4QQIA

Crystal structure of ankra2-rfx7 complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
176
structure length
176
Chain Sequence
LYFQGSTTPLLANSLSVHQLAAQGEMLYLATRIEQENVINHTDEEGFTPLMWAAAHGQIAVVEFLLQNGADPQLLGKGRESALSLACSKGYTDIVKMLLDCGVDVNEYDWNGGTPLLYAVHGNHVKCVKMLLESGADPTIETDSGYNSMDLAVALGYRSVQQVIESHLLKLLQNIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ankyrin repeat family A protein 2
publication title Ankyrin Repeats of ANKRA2 Recognize a PxLPxL Motif on the 3M Syndrome Protein CCDC8.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 57
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2014-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
A PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4qqiA00
5HRYA 4YDWA 5KNHD 2QYJA 3V79K 2B0OE 3TWRA 1S70B 1D9SA 5AARA 5CECB 5CBOA 3T9KA 1MJ0A 3EHRA 2XEEA 4BSZB 4GPMA 5HKPA 3EU9A 1OY3D 4DX2A 5FIOA 5CEAA 3JXJA 3TWQA 3W9FA 1IXVA 4DX7D 4OAVB 5AQ9A 5AN8A 3J5QB 3V31A 4LG6A 3TWSA 5CEDB 3F6QA 1UOHA 3ZU7B 1BU9A 4UUCA 5EIDA 3C5RA 4C48B 4OAUC 5FINA 4BEPA 4RLYA 2ETBA 2XZTG 4U8YD 1SW6A 3Q9UC 2PNNA 3UXGA 4GMRA 2F8XK 4YDYA 5JMND 1AP7A 3NBNB 2Y1LE 4ZFHA 4N5QA 1A5EA 4CZ2D 1BD8A 2BKKB 5KNGA 4U8VD 1MX2A 2ZGGA 3NOCD 5CBNA 4ZHBA 3KEAA 1MX4A 1MYOA 2L6BA 3JXIA 2DZNA 3DEOA 1TR4A 4B93B 4TUMA 4BESA 3AJIA 2XZDG 5AQAA 3TWVA 4K5AB 2ZGDA 4QQIA 1MX6A 3ZKJA 5ITZF 4CYMD 2BKGA 4J7WA 5EILA 4DX1A 1YYHA 4K5CA 2DWZA 2P2CP 1DC2A 1WDYA 4G8LA 4HI8A 2F37A 4HI9A 2XEHA 2MYOA 4HRLA 2V4HC 1N0QA 3V2XA 4JB8P 5KBAA 3TWWA 2F8YA 5HS0A 3UI2A 1WG0A 4O60A 5EYLA 1K1BA 1NFIE 2HE0A 2QC9A 3V30A 2FO1E 4F6RD 4DRXE 5JA4D 2ETCA 4HB5A 2V5QC 2J8SD 2JABA 5EIBE 3HRAA 3T8KA 4LSZE 3ZUVB 4HNAD 4HRNA 1G3NB 5ENPD 3TWXA 1BI8B 4LNUD 3TWUA 4BERA 1IKND 5EYPF 4A63B 2Y0BG 1IHBA 4DUIA 4Z68A 2NYJA 4NIKA 1QYMA 4ATZD 5ENTD 4DX6D 5AAOA 4HBDA 3V2OA 3SO8A 2RFMA 4U96D 1YMPA 3IXEA 4DX5D 2AJAA 1AWCB 5ENOD 1BI7B 5EN5D 3W9GA 2VGEA 4QFVA 3AAAC 5CERB 1OT8A 3EHQA 3UTMA 4F1PA 5KWDA 2XENA 3D9HA 5AQBA 1K1AA 2A5EA 4J8YA 5ENSD 5AQ7A 1DCQA 3B95A 1SVXA 3Q9NC 4BETA 1N0RA 2ETAA 3B7BA 4U95D 3TWTA 3NOGD 2DVWA 1N11A 1YCSB 2RFAA 3J5PA 4G8KA 4O1PA 3JUEA 3HG0D 4HLLA 4HQDA 2DZOA 1BLXB 5ENQD 4HRMB 3DEPA 2KXPC 4O1OA 5D66A 5ENRD 5BXOA 4K5BA 3ZNGA 3LJNA 1K3ZD 5BXUA 2KBXA
chains in the Genus database with same CATH superfamily
3FTWA 3HXCA 3LDZA 1GW6A 5FQ7A 4HOSA 3GZSA 3QWPA 4JXTA 4C0EA 4BFRA 3RO3A 3W9FA 3J5QB 3TWSA 1DCEA 3F6QA 3TGOA 2PQNA 4APOA 5FINA 3UQ3A 2ETBA 4C0MA 2WB2A 3CHPA 2GRRB 3Q5MA 4U07A 4XI0A 4AJWA 1MX2A 1D8EA 5CBNA 2CHWA 2WXGA 4TUMA 4GYWA 4K5AB 4I2ZA 5LOZA 2KCKA 3WXXA 4RG6A 5FZSA 3L08A 3MGBA 3PUKA 3MZLB 4E85A 3SFZA 4J0UA 4HRLA 2JEKA 3X2QE 4JPSA 3LS8A 2F8YA 3PEVB 3UI2A 1WG0A 4N3BA 4F6RD 3DSSA 4KZ0A 3QDNA 3ZUVB 3LVRE 2VGXA 3JCKC 2GRNB 3SFXA 2P9KG 4EBAA 2C2LA 1O5MA 5LFAA 1IQUA 3RIBA 3RRNB 3B7TA 3AAAC 4GTVA 4C9BB 1WY6A 5AQ7A 4TXPA 4CDMA 3L16A 1N4SA 2B6CA 3ZXPA 4IRUA 2KXPC 4I17A 4HFGA 2WXHA 2WQ6A 3NB2A 2IONA 3AG3E 2R17C 4AY6A 3ESLA 1LD8A 4BWRA 1ELRA 4GZDA 3CK7A 5EIDA 3DSVA 2Y4UA 1SW6A 2IFUA 1TNOA 3B7RL 5AENA 4A55A 1FT2A 3CGHA 2DZNA 3IV0A 4CGWA 5KJKA 2ZGDA 3ABLE 2WQ7A 4WNEA 3CQCB 3SBSA 1DC2A 1K8KG 3RKVA 1KZPA 3Q47B 2ZIRA 2QFCA 2AVPA 4CT0A 3ZGQA 4FP7A 4ANWA 1DNPA 2XPIA 1G3NB 2AXVA 5ENPD 4F1SA 1IHBA 2MHKA 3CR3A 1N4RA 3CVYA 1HX8A 4QFVA 4FLBA 4G25A 4OVVA 3ZYLA 1JWFA 3B95A 1OCZE 4U04A 3ZHEB 3ZNGA 2IY0C 2UY1A 4EHMA 1W3BA 4UWGA 3HHMA 5HRYA 3SD5A 4WNDA 5AARA 1N95A 3T9KA 1MJ0A 3EHRA 2ZU6B 1U3DA 1ZBPA 3JXJA 2WXMA 3LKUA 2WXOA 2IU1A 2Y3AA 3EHMA 4BY6A 4UQYA 4DJAA 3QAQA 3WG7E 2YHEA 3NBNB 4UWHA 1LTXA 2KZTB 3B13A 3NOCD 5HI7A 3DEOA 1TR4A 2NSZA 4JHJA 4DX1A 3JQ0A 2V4LA 4G11A 1SA5A 1N4PA 4XKCA 2FO1E 1OWPA 3CVPA 3P1UA 2I2OA 2V5QC 1H6PA 3CSFA 5G04C 2J9QA 4XKBA 2A4ZA 4CDNA 5EYPF 3GZ2A 3FP3A 4Q94A 2H6FA 4I6GA 2GRMA 4KBQA 4GTQA 3MYVA 1QQEA 4YVOA 2ETAA 3NOGD 2J4BA 1YCSB 4G8KA 1V54E 4N2QA 3ZVVA 1H2TC 3UMVA 2QYUA 3ULYA 3QNKA 3AS8A 4XX5A 3U64A 3L54A 1UJJA 2GRPB 5CECB 3C3OA 4GPMA 5T8IA 1OY3D 4IYPA 5G05C 3LVQE 5JJTA 2VSXE 1KZOA 4FADA 1FT1A 2JLBA 4TUUA 2P9NG 2CFUA 2M63A 2XZTG 2Y69E 4ILIA 4IN3B 3U3WA 3RU0A 3PH0C 4GZ3A 4GB9A 1E8XA 1NI1A 2WXFA 3VLFA 1ELWA 2KCLA 3KSQA 3S7JA 2X6IA 1LF8A 4HI9A 5A23A 3TWWA 3SF4A 2XHEA 1Z5SC 2F0YA 2VTBA 1NFIE 2HE0A 4Q69A 2J8SD 3IHYA 1JPLA 1E7UA 3TWXA 5EDSA 3ZYMA 4EBAG 3SHFA 2PM7A 5KJNA 4XEIG 3UIPC 1QYMA 1INZA 5H7PA 4L2YA 1KPSB 3ZYKA 3SQVA 3DSWA 4I43A 4A3VA 3HVEB 3DBSA 4HLLA 5D66A 3QWWA 4XIFA 3CHOA 4YDWA 1HXIA 2IO2C 2L9BA 3ML8A 1KT0A 2BTDA 3FH5A 2OEVA 4RQIA 4ANXA 3L9TA 5FIOA 2I9CA 4OVUA 3S7DA 5C1DA 2WMOA 4MS6A 3SBTB 3S2AA 3V31A 4Y6CA 4CRWA 4FA6A 2R5SA 2R59A 4YDYA 1UJKA 2IQCA 4CEMA 1A5EA 4L23A 3LXUX 1HO8A 3CVVA 2LUHA 3G2UA 5J08A 1MQSA 2WXNA 2E2EA 4PS7A 1BPOA 2WXLA 4HI8A 2F37A 4JL0A 2XS8A 1Y8MA 2QY7A 3OTNA 2V4HC 4I1AA 4EQFA 4DRXE 4HB5A 4GTMA 3T8KA 4F53A 3I4RB 3HXDA 4F7AA 4ATZD 2H6GA 2LNIA 3CKCA 4I2WA 3PNLB 1MHQA 3IEGA 4LEUA 2WXJA 2P9LG 1DVPA 4ACKA 4U7EB 3FUNA 1N4QA 3AS4A 5D0QD 5ENRD 5ARGA 3GYZA 3ABKE 4A1SA 1XNFA 2YNQA 3QJZA 3D9OA 3ASFA 1IXVA 3T8MA 2CFZA 2WXKA 3PZ4A 4OAUC 1HF8A 3UXGA 1NA0A 1SQMA 4L2LA 5T3RA 3FU0A 4ZFHA 4BTAA 2ZGGA 3MKQA 3AG2E 3LYAA 1SZ9A 3JXIA 4MKTA 2OCCE 4GPKA 1E90A 3O48A 5AQAA 4GTTA 3ZKJA 3CHSA 1JUQA 2WMNA 3R9AB 2LO6A 3CVUA 2XGSA 4LNUD 2NXPA 1WAO1 1TEZA 3OXFA 3UT4A 2HYZA 4U96D 4HORA 2L0IA 4KYOB 3W9GA 1H2UA 4GTOA 2XRZA 2ONDA 3UX4A 5FJYA 3LEWA 4J8YA 2VSOE 4WUYA 4MLPA 4HOQA 3B7BA 1Q2ZA 2MRIA 4KT6B 1JCSA 2WXIA 2RFAA 5FT9A 3IBEA 5BXOA 4UI9C 4KZCA 5FZQA 5KNHD 2EQXA 3FUIA 2LAIA 4P29A 3DRAA 3MV3B 4UI9K 2J4DA 2AXZA 2R02A 3QWVA 3CHRA 3ZEFA 2IEJA 1FCHA 5DBKA 3LY9A 5CCLA 4CZ2D 4D10C 2BKKB 3FEXA 4XE0A 2J08A 1HFAA 1NP7A 5BV1A 1E8YA 1TJCA 1MX6A 3FU3A 3CVWA 4J7WA 1IQRA 3C3QA 4NURA 4AIFA 3HXEA 2LXLA 4GMJA 4GAAA 4HRNA 5A7DB 4BERA 5E76A 3Q79A 2P9SG 2QZAA 3L17A 4N5CA 1OWMA 4GA2A 2J09A 5ENOD 3K9IA 3D9MA 4H7XA 4ATGA 3ONKA 4PS3A 1HS6A 2GGFA 4FULA 3R7QA 5CMYA 3VLDA 3HIZA 3PS6A 4GMLA 2BEDA 2XPZA 3B7UX 3RK6A 3U66A 1OXJA 4BT9A 3ZFWA 2BUGA 5BT1A 1S63A 4HS2A 2YINA 4YNDA 4JD2G 4DX7D 5FQ4A 2GRLA 5BW8C 4AM9A 1O1RA 1O1SA 3CIAA 3FEYA 2X6FA 2F8XK 3S7FA 3CHMA 2DBAA 1AP7A 4GTRA 3D9PA 4AVXA 4CGVA 5ANLA 2YHCA 1MYOA 3DSUA 1EF1C 3FULA 4FLHA 3OXGA 3TWVA 3BQOA 1TN8A 2L6JA 1JCQA 3O4ZA 4CYMD 5ITZF 3RRUA 3E37A 3FUMA 5LCWC 4YVQC 3DWLG 3FUDA 3ZIMA 4ILHB 2IJGX 1H2VC 3JQ1A 4XZ4A 2A5UA 2QC9A 3FWVA 4JHRA 1SA4A 3HRAA 4CDRA 3TJPA 4N2SA 2X6JA 3SZ7A 2XGMA 3PE3A 4WNFA 1D8DA 2NC9A 3AU4A 2C0MA 2RFMA 4X8QA 1AWCB 1ZB1A 2YQ8A 5CRUA 1NA3A 5CERB 2GROB 3UTMA 2I1KA 2DYRE 1HE8A 2VJ8A 3MJWA 1L5JA 4HRMB 2LAHA 4DI4A 3FUHA 4LRZA 4K03A 3D9JA 2FO7A 4A1GA 4CT4A 3CHQA 3MV2B 3E34A 3ONLA 5CEDB 3ZHEA 3FTSA 4U8YD 5CMWA 2WVIA 2DCPA 4GTSA 4WWNA 2H6HA 4TXRA 2EINE 1EDUA 4JHKA 3VTYA 4LNGA 1NL4A 4ZHBA 4UWLA 4JC8A 4Q96A 3GW4A 5ANRA 2EIKE 4J8DA 3EJNA 5CRVA 1YYHA 4I9EA 1E96B 2MYOA 3RAUA 4U0SA 4U63A 1IYGA 4GZ5A 2ZISA 1XGWA 5G04J 3D9LA 5EIBE 3PREA 5IY5E 4J6IA 3FY4A 2KZTA 4FU3A 1N9AA 3UM3A 3DPYA 4NQ0A 1Z3XA 4U0UA 1X5BA 3E33A 3IXEA 1Z6TA 4V3IA 3CV0A 3U4TA 4EZJA 3EHQA 3HXBA 4B8AA 1NZNA 2I6HA 3Q4AB 1DCQA 4U95D 5BPPA 4IULA 2LSVA 3JUEA 3BEEA 1BLXB 3HDXA 3QARA 4GZ6A 1TYQG 4H7YA 4N3AA 5BUZA 3LJNA 5CHEE 4L1BA 1H6OA 5ARFA 4HXIA 2HO1A 1FPPA 4O6FA 1HU3A 2R03A 5B1BE 3ZW3A 3TWRA 2XEEA 3TXMA 5G05J 5HKPA 5FZRA 3SNXA 4FHKA 3PZ2A 4ANUA 1Y6IA 4UUCA 3ESKA 3URZA 2ZXWE 2P9PG 3DSXA 3ZN3A 3EIJA 4ANVA 3N71A 2OEWA 1MX4A 3R9MA 2P9IG 4DLQA 3BG0B 4BESA 4ME2A 2KATA 4UWFA 2OOEA 4I6JA 3G2TA 2DWZA 2Y4TA 1EPUA 3L6AA 4KMOA 3FUKA 1H6KA 5KBAA 3LPZA 3V30A 2ETCA 1E8WA 3Q7AA 1FVFA 4E6HA 2DIWA 3TWUA 1IKND 3PNTB 2EIME 4I1OB 5ENTD 3V2OA 2XS1A 5LP0A 4CCAA 3FTVA 4GTPA 2WPVA 5ENSD 4J8FA 1SVXA 3TWTA 2PQRA 4RSYA 2DVWA 4AOFA 3HG0D 3JYSA 4APFA 2WM9A 1VDYA 2WXQA 3Q75A 4G26A 3GZ1A 5A6CA 4BTBA 1OWNA 1S70B 3ASNE 2IOLA 4DPRA 3OXLA 4HLEA 4HOUA 3DSTA 4JEHA 4GCNA 4YDEA 3HVEA 5EKQD 4TV3A 3D3MA 4A3TA 3DXMG 1PC2A 5JMND 3FTYA 5G2NA 3AU5A 3PZDA 1BD8A 2VGXB 4U8VD 4DK5A 1O1TA 4AP2A 4HVBA 3FUJA 3APFA 4QQIA 4RG9A 1Z3YA 2BKGA 2FBNA 4AY5A 4J8SA 4UQXA 1OWOA 1PY1A 2KCVA 5J90A 2XRYA 4O60A 1HZ4A 1RW2A 3UKUG 3Q78A 5JA4D 3E30A 3VLEA 3EHNA 4LSZE 4HNAD 4WWOA 1X81A 5KJLA 4EECA 4DUIA 4NIKA 3FTZA 5AAOA 4WAFA 3BG1B 5EN5D 2GRQB 3D9HA 4FJYA 4KXKB 3ABME 3I4GA 4BETA 2HM8A 5G55A 4GCOA 4AEZC 4O1OA 2CG3A 1OCOE 2RG8A 3NZUA 1K3ZD 1TNUA 4KVOA 2IF4A 3PVLA 4DX2A 2FI7A 2V5FA 3MKRA 2RD0A 2IOSA 4PUCA 3ZU7B 3ZXSA 3C5RA 5KCMA 3Q49B 3G2VA 4GMRA 2L0TB 2LSUA 4GYYA 4I9CA 1YA0A 3LY7A 2J49A 4PDXA 3PZ3A 2XEVA 1QBQA 3AJIA 4RVBA 3PE4A 4ABNA 3AS5A 5EX3A 1WDYA 2C0LA 2XEHA 2E0IA 4WWPA 2WXRA 3FTUA 2PL2A 1P5QA 2X3MA 2MOWA 4JVSA 2WQHA 3SGHA 4M3OA 3UPVA 3QC1A 3FFLA 5DIZA 4G23A 1N52A 2UY1B 3PDNA 4Z68A 4DX6D 1TNYA 4UWKA 4KVMA 3ENEA 5BV0A 1QZ2A 2OVFA 4DLOA 2XENA 1K1AA 2R05A 3FUFA 1N0RA 4MBGA 3CVQA 2CHZA 4O1PA 4UI9J 1E8ZA 4K5BA 5FTPA 2KBXA 4BX9A 3APDA 1D9SA 2WXPA 5FWQA 1UN8A 3I3NA 3KEZA 1UG3A 4ACLA 1UW4B 3ULEG 4LNBA 4NRHB 1S0PA 5T4YA 4OAVB 5AN8A 5ENNA 2VSNA 3C98A 4C48B 5AYWD 2KC7A 3FU5A 3QK0A 3Q9UC 1IHGA 1KT1A 1A17A 3UM1A 1OCRE 2Y1LE 1S64A 5C2YA 3EUVA 3CLJA 3AG1E 5E75A 3TAXA 2R2LA 4B93B 3CK8A 5HQ8A 3MX3A 5BNWA 3E32A 3UIOC 1TN6A 4GYOA 4GA0A 1E7VA 4G2VA 5HS0A 3Q15A 1TNBA 5EYLA 1K1BA 2XGOA 2ILRA 4R7LA 4TXQA 5D0OD 2JABA 4N39A 4DI3A 3FHEA 4B8CB 5FQ6A 4U8HA 3RSEG 4B89A 2AXUA 3QKYA 4HBDA 3OAWA 3RRMB 3ZRHA 3CVNA 3BUAA 1YMPA 3NZSA 2AJAA 2RKKA 5B3SE 3ZYQA 2X6HA 1B89A 2A5EA 2V8SE 2CG2A 3B7SA 1N11A 1EYHA 4BT8A 4HQDA 3AG4E 3DEPA 2IO3C 2VQ2A 3TXNA 4FJZA 4K0RA 3Q7FA 3PRZA 4JEUA 2H6IA 2QYJA 3V79K 3NQPA 1N54A 1H19A 2VGYA 3FH8A 4BSZB 3EU9A 4NACA 5AQ9A 3PEUB 4LG6A 1BU9A 2FEZA 3EU5A 3UT7A 1ZU2A 5D2MC 3CVLA 3FU6A 3ASOE 2VTBB 3ASGA 3EIQC 1UN9A 5KNGA 3C72A 2L6BA 4GU5A 2XQ0A 3EDTB 4BSXA 2XCBA 2BF0X 4HOTA 3SFYA 4K5CA 5LCWJ 2P2CP 3CSTA 3HYMB 3MA5A 4FC8A 1QNFA 3RJVA 3L13A 4FHJA 4I1MA 3FTXA 4L7TA 4OYSA 2FULA 3RO2A 4JZYA 4W9RA 3D9NA 3L82A 4B94A 2EILE 4LUNU 3Q73A 3MCXA 3ML9A 3CK9A 1U3CA 2J07A 2VGEA 5AJLA 3E4BA 4F3VA 3P2BA 4LCTA 3TG5A 1TJFA 1N94A 3J5PA 5KJMA 5CCMA 3G2SA 4URKA 2X38A 2KM4A 2I1JA 1HG5A 5BXUA 1U2VG 3S7BA 3KAEA 3BU8A 2AW6A 1TNZA 3L22A 3SI5A 3UM0A 4L9PA 5CEAA 3CEQA 3QOUA 3LCAA 3KSLA 4M7CA 3HXFA 4BEPA 4EZKA 4RLYA 4XI9A 3LJ3A 2V0PA 3TG4A 2HR2A 5AIJA 1OWLA 1OCCE 3IHVA 4JA7A 2FF4A 3KEAA 3T5XA 4EZLA 4WNGA 2P58C 4U0ZA 4YDOA 2LXMA 3QB2A 3UINC 4TRQA 5EILA 5JHAA 5M72A 5JJ6A 3SY2A 3FH7A 2XPYA 5EX0A 2XCCA 4LERA 2Q7FA 4GZCA 3DPDA 1ELKA 3PZ1A 2PZIA 1TN7A 4I6EA 1SZAA 4A63B 2Y0BG 3JUIA 3ZPJA 3C3RA 2DYSE 2CHXA 4DX5D 1HG2A 1BI7B 5FQ8A 1OT8A 2OV8A 5KWDA 3CQGB 1JWGA 5JHBA 4MRUA 4AXHA 3Q9NC 5LX8A 1HH8A 3MEKA 4PS8A 4GA1A 1KLXA 3KD7A 3D9IA 3FDHA 3G2WA 2DZOA 3UUXA 3MKQB 3ASHA 4UQZA 4Y6WA 2B0OE 5CBOA 4AV7A 5JJ7A 3PUJA 4JW1A 3TWQA 1FVHA 1UOHA 3LY8A 1LD7A 5B1AE 2UWJG 1PAQA 4N3CA 2PNNA 4N5QA 2PM6A 3KS2A 3IKOB 2VSYA 3T5VA 2XZDG 1RZ4A 3DXKG 3I5PA 4BX8A 3CKBA 4EPZA 2EIJE 3ISMC 3D9KA 4G8LA 4B0ZA 4J8EA 1MZCA 1N0QA 3V2XA 4JB8P 3R7RA 2AWIA 2P9UG 2VYIA 1BI8B 3VTXA 3U9WA 2GW1A 4G1TA 3CVXA 1JCRA 2NYJA 5AJDA 3UKRG 1WM5A 1OUVA 3SO8A 3ASDA 3NAWA 2X6KA 4ILGA 4F1PA 5AQBA 3UM2A 3NF1A 3APCA 4PH4B 3TL5A 2OVBA 3ULQA 1V55E 3FUEA 5ENQD 1H0AA 3UT8A 4JA9A 4G24A
chains in the Genus database with same CATH topology
5HRYA 4YDWA 5KNHD 2QYJA 3V79K 2B0OE 3TWRA 1S70B 1D9SA 5AARA 5CECB 5CBOA 3T9KA 1MJ0A 3EHRA 2XEEA 4BSZB 4GPMA 5HKPA 3EU9A 1OY3D 4DX2A 5FIOA 5CEAA 3JXJA 3TWQA 3W9FA 1IXVA 4DX7D 4OAVB 5AQ9A 5AN8A 3J5QB 3V31A 4LG6A 3TWSA 5CEDB 3F6QA 1UOHA 3ZU7B 1BU9A 4UUCA 5EIDA 3C5RA 4C48B 4OAUC 5FINA 4BEPA 4RLYA 2ETBA 2XZTG 4U8YD 1SW6A 3Q9UC 2PNNA 3UXGA 4GMRA 2F8XK 4YDYA 5JMND 1AP7A 3NBNB 2Y1LE 4ZFHA 4N5QA 1A5EA 4CZ2D 1BD8A 2BKKB 5KNGA 4U8VD 1MX2A 2ZGGA 3NOCD 5CBNA 4ZHBA 3KEAA 1MX4A 1MYOA 2L6BA 3JXIA 2DZNA 3DEOA 1TR4A 4B93B 4TUMA 4BESA 3AJIA 2XZDG 5AQAA 3TWVA 4K5AB 2ZGDA 4QQIA 1MX6A 3ZKJA 5ITZF 4CYMD 2BKGA 4J7WA 5EILA 4DX1A 1YYHA 4K5CA 2DWZA 2P2CP 1DC2A 1WDYA 4G8LA 4HI8A 2F37A 4HI9A 2XEHA 2MYOA 4HRLA 2V4HC 1N0QA 3V2XA 4JB8P 5KBAA 3TWWA 2F8YA 5HS0A 3UI2A 1WG0A 4O60A 5EYLA 1K1BA 1NFIE 2HE0A 2QC9A 3V30A 2FO1E 4F6RD 4DRXE 5JA4D 2ETCA 4HB5A 2V5QC 2J8SD 2JABA 5EIBE 3HRAA 3T8KA 4LSZE 3ZUVB 4HNAD 4HRNA 1G3NB 5ENPD 3TWXA 1BI8B 4LNUD 3TWUA 4BERA 1IKND 5EYPF 4A63B 2Y0BG 1IHBA 4DUIA 4Z68A 2NYJA 4NIKA 1QYMA 4ATZD 5ENTD 4DX6D 5AAOA 4HBDA 3V2OA 3SO8A 2RFMA 4U96D 1YMPA 3IXEA 4DX5D 2AJAA 1AWCB 5ENOD 1BI7B 5EN5D 3W9GA 2VGEA 4QFVA 3AAAC 5CERB 1OT8A 3EHQA 3UTMA 4F1PA 5KWDA 2XENA 3D9HA 5AQBA 1K1AA 2A5EA 4J8YA 5ENSD 5AQ7A 1DCQA 3B95A 1SVXA 3Q9NC 4BETA 1N0RA 2ETAA 3B7BA 4U95D 3TWTA 3NOGD 2DVWA 1N11A 1YCSB 2RFAA 3J5PA 4G8KA 4O1PA 3JUEA 3HG0D 4HLLA 4HQDA 2DZOA 1BLXB 5ENQD 4HRMB 3DEPA 2KXPC 4O1OA 5D66A 5ENRD 5BXOA 4K5BA 3ZNGA 3LJNA 1K3ZD 5BXUA 2KBXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HRY A;  4YDW A;  5KNH D;  2QYJ A;  3V79 K;  2B0O E;  3TWR A;  1S70 B;  1D9S A;  5AAR A;  5CEC B;  5CBO A;  3T9K A;  1MJ0 A;  3EHR A;  2XEE A;  4BSZ B;  4GPM A;  5HKP A;  3EU9 A;  1OY3 D;  4DX2 A;  5FIO A;  5CEA A;  3JXJ A;  3TWQ A;  3W9F A;  1IXV A;  4DX7 D;  4OAV B;  5AQ9 A;  5AN8 A;  3J5Q B;  3V31 A;  4LG6 A;  3TWS A;  5CED B;  3F6Q A;  1UOH A;  3ZU7 B;  1BU9 A;  4UUC A;  5EID A;  3C5R A;  4C48 B;  4OAU C;  5FIN A;  4BEP A;  4RLY A;  2ETB A;  2XZT G;  4U8Y D;  1SW6 A;  3Q9U C;  2PNN A;  3UXG A;  4GMR A;  2F8X K;  4YDY A;  5JMN D;  1AP7 A;  3NBN B;  2Y1L E;  4ZFH A;  4N5Q A;  1A5E A;  4CZ2 D;  1BD8 A;  2BKK B;  5KNG A;  4U8V D;  1MX2 A;  2ZGG A;  3NOC D;  5CBN A;  4ZHB A;  3KEA A;  1MX4 A;  1MYO A;  2L6B A;  3JXI A;  2DZN A;  3DEO A;  1TR4 A;  4B93 B;  4TUM A;  4BES A;  3AJI A;  2XZD G;  5AQA A;  3TWV A;  4K5A B;  2ZGD A;  4QQI A;  1MX6 A;  3ZKJ A;  5ITZ F;  4CYM D;  2BKG A;  4J7W A;  5EIL A;  4DX1 A;  1YYH A;  4K5C A;  2DWZ A;  2P2C P;  1DC2 A;  1WDY A;  4G8L A;  4HI8 A;  2F37 A;  4HI9 A;  2XEH A;  2MYO A;  4HRL A;  2V4H C;  1N0Q A;  3V2X A;  4JB8 P;  5KBA A;  3TWW A;  2F8Y A;  5HS0 A;  3UI2 A;  1WG0 A;  4O60 A;  5EYL A;  1K1B A;  1NFI E;  2HE0 A;  2QC9 A;  3V30 A;  2FO1 E;  4F6R D;  4DRX E;  5JA4 D;  2ETC A;  4HB5 A;  2V5Q C;  2J8S D;  2JAB A;  5EIB E;  3HRA A;  3T8K A;  4LSZ E;  3ZUV B;  4HNA D;  4HRN A;  1G3N B;  5ENP D;  3TWX A;  1BI8 B;  4LNU D;  3TWU A;  4BER A;  1IKN D;  5EYP F;  4A63 B;  2Y0B G;  1IHB A;  4DUI A;  4Z68 A;  2NYJ A;  4NIK A;  1QYM A;  4ATZ D;  5ENT D;  4DX6 D;  5AAO A;  4HBD A;  3V2O A;  3SO8 A;  2RFM A;  4U96 D;  1YMP A;  3IXE A;  4DX5 D;  2AJA A;  1AWC B;  5ENO D;  1BI7 B;  5EN5 D;  3W9G A;  2VGE A;  4QFV A;  3AAA C;  5CER B;  1OT8 A;  3EHQ A;  3UTM A;  4F1P A;  5KWD A;  2XEN A;  3D9H A;  5AQB A;  1K1A A;  2A5E A;  4J8Y A;  5ENS D;  5AQ7 A;  1DCQ A;  3B95 A;  1SVX A;  3Q9N C;  4BET A;  1N0R A;  2ETA A;  3B7B A;  4U95 D;  3TWT A;  3NOG D;  2DVW A;  1N11 A;  1YCS B;  2RFA A;  3J5P A;  4G8K A;  4O1P A;  3JUE A;  3HG0 D;  4HLL A;  4HQD A;  2DZO A;  1BLX B;  5ENQ D;  4HRM B;  3DEP A;  2KXP C;  4O1O A;  5D66 A;  5ENR D;  5BXO A;  4K5B A;  3ZNG A;  3LJN A;  1K3Z D;  5BXU A;  2KBX A; 
#chains in the Genus database with same CATH topology
 3FTW A;  3HXC A;  3LDZ A;  1GW6 A;  5FQ7 A;  4HOS A;  3GZS A;  3QWP A;  4JXT A;  4C0E A;  4BFR A;  3RO3 A;  3W9F A;  3J5Q B;  3TWS A;  1DCE A;  3F6Q A;  3TGO A;  2PQN A;  4APO A;  5FIN A;  3UQ3 A;  2ETB A;  4C0M A;  2WB2 A;  3CHP A;  2GRR B;  3Q5M A;  4U07 A;  4XI0 A;  4AJW A;  1MX2 A;  1D8E A;  5CBN A;  2CHW A;  2WXG A;  4TUM A;  4GYW A;  4K5A B;  4I2Z A;  5LOZ A;  2KCK A;  3WXX A;  4RG6 A;  5FZS A;  3L08 A;  3MGB A;  3PUK A;  3MZL B;  4E85 A;  3SFZ A;  4J0U A;  4HRL A;  2JEK A;  3X2Q E;  4JPS A;  3LS8 A;  2F8Y A;  3PEV B;  3UI2 A;  1WG0 A;  4N3B A;  4F6R D;  3DSS A;  4KZ0 A;  3QDN A;  3ZUV B;  3LVR E;  2VGX A;  3JCK C;  2GRN B;  3SFX A;  2P9K G;  4EBA A;  2C2L A;  1O5M A;  5LFA A;  1IQU A;  3RIB A;  3RRN B;  3B7T A;  3AAA C;  4GTV A;  4C9B B;  1WY6 A;  5AQ7 A;  4TXP A;  4CDM A;  3L16 A;  1N4S A;  2B6C A;  3ZXP A;  4IRU A;  2KXP C;  4I17 A;  4HFG A;  2WXH A;  2WQ6 A;  3NB2 A;  2ION A;  3AG3 E;  2R17 C;  4AY6 A;  3ESL A;  1LD8 A;  4BWR A;  1ELR A;  4GZD A;  3CK7 A;  5EID A;  3DSV A;  2Y4U A;  1SW6 A;  2IFU A;  1TNO A;  3B7R L;  5AEN A;  4A55 A;  1FT2 A;  3CGH A;  2DZN A;  3IV0 A;  4CGW A;  5KJK A;  2ZGD A;  3ABL E;  2WQ7 A;  4WNE A;  3CQC B;  3SBS A;  1DC2 A;  1K8K G;  3RKV A;  1KZP A;  3Q47 B;  2ZIR A;  2QFC A;  2AVP A;  4CT0 A;  3ZGQ A;  4FP7 A;  4ANW A;  1DNP A;  2XPI A;  1G3N B;  2AXV A;  5ENP D;  4F1S A;  1IHB A;  2MHK A;  3CR3 A;  1N4R A;  3CVY A;  1HX8 A;  4QFV A;  4FLB A;  4G25 A;  4OVV A;  3ZYL A;  1JWF A;  3B95 A;  1OCZ E;  4U04 A;  3ZHE B;  3ZNG A;  2IY0 C;  2UY1 A;  4EHM A;  1W3B A;  4UWG A;  3HHM A;  5HRY A;  3SD5 A;  4WND A;  5AAR A;  1N95 A;  3T9K A;  1MJ0 A;  3EHR A;  2ZU6 B;  1U3D A;  1ZBP A;  3JXJ A;  2WXM A;  3LKU A;  2WXO A;  2IU1 A;  2Y3A A;  3EHM A;  4BY6 A;  4UQY A;  4DJA A;  3QAQ A;  3WG7 E;  2YHE A;  3NBN B;  4UWH A;  1LTX A;  2KZT B;  3B13 A;  3NOC D;  5HI7 A;  3DEO A;  1TR4 A;  2NSZ A;  4JHJ A;  4DX1 A;  3JQ0 A;  2V4L A;  4G11 A;  1SA5 A;  1N4P A;  4XKC A;  2FO1 E;  1OWP A;  3CVP A;  3P1U A;  2I2O A;  2V5Q C;  1H6P A;  3CSF A;  5G04 C;  2J9Q A;  4XKB A;  2A4Z A;  4CDN A;  5EYP F;  3GZ2 A;  3FP3 A;  4Q94 A;  2H6F A;  4I6G A;  2GRM A;  4KBQ A;  4GTQ A;  3MYV A;  1QQE A;  4YVO A;  2ETA A;  3NOG D;  2J4B A;  1YCS B;  4G8K A;  1V54 E;  4N2Q A;  3ZVV A;  1H2T C;  3UMV A;  2QYU A;  3ULY A;  3QNK A;  3AS8 A;  4XX5 A;  3U64 A;  3L54 A;  1UJJ A;  2GRP B;  5CEC B;  3C3O A;  4GPM A;  5T8I A;  1OY3 D;  4IYP A;  5G05 C;  3LVQ E;  5JJT A;  2VSX E;  1KZO A;  4FAD A;  1FT1 A;  2JLB A;  4TUU A;  2P9N G;  2CFU A;  2M63 A;  2XZT G;  2Y69 E;  4ILI A;  4IN3 B;  3U3W A;  3RU0 A;  3PH0 C;  4GZ3 A;  4GB9 A;  1E8X A;  1NI1 A;  2WXF A;  3VLF A;  1ELW A;  2KCL A;  3KSQ A;  3S7J A;  2X6I A;  1LF8 A;  4HI9 A;  5A23 A;  3TWW A;  3SF4 A;  2XHE A;  1Z5S C;  2F0Y A;  2VTB A;  1NFI E;  2HE0 A;  4Q69 A;  2J8S D;  3IHY A;  1JPL A;  1E7U A;  3TWX A;  5EDS A;  3ZYM A;  4EBA G;  3SHF A;  2PM7 A;  5KJN A;  4XEI G;  3UIP C;  1QYM A;  1INZ A;  5H7P A;  4L2Y A;  1KPS B;  3ZYK A;  3SQV A;  3DSW A;  4I43 A;  4A3V A;  3HVE B;  3DBS A;  4HLL A;  5D66 A;  3QWW A;  4XIF A;  3CHO A;  4YDW A;  1HXI A;  2IO2 C;  2L9B A;  3ML8 A;  1KT0 A;  2BTD A;  3FH5 A;  2OEV A;  4RQI A;  4ANX A;  3L9T A;  5FIO A;  2I9C A;  4OVU A;  3S7D A;  5C1D A;  2WMO A;  4MS6 A;  3SBT B;  3S2A A;  3V31 A;  4Y6C A;  4CRW A;  4FA6 A;  2R5S A;  2R59 A;  4YDY A;  1UJK A;  2IQC A;  4CEM A;  1A5E A;  4L23 A;  3LXU X;  1HO8 A;  3CVV A;  2LUH A;  3G2U A;  5J08 A;  1MQS A;  2WXN A;  2E2E A;  4PS7 A;  1BPO A;  2WXL A;  4HI8 A;  2F37 A;  4JL0 A;  2XS8 A;  1Y8M A;  2QY7 A;  3OTN A;  2V4H C;  4I1A A;  4EQF A;  4DRX E;  4HB5 A;  4GTM A;  3T8K A;  4F53 A;  3I4R B;  3HXD A;  4F7A A;  4ATZ D;  2H6G A;  2LNI A;  3CKC A;  4I2W A;  3PNL B;  1MHQ A;  3IEG A;  4LEU A;  2WXJ A;  2P9L G;  1DVP A;  4ACK A;  4U7E B;  3FUN A;  1N4Q A;  3AS4 A;  5D0Q D;  5ENR D;  5ARG A;  3GYZ A;  3ABK E;  4A1S A;  1XNF A;  2YNQ A;  3QJZ A;  3D9O A;  3ASF A;  1IXV A;  3T8M A;  2CFZ A;  2WXK A;  3PZ4 A;  4OAU C;  1HF8 A;  3UXG A;  1NA0 A;  1SQM A;  4L2L A;  5T3R A;  3FU0 A;  4ZFH A;  4BTA A;  2ZGG A;  3MKQ A;  3AG2 E;  3LYA A;  1SZ9 A;  3JXI A;  4MKT A;  2OCC E;  4GPK A;  1E90 A;  3O48 A;  5AQA A;  4GTT A;  3ZKJ A;  3CHS A;  1JUQ A;  2WMN A;  3R9A B;  2LO6 A;  3CVU A;  2XGS A;  4LNU D;  2NXP A;  1WAO 1;  1TEZ A;  3OXF A;  3UT4 A;  2HYZ A;  4U96 D;  4HOR A;  2L0I A;  4KYO B;  3W9G A;  1H2U A;  4GTO A;  2XRZ A;  2OND A;  3UX4 A;  5FJY A;  3LEW A;  4J8Y A;  2VSO E;  4WUY A;  4MLP A;  4HOQ A;  3B7B A;  1Q2Z A;  2MRI A;  4KT6 B;  1JCS A;  2WXI A;  2RFA A;  5FT9 A;  3IBE A;  5BXO A;  4UI9 C;  4KZC A;  5FZQ A;  5KNH D;  2EQX A;  3FUI A;  2LAI A;  4P29 A;  3DRA A;  3MV3 B;  4UI9 K;  2J4D A;  2AXZ A;  2R02 A;  3QWV A;  3CHR A;  3ZEF A;  2IEJ A;  1FCH A;  5DBK A;  3LY9 A;  5CCL A;  4CZ2 D;  4D10 C;  2BKK B;  3FEX A;  4XE0 A;  2J08 A;  1HFA A;  1NP7 A;  5BV1 A;  1E8Y A;  1TJC A;  1MX6 A;  3FU3 A;  3CVW A;  4J7W A;  1IQR A;  3C3Q A;  4NUR A;  4AIF A;  3HXE A;  2LXL A;  4GMJ A;  4GAA A;  4HRN A;  5A7D B;  4BER A;  5E76 A;  3Q79 A;  2P9S G;  2QZA A;  3L17 A;  4N5C A;  1OWM A;  4GA2 A;  2J09 A;  5ENO D;  3K9I A;  3D9M A;  4H7X A;  4ATG A;  3ONK A;  4PS3 A;  1HS6 A;  2GGF A;  4FUL A;  3R7Q A;  5CMY A;  3VLD A;  3HIZ A;  3PS6 A;  4GML A;  2BED A;  2XPZ A;  3B7U X;  3RK6 A;  3U66 A;  1OXJ A;  4BT9 A;  3ZFW A;  2BUG A;  5BT1 A;  1S63 A;  4HS2 A;  2YIN A;  4YND A;  4JD2 G;  4DX7 D;  5FQ4 A;  2GRL A;  5BW8 C;  4AM9 A;  1O1R A;  1O1S A;  3CIA A;  3FEY A;  2X6F A;  2F8X K;  3S7F A;  3CHM A;  2DBA A;  1AP7 A;  4GTR A;  3D9P A;  4AVX A;  4CGV A;  5ANL A;  2YHC A;  1MYO A;  3DSU A;  1EF1 C;  3FUL A;  4FLH A;  3OXG A;  3TWV A;  3BQO A;  1TN8 A;  2L6J A;  1JCQ A;  3O4Z A;  4CYM D;  5ITZ F;  3RRU A;  3E37 A;  3FUM A;  5LCW C;  4YVQ C;  3DWL G;  3FUD A;  3ZIM A;  4ILH B;  2IJG X;  1H2V C;  3JQ1 A;  4XZ4 A;  2A5U A;  2QC9 A;  3FWV A;  4JHR A;  1SA4 A;  3HRA A;  4CDR A;  3TJP A;  4N2S A;  2X6J A;  3SZ7 A;  2XGM A;  3PE3 A;  4WNF A;  1D8D A;  2NC9 A;  3AU4 A;  2C0M A;  2RFM A;  4X8Q A;  1AWC B;  1ZB1 A;  2YQ8 A;  5CRU A;  1NA3 A;  5CER B;  2GRO B;  3UTM A;  2I1K A;  2DYR E;  1HE8 A;  2VJ8 A;  3MJW A;  1L5J A;  4HRM B;  2LAH A;  4DI4 A;  3FUH A;  4LRZ A;  4K03 A;  3D9J A;  2FO7 A;  4A1G A;  4CT4 A;  3CHQ A;  3MV2 B;  3E34 A;  3ONL A;  5CED B;  3ZHE A;  3FTS A;  4U8Y D;  5CMW A;  2WVI A;  2DCP A;  4GTS A;  4WWN A;  2H6H A;  4TXR A;  2EIN E;  1EDU A;  4JHK A;  3VTY A;  4LNG A;  1NL4 A;  4ZHB A;  4UWL A;  4JC8 A;  4Q96 A;  3GW4 A;  5ANR A;  2EIK E;  4J8D A;  3EJN A;  5CRV A;  1YYH A;  4I9E A;  1E96 B;  2MYO A;  3RAU A;  4U0S A;  4U63 A;  1IYG A;  4GZ5 A;  2ZIS A;  1XGW A;  5G04 J;  3D9L A;  5EIB E;  3PRE A;  5IY5 E;  4J6I A;  3FY4 A;  2KZT A;  4FU3 A;  1N9A A;  3UM3 A;  3DPY A;  4NQ0 A;  1Z3X A;  4U0U A;  1X5B A;  3E33 A;  3IXE A;  1Z6T A;  4V3I A;  3CV0 A;  3U4T A;  4EZJ A;  3EHQ A;  3HXB A;  4B8A A;  1NZN A;  2I6H A;  3Q4A B;  1DCQ A;  4U95 D;  5BPP A;  4IUL A;  2LSV A;  3JUE A;  3BEE A;  1BLX B;  3HDX A;  3QAR A;  4GZ6 A;  1TYQ G;  4H7Y A;  4N3A A;  5BUZ A;  3LJN A;  5CHE E;  4L1B A;  1H6O A;  5ARF A;  4HXI A;  2HO1 A;  1FPP A;  4O6F A;  1HU3 A;  2R03 A;  5B1B E;  3ZW3 A;  3TWR A;  2XEE A;  3TXM A;  5G05 J;  5HKP A;  5FZR A;  3SNX A;  4FHK A;  3PZ2 A;  4ANU A;  1Y6I A;  4UUC A;  3ESK A;  3URZ A;  2ZXW E;  2P9P G;  3DSX A;  3ZN3 A;  3EIJ A;  4ANV A;  3N71 A;  2OEW A;  1MX4 A;  3R9M A;  2P9I G;  4DLQ A;  3BG0 B;  4BES A;  4ME2 A;  2KAT A;  4UWF A;  2OOE A;  4I6J A;  3G2T A;  2DWZ A;  2Y4T A;  1EPU A;  3L6A A;  4KMO A;  3FUK A;  1H6K A;  5KBA A;  3LPZ A;  3V30 A;  2ETC A;  1E8W A;  3Q7A A;  1FVF A;  4E6H A;  2DIW A;  3TWU A;  1IKN D;  3PNT B;  2EIM E;  4I1O B;  5ENT D;  3V2O A;  2XS1 A;  5LP0 A;  4CCA A;  3FTV A;  4GTP A;  2WPV A;  5ENS D;  4J8F A;  1SVX A;  3TWT A;  2PQR A;  4RSY A;  2DVW A;  4AOF A;  3HG0 D;  3JYS A;  4APF A;  2WM9 A;  1VDY A;  2WXQ A;  3Q75 A;  4G26 A;  3GZ1 A;  5A6C A;  4BTB A;  1OWN A;  1S70 B;  3ASN E;  2IOL A;  4DPR A;  3OXL A;  4HLE A;  4HOU A;  3DST A;  4JEH A;  4GCN A;  4YDE A;  3HVE A;  5EKQ D;  4TV3 A;  3D3M A;  4A3T A;  3DXM G;  1PC2 A;  5JMN D;  3FTY A;  5G2N A;  3AU5 A;  3PZD A;  1BD8 A;  2VGX B;  4U8V D;  4DK5 A;  1O1T A;  4AP2 A;  4HVB A;  3FUJ A;  3APF A;  4QQI A;  4RG9 A;  1Z3Y A;  2BKG A;  2FBN A;  4AY5 A;  4J8S A;  4UQX A;  1OWO A;  1PY1 A;  2KCV A;  5J90 A;  2XRY A;  4O60 A;  1HZ4 A;  1RW2 A;  3UKU G;  3Q78 A;  5JA4 D;  3E30 A;  3VLE A;  3EHN A;  4LSZ E;  4HNA D;  4WWO A;  1X81 A;  5KJL A;  4EEC A;  4DUI A;  4NIK A;  3FTZ A;  5AAO A;  4WAF A;  3BG1 B;  5EN5 D;  2GRQ B;  3D9H A;  4FJY A;  4KXK B;  3ABM E;  3I4G A;  4BET A;  2HM8 A;  5G55 A;  4GCO A;  4AEZ C;  4O1O A;  2CG3 A;  1OCO E;  2RG8 A;  3NZU A;  1K3Z D;  1TNU A;  4KVO A;  2IF4 A;  3PVL A;  4DX2 A;  2FI7 A;  2V5F A;  3MKR A;  2RD0 A;  2IOS A;  4PUC A;  3ZU7 B;  3ZXS A;  3C5R A;  5KCM A;  3Q49 B;  3G2V A;  4GMR A;  2L0T B;  2LSU A;  4GYY A;  4I9C A;  1YA0 A;  3LY7 A;  2J49 A;  4PDX A;  3PZ3 A;  2XEV A;  1QBQ A;  3AJI A;  4RVB A;  3PE4 A;  4ABN A;  3AS5 A;  5EX3 A;  1WDY A;  2C0L A;  2XEH A;  2E0I A;  4WWP A;  2WXR A;  3FTU A;  2PL2 A;  1P5Q A;  2X3M A;  2MOW A;  4JVS A;  2WQH A;  3SGH A;  4M3O A;  3UPV A;  3QC1 A;  3FFL A;  5DIZ A;  4G23 A;  1N52 A;  2UY1 B;  3PDN A;  4Z68 A;  4DX6 D;  1TNY A;  4UWK A;  4KVM A;  3ENE A;  5BV0 A;  1QZ2 A;  2OVF A;  4DLO A;  2XEN A;  1K1A A;  2R05 A;  3FUF A;  1N0R A;  4MBG A;  3CVQ A;  2CHZ A;  4O1P A;  4UI9 J;  1E8Z A;  4K5B A;  5FTP A;  2KBX A;  4BX9 A;  3APD A;  1D9S A;  2WXP A;  5FWQ A;  1UN8 A;  3I3N A;  3KEZ A;  1UG3 A;  4ACL A;  1UW4 B;  3ULE G;  4LNB A;  4NRH B;  1S0P A;  5T4Y A;  4OAV B;  5AN8 A;  5ENN A;  2VSN A;  3C98 A;  4C48 B;  5AYW D;  2KC7 A;  3FU5 A;  3QK0 A;  3Q9U C;  1IHG A;  1KT1 A;  1A17 A;  3UM1 A;  1OCR E;  2Y1L E;  1S64 A;  5C2Y A;  3EUV A;  3CLJ A;  3AG1 E;  5E75 A;  3TAX A;  2R2L A;  4B93 B;  3CK8 A;  5HQ8 A;  3MX3 A;  5BNW A;  3E32 A;  3UIO C;  1TN6 A;  4GYO A;  4GA0 A;  1E7V A;  4G2V A;  5HS0 A;  3Q15 A;  1TNB A;  5EYL A;  1K1B A;  2XGO A;  2ILR A;  4R7L A;  4TXQ A;  5D0O D;  2JAB A;  4N39 A;  4DI3 A;  3FHE A;  4B8C B;  5FQ6 A;  4U8H A;  3RSE G;  4B89 A;  2AXU A;  3QKY A;  4HBD A;  3OAW A;  3RRM B;  3ZRH A;  3CVN A;  3BUA A;  1YMP A;  3NZS A;  2AJA A;  2RKK A;  5B3S E;  3ZYQ A;  2X6H A;  1B89 A;  2A5E A;  2V8S E;  2CG2 A;  3B7S A;  1N11 A;  1EYH A;  4BT8 A;  4HQD A;  3AG4 E;  3DEP A;  2IO3 C;  2VQ2 A;  3TXN A;  4FJZ A;  4K0R A;  3Q7F A;  3PRZ A;  4JEU A;  2H6I A;  2QYJ A;  3V79 K;  3NQP A;  1N54 A;  1H19 A;  2VGY A;  3FH8 A;  4BSZ B;  3EU9 A;  4NAC A;  5AQ9 A;  3PEU B;  4LG6 A;  1BU9 A;  2FEZ A;  3EU5 A;  3UT7 A;  1ZU2 A;  5D2M C;  3CVL A;  3FU6 A;  3ASO E;  2VTB B;  3ASG A;  3EIQ C;  1UN9 A;  5KNG A;  3C72 A;  2L6B A;  4GU5 A;  2XQ0 A;  3EDT B;  4BSX A;  2XCB A;  2BF0 X;  4HOT A;  3SFY A;  4K5C A;  5LCW J;  2P2C P;  3CST A;  3HYM B;  3MA5 A;  4FC8 A;  1QNF A;  3RJV A;  3L13 A;  4FHJ A;  4I1M A;  3FTX A;  4L7T A;  4OYS A;  2FUL A;  3RO2 A;  4JZY A;  4W9R A;  3D9N A;  3L82 A;  4B94 A;  2EIL E;  4LUN U;  3Q73 A;  3MCX A;  3ML9 A;  3CK9 A;  1U3C A;  2J07 A;  2VGE A;  5AJL A;  3E4B A;  4F3V A;  3P2B A;  4LCT A;  3TG5 A;  1TJF A;  1N94 A;  3J5P A;  5KJM A;  5CCM A;  3G2S A;  4URK A;  2X38 A;  2KM4 A;  2I1J A;  1HG5 A;  5BXU A;  1U2V G;  3S7B A;  3KAE A;  3BU8 A;  2AW6 A;  1TNZ A;  3L22 A;  3SI5 A;  3UM0 A;  4L9P A;  5CEA A;  3CEQ A;  3QOU A;  3LCA A;  3KSL A;  4M7C A;  3HXF A;  4BEP A;  4EZK A;  4RLY A;  4XI9 A;  3LJ3 A;  2V0P A;  3TG4 A;  2HR2 A;  5AIJ A;  1OWL A;  1OCC E;  3IHV A;  4JA7 A;  2FF4 A;  3KEA A;  3T5X A;  4EZL A;  4WNG A;  2P58 C;  4U0Z A;  4YDO A;  2LXM A;  3QB2 A;  3UIN C;  4TRQ A;  5EIL A;  5JHA A;  5M72 A;  5JJ6 A;  3SY2 A;  3FH7 A;  2XPY A;  5EX0 A;  2XCC A;  4LER A;  2Q7F A;  4GZC A;  3DPD A;  1ELK A;  3PZ1 A;  2PZI A;  1TN7 A;  4I6E A;  1SZA A;  4A63 B;  2Y0B G;  3JUI A;  3ZPJ A;  3C3R A;  2DYS E;  2CHX A;  4DX5 D;  1HG2 A;  1BI7 B;  5FQ8 A;  1OT8 A;  2OV8 A;  5KWD A;  3CQG B;  1JWG A;  5JHB A;  4MRU A;  4AXH A;  3Q9N C;  5LX8 A;  1HH8 A;  3MEK A;  4PS8 A;  4GA1 A;  1KLX A;  3KD7 A;  3D9I A;  3FDH A;  3G2W A;  2DZO A;  3UUX A;  3MKQ B;  3ASH A;  4UQZ A;  4Y6W A;  2B0O E;  5CBO A;  4AV7 A;  5JJ7 A;  3PUJ A;  4JW1 A;  3TWQ A;  1FVH A;  1UOH A;  3LY8 A;  1LD7 A;  5B1A E;  2UWJ G;  1PAQ A;  4N3C A;  2PNN A;  4N5Q A;  2PM6 A;  3KS2 A;  3IKO B;  2VSY A;  3T5V A;  2XZD G;  1RZ4 A;  3DXK G;  3I5P A;  4BX8 A;  3CKB A;  4EPZ A;  2EIJ E;  3ISM C;  3D9K A;  4G8L A;  4B0Z A;  4J8E A;  1MZC A;  1N0Q A;  3V2X A;  4JB8 P;  3R7R A;  2AWI A;  2P9U G;  2VYI A;  1BI8 B;  3VTX A;  3U9W A;  2GW1 A;  4G1T A;  3CVX A;  1JCR A;  2NYJ A;  5AJD A;  3UKR G;  1WM5 A;  1OUV A;  3SO8 A;  3ASD A;  3NAW A;  2X6K A;  4ILG A;  4F1P A;  5AQB A;  3UM2 A;  3NF1 A;  3APC A;  4PH4 B;  3TL5 A;  2OVB A;  3ULQ A;  1V55 E;  3FUE A;  5ENQ D;  1H0A A;  3UT8 A;  4JA9 A;  4G24 A; 
#chains in the Genus database with same CATH homology
 5HRY A;  4YDW A;  5KNH D;  2QYJ A;  3V79 K;  2B0O E;  3TWR A;  1S70 B;  1D9S A;  5AAR A;  5CEC B;  5CBO A;  3T9K A;  1MJ0 A;  3EHR A;  2XEE A;  4BSZ B;  4GPM A;  5HKP A;  3EU9 A;  1OY3 D;  4DX2 A;  5FIO A;  5CEA A;  3JXJ A;  3TWQ A;  3W9F A;  1IXV A;  4DX7 D;  4OAV B;  5AQ9 A;  5AN8 A;  3J5Q B;  3V31 A;  4LG6 A;  3TWS A;  5CED B;  3F6Q A;  1UOH A;  3ZU7 B;  1BU9 A;  4UUC A;  5EID A;  3C5R A;  4C48 B;  4OAU C;  5FIN A;  4BEP A;  4RLY A;  2ETB A;  2XZT G;  4U8Y D;  1SW6 A;  3Q9U C;  2PNN A;  3UXG A;  4GMR A;  2F8X K;  4YDY A;  5JMN D;  1AP7 A;  3NBN B;  2Y1L E;  4ZFH A;  4N5Q A;  1A5E A;  4CZ2 D;  1BD8 A;  2BKK B;  5KNG A;  4U8V D;  1MX2 A;  2ZGG A;  3NOC D;  5CBN A;  4ZHB A;  3KEA A;  1MX4 A;  1MYO A;  2L6B A;  3JXI A;  2DZN A;  3DEO A;  1TR4 A;  4B93 B;  4TUM A;  4BES A;  3AJI A;  2XZD G;  5AQA A;  3TWV A;  4K5A B;  2ZGD A;  4QQI A;  1MX6 A;  3ZKJ A;  5ITZ F;  4CYM D;  2BKG A;  4J7W A;  5EIL A;  4DX1 A;  1YYH A;  4K5C A;  2DWZ A;  2P2C P;  1DC2 A;  1WDY A;  4G8L A;  4HI8 A;  2F37 A;  4HI9 A;  2XEH A;  2MYO A;  4HRL A;  2V4H C;  1N0Q A;  3V2X A;  4JB8 P;  5KBA A;  3TWW A;  2F8Y A;  5HS0 A;  3UI2 A;  1WG0 A;  4O60 A;  5EYL A;  1K1B A;  1NFI E;  2HE0 A;  2QC9 A;  3V30 A;  2FO1 E;  4F6R D;  4DRX E;  5JA4 D;  2ETC A;  4HB5 A;  2V5Q C;  2J8S D;  2JAB A;  5EIB E;  3HRA A;  3T8K A;  4LSZ E;  3ZUV B;  4HNA D;  4HRN A;  1G3N B;  5ENP D;  3TWX A;  1BI8 B;  4LNU D;  3TWU A;  4BER A;  1IKN D;  5EYP F;  4A63 B;  2Y0B G;  1IHB A;  4DUI A;  4Z68 A;  2NYJ A;  4NIK A;  1QYM A;  4ATZ D;  5ENT D;  4DX6 D;  5AAO A;  4HBD A;  3V2O A;  3SO8 A;  2RFM A;  4U96 D;  1YMP A;  3IXE A;  4DX5 D;  2AJA A;  1AWC B;  5ENO D;  1BI7 B;  5EN5 D;  3W9G A;  2VGE A;  4QFV A;  3AAA C;  5CER B;  1OT8 A;  3EHQ A;  3UTM A;  4F1P A;  5KWD A;  2XEN A;  3D9H A;  5AQB A;  1K1A A;  2A5E A;  4J8Y A;  5ENS D;  5AQ7 A;  1DCQ A;  3B95 A;  1SVX A;  3Q9N C;  4BET A;  1N0R A;  2ETA A;  3B7B A;  4U95 D;  3TWT A;  3NOG D;  2DVW A;  1N11 A;  1YCS B;  2RFA A;  3J5P A;  4G8K A;  4O1P A;  3JUE A;  3HG0 D;  4HLL A;  4HQD A;  2DZO A;  1BLX B;  5ENQ D;  4HRM B;  3DEP A;  2KXP C;  4O1O A;  5D66 A;  5ENR D;  5BXO A;  4K5B A;  3ZNG A;  3LJN A;  1K3Z D;  5BXU A;  2KBX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...