKANVEYAIANYLHGADNMATDVWWASKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SusD homolog
publication title Structure of BT_3984, a member of the SusD/RagB family of nutrient-binding molecules.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Metal binding protein
total genus 187
structure length 507
sequence length 507
ec nomenclature
pdb deposition date 2008-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12741 SusD-like Susd and RagB outer membrane lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3cghA00
3OTNA 3P1UA 4F7AA 5E75A 3FDHA 3JQ0A 3CKBA 4PUCA 3NQPA 3IV0A 3KEZA 3CKCA 3I4GA 4Q69A 5J90A 3CK7A 3HDXA 4MRUA 3SGHA 3LEWA 3MX3A 4L7TA 3MYVA 3JYSA 5FQ4A 3GZSA 5FQ6A 5LX8A 5T4YA 5FQ8A 3MCXA 5E76A 5T3RA 3CK8A 3EHNA 3CGHA 3JQ1A 3CK9A 3QNKA 5FQ7A 3SNXA 3EJNA 4F53A 3L22A 4LERA 3EHMA
chains in the Genus database with same CATH superfamily
4L2LA 2KM4A 1DVPA 2VJ8A 5D0OD 1OWLA 4I43A 4HI8A 4MBGA 4R7LA 3I4GA 3FULA 4BX8A 2DIWA 3I4RB 1KZOA 3UM0A 3DEOA 4N2QA 3EIJA 2BKGA 3TWVA 4A1SA 1BI8B 3OXGA 4GA1A 2KATA 2V5QC 3QKYA 3HG0D 2P9KG 5H7PA 4BTBA 3MA5A 1U3CA 3AG2E 5BT1A 1TJCA 3KD7A 1ELWA 3FTSA 3CEQA 3RK6A 4ANWA 3NAWA 1QQEA 2VSNA 5BPPA 5ENSD 3U9WA 4EZKA 3C3RA 4GTTA 3AG3E 2XPZA 3GZ1A 4LNBA 3MJWA 4K5AB 5A6CA 3PE3A 3DSVA 5DIZA 5CEAA 1LD7A 3AJIA 5FZSA 5JMND 2CHZA 4URKA 4FC8A 2WXRA 1NZNA 3O4ZA 3MZLB 3IKOB 4JL0A 3ESLA 2KBXA 4HQDA 3FFLA 4AIFA 3VLFA 4I1AA 2DZNA 4N2SA 3FTVA 3D9LA 2EIME 4FLHA 1JCRA 1OCOE 4EQFA 3QC1A 2WXMA 2BTDA 1AWCB 1IQRA 3VTYA 4U07A 4WAFA 3UM2A 2ETBA 4XIFA 1HG5A 2EILE 3NOCD 4ILGA 4U8VD 3V79K 4QFVA 1X5BA 2F8YA 3Q47B 2I9CA 4JA7A 1IHGA 1OCRE 3D9IA 3E33A 5ANLA 3D9KA 4WNFA 1B89A 3QWPA 2ZISA 5A23A 1QNFA 5ENOD 4APOA 2AXVA 2X6IA 5ARFA 3AS4A 5FJYA 4CT0A 1E7VA 3MX3A 4G25A 4GYOA 4BSXA 4GPKA 1HX8A 3CHOA 2B6CA 3EHQA 2E2EA 4GB9A 3IEGA 3CLJA 2XZDG 1LTXA 5EYPF 2NYJA 3MGBA 3LJ3A 3IHVA 4I2ZA 4KBQA 4AVXA 2XGOA 3TG4A 4GYWA 3BU8A 2PQNA 2RFMA 2VSYA 4J6IA 4TUMA 3CHPA 3QDNA 3S7FA 1OUVA 4OVVA 3PEVB 1IKND 2QZAA 3URZA 4AM9A 4GA2A 4GTRA 5CBOA 4BETA 4GTPA 2QFCA 3PNTB 5KNGA 4UWFA 2LUHA 4L9PA 3KEZA 1N94A 2GRLA 5AQBA 3PZ1A 1TNOA 2WXPA 2VGEA 4CDRA 5FQ8A 4K5BA 4ANXA 3AG4E 3RJVA 4A55A 4C48B 1HF8A 4B93B 3E34A 3PZ2A 4ANUA 2P9SG 5LOZA 4A3VA 4N3CA 1HU3A 3E4BA 3L54A 4XX5A 3T8MA 3PUJA 5KWDA 2H6IA 3MKQA 5EX0A 3ZW3A 4OAUC 1BD8A 2IU1A 3ZEFA 3ML9A 4CEMA 4WNDA 2XENA 3D9MA 3G2TA 3CVUA 2AXZA 4YDWA 2R02A 4V3IA 2GRMA 5EKQD 1SVXA 3ZIMA 1OT8A 2WXFA 2RG8A 3D9NA 3HXFA 4G23A 1E8WA 2XEVA 3B13A 3FTWA 1K8KG 2EIKE 1UG3A 4GYYA 4U04A 3DXMG 4NQ0A 1IYGA 2EINE 3SFXA 2L6JA 5EYLA 4B89A 1H2TC 3FUEA 2AW6A 4I6GA 3FUFA 1HZ4A 4JHKA 5CMYA 2XS1A 3HXBA 5ENRD 4LCTA 3L13A 2X6HA 2JLBA 1BLXB 1KLXA 2OCCE 4GZCA 5DBKA 4J8YA 2QY7A 1UN8A 3FHEA 4ZHBA 4YDEA 1H6KA 4WWNA 4HOTA 2IF4A 4Y6CA 2WXIA 4RVBA 4NURA 3R7RA 4N3BA 3HYMB 4GTVA 3EDTB 3Q9UC 4UWLA 4JHRA 2PNNA 3NZSA 4B0ZA 3TXMA 2OEWA 3C72A 3U64A 4RLYA 4I9EA 4F3VA 3LJNA 5LP0A 4HOSA 4U96D 4L7TA 2YNQA 3L08A 3T9KA 1E8ZA 1MHQA 5T3RA 4DK5A 2XQ0A 1Z3XA 5CRUA 4U0SA 2Q7FA 4LEUA 5LCWC 2R59A 1ZU2A 3SHFA 1QZ2A 3ASNE 3DSUA 4UQXA 2MYOA 2UWJG 4BSZB 4YVQC 1E96B 2XZTG 3HXDA 3CSFA 3X2QE 2WQ7A 4N3AA 4TRQA 3L6AA 4PS7A 4YDOA 2P9IG 3C5RA 3FP3A 3PRZA 4HLLA 5T4YA 4AXHA 3WXXA 4XKCA 2EIJE 2KCLA 3LVRE 3ZVVA 3RIBA 2QYJA 2J08A 3LPZA 2WXLA 5CEDB 2WMNA 3ABME 3Q4AB 1UW4B 4B8CB 3E32A 4GTOA 2A5UA 3FDHA 2YQ8A 2ZIRA 1TNYA 3FUHA 2EQXA 2XEHA 3C98A 3PNLB 3ESKA 2PZIA 3MYVA 5A7DB 3B7TA 1JCSA 5HKPA 4CT4A 1MJ0A 2IO3C 3CHSA 3Q75A 2F0YA 1A5EA 2P2CP 4HRMB 4U8HA 4UI9K 4TXPA 3V2OA 3ZU7B 3JXJA 5HS0A 4DLOA 2XPIA 2XHEA 4M7CA 5HQ8A 3TWUA 3FEYA 3TWSA 5FIOA 2RD0A 3ONKA 4LERA 1SZAA 2DWZA 1YYHA 2LSUA 1IHBA 1ZBPA 4JD2G 3CVVA 2FF4A 3RAUA 3PUKA 3RU0A 3FUKA 4HORA 4HFGA 1Z5SC 5AQ7A 4YDYA 3QK0A 3C3QA 3OXLA 3EJNA 2FEZA 3HVEB 4MS6A 3CQCB 3FU6A 3SO8A 3LY9A 3AAAC 4I17A 1H2VC 1U2VG 5AQ9A 3D9JA 3FU0A 2KC7A 4KMOA 3CVLA 4K5CA 1N4PA 1A17A 3N71A 2GRRB 3FUDA 3B95A 3CR3A 1N4RA 3JUIA 2C2LA 4DX6D 1HO8A 4PH4B 1TNZA 2HE0A 3SZ7A 5LFAA 1H6OA 5CECB 5G55A 1N4QA 3CQGB 1SA4A 4JPSA 2F8XK 4F1SA 3CVQA 3TG5A 4B94A 4GZDA 4TV3A 3K9IA 5G04C 3CKCA 3VLDA 3UX4A 1U3DA 3ASOE 3IHYA 4GPMA 3LEWA 2CFZA 3FH8A 2OVFA 3DRAA 4PS8A 5G04J 1NP7A 1MYOA 4GTSA 1SQMA 3U4TA 5BXUA 2BF0X 4ME2A 3PEUB 3O48A 4P29A 3BEEA 1NA0A 4BESA 1Y8MA 3NOGD 2VYIA 2CG3A 3FU3A 4Q69A 4A3TA 5J90A 2HYZA 4I2WA 3SFZA 3G2WA 1O1SA 3RO3A 4EZLA 1SW6A 1N54A 3FUMA 3KSLA 5JHBA 3BUAA 2AVPA 5BW8C 4O1OA 3RRUA 4KVOA 5BV1A 2WQHA 3AG1E 4CCAA 3TL5A 3HXCA 1VDYA 3ASGA 5EDSA 2I2OA 2WXOA 1TJFA 3DBSA 1MZCA 1OWPA 1N11A 1S64A 2J09A 3FEXA 4U0UA 1DC2A 4GZ6A 4UI9C 1DNPA 3FUNA 3W9GA 4L23A 3LCAA 1MQSA 3Q7AA 5BXOA 3ZYLA 4HRNA 3IXEA 3E30A 4UI9J 5M72A 1E7UA 3UXGA 1HFAA 2BEDA 2KCKA 3ML8A 1FT1A 2Y3AA 5FQ4A 4JHJA 4EBAG 3UINC 3RSEG 3G2VA 4CGVA 1LD8A 1NA3A 5JHAA 4BTAA 2YINA 1OWMA 3UKUG 3UUXA 1NI1A 3UT4A 4BT8A 1HG2A 3UM3A 2LAIA 3EHRA 2GRQB 4DUIA 2MHKA 2P9UG 3UT7A 4HNAD 5AAOA 4F6RD 2R2LA 3CK7A 5CMWA 5ENNA 3SI5A 5FWQA 4XI9A 5AN8A 3FTUA 3PZ3A 3GW4A 5CRVA 1WM5A 4OVUA 3I3NA 3ZXPA 3T5VA 1SA5A 5AJDA 4AOFA 3FUJA 4GZ3A 4CGWA 3UKRG 4FU3A 2CG2A 4MRUA 4GU5A 3ZNGA 2PL2A 5CBNA 4AJWA 3PVLA 1WDYA 4AY5A 5JJ7A 2A5EA 3NBNB 5EILA 3PZ4A 5KJKA 3UPVA 4MKTA 4FHJA 2WB2A 5KBAA 2HM8A 5AIJA 4UWKA 3EUVA 3Q15A 5LX8A 2H6FA 2RFAA 3EHNA 3UQ3A 4CDMA 4H7YA 2P9LG 2C0MA 1PY1A 3CIAA 5ENQD 5AARA 2GRPB 2J4BA 3JCKC 4WWOA 4C9BB 4A63B 4YNDA 4EZJA 3SNXA 2LXLA 4I9CA 3ASFA 4L1BA 4ABNA 1K1AA 5ENTD 3BQOA 1BU9A 1KPSB 4XZ4A 2X6JA 2PM6A 5IY5E 3AS5A 4HI9A 4RG9A 4JEHA 1UN9A 3MV3B 4BWRA 3UMVA 3HIZA 5HI7A 4U63A 1N95A 2ONDA 2I6HA 4XKBA 5D0QD 2IQCA 3FWVA 4HLEA 3D9OA 4G11A 3FY4A 4EBAA 2IOLA 3AU4A 1E8XA 4J7WA 3ZKJA 3B7BA 2ZXWE 4PUCA 4K0RA 2XCCA 4IRUA 5EX3A 4JVSA 2H6HA 2WPVA 4FA6A 4I1OB 4HRLA 3I5PA 1YMPA 3APDA 4JA9A 3CSTA 4KXKB 5C2YA 3B7RL 3PS6A 2R03A 3ZPJA 3EHMA 2AXUA 1X81A 2ZGGA 2LAHA 3BG0B 4GCOA 2NC9A 1MX2A 5G05J 4J8FA 4DI3A 3P2BA 4LUNU 2XRYA 5C1DA 4UQZA 4HVBA 4GZ5A 4ACKA 1OWOA 1WY6A 5FINA 3S7JA 4E6HA 3CVYA 4MLPA 3U66A 4G26A 3LVQE 4BX9A 5B1AE 2GW1A 5BV0A 4LNGA 1D9SA 3LY7A 3APFA 4O60A 3UT8A 3S7DA 4KZ0A 4WWPA 4O6FA 2LSVA 4TUUA 2P58C 2UY1B 3EU9A 4CYMD 4DX2A 3ABKE 5G2NA 4LRZA 4TXRA 5BUZA 1N0QA 4DX5D 3UIOC 3LXUX 3CGHA 3DPDA 2FI7A 1P5QA 2F37A 3ZYQA 3KAEA 2OV8A 2B0OE 4HBDA 2KZTB 1G3NB 4Z68A 4CDNA 4JXTA 2LO6A 1WG0A 3CV0A 4N5QA 2VSXE 2DCPA 4GA0A 3TXNA 1UJJA 4DLQA 3ULQA 5AENA 3NQPA 4CZ2D 1MX4A 2J8SD 3NF1A 1IXVA 4YVOA 1ZB1A 3D9HA 4OYSA 3ZYMA 4JC8A 1JPLA 4GMLA 3SY2A 2PM7A 3QARA 1XGWA 3FH7A 2R17C 4RQIA 3T5XA 1O1TA 3TWXA 4U0ZA 2QYUA 4CRWA 5BNWA 3MEKA 3AS8A 2VGXB 1RW2A 3DSTA 2L6BA 3CVXA 3KSQA 1KT0A 4IYPA 2VTBB 4U8YD 3J5QB 5FZRA 1Z6TA 4UUCA 3J5PA 5ANRA 1QYMA 4L2YA 1FCHA 3APCA 3FU5A 4BERA 3ASHA 1V55E 2VQ2A 2E0IA 1PAQA 3G2UA 1EYHA 3CHQA 1KT1A 5KCMA 1S0PA 4NRHB 3CKBA 1S70B 2HO1A 3CVWA 1NFIE 2WXQA 3RO2A 1ELRA 3Q5MA 4G24A 4ATGA 4KVMA 4N39A 2RKKA 4DI4A 3JYSA 4PS3A 3UIPC 3S2AA 4AV7A 2WQ6A 1K3ZD 2VGXA 5D2MC 2OOEA 3PE4A 4LSZE 5T8IA 4GTQA 2VTBA 2MOWA 2NXPA 3HVEA 5J08A 4ILIA 4AEZC 4DJAA 3PREA 1EDUA 3R9MA 2XCBA 5HRYA 3D9PA 4KYOB 3L22A 2ZU6B 3JQ0A 3AU5A 2GRNB 2MRIA 4U95D 2XRZA 2JABA 3GZSA 3ZN3A 4XEIG 4FADA 5KJMA 3QNKA 3B7UX 1D8EA 4GAAA 2HR2A 3OTNA 4PDXA 4ZFHA 4GMJA 2FO7A 2Y4TA 2V4HC 3LY8A 1FPPA 1JUQA 4C0MA 4Q94A 2L0TB 3MV2B 3S7BA 1N52A 3B7SA 3Q9NC 5D66A 3ABLE 4JZYA 4O1PA 4E85A 2ZGDA 2WVIA 5KJNA 2XEEA 1H0AA 3QWVA 1V54E 2WXGA 3HDXA 4EECA 1DCEA 2OEVA 3Q79A 4J8DA 2WMOA 3UTMA 1IQUA 1JCQA 2OVBA 2KCVA 4FULA 3ZFWA 3LYAA 1OCCE 2J9QA 1BPOA 3HHMA 3SQVA 2CHXA 3ISMC 5FTPA 2V5FA 4UWGA 3QB2A 3R7QA 2R05A 3CK8A 3DPYA 4A1GA 1JWFA 3GYZA 3SBTB 4RSYA 1DCQA 2V4LA 5B3SE 3FTYA 2Y1LE 3Q78A 4EPZA 3ONLA 2X6FA 3FTZA 4LG6A 3ZUVB 4WUYA 2VGYA 4G2VA 1QBQA 3SF4A 3QWWA 3JQ1A 4BFRA 3ZYKA 4ATZD 1O1RA 1LF8A 5E75A 4AP2A 1RZ4A 3KEAA 2KXPC 4QQIA 2ETCA 2GGFA 3QOUA 4BY6A 2ETAA 4NACA 2FULA 3MKQB 2PQRA 4HOQA 1PC2A 3EIQC 3CHRA 1BI7B 3NB2A 5EIBE 1N4SA 2L0IA 1E90A 2VSOE 1N9AA 2J07A 2QC9A 3PZDA 4UWHA 2IEJA 1S63A 5JA4D 3PH0C 2J49A 1EF1C 4B8AA 1OXJA 5ITZF 3WG7E 4AY6A 2YHCA 2FBNA 2Y69E 3UI2A 3RKVA 2DBAA 3ZRHA 1Q2ZA 2L9BA 4HB5A 3TAXA 3CVNA 3MKRA 2BUGA 2YHEA 2R5SA 3ZHEB 3D3MA 4DX1A 4FJYA 3DSXA 2XS8A 5CCLA 3Q7FA 2JEKA 1TR4A 4J8SA 2XPYA 3VLEA 3LDZA 1OCZE 5FZQA 4Q96A 1FT2A 2WM9A 3F6QA 3G2SA 2GROB 1YA0A 1TYQG 3GZ2A 2DZOA 4Y6WA 5FQ6A 5JJTA 1HS6A 1TN7A 1UOHA 3NZUA 5JJ6A 1ELKA 4I6EA 2P9NG 4JW1A 3L16A 3ZHEA 2M63A 3DXKG 4XE0A 2J4DA 2XGMA 4U7EB 3SD5A 3ULYA 4BT9A 2I1KA 4JB8P 2AJAA 3FTXA 3V30A 5EIDA 3L17A 1H2UA 4J0UA 1KZPA 3FH5A 3LKUA 3UM1A 3ASDA 1HXIA 3ZGQA 3BG1B 3CHMA 3R9AB 4M3OA 4HOUA 2DYRE 5AQAA 3DSSA 4WNGA 4N5CA 5G05C 3QAQA 3V2XA 3SFYA 2WXJA 3DEPA 2WXHA 4FHKA 1HH8A 4G8KA 3JUEA 1TEZA 3QJZA 2Y4UA 4HXIA 3C3OA 3LS8A 2V8SE 4TXQA 5KJLA 1W3BA 4JEUA 1FVFA 1AP7A 4F7AA 2CHWA 4GTMA 3RRNB 4EHMA 1OWNA 1K1BA 1SZ9A 2IJGX 2IO2C 5LCWJ 1GW6A 1NL4A 5B1BE 3TWRA 3V31A 3PDNA 2IY0C 4OAVB 1XNFA 2H6GA 3DWLG 4G8LA 2FO1E 4RG6A 4BEPA 1H19A 4GMRA 3SGHA 4J8EA 1Z3YA 3VTXA 5CCMA 3DSWA 4FJZA 1MX6A 1JWGA 3Q73A 1TNUA 3CK9A 4I6JA 2BKKB 5AYWD 4F53A 2I1JA 5E76A 1HE8A 4WNEA 4X8QA 2X38A 3IV0A 5FT9A 4C0EA 2IFUA 2C0LA 4DRXE 1WAO1 4XI0A 1UJKA 4I1MA 2LXMA 1Y6IA 3U3WA 3FUIA 2V0PA 3HRAA 3P1UA 3TWWA 2WXNA 4W9RA 3IBEA 5ARGA 3ENEA 2UY1A 4UQYA 3TWQA 1INZA 3W9FA 1L5JA 3SBSA 3CVPA 4APFA 3L9TA 2NSZA 2ILRA 2X3MA 3TWTA 4DPRA 3T8KA 3OXFA 4NIKA 3ULEG 4FP7A 1FVHA 4IULA 4ACLA 4IN3B 2KZTA 1N0RA 1TN6A 2IONA 3MCXA 3ZXSA 4D10C 2LNIA 3JXIA 4LNUD 3E37A 1TN8A 4DX7D 1TNBA 5CERB 4KT6B 1H6PA 4GCNA 5CHEE 3HXEA 3TGOA 5EN5D 3EU5A 1D8DA 2XGSA 3RRMB 5AJLA 2Y0BG 4FLBA 5ENPD 4F1PA 2AWIA 1OY3D 2IOSA 4HS2A 2X6KA 2A4ZA 1O5MA 4H7XA 1EPUA 5KNHD 1E8YA 4G1TA 3TJPA 2DVWA 3Q49B 2CFUA 4K03A 4ILHB 4KZCA 2P9PG 2WXKA 3OAWA 3KS2A 4ANVA 1YCSB 2DYSE 3L82A 5FQ7A
chains in the Genus database with same CATH topology
4L2LA 3SBTB 4AXHA 2KM4A 1DVPA 2VJ8A 5D0OD 1OWLA 4I43A 4I9CA 4RSYA 3WXXA 3ASFA 2V4LA 4L1BA 4XKCA 2KCLA 3FTYA 4R7LA 3I4GA 3FULA 4BX8A 4ABNA 4EPZA 3LVRE 3ONLA 2DIWA 3I4RB 2X6FA 3FTZA 4N2QA 3EIJA 4WUYA 2VGYA 4G2VA 4A1SA 3ZVVA 3SF4A 3RIBA 2J08A 4XZ4A 2X6JA 3QWWA 2PM6A 3OXGA 3LPZA 3JQ1A 2WXLA 4BFRA 2WMNA 3AS5A 4GA1A 2KATA 3ZYKA 4RG9A 4JEHA 3QKYA 1UN9A 3Q4AB 1UW4B 4B8CB 3MV3B 1LF8A 2A5UA 3FDHA 5E75A 4AP2A 4BY6A 2YQ8A 4BWRA 3UMVA 4BTBA 3MA5A 1U3CA 5BT1A 3HIZA 5HI7A 3FUHA 4U63A 2GGFA 1TJCA 2ONDA 3QOUA 2EQXA 2I6HA 3KD7A 3C98A 1ELWA 3ESKA 3PNLB 3FTSA 4XKBA 5D0QD 3CEQA 2IQCA 2PZIA 3MYVA 3FWVA 4NACA 3RK6A 2FULA 4HLEA 5A7DB 4ANWA 1QQEA 2VSNA 2PQRA 3B7TA 3MKQB 5BPPA 4HOQA 3D9OA 4G11A 3FY4A 4EBAA 1PC2A 2IOLA 3AU4A 3CHRA 3EIQC 3U9WA 1E8XA 4CT4A 4EZKA 3CHSA 2L0IA 4PUCA 4K0RA 1E90A 2XCCA 2XPZA 3GZ1A 4IRUA 5EX3A 4JVSA 2WPVA 3MJWA 4FA6A 2VSOE 4U8HA 4I1OB 4UI9K 2J07A 3I5PA 5A6CA 3APDA 4DLOA 2XPIA 3PE3A 2XHEA 3PZDA 4JA9A 4UWHA 5HQ8A 3CSTA 5DIZA 4KXKB 3FEYA 5C2YA 5FZSA 3PH0C 2J49A 3B7RL 2RD0A 3PS6A 2CHZA 4URKA 1EF1C 4B8AA 3ONKA 4FC8A 4LERA 3ZPJA 2WXRA 3EHMA 1NZNA 4AY6A 3O4ZA 2YHCA 2AXUA 2FBNA 3MZLB 1SZAA 3IKOB 4JL0A 2LAHA 2LSUA 3ESLA 1ZBPA 3RKVA 3CVVA 2DBAA 3ZRHA 3BG0B 2L9BA 2FF4A 3FFLA 4AIFA 3TAXA 4GCOA 3PUKA 2NC9A 3CVNA 3RU0A 5G05J 4J8FA 3FUKA 3MKRA 2BUGA 2YHEA 3VLFA 2R5SA 4HORA 4HFGA 4DI3A 4I1AA 3ZHEB 3P2BA 4LUNU 3D3MA 3QK0A 4N2SA 3FTVA 2XRYA 3D9LA 3OXLA 4FJYA 3EJNA 4FLHA 2FEZA 3HVEB 4EQFA 3QC1A 5C1DA 4UQZA 5CCLA 2WXMA 2BTDA 2JEKA 4MS6A 4HVBA 1IQRA 3VTYA 4U07A 4GZ5A 4WAFA 3CQCB 4ACKA 4XIFA 1HG5A 3FU6A 3LY9A 1OWOA 1WY6A 4J8SA 4ILGA 3S7JA 2XPYA 4E6HA 4I17A 4QFVA 1H2VC 3CVYA 4MLPA 3D9JA 1X5BA 3FU0A 3Q47B 2I9CA 2KC7A 3LVQE 4G26A 4JA7A 3U66A 4BX9A 3VLEA 4KMOA 1IHGA 2GW1A 3CVLA 3LDZA 5BV0A 3LY7A 3D9IA 5ANLA 3D9KA 1A17A 3APFA 4WNFA 3UT8A 3N71A 3S7DA 1B89A 4KZ0A 3QWPA 5FZQA 4WWPA 3FUDA 4O6FA 4Q96A 2LSVA 2WM9A 5A23A 4TUUA 1QNFA 3CR3A 4APOA 2P58C 2C2LA 2UY1B 3JUIA 3G2SA 1HO8A 4PH4B 2AXVA 1YA0A 2X6IA 5ARFA 3AS4A 5FJYA 5G2NA 4LRZA 4CT0A 1E7VA 3SZ7A 3MX3A 4G25A 5BUZA 5LFAA 4GYOA 4BSXA 3GZ2A 4GPKA 4Y6WA 5FQ6A 1HX8A 1HS6A 5JJTA 5G55A 3CQGB 3LXUX 3NZUA 3CGHA 3CHOA 4JPSA 4F1SA 3CVQA 5JJ6A 3DPDA 3TG5A 1ELKA 2FI7A 2E2EA 4GB9A 4I6EA 3L16A 4JW1A 4B94A 4GZDA 3IEGA 3ZHEA 2M63A 4XE0A 3CLJA 4TV3A 1P5QA 3ZYQA 3KAEA 2J4DA 2OV8A 3K9IA 2XGMA 5G04C 3CKCA 3VLDA 2KZTB 3SD5A 3UX4A 4BT9A 2I1KA 4CDNA 1U3DA 3IHYA 4JXTA 3MGBA 3LJ3A 3IHVA 3LEWA 4I2ZA 2CFZA 3FH8A 4KBQA 4AVXA 2XGOA 3TG4A 3FTXA 2OVFA 4GYWA 2LO6A 4PS8A 5G04J 3CV0A 1NP7A 2PQNA 4J6IA 2VSYA 3CHPA 1SQMA 3U4TA 3QDNA 3S7FA 2BF0X 1OUVA 4ME2A 4OVVA 2VSXE 3L17A 3PEVB 2DCPA 3PEUB 3O48A 4GA0A 1H2UA 3BEEA 4P29A 3TXNA 3URZA 4AM9A 1UJJA 4J0UA 4GA2A 1NA0A 4DLQA 3ULQA 1Y8MA 2QFCA 3PNTB 2VYIA 3FH5A 4UWFA 3NQPA 5AENA 2CG3A 3KEZA 3LKUA 2GRLA 3FU3A 4Q69A 3NF1A 4A3TA 5J90A 2HYZA 3ASDA 4YVOA 4I2WA 1HXIA 4OYSA 3ZGQA 2WXPA 3ZYMA 3BG1B 3G2WA 3SFZA 4CDRA 3CHMA 4JC8A 5FQ8A 3R9AB 4M3OA 1JPLA 4HOUA 4ANXA 4GMLA 3RO3A 3RJVA 4A55A 1HF8A 4WNGA 4N5CA 4EZLA 1N54A 2PM7A 3FUMA 3QARA 5JHBA 1XGWA 2AVPA 3FH7A 5BW8C 2R17C 3RRUA 5G05C 4KVOA 5BV1A 2WQHA 3T5XA 3QAQA 4CCAA 4ANUA 3TL5A 5LOZA 1VDYA 4A3VA 2WXJA 3ASGA 2WXHA 5EDSA 4N3CA 1HU3A 4FHKA 3E4BA 3L54A 4XX5A 1HH8A 3T8MA 3PUJA 4U0ZA 2I2OA 2WXOA 3QJZA 4CRWA 2Y4UA 3MEKA 4HXIA 5BNWA 1TJFA 1TEZA 3AS8A 3DBSA 3LS8A 2V8SE 2VGXB 5KJLA 3CVXA 1W3BA 1KT0A 1OWPA 4IYPA 2VTBB 4JEUA 1FVFA 3MKQA 5EX0A 4F7AA 3ZW3A 2CHWA 2IU1A 3ZEFA 5FZRA 1Z6TA 2J09A 3ML9A 3RRNB 4CEMA 4WNDA 3FEXA 1OWNA 5ANRA 3D9MA 1SZ9A 4U0UA 2IJGX 4L2YA 1FCHA 5LCWJ 4GZ6A 3G2TA 1GW6A 4UI9C 3CVUA 3APCA 1DNPA 3FUNA 3FU5A 4L23A 2AXZA 3LCAA 1MQSA 3ASHA 3ZYLA 4V3IA 2VQ2A 2GRMA 2E0IA 5EKQD 1PAQA 3G2UA 3ZIMA 1EYHA 4UI9J 3CHQA 2WXFA 3PDNA 1KT1A 5KCMA 2RG8A 3D9NA 4G23A 1S0PA 1XNFA 4NRHB 5M72A 1E8WA 3CKBA 1E7UA 2HO1A 3CVWA 2WXQA 2XEVA 3RO2A 3B13A 1ELRA 1HFAA 3Q5MA 4G24A 3FTWA 4ATGA 4RG6A 2KCKA 1UG3A 3ML8A 4KVMA 4GYYA 4N39A 4U04A 2Y3AA 1H19A 3SGHA 4DI4A 4J8EA 4NQ0A 1Z3YA 3JYSA 5FQ4A 1IYGA 3VTXA 5CCMA 4FJZA 4PS3A 2L6JA 4JHJA 1JWGA 3S2AA 4EBAG 4AV7A 4I6JA 3CK9A 4B89A 2WQ6A 1H2TC 3FUEA 5AYWD 4F53A 2AW6A 2I1JA 5E76A 2VGXA 4I6GA 1HE8A 2OOEA 3FUFA 1HZ4A 3PE4A 3G2VA 4CGVA 4JHKA 1NA3A 4WNEA 5CMYA 5T8IA 5JHAA 2VTBA 2MOWA 2NXPA 2X38A 3IV0A 4BTAA 5FT9A 2YINA 3HVEA 4C0EA 2IFUA 1OWMA 5J08A 4ILIA 2C0LA 4AEZC 3UUXA 4DJAA 3PREA 4LCTA 1EDUA 3UT4A 4BT8A 1HG2A 1WAO1 4XI0A 3L13A 2LAIA 2XCBA 2X6HA 1UJKA 4I1MA 3D9PA 2JLBA 1KLXA 4GZCA 4KYOB 5DBKA 1Y6IA 2QY7A 3L22A 3U3WA 2ZU6B 3FUIA 1UN8A 2V0PA 2MHKA 3P1UA 3FHEA 2WXNA 3JQ0A 3AU5A 3UT7A 4W9RA 3IBEA 1H6KA 2MRIA 4WWNA 4HOTA 3CK7A 5ARGA 5CMWA 2IF4A 4Y6CA 3ENEA 5ENNA 3SI5A 4D10C 2XRZA 2WXIA 5FWQA 4RVBA 2UY1A 4UQYA 4NURA 4XI9A 1INZA 3GZSA 3FTUA 3R7RA 3ZN3A 4N3BA 1L5JA 3SBSA 3GW4A 3HYMB 3EDTB 3CVPA 4FADA 1WM5A 4APFA 5KJMA 3QNKA 3B7UX 4OVUA 4GAAA 4UWLA 2HR2A 3I3NA 2NSZA 3OTNA 4PDXA 2ILRA 4JHRA 3T5VA 2X3MA 3NZSA 4GMJA 2FO7A 5AJDA 4AOFA 3FUJA 4DPRA 4GZ3A 4B0ZA 2Y4TA 4CGWA 3TXMA 3OXFA 3LY8A 3U64A 4I9EA 4C0MA 1JUQA 4F3VA 4FP7A 1FVHA 4FU3A 4IULA 4ACLA 5LP0A 4Q94A 2CG2A 4MRUA 2L0TB 4IN3B 4GU5A 4HOSA 4L7TA 2KZTA 3MV2B 2YNQA 3L08A 2IONA 1E8ZA 2PL2A 1N52A 3MCXA 3S7BA 1MHQA 3ZXSA 3PVLA 5T3RA 4AJWA 2LNIA 4DK5A 3B7SA 4AY5A 2XQ0A 1Z3XA 5JJ7A 4U0SA 2Q7FA 4JZYA 4LEUA 5LCWC 4E85A 4KT6B 2WVIA 5KJKA 3UPVA 4GCNA 5CHEE 5KJNA 1H0AA 3TGOA 2R59A 3QWVA 4MKTA 4FHJA 2WB2A 1ZU2A 2WXGA 3HDXA 3SHFA 2XGSA 4EECA 2HM8A 5AIJA 1QZ2A 4UWKA 3RRMB 5AJLA 3Q15A 4FLBA 5LX8A 4J8DA 2AWIA 4UQXA 2IOSA 2WMOA 3EHNA 4HS2A 1IQUA 2UWJG 4YVQC 1E96B 2OVBA 2X6KA 2A4ZA 2KCVA 3UQ3A 4CDMA 3CSFA 4H7YA 4FULA 1EPUA 4H7XA 3ZFWA 3LYAA 2WQ7A 2C0MA 2J9QA 4N3AA 1BPOA 1PY1A 3HHMA 4TRQA 2CHXA 1E8YA 4G1TA 3TJPA 3L6AA 3CIAA 3Q49B 5FTPA 4PS7A 2CFUA 3FP3A 4K03A 4ILHB 4KZCA 2J4BA 3JCKC 2WXKA 3PRZA 4WWOA 4C9BB 2V5FA 3OAWA 4UWGA 3QB2A 3R7QA 3KS2A 5T4YA 4YNDA 4ANVA 4EZJA 3CK8A 5FQ7A 3SNXA 4A1GA 1JWFA 3GYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OTN A;  3P1U A;  4F7A A;  5E75 A;  3FDH A;  3JQ0 A;  3CKB A;  4PUC A;  3NQP A;  3IV0 A;  3KEZ A;  3CKC A;  3I4G A;  4Q69 A;  5J90 A;  3CK7 A;  3HDX A;  4MRU A;  3SGH A;  3LEW A;  3MX3 A;  4L7T A;  3MYV A;  3JYS A;  5FQ4 A;  3GZS A;  5FQ6 A;  5LX8 A;  5T4Y A;  5FQ8 A;  3MCX A;  5E76 A;  5T3R A;  3CK8 A;  3EHN A;  3CGH A;  3JQ1 A;  3CK9 A;  3QNK A;  5FQ7 A;  3SNX A;  3EJN A;  4F53 A;  3L22 A;  4LER A;  3EHM A; 
#chains in the Genus database with same CATH topology
 4L2L A;  2KM4 A;  1DVP A;  2VJ8 A;  5D0O D;  1OWL A;  4I43 A;  4HI8 A;  4MBG A;  4R7L A;  3I4G A;  3FUL A;  4BX8 A;  2DIW A;  3I4R B;  1KZO A;  3UM0 A;  3DEO A;  4N2Q A;  3EIJ A;  2BKG A;  3TWV A;  4A1S A;  1BI8 B;  3OXG A;  4GA1 A;  2KAT A;  2V5Q C;  3QKY A;  3HG0 D;  2P9K G;  5H7P A;  4BTB A;  3MA5 A;  1U3C A;  3AG2 E;  5BT1 A;  1TJC A;  3KD7 A;  1ELW A;  3FTS A;  3CEQ A;  3RK6 A;  4ANW A;  3NAW A;  1QQE A;  2VSN A;  5BPP A;  5ENS D;  3U9W A;  4EZK A;  3C3R A;  4GTT A;  3AG3 E;  2XPZ A;  3GZ1 A;  4LNB A;  3MJW A;  4K5A B;  5A6C A;  3PE3 A;  3DSV A;  5DIZ A;  5CEA A;  1LD7 A;  3AJI A;  5FZS A;  5JMN D;  2CHZ A;  4URK A;  4FC8 A;  2WXR A;  1NZN A;  3O4Z A;  3MZL B;  3IKO B;  4JL0 A;  3ESL A;  2KBX A;  4HQD A;  3FFL A;  4AIF A;  3VLF A;  4I1A A;  2DZN A;  4N2S A;  3FTV A;  3D9L A;  2EIM E;  4FLH A;  1JCR A;  1OCO E;  4EQF A;  3QC1 A;  2WXM A;  2BTD A;  1AWC B;  1IQR A;  3VTY A;  4U07 A;  4WAF A;  3UM2 A;  2ETB A;  4XIF A;  1HG5 A;  2EIL E;  3NOC D;  4ILG A;  4U8V D;  3V79 K;  4QFV A;  1X5B A;  2F8Y A;  3Q47 B;  2I9C A;  4JA7 A;  1IHG A;  1OCR E;  3D9I A;  3E33 A;  5ANL A;  3D9K A;  4WNF A;  1B89 A;  3QWP A;  2ZIS A;  5A23 A;  1QNF A;  5ENO D;  4APO A;  2AXV A;  2X6I A;  5ARF A;  3AS4 A;  5FJY A;  4CT0 A;  1E7V A;  3MX3 A;  4G25 A;  4GYO A;  4BSX A;  4GPK A;  1HX8 A;  3CHO A;  2B6C A;  3EHQ A;  2E2E A;  4GB9 A;  3IEG A;  3CLJ A;  2XZD G;  1LTX A;  5EYP F;  2NYJ A;  3MGB A;  3LJ3 A;  3IHV A;  4I2Z A;  4KBQ A;  4AVX A;  2XGO A;  3TG4 A;  4GYW A;  3BU8 A;  2PQN A;  2RFM A;  2VSY A;  4J6I A;  4TUM A;  3CHP A;  3QDN A;  3S7F A;  1OUV A;  4OVV A;  3PEV B;  1IKN D;  2QZA A;  3URZ A;  4AM9 A;  4GA2 A;  4GTR A;  5CBO A;  4BET A;  4GTP A;  2QFC A;  3PNT B;  5KNG A;  4UWF A;  2LUH A;  4L9P A;  3KEZ A;  1N94 A;  2GRL A;  5AQB A;  3PZ1 A;  1TNO A;  2WXP A;  2VGE A;  4CDR A;  5FQ8 A;  4K5B A;  4ANX A;  3AG4 E;  3RJV A;  4A55 A;  4C48 B;  1HF8 A;  4B93 B;  3E34 A;  3PZ2 A;  4ANU A;  2P9S G;  5LOZ A;  4A3V A;  4N3C A;  1HU3 A;  3E4B A;  3L54 A;  4XX5 A;  3T8M A;  3PUJ A;  5KWD A;  2H6I A;  3MKQ A;  5EX0 A;  3ZW3 A;  4OAU C;  1BD8 A;  2IU1 A;  3ZEF A;  3ML9 A;  4CEM A;  4WND A;  2XEN A;  3D9M A;  3G2T A;  3CVU A;  2AXZ A;  4YDW A;  2R02 A;  4V3I A;  2GRM A;  5EKQ D;  1SVX A;  3ZIM A;  1OT8 A;  2WXF A;  2RG8 A;  3D9N A;  3HXF A;  4G23 A;  1E8W A;  2XEV A;  3B13 A;  3FTW A;  1K8K G;  2EIK E;  1UG3 A;  4GYY A;  4U04 A;  3DXM G;  4NQ0 A;  1IYG A;  2EIN E;  3SFX A;  2L6J A;  5EYL A;  4B89 A;  1H2T C;  3FUE A;  2AW6 A;  4I6G A;  3FUF A;  1HZ4 A;  4JHK A;  5CMY A;  2XS1 A;  3HXB A;  5ENR D;  4LCT A;  3L13 A;  2X6H A;  2JLB A;  1BLX B;  1KLX A;  2OCC E;  4GZC A;  5DBK A;  4J8Y A;  2QY7 A;  1UN8 A;  3FHE A;  4ZHB A;  4YDE A;  1H6K A;  4WWN A;  4HOT A;  2IF4 A;  4Y6C A;  2WXI A;  4RVB A;  4NUR A;  3R7R A;  4N3B A;  3HYM B;  4GTV A;  3EDT B;  3Q9U C;  4UWL A;  4JHR A;  2PNN A;  3NZS A;  4B0Z A;  3TXM A;  2OEW A;  3C72 A;  3U64 A;  4RLY A;  4I9E A;  4F3V A;  3LJN A;  5LP0 A;  4HOS A;  4U96 D;  4L7T A;  2YNQ A;  3L08 A;  3T9K A;  1E8Z A;  1MHQ A;  5T3R A;  4DK5 A;  2XQ0 A;  1Z3X A;  5CRU A;  4U0S A;  2Q7F A;  4LEU A;  5LCW C;  2R59 A;  1ZU2 A;  3SHF A;  1QZ2 A;  3ASN E;  3DSU A;  4UQX A;  2MYO A;  2UWJ G;  4BSZ B;  4YVQ C;  1E96 B;  2XZT G;  3HXD A;  3CSF A;  3X2Q E;  2WQ7 A;  4N3A A;  4TRQ A;  3L6A A;  4PS7 A;  4YDO A;  2P9I G;  3C5R A;  3FP3 A;  3PRZ A;  4HLL A;  5T4Y A;  4AXH A;  3WXX A;  4XKC A;  2EIJ E;  2KCL A;  3LVR E;  3ZVV A;  3RIB A;  2QYJ A;  2J08 A;  3LPZ A;  2WXL A;  5CED B;  2WMN A;  3ABM E;  3Q4A B;  1UW4 B;  4B8C B;  3E32 A;  4GTO A;  2A5U A;  3FDH A;  2YQ8 A;  2ZIR A;  1TNY A;  3FUH A;  2EQX A;  2XEH A;  3C98 A;  3PNL B;  3ESK A;  2PZI A;  3MYV A;  5A7D B;  3B7T A;  1JCS A;  5HKP A;  4CT4 A;  1MJ0 A;  2IO3 C;  3CHS A;  3Q75 A;  2F0Y A;  1A5E A;  2P2C P;  4HRM B;  4U8H A;  4UI9 K;  4TXP A;  3V2O A;  3ZU7 B;  3JXJ A;  5HS0 A;  4DLO A;  2XPI A;  2XHE A;  4M7C A;  5HQ8 A;  3TWU A;  3FEY A;  3TWS A;  5FIO A;  2RD0 A;  3ONK A;  4LER A;  1SZA A;  2DWZ A;  1YYH A;  2LSU A;  1IHB A;  1ZBP A;  4JD2 G;  3CVV A;  2FF4 A;  3RAU A;  3PUK A;  3RU0 A;  3FUK A;  4HOR A;  4HFG A;  1Z5S C;  5AQ7 A;  4YDY A;  3QK0 A;  3C3Q A;  3OXL A;  3EJN A;  2FEZ A;  3HVE B;  4MS6 A;  3CQC B;  3FU6 A;  3SO8 A;  3LY9 A;  3AAA C;  4I17 A;  1H2V C;  1U2V G;  5AQ9 A;  3D9J A;  3FU0 A;  2KC7 A;  4KMO A;  3CVL A;  4K5C A;  1N4P A;  1A17 A;  3N71 A;  2GRR B;  3FUD A;  3B95 A;  3CR3 A;  1N4R A;  3JUI A;  2C2L A;  4DX6 D;  1HO8 A;  4PH4 B;  1TNZ A;  2HE0 A;  3SZ7 A;  5LFA A;  1H6O A;  5CEC B;  5G55 A;  1N4Q A;  3CQG B;  1SA4 A;  4JPS A;  2F8X K;  4F1S A;  3CVQ A;  3TG5 A;  4B94 A;  4GZD A;  4TV3 A;  3K9I A;  5G04 C;  3CKC A;  3VLD A;  3UX4 A;  1U3D A;  3ASO E;  3IHY A;  4GPM A;  3LEW A;  2CFZ A;  3FH8 A;  2OVF A;  3DRA A;  4PS8 A;  5G04 J;  1NP7 A;  1MYO A;  4GTS A;  1SQM A;  3U4T A;  5BXU A;  2BF0 X;  4ME2 A;  3PEU B;  3O48 A;  4P29 A;  3BEE A;  1NA0 A;  4BES A;  1Y8M A;  3NOG D;  2VYI A;  2CG3 A;  3FU3 A;  4Q69 A;  4A3T A;  5J90 A;  2HYZ A;  4I2W A;  3SFZ A;  3G2W A;  1O1S A;  3RO3 A;  4EZL A;  1SW6 A;  1N54 A;  3FUM A;  3KSL A;  5JHB A;  3BUA A;  2AVP A;  5BW8 C;  4O1O A;  3RRU A;  4KVO A;  5BV1 A;  2WQH A;  3AG1 E;  4CCA A;  3TL5 A;  3HXC A;  1VDY A;  3ASG A;  5EDS A;  2I2O A;  2WXO A;  1TJF A;  3DBS A;  1MZC A;  1OWP A;  1N11 A;  1S64 A;  2J09 A;  3FEX A;  4U0U A;  1DC2 A;  4GZ6 A;  4UI9 C;  1DNP A;  3FUN A;  3W9G A;  4L23 A;  3LCA A;  1MQS A;  3Q7A A;  5BXO A;  3ZYL A;  4HRN A;  3IXE A;  3E30 A;  4UI9 J;  5M72 A;  1E7U A;  3UXG A;  1HFA A;  2BED A;  2KCK A;  3ML8 A;  1FT1 A;  2Y3A A;  5FQ4 A;  4JHJ A;  4EBA G;  3UIN C;  3RSE G;  3G2V A;  4CGV A;  1LD8 A;  1NA3 A;  5JHA A;  4BTA A;  2YIN A;  1OWM A;  3UKU G;  3UUX A;  1NI1 A;  3UT4 A;  4BT8 A;  1HG2 A;  3UM3 A;  2LAI A;  3EHR A;  2GRQ B;  4DUI A;  2MHK A;  2P9U G;  3UT7 A;  4HNA D;  5AAO A;  4F6R D;  2R2L A;  3CK7 A;  5CMW A;  5ENN A;  3SI5 A;  5FWQ A;  4XI9 A;  5AN8 A;  3FTU A;  3PZ3 A;  3GW4 A;  5CRV A;  1WM5 A;  4OVU A;  3I3N A;  3ZXP A;  3T5V A;  1SA5 A;  5AJD A;  4AOF A;  3FUJ A;  4GZ3 A;  4CGW A;  3UKR G;  4FU3 A;  2CG2 A;  4MRU A;  4GU5 A;  3ZNG A;  2PL2 A;  5CBN A;  4AJW A;  3PVL A;  1WDY A;  4AY5 A;  5JJ7 A;  2A5E A;  3NBN B;  5EIL A;  3PZ4 A;  5KJK A;  3UPV A;  4MKT A;  4FHJ A;  2WB2 A;  5KBA A;  2HM8 A;  5AIJ A;  4UWK A;  3EUV A;  3Q15 A;  5LX8 A;  2H6F A;  2RFA A;  3EHN A;  3UQ3 A;  4CDM A;  4H7Y A;  2P9L G;  2C0M A;  1PY1 A;  3CIA A;  5ENQ D;  5AAR A;  2GRP B;  2J4B A;  3JCK C;  4WWO A;  4C9B B;  4A63 B;  4YND A;  4EZJ A;  3SNX A;  2LXL A;  4I9C A;  3ASF A;  4L1B A;  4ABN A;  1K1A A;  5ENT D;  3BQO A;  1BU9 A;  1KPS B;  4XZ4 A;  2X6J A;  2PM6 A;  5IY5 E;  3AS5 A;  4HI9 A;  4RG9 A;  4JEH A;  1UN9 A;  3MV3 B;  4BWR A;  3UMV A;  3HIZ A;  5HI7 A;  4U63 A;  1N95 A;  2OND A;  2I6H A;  4XKB A;  5D0Q D;  2IQC A;  3FWV A;  4HLE A;  3D9O A;  4G11 A;  3FY4 A;  4EBA A;  2IOL A;  3AU4 A;  1E8X A;  4J7W A;  3ZKJ A;  3B7B A;  2ZXW E;  4PUC A;  4K0R A;  2XCC A;  4IRU A;  5EX3 A;  4JVS A;  2H6H A;  2WPV A;  4FA6 A;  4I1O B;  4HRL A;  3I5P A;  1YMP A;  3APD A;  4JA9 A;  3CST A;  4KXK B;  5C2Y A;  3B7R L;  3PS6 A;  2R03 A;  3ZPJ A;  3EHM A;  2AXU A;  1X81 A;  2ZGG A;  2LAH A;  3BG0 B;  4GCO A;  2NC9 A;  1MX2 A;  5G05 J;  4J8F A;  4DI3 A;  3P2B A;  4LUN U;  2XRY A;  5C1D A;  4UQZ A;  4HVB A;  4GZ5 A;  4ACK A;  1OWO A;  1WY6 A;  5FIN A;  3S7J A;  4E6H A;  3CVY A;  4MLP A;  3U66 A;  4G26 A;  3LVQ E;  4BX9 A;  5B1A E;  2GW1 A;  5BV0 A;  4LNG A;  1D9S A;  3LY7 A;  3APF A;  4O60 A;  3UT8 A;  3S7D A;  4KZ0 A;  4WWP A;  4O6F A;  2LSV A;  4TUU A;  2P58 C;  2UY1 B;  3EU9 A;  4CYM D;  4DX2 A;  3ABK E;  5G2N A;  4LRZ A;  4TXR A;  5BUZ A;  1N0Q A;  4DX5 D;  3UIO C;  3LXU X;  3CGH A;  3DPD A;  2FI7 A;  1P5Q A;  2F37 A;  3ZYQ A;  3KAE A;  2OV8 A;  2B0O E;  4HBD A;  2KZT B;  1G3N B;  4Z68 A;  4CDN A;  4JXT A;  2LO6 A;  1WG0 A;  3CV0 A;  4N5Q A;  2VSX E;  2DCP A;  4GA0 A;  3TXN A;  1UJJ A;  4DLQ A;  3ULQ A;  5AEN A;  3NQP A;  4CZ2 D;  1MX4 A;  2J8S D;  3NF1 A;  1IXV A;  4YVO A;  1ZB1 A;  3D9H A;  4OYS A;  3ZYM A;  4JC8 A;  1JPL A;  4GML A;  3SY2 A;  2PM7 A;  3QAR A;  1XGW A;  3FH7 A;  2R17 C;  4RQI A;  3T5X A;  1O1T A;  3TWX A;  4U0Z A;  2QYU A;  4CRW A;  5BNW A;  3MEK A;  3AS8 A;  2VGX B;  1RW2 A;  3DST A;  2L6B A;  3CVX A;  3KSQ A;  1KT0 A;  4IYP A;  2VTB B;  4U8Y D;  3J5Q B;  5FZR A;  1Z6T A;  4UUC A;  3J5P A;  5ANR A;  1QYM A;  4L2Y A;  1FCH A;  3APC A;  3FU5 A;  4BER A;  3ASH A;  1V55 E;  2VQ2 A;  2E0I A;  1PAQ A;  3G2U A;  1EYH A;  3CHQ A;  1KT1 A;  5KCM A;  1S0P A;  4NRH B;  3CKB A;  1S70 B;  2HO1 A;  3CVW A;  1NFI E;  2WXQ A;  3RO2 A;  1ELR A;  3Q5M A;  4G24 A;  4ATG A;  4KVM A;  4N39 A;  2RKK A;  4DI4 A;  3JYS A;  4PS3 A;  3UIP C;  3S2A A;  4AV7 A;  2WQ6 A;  1K3Z D;  2VGX A;  5D2M C;  2OOE A;  3PE4 A;  4LSZ E;  5T8I A;  4GTQ A;  2VTB A;  2MOW A;  2NXP A;  3HVE A;  5J08 A;  4ILI A;  4AEZ C;  4DJA A;  3PRE A;  1EDU A;  3R9M A;  2XCB A;  5HRY A;  3D9P A;  4KYO B;  3L22 A;  2ZU6 B;  3JQ0 A;  3AU5 A;  2GRN B;  2MRI A;  4U95 D;  2XRZ A;  2JAB A;  3GZS A;  3ZN3 A;  4XEI G;  4FAD A;  5KJM A;  3QNK A;  3B7U X;  1D8E A;  4GAA A;  2HR2 A;  3OTN A;  4PDX A;  4ZFH A;  4GMJ A;  2FO7 A;  2Y4T A;  2V4H C;  3LY8 A;  1FPP A;  1JUQ A;  4C0M A;  4Q94 A;  2L0T B;  3MV2 B;  3S7B A;  1N52 A;  3B7S A;  3Q9N C;  5D66 A;  3ABL E;  4JZY A;  4O1P A;  4E85 A;  2ZGD A;  2WVI A;  5KJN A;  2XEE A;  1H0A A;  3QWV A;  1V54 E;  2WXG A;  3HDX A;  4EEC A;  1DCE A;  2OEV A;  3Q79 A;  4J8D A;  2WMO A;  3UTM A;  1IQU A;  1JCQ A;  2OVB A;  2KCV A;  4FUL A;  3ZFW A;  3LYA A;  1OCC E;  2J9Q A;  1BPO A;  3HHM A;  3SQV A;  2CHX A;  3ISM C;  5FTP A;  2V5F A;  4UWG A;  3QB2 A;  3R7Q A;  2R05 A;  3CK8 A;  3DPY A;  4A1G A;  1JWF A;  3GYZ A;  3SBT B;  4RSY A;  1DCQ A;  2V4L A;  5B3S E;  3FTY A;  2Y1L E;  3Q78 A;  4EPZ A;  3ONL A;  2X6F A;  3FTZ A;  4LG6 A;  3ZUV B;  4WUY A;  2VGY A;  4G2V A;  1QBQ A;  3SF4 A;  3QWW A;  3JQ1 A;  4BFR A;  3ZYK A;  4ATZ D;  1O1R A;  1LF8 A;  5E75 A;  4AP2 A;  1RZ4 A;  3KEA A;  2KXP C;  4QQI A;  2ETC A;  2GGF A;  3QOU A;  4BY6 A;  2ETA A;  4NAC A;  2FUL A;  3MKQ B;  2PQR A;  4HOQ A;  1PC2 A;  3EIQ C;  3CHR A;  1BI7 B;  3NB2 A;  5EIB E;  1N4S A;  2L0I A;  1E90 A;  2VSO E;  1N9A A;  2J07 A;  2QC9 A;  3PZD A;  4UWH A;  2IEJ A;  1S63 A;  5JA4 D;  3PH0 C;  2J49 A;  1EF1 C;  4B8A A;  1OXJ A;  5ITZ F;  3WG7 E;  4AY6 A;  2YHC A;  2FBN A;  2Y69 E;  3UI2 A;  3RKV A;  2DBA A;  3ZRH A;  1Q2Z A;  2L9B A;  4HB5 A;  3TAX A;  3CVN A;  3MKR A;  2BUG A;  2YHE A;  2R5S A;  3ZHE B;  3D3M A;  4DX1 A;  4FJY A;  3DSX A;  2XS8 A;  5CCL A;  3Q7F A;  2JEK A;  1TR4 A;  4J8S A;  2XPY A;  3VLE A;  3LDZ A;  1OCZ E;  5FZQ A;  4Q96 A;  1FT2 A;  2WM9 A;  3F6Q A;  3G2S A;  2GRO B;  1YA0 A;  1TYQ G;  3GZ2 A;  2DZO A;  4Y6W A;  5FQ6 A;  5JJT A;  1HS6 A;  1TN7 A;  1UOH A;  3NZU A;  5JJ6 A;  1ELK A;  4I6E A;  2P9N G;  4JW1 A;  3L16 A;  3ZHE A;  2M63 A;  3DXK G;  4XE0 A;  2J4D A;  2XGM A;  4U7E B;  3SD5 A;  3ULY A;  4BT9 A;  2I1K A;  4JB8 P;  2AJA A;  3FTX A;  3V30 A;  5EID A;  3L17 A;  1H2U A;  4J0U A;  1KZP A;  3FH5 A;  3LKU A;  3UM1 A;  3ASD A;  1HXI A;  3ZGQ A;  3BG1 B;  3CHM A;  3R9A B;  4M3O A;  4HOU A;  2DYR E;  5AQA A;  3DSS A;  4WNG A;  4N5C A;  5G05 C;  3QAQ A;  3V2X A;  3SFY A;  2WXJ A;  3DEP A;  2WXH A;  4FHK A;  1HH8 A;  4G8K A;  3JUE A;  1TEZ A;  3QJZ A;  2Y4U A;  4HXI A;  3C3O A;  3LS8 A;  2V8S E;  4TXQ A;  5KJL A;  1W3B A;  4JEU A;  1FVF A;  1AP7 A;  4F7A A;  2CHW A;  4GTM A;  3RRN B;  4EHM A;  1OWN A;  1K1B A;  1SZ9 A;  2IJG X;  2IO2 C;  5LCW J;  1GW6 A;  1NL4 A;  5B1B E;  3TWR A;  3V31 A;  3PDN A;  2IY0 C;  4OAV B;  1XNF A;  2H6G A;  3DWL G;  4G8L A;  2FO1 E;  4RG6 A;  4BEP A;  1H19 A;  4GMR A;  3SGH A;  4J8E A;  1Z3Y A;  3VTX A;  5CCM A;  3DSW A;  4FJZ A;  1MX6 A;  1JWG A;  3Q73 A;  1TNU A;  3CK9 A;  4I6J A;  2BKK B;  5AYW D;  4F53 A;  2I1J A;  5E76 A;  1HE8 A;  4WNE A;  4X8Q A;  2X38 A;  3IV0 A;  5FT9 A;  4C0E A;  2IFU A;  2C0L A;  4DRX E;  1WAO 1;  4XI0 A;  1UJK A;  4I1M A;  2LXM A;  1Y6I A;  3U3W A;  3FUI A;  2V0P A;  3HRA A;  3P1U A;  3TWW A;  2WXN A;  4W9R A;  3IBE A;  5ARG A;  3ENE A;  2UY1 A;  4UQY A;  3TWQ A;  1INZ A;  3W9F A;  1L5J A;  3SBS A;  3CVP A;  4APF A;  3L9T A;  2NSZ A;  2ILR A;  2X3M A;  3TWT A;  4DPR A;  3T8K A;  3OXF A;  4NIK A;  3ULE G;  4FP7 A;  1FVH A;  4IUL A;  4ACL A;  4IN3 B;  2KZT A;  1N0R A;  1TN6 A;  2ION A;  3MCX A;  3ZXS A;  4D10 C;  2LNI A;  3JXI A;  4LNU D;  3E37 A;  1TN8 A;  4DX7 D;  1TNB A;  5CER B;  4KT6 B;  1H6P A;  4GCN A;  5CHE E;  3HXE A;  3TGO A;  5EN5 D;  3EU5 A;  1D8D A;  2XGS A;  3RRM B;  5AJL A;  2Y0B G;  4FLB A;  5ENP D;  4F1P A;  2AWI A;  1OY3 D;  2IOS A;  4HS2 A;  2X6K A;  2A4Z A;  1O5M A;  4H7X A;  1EPU A;  5KNH D;  1E8Y A;  4G1T A;  3TJP A;  2DVW A;  3Q49 B;  2CFU A;  4K03 A;  4ILH B;  4KZC A;  2P9P G;  2WXK A;  3OAW A;  3KS2 A;  4ANV A;  1YCS B;  2DYS E;  3L82 A;  5FQ7 A; 
#chains in the Genus database with same CATH homology
 4L2L A;  3SBT B;  4AXH A;  2KM4 A;  1DVP A;  2VJ8 A;  5D0O D;  1OWL A;  4I43 A;  4I9C A;  4RSY A;  3WXX A;  3ASF A;  2V4L A;  4L1B A;  4XKC A;  2KCL A;  3FTY A;  4R7L A;  3I4G A;  3FUL A;  4BX8 A;  4ABN A;  4EPZ A;  3LVR E;  3ONL A;  2DIW A;  3I4R B;  2X6F A;  3FTZ A;  4N2Q A;  3EIJ A;  4WUY A;  2VGY A;  4G2V A;  4A1S A;  3ZVV A;  3SF4 A;  3RIB A;  2J08 A;  4XZ4 A;  2X6J A;  3QWW A;  2PM6 A;  3OXG A;  3LPZ A;  3JQ1 A;  2WXL A;  4BFR A;  2WMN A;  3AS5 A;  4GA1 A;  2KAT A;  3ZYK A;  4RG9 A;  4JEH A;  3QKY A;  1UN9 A;  3Q4A B;  1UW4 B;  4B8C B;  3MV3 B;  1LF8 A;  2A5U A;  3FDH A;  5E75 A;  4AP2 A;  4BY6 A;  2YQ8 A;  4BWR A;  3UMV A;  4BTB A;  3MA5 A;  1U3C A;  5BT1 A;  3HIZ A;  5HI7 A;  3FUH A;  4U63 A;  2GGF A;  1TJC A;  2OND A;  3QOU A;  2EQX A;  2I6H A;  3KD7 A;  3C98 A;  1ELW A;  3ESK A;  3PNL B;  3FTS A;  4XKB A;  5D0Q D;  3CEQ A;  2IQC A;  2PZI A;  3MYV A;  3FWV A;  4NAC A;  3RK6 A;  2FUL A;  4HLE A;  5A7D B;  4ANW A;  1QQE A;  2VSN A;  2PQR A;  3B7T A;  3MKQ B;  5BPP A;  4HOQ A;  3D9O A;  4G11 A;  3FY4 A;  4EBA A;  1PC2 A;  2IOL A;  3AU4 A;  3CHR A;  3EIQ C;  3U9W A;  1E8X A;  4CT4 A;  4EZK A;  3CHS A;  2L0I A;  4PUC A;  4K0R A;  1E90 A;  2XCC A;  2XPZ A;  3GZ1 A;  4IRU A;  5EX3 A;  4JVS A;  2WPV A;  3MJW A;  4FA6 A;  2VSO E;  4U8H A;  4I1O B;  4UI9 K;  2J07 A;  3I5P A;  5A6C A;  3APD A;  4DLO A;  2XPI A;  3PE3 A;  2XHE A;  3PZD A;  4JA9 A;  4UWH A;  5HQ8 A;  3CST A;  5DIZ A;  4KXK B;  3FEY A;  5C2Y A;  5FZS A;  3PH0 C;  2J49 A;  3B7R L;  2RD0 A;  3PS6 A;  2CHZ A;  4URK A;  1EF1 C;  4B8A A;  3ONK A;  4FC8 A;  4LER A;  3ZPJ A;  2WXR A;  3EHM A;  1NZN A;  4AY6 A;  3O4Z A;  2YHC A;  2AXU A;  2FBN A;  3MZL B;  1SZA A;  3IKO B;  4JL0 A;  2LAH A;  2LSU A;  3ESL A;  1ZBP A;  3RKV A;  3CVV A;  2DBA A;  3ZRH A;  3BG0 B;  2L9B A;  2FF4 A;  3FFL A;  4AIF A;  3TAX A;  4GCO A;  3PUK A;  2NC9 A;  3CVN A;  3RU0 A;  5G05 J;  4J8F A;  3FUK A;  3MKR A;  2BUG A;  2YHE A;  3VLF A;  2R5S A;  4HOR A;  4HFG A;  4DI3 A;  4I1A A;  3ZHE B;  3P2B A;  4LUN U;  3D3M A;  3QK0 A;  4N2S A;  3FTV A;  2XRY A;  3D9L A;  3OXL A;  4FJY A;  3EJN A;  4FLH A;  2FEZ A;  3HVE B;  4EQF A;  3QC1 A;  5C1D A;  4UQZ A;  5CCL A;  2WXM A;  2BTD A;  2JEK A;  4MS6 A;  4HVB A;  1IQR A;  3VTY A;  4U07 A;  4GZ5 A;  4WAF A;  3CQC B;  4ACK A;  4XIF A;  1HG5 A;  3FU6 A;  3LY9 A;  1OWO A;  1WY6 A;  4J8S A;  4ILG A;  3S7J A;  2XPY A;  4E6H A;  4I17 A;  4QFV A;  1H2V C;  3CVY A;  4MLP A;  3D9J A;  1X5B A;  3FU0 A;  3Q47 B;  2I9C A;  2KC7 A;  3LVQ E;  4G26 A;  4JA7 A;  3U66 A;  4BX9 A;  3VLE A;  4KMO A;  1IHG A;  2GW1 A;  3CVL A;  3LDZ A;  5BV0 A;  3LY7 A;  3D9I A;  5ANL A;  3D9K A;  1A17 A;  3APF A;  4WNF A;  3UT8 A;  3N71 A;  3S7D A;  1B89 A;  4KZ0 A;  3QWP A;  5FZQ A;  4WWP A;  3FUD A;  4O6F A;  4Q96 A;  2LSV A;  2WM9 A;  5A23 A;  4TUU A;  1QNF A;  3CR3 A;  4APO A;  2P58 C;  2C2L A;  2UY1 B;  3JUI A;  3G2S A;  1HO8 A;  4PH4 B;  2AXV A;  1YA0 A;  2X6I A;  5ARF A;  3AS4 A;  5FJY A;  5G2N A;  4LRZ A;  4CT0 A;  1E7V A;  3SZ7 A;  3MX3 A;  4G25 A;  5BUZ A;  5LFA A;  4GYO A;  4BSX A;  3GZ2 A;  4GPK A;  4Y6W A;  5FQ6 A;  1HX8 A;  1HS6 A;  5JJT A;  5G55 A;  3CQG B;  3LXU X;  3NZU A;  3CGH A;  3CHO A;  4JPS A;  4F1S A;  3CVQ A;  5JJ6 A;  3DPD A;  3TG5 A;  1ELK A;  2FI7 A;  2E2E A;  4GB9 A;  4I6E A;  3L16 A;  4JW1 A;  4B94 A;  4GZD A;  3IEG A;  3ZHE A;  2M63 A;  4XE0 A;  3CLJ A;  4TV3 A;  1P5Q A;  3ZYQ A;  3KAE A;  2J4D A;  2OV8 A;  3K9I A;  2XGM A;  5G04 C;  3CKC A;  3VLD A;  2KZT B;  3SD5 A;  3UX4 A;  4BT9 A;  2I1K A;  4CDN A;  1U3D A;  3IHY A;  4JXT A;  3MGB A;  3LJ3 A;  3IHV A;  3LEW A;  4I2Z A;  2CFZ A;  3FH8 A;  4KBQ A;  4AVX A;  2XGO A;  3TG4 A;  3FTX A;  2OVF A;  4GYW A;  2LO6 A;  4PS8 A;  5G04 J;  3CV0 A;  1NP7 A;  2PQN A;  4J6I A;  2VSY A;  3CHP A;  1SQM A;  3U4T A;  3QDN A;  3S7F A;  2BF0 X;  1OUV A;  4ME2 A;  4OVV A;  2VSX E;  3L17 A;  3PEV B;  2DCP A;  3PEU B;  3O48 A;  4GA0 A;  1H2U A;  3BEE A;  4P29 A;  3TXN A;  3URZ A;  4AM9 A;  1UJJ A;  4J0U A;  4GA2 A;  1NA0 A;  4DLQ A;  3ULQ A;  1Y8M A;  2QFC A;  3PNT B;  2VYI A;  3FH5 A;  4UWF A;  3NQP A;  5AEN A;  2CG3 A;  3KEZ A;  3LKU A;  2GRL A;  3FU3 A;  4Q69 A;  3NF1 A;  4A3T A;  5J90 A;  2HYZ A;  3ASD A;  4YVO A;  4I2W A;  1HXI A;  4OYS A;  3ZGQ A;  2WXP A;  3ZYM A;  3BG1 B;  3G2W A;  3SFZ A;  4CDR A;  3CHM A;  4JC8 A;  5FQ8 A;  3R9A B;  4M3O A;  1JPL A;  4HOU A;  4ANX A;  4GML A;  3RO3 A;  3RJV A;  4A55 A;  1HF8 A;  4WNG A;  4N5C A;  4EZL A;  1N54 A;  2PM7 A;  3FUM A;  3QAR A;  5JHB A;  1XGW A;  2AVP A;  3FH7 A;  5BW8 C;  2R17 C;  3RRU A;  5G05 C;  4KVO A;  5BV1 A;  2WQH A;  3T5X A;  3QAQ A;  4CCA A;  4ANU A;  3TL5 A;  5LOZ A;  1VDY A;  4A3V A;  2WXJ A;  3ASG A;  2WXH A;  5EDS A;  4N3C A;  1HU3 A;  4FHK A;  3E4B A;  3L54 A;  4XX5 A;  1HH8 A;  3T8M A;  3PUJ A;  4U0Z A;  2I2O A;  2WXO A;  3QJZ A;  4CRW A;  2Y4U A;  3MEK A;  4HXI A;  5BNW A;  1TJF A;  1TEZ A;  3AS8 A;  3DBS A;  3LS8 A;  2V8S E;  2VGX B;  5KJL A;  3CVX A;  1W3B A;  1KT0 A;  1OWP A;  4IYP A;  2VTB B;  4JEU A;  1FVF A;  3MKQ A;  5EX0 A;  4F7A A;  3ZW3 A;  2CHW A;  2IU1 A;  3ZEF A;  5FZR A;  1Z6T A;  2J09 A;  3ML9 A;  3RRN B;  4CEM A;  4WND A;  3FEX A;  1OWN A;  5ANR A;  3D9M A;  1SZ9 A;  4U0U A;  2IJG X;  4L2Y A;  1FCH A;  5LCW J;  4GZ6 A;  3G2T A;  1GW6 A;  4UI9 C;  3CVU A;  3APC A;  1DNP A;  3FUN A;  3FU5 A;  4L23 A;  2AXZ A;  3LCA A;  1MQS A;  3ASH A;  3ZYL A;  4V3I A;  2VQ2 A;  2GRM A;  2E0I A;  5EKQ D;  1PAQ A;  3G2U A;  3ZIM A;  1EYH A;  4UI9 J;  3CHQ A;  2WXF A;  3PDN A;  1KT1 A;  5KCM A;  2RG8 A;  3D9N A;  4G23 A;  1S0P A;  1XNF A;  4NRH B;  5M72 A;  1E8W A;  3CKB A;  1E7U A;  2HO1 A;  3CVW A;  2WXQ A;  2XEV A;  3RO2 A;  3B13 A;  1ELR A;  1HFA A;  3Q5M A;  4G24 A;  3FTW A;  4ATG A;  4RG6 A;  2KCK A;  1UG3 A;  3ML8 A;  4KVM A;  4GYY A;  4N39 A;  4U04 A;  2Y3A A;  1H19 A;  3SGH A;  4DI4 A;  4J8E A;  4NQ0 A;  1Z3Y A;  3JYS A;  5FQ4 A;  1IYG A;  3VTX A;  5CCM A;  4FJZ A;  4PS3 A;  2L6J A;  4JHJ A;  1JWG A;  3S2A A;  4EBA G;  4AV7 A;  4I6J A;  3CK9 A;  4B89 A;  2WQ6 A;  1H2T C;  3FUE A;  5AYW D;  4F53 A;  2AW6 A;  2I1J A;  5E76 A;  2VGX A;  4I6G A;  1HE8 A;  2OOE A;  3FUF A;  1HZ4 A;  3PE4 A;  3G2V A;  4CGV A;  4JHK A;  1NA3 A;  4WNE A;  5CMY A;  5T8I A;  5JHA A;  2VTB A;  2MOW A;  2NXP A;  2X38 A;  3IV0 A;  4BTA A;  5FT9 A;  2YIN A;  3HVE A;  4C0E A;  2IFU A;  1OWM A;  5J08 A;  4ILI A;  2C0L A;  4AEZ C;  3UUX A;  4DJA A;  3PRE A;  4LCT A;  1EDU A;  3UT4 A;  4BT8 A;  1HG2 A;  1WAO 1;  4XI0 A;  3L13 A;  2LAI A;  2XCB A;  2X6H A;  1UJK A;  4I1M A;  3D9P A;  2JLB A;  1KLX A;  4GZC A;  4KYO B;  5DBK A;  1Y6I A;  2QY7 A;  3L22 A;  3U3W A;  2ZU6 B;  3FUI A;  1UN8 A;  2V0P A;  2MHK A;  3P1U A;  3FHE A;  2WXN A;  3JQ0 A;  3AU5 A;  3UT7 A;  4W9R A;  3IBE A;  1H6K A;  2MRI A;  4WWN A;  4HOT A;  3CK7 A;  5ARG A;  5CMW A;  2IF4 A;  4Y6C A;  3ENE A;  5ENN A;  3SI5 A;  4D10 C;  2XRZ A;  2WXI A;  5FWQ A;  4RVB A;  2UY1 A;  4UQY A;  4NUR A;  4XI9 A;  1INZ A;  3GZS A;  3FTU A;  3R7R A;  3ZN3 A;  4N3B A;  1L5J A;  3SBS A;  3GW4 A;  3HYM B;  3EDT B;  3CVP A;  4FAD A;  1WM5 A;  4APF A;  5KJM A;  3QNK A;  3B7U X;  4OVU A;  4GAA A;  4UWL A;  2HR2 A;  3I3N A;  2NSZ A;  3OTN A;  4PDX A;  2ILR A;  4JHR A;  3T5V A;  2X3M A;  3NZS A;  4GMJ A;  2FO7 A;  5AJD A;  4AOF A;  3FUJ A;  4DPR A;  4GZ3 A;  4B0Z A;  2Y4T A;  4CGW A;  3TXM A;  3OXF A;  3LY8 A;  3U64 A;  4I9E A;  4C0M A;  1JUQ A;  4F3V A;  4FP7 A;  1FVH A;  4FU3 A;  4IUL A;  4ACL A;  5LP0 A;  4Q94 A;  2CG2 A;  4MRU A;  2L0T B;  4IN3 B;  4GU5 A;  4HOS A;  4L7T A;  2KZT A;  3MV2 B;  2YNQ A;  3L08 A;  2ION A;  1E8Z A;  2PL2 A;  1N52 A;  3MCX A;  3S7B A;  1MHQ A;  3ZXS A;  3PVL A;  5T3R A;  4AJW A;  2LNI A;  4DK5 A;  3B7S A;  4AY5 A;  2XQ0 A;  1Z3X A;  5JJ7 A;  4U0S A;  2Q7F A;  4JZY A;  4LEU A;  5LCW C;  4E85 A;  4KT6 B;  2WVI A;  5KJK A;  3UPV A;  4GCN A;  5CHE E;  5KJN A;  1H0A A;  3TGO A;  2R59 A;  3QWV A;  4MKT A;  4FHJ A;  2WB2 A;  1ZU2 A;  2WXG A;  3HDX A;  3SHF A;  2XGS A;  4EEC A;  2HM8 A;  5AIJ A;  1QZ2 A;  4UWK A;  3RRM B;  5AJL A;  3Q15 A;  4FLB A;  5LX8 A;  4J8D A;  2AWI A;  4UQX A;  2IOS A;  2WMO A;  3EHN A;  4HS2 A;  1IQU A;  2UWJ G;  4YVQ C;  1E96 B;  2OVB A;  2X6K A;  2A4Z A;  2KCV A;  3UQ3 A;  4CDM A;  3CSF A;  4H7Y A;  4FUL A;  1EPU A;  4H7X A;  3ZFW A;  3LYA A;  2WQ7 A;  2C0M A;  2J9Q A;  4N3A A;  1BPO A;  1PY1 A;  3HHM A;  4TRQ A;  2CHX A;  1E8Y A;  4G1T A;  3TJP A;  3L6A A;  3CIA A;  3Q49 B;  5FTP A;  4PS7 A;  2CFU A;  3FP3 A;  4K03 A;  4ILH B;  4KZC A;  2J4B A;  3JCK C;  2WXK A;  3PRZ A;  4WWO A;  4C9B B;  2V5F A;  3OAW A;  4UWG A;  3QB2 A;  3R7Q A;  3KS2 A;  5T4Y A;  4YND A;  4ANV A;  4EZJ A;  3CK8 A;  5FQ7 A;  3SNX A;  4A1G A;  1JWF A;  3GYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...