3CGHA

Crystal structure of a susd homolog (bt_3984) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
507
structure length
507
Chain Sequence
PYEAPDLSADGYALGSAMNNLAGCVVSPDVNTAQFTDCLLGGPLGGYFADSNAGFTETISNFNPKDDWSRVFLKSDKIIPTLYSNLTQVKLVSQNTNDPVPYAIAQVIKVAAMHRVTDAFGPIPYSQIGANGEIATPYDSQEVTYNTFFDELNAAIATLNENSNEQLVPTADYIYKGDVKKWIRFANSLKLRLAIRIAYANPVKAQQMAEEAVNPANGGVIESNADNATWNYFETSQNPIYVATRYNQVQTSDHGGVPCLTGGDTHAAADIICYMNGYKDNRREKFFTKSEWAGQDYVGMRRGIVIPELKTTGHKYSGVNIAPTSPLYWMNAAEVAFLRAEGQAVFNFSMGGTAESFYNQGIRLSFEQWGADGVEDYLKDDVNKPTAYTDPAGTNTYQNALSNITIKWNDSADKEEKQERIIVQKWIANWQLGNEAWADFRRTGYPKLIPVKENKSGGVVDSEKGARRMPYPLDEFVSNKANVEYAIANYLHGADNMATDVWWASKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords SusD homolog
publication title Structure of BT_3984, a member of the SusD/RagB family of nutrient-binding molecules.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
total genus 187
structure length 507
sequence length 507
ec nomenclature
pdb deposition date 2008-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12741 SusD-like Susd and RagB outer membrane lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3cghA00
3CK7A 3I4GA 3IV0A 3MYVA 3CK9A 3CKCA 3L22A 3NQPA 5E76A 4Q69A 3FDHA 4LERA 3SGHA 3JQ0A 5T3RA 3EHMA 3OTNA 5FQ7A 5FQ6A 3EHNA 3CGHA 5T4YA 4F7AA 5LX8A 5J90A 3SNXA 3MCXA 3CKBA 3MX3A 5E75A 3EJNA 3LEWA 3JQ1A 3GZSA 4PUCA 5FQ4A 4F53A 3P1UA 5FQ8A 3JYSA 4L7TA 3QNKA 3KEZA 3HDXA 3CK8A 4MRUA
chains in the Genus database with same CATH superfamily
1JCQA 2OCCE 5JJ7A 2WXRA 1AWCB 1Y8MA 5BT1A 3GYZA 2VYIA 4XKBA 4I6GA 2WXQA 2QZAA 1N9AA 3B95A 3L17A 4YDEA 3EHQA 1BU9A 4U63A 3ZUVB 4DX1A 4HLEA 2WM9A 3CGHA 5CRVA 3ASDA 3KEAA 2CHWA 3SNXA 5KJKA 3IKOB 4GA1A 3O4ZA 3FUJA 1RW2A 3CK9A 2A5UA 2C0MA 4PS3A 5AQ7A 2ETAA 5BW8C 2JABA 5LCWJ 1SW6A 4XX5A 4F3VA 2GRQB 4J8DA 3URZA 4C0MA 5BXOA 3ENEA 2H6FA 4I1MA 2XEHA 4JA9A 4NURA 4QQIA 4L9PA 1UJJA 2R05A 1U2VG 2J4BA 4CYMD 4XEIG 2XRYA 3DSWA 5FZSA 4EPZA 2EINE 4HBDA 4OAVB 1TNZA 3S7JA 3CVVA 4BSXA 3APCA 5BV1A 4JPSA 2OEWA 1INZA 4G2VA 4L7TA 3V79K 2AXVA 2J08A 4FHJA 3PDNA 1JWFA 3T8MA 4GCOA 3ZKJA 4AY6A 5AJDA 3MV3B 3RO2A 4NQ0A 4DX7D 4GA2A 3I3NA 3CHPA 5CCMA 4UWKA 3V31A 1V54E 1E96B 3EHRA 1BLXB 2DYSE 3Q5MA 4XKCA 4JZYA 2EIME 4O1OA 2PQRA 2XPIA 4FULA 4DPRA 2KCLA 2P9PG 4GYWA 4GYYA 3TWWA 1WDYA 4JHKA 1A5EA 1Z3YA 5LOZA 3UIPC 1EYHA 3ASHA 1OWLA 3UXGA 3AS8A 2YQ8A 3UKRG 2PL2A 1IKND 4WNEA 5HI7A 3D9HA 4U96D 1ZU2A 1MQSA 2GW1A 3FULA 3RAUA 3MYVA 3FU0A 3MKQA 3RIBA 2XQ0A 3QK0A 3ASNE 4N3BA 4TUUA 1MX4A 2XENA 3T8KA 2YINA 2A5EA 3UX4A 4MKTA 4DK5A 3FY4A 3N71A 4G26A 4IULA 4ANUA 1Z5SC 4GTTA 4UWFA 3CVUA 5CMYA 4LEUA 1N4PA 2P9UG 3WG7E 3VTYA 3UT4A 4JVSA 3NOGD 1OCCE 5HS0A 5EN5D 2PM6A 5CECB 3DEPA 1ELWA 4I6JA 3CVYA 3TL5A 4BY6A 3C3RA 4GB9A 4HRNA 4UQZA 5JJTA 3U64A 3CR3A 2WXHA 5HQ8A 2DWZA 1HU3A 2LAHA 3ABLE 2QC9A 3ASGA 5CEAA 5CBOA 2J4DA 3ZYMA 5D0OD 2IU1A 4WWPA 2V4HC 3FUNA 4FC8A 2I6HA 3ASFA 4QFVA 3WXXA 3L13A 4ATGA 3OTNA 1N4RA 5AIJA 3O48A 4Y6WA 2VQ2A 3FU6A 1HG5A 5EYPF 2WXNA 5AQBA 3RK6A 2WVIA 4J8FA 3NOCD 4URKA 3DXMG 4IYPA 2YHCA 2WXIA 5JA4D 3TWTA 3SBSA 5J08A 3DWLG 4CGVA 3SF4A 1PY1A 3TWXA 2DZOA 4O60A 3AJIA 2GRRB 4U07A 3UT7A 3Q75A 4MS6A 2DYRE 4XI9A 4F1PA 4FJYA 1JCRA 3UMVA 4KMOA 1ELKA 2HM8A 2NSZA 3UINC 3TWRA 2Y3AA 2UWJG 3VLFA 1FVFA 4GTMA 1KT0A 1KT1A 5C2YA 3Q15A 3NQPA 4HRLA 2MOWA 3F6QA 4AIFA 1LF8A 2EILE 4IN3B 3E4BA 1TN7A 3U3WA 2J9QA 2VSYA 3IHYA 2P9IG 2IOSA 3QJZA 3ZGQA 3KD7A 2X6JA 3AS5A 5FINA 5CEDB 4CGWA 4KXKB 2Y4UA 2R5SA 3DPDA 4UQYA 4M7CA 1B89A 4YVQC 2OOEA 5HKPA 4HORA 2P2CP 3L6AA 3TWSA 5B1BE 3Q7AA 5AYWD 2LUHA 4FADA 4RG9A 3DBSA 4RQIA 2LSVA 4O6FA 1O5MA 2L0TB 4NIKA 4N2SA 4J8YA 3BQOA 3ZYQA 5T8IA 3FWVA 1D9SA 3I4GA 5A6CA 3UM0A 3OXLA 3MEKA 4AVXA 1TN8A 3K9IA 3DSVA 4UWLA 4J0UA 1SQMA 1HX8A 3FH8A 4B8AA 2I9CA 4AXHA 3Q9NC 3P1UA 3E33A 1G3NB 2XHEA 3U4TA 4Z68A 3CLJA 1MYOA 3TWUA 2VSOE 1QYMA 2NYJA 3R7QA 4AY5A 3DEOA 1HH8A 3GZSA 1FT1A 2FI7A 2E2EA 4G24A 3UPVA 5AN8A 5D0QD 2H6GA 4YVOA 2LAIA 2V5FA 5KBAA 5DBKA 2Y4TA 5KWDA 4LRZA 4DX6D 4DLQA 4J6IA 3NB2A 3SO8A 1EDUA 1HE8A 2FEZA 3UTMA 3CKBA 3BG1B 1WM5A 1HZ4A 4L23A 5JJ6A 1RZ4A 4Q94A 2GRPB 4BETA 2P9KG 5T3RA 3FTZA 4HVBA 2AXZA 4DLOA 2H6IA 3GW4A 2ETBA 2PNNA 3D9OA 2F8XK 5ENTD 3ZRHA 5AJLA 1N94A 2HR2A 3VLDA 2XGMA 1O1TA 1HO8A 1IXVA 2WXKA 1IHGA 4CT4A 2P9NG 3CIAA 5D2MC 1LTXA 2A4ZA 2XZTG 2EIJE 4JHJA 1OY3D 4EZLA 3FTXA 4N3CA 3QNKA 3E30A 4XE0A 4GMRA 2L6JA 2Y69E 4HS2A 5ENNA 2IJGX 1ZBPA 4Q69A 2F37A 3RSEG 1JWGA 1IQRA 5DIZA 3EIQC 3EHMA 2LXLA 3TG4A 4EQFA 3TXNA 3KSLA 5HRYA 1L5JA 2J8SD 2OEVA 3L9TA 3J5PA 2X38A 5C1DA 2XEVA 3JXJA 2EQXA 4NRHB 3FTSA 3AG2E 1S0PA 3PEUB 3FDHA 4I9CA 2GRNB 3ZHEB 4I17A 3CHRA 3PEVB 2XPZA 2BKGA 2IONA 3LJNA 3X2QE 4J8EA 3FTYA 4HOSA 2AW6A 1UW4B 5FIOA 4N2QA 3HRAA 4X8QA 2V8SE 5BNWA 4I9EA 2BEDA 4CDRA 3ESLA 3FHEA 2DBAA 4UI9J 1TJFA 3QWVA 5FT9A 1HF8A 3I4RB 3FTUA 5FQ8A 2VSNA 3FUDA 3CSTA 3NZUA 4V3IA 2IOLA 3ABKE 3HHMA 4I43A 3E34A 3RKVA 2XEEA 5CRUA 3AU4A 1Z3XA 2CG2A 2V4LA 3LY7A 2AWIA 3FFLA 4A55A 1JCSA 4OAUC 2MRIA 4HOUA 5BXUA 2Y0BG 1EPUA 3RJVA 3ABME 4EZJA 3CK8A 2FBNA 2WPVA 1NFIE 4KYOB 1N11A 4GZDA 1OCOE 1E8YA 5EIBE 3FUEA 1TYQG 3C5RA 3PH0C 4J7WA 2WXFA 1TNUA 3FP3A 3SFXA 3QC1A 4A1GA 4NACA 2IFUA 2X6IA 4G1TA 3AG3E 4K5AB 4WWNA 4EBAG 3ZEFA 4P29A 2ILRA 3BEEA 3HXBA 4GU5A 5A7DB 5G2NA 3FU5A 5KJMA 5ENSD 3CQCB 4OVVA 4GYOA 3ULYA 2YHEA 4GZ6A 4U0UA 3CVPA 3QAQA 5T4YA 2KC7A 5AARA 3B7SA 4A1SA 4UWHA 3FUIA 4G8KA 1H2VC 1TNOA 1TJCA 1YCSB 4K5CA 2B6CA 3CHOA 5BUZA 1FPPA 3CHMA 4KBQA 1IYGA 2IY0C 4K5BA 4U8YD 2MHKA 3CSFA 5ENQD 4RSYA 3PE4A 3PNLB 4GMLA 1Y6IA 2AXUA 3B13A 1Z6TA 2NC9A 3TWVA 2P58C 4AEZC 4BSZB 3QARA 4LNGA 4W9RA 2CFUA 4WNFA 4JHRA 4EBAA 1JPLA 4ME2A 3D9NA 3MKQB 1A17A 3T5VA 3D9LA 4HOQA 1BI8B 3ONKA 1DC2A 3CQGB 3SY2A 4JL0A 5FJYA 3RO3A 3AU5A 4AM9A 4CRWA 3U9WA 3UUXA 1MX2A 5G05J 3Q73A 1YMPA 3QB2A 3FU3A 4HFGA 3MZLB 1LD8A 2R02A 3DPYA 2KZTA 3FH5A 3BG0B 1H2UA 3S2AA 1SA5A 4RLYA 3ULQA 3VTXA 3MJWA 4WNGA 2ETCA 3G2TA 4FHKA 4XIFA 4F6RD 1H6PA 2XGOA 3S7BA 2J49A 2HO1A 3ONLA 4WAFA 4ANWA 4G23A 4WUYA 5LCWC 2FO7A 4ANVA 3Q79A 2VGEA 4UI9C 2QFCA 4H7YA 3AG4E 1N0RA 2PM7A 5AQ9A 4DX2A 2OV8A 4BTAA 1TEZA 4DJAA 1BI7B 2FF4A 2V5QC 1DVPA 3B7UX 3DSXA 3ZXPA 4WWOA 4APOA 1N4SA 4GTOA 4OYSA 4L1BA 4HI9A 2VTBA 1MHQA 1O1SA 3B7RL 1UJKA 2R17C 2XCCA 4O1PA 2CHXA 4GCNA 1ZB1A 2XGSA 2WXGA 5FTPA 4JXTA 2WMNA 4BT8A 3MA5A 2WXJA 3UI2A 3SHFA 4Q96A 5BV0A 3JUIA 3FEXA 2CG3A 3R7RA 3NF1A 2LSUA 3AAAC 3EHNA 3Q78A 4RG6A 4BWRA 3UM3A 3MKRA 4TUMA 3ZFWA 2FO1E 1QNFA 3L54A 4DUIA 4I2WA 3CK7A 4GTVA 4L2YA 3PRZA 4ILGA 1E8WA 3GZ2A 3UT8A 4J8SA 2VTBB 2BTDA 2WXOA 3TAXA 5M72A 3TJPA 1HXIA 3PZ3A 5KJLA 1DCEA 2JEKA 1N52A 3G2VA 4FP7A 1U3CA 5JHBA 2KCVA 3U66A 3LEWA 3RRNB 4GMJA 1K3ZD 4LNBA 3LS8A 2XPYA 4TXPA 4UWGA 4UQXA 2FULA 2QY7A 3SI5A 1E7VA 3ISMC 4KZ0A 1KZPA 2WXLA 2E0IA 1H6OA 3C72A 1UOHA 5J90A 3OXFA 4BESA 1D8EA 3UM1A 1O1RA 3IEGA 1ELRA 3EIJA 4I1OB 2LO6A 1HG2A 3UIOC 3EU9A 3ML8A 5KCMA 3L22A 5AQAA 3PUKA 4MBGA 3HVEA 5JMND 2DVWA 2C2LA 3JXIA 1TN6A 5G04J 4DI3A 3EJNA 3IHVA 3LVQE 3JQ1A 3TGOA 5EX0A 2WQHA 2RFMA 3R9AB 1NA3A 3ML9A 2DCPA 2UY1A 4JW1A 4LERA 2XRZA 4IRUA 3PREA 3FUMA 3KSQA 5G55A 3LY9A 2WQ6A 4DRXE 5LFAA 5ENRD 3ASOE 4MLPA 2ZGDA 4GTSA 1LD7A 1NI1A 1E8ZA 2B0OE 1YYHA 5ITZF 3D9PA 3T9KA 2KXPC 2XS8A 3QKYA 2KM4A 3HVEB 1OXJA 1AP7A 1W3BA 3EDTB 3EU5A 3D9KA 3CEQA 1K1AA 3BUAA 3B7TA 4ZHBA 2F8YA 4G11A 3DSTA 4M3OA 3EUVA 3TG5A 2UY1B 4TRQA 5EIDA 2EIKE 3HXEA 1WAO1 1D8DA 2HYZA 1X81A 4BFRA 5JHAA 4U8HA 4CDNA 2WB2A 4GZ5A 4B93B 3ZU7B 4FJZA 3Q47B 4HQDA 4ACKA 4JC8A 3R9MA 4C9BB 2PQNA 4E85A 3RU0A 4LSZE 3SGHA 4TXQA 1E7UA 3MGBA 4HRMB 4KZCA 1OCZE 4GAAA 1OT8A 1FCHA 4RVBA 2IO3C 3HG0D 3PVLA 3QWWA 2J09A 4EECA 1OWMA 3OXGA 4CDMA 4DX5D 3SZ7A 4GTPA 4ANXA 1PAQA 2DZNA 1TNYA 3C3OA 3B7BA 4LNUD 1QQEA 3HDXA 2IO2C 2ZIRA 3E32A 3PE3A 3UKUG 4E6HA 2ZISA 1WY6A 4AOFA 4ATZD 4UI9K 5A23A 3QDNA 2WXMA 3PZDA 3Q9UC 3J5QB 4I1AA 3IXEA 1OWOA 1IHBA 2VSXE 4C48B 2R2LA 3HYMB 3PZ4A 2L9BA 1MX6A 4A3VA 3FTVA 5E76A 4KVOA 1HS6A 2HE0A 1H6KA 1GW6A 1PC2A 2V0PA 3S7FA 2OVFA 2Q7FA 4AJWA 3HXFA 4ILHB 5E75A 5CHEE 3G2SA 4TV3A 4B89A 5ARGA 4MRUA 3MV2B 1N4QA 3CVQA 3PZ2A 3I5PA 4B94A 1WG0A 4K0RA 2X3MA 3SFYA 1MJ0A 4PS8A 2OVBA 2MYOA 4ABNA 2VGYA 3ZXSA 4U04A 3RRUA 4APFA 4GZCA 3ULEG 3W9GA 2GRMA 1UN9A 4I6EA 3E37A 4KT6B 2P9SG 1EF1C 4Y6CA 3LJ3A 3Q7FA 1H19A 2L6BA 1H0AA 5G04C 4GZ3A 4YNDA 1KPSB 5KNGA 1OCRE 4GTQA 4OVUA 5FQ6A 1Q2ZA 3S7DA 4FLHA 4B0ZA 2RFAA 3L82A 1MZCA 2QYJA 3DSUA 3ESKA 1NL4A 1XNFA 4XZ4A 3D9IA 3NBNB 3LY8A 5ANLA 3CV0A 3TWQA 3V2OA 3G2WA 1E90A 1FT2A 3ZYLA 2C0LA 3C3QA 3ZNGA 2R03A 3ZIMA 3NAWA 4GA0A 1N0QA 1SZ9A 2M63A 3KS2A 2I1JA 5CMWA 4U0ZA 1SZAA 4GTRA 3CVWA 2F0YA 4A63B 4G8LA 1SA4A 4BX9A 2WMOA 2GGFA 3DXKG 3JQ0A 3LDZA 4DI4A 3QWPA 3SQVA 2DIWA 4YDYA 2P9LG 3LCAA 1XGWA 3Q4AB 4TXRA 1K8KG 2GRLA 3PUJA 1BD8A 3ZVVA 4D10C 5CERB 5LP0A 1OWPA 2PZIA 4HLLA 1U3DA 4GPKA 3DRAA 1QBQA 3JUEA 5EILA 1UN8A 5FZQA 3LVRE 2I1KA 3FUFA 2ZXWE 3NZSA 5ANRA 1TR4A 2Y1LE 2CHZA 5FQ7A 2LNIA 5LX8A 3SD5A 1DNPA 1SVXA 4I2ZA 3AG1E 4K03A 4PS7A 2XZDG 4N39A 5IY5E 4EHMA 3ZYKA 3OAWA 2KZTB 3GZ1A 3ZW3A 3PNTB 2VGXA 5ENPD 3APFA 4BEPA 3UQ3A 3ZN3A 4FU3A 4N5CA 3FH7A 3VLEA 1V55E 4N5QA 4ILIA 3D3MA 4JEUA 3G2UA 3CVLA 4HNAD 5BPPA 4EZKA 3APDA 4AV7A 5AENA 5ARFA 5EX3A 2IF4A 3LKUA 4HB5A 2AVPA 1NZNA 4KVMA 4JB8P 2ZGGA 4CZ2D 4AP2A 2KBXA 3SBTB 4CT0A 1DCQA 4HXIA 3BU8A 4JA7A 2WXPA 4ACLA 2RG8A 4F53A 2WQ7A 1FVHA 1NP7A 3LXUX 1N95A 2X6HA 2X6KA 4U95D 3V2XA 4FA6A 2VGXB 1S63A 4LUNU 1H2TC 4JD2G 3CKCA 4HOTA 5KNHD 4FLBA 3HXCA 3D9MA 2JLBA 5EDSA 4U0SA 2ONDA 3SFZA 3L16A 3DSSA 1NA0A 3AS4A 4A3TA 3JYSA 1OUVA 5FWQA 3CVNA 2R59A 3IV0A 3FTWA 4U7EB 5EKQD 4XI0A 4G25A 1QZ2A 4CCAA 4BERA 4YDWA 4N3AA 4LCTA 5EYLA 5FQ4A 4WNDA 5H7PA 2AJAA 2IQCA 5ENOD 3V30A 3D9JA 2BKKB 3ZPJA 2XS1A 3L08A 1JUQA 4L2LA 5CBNA 3CHSA 3PZ1A 5KJNA 1BPOA 1P5QA 3HXDA 4ZFHA 4PDXA 5D66A 2RD0A 3KAEA 1KLXA 4CEMA 3JCKC 3KEZA 2RKKA 2BUGA 2BF0X 1K1BA 2KATA 2XCBA 1TNBA 2L0IA 1IQUA 5B3SE 2ZU6B 3HIZA 4F7AA 4BX8A 4PH4B 3FEYA 3MX3A 3FUKA 3LPZA 3P2BA 4F1SA 1YA0A 1S70B 5G05C 1OWNA 3T5XA 3Q49B 5B1AE 3IBEA 4LG6A 2X6FA 4B8CB 3UM2A 2LXMA 3RRMB 2CFZA 4H7XA 3CVXA 3PS6A 4C0EA 4U8VD 2GROB 4GPMA 1VDYA 3MCXA 2YNQA 3ZHEA 5FZRA 4HI8A 3W9FA 3TXMA 2VJ8A 3FUHA 4UUCA 2IEJA 5AAOA 1N54A 2KCKA 4YDOA 1E8XA 1S64A 2QYUA 5CCLA 2I2OA 1KZOA 4JEHA 3LYAA 1HFAA 4BTBA 2J07A 4R7LA 3C98A 1X5BA 4BT9A 3QOUA 2NXPA 1UG3A 3CHQA 2H6HA 4PUCA
chains in the Genus database with same CATH topology
3I4GA 3MV2B 3ULQA 3VTXA 3CVQA 3MJWA 3I5PA 4B94A 5A6CA 4K0RA 2WXRA 2X3MA 1Y8MA 4WNGA 5JJ7A 3OXLA 3MEKA 4PS8A 4AVXA 2OVBA 3G2TA 4FHKA 4XIFA 3K9IA 4ABNA 4UWLA 2VGYA 3ZXSA 2XGOA 4J0UA 4U04A 3RRUA 3S7BA 5BT1A 3GYZA 1SQMA 1HX8A 2J49A 2VYIA 3FH8A 4GZCA 4APFA 4XKBA 2GRMA 1UN9A 2HO1A 2I9CA 4I6EA 4I6GA 4KT6B 4B8AA 1EF1C 3ONLA 4AXHA 4WAFA 3P1UA 4ANWA 4G23A 4WUYA 4Y6CA 5LCWC 2FO7A 3LJ3A 2XHEA 3U4TA 1H19A 3CLJA 4ANVA 1H0AA 4UI9C 5G04C 2QFCA 2WXQA 4H7YA 4GZ3A 4YNDA 2PM7A 3L17A 2VSOE 4OVUA 4U63A 4HLEA 5FQ6A 2WM9A 3R7QA 4AY5A 3CGHA 3ASDA 1HH8A 2CHWA 3SNXA 3S7DA 4FLHA 4B0ZA 5KJKA 3IKOB 3GZSA 2OV8A 2FI7A 2E2EA 4G24A 4BTAA 4DJAA 3UPVA 1TEZA 2FF4A 4GA1A 1DVPA 5D0QD 3B7UX 3O4ZA 4YVOA 4WWOA 3ESKA 2LAIA 2V5FA 3FUJA 1XNFA 4APOA 5DBKA 4XZ4A 3CK9A 2A5UA 2C0MA 2Y4TA 4PS3A 3D9IA 4OYSA 4L1BA 4LRZA 5BW8C 2VTBA 4DLQA 1MHQA 3LY8A 5LCWJ 4J6IA 4XX5A 4F3VA 3B7RL 1EDUA 1UJKA 5ANLA 2R17C 1HE8A 2FEZA 2XCCA 3CKBA 3CV0A 3BG1B 1WM5A 1HZ4A 2CHXA 4J8DA 4GCNA 3G2WA 3URZA 4C0MA 3ENEA 2XGSA 4L23A 1E90A 2WXGA 5FTPA 4JXTA 2WMNA 4BT8A 3MA5A 2WXJA 3ZYLA 3SHFA 5JJ6A 4Q96A 4I1MA 2C0LA 5BV0A 4Q94A 3JUIA 4JA9A 3FEXA 4NURA 2CG3A 3R7RA 1UJJA 2J4BA 5T3RA 3FTZA 3NF1A 4HVBA 2AXZA 2XRYA 2LSUA 3EHNA 4RG6A 5FZSA 3ZIMA 4BWRA 3GW4A 4DLOA 4GA0A 4EPZA 3D9OA 3S7JA 3CVVA 3MKRA 4BSXA 1SZ9A 3ZFWA 3APCA 3ZRHA 4JPSA 2M63A 5BV1A 5AJLA 3KS2A 1QNFA 2I1JA 4G2VA 4L7TA 5CMWA 1INZA 2HR2A 3VLDA 2XGMA 3L54A 1SZAA 4U0ZA 4I2WA 1HO8A 2AXVA 3CK7A 3CVWA 2J08A 4FHJA 3PDNA 1JWFA 4BX9A 2WXKA 1IHGA 4L2YA 3T8MA 3CIAA 2WMOA 4GCOA 4CT4A 4AY6A 5AJDA 2GGFA 3MV3B 3RO2A 3JQ0A 2A4ZA 4NQ0A 3LDZA 4DI4A 3PRZA 4GA2A 3I3NA 3CHPA 4ILGA 4JHJA 3QWPA 1E8WA 3GZ2A 2DIWA 3UT8A 5CCMA 4UWKA 4EZLA 4J8SA 3FTXA 4N3CA 3QNKA 2BTDA 2WXOA 2VTBB 1E96B 4XE0A 3TAXA 3TJPA 5M72A 2L6JA 4HS2A 5ENNA 1HXIA 2IJGX 3LCAA 1ZBPA 5KJLA 2JEKA 4Q69A 3Q5MA 4XKCA 1N52A 1JWGA 4JZYA 1IQRA 1XGWA 3Q4AB 5DIZA 3EIQC 2GRLA 3PUJA 2PQRA 3EHMA 3G2VA 3ZVVA 4D10C 3TG4A 4EQFA 2XPIA 3TXNA 5LP0A 4FP7A 1U3CA 1L5JA 5JHBA 4FULA 1OWPA 2KCVA 3U66A 2PZIA 4DPRA 3LEWA 2KCLA 1U3DA 4GYWA 4GYYA 3RRNB 4GMJA 4GPKA 4JHKA 2X38A 1Z3YA 5C1DA 2XEVA 5LOZA 1UN8A 5FZQA 3LVRE 3LS8A 1EYHA 2EQXA 2XPYA 4NRHB 3FTSA 2I1KA 4UQXA 3FUFA 4UWGA 2FULA 3ASHA 1S0PA 2QY7A 3PEUB 1OWLA 3FDHA 3SI5A 3NZSA 4I9CA 5ANRA 1E7VA 3ZHEB 4KZ0A 2CHZA 4I17A 3AS8A 2YQ8A 3CHRA 5FQ7A 2WXLA 2LNIA 3PEVB 2E0IA 1DNPA 2PL2A 3SD5A 5LX8A 4WNEA 4I2ZA 2XPZA 5HI7A 5J90A 3OXFA 2IONA 4J8EA 3FTYA 4K03A 4PS7A 4HOSA 1ZU2A 2AW6A 1MQSA 1ELRA 2GW1A 3EIJA 3IEGA 4I1OB 4N39A 2LO6A 1UW4B 1HG2A 4N2QA 3FULA 3ML8A 3MYVA 2V8SE 3L22A 5KCMA 5BNWA 3FU0A 3MKQA 3PUKA 3RIBA 2XQ0A 3OAWA 3QK0A 3ZYKA 2KZTB 3GZ1A 4I9EA 3HVEA 4TUUA 4N3BA 3ZW3A 3PNTB 2C2LA 4CDRA 2VGXA 2YINA 3ESLA 2DBAA 3FHEA 4UI9J 5G04J 3APFA 1TJFA 4DI3A 3UX4A 3EJNA 3IHVA 3LVQE 3JQ1A 3QWVA 3UQ3A 4MKTA 5FT9A 3TGOA 1HF8A 3I4RB 3FTUA 5EX0A 5FQ8A 2WQHA 4DK5A 3R9AB 3FY4A 3ZN3A 1NA3A 3ML9A 4FU3A 4N5CA 2VSNA 3FH7A 3FUDA 3N71A 4G26A 3CSTA 3VLEA 4IULA 4ANUA 3NZUA 2DCPA 2UY1A 4UWFA 4JW1A 4ILIA 3D3MA 4JEUA 4LERA 4V3IA 4IRUA 3CVUA 3PREA 5CMYA 2XRZA 3G2UA 3FUMA 3CVLA 4LEUA 2IOLA 5BPPA 3HHMA 5G55A 4I43A 4EZKA 3LY9A 3VTYA 3RKVA 3APDA 3UT4A 4AV7A 5AENA 2WQ6A 5ARFA 5LFAA 4JVSA 5EX3A 2IF4A 3AU4A 1Z3XA 2CG2A 3LKUA 2V4LA 4MLPA 3LY7A 2AWIA 3FFLA 2AVPA 4A55A 1NZNA 2PM6A 4KVMA 1ELWA 1E8ZA 4I6JA 3CVYA 3TL5A 4BY6A 4AP2A 2MRIA 4GB9A 3SBTB 4CT0A 4UQZA 5JJTA 4HOUA 4HXIA 3CR3A 3U64A 4JA7A 2WXHA 2WXPA 4ACLA 5HQ8A 2RG8A 3D9PA 4F53A 3QKYA 2KM4A 2WQ7A 1EPUA 1FVHA 1HU3A 1NP7A 2LAHA 3HVEB 2X6HA 3LXUX 3RJVA 4EZJA 1W3BA 2X6KA 3ASGA 3EDTB 4FA6A 3CK8A 2J4DA 2FBNA 3ZYMA 3D9KA 3CEQA 5D0OD 2WPVA 2VGXB 2IU1A 4LUNU 1H2TC 4KYOB 4WWPA 3CKCA 4HOTA 3FUNA 4GZDA 4FC8A 2I6HA 3ASFA 4FLBA 4QFVA 3WXXA 3B7TA 3L13A 4ATGA 3OTNA 3D9MA 4G11A 4M3OA 5AIJA 1E8YA 2JLBA 3O48A 5EDSA 4U0SA 2ONDA 4Y6WA 2VQ2A 3SFZA 3L16A 2UY1B 3FUEA 3TG5A 3FU6A 4TRQA 1HG5A 1NA0A 3AS4A 2WXNA 3PH0C 4A3TA 3JYSA 1OUVA 3RK6A 5FWQA 3CVNA 2R59A 1WAO1 2WVIA 4J8FA 2HYZA 2WXFA 4BFRA 3FP3A 3IV0A 4URKA 3FTWA 5JHAA 4U8HA 4IYPA 5EKQD 3QC1A 4A1GA 4CDNA 2WB2A 4NACA 4XI0A 2IFUA 2X6IA 2YHCA 4GZ5A 4G25A 1QZ2A 2WXIA 4CCAA 4G1TA 4FJZA 3Q47B 3SBSA 4WWNA 4N3AA 4LCTA 5J08A 4EBAG 3ZEFA 4ACKA 4P29A 5FQ4A 2ILRA 3BEEA 4WNDA 4CGVA 4JC8A 3SF4A 1PY1A 4C9BB 2PQNA 4GU5A 4E85A 5A7DB 3RU0A 5G2NA 2IQCA 3FU5A 3D9JA 5KJMA 4U07A 3ZPJA 3L08A 3UT7A 3CQCB 1JUQA 4L2LA 4OVVA 4MS6A 4XI9A 3SGHA 4GYOA 3CHSA 4FJYA 2YHEA 4GZ6A 3UMVA 4KMOA 1E7UA 5KJNA 1BPOA 3MGBA 1P5QA 1ELKA 3CVPA 4U0UA 3QAQA 5T4YA 2KC7A 4KZCA 3B7SA 2HM8A 2NSZA 4GAAA 4PDXA 1FCHA 2Y3AA 4RVBA 2UWJG 2RD0A 3KAEA 3VLFA 3S2AA 1FVFA 4UWHA 1KLXA 4A1SA 3FUIA 3PVLA 4CEMA 3QWWA 2J09A 3JCKC 1H2VC 3KEZA 1TJCA 4EECA 3CHOA 2BUGA 2BF0X 1KT0A 1KT1A 5C2YA 1OWMA 3OXGA 3Q15A 4CDMA 2KATA 5BUZA 3CHMA 4KBQA 2XCBA 3NQPA 5ARGA 1IYGA 2L0IA 3SZ7A 2MOWA 4ANXA 4AIFA 1IQUA 1PAQA 2ZU6B 2MHKA 3CSFA 1LF8A 3HIZA 4IN3B 4RSYA 3E4BA 4F7AA 3PE4A 4BX8A 4PH4B 3PNLB 3U3WA 4GMLA 1Y6IA 2J9QA 2VSYA 2AXUA 3FEYA 3B13A 1Z6TA 3IHYA 3MX3A 2NC9A 2P58C 3FUKA 4AEZC 3LPZA 3P2BA 2IOSA 1QQEA 1YA0A 3QJZA 3ZGQA 3KD7A 5G05C 4F1SA 3QARA 1OWNA 3HDXA 3T5XA 2X6JA 3AS5A 3Q49B 3IBEA 2X6FA 4W9RA 4B8CB 4CGWA 4KXKB 2Y4UA 3RRMB 3PE3A 2CFZA 2R5SA 3DPDA 4H7XA 4UQYA 3CVXA 3PS6A 2CFUA 4C0EA 1B89A 4WNFA 4E6HA 4JHRA 4EBAA 1WY6A 4YVQC 1JPLA 4AOFA 2OOEA 4UI9K 4ME2A 1VDYA 3QDNA 3D9NA 5A23A 3MCXA 2WXMA 2YNQA 3MKQB 1A17A 3PZDA 3ZHEA 5FZRA 4HORA 3L6AA 3T5VA 4I1AA 3D9LA 4HOQA 2VJ8A 3FUHA 1OWOA 3TXMA 2VSXE 5AYWD 3HYMB 4FADA 3ONKA 1N54A 2KCKA 4RG9A 3CQGB 2L9BA 4A3VA 1E8XA 3FTVA 4JL0A 5E76A 4KVOA 5FJYA 3DBSA 1HS6A 3RO3A 3AU5A 4AM9A 4CRWA 1H6KA 3U9WA 5CCLA 2I2OA 3UUXA 5G05J 1GW6A 1PC2A 2V0PA 4JEHA 3S7FA 3LYAA 1HFAA 2OVFA 2Q7FA 2J07A 2LSVA 3QB2A 3FU3A 4R7LA 4BTBA 3C98A 4O6FA 4HFGA 4AJWA 1X5BA 4BT9A 3QOUA 2NXPA 3MZLB 2L0TB 4ILHB 1UG3A 5CHEE 5E75A 4N2SA 3G2SA 2KZTA 3ZYQA 3FH5A 3BG0B 4TV3A 3CHQA 5T8IA 4B89A 1H2UA 3FWVA 4PUCA 4MRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CK7 A;  3I4G A;  3IV0 A;  3MYV A;  3CK9 A;  3CKC A;  3L22 A;  3NQP A;  5E76 A;  4Q69 A;  3FDH A;  4LER A;  3SGH A;  3JQ0 A;  5T3R A;  3EHM A;  3OTN A;  5FQ7 A;  5FQ6 A;  3EHN A;  3CGH A;  5T4Y A;  4F7A A;  5LX8 A;  5J90 A;  3SNX A;  3MCX A;  3CKB A;  3MX3 A;  5E75 A;  3EJN A;  3LEW A;  3JQ1 A;  3GZS A;  4PUC A;  5FQ4 A;  4F53 A;  3P1U A;  5FQ8 A;  3JYS A;  4L7T A;  3QNK A;  3KEZ A;  3HDX A;  3CK8 A;  4MRU A; 
#chains in the Genus database with same CATH topology
 1JCQ A;  2OCC E;  5JJ7 A;  2WXR A;  1AWC B;  1Y8M A;  5BT1 A;  3GYZ A;  2VYI A;  4XKB A;  4I6G A;  2WXQ A;  2QZA A;  1N9A A;  3B95 A;  3L17 A;  4YDE A;  3EHQ A;  1BU9 A;  4U63 A;  3ZUV B;  4DX1 A;  4HLE A;  2WM9 A;  3CGH A;  5CRV A;  3ASD A;  3KEA A;  2CHW A;  3SNX A;  5KJK A;  3IKO B;  4GA1 A;  3O4Z A;  3FUJ A;  1RW2 A;  3CK9 A;  2A5U A;  2C0M A;  4PS3 A;  5AQ7 A;  2ETA A;  5BW8 C;  2JAB A;  5LCW J;  1SW6 A;  4XX5 A;  4F3V A;  2GRQ B;  4J8D A;  3URZ A;  4C0M A;  5BXO A;  3ENE A;  2H6F A;  4I1M A;  2XEH A;  4JA9 A;  4NUR A;  4QQI A;  4L9P A;  1UJJ A;  2R05 A;  1U2V G;  2J4B A;  4CYM D;  4XEI G;  2XRY A;  3DSW A;  5FZS A;  4EPZ A;  2EIN E;  4HBD A;  4OAV B;  1TNZ A;  3S7J A;  3CVV A;  4BSX A;  3APC A;  5BV1 A;  4JPS A;  2OEW A;  1INZ A;  4G2V A;  4L7T A;  3V79 K;  2AXV A;  2J08 A;  4FHJ A;  3PDN A;  1JWF A;  3T8M A;  4GCO A;  3ZKJ A;  4AY6 A;  5AJD A;  3MV3 B;  3RO2 A;  4NQ0 A;  4DX7 D;  4GA2 A;  3I3N A;  3CHP A;  5CCM A;  4UWK A;  3V31 A;  1V54 E;  1E96 B;  3EHR A;  1BLX B;  2DYS E;  3Q5M A;  4XKC A;  4JZY A;  2EIM E;  4O1O A;  2PQR A;  2XPI A;  4FUL A;  4DPR A;  2KCL A;  2P9P G;  4GYW A;  4GYY A;  3TWW A;  1WDY A;  4JHK A;  1A5E A;  1Z3Y A;  5LOZ A;  3UIP C;  1EYH A;  3ASH A;  1OWL A;  3UXG A;  3AS8 A;  2YQ8 A;  3UKR G;  2PL2 A;  1IKN D;  4WNE A;  5HI7 A;  3D9H A;  4U96 D;  1ZU2 A;  1MQS A;  2GW1 A;  3FUL A;  3RAU A;  3MYV A;  3FU0 A;  3MKQ A;  3RIB A;  2XQ0 A;  3QK0 A;  3ASN E;  4N3B A;  4TUU A;  1MX4 A;  2XEN A;  3T8K A;  2YIN A;  2A5E A;  3UX4 A;  4MKT A;  4DK5 A;  3FY4 A;  3N71 A;  4G26 A;  4IUL A;  4ANU A;  1Z5S C;  4GTT A;  4UWF A;  3CVU A;  5CMY A;  4LEU A;  1N4P A;  2P9U G;  3WG7 E;  3VTY A;  3UT4 A;  4JVS A;  3NOG D;  1OCC E;  5HS0 A;  5EN5 D;  2PM6 A;  5CEC B;  3DEP A;  1ELW A;  4I6J A;  3CVY A;  3TL5 A;  4BY6 A;  3C3R A;  4GB9 A;  4HRN A;  4UQZ A;  5JJT A;  3U64 A;  3CR3 A;  2WXH A;  5HQ8 A;  2DWZ A;  1HU3 A;  2LAH A;  3ABL E;  2QC9 A;  3ASG A;  5CEA A;  5CBO A;  2J4D A;  3ZYM A;  5D0O D;  2IU1 A;  4WWP A;  2V4H C;  3FUN A;  4FC8 A;  2I6H A;  3ASF A;  4QFV A;  3WXX A;  3L13 A;  4ATG A;  3OTN A;  1N4R A;  5AIJ A;  3O48 A;  4Y6W A;  2VQ2 A;  3FU6 A;  1HG5 A;  5EYP F;  2WXN A;  5AQB A;  3RK6 A;  2WVI A;  4J8F A;  3NOC D;  4URK A;  3DXM G;  4IYP A;  2YHC A;  2WXI A;  5JA4 D;  3TWT A;  3SBS A;  5J08 A;  3DWL G;  4CGV A;  3SF4 A;  1PY1 A;  3TWX A;  2DZO A;  4O60 A;  3AJI A;  2GRR B;  4U07 A;  3UT7 A;  3Q75 A;  4MS6 A;  2DYR E;  4XI9 A;  4F1P A;  4FJY A;  1JCR A;  3UMV A;  4KMO A;  1ELK A;  2HM8 A;  2NSZ A;  3UIN C;  3TWR A;  2Y3A A;  2UWJ G;  3VLF A;  1FVF A;  4GTM A;  1KT0 A;  1KT1 A;  5C2Y A;  3Q15 A;  3NQP A;  4HRL A;  2MOW A;  3F6Q A;  4AIF A;  1LF8 A;  2EIL E;  4IN3 B;  3E4B A;  1TN7 A;  3U3W A;  2J9Q A;  2VSY A;  3IHY A;  2P9I G;  2IOS A;  3QJZ A;  3ZGQ A;  3KD7 A;  2X6J A;  3AS5 A;  5FIN A;  5CED B;  4CGW A;  4KXK B;  2Y4U A;  2R5S A;  3DPD A;  4UQY A;  4M7C A;  1B89 A;  4YVQ C;  2OOE A;  5HKP A;  4HOR A;  2P2C P;  3L6A A;  3TWS A;  5B1B E;  3Q7A A;  5AYW D;  2LUH A;  4FAD A;  4RG9 A;  3DBS A;  4RQI A;  2LSV A;  4O6F A;  1O5M A;  2L0T B;  4NIK A;  4N2S A;  4J8Y A;  3BQO A;  3ZYQ A;  5T8I A;  3FWV A;  1D9S A;  3I4G A;  5A6C A;  3UM0 A;  3OXL A;  3MEK A;  4AVX A;  1TN8 A;  3K9I A;  3DSV A;  4UWL A;  4J0U A;  1SQM A;  1HX8 A;  3FH8 A;  4B8A A;  2I9C A;  4AXH A;  3Q9N C;  3P1U A;  3E33 A;  1G3N B;  2XHE A;  3U4T A;  4Z68 A;  3CLJ A;  1MYO A;  3TWU A;  2VSO E;  1QYM A;  2NYJ A;  3R7Q A;  4AY5 A;  3DEO A;  1HH8 A;  3GZS A;  1FT1 A;  2FI7 A;  2E2E A;  4G24 A;  3UPV A;  5AN8 A;  5D0Q D;  2H6G A;  4YVO A;  2LAI A;  2V5F A;  5KBA A;  5DBK A;  2Y4T A;  5KWD A;  4LRZ A;  4DX6 D;  4DLQ A;  4J6I A;  3NB2 A;  3SO8 A;  1EDU A;  1HE8 A;  2FEZ A;  3UTM A;  3CKB A;  3BG1 B;  1WM5 A;  1HZ4 A;  4L23 A;  5JJ6 A;  1RZ4 A;  4Q94 A;  2GRP B;  4BET A;  2P9K G;  5T3R A;  3FTZ A;  4HVB A;  2AXZ A;  4DLO A;  2H6I A;  3GW4 A;  2ETB A;  2PNN A;  3D9O A;  2F8X K;  5ENT D;  3ZRH A;  5AJL A;  1N94 A;  2HR2 A;  3VLD A;  2XGM A;  1O1T A;  1HO8 A;  1IXV A;  2WXK A;  1IHG A;  4CT4 A;  2P9N G;  3CIA A;  5D2M C;  1LTX A;  2A4Z A;  2XZT G;  2EIJ E;  4JHJ A;  1OY3 D;  4EZL A;  3FTX A;  4N3C A;  3QNK A;  3E30 A;  4XE0 A;  4GMR A;  2L6J A;  2Y69 E;  4HS2 A;  5ENN A;  2IJG X;  1ZBP A;  4Q69 A;  2F37 A;  3RSE G;  1JWG A;  1IQR A;  5DIZ A;  3EIQ C;  3EHM A;  2LXL A;  3TG4 A;  4EQF A;  3TXN A;  3KSL A;  5HRY A;  1L5J A;  2J8S D;  2OEV A;  3L9T A;  3J5P A;  2X38 A;  5C1D A;  2XEV A;  3JXJ A;  2EQX A;  4NRH B;  3FTS A;  3AG2 E;  1S0P A;  3PEU B;  3FDH A;  4I9C A;  2GRN B;  3ZHE B;  4I17 A;  3CHR A;  3PEV B;  2XPZ A;  2BKG A;  2ION A;  3LJN A;  3X2Q E;  4J8E A;  3FTY A;  4HOS A;  2AW6 A;  1UW4 B;  5FIO A;  4N2Q A;  3HRA A;  4X8Q A;  2V8S E;  5BNW A;  4I9E A;  2BED A;  4CDR A;  3ESL A;  3FHE A;  2DBA A;  4UI9 J;  1TJF A;  3QWV A;  5FT9 A;  1HF8 A;  3I4R B;  3FTU A;  5FQ8 A;  2VSN A;  3FUD A;  3CST A;  3NZU A;  4V3I A;  2IOL A;  3ABK E;  3HHM A;  4I43 A;  3E34 A;  3RKV A;  2XEE A;  5CRU A;  3AU4 A;  1Z3X A;  2CG2 A;  2V4L A;  3LY7 A;  2AWI A;  3FFL A;  4A55 A;  1JCS A;  4OAU C;  2MRI A;  4HOU A;  5BXU A;  2Y0B G;  1EPU A;  3RJV A;  3ABM E;  4EZJ A;  3CK8 A;  2FBN A;  2WPV A;  1NFI E;  4KYO B;  1N11 A;  4GZD A;  1OCO E;  1E8Y A;  5EIB E;  3FUE A;  1TYQ G;  3C5R A;  3PH0 C;  4J7W A;  2WXF A;  1TNU A;  3FP3 A;  3SFX A;  3QC1 A;  4A1G A;  4NAC A;  2IFU A;  2X6I A;  4G1T A;  3AG3 E;  4K5A B;  4WWN A;  4EBA G;  3ZEF A;  4P29 A;  2ILR A;  3BEE A;  3HXB A;  4GU5 A;  5A7D B;  5G2N A;  3FU5 A;  5KJM A;  5ENS D;  3CQC B;  4OVV A;  4GYO A;  3ULY A;  2YHE A;  4GZ6 A;  4U0U A;  3CVP A;  3QAQ A;  5T4Y A;  2KC7 A;  5AAR A;  3B7S A;  4A1S A;  4UWH A;  3FUI A;  4G8K A;  1H2V C;  1TNO A;  1TJC A;  1YCS B;  4K5C A;  2B6C A;  3CHO A;  5BUZ A;  1FPP A;  3CHM A;  4KBQ A;  1IYG A;  2IY0 C;  4K5B A;  4U8Y D;  2MHK A;  3CSF A;  5ENQ D;  4RSY A;  3PE4 A;  3PNL B;  4GML A;  1Y6I A;  2AXU A;  3B13 A;  1Z6T A;  2NC9 A;  3TWV A;  2P58 C;  4AEZ C;  4BSZ B;  3QAR A;  4LNG A;  4W9R A;  2CFU A;  4WNF A;  4JHR A;  4EBA A;  1JPL A;  4ME2 A;  3D9N A;  3MKQ B;  1A17 A;  3T5V A;  3D9L A;  4HOQ A;  1BI8 B;  3ONK A;  1DC2 A;  3CQG B;  3SY2 A;  4JL0 A;  5FJY A;  3RO3 A;  3AU5 A;  4AM9 A;  4CRW A;  3U9W A;  3UUX A;  1MX2 A;  5G05 J;  3Q73 A;  1YMP A;  3QB2 A;  3FU3 A;  4HFG A;  3MZL B;  1LD8 A;  2R02 A;  3DPY A;  2KZT A;  3FH5 A;  3BG0 B;  1H2U A;  3S2A A;  1SA5 A;  4RLY A;  3ULQ A;  3VTX A;  3MJW A;  4WNG A;  2ETC A;  3G2T A;  4FHK A;  4XIF A;  4F6R D;  1H6P A;  2XGO A;  3S7B A;  2J49 A;  2HO1 A;  3ONL A;  4WAF A;  4ANW A;  4G23 A;  4WUY A;  5LCW C;  2FO7 A;  4ANV A;  3Q79 A;  2VGE A;  4UI9 C;  2QFC A;  4H7Y A;  3AG4 E;  1N0R A;  2PM7 A;  5AQ9 A;  4DX2 A;  2OV8 A;  4BTA A;  1TEZ A;  4DJA A;  1BI7 B;  2FF4 A;  2V5Q C;  1DVP A;  3B7U X;  3DSX A;  3ZXP A;  4WWO A;  4APO A;  1N4S A;  4GTO A;  4OYS A;  4L1B A;  4HI9 A;  2VTB A;  1MHQ A;  1O1S A;  3B7R L;  1UJK A;  2R17 C;  2XCC A;  4O1P A;  2CHX A;  4GCN A;  1ZB1 A;  2XGS A;  2WXG A;  5FTP A;  4JXT A;  2WMN A;  4BT8 A;  3MA5 A;  2WXJ A;  3UI2 A;  3SHF A;  4Q96 A;  5BV0 A;  3JUI A;  3FEX A;  2CG3 A;  3R7R A;  3NF1 A;  2LSU A;  3AAA C;  3EHN A;  3Q78 A;  4RG6 A;  4BWR A;  3UM3 A;  3MKR A;  4TUM A;  3ZFW A;  2FO1 E;  1QNF A;  3L54 A;  4DUI A;  4I2W A;  3CK7 A;  4GTV A;  4L2Y A;  3PRZ A;  4ILG A;  1E8W A;  3GZ2 A;  3UT8 A;  4J8S A;  2VTB B;  2BTD A;  2WXO A;  3TAX A;  5M72 A;  3TJP A;  1HXI A;  3PZ3 A;  5KJL A;  1DCE A;  2JEK A;  1N52 A;  3G2V A;  4FP7 A;  1U3C A;  5JHB A;  2KCV A;  3U66 A;  3LEW A;  3RRN B;  4GMJ A;  1K3Z D;  4LNB A;  3LS8 A;  2XPY A;  4TXP A;  4UWG A;  4UQX A;  2FUL A;  2QY7 A;  3SI5 A;  1E7V A;  3ISM C;  4KZ0 A;  1KZP A;  2WXL A;  2E0I A;  1H6O A;  3C72 A;  1UOH A;  5J90 A;  3OXF A;  4BES A;  1D8E A;  3UM1 A;  1O1R A;  3IEG A;  1ELR A;  3EIJ A;  4I1O B;  2LO6 A;  1HG2 A;  3UIO C;  3EU9 A;  3ML8 A;  5KCM A;  3L22 A;  5AQA A;  3PUK A;  4MBG A;  3HVE A;  5JMN D;  2DVW A;  2C2L A;  3JXI A;  1TN6 A;  5G04 J;  4DI3 A;  3EJN A;  3IHV A;  3LVQ E;  3JQ1 A;  3TGO A;  5EX0 A;  2WQH A;  2RFM A;  3R9A B;  1NA3 A;  3ML9 A;  2DCP A;  2UY1 A;  4JW1 A;  4LER A;  2XRZ A;  4IRU A;  3PRE A;  3FUM A;  3KSQ A;  5G55 A;  3LY9 A;  2WQ6 A;  4DRX E;  5LFA A;  5ENR D;  3ASO E;  4MLP A;  2ZGD A;  4GTS A;  1LD7 A;  1NI1 A;  1E8Z A;  2B0O E;  1YYH A;  5ITZ F;  3D9P A;  3T9K A;  2KXP C;  2XS8 A;  3QKY A;  2KM4 A;  3HVE B;  1OXJ A;  1AP7 A;  1W3B A;  3EDT B;  3EU5 A;  3D9K A;  3CEQ A;  1K1A A;  3BUA A;  3B7T A;  4ZHB A;  2F8Y A;  4G11 A;  3DST A;  4M3O A;  3EUV A;  3TG5 A;  2UY1 B;  4TRQ A;  5EID A;  2EIK E;  3HXE A;  1WAO 1;  1D8D A;  2HYZ A;  1X81 A;  4BFR A;  5JHA A;  4U8H A;  4CDN A;  2WB2 A;  4GZ5 A;  4B93 B;  3ZU7 B;  4FJZ A;  3Q47 B;  4HQD A;  4ACK A;  4JC8 A;  3R9M A;  4C9B B;  2PQN A;  4E85 A;  3RU0 A;  4LSZ E;  3SGH A;  4TXQ A;  1E7U A;  3MGB A;  4HRM B;  4KZC A;  1OCZ E;  4GAA A;  1OT8 A;  1FCH A;  4RVB A;  2IO3 C;  3HG0 D;  3PVL A;  3QWW A;  2J09 A;  4EEC A;  1OWM A;  3OXG A;  4CDM A;  4DX5 D;  3SZ7 A;  4GTP A;  4ANX A;  1PAQ A;  2DZN A;  1TNY A;  3C3O A;  3B7B A;  4LNU D;  1QQE A;  3HDX A;  2IO2 C;  2ZIR A;  3E32 A;  3PE3 A;  3UKU G;  4E6H A;  2ZIS A;  1WY6 A;  4AOF A;  4ATZ D;  4UI9 K;  5A23 A;  3QDN A;  2WXM A;  3PZD A;  3Q9U C;  3J5Q B;  4I1A A;  3IXE A;  1OWO A;  1IHB A;  2VSX E;  4C48 B;  2R2L A;  3HYM B;  3PZ4 A;  2L9B A;  1MX6 A;  4A3V A;  3FTV A;  5E76 A;  4KVO A;  1HS6 A;  2HE0 A;  1H6K A;  1GW6 A;  1PC2 A;  2V0P A;  3S7F A;  2OVF A;  2Q7F A;  4AJW A;  3HXF A;  4ILH B;  5E75 A;  5CHE E;  3G2S A;  4TV3 A;  4B89 A;  5ARG A;  4MRU A;  3MV2 B;  1N4Q A;  3CVQ A;  3PZ2 A;  3I5P A;  4B94 A;  1WG0 A;  4K0R A;  2X3M A;  3SFY A;  1MJ0 A;  4PS8 A;  2OVB A;  2MYO A;  4ABN A;  2VGY A;  3ZXS A;  4U04 A;  3RRU A;  4APF A;  4GZC A;  3ULE G;  3W9G A;  2GRM A;  1UN9 A;  4I6E A;  3E37 A;  4KT6 B;  2P9S G;  1EF1 C;  4Y6C A;  3LJ3 A;  3Q7F A;  1H19 A;  2L6B A;  1H0A A;  5G04 C;  4GZ3 A;  4YND A;  1KPS B;  5KNG A;  1OCR E;  4GTQ A;  4OVU A;  5FQ6 A;  1Q2Z A;  3S7D A;  4FLH A;  4B0Z A;  2RFA A;  3L82 A;  1MZC A;  2QYJ A;  3DSU A;  3ESK A;  1NL4 A;  1XNF A;  4XZ4 A;  3D9I A;  3NBN B;  3LY8 A;  5ANL A;  3CV0 A;  3TWQ A;  3V2O A;  3G2W A;  1E90 A;  1FT2 A;  3ZYL A;  2C0L A;  3C3Q A;  3ZNG A;  2R03 A;  3ZIM A;  3NAW A;  4GA0 A;  1N0Q A;  1SZ9 A;  2M63 A;  3KS2 A;  2I1J A;  5CMW A;  4U0Z A;  1SZA A;  4GTR A;  3CVW A;  2F0Y A;  4A63 B;  4G8L A;  1SA4 A;  4BX9 A;  2WMO A;  2GGF A;  3DXK G;  3JQ0 A;  3LDZ A;  4DI4 A;  3QWP A;  3SQV A;  2DIW A;  4YDY A;  2P9L G;  3LCA A;  1XGW A;  3Q4A B;  4TXR A;  1K8K G;  2GRL A;  3PUJ A;  1BD8 A;  3ZVV A;  4D10 C;  5CER B;  5LP0 A;  1OWP A;  2PZI A;  4HLL A;  1U3D A;  4GPK A;  3DRA A;  1QBQ A;  3JUE A;  5EIL A;  1UN8 A;  5FZQ A;  3LVR E;  2I1K A;  3FUF A;  2ZXW E;  3NZS A;  5ANR A;  1TR4 A;  2Y1L E;  2CHZ A;  5FQ7 A;  2LNI A;  5LX8 A;  3SD5 A;  1DNP A;  1SVX A;  4I2Z A;  3AG1 E;  4K03 A;  4PS7 A;  2XZD G;  4N39 A;  5IY5 E;  4EHM A;  3ZYK A;  3OAW A;  2KZT B;  3GZ1 A;  3ZW3 A;  3PNT B;  2VGX A;  5ENP D;  3APF A;  4BEP A;  3UQ3 A;  3ZN3 A;  4FU3 A;  4N5C A;  3FH7 A;  3VLE A;  1V55 E;  4N5Q A;  4ILI A;  3D3M A;  4JEU A;  3G2U A;  3CVL A;  4HNA D;  5BPP A;  4EZK A;  3APD A;  4AV7 A;  5AEN A;  5ARF A;  5EX3 A;  2IF4 A;  3LKU A;  4HB5 A;  2AVP A;  1NZN A;  4KVM A;  4JB8 P;  2ZGG A;  4CZ2 D;  4AP2 A;  2KBX A;  3SBT B;  4CT0 A;  1DCQ A;  4HXI A;  3BU8 A;  4JA7 A;  2WXP A;  4ACL A;  2RG8 A;  4F53 A;  2WQ7 A;  1FVH A;  1NP7 A;  3LXU X;  1N95 A;  2X6H A;  2X6K A;  4U95 D;  3V2X A;  4FA6 A;  2VGX B;  1S63 A;  4LUN U;  1H2T C;  4JD2 G;  3CKC A;  4HOT A;  5KNH D;  4FLB A;  3HXC A;  3D9M A;  2JLB A;  5EDS A;  4U0S A;  2OND A;  3SFZ A;  3L16 A;  3DSS A;  1NA0 A;  3AS4 A;  4A3T A;  3JYS A;  1OUV A;  5FWQ A;  3CVN A;  2R59 A;  3IV0 A;  3FTW A;  4U7E B;  5EKQ D;  4XI0 A;  4G25 A;  1QZ2 A;  4CCA A;  4BER A;  4YDW A;  4N3A A;  4LCT A;  5EYL A;  5FQ4 A;  4WND A;  5H7P A;  2AJA A;  2IQC A;  5ENO D;  3V30 A;  3D9J A;  2BKK B;  3ZPJ A;  2XS1 A;  3L08 A;  1JUQ A;  4L2L A;  5CBN A;  3CHS A;  3PZ1 A;  5KJN A;  1BPO A;  1P5Q A;  3HXD A;  4ZFH A;  4PDX A;  5D66 A;  2RD0 A;  3KAE A;  1KLX A;  4CEM A;  3JCK C;  3KEZ A;  2RKK A;  2BUG A;  2BF0 X;  1K1B A;  2KAT A;  2XCB A;  1TNB A;  2L0I A;  1IQU A;  5B3S E;  2ZU6 B;  3HIZ A;  4F7A A;  4BX8 A;  4PH4 B;  3FEY A;  3MX3 A;  3FUK A;  3LPZ A;  3P2B A;  4F1S A;  1YA0 A;  1S70 B;  5G05 C;  1OWN A;  3T5X A;  3Q49 B;  5B1A E;  3IBE A;  4LG6 A;  2X6F A;  4B8C B;  3UM2 A;  2LXM A;  3RRM B;  2CFZ A;  4H7X A;  3CVX A;  3PS6 A;  4C0E A;  4U8V D;  2GRO B;  4GPM A;  1VDY A;  3MCX A;  2YNQ A;  3ZHE A;  5FZR A;  4HI8 A;  3W9F A;  3TXM A;  2VJ8 A;  3FUH A;  4UUC A;  2IEJ A;  5AAO A;  1N54 A;  2KCK A;  4YDO A;  1E8X A;  1S64 A;  2QYU A;  5CCL A;  2I2O A;  1KZO A;  4JEH A;  3LYA A;  1HFA A;  4BTB A;  2J07 A;  4R7L A;  3C98 A;  1X5B A;  4BT9 A;  3QOU A;  2NXP A;  1UG3 A;  3CHQ A;  2H6H A;  4PUC A; 
#chains in the Genus database with same CATH homology
 3I4G A;  3MV2 B;  3ULQ A;  3VTX A;  3CVQ A;  3MJW A;  3I5P A;  4B94 A;  5A6C A;  4K0R A;  2WXR A;  2X3M A;  1Y8M A;  4WNG A;  5JJ7 A;  3OXL A;  3MEK A;  4PS8 A;  4AVX A;  2OVB A;  3G2T A;  4FHK A;  4XIF A;  3K9I A;  4ABN A;  4UWL A;  2VGY A;  3ZXS A;  2XGO A;  4J0U A;  4U04 A;  3RRU A;  3S7B A;  5BT1 A;  3GYZ A;  1SQM A;  1HX8 A;  2J49 A;  2VYI A;  3FH8 A;  4GZC A;  4APF A;  4XKB A;  2GRM A;  1UN9 A;  2HO1 A;  2I9C A;  4I6E A;  4I6G A;  4KT6 B;  4B8A A;  1EF1 C;  3ONL A;  4AXH A;  4WAF A;  3P1U A;  4ANW A;  4G23 A;  4WUY A;  4Y6C A;  5LCW C;  2FO7 A;  3LJ3 A;  2XHE A;  3U4T A;  1H19 A;  3CLJ A;  4ANV A;  1H0A A;  4UI9 C;  5G04 C;  2QFC A;  2WXQ A;  4H7Y A;  4GZ3 A;  4YND A;  2PM7 A;  3L17 A;  2VSO E;  4OVU A;  4U63 A;  4HLE A;  5FQ6 A;  2WM9 A;  3R7Q A;  4AY5 A;  3CGH A;  3ASD A;  1HH8 A;  2CHW A;  3SNX A;  3S7D A;  4FLH A;  4B0Z A;  5KJK A;  3IKO B;  3GZS A;  2OV8 A;  2FI7 A;  2E2E A;  4G24 A;  4BTA A;  4DJA A;  3UPV A;  1TEZ A;  2FF4 A;  4GA1 A;  1DVP A;  5D0Q D;  3B7U X;  3O4Z A;  4YVO A;  4WWO A;  3ESK A;  2LAI A;  2V5F A;  3FUJ A;  1XNF A;  4APO A;  5DBK A;  4XZ4 A;  3CK9 A;  2A5U A;  2C0M A;  2Y4T A;  4PS3 A;  3D9I A;  4OYS A;  4L1B A;  4LRZ A;  5BW8 C;  2VTB A;  4DLQ A;  1MHQ A;  3LY8 A;  5LCW J;  4J6I A;  4XX5 A;  4F3V A;  3B7R L;  1EDU A;  1UJK A;  5ANL A;  2R17 C;  1HE8 A;  2FEZ A;  2XCC A;  3CKB A;  3CV0 A;  3BG1 B;  1WM5 A;  1HZ4 A;  2CHX A;  4J8D A;  4GCN A;  3G2W A;  3URZ A;  4C0M A;  3ENE A;  2XGS A;  4L23 A;  1E90 A;  2WXG A;  5FTP A;  4JXT A;  2WMN A;  4BT8 A;  3MA5 A;  2WXJ A;  3ZYL A;  3SHF A;  5JJ6 A;  4Q96 A;  4I1M A;  2C0L A;  5BV0 A;  4Q94 A;  3JUI A;  4JA9 A;  3FEX A;  4NUR A;  2CG3 A;  3R7R A;  1UJJ A;  2J4B A;  5T3R A;  3FTZ A;  3NF1 A;  4HVB A;  2AXZ A;  2XRY A;  2LSU A;  3EHN A;  4RG6 A;  5FZS A;  3ZIM A;  4BWR A;  3GW4 A;  4DLO A;  4GA0 A;  4EPZ A;  3D9O A;  3S7J A;  3CVV A;  3MKR A;  4BSX A;  1SZ9 A;  3ZFW A;  3APC A;  3ZRH A;  4JPS A;  2M63 A;  5BV1 A;  5AJL A;  3KS2 A;  1QNF A;  2I1J A;  4G2V A;  4L7T A;  5CMW A;  1INZ A;  2HR2 A;  3VLD A;  2XGM A;  3L54 A;  1SZA A;  4U0Z A;  4I2W A;  1HO8 A;  2AXV A;  3CK7 A;  3CVW A;  2J08 A;  4FHJ A;  3PDN A;  1JWF A;  4BX9 A;  2WXK A;  1IHG A;  4L2Y A;  3T8M A;  3CIA A;  2WMO A;  4GCO A;  4CT4 A;  4AY6 A;  5AJD A;  2GGF A;  3MV3 B;  3RO2 A;  3JQ0 A;  2A4Z A;  4NQ0 A;  3LDZ A;  4DI4 A;  3PRZ A;  4GA2 A;  3I3N A;  3CHP A;  4ILG A;  4JHJ A;  3QWP A;  1E8W A;  3GZ2 A;  2DIW A;  3UT8 A;  5CCM A;  4UWK A;  4EZL A;  4J8S A;  3FTX A;  4N3C A;  3QNK A;  2BTD A;  2WXO A;  2VTB B;  1E96 B;  4XE0 A;  3TAX A;  3TJP A;  5M72 A;  2L6J A;  4HS2 A;  5ENN A;  1HXI A;  2IJG X;  3LCA A;  1ZBP A;  5KJL A;  2JEK A;  4Q69 A;  3Q5M A;  4XKC A;  1N52 A;  1JWG A;  4JZY A;  1IQR A;  1XGW A;  3Q4A B;  5DIZ A;  3EIQ C;  2GRL A;  3PUJ A;  2PQR A;  3EHM A;  3G2V A;  3ZVV A;  4D10 C;  3TG4 A;  4EQF A;  2XPI A;  3TXN A;  5LP0 A;  4FP7 A;  1U3C A;  1L5J A;  5JHB A;  4FUL A;  1OWP A;  2KCV A;  3U66 A;  2PZI A;  4DPR A;  3LEW A;  2KCL A;  1U3D A;  4GYW A;  4GYY A;  3RRN B;  4GMJ A;  4GPK A;  4JHK A;  2X38 A;  1Z3Y A;  5C1D A;  2XEV A;  5LOZ A;  1UN8 A;  5FZQ A;  3LVR E;  3LS8 A;  1EYH A;  2EQX A;  2XPY A;  4NRH B;  3FTS A;  2I1K A;  4UQX A;  3FUF A;  4UWG A;  2FUL A;  3ASH A;  1S0P A;  2QY7 A;  3PEU B;  1OWL A;  3FDH A;  3SI5 A;  3NZS A;  4I9C A;  5ANR A;  1E7V A;  3ZHE B;  4KZ0 A;  2CHZ A;  4I17 A;  3AS8 A;  2YQ8 A;  3CHR A;  5FQ7 A;  2WXL A;  2LNI A;  3PEV B;  2E0I A;  1DNP A;  2PL2 A;  3SD5 A;  5LX8 A;  4WNE A;  4I2Z A;  2XPZ A;  5HI7 A;  5J90 A;  3OXF A;  2ION A;  4J8E A;  3FTY A;  4K03 A;  4PS7 A;  4HOS A;  1ZU2 A;  2AW6 A;  1MQS A;  1ELR A;  2GW1 A;  3EIJ A;  3IEG A;  4I1O B;  4N39 A;  2LO6 A;  1UW4 B;  1HG2 A;  4N2Q A;  3FUL A;  3ML8 A;  3MYV A;  2V8S E;  3L22 A;  5KCM A;  5BNW A;  3FU0 A;  3MKQ A;  3PUK A;  3RIB A;  2XQ0 A;  3OAW A;  3QK0 A;  3ZYK A;  2KZT B;  3GZ1 A;  4I9E A;  3HVE A;  4TUU A;  4N3B A;  3ZW3 A;  3PNT B;  2C2L A;  4CDR A;  2VGX A;  2YIN A;  3ESL A;  2DBA A;  3FHE A;  4UI9 J;  5G04 J;  3APF A;  1TJF A;  4DI3 A;  3UX4 A;  3EJN A;  3IHV A;  3LVQ E;  3JQ1 A;  3QWV A;  3UQ3 A;  4MKT A;  5FT9 A;  3TGO A;  1HF8 A;  3I4R B;  3FTU A;  5EX0 A;  5FQ8 A;  2WQH A;  4DK5 A;  3R9A B;  3FY4 A;  3ZN3 A;  1NA3 A;  3ML9 A;  4FU3 A;  4N5C A;  2VSN A;  3FH7 A;  3FUD A;  3N71 A;  4G26 A;  3CST A;  3VLE A;  4IUL A;  4ANU A;  3NZU A;  2DCP A;  2UY1 A;  4UWF A;  4JW1 A;  4ILI A;  3D3M A;  4JEU A;  4LER A;  4V3I A;  4IRU A;  3CVU A;  3PRE A;  5CMY A;  2XRZ A;  3G2U A;  3FUM A;  3CVL A;  4LEU A;  2IOL A;  5BPP A;  3HHM A;  5G55 A;  4I43 A;  4EZK A;  3LY9 A;  3VTY A;  3RKV A;  3APD A;  3UT4 A;  4AV7 A;  5AEN A;  2WQ6 A;  5ARF A;  5LFA A;  4JVS A;  5EX3 A;  2IF4 A;  3AU4 A;  1Z3X A;  2CG2 A;  3LKU A;  2V4L A;  4MLP A;  3LY7 A;  2AWI A;  3FFL A;  2AVP A;  4A55 A;  1NZN A;  2PM6 A;  4KVM A;  1ELW A;  1E8Z A;  4I6J A;  3CVY A;  3TL5 A;  4BY6 A;  4AP2 A;  2MRI A;  4GB9 A;  3SBT B;  4CT0 A;  4UQZ A;  5JJT A;  4HOU A;  4HXI A;  3CR3 A;  3U64 A;  4JA7 A;  2WXH A;  2WXP A;  4ACL A;  5HQ8 A;  2RG8 A;  3D9P A;  4F53 A;  3QKY A;  2KM4 A;  2WQ7 A;  1EPU A;  1FVH A;  1HU3 A;  1NP7 A;  2LAH A;  3HVE B;  2X6H A;  3LXU X;  3RJV A;  4EZJ A;  1W3B A;  2X6K A;  3ASG A;  3EDT B;  4FA6 A;  3CK8 A;  2J4D A;  2FBN A;  3ZYM A;  3D9K A;  3CEQ A;  5D0O D;  2WPV A;  2VGX B;  2IU1 A;  4LUN U;  1H2T C;  4KYO B;  4WWP A;  3CKC A;  4HOT A;  3FUN A;  4GZD A;  4FC8 A;  2I6H A;  3ASF A;  4FLB A;  4QFV A;  3WXX A;  3B7T A;  3L13 A;  4ATG A;  3OTN A;  3D9M A;  4G11 A;  4M3O A;  5AIJ A;  1E8Y A;  2JLB A;  3O48 A;  5EDS A;  4U0S A;  2OND A;  4Y6W A;  2VQ2 A;  3SFZ A;  3L16 A;  2UY1 B;  3FUE A;  3TG5 A;  3FU6 A;  4TRQ A;  1HG5 A;  1NA0 A;  3AS4 A;  2WXN A;  3PH0 C;  4A3T A;  3JYS A;  1OUV A;  3RK6 A;  5FWQ A;  3CVN A;  2R59 A;  1WAO 1;  2WVI A;  4J8F A;  2HYZ A;  2WXF A;  4BFR A;  3FP3 A;  3IV0 A;  4URK A;  3FTW A;  5JHA A;  4U8H A;  4IYP A;  5EKQ D;  3QC1 A;  4A1G A;  4CDN A;  2WB2 A;  4NAC A;  4XI0 A;  2IFU A;  2X6I A;  2YHC A;  4GZ5 A;  4G25 A;  1QZ2 A;  2WXI A;  4CCA A;  4G1T A;  4FJZ A;  3Q47 B;  3SBS A;  4WWN A;  4N3A A;  4LCT A;  5J08 A;  4EBA G;  3ZEF A;  4ACK A;  4P29 A;  5FQ4 A;  2ILR A;  3BEE A;  4WND A;  4CGV A;  4JC8 A;  3SF4 A;  1PY1 A;  4C9B B;  2PQN A;  4GU5 A;  4E85 A;  5A7D B;  3RU0 A;  5G2N A;  2IQC A;  3FU5 A;  3D9J A;  5KJM A;  4U07 A;  3ZPJ A;  3L08 A;  3UT7 A;  3CQC B;  1JUQ A;  4L2L A;  4OVV A;  4MS6 A;  4XI9 A;  3SGH A;  4GYO A;  3CHS A;  4FJY A;  2YHE A;  4GZ6 A;  3UMV A;  4KMO A;  1E7U A;  5KJN A;  1BPO A;  3MGB A;  1P5Q A;  1ELK A;  3CVP A;  4U0U A;  3QAQ A;  5T4Y A;  2KC7 A;  4KZC A;  3B7S A;  2HM8 A;  2NSZ A;  4GAA A;  4PDX A;  1FCH A;  2Y3A A;  4RVB A;  2UWJ G;  2RD0 A;  3KAE A;  3VLF A;  3S2A A;  1FVF A;  4UWH A;  1KLX A;  4A1S A;  3FUI A;  3PVL A;  4CEM A;  3QWW A;  2J09 A;  3JCK C;  1H2V C;  3KEZ A;  1TJC A;  4EEC A;  3CHO A;  2BUG A;  2BF0 X;  1KT0 A;  1KT1 A;  5C2Y A;  1OWM A;  3OXG A;  3Q15 A;  4CDM A;  2KAT A;  5BUZ A;  3CHM A;  4KBQ A;  2XCB A;  3NQP A;  5ARG A;  1IYG A;  2L0I A;  3SZ7 A;  2MOW A;  4ANX A;  4AIF A;  1IQU A;  1PAQ A;  2ZU6 B;  2MHK A;  3CSF A;  1LF8 A;  3HIZ A;  4IN3 B;  4RSY A;  3E4B A;  4F7A A;  3PE4 A;  4BX8 A;  4PH4 B;  3PNL B;  3U3W A;  4GML A;  1Y6I A;  2J9Q A;  2VSY A;  2AXU A;  3FEY A;  3B13 A;  1Z6T A;  3IHY A;  3MX3 A;  2NC9 A;  2P58 C;  3FUK A;  4AEZ C;  3LPZ A;  3P2B A;  2IOS A;  1QQE A;  1YA0 A;  3QJZ A;  3ZGQ A;  3KD7 A;  5G05 C;  4F1S A;  3QAR A;  1OWN A;  3HDX A;  3T5X A;  2X6J A;  3AS5 A;  3Q49 B;  3IBE A;  2X6F A;  4W9R A;  4B8C B;  4CGW A;  4KXK B;  2Y4U A;  3RRM B;  3PE3 A;  2CFZ A;  2R5S A;  3DPD A;  4H7X A;  4UQY A;  3CVX A;  3PS6 A;  2CFU A;  4C0E A;  1B89 A;  4WNF A;  4E6H A;  4JHR A;  4EBA A;  1WY6 A;  4YVQ C;  1JPL A;  4AOF A;  2OOE A;  4UI9 K;  4ME2 A;  1VDY A;  3QDN A;  3D9N A;  5A23 A;  3MCX A;  2WXM A;  2YNQ A;  3MKQ B;  1A17 A;  3PZD A;  3ZHE A;  5FZR A;  4HOR A;  3L6A A;  3T5V A;  4I1A A;  3D9L A;  4HOQ A;  2VJ8 A;  3FUH A;  1OWO A;  3TXM A;  2VSX E;  5AYW D;  3HYM B;  4FAD A;  3ONK A;  1N54 A;  2KCK A;  4RG9 A;  3CQG B;  2L9B A;  4A3V A;  1E8X A;  3FTV A;  4JL0 A;  5E76 A;  4KVO A;  5FJY A;  3DBS A;  1HS6 A;  3RO3 A;  3AU5 A;  4AM9 A;  4CRW A;  1H6K A;  3U9W A;  5CCL A;  2I2O A;  3UUX A;  5G05 J;  1GW6 A;  1PC2 A;  2V0P A;  4JEH A;  3S7F A;  3LYA A;  1HFA A;  2OVF A;  2Q7F A;  2J07 A;  2LSV A;  3QB2 A;  3FU3 A;  4R7L A;  4BTB A;  3C98 A;  4O6F A;  4HFG A;  4AJW A;  1X5B A;  4BT9 A;  3QOU A;  2NXP A;  3MZL B;  2L0T B;  4ILH B;  1UG3 A;  5CHE E;  5E75 A;  4N2S A;  3G2S A;  2KZT A;  3ZYQ A;  3FH5 A;  3BG0 B;  4TV3 A;  3CHQ A;  5T8I A;  4B89 A;  1H2U A;  3FWV A;  4PUC A;  4MRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...