4QQIA

Crystal structure of ankra2-rfx7 complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
176
structure length
176
Chain Sequence
LYFQGSTTPLLANSLSVHQLAAQGEMLYLATRIEQENVINHTDEEGFTPLMWAAAHGQIAVVEFLLQNGADPQLLGKGRESALSLACSKGYTDIVKMLLDCGVDVNEYDWNGGTPLLYAVHGNHVKCVKMLLESGADPTIETDSGYNSMDLAVALGYRSVQQVIESHLLKLLQNIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Ankyrin repeat family A protein 2
publication title Ankyrin Repeats of ANKRA2 Recognize a PxLPxL Motif on the 3M Syndrome Protein CCDC8.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2014-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
A PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4qqiA00
1BI8B 4BESA 1IHBA 4RLYA 2MYOA 4OAVB 3W9GA 2B0OE 4TUMA 1TR4A 4ZFHA 5ITZF 1SW6A 2F8YA 3J5QB 5EN5D 2DVWA 4BEPA 2V4HC 4DX5D 4BETA 3V31A 2XENA 5AQAA 2DZOA 3SO8A 4G8LA 5CERB 3V30A 3Q9NC 2P2CP 5KWDA 3V79K 4QQIA 4U95D 2J8SD 5AARA 4O1PA 3TWVA 1YCSB 4QFVA 5KNGA 4O1OA 1BLXB 4ZHBA 5HS0A 5CEDB 4DX1A 5AN8A 2V5QC 3DEOA 1MX4A 1BU9A 2RFMA 4CZ2D 3HG0D 4GPMA 1BD8A 3V2XA 1YYHA 2QC9A 1AWCB 3HRAA 1K3ZD 4HRMB 1QYMA 1WDYA 2ETCA 4K5BA 2PNNA 5EYLA 4HRLA 4CYMD 3W9FA 5CBNA 3TWWA 3T8KA 3ZUVB 2ZGGA 1MX6A 3TWSA 4HI9A 3ZKJA 3TWQA 1N0RA 4B93B 2NYJA 3D9HA 3UTMA 4DX6D 2XEHA 5HRYA 5ENOD 1AP7A 4F1PA 4NIKA 4ATZD 5KBAA 2BKKB 3LJNA 5BXUA 3B7BA 4JB8P 5ENPD 2RFAA 4HBDA 2A5EA 5AAOA 3JXJA 1DCQA 4HRNA 3NOCD 4G8KA 1OT8A 3C5RA 4U96D 3TWTA 1DC2A 2JABA 4HB5A 4N5QA 4GMRA 5D66A 4F6RD 4DUIA 1N0QA 4A63B 4Z68A 4LSZE 3TWXA 1YMPA 2Y0BG 4BERA 4DRXE 1SVXA 5ENTD 5EIBE 2FO1E 2VGEA 4HQDA 1WG0A 3V2OA 2DZNA 5ENQD 4HI8A 5FINA 3IXEA 3ZU7B 4U8YD 2Y1LE 5CEAA 5AQ9A 2L6BA 4LG6A 5EILA 4O60A 5EYPF 1A5EA 1MJ0A 5BXOA 3EU9A 4HLLA 4LNUD 5JMND 3TWUA 1IKND 3Q9UC 4UUCA 4YDWA 1OY3D 2DWZA 3T9KA 1D9SA 5ENSD 3KEAA 2KXPC 3JUEA 4K5CA 4HNAD 4DX7D 5CBOA 4U8VD 1MYOA 3ZNGA 3TWRA 1S70B 1K1AA 2XZTG 3AJIA 3NBNB 3AAAC 2HE0A 1IXVA 2XEEA 4K5AB 2F37A 2F8XK 1G3NB 2BKGA 3NOGD 5AQBA 4BSZB 2AJAA 3EHQA 2KBXA 4J7WA 1N11A 3UXGA 3F6QA 5AQ7A 4DX2A 3J5PA 4OAUC 5ENRD 2ETAA 2ZGDA 5HKPA 3JXIA 3UI2A 5FIOA 1MX2A 5CECB 3DEPA 4J8YA 2XZDG 2QYJA 4YDYA 3B95A 3EHRA 1K1BA 1NFIE 5JA4D 1BI7B 1UOHA 2ETBA 4C48B 5EIDA 5KNHD
chains in the Genus database with same CATH superfamily
3QWWA 2IO2C 3W9GA 1UJJA 3PVLA 5M72A 4BEPA 1TNOA 1HU3A 4GCNA 5BW8C 2WB2A 4A1SA 4KXKB 3TJPA 3DSSA 5BV0A 3PEVB 3APCA 4XZ4A 1N94A 2AXZA 2RKKA 4N2QA 1AWCB 1RZ4A 3S2AA 3FEYA 4K5BA 4CDNA 3PZ4A 4EZKA 3W9FA 4UI9K 3S7DA 4M7CA 4Y6WA 4DJAA 1VDYA 3MKQB 2R5SA 4KVMA 2FI7A 2RFAA 5FTPA 3SY2A 3KSLA 1KPSB 4U96D 5ANLA 2E2EA 4B89A 1O5MA 4UWGA 3CSTA 3TAXA 5ENTD 2KC7A 3UM0A 3Q7FA 1NA3A 3ASGA 3R9AB 2L6BA 4I17A 4FU3A 4JVSA 1Q2ZA 3DBSA 3CVLA 1MZCA 4JA9A 3IBEA 5KJNA 2X6HA 4GPKA 3HXCA 2EIJE 3C72A 4XKBA 5ANRA 3NBNB 2J08A 3MKRA 1G3NB 3ZPJA 2XGOA 4EQFA 4BTAA 5ENRD 3CVUA 5DBKA 3CHRA 3Q15A 1TN6A 3U9WA 3ABLE 4GTMA 3L9TA 1SQMA 1H6PA 3ML8A 3HVEA 2VQ2A 3ULYA 3CHPA 3SQVA 4HOUA 1YYHA 2YNQA 2VJ8A 4AY5A 2ETCA 3AG3E 1QNFA 3ZKJA 1OUVA 3SFXA 4AP2A 3LJ3A 1OXJA 1Z3XA 4F1PA 2P9IG 2J4BA 4HB5A 5D66A 1N4SA 3CVYA 2P9LG 4GTOA 3G2VA 4A55A 1OY3D 2OVBA 1HG5A 5G04C 3ULQA 2P58C 2FEZA 2R03A 2F8XK 2L6JA 3LXUX 4PUCA 4JZYA 2KBXA 2P9SG 5ARGA 1Y6IA 3LKUA 2GRMA 4G24A 2KZTA 4YDYA 2QYJA 4TV3A 1A17A 1E90A 4JHRA 3MZLB 3P1UA 4BY6A 4J6IA 4CT4A 3V30A 4QQIA 2LXLA 2IOLA 3UUXA 3EU5A 5CMWA 4UQZA 4AOFA 4URKA 4M3OA 1MX4A 3PREA 4ILGA 5T4YA 2YHCA 2QC9A 5BT1A 4NURA 3SD5A 2P9NG 3I4RB 3FWVA 3ZUVB 1EYHA 3UT7A 1FPPA 1MX6A 3Q7AA 3DPYA 2XCCA 3I5PA 4J8EA 4G11A 1FCHA 1AP7A 2HYZA 1OCRE 2EINE 1N4PA 2J09A 2VGXA 3T5XA 3FEXA 5CRVA 4JPSA 2XPYA 1Y8MA 3FUEA 1E7UA 3QDNA 4GTRA 2P9UG 4HI8A 2Q7FA 4LNBA 2PL2A 3TG5A 4UUCA 3APDA 2E0IA 4F3VA 2BUGA 2XZTG 3AJIA 4OYSA 4Q94A 2XPZA 2A4ZA 2FF4A 2XEEA 1HXIA 1ELKA 2ILRA 5AQBA 2FULA 5AQ7A 3DSUA 4FLBA 4MRUA 4D10C 4XI9A 1TNYA 4AEZC 1QBQA 4C48B 4HS2A 4Z68A 2L0IA 1P5QA 3LVQE 1KLXA 4JHJA 1ZU2A 2KZTB 3LVRE 3RKVA 5KJLA 3V79K 1N9AA 2VSYA 4OVUA 4DX1A 3U3WA 3RK6A 2C0MA 4IYPA 4UI9C 4HOQA 1BD8A 2WVIA 1OWNA 4OVVA 4UQYA 4EZLA 3TWQA 3UM1A 2NYJA 1OWLA 1OWMA 4CDMA 1KZPA 3AG4E 2XRZA 3DSTA 4GMLA 1IYGA 2ZU6B 5FQ6A 1DNPA 2LUHA 3E34A 3L22A 5KCMA 1DVPA 2VGXB 5D0QD 1UN9A 2JEKA 2L9BA 5CEAA 5EYPF 4E6HA 4LNUD 1X5BA 4DLQA 3HHMA 1IKND 4JA7A 1D9SA 3UKUG 3CLJA 4F1SA 4J0UA 4FHKA 1K1AA 4RQIA 5BNWA 2I9CA 2VTBA 4I1MA 4PS7A 3GW4A 3FUDA 1U3DA 3DEPA 2Y3AA 1S0PA 2WXKA 2WXHA 1BI7B 3NB2A 4TUMA 3PDNA 4G25A 4EZJA 4U0UA 2C0LA 2NC9A 3PNTB 5HS0A 4U8HA 1K8KG 3Q78A 4WNGA 4U0SA 3D9MA 3NF1A 3EHMA 3SZ7A 3SBSA 1XNFA 2PNNA 5A23A 3T8KA 3CK9A 3ONKA 2KCKA 3HXFA 4JL0A 2PQRA 5LX8A 3MV3B 2I6HA 4J8SA 2X3MA 5ENOD 4EHMA 4NIKA 3RO2A 3C5RA 2XRYA 4N5QA 4ACLA 1HH8A 4JXTA 4GTQA 4GA2A 5KJMA 3V2OA 1N4RA 3JYSA 3QJZA 1JWGA 3T5VA 3CHQA 3QOUA 2EIKE 4YNDA 1OCOE 2A5UA 1ZBPA 3CQGB 2I1KA 2QYUA 2X6JA 1S70B 2MRIA 3CHSA 4JEUA 2XCBA 3DRAA 4WUYA 3GZSA 5FIOA 4JHKA 1UOHA 3VLFA 5FQ8A 3NQPA 4G2VA 2F8YA 3J5QB 4DX5D 3V31A 3FHEA 4GCOA 3DSVA 2OV8A 4O1PA 2VGYA 2GRQB 3TWVA 4EBAA 5CRUA 3CVWA 1BLXB 4RSYA 3B7UX 5D0OD 3HG0D 3TG4A 5G2NA 3V2XA 4IULA 3HXEA 5LCWC 1TN7A 4B94A 2OEWA 3B7RL 4YDOA 1B89A 2IEJA 2WXJA 2H6FA 2LSVA 3MJWA 2DIWA 4WWNA 4B93B 4IN3B 2RD0A 4BT9A 4MLPA 3E33A 3ENEA 5EX3A 3QC1A 2EQXA 2ZISA 3NOCD 3Q79A 4WAFA 3OXGA 4KMOA 4N3BA 4GTVA 2VGEA 4HQDA 1WG0A 2Y1LE 4O60A 4XIFA 2MHKA 5BXOA 3EU9A 3FUMA 2R17C 1LD8A 3ABME 4HXIA 5BPPA 3FU0A 2KXPC 5CBOA 1O1TA 3AAAC 3Q49B 3AG1E 3RRNB 3HDXA 5DIZA 5G05J 3NZSA 3UM3A 2ZGDA 1KZOA 3D9PA 2YQ8A 3PNLB 3B95A 2PM7A 3QKYA 4I43A 5EIDA 2AXUA 4K0RA 4BETA 1PY1A 3KSQA 4NQ0A 2DZOA 3LY7A 4GYYA 3FUKA 3HIZA 3EIQC 3QWVA 4J8DA 1SA5A 1TNUA 3DSXA 3L16A 2WQ6A 1TEZA 3AS4A 2MOWA 1HG2A 3UPVA 2WXIA 2QY7A 3TWWA 1S63A 4HI9A 3SFYA 3PZ1A 3D9HA 3CIAA 3EJNA 4BFRA 4UWLA 4N3AA 3JXJA 4H7YA 4G8KA 5IY5E 3ASHA 4JW1A 4A63B 3LPZA 1TYQG 4MS6A 2H6HA 4CEMA 3RRMB 2IJGX 2PQNA 3PUKA 1U2VG 4DPRA 3JUEA 1LF8A 3B13A 1O1RA 3CVNA 4L2LA 3EHQA 5BUZA 1HZ4A 1JCRA 5CECB 4J8YA 5B3SE 3FH7A 3FH5A 3IHYA 1ELWA 1NFIE 3U4TA 3N71A 4RLYA 1TR4A 1SW6A 3UINC 4HORA 2WQHA 2CG3A 3PZ3A 4LRZA 2P9KG 3FU3A 3QK0A 2GRRB 3RU0A 1YCSB 2BF0X 2V5FA 3L82A 4PDXA 2WXPA 3OAWA 3ASNE 2P9PG 3LEWA 3C98A 3BQOA 3CGHA 4NACA 4CGVA 1KT1A 4HRLA 3MGBA 3ZIMA 3MV2B 4TXPA 2XS1A 4AV7A 2WM9A 4DX6D 4GZ6A 3BG0B 3OTNA 5LP0A 3ZN3A 1JCSA 2RG8A 3VLEA 3IKOB 2DYRE 5E75A 3TWTA 1SA4A 2UY1A 1OWPA 3EDTB 1JCQA 2DZNA 5ENQD 3VTXA 4TXRA 4BX9A 3DPDA 1WM5A 1OWOA 3OXFA 2IY0C 4LNGA 4XEIG 3E32A 4W9RA 1MHQA 3CQCB 4BX8A 3PH0C 4I2ZA 2IOSA 2WXRA 4ILIA 3FTUA 2X38A 3SF4A 3TL5A 2ETBA 4BESA 1FT2A 2F0YA 5J90A 3FTYA 3S7FA 4HVBA 3C3OA 3RO3A 3VLDA 3FTXA 3WXXA 5AENA 2XHEA 3FUFA 2WXOA 4O1OA 3LY9A 2CHXA 1U3CA 1H0AA 4B8AA 3U66A 3LS8A 2DBAA 4CCAA 3FDHA 3E4BA 2CFZA 2XS8A 4AJWA 5EYLA 1TJCA 2IFUA 2V0PA 2I2OA 1JWFA 2HM8A 3UT4A 4B0ZA 1OCCE 2IF4A 3AG2E 1HX8A 2KCVA 3D9IA 2OVFA 4UWFA 2GGFA 4XI0A 2LAIA 2DCPA 1O1SA 4FJZA 1EDUA 2GROB 2X6IA 4DUIA 3FUIA 3IHVA 3TWXA 3CV0A 1NL4A 2XGSA 4GTTA 3AU4A 4AIFA 1MQSA 4HLEA 2UY1B 3G2WA 1PC2A 3CHMA 4I9CA 4ATGA 4FADA 4Q69A 4RVBA 3ZNGA 4GYWA 2OEVA 3PUJA 3O48A 5CHEE 2R02A 2BKGA 3K9IA 5FT9A 2LO6A 1HO8A 1N11A 4DX2A 4O6FA 2XPIA 3UI2A 4FA6A 3NZUA 3FFLA 4WNDA 5KNHD 1E96B 3KEZA 4ZFHA 2H6GA 2VSNA 3JUIA 3ZW3A 1Z6TA 5A7DB 1Z3YA 3DSWA 4FC8A 2HO1A 3L6AA 3UX4A 4GZ3A 2WMNA 4JEHA 5LOZA 5CEDB 3QAQA 2V5QC 5EKQD 4N5CA 4X8QA 3CVQA 3UMVA 3PEUB 5CBNA 4LUNU 3ESKA 1NA0A 3L08A 3ASOE 5BXUA 3B7BA 1EPUA 2YINA 1LTXA 2WMOA 4I9EA 4UQXA 1OT8A 4N39A 4LEUA 4DRXE 4WNEA 2FO1E 3HXBA 3ZU7B 5AQ9A 4LG6A 3TXNA 3C3QA 3APFA 3QWPA 3DXMG 3LCAA 4RG6A 2IQCA 5FQ7A 3C3RA 3MCXA 4HNAD 2GRPB 4Q96A 3RAUA 4YVQC 2HE0A 4N3CA 3HXDA 3BUAA 3P2BA 4ANUA 3F6QA 3ZYMA 3J5PA 1GW6A 4TXQA 3D9OA 5JA4D 4G1TA 4OAVB 1V55E 3HYMB 4MKTA 4A1GA 2AXVA 2R2LA 3ZVVA 2V4HC 5AYWD 1KT0A 5AQAA 1E8WA 4G8LA 4CRWA 3EIJA 2V4LA 4GMJA 5KWDA 4KYOB 3FUHA 3EUVA 2VYIA 1PAQA 1H2TC 3D9JA 3T8MA 4CDRA 3RJVA 1BU9A 4C0EA 4GZDA 4L1BA 1V54E 4LERA 2FBNA 5B1BE 2PM6A 1N0RA 2ZXWE 3ASDA 4GU5A 1H2VC 3L17A 4KT6B 3R7QA 4GZCA 2BKKB 3LJNA 4ANXA 4C0MA 1IHGA 2WPVA 5JHAA 1DC2A 3CK8A 2X6KA 4WWOA 3ZFWA 4IRUA 4ACKA 2GRLA 1YMPA 1HFAA 3FULA 3CKBA 4I2WA 3Q47B 3FH8A 3ZHEB 5FINA 2IO3C 5B1AE 4HLLA 5JMND 2DWZA 3T9KA 4LCTA 4DX7D 2LAHA 3BU8A 4BSXA 1IQRA 1EF1C 3PS6A 5FZQA 4BSZB 5T3RA 4AM9A 3FP3A 4TRQA 1MX2A 1YA0A 3I3NA 2LXMA 2XZDG 3EHRA 4XX5A 3GZ2A 2KM4A 2LSUA 4I6JA 4L7TA 4GTPA 2DVWA 2X6FA 5CERB 3D3MA 2Y69E 3PZ2A 3PE3A 5E76A 5EDSA 2IU1A 2Y4UA 4CZ2D 4V3IA 4A3VA 4U63A 1WAO1 4J8FA 2WXLA 3LDZA 2WXMA 1TN8A 1H19A 3UM2A 2ZGGA 3SHFA 1E8XA 1TNZA 5HRYA 3CVVA 4U04A 5KBAA 1HF8A 4KBQA 4HBDA 2WQ7A 4N2SA 1FVFA 2JABA 3PE4A 3PRZA 4GMRA 3JCKC 2Y0BG 4BERA 2WXFA 3E37A 3B7SA 1UJKA 3PZDA 4DK5A 5EILA 1MJ0A 3CKCA 3FTVA 3MA5A 4ILHB 3KEAA 1H6KA 1MYOA 3TWRA 3UIPC 3UQ3A 3SGHA 2M63A 3FUNA 2BEDA 1D8EA 2OOEA 4XKCA 4BT8A 4H7XA 4RG9A 3KS2A 4HFGA 2J49A 4HOSA 1UG3A 2MYOA 4GZ5A 2ONDA 5CCMA 5LCWJ 3QARA 3QB2A 4KZ0A 2JLBA 3ZGQA 2P2CP 5BV1A 1ELRA 4ANWA 3CK7A 4ME2A 3I4GA 4FLHA 5T8IA 1TJFA 1UW4B 3ZXSA 2KATA 4HRMB 3OXLA 4WWPA 4DI4A 4KZCA 2WXGA 3TGOA 1HE8A 3ML9A 3TWSA 3UT8A 4F53A 2Y4TA 4GAAA 3CHOA 1E8YA 3GZ1A 4PH4B 3X2QE 3SNXA 3SFZA 5EX0A 3IV0A 5D2MC 4G26A 4GA1A 4WNFA 2I1JA 2CG2A 3EHNA 3FTZA 2ZIRA 4EBAG 3JQ0A 3CSFA 1OCZE 4TUUA 4Y6CA 3MEKA 4B8CB 2GRNB 3TWUA 4I6EA 2YHEA 4K5CA 2QZAA 1XGWA 3E30A 4YVOA 4R7LA 4I6GA 3SI5A 4A3TA 3AS5A 3ZYLA 3U64A 4K5AB 2XGMA 3NOGD 3VTYA 3UXGA 3G2UA 4P29A 4OAUC 4U7EB 3FTWA 3G2TA 3QNKA 3ZYKA 4APOA 1S64A 4MBGA 1BI8B 1IHBA 3HVEB 5JJTA 4GTSA 1JUQA 3R9MA 2XENA 4JD2G 2VSXE 3BG1B 4DI3A 1E7VA 2AVPA 2PZIA 4ANVA 5FWQA 3DEOA 3R7RA 4GPMA 4AXHA 3HRAA 1QYMA 1WDYA 4CYMD 4PS3A 4HOTA 3FU5A 5AIJA 1H2UA 4KVOA 4K03A 4L9PA 4DLOA 4ABNA 5FZSA 4JB8P 2A5EA 1DCEA 4NRHB 4GA0A 5FQ4A 3S7JA 5HI7A 1N0QA 4LSZE 5FZRA 4BWRA 1W3BA 5EIBE 2AW6A 1QQEA 5CMYA 3ESLA 5AJLA 3Q9UC 4YDWA 5FJYA 5JJ6A 4CT0A 2B6CA 3SBTB 2EIME 3FTSA 1Z5SC 1IQUA 3B7TA 5G04J 3TXMA 2F37A 2R05A 4AVXA 4J7WA 4L2YA 3JQ1A 2ETAA 3FU6A 3JXIA 2UWJG 5HKPA 2XQ0A 3CR3A 3NAWA 5ITZF 3AS8A 3CEQA 4FHJA 3O4ZA 3ZRHA 4U0ZA 2KCLA 2HR2A 4L23A 4U95D 5AARA 3KD7A 4QFVA 2J07A 5KNGA 3Q73A 5AN8A 2AWIA 4YDEA 2RFMA 1N95A 4FP7A 3RRUA 1LD7A 2XEVA 1K3ZD 4FULA 5AJDA 1L5JA 2R59A 4F7AA 3DXKG 5JJ7A 4GB9A 2QFCA 3ASFA 1INZA 3CVPA 2H6IA 2XEHA 5A6CA 3ABKE 5H7PA 4ATZD 3D9LA 4G23A 3D9NA 5AAOA 1DCQA 3UIOC 2DYSE 2OCCE 2GW1A 3L54A 4F6RD 1SVXA 1E8ZA 3CVXA 3Q5MA 3IXEA 4I1AA 2CFUA 4FJYA 5G55A 4UWHA 5KJKA 4EPZA 2C2LA 4U8VD 1JPLA 5C2YA 2IONA 5C1DA 2L0TB 3ULEG 3ZHEA 4EECA 3UKRG 1WY6A 1IXVA 3ONLA 4U07A 1ZB1A 2AJAA 4JC8A 3Q75A 3FUJA 1FT1A 1K1BA 3DWLG 3ZXPA 2B0OE 2J9QA 5LFAA 1N52A 5EN5D 2WXNA 1SZ9A 3SO8A 4E85A 1N4QA 3BEEA 2V8SE 3Q9NC 3Q4AB 5G05C 2J8SD 1TNBA 1N54A 1NI1A 1H6OA 3LYAA 4ZHBA 4UWKA 2FO7A 3FY4A 3L13A 3KAEA 5ARFA 3RIBA 5J08A 2EILE 4UI9J 3MKQA 3G2SA 3ZEFA 1NP7A 4I1OB 5CCLA 1BPOA 2NSZA 3S7BA 4XE0A 5HQ8A 3IEGA 1X81A 3UTMA 3D9KA 3RSEG 4C9BB 1D8DA 1QZ2A 5ENPD 3AU5A 2BTDA 4HRNA 3ISMC 2NXPA 3MX3A 4PS8A 2WXQA 1UN8A 4GYOA 1FVHA 4U8YD 3WG7E 1A5EA 4BTBA 2VSOE 2VTBB 3GYZA 3ZYQA 5ENSD 2CHWA 2CHZA 1RW2A 2LNIA 4AY6A 1HS6A 4CGWA 5ENNA 3LY8A 1NZNA 3URZA 4APFA 2J4DA 3MYVA 1SZAA 5JHBA
chains in the Genus database with same CATH topology
1BI8B 4BESA 1IHBA 4RLYA 2MYOA 4OAVB 3W9GA 2B0OE 4TUMA 1TR4A 4ZFHA 5ITZF 1SW6A 2F8YA 3J5QB 5EN5D 2DVWA 4BEPA 2V4HC 4DX5D 4BETA 3V31A 2XENA 5AQAA 2DZOA 3SO8A 4G8LA 5CERB 3V30A 3Q9NC 2P2CP 5KWDA 3V79K 4QQIA 4U95D 2J8SD 5AARA 4O1PA 3TWVA 1YCSB 4QFVA 5KNGA 4O1OA 1BLXB 4ZHBA 5HS0A 5CEDB 4DX1A 5AN8A 2V5QC 3DEOA 1MX4A 1BU9A 2RFMA 4CZ2D 3HG0D 4GPMA 1BD8A 3V2XA 1YYHA 2QC9A 1AWCB 3HRAA 1K3ZD 4HRMB 1QYMA 1WDYA 2ETCA 4K5BA 2PNNA 5EYLA 4HRLA 4CYMD 3W9FA 5CBNA 3TWWA 3T8KA 3ZUVB 2ZGGA 1MX6A 3TWSA 4HI9A 3ZKJA 3TWQA 1N0RA 4B93B 2NYJA 3D9HA 3UTMA 4DX6D 2XEHA 5HRYA 5ENOD 1AP7A 4F1PA 4NIKA 4ATZD 5KBAA 2BKKB 3LJNA 5BXUA 3B7BA 4JB8P 5ENPD 2RFAA 4HBDA 2A5EA 5AAOA 3JXJA 1DCQA 4HRNA 3NOCD 4G8KA 1OT8A 3C5RA 4U96D 3TWTA 1DC2A 2JABA 4HB5A 4N5QA 4GMRA 5D66A 4F6RD 4DUIA 1N0QA 4A63B 4Z68A 4LSZE 3TWXA 1YMPA 2Y0BG 4BERA 4DRXE 1SVXA 5ENTD 5EIBE 2FO1E 2VGEA 4HQDA 1WG0A 3V2OA 2DZNA 5ENQD 4HI8A 5FINA 3IXEA 3ZU7B 4U8YD 2Y1LE 5CEAA 5AQ9A 2L6BA 4LG6A 5EILA 4O60A 5EYPF 1A5EA 1MJ0A 5BXOA 3EU9A 4HLLA 4LNUD 5JMND 3TWUA 1IKND 3Q9UC 4UUCA 4YDWA 1OY3D 2DWZA 3T9KA 1D9SA 5ENSD 3KEAA 2KXPC 3JUEA 4K5CA 4HNAD 4DX7D 5CBOA 4U8VD 1MYOA 3ZNGA 3TWRA 1S70B 1K1AA 2XZTG 3AJIA 3NBNB 3AAAC 2HE0A 1IXVA 2XEEA 4K5AB 2F37A 2F8XK 1G3NB 2BKGA 3NOGD 5AQBA 4BSZB 2AJAA 3EHQA 2KBXA 4J7WA 1N11A 3UXGA 3F6QA 5AQ7A 4DX2A 3J5PA 4OAUC 5ENRD 2ETAA 2ZGDA 5HKPA 3JXIA 3UI2A 5FIOA 1MX2A 5CECB 3DEPA 4J8YA 2XZDG 2QYJA 4YDYA 3B95A 3EHRA 1K1BA 1NFIE 5JA4D 1BI7B 1UOHA 2ETBA 4C48B 5EIDA 5KNHD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BI8 B;  4BES A;  1IHB A;  4RLY A;  2MYO A;  4OAV B;  3W9G A;  2B0O E;  4TUM A;  1TR4 A;  4ZFH A;  5ITZ F;  1SW6 A;  2F8Y A;  3J5Q B;  5EN5 D;  2DVW A;  4BEP A;  2V4H C;  4DX5 D;  4BET A;  3V31 A;  2XEN A;  5AQA A;  2DZO A;  3SO8 A;  4G8L A;  5CER B;  3V30 A;  3Q9N C;  2P2C P;  5KWD A;  3V79 K;  4QQI A;  4U95 D;  2J8S D;  5AAR A;  4O1P A;  3TWV A;  1YCS B;  4QFV A;  5KNG A;  4O1O A;  1BLX B;  4ZHB A;  5HS0 A;  5CED B;  4DX1 A;  5AN8 A;  2V5Q C;  3DEO A;  1MX4 A;  1BU9 A;  2RFM A;  4CZ2 D;  3HG0 D;  4GPM A;  1BD8 A;  3V2X A;  1YYH A;  2QC9 A;  1AWC B;  3HRA A;  1K3Z D;  4HRM B;  1QYM A;  1WDY A;  2ETC A;  4K5B A;  2PNN A;  5EYL A;  4HRL A;  4CYM D;  3W9F A;  5CBN A;  3TWW A;  3T8K A;  3ZUV B;  2ZGG A;  1MX6 A;  3TWS A;  4HI9 A;  3ZKJ A;  3TWQ A;  1N0R A;  4B93 B;  2NYJ A;  3D9H A;  3UTM A;  4DX6 D;  2XEH A;  5HRY A;  5ENO D;  1AP7 A;  4F1P A;  4NIK A;  4ATZ D;  5KBA A;  2BKK B;  3LJN A;  5BXU A;  3B7B A;  4JB8 P;  5ENP D;  2RFA A;  4HBD A;  2A5E A;  5AAO A;  3JXJ A;  1DCQ A;  4HRN A;  3NOC D;  4G8K A;  1OT8 A;  3C5R A;  4U96 D;  3TWT A;  1DC2 A;  2JAB A;  4HB5 A;  4N5Q A;  4GMR A;  5D66 A;  4F6R D;  4DUI A;  1N0Q A;  4A63 B;  4Z68 A;  4LSZ E;  3TWX A;  1YMP A;  2Y0B G;  4BER A;  4DRX E;  1SVX A;  5ENT D;  5EIB E;  2FO1 E;  2VGE A;  4HQD A;  1WG0 A;  3V2O A;  2DZN A;  5ENQ D;  4HI8 A;  5FIN A;  3IXE A;  3ZU7 B;  4U8Y D;  2Y1L E;  5CEA A;  5AQ9 A;  2L6B A;  4LG6 A;  5EIL A;  4O60 A;  5EYP F;  1A5E A;  1MJ0 A;  5BXO A;  3EU9 A;  4HLL A;  4LNU D;  5JMN D;  3TWU A;  1IKN D;  3Q9U C;  4UUC A;  4YDW A;  1OY3 D;  2DWZ A;  3T9K A;  1D9S A;  5ENS D;  3KEA A;  2KXP C;  3JUE A;  4K5C A;  4HNA D;  4DX7 D;  5CBO A;  4U8V D;  1MYO A;  3ZNG A;  3TWR A;  1S70 B;  1K1A A;  2XZT G;  3AJI A;  3NBN B;  3AAA C;  2HE0 A;  1IXV A;  2XEE A;  4K5A B;  2F37 A;  2F8X K;  1G3N B;  2BKG A;  3NOG D;  5AQB A;  4BSZ B;  2AJA A;  3EHQ A;  2KBX A;  4J7W A;  1N11 A;  3UXG A;  3F6Q A;  5AQ7 A;  4DX2 A;  3J5P A;  4OAU C;  5ENR D;  2ETA A;  2ZGD A;  5HKP A;  3JXI A;  3UI2 A;  5FIO A;  1MX2 A;  5CEC B;  3DEP A;  4J8Y A;  2XZD G;  2QYJ A;  4YDY A;  3B95 A;  3EHR A;  1K1B A;  1NFI E;  5JA4 D;  1BI7 B;  1UOH A;  2ETB A;  4C48 B;  5EID A;  5KNH D; 
#chains in the Genus database with same CATH topology
 3QWW A;  2IO2 C;  3W9G A;  1UJJ A;  3PVL A;  5M72 A;  4BEP A;  1TNO A;  1HU3 A;  4GCN A;  5BW8 C;  2WB2 A;  4A1S A;  4KXK B;  3TJP A;  3DSS A;  5BV0 A;  3PEV B;  3APC A;  4XZ4 A;  1N94 A;  2AXZ A;  2RKK A;  4N2Q A;  1AWC B;  1RZ4 A;  3S2A A;  3FEY A;  4K5B A;  4CDN A;  3PZ4 A;  4EZK A;  3W9F A;  4UI9 K;  3S7D A;  4M7C A;  4Y6W A;  4DJA A;  1VDY A;  3MKQ B;  2R5S A;  4KVM A;  2FI7 A;  2RFA A;  5FTP A;  3SY2 A;  3KSL A;  1KPS B;  4U96 D;  5ANL A;  2E2E A;  4B89 A;  1O5M A;  4UWG A;  3CST A;  3TAX A;  5ENT D;  2KC7 A;  3UM0 A;  3Q7F A;  1NA3 A;  3ASG A;  3R9A B;  2L6B A;  4I17 A;  4FU3 A;  4JVS A;  1Q2Z A;  3DBS A;  3CVL A;  1MZC A;  4JA9 A;  3IBE A;  5KJN A;  2X6H A;  4GPK A;  3HXC A;  2EIJ E;  3C72 A;  4XKB A;  5ANR A;  3NBN B;  2J08 A;  3MKR A;  1G3N B;  3ZPJ A;  2XGO A;  4EQF A;  4BTA A;  5ENR D;  3CVU A;  5DBK A;  3CHR A;  3Q15 A;  1TN6 A;  3U9W A;  3ABL E;  4GTM A;  3L9T A;  1SQM A;  1H6P A;  3ML8 A;  3HVE A;  2VQ2 A;  3ULY A;  3CHP A;  3SQV A;  4HOU A;  1YYH A;  2YNQ A;  2VJ8 A;  4AY5 A;  2ETC A;  3AG3 E;  1QNF A;  3ZKJ A;  1OUV A;  3SFX A;  4AP2 A;  3LJ3 A;  1OXJ A;  1Z3X A;  4F1P A;  2P9I G;  2J4B A;  4HB5 A;  5D66 A;  1N4S A;  3CVY A;  2P9L G;  4GTO A;  3G2V A;  4A55 A;  1OY3 D;  2OVB A;  1HG5 A;  5G04 C;  3ULQ A;  2P58 C;  2FEZ A;  2R03 A;  2F8X K;  2L6J A;  3LXU X;  4PUC A;  4JZY A;  2KBX A;  2P9S G;  5ARG A;  1Y6I A;  3LKU A;  2GRM A;  4G24 A;  2KZT A;  4YDY A;  2QYJ A;  4TV3 A;  1A17 A;  1E90 A;  4JHR A;  3MZL B;  3P1U A;  4BY6 A;  4J6I A;  4CT4 A;  3V30 A;  4QQI A;  2LXL A;  2IOL A;  3UUX A;  3EU5 A;  5CMW A;  4UQZ A;  4AOF A;  4URK A;  4M3O A;  1MX4 A;  3PRE A;  4ILG A;  5T4Y A;  2YHC A;  2QC9 A;  5BT1 A;  4NUR A;  3SD5 A;  2P9N G;  3I4R B;  3FWV A;  3ZUV B;  1EYH A;  3UT7 A;  1FPP A;  1MX6 A;  3Q7A A;  3DPY A;  2XCC A;  3I5P A;  4J8E A;  4G11 A;  1FCH A;  1AP7 A;  2HYZ A;  1OCR E;  2EIN E;  1N4P A;  2J09 A;  2VGX A;  3T5X A;  3FEX A;  5CRV A;  4JPS A;  2XPY A;  1Y8M A;  3FUE A;  1E7U A;  3QDN A;  4GTR A;  2P9U G;  4HI8 A;  2Q7F A;  4LNB A;  2PL2 A;  3TG5 A;  4UUC A;  3APD A;  2E0I A;  4F3V A;  2BUG A;  2XZT G;  3AJI A;  4OYS A;  4Q94 A;  2XPZ A;  2A4Z A;  2FF4 A;  2XEE A;  1HXI A;  1ELK A;  2ILR A;  5AQB A;  2FUL A;  5AQ7 A;  3DSU A;  4FLB A;  4MRU A;  4D10 C;  4XI9 A;  1TNY A;  4AEZ C;  1QBQ A;  4C48 B;  4HS2 A;  4Z68 A;  2L0I A;  1P5Q A;  3LVQ E;  1KLX A;  4JHJ A;  1ZU2 A;  2KZT B;  3LVR E;  3RKV A;  5KJL A;  3V79 K;  1N9A A;  2VSY A;  4OVU A;  4DX1 A;  3U3W A;  3RK6 A;  2C0M A;  4IYP A;  4UI9 C;  4HOQ A;  1BD8 A;  2WVI A;  1OWN A;  4OVV A;  4UQY A;  4EZL A;  3TWQ A;  3UM1 A;  2NYJ A;  1OWL A;  1OWM A;  4CDM A;  1KZP A;  3AG4 E;  2XRZ A;  3DST A;  4GML A;  1IYG A;  2ZU6 B;  5FQ6 A;  1DNP A;  2LUH A;  3E34 A;  3L22 A;  5KCM A;  1DVP A;  2VGX B;  5D0Q D;  1UN9 A;  2JEK A;  2L9B A;  5CEA A;  5EYP F;  4E6H A;  4LNU D;  1X5B A;  4DLQ A;  3HHM A;  1IKN D;  4JA7 A;  1D9S A;  3UKU G;  3CLJ A;  4F1S A;  4J0U A;  4FHK A;  1K1A A;  4RQI A;  5BNW A;  2I9C A;  2VTB A;  4I1M A;  4PS7 A;  3GW4 A;  3FUD A;  1U3D A;  3DEP A;  2Y3A A;  1S0P A;  2WXK A;  2WXH A;  1BI7 B;  3NB2 A;  4TUM A;  3PDN A;  4G25 A;  4EZJ A;  4U0U A;  2C0L A;  2NC9 A;  3PNT B;  5HS0 A;  4U8H A;  1K8K G;  3Q78 A;  4WNG A;  4U0S A;  3D9M A;  3NF1 A;  3EHM A;  3SZ7 A;  3SBS A;  1XNF A;  2PNN A;  5A23 A;  3T8K A;  3CK9 A;  3ONK A;  2KCK A;  3HXF A;  4JL0 A;  2PQR A;  5LX8 A;  3MV3 B;  2I6H A;  4J8S A;  2X3M A;  5ENO D;  4EHM A;  4NIK A;  3RO2 A;  3C5R A;  2XRY A;  4N5Q A;  4ACL A;  1HH8 A;  4JXT A;  4GTQ A;  4GA2 A;  5KJM A;  3V2O A;  1N4R A;  3JYS A;  3QJZ A;  1JWG A;  3T5V A;  3CHQ A;  3QOU A;  2EIK E;  4YND A;  1OCO E;  2A5U A;  1ZBP A;  3CQG B;  2I1K A;  2QYU A;  2X6J A;  1S70 B;  2MRI A;  3CHS A;  4JEU A;  2XCB A;  3DRA A;  4WUY A;  3GZS A;  5FIO A;  4JHK A;  1UOH A;  3VLF A;  5FQ8 A;  3NQP A;  4G2V A;  2F8Y A;  3J5Q B;  4DX5 D;  3V31 A;  3FHE A;  4GCO A;  3DSV A;  2OV8 A;  4O1P A;  2VGY A;  2GRQ B;  3TWV A;  4EBA A;  5CRU A;  3CVW A;  1BLX B;  4RSY A;  3B7U X;  5D0O D;  3HG0 D;  3TG4 A;  5G2N A;  3V2X A;  4IUL A;  3HXE A;  5LCW C;  1TN7 A;  4B94 A;  2OEW A;  3B7R L;  4YDO A;  1B89 A;  2IEJ A;  2WXJ A;  2H6F A;  2LSV A;  3MJW A;  2DIW A;  4WWN A;  4B93 B;  4IN3 B;  2RD0 A;  4BT9 A;  4MLP A;  3E33 A;  3ENE A;  5EX3 A;  3QC1 A;  2EQX A;  2ZIS A;  3NOC D;  3Q79 A;  4WAF A;  3OXG A;  4KMO A;  4N3B A;  4GTV A;  2VGE A;  4HQD A;  1WG0 A;  2Y1L E;  4O60 A;  4XIF A;  2MHK A;  5BXO A;  3EU9 A;  3FUM A;  2R17 C;  1LD8 A;  3ABM E;  4HXI A;  5BPP A;  3FU0 A;  2KXP C;  5CBO A;  1O1T A;  3AAA C;  3Q49 B;  3AG1 E;  3RRN B;  3HDX A;  5DIZ A;  5G05 J;  3NZS A;  3UM3 A;  2ZGD A;  1KZO A;  3D9P A;  2YQ8 A;  3PNL B;  3B95 A;  2PM7 A;  3QKY A;  4I43 A;  5EID A;  2AXU A;  4K0R A;  4BET A;  1PY1 A;  3KSQ A;  4NQ0 A;  2DZO A;  3LY7 A;  4GYY A;  3FUK A;  3HIZ A;  3EIQ C;  3QWV A;  4J8D A;  1SA5 A;  1TNU A;  3DSX A;  3L16 A;  2WQ6 A;  1TEZ A;  3AS4 A;  2MOW A;  1HG2 A;  3UPV A;  2WXI A;  2QY7 A;  3TWW A;  1S63 A;  4HI9 A;  3SFY A;  3PZ1 A;  3D9H A;  3CIA A;  3EJN A;  4BFR A;  4UWL A;  4N3A A;  3JXJ A;  4H7Y A;  4G8K A;  5IY5 E;  3ASH A;  4JW1 A;  4A63 B;  3LPZ A;  1TYQ G;  4MS6 A;  2H6H A;  4CEM A;  3RRM B;  2IJG X;  2PQN A;  3PUK A;  1U2V G;  4DPR A;  3JUE A;  1LF8 A;  3B13 A;  1O1R A;  3CVN A;  4L2L A;  3EHQ A;  5BUZ A;  1HZ4 A;  1JCR A;  5CEC B;  4J8Y A;  5B3S E;  3FH7 A;  3FH5 A;  3IHY A;  1ELW A;  1NFI E;  3U4T A;  3N71 A;  4RLY A;  1TR4 A;  1SW6 A;  3UIN C;  4HOR A;  2WQH A;  2CG3 A;  3PZ3 A;  4LRZ A;  2P9K G;  3FU3 A;  3QK0 A;  2GRR B;  3RU0 A;  1YCS B;  2BF0 X;  2V5F A;  3L82 A;  4PDX A;  2WXP A;  3OAW A;  3ASN E;  2P9P G;  3LEW A;  3C98 A;  3BQO A;  3CGH A;  4NAC A;  4CGV A;  1KT1 A;  4HRL A;  3MGB A;  3ZIM A;  3MV2 B;  4TXP A;  2XS1 A;  4AV7 A;  2WM9 A;  4DX6 D;  4GZ6 A;  3BG0 B;  3OTN A;  5LP0 A;  3ZN3 A;  1JCS A;  2RG8 A;  3VLE A;  3IKO B;  2DYR E;  5E75 A;  3TWT A;  1SA4 A;  2UY1 A;  1OWP A;  3EDT B;  1JCQ A;  2DZN A;  5ENQ D;  3VTX A;  4TXR A;  4BX9 A;  3DPD A;  1WM5 A;  1OWO A;  3OXF A;  2IY0 C;  4LNG A;  4XEI G;  3E32 A;  4W9R A;  1MHQ A;  3CQC B;  4BX8 A;  3PH0 C;  4I2Z A;  2IOS A;  2WXR A;  4ILI A;  3FTU A;  2X38 A;  3SF4 A;  3TL5 A;  2ETB A;  4BES A;  1FT2 A;  2F0Y A;  5J90 A;  3FTY A;  3S7F A;  4HVB A;  3C3O A;  3RO3 A;  3VLD A;  3FTX A;  3WXX A;  5AEN A;  2XHE A;  3FUF A;  2WXO A;  4O1O A;  3LY9 A;  2CHX A;  1U3C A;  1H0A A;  4B8A A;  3U66 A;  3LS8 A;  2DBA A;  4CCA A;  3FDH A;  3E4B A;  2CFZ A;  2XS8 A;  4AJW A;  5EYL A;  1TJC A;  2IFU A;  2V0P A;  2I2O A;  1JWF A;  2HM8 A;  3UT4 A;  4B0Z A;  1OCC E;  2IF4 A;  3AG2 E;  1HX8 A;  2KCV A;  3D9I A;  2OVF A;  4UWF A;  2GGF A;  4XI0 A;  2LAI A;  2DCP A;  1O1S A;  4FJZ A;  1EDU A;  2GRO B;  2X6I A;  4DUI A;  3FUI A;  3IHV A;  3TWX A;  3CV0 A;  1NL4 A;  2XGS A;  4GTT A;  3AU4 A;  4AIF A;  1MQS A;  4HLE A;  2UY1 B;  3G2W A;  1PC2 A;  3CHM A;  4I9C A;  4ATG A;  4FAD A;  4Q69 A;  4RVB A;  3ZNG A;  4GYW A;  2OEV A;  3PUJ A;  3O48 A;  5CHE E;  2R02 A;  2BKG A;  3K9I A;  5FT9 A;  2LO6 A;  1HO8 A;  1N11 A;  4DX2 A;  4O6F A;  2XPI A;  3UI2 A;  4FA6 A;  3NZU A;  3FFL A;  4WND A;  5KNH D;  1E96 B;  3KEZ A;  4ZFH A;  2H6G A;  2VSN A;  3JUI A;  3ZW3 A;  1Z6T A;  5A7D B;  1Z3Y A;  3DSW A;  4FC8 A;  2HO1 A;  3L6A A;  3UX4 A;  4GZ3 A;  2WMN A;  4JEH A;  5LOZ A;  5CED B;  3QAQ A;  2V5Q C;  5EKQ D;  4N5C A;  4X8Q A;  3CVQ A;  3UMV A;  3PEU B;  5CBN A;  4LUN U;  3ESK A;  1NA0 A;  3L08 A;  3ASO E;  5BXU A;  3B7B A;  1EPU A;  2YIN A;  1LTX A;  2WMO A;  4I9E A;  4UQX A;  1OT8 A;  4N39 A;  4LEU A;  4DRX E;  4WNE A;  2FO1 E;  3HXB A;  3ZU7 B;  5AQ9 A;  4LG6 A;  3TXN A;  3C3Q A;  3APF A;  3QWP A;  3DXM G;  3LCA A;  4RG6 A;  2IQC A;  5FQ7 A;  3C3R A;  3MCX A;  4HNA D;  2GRP B;  4Q96 A;  3RAU A;  4YVQ C;  2HE0 A;  4N3C A;  3HXD A;  3BUA A;  3P2B A;  4ANU A;  3F6Q A;  3ZYM A;  3J5P A;  1GW6 A;  4TXQ A;  3D9O A;  5JA4 D;  4G1T A;  4OAV B;  1V55 E;  3HYM B;  4MKT A;  4A1G A;  2AXV A;  2R2L A;  3ZVV A;  2V4H C;  5AYW D;  1KT0 A;  5AQA A;  1E8W A;  4G8L A;  4CRW A;  3EIJ A;  2V4L A;  4GMJ A;  5KWD A;  4KYO B;  3FUH A;  3EUV A;  2VYI A;  1PAQ A;  1H2T C;  3D9J A;  3T8M A;  4CDR A;  3RJV A;  1BU9 A;  4C0E A;  4GZD A;  4L1B A;  1V54 E;  4LER A;  2FBN A;  5B1B E;  2PM6 A;  1N0R A;  2ZXW E;  3ASD A;  4GU5 A;  1H2V C;  3L17 A;  4KT6 B;  3R7Q A;  4GZC A;  2BKK B;  3LJN A;  4ANX A;  4C0M A;  1IHG A;  2WPV A;  5JHA A;  1DC2 A;  3CK8 A;  2X6K A;  4WWO A;  3ZFW A;  4IRU A;  4ACK A;  2GRL A;  1YMP A;  1HFA A;  3FUL A;  3CKB A;  4I2W A;  3Q47 B;  3FH8 A;  3ZHE B;  5FIN A;  2IO3 C;  5B1A E;  4HLL A;  5JMN D;  2DWZ A;  3T9K A;  4LCT A;  4DX7 D;  2LAH A;  3BU8 A;  4BSX A;  1IQR A;  1EF1 C;  3PS6 A;  5FZQ A;  4BSZ B;  5T3R A;  4AM9 A;  3FP3 A;  4TRQ A;  1MX2 A;  1YA0 A;  3I3N A;  2LXM A;  2XZD G;  3EHR A;  4XX5 A;  3GZ2 A;  2KM4 A;  2LSU A;  4I6J A;  4L7T A;  4GTP A;  2DVW A;  2X6F A;  5CER B;  3D3M A;  2Y69 E;  3PZ2 A;  3PE3 A;  5E76 A;  5EDS A;  2IU1 A;  2Y4U A;  4CZ2 D;  4V3I A;  4A3V A;  4U63 A;  1WAO 1;  4J8F A;  2WXL A;  3LDZ A;  2WXM A;  1TN8 A;  1H19 A;  3UM2 A;  2ZGG A;  3SHF A;  1E8X A;  1TNZ A;  5HRY A;  3CVV A;  4U04 A;  5KBA A;  1HF8 A;  4KBQ A;  4HBD A;  2WQ7 A;  4N2S A;  1FVF A;  2JAB A;  3PE4 A;  3PRZ A;  4GMR A;  3JCK C;  2Y0B G;  4BER A;  2WXF A;  3E37 A;  3B7S A;  1UJK A;  3PZD A;  4DK5 A;  5EIL A;  1MJ0 A;  3CKC A;  3FTV A;  3MA5 A;  4ILH B;  3KEA A;  1H6K A;  1MYO A;  3TWR A;  3UIP C;  3UQ3 A;  3SGH A;  2M63 A;  3FUN A;  2BED A;  1D8E A;  2OOE A;  4XKC A;  4BT8 A;  4H7X A;  4RG9 A;  3KS2 A;  4HFG A;  2J49 A;  4HOS A;  1UG3 A;  2MYO A;  4GZ5 A;  2OND A;  5CCM A;  5LCW J;  3QAR A;  3QB2 A;  4KZ0 A;  2JLB A;  3ZGQ A;  2P2C P;  5BV1 A;  1ELR A;  4ANW A;  3CK7 A;  4ME2 A;  3I4G A;  4FLH A;  5T8I A;  1TJF A;  1UW4 B;  3ZXS A;  2KAT A;  4HRM B;  3OXL A;  4WWP A;  4DI4 A;  4KZC A;  2WXG A;  3TGO A;  1HE8 A;  3ML9 A;  3TWS A;  3UT8 A;  4F53 A;  2Y4T A;  4GAA A;  3CHO A;  1E8Y A;  3GZ1 A;  4PH4 B;  3X2Q E;  3SNX A;  3SFZ A;  5EX0 A;  3IV0 A;  5D2M C;  4G26 A;  4GA1 A;  4WNF A;  2I1J A;  2CG2 A;  3EHN A;  3FTZ A;  2ZIR A;  4EBA G;  3JQ0 A;  3CSF A;  1OCZ E;  4TUU A;  4Y6C A;  3MEK A;  4B8C B;  2GRN B;  3TWU A;  4I6E A;  2YHE A;  4K5C A;  2QZA A;  1XGW A;  3E30 A;  4YVO A;  4R7L A;  4I6G A;  3SI5 A;  4A3T A;  3AS5 A;  3ZYL A;  3U64 A;  4K5A B;  2XGM A;  3NOG D;  3VTY A;  3UXG A;  3G2U A;  4P29 A;  4OAU C;  4U7E B;  3FTW A;  3G2T A;  3QNK A;  3ZYK A;  4APO A;  1S64 A;  4MBG A;  1BI8 B;  1IHB A;  3HVE B;  5JJT A;  4GTS A;  1JUQ A;  3R9M A;  2XEN A;  4JD2 G;  2VSX E;  3BG1 B;  4DI3 A;  1E7V A;  2AVP A;  2PZI A;  4ANV A;  5FWQ A;  3DEO A;  3R7R A;  4GPM A;  4AXH A;  3HRA A;  1QYM A;  1WDY A;  4CYM D;  4PS3 A;  4HOT A;  3FU5 A;  5AIJ A;  1H2U A;  4KVO A;  4K03 A;  4L9P A;  4DLO A;  4ABN A;  5FZS A;  4JB8 P;  2A5E A;  1DCE A;  4NRH B;  4GA0 A;  5FQ4 A;  3S7J A;  5HI7 A;  1N0Q A;  4LSZ E;  5FZR A;  4BWR A;  1W3B A;  5EIB E;  2AW6 A;  1QQE A;  5CMY A;  3ESL A;  5AJL A;  3Q9U C;  4YDW A;  5FJY A;  5JJ6 A;  4CT0 A;  2B6C A;  3SBT B;  2EIM E;  3FTS A;  1Z5S C;  1IQU A;  3B7T A;  5G04 J;  3TXM A;  2F37 A;  2R05 A;  4AVX A;  4J7W A;  4L2Y A;  3JQ1 A;  2ETA A;  3FU6 A;  3JXI A;  2UWJ G;  5HKP A;  2XQ0 A;  3CR3 A;  3NAW A;  5ITZ F;  3AS8 A;  3CEQ A;  4FHJ A;  3O4Z A;  3ZRH A;  4U0Z A;  2KCL A;  2HR2 A;  4L23 A;  4U95 D;  5AAR A;  3KD7 A;  4QFV A;  2J07 A;  5KNG A;  3Q73 A;  5AN8 A;  2AWI A;  4YDE A;  2RFM A;  1N95 A;  4FP7 A;  3RRU A;  1LD7 A;  2XEV A;  1K3Z D;  4FUL A;  5AJD A;  1L5J A;  2R59 A;  4F7A A;  3DXK G;  5JJ7 A;  4GB9 A;  2QFC A;  3ASF A;  1INZ A;  3CVP A;  2H6I A;  2XEH A;  5A6C A;  3ABK E;  5H7P A;  4ATZ D;  3D9L A;  4G23 A;  3D9N A;  5AAO A;  1DCQ A;  3UIO C;  2DYS E;  2OCC E;  2GW1 A;  3L54 A;  4F6R D;  1SVX A;  1E8Z A;  3CVX A;  3Q5M A;  3IXE A;  4I1A A;  2CFU A;  4FJY A;  5G55 A;  4UWH A;  5KJK A;  4EPZ A;  2C2L A;  4U8V D;  1JPL A;  5C2Y A;  2ION A;  5C1D A;  2L0T B;  3ULE G;  3ZHE A;  4EEC A;  3UKR G;  1WY6 A;  1IXV A;  3ONL A;  4U07 A;  1ZB1 A;  2AJA A;  4JC8 A;  3Q75 A;  3FUJ A;  1FT1 A;  1K1B A;  3DWL G;  3ZXP A;  2B0O E;  2J9Q A;  5LFA A;  1N52 A;  5EN5 D;  2WXN A;  1SZ9 A;  3SO8 A;  4E85 A;  1N4Q A;  3BEE A;  2V8S E;  3Q9N C;  3Q4A B;  5G05 C;  2J8S D;  1TNB A;  1N54 A;  1NI1 A;  1H6O A;  3LYA A;  4ZHB A;  4UWK A;  2FO7 A;  3FY4 A;  3L13 A;  3KAE A;  5ARF A;  3RIB A;  5J08 A;  2EIL E;  4UI9 J;  3MKQ A;  3G2S A;  3ZEF A;  1NP7 A;  4I1O B;  5CCL A;  1BPO A;  2NSZ A;  3S7B A;  4XE0 A;  5HQ8 A;  3IEG A;  1X81 A;  3UTM A;  3D9K A;  3RSE G;  4C9B B;  1D8D A;  1QZ2 A;  5ENP D;  3AU5 A;  2BTD A;  4HRN A;  3ISM C;  2NXP A;  3MX3 A;  4PS8 A;  2WXQ A;  1UN8 A;  4GYO A;  1FVH A;  4U8Y D;  3WG7 E;  1A5E A;  4BTB A;  2VSO E;  2VTB B;  3GYZ A;  3ZYQ A;  5ENS D;  2CHW A;  2CHZ A;  1RW2 A;  2LNI A;  4AY6 A;  1HS6 A;  4CGW A;  5ENN A;  3LY8 A;  1NZN A;  3URZ A;  4APF A;  2J4D A;  3MYV A;  1SZA A;  5JHB A; 
#chains in the Genus database with same CATH homology
 1BI8 B;  4BES A;  1IHB A;  4RLY A;  2MYO A;  4OAV B;  3W9G A;  2B0O E;  4TUM A;  1TR4 A;  4ZFH A;  5ITZ F;  1SW6 A;  2F8Y A;  3J5Q B;  5EN5 D;  2DVW A;  4BEP A;  2V4H C;  4DX5 D;  4BET A;  3V31 A;  2XEN A;  5AQA A;  2DZO A;  3SO8 A;  4G8L A;  5CER B;  3V30 A;  3Q9N C;  2P2C P;  5KWD A;  3V79 K;  4QQI A;  4U95 D;  2J8S D;  5AAR A;  4O1P A;  3TWV A;  1YCS B;  4QFV A;  5KNG A;  4O1O A;  1BLX B;  4ZHB A;  5HS0 A;  5CED B;  4DX1 A;  5AN8 A;  2V5Q C;  3DEO A;  1MX4 A;  1BU9 A;  2RFM A;  4CZ2 D;  3HG0 D;  4GPM A;  1BD8 A;  3V2X A;  1YYH A;  2QC9 A;  1AWC B;  3HRA A;  1K3Z D;  4HRM B;  1QYM A;  1WDY A;  2ETC A;  4K5B A;  2PNN A;  5EYL A;  4HRL A;  4CYM D;  3W9F A;  5CBN A;  3TWW A;  3T8K A;  3ZUV B;  2ZGG A;  1MX6 A;  3TWS A;  4HI9 A;  3ZKJ A;  3TWQ A;  1N0R A;  4B93 B;  2NYJ A;  3D9H A;  3UTM A;  4DX6 D;  2XEH A;  5HRY A;  5ENO D;  1AP7 A;  4F1P A;  4NIK A;  4ATZ D;  5KBA A;  2BKK B;  3LJN A;  5BXU A;  3B7B A;  4JB8 P;  5ENP D;  2RFA A;  4HBD A;  2A5E A;  5AAO A;  3JXJ A;  1DCQ A;  4HRN A;  3NOC D;  4G8K A;  1OT8 A;  3C5R A;  4U96 D;  3TWT A;  1DC2 A;  2JAB A;  4HB5 A;  4N5Q A;  4GMR A;  5D66 A;  4F6R D;  4DUI A;  1N0Q A;  4A63 B;  4Z68 A;  4LSZ E;  3TWX A;  1YMP A;  2Y0B G;  4BER A;  4DRX E;  1SVX A;  5ENT D;  5EIB E;  2FO1 E;  2VGE A;  4HQD A;  1WG0 A;  3V2O A;  2DZN A;  5ENQ D;  4HI8 A;  5FIN A;  3IXE A;  3ZU7 B;  4U8Y D;  2Y1L E;  5CEA A;  5AQ9 A;  2L6B A;  4LG6 A;  5EIL A;  4O60 A;  5EYP F;  1A5E A;  1MJ0 A;  5BXO A;  3EU9 A;  4HLL A;  4LNU D;  5JMN D;  3TWU A;  1IKN D;  3Q9U C;  4UUC A;  4YDW A;  1OY3 D;  2DWZ A;  3T9K A;  1D9S A;  5ENS D;  3KEA A;  2KXP C;  3JUE A;  4K5C A;  4HNA D;  4DX7 D;  5CBO A;  4U8V D;  1MYO A;  3ZNG A;  3TWR A;  1S70 B;  1K1A A;  2XZT G;  3AJI A;  3NBN B;  3AAA C;  2HE0 A;  1IXV A;  2XEE A;  4K5A B;  2F37 A;  2F8X K;  1G3N B;  2BKG A;  3NOG D;  5AQB A;  4BSZ B;  2AJA A;  3EHQ A;  2KBX A;  4J7W A;  1N11 A;  3UXG A;  3F6Q A;  5AQ7 A;  4DX2 A;  3J5P A;  4OAU C;  5ENR D;  2ETA A;  2ZGD A;  5HKP A;  3JXI A;  3UI2 A;  5FIO A;  1MX2 A;  5CEC B;  3DEP A;  4J8Y A;  2XZD G;  2QYJ A;  4YDY A;  3B95 A;  3EHR A;  1K1B A;  1NFI E;  5JA4 D;  1BI7 B;  1UOH A;  2ETB A;  4C48 B;  5EID A;  5KNH D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...