4QQIA

Crystal structure of ankra2-rfx7 complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
176
structure length
176
Chain Sequence
b'LYFQGSTTPLLANSLSVHQLAAQGEMLYLATRIEQENVINHTDEEGFTPLMWAAAHGQIAVVEFLLQNGADPQLLGKGRESALSLACSKGYTDIVKMLLDCGVDVNEYDWNGGTPLLYAVHGNHVKCVKMLLESGADPTIETDSGYNSMDLAVALGYRSVQQVIESHLLKLLQNIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ankyrin repeat family A protein 2
publication title Ankyrin Repeats of ANKRA2 Recognize a PxLPxL Motif on the 3M Syndrome Protein CCDC8.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 57
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2014-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
A PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4qqiA00
3NBNB 3ZU7B 4K5AB 3T8KA 2ETAA 5CEDB 1OT8A 2VGEA 4DX7D 4N5QA 3V2OA 3TWQA 3V31A 3IXEA 3TWXA 3DEPA 5CBNA 1IKND 4DX1A 1IXVA 1DCQA 5BXUA 5EILA 2FO1E 4CZ2D 1BU9A 4DX5D 1AP7A 4O1OA 1MYOA 4K5BA 2V5QC 2JABA 2MYOA 2ZGDA 2J8SD 4HLLA 4HRNA 3TWVA 5AQBA 3UXGA 3ZKJA 4BERA 4BEPA 2HE0A 2Y0BG 5ENSD 5FINA 3B95A 5CEAA 2DZOA 4U95D 4HB5A 5FIOA 5ENTD 4U8VD 2B0OE 3TWWA 4DUIA 4DX2A 1G3NB 4GPMA 3T9KA 2KBXA 1K3ZD 5KBAA 4UUCA 2DZNA 4HI9A 3W9GA 1IHBA 2ZGGA 3J5PA 3LJNA 4G8KA 4F6RD 4GMRA 4BESA 2QC9A 4LNUD 1WG0A 2F37A 2NYJA 5ITZF 1N0RA 5AQ7A 3V30A 4ATZD 3KEAA 5CBOA 4QQIA 3TWSA 4B93B 2XZTG 4TUMA 3EHRA 3HRAA 4BSZB 4O1PA 3AJIA 5ENPD 1K1AA 4YDWA 2XEEA 5HRYA 3J5QB 2RFMA 4OAUC 1SW6A 2BKGA 5ENQD 1YYHA 3DEOA 5EIBE 3HG0D 3UI2A 4HNAD 4Z68A 5KNGA 1MX4A 4NIKA 1MJ0A 5ENRD 4C48B 4U8YD 5AQAA 1K1BA 5ENOD 2DVWA 2PNNA 3EHQA 1MX6A 1BI8B 3Q9NC 4RLYA 3TWRA 5CECB 4K5CA 5JMND 5AAOA 4LSZE 2F8YA 3C5RA 5AN8A 1BI7B 3ZNGA 4F1PA 3Q9UC 2XEHA 3V79K 4ZHBA 1N11A 2XENA 4YDYA 3TWTA 4O60A 4OAVB 4QFVA 2BKKB 4JB8P 5JA4D 4U96D 4BETA 4CYMD 4HI8A 3F6QA 3V2XA 5BXOA 3D9HA 1D9SA 1WDYA 5EN5D 3SO8A 3B7BA 5HKPA 4DRXE 4HBDA 3TWUA 4G8LA 1TR4A 2DWZA 1NFIE 1YMPA 2ETCA 1SVXA 4ZFHA 2AJAA 5KNHD 3AAAC 1DC2A 4J8YA 5CERB 1OY3D 2A5EA 1N0QA 1BLXB 1S70B 3NOGD 1AWCB 1YCSB 3JXIA 2RFAA 2ETBA 5AQ9A 5KWDA 4HRMB 4DX6D 2KXPC 5HS0A 4A63B 1A5EA 2Y1LE 4LG6A 5AARA 3W9FA 2F8XK 4HQDA 2XZDG 4HRLA 3JXJA 3UTMA 2QYJA 1QYMA 2P2CP 3EU9A 3NOCD 1UOHA 2V4HC 5D66A 5EYLA 5EYPF 3JUEA 2L6BA 4J7WA 5EIDA 3ZUVB 1MX2A 1BD8A
chains in the Genus database with same CATH superfamily
3ZU7B 5ARFA 4EPZA 1OT8A 1FVHA 3BEEA 3ZYKA 4L23A 2PM6A 4G11A 2LXLA 3UKRG 1LD8A 3ASOE 1NP7A 3PUKA 4ILGA 4BERA 3UT4A 2NSZA 3OXFA 3RKVA 1EPUA 4ILIA 3SBSA 3W9GA 4ANWA 3FH5A 4QQIA 4DLOA 5CRUA 5FZQA 1K8KG 3S7FA 4GA2A 5FTPA 4O1PA 4O6FA 1SW6A 5ENQD 3NZUA 3HG0D 4Z68A 2UY1B 3UT8A 3UM3A 2XRYA 1TN8A 5AENA 3VTXA 1JCRA 4I6JA 5AAOA 4GZ5A 5C2YA 1HO8A 3ONKA 5D0QD 2A5UA 1JWGA 4GCNA 4WUYA 3AS5A 1HG2A 3WXXA 2AXUA 3ZYQA 4NRHB 3TL5A 5KJKA 4WNFA 2OVFA 2RFAA 3RRUA 2IFUA 1O1SA 2GRPB 5HS0A 4UI9K 4JW1A 4ACLA 5CCLA 1PAQA 3SFYA 2E0IA 2RKKA 3OTNA 5FZRA 3HXBA 4LERA 3LCAA 3FUDA 2Y4UA 3ZHEA 4NQ0A 3AG4E 3VTYA 5FQ4A 4BFRA 1BPOA 3HDXA 5HQ8A 2I1KA 4BEPA 3FULA 2XQ0A 3BQOA 5KBAA 3FUJA 3LJNA 3ULEG 4AVXA 4ATZD 2BTDA 3D3MA 3ZGQA 4GPKA 3CQCB 5E75A 1IQUA 3VLDA 3CHPA 3IEGA 1RW2A 4AY5A 3L13A 3TG4A 2KATA 3JUIA 4GTSA 1TNZA 3OAWA 1Z3YA 3D9MA 4CYMD 3FUFA 3D9HA 2YNQA 4I6EA 3LXUX 1TYQG 3GZ2A 5CRVA 4LNGA 1IHGA 1QBQA 4ILHB 2ETBA 3CVLA 2VGXA 1D8EA 4KBQA 4EBAA 5AARA 3W9FA 3ZIMA 1OCOE 4EHMA 1OCCE 1EYHA 4I43A 1S0PA 4WWOA 1H6KA 4A1SA 4M3OA 3LVQE 3V2OA 3ENEA 3PZ4A 3TXMA 5CBNA 1IXVA 2CFZA 4EBAG 2BF0X 4DX5D 3AG3E 4KT6B 3JQ1A 4K5BA 5H7PA 2MYOA 3ULYA 2XS8A 2H6IA 5ENTD 2B0OE 4R7LA 3UUXA 5M72A 3RRMB 2P9IG 3QB2A 3RSEG 3NQPA 3WG7E 1E8ZA 3RJVA 3EDTB 2XZTG 3CKCA 5FQ8A 3HRAA 1OWMA 3FU5A 2RFMA 3CSFA 4IULA 2X6FA 5EIBE 4FA6A 1SA4A 1X81A 3PH0C 3O48A 5LCWJ 1UJJA 3ONLA 3RRNB 3Q9NC 4MLPA 3TGOA 4UWKA 2VSYA 4PS7A 4O60A 1H6OA 2H6HA 1B89A 1ZU2A 4U96D 2GW1A 3LKUA 2RG8A 1SVXA 2YHEA 4ATGA 2WXJA 3HYMB 4N5CA 2OCCE 4Q69A 5BNWA 3L9TA 2J07A 3FFLA 1TN7A 4A3VA 1A5EA 2JEKA 1H2UA 3CVVA 4ANXA 4GZDA 3LDZA 4YDEA 3CV0A 3LVRE 4WNDA 2M63A 3C98A 3S7DA 2L0IA 5JJ7A 3GZ1A 4GTRA 4FC8A 4EZJA 1AP7A 3HXDA 2JABA 1O5MA 5ENSD 2FULA 3KSLA 3VLFA 1TNYA 4TRQA 2KC7A 4HI9A 2ZGGA 5T8IA 4RVBA 3Q78A 4GMRA 1ZBPA 1WG0A 4L7TA 3PVLA 2AVPA 1HS6A 1UN9A 1TNOA 4KZ0A 3ZXSA 2WXRA 3UI2A 1MX4A 1VDYA 2RD0A 3T8MA 1HZ4A 2J49A 1E90A 3CK7A 4N3CA 1BI7B 3Q9UC 5B1BE 3UIPC 1NA3A 2XENA 2WXKA 4N39A 2F0YA 4CDRA 3Q5MA 2R5SA 2PQNA 5EN5D 3SO8A 4DRXE 1W3BA 1JPLA 4G8LA 1NFIE 3AS4A 4I1OB 3CVWA 4FHKA 3ZRHA 4FJZA 1HFAA 4G25A 3MKQB 1OCZE 4BTAA 3E32A 4F3VA 5DBKA 2YINA 1N94A 1HG5A 3EU9A 3FTXA 3HXEA 2KZTA 3SFXA 4IYPA 3RAUA 1BD8A 4K5AB 4DX7D 1ZB1A 1UJKA 3MV2B 4HORA 1MYOA 5LX8A 3ZFWA 3CVYA 4HRNA 4CGWA 4LRZA 3QNKA 2VTBB 3AU4A 5FINA 3U4TA 2DZOA 4ABNA 3RO2A 2IY0C 3NZSA 3D9LA 3SQVA 2NYJA 5E76A 3HXCA 4ANVA 3UPVA 2OEVA 3CR3A 1X5BA 4GAAA 3HVEA 2WXLA 5FJYA 3UM1A 5DIZA 3KD7A 2P9PG 3SFZA 5AN8A 3C5RA 3ZNGA 4LCTA 3IHYA 1EF1C 5G05C 4KVMA 4MBGA 2YHCA 3V2XA 2EIJE 2XGSA 1WDYA 4F53A 4LEUA 3ZYMA 1TR4A 1YMPA 4A1GA 1DC2A 2A5EA 5J08A 1AWCB 3D9PA 3ASFA 4J8DA 3ABME 1HXIA 2F8XK 2EIME 3FUIA 4J0UA 3SGHA 4RSYA 1JWFA 3DSTA 5EIDA 1PC2A 4OVUA 2KCVA 3DBSA 2IQCA 2H6FA 3DEPA 2OEWA 4JZYA 3CVPA 5ANLA 1U3CA 1N9AA 4CZ2D 3P1UA 3APDA 4U0UA 4K03A 1KZOA 2J8SD 4XE0A 5CEAA 4JHRA 3TWWA 3APCA 2BUGA 2KBXA 3I4GA 3CK9A 4GCOA 2ZU6B 1H2VC 2R59A 3U9WA 2OV8A 4XEIG 2AWIA 3EHRA 1FVFA 2PL2A 3U66A 3L22A 3QC1A 3DEOA 3U64A 3UKUG 3L17A 3ZN3A 4HNAD 1HX8A 5ENOD 4GMJA 4MRUA 4XIFA 3TWRA 2HYZA 2F8YA 2V8SE 2XEHA 3QOUA 3TWTA 4U63A 3EJNA 4JXTA 3ZHEB 3MCXA 3Q73A 3TWUA 2DWZA 3UQ3A 5KJLA 5FQ6A 5FQ7A 3E30A 2VQ2A 3Q7AA 3CSTA 2KXPC 4HRLA 2QYJA 2P9SG 1OWOA 3MZLB 2V4HC 4FU3A 4L2LA 4NURA 4N5QA 4HOTA 1OUVA 1UN8A 4CT0A 3PE3A 4HOQA 5IY5E 2Y0BG 4I2ZA 4GTQA 3FUEA 4GU5A 1HU3A 3JYSA 5CMYA 4CDNA 3V30A 2P9UG 2DBAA 1WAO1 4B93B 3PRZA 1JUQA 1KLXA 1YA0A 3TXNA 3CKBA 4U8YD 1O1TA 1MX6A 2WQHA 4C0EA 4K5CA 4RQIA 2UY1A 2VYIA 3PZ2A 3FTUA 2EILE 2IU1A 3PDNA 5EX3A 2P9KG 2L0TB 2WXQA 3CVNA 2H6GA 3APFA 3FEYA 4XKCA 1E8YA 3DXMG 2J08A 4GA0A 4UQYA 4JD2G 2WXFA 1ELKA 3DXKG 2ZXWE 2Y1LE 4G1TA 2EQXA 4B8AA 1KT0A 5EKQD 2X3MA 4DI3A 2J4DA 4AXHA 3DSXA 3ZW3A 4UQZA 4G23A 4A55A 2Y3AA 4Q96A 4FHJA 3PNTB 3CQGB 4FP7A 3N71A 1OWNA 2MRIA 5HI7A 3K9IA 2Y4TA 3UXGA 1H19A 3JCKC 3QJZA 3C3RA 2WXGA 4GPMA 2NC9A 4UUCA 3J5PA 4G8KA 3QKYA 4E85A 5G04J 3ASHA 5ITZF 4Y6WA 3KEAA 3MKRA 4UWHA 3DSVA 4GYOA 3FU3A 4KZCA 5BW8C 1K1AA 3RO3A 3ESKA 4TXRA 4G2VA 3I4RB 3OXGA 4BWRA 1ELWA 3IKOB 1E8XA 2EIKE 3L16A 3FU6A 2XPIA 4YDYA 4J8SA 3D9NA 2BKKB 2I2OA 3AU5A 4H7XA 4ANUA 1HE8A 2CFUA 4IN3B 4BX8A 2ONDA 4DJAA 1Q2ZA 2IOSA 4GTMA 1BLXB 2GRLA 3B13A 5D2MC 3S7BA 5KWDA 4EECA 3PNLB 4GTTA 2XS1A 4EZKA 3UINC 3C72A 5LFAA 1OXJA 3QWPA 5HKPA 1NA0A 3NBNB 3E34A 2ETAA 4YVQC 4W9RA 3IXEA 4UI9J 3TWXA 4CT4A 2WQ7A 4BT8A 1TN6A 3EUVA 4PUCA 1H0AA 3MX3A 4O1OA 2GRNB 3GZSA 3PEUB 5EDSA 4HLLA 3ZKJA 3LS8A 2WXPA 4E6HA 3UX4A 4DX2A 5FZSA 1K3ZD 2XCBA 1N52A 4F6RD 4U8HA 3BG1B 1WY6A 5CBOA 3L08A 3D9JA 3EIJA 3Q7FA 1V54E 1IYGA 3CHRA 1Z5SC 3J5QB 4U0SA 1EDUA 3SI5A 3T5VA 3IBEA 3T5XA 1U2VG 4H7YA 3O4ZA 3ML8A 1TNUA 2X38A 4X8QA 4PDXA 3Q47B 2Y69E 2KZTB 3V79K 3FTZA 4I9CA 3IV0A 2DYSE 4URKA 3HHMA 2WXOA 3KS2A 2V0PA 4C0MA 5ANRA 3FUHA 2VJ8A 4RG6A 3LJ3A 3R9AB 4ZFHA 5AIJA 1OY3D 1UG3A 4IRUA 4CDMA 2CHZA 3JXIA 3P2BA 3MA5A 3ASGA 4JPSA 3EU5A 3UMVA 4CGVA 1MZCA 2JLBA 2XHEA 5EYLA 4GZCA 3Q79A 1DNPA 3ASNE 1OWPA 3FWVA 3CVXA 1Y8MA 2V5FA 5D0OD 5BXUA 3Q4AB 4AEZC 3HVEB 4JEUA 1V55E 3FDHA 2CHWA 3TWVA 2HE0A 4LNBA 5FIOA 4DUIA 2WM9A 4N3AA 2QZAA 2UWJG 1N54A 2WXNA 2DYRE 2FI7A 2X6JA 3AS8A 4I1MA 4HFGA 3ZEFA 5KJMA 1YYHA 2R2LA 1Y6IA 4TXQA 4C48B 2OVBA 3ZXPA 5ENNA 2DVWA 3PEVB 3C3OA 3L6AA 5KJNA 4AY6A 4EZLA 4F1PA 3EHMA 1N11A 2VGYA 4LUNU 3UM2A 3KEZA 2PM7A 4CCAA 3MYVA 5BUZA 3LY7A 2WXHA 5JHAA 2VSNA 3FHEA 4JEHA 4HBDA 2R05A 4UWGA 2WB2A 5LCWC 2ETCA 3AG2E 3G2VA 2AJAA 2GGFA 2LAIA 4PH4B 3E33A 3FUNA 3UTMA 1N4SA 3MGBA 4N2QA 1UOHA 3MKQA 3JUEA 3SZ7A 4CRWA 4J8FA 4I6GA 3ZVVA 2VGEA 2WPVA 3LEWA 2GROB 5EILA 3RIBA 3PREA 2R02A 3Q15A 3SHFA 2I9CA 1LD7A 1G3NB 1NI1A 3UT7A 4JHKA 4XI9A 4HOSA 2XRZA 1TJCA 2IJGX 2X6KA 3DSUA 4XKBA 4TUMA 4AV7A 2DIWA 1H2TC 3FTSA 4M7CA 3ESLA 2XGOA 4PS8A 5AJDA 4NIKA 3ULQA 5AYWD 2IONA 5CECB 3CLJA 3RK6A 3FTWA 2FO7A 3CGHA 3G2TA 3EHNA 3B7TA 3BG0B 2FBNA 4JB8P 2V4LA 3R9MA 2XPYA 1E7UA 3KSQA 2ZIRA 2R17C 2CHXA 2HM8A 4J8YA 2P58C 5CHEE 4L2YA 3I3NA 2XCCA 2KM4A 3NF1A 4DX6D 4B94A 4WAFA 3ABLE 4LG6A 3E4BA 3NB2A 2LO6A 4N3BA 4PS3A 1SQMA 1Z3XA 1MX2A 3TWSA 2XGMA 5CEDB 3PZDA 4U7EB 1JCSA 3JQ0A 1DCQA 2WMOA 2PZIA 1KPSB 2LAHA 4L1BA 5T4YA 3CK8A 3B95A 4MKTA 1UW4B 5JHBA 3SF4A 4HLEA 5AQ7A 5KCMA 3MJWA 2CG3A 4GZ6A 3S2AA 2IF4A 1KZPA 2J4BA 3TG5A 4NACA 3DSWA 4V3IA 1SZ9A 1FPPA 4I9EA 2PNNA 3L54A 1BI8B 4RLYA 4N2SA 3IHVA 2C0LA 4DPRA 4ZHBA 5J90A 4OAVB 5G2NA 4ME2A 4BETA 3ZYLA 3ABKE 3F6QA 1A17A 1LTXA 3D9KA 2XEVA 2HO1A 2QFCA 1S64A 2WXMA 2IO3C 3OXLA 4DK5A 2VGXB 1QQEA 2LXMA 2MOWA 1E7VA 2QY7A 3HXFA 4GTOA 4XX5A 4A63B 4GYYA 4AP2A 4F1SA 3SBTB 4JA9A 3FEXA 1LF8A 4J6IA 5D66A 2X6HA 4HVBA 2L6BA 3TAXA 1INZA 3DWLG 4YNDA 3S7JA 4APFA 4GB9A 1ELRA 4Y6CA 1OWLA 2J9QA 5AQBA 4DLQA 4U07A 3G2SA 2X6IA 4B0ZA 1N4RA 4Q94A 1SZAA 1OCRE 3X2QE 3KAEA 1GW6A 4LNUD 1PY1A 4APOA 5C1DA 3D9OA 1SA5A 3QK0A 2C0MA 4YDWA 4OAUC 4UQXA 2BKGA 3MEKA 4G24A 2IEJA 1MJ0A 5ENRD 5AQAA 1K1BA 4OVVA 3EHQA 4JA7A 3QARA 5B1AE 3LY8A 4FULA 4FLHA 4C9BB 1NZNA 5ARGA 4KVOA 2LSVA 3ZPJA 4RG9A 3PE4A 3URZA 5BXOA 3Q49B 3I5PA 5BV1A 1FCHA 1YCSB 3FUKA 3EIQC 4GTVA 4XI0A 3RU0A 3TJPA 2WXIA 1QNFA 4DI4A 1O1RA 1TEZA 1NL4A 4KYOB 4FJYA 2AXVA 3ZUVB 4TUUA 2L6JA 2B6CA 2VSXE 1TJFA 3CHQA 1IKND 3G2WA 2VSOE 2FO1E 5LP0A 3C3QA 3CVQA 3QAQA 2ZGDA 3LPZA 4U95D 2P9NG 4HB5A 3T9KA 2QC9A 4WWPA 2F37A 4TXPA 5B3SE 2EINE 2PQRA 3FUMA 2R03A 5G05J 4MS6A 4BSZB 5ENPD 1DVPA 2C2LA 1FT1A 1HF8A 4TV3A 5A7DB 2GRQB 4KMOA 3FY4A 2LNIA 3L82A 2I1JA 3FH7A 3E37A 4GYWA 3D9IA 4QFVA 5JA4D 1P5QA 1D9SA 3CHOA 4AOFA 3MV3B 3BU8A 5EX0A 2AXZA 4WNEA 5KNHD 3BUAA 2KCLA 1S70B 3NOGD 4YVOA 3DPDA 4FADA 5T3RA 3FU0A 1D8DA 2FF4A 5G55A 2FEZA 3JXJA 4J8EA 4HOUA 2KCKA 1IQRA 3FP3A 5A6CA 1XGWA 3R7QA 4XZ4A 2WQ6A 3T8KA 1FT2A 2HR2A 2I6HA 4DX1A 5CMWA 2MHKA 3ISMC 5JJ6A 1BU9A 2IO2C 4P29A 3FTVA 3LY9A 4U8VD 3SY2A 4A3TA 4U0ZA 3G2UA 4KXKB 2DZNA 1KT1A 4ACKA 2QYUA 4I1AA 5JJTA 4BY6A 5FWQA 1HH8A 1DCEA 4GMLA 1MHQA 3PUJA 1N4PA 3B7SA 3AJIA 4GZ3A 1JCQA 4GTPA 3R7RA 3UIOC 4UWLA 3SD5A 3GW4A 5KNGA 4D10C 4F7AA 2IOLA 1E8WA 3PZ1A 4YDOA 5G04C 5JMND 3FH8A 1XNFA 3DPYA 2DCPA 3CHMA 3UM0A 1S63A 4I2WA 3U3WA 4G26A 2LSUA 3ASDA 4B8CB 1MQSA 2GRMA 4WNGA 3AAAC 3AG1E 1U3DA 1WM5A 2E2EA 1E96B 4WWNA 3LYAA 2XZDG 4HS2A 1QYMA 2P2CP 2NXPA 1N95A 2J09A 5EYPF 2AW6A 1N4QA 3HIZA 3QWVA 4J7WA 4U04A 2ILRA 2BEDA 5BV0A 4BT9A 3V31A 3NAWA 3TWQA 3CVUA 3PZ3A 2A4ZA 5CCMA 2CG2A 3B7RL 3VLEA 2V5QC 4UWFA 3DRAA 5FT9A 2Q7FA 2P9LG 4I17A 4JVSA 2ZISA 3ML9A 1IHBA 3B7UX 4L9PA 4BESA 4UI9C 1N0RA 3CHSA 3DSSA 2L9BA 3QDNA 3SNXA 5HRYA 2XEEA 4AJWA 5BT1A 5LOZA 4BSXA 4BTBA 2YQ8A 4K0RA 4HXIA 2LUHA 2VTBA 4EQFA 1RZ4A 3CIAA 4JHJA 1H6PA 4LSZE 1L5JA 2WMNA 4FLBA 1Z6TA 3QWWA 2WVIA 5AJLA 4JL0A 4HI8A 2GRRB 3Q75A 3B7BA 2XPZA 4OYSA 4AIFA 4BX9A 5CERB 4AM9A 1N0QA 2OOEA 4GA1A 4CEMA 5AQ9A 3CEQA 4HRMB 4JC8A 5A23A 3FTYA 1TNBA 4HQDA 3NOCD 1QZ2A 4B89A 3PS6A 5BPPA 3GYZA
chains in the Genus database with same CATH topology
3NBNB 3ZU7B 4K5AB 3T8KA 2ETAA 5CEDB 1OT8A 2VGEA 4DX7D 4N5QA 3V2OA 3TWQA 3V31A 3IXEA 3TWXA 3DEPA 5CBNA 1IKND 4DX1A 1IXVA 1DCQA 5BXUA 5EILA 2FO1E 4CZ2D 1BU9A 4DX5D 1AP7A 4O1OA 1MYOA 4K5BA 2V5QC 2JABA 2MYOA 2ZGDA 2J8SD 4HLLA 4HRNA 3TWVA 5AQBA 3UXGA 3ZKJA 4BERA 4BEPA 2HE0A 2Y0BG 5ENSD 5FINA 3B95A 5CEAA 2DZOA 4U95D 4HB5A 5FIOA 5ENTD 4U8VD 2B0OE 3TWWA 4DUIA 4DX2A 1G3NB 4GPMA 3T9KA 2KBXA 1K3ZD 5KBAA 4UUCA 2DZNA 4HI9A 3W9GA 1IHBA 2ZGGA 3J5PA 3LJNA 4G8KA 4F6RD 4GMRA 4BESA 2QC9A 4LNUD 1WG0A 2F37A 2NYJA 5ITZF 1N0RA 5AQ7A 3V30A 4ATZD 3KEAA 5CBOA 4QQIA 3TWSA 4B93B 2XZTG 4TUMA 3EHRA 3HRAA 4BSZB 4O1PA 3AJIA 5ENPD 1K1AA 4YDWA 2XEEA 5HRYA 3J5QB 2RFMA 4OAUC 1SW6A 2BKGA 5ENQD 1YYHA 3DEOA 5EIBE 3HG0D 3UI2A 4HNAD 4Z68A 5KNGA 1MX4A 4NIKA 1MJ0A 5ENRD 4C48B 4U8YD 5AQAA 1K1BA 5ENOD 2DVWA 2PNNA 3EHQA 1MX6A 1BI8B 3Q9NC 4RLYA 3TWRA 5CECB 4K5CA 5JMND 5AAOA 4LSZE 2F8YA 3C5RA 5AN8A 1BI7B 3ZNGA 4F1PA 3Q9UC 2XEHA 3V79K 4ZHBA 1N11A 2XENA 4YDYA 3TWTA 4O60A 4OAVB 4QFVA 2BKKB 4JB8P 5JA4D 4U96D 4BETA 4CYMD 4HI8A 3F6QA 3V2XA 5BXOA 3D9HA 1D9SA 1WDYA 5EN5D 3SO8A 3B7BA 5HKPA 4DRXE 4HBDA 3TWUA 4G8LA 1TR4A 2DWZA 1NFIE 1YMPA 2ETCA 1SVXA 4ZFHA 2AJAA 5KNHD 3AAAC 1DC2A 4J8YA 5CERB 1OY3D 2A5EA 1N0QA 1BLXB 1S70B 3NOGD 1AWCB 1YCSB 3JXIA 2RFAA 2ETBA 5AQ9A 5KWDA 4HRMB 4DX6D 2KXPC 5HS0A 4A63B 1A5EA 2Y1LE 4LG6A 5AARA 3W9FA 2F8XK 4HQDA 2XZDG 4HRLA 3JXJA 3UTMA 2QYJA 1QYMA 2P2CP 3EU9A 3NOCD 1UOHA 2V4HC 5D66A 5EYLA 5EYPF 3JUEA 2L6BA 4J7WA 5EIDA 3ZUVB 1MX2A 1BD8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NBN B;  3ZU7 B;  4K5A B;  3T8K A;  2ETA A;  5CED B;  1OT8 A;  2VGE A;  4DX7 D;  4N5Q A;  3V2O A;  3TWQ A;  3V31 A;  3IXE A;  3TWX A;  3DEP A;  5CBN A;  1IKN D;  4DX1 A;  1IXV A;  1DCQ A;  5BXU A;  5EIL A;  2FO1 E;  4CZ2 D;  1BU9 A;  4DX5 D;  1AP7 A;  4O1O A;  1MYO A;  4K5B A;  2V5Q C;  2JAB A;  2MYO A;  2ZGD A;  2J8S D;  4HLL A;  4HRN A;  3TWV A;  5AQB A;  3UXG A;  3ZKJ A;  4BER A;  4BEP A;  2HE0 A;  2Y0B G;  5ENS D;  5FIN A;  3B95 A;  5CEA A;  2DZO A;  4U95 D;  4HB5 A;  5FIO A;  5ENT D;  4U8V D;  2B0O E;  3TWW A;  4DUI A;  4DX2 A;  1G3N B;  4GPM A;  3T9K A;  2KBX A;  1K3Z D;  5KBA A;  4UUC A;  2DZN A;  4HI9 A;  3W9G A;  1IHB A;  2ZGG A;  3J5P A;  3LJN A;  4G8K A;  4F6R D;  4GMR A;  4BES A;  2QC9 A;  4LNU D;  1WG0 A;  2F37 A;  2NYJ A;  5ITZ F;  1N0R A;  5AQ7 A;  3V30 A;  4ATZ D;  3KEA A;  5CBO A;  4QQI A;  3TWS A;  4B93 B;  2XZT G;  4TUM A;  3EHR A;  3HRA A;  4BSZ B;  4O1P A;  3AJI A;  5ENP D;  1K1A A;  4YDW A;  2XEE A;  5HRY A;  3J5Q B;  2RFM A;  4OAU C;  1SW6 A;  2BKG A;  5ENQ D;  1YYH A;  3DEO A;  5EIB E;  3HG0 D;  3UI2 A;  4HNA D;  4Z68 A;  5KNG A;  1MX4 A;  4NIK A;  1MJ0 A;  5ENR D;  4C48 B;  4U8Y D;  5AQA A;  1K1B A;  5ENO D;  2DVW A;  2PNN A;  3EHQ A;  1MX6 A;  1BI8 B;  3Q9N C;  4RLY A;  3TWR A;  5CEC B;  4K5C A;  5JMN D;  5AAO A;  4LSZ E;  2F8Y A;  3C5R A;  5AN8 A;  1BI7 B;  3ZNG A;  4F1P A;  3Q9U C;  2XEH A;  3V79 K;  4ZHB A;  1N11 A;  2XEN A;  4YDY A;  3TWT A;  4O60 A;  4OAV B;  4QFV A;  2BKK B;  4JB8 P;  5JA4 D;  4U96 D;  4BET A;  4CYM D;  4HI8 A;  3F6Q A;  3V2X A;  5BXO A;  3D9H A;  1D9S A;  1WDY A;  5EN5 D;  3SO8 A;  3B7B A;  5HKP A;  4DRX E;  4HBD A;  3TWU A;  4G8L A;  1TR4 A;  2DWZ A;  1NFI E;  1YMP A;  2ETC A;  1SVX A;  4ZFH A;  2AJA A;  5KNH D;  3AAA C;  1DC2 A;  4J8Y A;  5CER B;  1OY3 D;  2A5E A;  1N0Q A;  1BLX B;  1S70 B;  3NOG D;  1AWC B;  1YCS B;  3JXI A;  2RFA A;  2ETB A;  5AQ9 A;  5KWD A;  4HRM B;  4DX6 D;  2KXP C;  5HS0 A;  4A63 B;  1A5E A;  2Y1L E;  4LG6 A;  5AAR A;  3W9F A;  2F8X K;  4HQD A;  2XZD G;  4HRL A;  3JXJ A;  3UTM A;  2QYJ A;  1QYM A;  2P2C P;  3EU9 A;  3NOC D;  1UOH A;  2V4H C;  5D66 A;  5EYL A;  5EYP F;  3JUE A;  2L6B A;  4J7W A;  5EID A;  3ZUV B;  1MX2 A;  1BD8 A; 
#chains in the Genus database with same CATH topology
 3ZU7 B;  5ARF A;  4EPZ A;  1OT8 A;  1FVH A;  3BEE A;  3ZYK A;  4L23 A;  2PM6 A;  4G11 A;  2LXL A;  3UKR G;  1LD8 A;  3ASO E;  1NP7 A;  3PUK A;  4ILG A;  4BER A;  3UT4 A;  2NSZ A;  3OXF A;  3RKV A;  1EPU A;  4ILI A;  3SBS A;  3W9G A;  4ANW A;  3FH5 A;  4QQI A;  4DLO A;  5CRU A;  5FZQ A;  1K8K G;  3S7F A;  4GA2 A;  5FTP A;  4O1P A;  4O6F A;  1SW6 A;  5ENQ D;  3NZU A;  3HG0 D;  4Z68 A;  2UY1 B;  3UT8 A;  3UM3 A;  2XRY A;  1TN8 A;  5AEN A;  3VTX A;  1JCR A;  4I6J A;  5AAO A;  4GZ5 A;  5C2Y A;  1HO8 A;  3ONK A;  5D0Q D;  2A5U A;  1JWG A;  4GCN A;  4WUY A;  3AS5 A;  1HG2 A;  3WXX A;  2AXU A;  3ZYQ A;  4NRH B;  3TL5 A;  5KJK A;  4WNF A;  2OVF A;  2RFA A;  3RRU A;  2IFU A;  1O1S A;  2GRP B;  5HS0 A;  4UI9 K;  4JW1 A;  4ACL A;  5CCL A;  1PAQ A;  3SFY A;  2E0I A;  2RKK A;  3OTN A;  5FZR A;  3HXB A;  4LER A;  3LCA A;  3FUD A;  2Y4U A;  3ZHE A;  4NQ0 A;  3AG4 E;  3VTY A;  5FQ4 A;  4BFR A;  1BPO A;  3HDX A;  5HQ8 A;  2I1K A;  4BEP A;  3FUL A;  2XQ0 A;  3BQO A;  5KBA A;  3FUJ A;  3LJN A;  3ULE G;  4AVX A;  4ATZ D;  2BTD A;  3D3M A;  3ZGQ A;  4GPK A;  3CQC B;  5E75 A;  1IQU A;  3VLD A;  3CHP A;  3IEG A;  1RW2 A;  4AY5 A;  3L13 A;  3TG4 A;  2KAT A;  3JUI A;  4GTS A;  1TNZ A;  3OAW A;  1Z3Y A;  3D9M A;  4CYM D;  3FUF A;  3D9H A;  2YNQ A;  4I6E A;  3LXU X;  1TYQ G;  3GZ2 A;  5CRV A;  4LNG A;  1IHG A;  1QBQ A;  4ILH B;  2ETB A;  3CVL A;  2VGX A;  1D8E A;  4KBQ A;  4EBA A;  5AAR A;  3W9F A;  3ZIM A;  1OCO E;  4EHM A;  1OCC E;  1EYH A;  4I43 A;  1S0P A;  4WWO A;  1H6K A;  4A1S A;  4M3O A;  3LVQ E;  3V2O A;  3ENE A;  3PZ4 A;  3TXM A;  5CBN A;  1IXV A;  2CFZ A;  4EBA G;  2BF0 X;  4DX5 D;  3AG3 E;  4KT6 B;  3JQ1 A;  4K5B A;  5H7P A;  2MYO A;  3ULY A;  2XS8 A;  2H6I A;  5ENT D;  2B0O E;  4R7L A;  3UUX A;  5M72 A;  3RRM B;  2P9I G;  3QB2 A;  3RSE G;  3NQP A;  3WG7 E;  1E8Z A;  3RJV A;  3EDT B;  2XZT G;  3CKC A;  5FQ8 A;  3HRA A;  1OWM A;  3FU5 A;  2RFM A;  3CSF A;  4IUL A;  2X6F A;  5EIB E;  4FA6 A;  1SA4 A;  1X81 A;  3PH0 C;  3O48 A;  5LCW J;  1UJJ A;  3ONL A;  3RRN B;  3Q9N C;  4MLP A;  3TGO A;  4UWK A;  2VSY A;  4PS7 A;  4O60 A;  1H6O A;  2H6H A;  1B89 A;  1ZU2 A;  4U96 D;  2GW1 A;  3LKU A;  2RG8 A;  1SVX A;  2YHE A;  4ATG A;  2WXJ A;  3HYM B;  4N5C A;  2OCC E;  4Q69 A;  5BNW A;  3L9T A;  2J07 A;  3FFL A;  1TN7 A;  4A3V A;  1A5E A;  2JEK A;  1H2U A;  3CVV A;  4ANX A;  4GZD A;  3LDZ A;  4YDE A;  3CV0 A;  3LVR E;  4WND A;  2M63 A;  3C98 A;  3S7D A;  2L0I A;  5JJ7 A;  3GZ1 A;  4GTR A;  4FC8 A;  4EZJ A;  1AP7 A;  3HXD A;  2JAB A;  1O5M A;  5ENS D;  2FUL A;  3KSL A;  3VLF A;  1TNY A;  4TRQ A;  2KC7 A;  4HI9 A;  2ZGG A;  5T8I A;  4RVB A;  3Q78 A;  4GMR A;  1ZBP A;  1WG0 A;  4L7T A;  3PVL A;  2AVP A;  1HS6 A;  1UN9 A;  1TNO A;  4KZ0 A;  3ZXS A;  2WXR A;  3UI2 A;  1MX4 A;  1VDY A;  2RD0 A;  3T8M A;  1HZ4 A;  2J49 A;  1E90 A;  3CK7 A;  4N3C A;  1BI7 B;  3Q9U C;  5B1B E;  3UIP C;  1NA3 A;  2XEN A;  2WXK A;  4N39 A;  2F0Y A;  4CDR A;  3Q5M A;  2R5S A;  2PQN A;  5EN5 D;  3SO8 A;  4DRX E;  1W3B A;  1JPL A;  4G8L A;  1NFI E;  3AS4 A;  4I1O B;  3CVW A;  4FHK A;  3ZRH A;  4FJZ A;  1HFA A;  4G25 A;  3MKQ B;  1OCZ E;  4BTA A;  3E32 A;  4F3V A;  5DBK A;  2YIN A;  1N94 A;  1HG5 A;  3EU9 A;  3FTX A;  3HXE A;  2KZT A;  3SFX A;  4IYP A;  3RAU A;  1BD8 A;  4K5A B;  4DX7 D;  1ZB1 A;  1UJK A;  3MV2 B;  4HOR A;  1MYO A;  5LX8 A;  3ZFW A;  3CVY A;  4HRN A;  4CGW A;  4LRZ A;  3QNK A;  2VTB B;  3AU4 A;  5FIN A;  3U4T A;  2DZO A;  4ABN A;  3RO2 A;  2IY0 C;  3NZS A;  3D9L A;  3SQV A;  2NYJ A;  5E76 A;  3HXC A;  4ANV A;  3UPV A;  2OEV A;  3CR3 A;  1X5B A;  4GAA A;  3HVE A;  2WXL A;  5FJY A;  3UM1 A;  5DIZ A;  3KD7 A;  2P9P G;  3SFZ A;  5AN8 A;  3C5R A;  3ZNG A;  4LCT A;  3IHY A;  1EF1 C;  5G05 C;  4KVM A;  4MBG A;  2YHC A;  3V2X A;  2EIJ E;  2XGS A;  1WDY A;  4F53 A;  4LEU A;  3ZYM A;  1TR4 A;  1YMP A;  4A1G A;  1DC2 A;  2A5E A;  5J08 A;  1AWC B;  3D9P A;  3ASF A;  4J8D A;  3ABM E;  1HXI A;  2F8X K;  2EIM E;  3FUI A;  4J0U A;  3SGH A;  4RSY A;  1JWF A;  3DST A;  5EID A;  1PC2 A;  4OVU A;  2KCV A;  3DBS A;  2IQC A;  2H6F A;  3DEP A;  2OEW A;  4JZY A;  3CVP A;  5ANL A;  1U3C A;  1N9A A;  4CZ2 D;  3P1U A;  3APD A;  4U0U A;  4K03 A;  1KZO A;  2J8S D;  4XE0 A;  5CEA A;  4JHR A;  3TWW A;  3APC A;  2BUG A;  2KBX A;  3I4G A;  3CK9 A;  4GCO A;  2ZU6 B;  1H2V C;  2R59 A;  3U9W A;  2OV8 A;  4XEI G;  2AWI A;  3EHR A;  1FVF A;  2PL2 A;  3U66 A;  3L22 A;  3QC1 A;  3DEO A;  3U64 A;  3UKU G;  3L17 A;  3ZN3 A;  4HNA D;  1HX8 A;  5ENO D;  4GMJ A;  4MRU A;  4XIF A;  3TWR A;  2HYZ A;  2F8Y A;  2V8S E;  2XEH A;  3QOU A;  3TWT A;  4U63 A;  3EJN A;  4JXT A;  3ZHE B;  3MCX A;  3Q73 A;  3TWU A;  2DWZ A;  3UQ3 A;  5KJL A;  5FQ6 A;  5FQ7 A;  3E30 A;  2VQ2 A;  3Q7A A;  3CST A;  2KXP C;  4HRL A;  2QYJ A;  2P9S G;  1OWO A;  3MZL B;  2V4H C;  4FU3 A;  4L2L A;  4NUR A;  4N5Q A;  4HOT A;  1OUV A;  1UN8 A;  4CT0 A;  3PE3 A;  4HOQ A;  5IY5 E;  2Y0B G;  4I2Z A;  4GTQ A;  3FUE A;  4GU5 A;  1HU3 A;  3JYS A;  5CMY A;  4CDN A;  3V30 A;  2P9U G;  2DBA A;  1WAO 1;  4B93 B;  3PRZ A;  1JUQ A;  1KLX A;  1YA0 A;  3TXN A;  3CKB A;  4U8Y D;  1O1T A;  1MX6 A;  2WQH A;  4C0E A;  4K5C A;  4RQI A;  2UY1 A;  2VYI A;  3PZ2 A;  3FTU A;  2EIL E;  2IU1 A;  3PDN A;  5EX3 A;  2P9K G;  2L0T B;  2WXQ A;  3CVN A;  2H6G A;  3APF A;  3FEY A;  4XKC A;  1E8Y A;  3DXM G;  2J08 A;  4GA0 A;  4UQY A;  4JD2 G;  2WXF A;  1ELK A;  3DXK G;  2ZXW E;  2Y1L E;  4G1T A;  2EQX A;  4B8A A;  1KT0 A;  5EKQ D;  2X3M A;  4DI3 A;  2J4D A;  4AXH A;  3DSX A;  3ZW3 A;  4UQZ A;  4G23 A;  4A55 A;  2Y3A A;  4Q96 A;  4FHJ A;  3PNT B;  3CQG B;  4FP7 A;  3N71 A;  1OWN A;  2MRI A;  5HI7 A;  3K9I A;  2Y4T A;  3UXG A;  1H19 A;  3JCK C;  3QJZ A;  3C3R A;  2WXG A;  4GPM A;  2NC9 A;  4UUC A;  3J5P A;  4G8K A;  3QKY A;  4E85 A;  5G04 J;  3ASH A;  5ITZ F;  4Y6W A;  3KEA A;  3MKR A;  4UWH A;  3DSV A;  4GYO A;  3FU3 A;  4KZC A;  5BW8 C;  1K1A A;  3RO3 A;  3ESK A;  4TXR A;  4G2V A;  3I4R B;  3OXG A;  4BWR A;  1ELW A;  3IKO B;  1E8X A;  2EIK E;  3L16 A;  3FU6 A;  2XPI A;  4YDY A;  4J8S A;  3D9N A;  2BKK B;  2I2O A;  3AU5 A;  4H7X A;  4ANU A;  1HE8 A;  2CFU A;  4IN3 B;  4BX8 A;  2OND A;  4DJA A;  1Q2Z A;  2IOS A;  4GTM A;  1BLX B;  2GRL A;  3B13 A;  5D2M C;  3S7B A;  5KWD A;  4EEC A;  3PNL B;  4GTT A;  2XS1 A;  4EZK A;  3UIN C;  3C72 A;  5LFA A;  1OXJ A;  3QWP A;  5HKP A;  1NA0 A;  3NBN B;  3E34 A;  2ETA A;  4YVQ C;  4W9R A;  3IXE A;  4UI9 J;  3TWX A;  4CT4 A;  2WQ7 A;  4BT8 A;  1TN6 A;  3EUV A;  4PUC A;  1H0A A;  3MX3 A;  4O1O A;  2GRN B;  3GZS A;  3PEU B;  5EDS A;  4HLL A;  3ZKJ A;  3LS8 A;  2WXP A;  4E6H A;  3UX4 A;  4DX2 A;  5FZS A;  1K3Z D;  2XCB A;  1N52 A;  4F6R D;  4U8H A;  3BG1 B;  1WY6 A;  5CBO A;  3L08 A;  3D9J A;  3EIJ A;  3Q7F A;  1V54 E;  1IYG A;  3CHR A;  1Z5S C;  3J5Q B;  4U0S A;  1EDU A;  3SI5 A;  3T5V A;  3IBE A;  3T5X A;  1U2V G;  4H7Y A;  3O4Z A;  3ML8 A;  1TNU A;  2X38 A;  4X8Q A;  4PDX A;  3Q47 B;  2Y69 E;  2KZT B;  3V79 K;  3FTZ A;  4I9C A;  3IV0 A;  2DYS E;  4URK A;  3HHM A;  2WXO A;  3KS2 A;  2V0P A;  4C0M A;  5ANR A;  3FUH A;  2VJ8 A;  4RG6 A;  3LJ3 A;  3R9A B;  4ZFH A;  5AIJ A;  1OY3 D;  1UG3 A;  4IRU A;  4CDM A;  2CHZ A;  3JXI A;  3P2B A;  3MA5 A;  3ASG A;  4JPS A;  3EU5 A;  3UMV A;  4CGV A;  1MZC A;  2JLB A;  2XHE A;  5EYL A;  4GZC A;  3Q79 A;  1DNP A;  3ASN E;  1OWP A;  3FWV A;  3CVX A;  1Y8M A;  2V5F A;  5D0O D;  5BXU A;  3Q4A B;  4AEZ C;  3HVE B;  4JEU A;  1V55 E;  3FDH A;  2CHW A;  3TWV A;  2HE0 A;  4LNB A;  5FIO A;  4DUI A;  2WM9 A;  4N3A A;  2QZA A;  2UWJ G;  1N54 A;  2WXN A;  2DYR E;  2FI7 A;  2X6J A;  3AS8 A;  4I1M A;  4HFG A;  3ZEF A;  5KJM A;  1YYH A;  2R2L A;  1Y6I A;  4TXQ A;  4C48 B;  2OVB A;  3ZXP A;  5ENN A;  2DVW A;  3PEV B;  3C3O A;  3L6A A;  5KJN A;  4AY6 A;  4EZL A;  4F1P A;  3EHM A;  1N11 A;  2VGY A;  4LUN U;  3UM2 A;  3KEZ A;  2PM7 A;  4CCA A;  3MYV A;  5BUZ A;  3LY7 A;  2WXH A;  5JHA A;  2VSN A;  3FHE A;  4JEH A;  4HBD A;  2R05 A;  4UWG A;  2WB2 A;  5LCW C;  2ETC A;  3AG2 E;  3G2V A;  2AJA A;  2GGF A;  2LAI A;  4PH4 B;  3E33 A;  3FUN A;  3UTM A;  1N4S A;  3MGB A;  4N2Q A;  1UOH A;  3MKQ A;  3JUE A;  3SZ7 A;  4CRW A;  4J8F A;  4I6G A;  3ZVV A;  2VGE A;  2WPV A;  3LEW A;  2GRO B;  5EIL A;  3RIB A;  3PRE A;  2R02 A;  3Q15 A;  3SHF A;  2I9C A;  1LD7 A;  1G3N B;  1NI1 A;  3UT7 A;  4JHK A;  4XI9 A;  4HOS A;  2XRZ A;  1TJC A;  2IJG X;  2X6K A;  3DSU A;  4XKB A;  4TUM A;  4AV7 A;  2DIW A;  1H2T C;  3FTS A;  4M7C A;  3ESL A;  2XGO A;  4PS8 A;  5AJD A;  4NIK A;  3ULQ A;  5AYW D;  2ION A;  5CEC B;  3CLJ A;  3RK6 A;  3FTW A;  2FO7 A;  3CGH A;  3G2T A;  3EHN A;  3B7T A;  3BG0 B;  2FBN A;  4JB8 P;  2V4L A;  3R9M A;  2XPY A;  1E7U A;  3KSQ A;  2ZIR A;  2R17 C;  2CHX A;  2HM8 A;  4J8Y A;  2P58 C;  5CHE E;  4L2Y A;  3I3N A;  2XCC A;  2KM4 A;  3NF1 A;  4DX6 D;  4B94 A;  4WAF A;  3ABL E;  4LG6 A;  3E4B A;  3NB2 A;  2LO6 A;  4N3B A;  4PS3 A;  1SQM A;  1Z3X A;  1MX2 A;  3TWS A;  2XGM A;  5CED B;  3PZD A;  4U7E B;  1JCS A;  3JQ0 A;  1DCQ A;  2WMO A;  2PZI A;  1KPS B;  2LAH A;  4L1B A;  5T4Y A;  3CK8 A;  3B95 A;  4MKT A;  1UW4 B;  5JHB A;  3SF4 A;  4HLE A;  5AQ7 A;  5KCM A;  3MJW A;  2CG3 A;  4GZ6 A;  3S2A A;  2IF4 A;  1KZP A;  2J4B A;  3TG5 A;  4NAC A;  3DSW A;  4V3I A;  1SZ9 A;  1FPP A;  4I9E A;  2PNN A;  3L54 A;  1BI8 B;  4RLY A;  4N2S A;  3IHV A;  2C0L A;  4DPR A;  4ZHB A;  5J90 A;  4OAV B;  5G2N A;  4ME2 A;  4BET A;  3ZYL A;  3ABK E;  3F6Q A;  1A17 A;  1LTX A;  3D9K A;  2XEV A;  2HO1 A;  2QFC A;  1S64 A;  2WXM A;  2IO3 C;  3OXL A;  4DK5 A;  2VGX B;  1QQE A;  2LXM A;  2MOW A;  1E7V A;  2QY7 A;  3HXF A;  4GTO A;  4XX5 A;  4A63 B;  4GYY A;  4AP2 A;  4F1S A;  3SBT B;  4JA9 A;  3FEX A;  1LF8 A;  4J6I A;  5D66 A;  2X6H A;  4HVB A;  2L6B A;  3TAX A;  1INZ A;  3DWL G;  4YND A;  3S7J A;  4APF A;  4GB9 A;  1ELR A;  4Y6C A;  1OWL A;  2J9Q A;  5AQB A;  4DLQ A;  4U07 A;  3G2S A;  2X6I A;  4B0Z A;  1N4R A;  4Q94 A;  1SZA A;  1OCR E;  3X2Q E;  3KAE A;  1GW6 A;  4LNU D;  1PY1 A;  4APO A;  5C1D A;  3D9O A;  1SA5 A;  3QK0 A;  2C0M A;  4YDW A;  4OAU C;  4UQX A;  2BKG A;  3MEK A;  4G24 A;  2IEJ A;  1MJ0 A;  5ENR D;  5AQA A;  1K1B A;  4OVV A;  3EHQ A;  4JA7 A;  3QAR A;  5B1A E;  3LY8 A;  4FUL A;  4FLH A;  4C9B B;  1NZN A;  5ARG A;  4KVO A;  2LSV A;  3ZPJ A;  4RG9 A;  3PE4 A;  3URZ A;  5BXO A;  3Q49 B;  3I5P A;  5BV1 A;  1FCH A;  1YCS B;  3FUK A;  3EIQ C;  4GTV A;  4XI0 A;  3RU0 A;  3TJP A;  2WXI A;  1QNF A;  4DI4 A;  1O1R A;  1TEZ A;  1NL4 A;  4KYO B;  4FJY A;  2AXV A;  3ZUV B;  4TUU A;  2L6J A;  2B6C A;  2VSX E;  1TJF A;  3CHQ A;  1IKN D;  3G2W A;  2VSO E;  2FO1 E;  5LP0 A;  3C3Q A;  3CVQ A;  3QAQ A;  2ZGD A;  3LPZ A;  4U95 D;  2P9N G;  4HB5 A;  3T9K A;  2QC9 A;  4WWP A;  2F37 A;  4TXP A;  5B3S E;  2EIN E;  2PQR A;  3FUM A;  2R03 A;  5G05 J;  4MS6 A;  4BSZ B;  5ENP D;  1DVP A;  2C2L A;  1FT1 A;  1HF8 A;  4TV3 A;  5A7D B;  2GRQ B;  4KMO A;  3FY4 A;  2LNI A;  3L82 A;  2I1J A;  3FH7 A;  3E37 A;  4GYW A;  3D9I A;  4QFV A;  5JA4 D;  1P5Q A;  1D9S A;  3CHO A;  4AOF A;  3MV3 B;  3BU8 A;  5EX0 A;  2AXZ A;  4WNE A;  5KNH D;  3BUA A;  2KCL A;  1S70 B;  3NOG D;  4YVO A;  3DPD A;  4FAD A;  5T3R A;  3FU0 A;  1D8D A;  2FF4 A;  5G55 A;  2FEZ A;  3JXJ A;  4J8E A;  4HOU A;  2KCK A;  1IQR A;  3FP3 A;  5A6C A;  1XGW A;  3R7Q A;  4XZ4 A;  2WQ6 A;  3T8K A;  1FT2 A;  2HR2 A;  2I6H A;  4DX1 A;  5CMW A;  2MHK A;  3ISM C;  5JJ6 A;  1BU9 A;  2IO2 C;  4P29 A;  3FTV A;  3LY9 A;  4U8V D;  3SY2 A;  4A3T A;  4U0Z A;  3G2U A;  4KXK B;  2DZN A;  1KT1 A;  4ACK A;  2QYU A;  4I1A A;  5JJT A;  4BY6 A;  5FWQ A;  1HH8 A;  1DCE A;  4GML A;  1MHQ A;  3PUJ A;  1N4P A;  3B7S A;  3AJI A;  4GZ3 A;  1JCQ A;  4GTP A;  3R7R A;  3UIO C;  4UWL A;  3SD5 A;  3GW4 A;  5KNG A;  4D10 C;  4F7A A;  2IOL A;  1E8W A;  3PZ1 A;  4YDO A;  5G04 C;  5JMN D;  3FH8 A;  1XNF A;  3DPY A;  2DCP A;  3CHM A;  3UM0 A;  1S63 A;  4I2W A;  3U3W A;  4G26 A;  2LSU A;  3ASD A;  4B8C B;  1MQS A;  2GRM A;  4WNG A;  3AAA C;  3AG1 E;  1U3D A;  1WM5 A;  2E2E A;  1E96 B;  4WWN A;  3LYA A;  2XZD G;  4HS2 A;  1QYM A;  2P2C P;  2NXP A;  1N95 A;  2J09 A;  5EYP F;  2AW6 A;  1N4Q A;  3HIZ A;  3QWV A;  4J7W A;  4U04 A;  2ILR A;  2BED A;  5BV0 A;  4BT9 A;  3V31 A;  3NAW A;  3TWQ A;  3CVU A;  3PZ3 A;  2A4Z A;  5CCM A;  2CG2 A;  3B7R L;  3VLE A;  2V5Q C;  4UWF A;  3DRA A;  5FT9 A;  2Q7F A;  2P9L G;  4I17 A;  4JVS A;  2ZIS A;  3ML9 A;  1IHB A;  3B7U X;  4L9P A;  4BES A;  4UI9 C;  1N0R A;  3CHS A;  3DSS A;  2L9B A;  3QDN A;  3SNX A;  5HRY A;  2XEE A;  4AJW A;  5BT1 A;  5LOZ A;  4BSX A;  4BTB A;  2YQ8 A;  4K0R A;  4HXI A;  2LUH A;  2VTB A;  4EQF A;  1RZ4 A;  3CIA A;  4JHJ A;  1H6P A;  4LSZ E;  1L5J A;  2WMN A;  4FLB A;  1Z6T A;  3QWW A;  2WVI A;  5AJL A;  4JL0 A;  4HI8 A;  2GRR B;  3Q75 A;  3B7B A;  2XPZ A;  4OYS A;  4AIF A;  4BX9 A;  5CER B;  4AM9 A;  1N0Q A;  2OOE A;  4GA1 A;  4CEM A;  5AQ9 A;  3CEQ A;  4HRM B;  4JC8 A;  5A23 A;  3FTY A;  1TNB A;  4HQD A;  3NOC D;  1QZ2 A;  4B89 A;  3PS6 A;  5BPP A;  3GYZ A; 
#chains in the Genus database with same CATH homology
 3NBN B;  3ZU7 B;  4K5A B;  3T8K A;  2ETA A;  5CED B;  1OT8 A;  2VGE A;  4DX7 D;  4N5Q A;  3V2O A;  3TWQ A;  3V31 A;  3IXE A;  3TWX A;  3DEP A;  5CBN A;  1IKN D;  4DX1 A;  1IXV A;  1DCQ A;  5BXU A;  5EIL A;  2FO1 E;  4CZ2 D;  1BU9 A;  4DX5 D;  1AP7 A;  4O1O A;  1MYO A;  4K5B A;  2V5Q C;  2JAB A;  2MYO A;  2ZGD A;  2J8S D;  4HLL A;  4HRN A;  3TWV A;  5AQB A;  3UXG A;  3ZKJ A;  4BER A;  4BEP A;  2HE0 A;  2Y0B G;  5ENS D;  5FIN A;  3B95 A;  5CEA A;  2DZO A;  4U95 D;  4HB5 A;  5FIO A;  5ENT D;  4U8V D;  2B0O E;  3TWW A;  4DUI A;  4DX2 A;  1G3N B;  4GPM A;  3T9K A;  2KBX A;  1K3Z D;  5KBA A;  4UUC A;  2DZN A;  4HI9 A;  3W9G A;  1IHB A;  2ZGG A;  3J5P A;  3LJN A;  4G8K A;  4F6R D;  4GMR A;  4BES A;  2QC9 A;  4LNU D;  1WG0 A;  2F37 A;  2NYJ A;  5ITZ F;  1N0R A;  5AQ7 A;  3V30 A;  4ATZ D;  3KEA A;  5CBO A;  4QQI A;  3TWS A;  4B93 B;  2XZT G;  4TUM A;  3EHR A;  3HRA A;  4BSZ B;  4O1P A;  3AJI A;  5ENP D;  1K1A A;  4YDW A;  2XEE A;  5HRY A;  3J5Q B;  2RFM A;  4OAU C;  1SW6 A;  2BKG A;  5ENQ D;  1YYH A;  3DEO A;  5EIB E;  3HG0 D;  3UI2 A;  4HNA D;  4Z68 A;  5KNG A;  1MX4 A;  4NIK A;  1MJ0 A;  5ENR D;  4C48 B;  4U8Y D;  5AQA A;  1K1B A;  5ENO D;  2DVW A;  2PNN A;  3EHQ A;  1MX6 A;  1BI8 B;  3Q9N C;  4RLY A;  3TWR A;  5CEC B;  4K5C A;  5JMN D;  5AAO A;  4LSZ E;  2F8Y A;  3C5R A;  5AN8 A;  1BI7 B;  3ZNG A;  4F1P A;  3Q9U C;  2XEH A;  3V79 K;  4ZHB A;  1N11 A;  2XEN A;  4YDY A;  3TWT A;  4O60 A;  4OAV B;  4QFV A;  2BKK B;  4JB8 P;  5JA4 D;  4U96 D;  4BET A;  4CYM D;  4HI8 A;  3F6Q A;  3V2X A;  5BXO A;  3D9H A;  1D9S A;  1WDY A;  5EN5 D;  3SO8 A;  3B7B A;  5HKP A;  4DRX E;  4HBD A;  3TWU A;  4G8L A;  1TR4 A;  2DWZ A;  1NFI E;  1YMP A;  2ETC A;  1SVX A;  4ZFH A;  2AJA A;  5KNH D;  3AAA C;  1DC2 A;  4J8Y A;  5CER B;  1OY3 D;  2A5E A;  1N0Q A;  1BLX B;  1S70 B;  3NOG D;  1AWC B;  1YCS B;  3JXI A;  2RFA A;  2ETB A;  5AQ9 A;  5KWD A;  4HRM B;  4DX6 D;  2KXP C;  5HS0 A;  4A63 B;  1A5E A;  2Y1L E;  4LG6 A;  5AAR A;  3W9F A;  2F8X K;  4HQD A;  2XZD G;  4HRL A;  3JXJ A;  3UTM A;  2QYJ A;  1QYM A;  2P2C P;  3EU9 A;  3NOC D;  1UOH A;  2V4H C;  5D66 A;  5EYL A;  5EYP F;  3JUE A;  2L6B A;  4J7W A;  5EID A;  3ZUV B;  1MX2 A;  1BD8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...