4HB5A

Crystal structure of engineered protein. northeast structural genomics consortium target or267.
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
157
structure length
157
Chain Sequence
SELGKRLIEAAENGNKDRVKDLLENGADPNASDSDGRTPLHYAAENGHKEIVKLLLSKGADPNAKDSDGRTPLHYAAENGHKEIVKLLLSKGADPNAKDSDGRTPLHYAAENGHKEIVKLLLSKGADPNTSDSDGRTPLDLAREHGNEEIVKLLEKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords Engineered Protein
publication title Computational design of self-assembling cyclic protein homo-oligomers.
pubmed doi rcsb
source organism Artificial gene
total genus 57
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4hb5A00
3V30A 5AQ7A 4DRXE 5JMND 3TWQA 2XENA 1K3ZD 3DEPA 4GMRA 5AQBA 4BEPA 4C48B 1K1AA 2JABA 5HKPA 5ENSD 4J7WA 2VGEA 3B95A 2QYJA 4HLLA 2DVWA 2KXPC 3EHQA 3DEOA 5HRYA 3J5PA 4UUCA 5ENPD 2NYJA 1WDYA 1DCQA 5AARA 4BSZB 5EILA 1BU9A 2ZGGA 4OAVB 2XZDG 4J8YA 4DX1A 5ITZF 2ETCA 3JXJA 3W9FA 5EN5D 3W9GA 5KNGA 4OAUC 4U96D 3TWUA 3TWVA 5CEAA 1BI7B 3J5QB 3Q9NC 3TWRA 2KBXA 5CECB 1DC2A 3NOGD 3UI2A 2ETBA 3ZU7B 4CZ2D 3NBNB 4CYMD 4K5AB 4A63B 4ZFHA 1MJ0A 5KWDA 3D9HA 1IXVA 1MX6A 5EIDA 1K1BA 3EU9A 5CBNA 2XZTG 1OY3D 4HRLA 1G3NB 5CBOA 1BD8A 1UOHA 5EYLA 4BESA 3ZKJA 4YDWA 1N0QA 2XEEA 4LNUD 4B93B 2J8SD 5CEDB 3HG0D 3ZUVB 4F6RD 1YYHA 4N5QA 1IHBA 2L6BA 1IKND 2F8YA 4ZHBA 3SO8A 2DZNA 3AJIA 4Z68A 3C5RA 4O1PA 1BLXB 2A5EA 4QFVA 4DX5D 3HRAA 2V5QC 5KBAA 3V31A 5BXOA 5AQ9A 3T9KA 3AAAC 4HI8A 2AJAA 1MX2A 5AN8A 3LJNA 4U95D 3V2OA 4BETA 4O1OA 4QQIA 5ENRD 2FO1E 4G8KA 1BI8B 4HBDA 3B7BA 4G8LA 1WG0A 4TUMA 5FIOA 2V4HC 1A5EA 5KNHD 4DX2A 4DX6D 4K5BA 2P2CP 4DUIA 2Y1LE 5AAOA 1TR4A 3T8KA 2MYOA 4U8VD 3KEAA 3TWXA 4F1PA 1MYOA 4ATZD 4JB8P 5FINA 3ZNGA 5EIBE 1D9SA 3Q9UC 5D66A 4RLYA 1OT8A 4O60A 2DZOA 4NIKA 2F37A 5ENQD 4GPMA 5ENTD 1MX4A 5CERB 4K5CA 4DX7D 2XEHA 1AWCB 2BKGA 5EYPF 4HNAD 2DWZA 2QC9A 4HQDA 3IXEA 2RFMA 3UXGA 4HB5A 2F8XK 5AQAA 2ZGDA 5BXUA 3NOCD 3UTMA 3F6QA 3V79K 2B0OE 1S70B 3TWTA 1SW6A 3V2XA 2HE0A 4BERA 4HI9A 1N11A 2BKKB 4YDYA 1YCSB 3JXIA 1SVXA 4U8YD 5ENOD 1YMPA 3TWWA 2Y0BG 2RFAA 1N0RA 4LG6A 3EHRA 4HRNA 3TWSA 1QYMA 2ETAA 5JA4D 1NFIE 2PNNA 4LSZE 5HS0A 4HRMB 3JUEA 1AP7A
chains in the Genus database with same CATH superfamily
5JJ7A 2H6GA 3DBSA 3CHRA 2P9KG 4BWRA 3BU8A 5ENNA 4A3TA 4GZDA 2KXPC 4UUCA 4JPSA 4Y6CA 5ITZF 1TJCA 4CEMA 3ONKA 4KVOA 3PREA 3ZXPA 3CVUA 4L2YA 3APCA 3ZKJA 5CEDB 4U8HA 4N5QA 2WQ7A 3CVPA 4QFVA 3SGHA 1HX8A 2H6FA 3RRNB 3ML9A 5LX8A 1OCRE 5A6CA 4G25A 1LD7A 2R02A 2IY0C 4GYYA 5CRVA 4I2ZA 4DI4A 5BNWA 3QC1A 4L2LA 2QC9A 4HB5A 3BEEA 2IU1A 4JHRA 3D9JA 4XE0A 3FU5A 4I1MA 1EF1C 3FWVA 1NA3A 5CHEE 3Q75A 3D9MA 3CSTA 5DIZA 3ZPJA 3APDA 4LSZE 3E37A 4RVBA 1HF8A 2WPVA 1V54E 3PUKA 3JUEA 3S7JA 1OWLA 3UM2A 4J6IA 2MRIA 3CVYA 4FA6A 4XKBA 3ASHA 4XIFA 2VGEA 3EHQA 3FY4A 1BU9A 1FT2A 2YNQA 5E76A 3CSFA 4ILGA 4RSYA 4A3VA 4DJAA 4Q69A 4CYMD 1K1BA 3PS6A 3P2BA 3GZ1A 3GZSA 4EPZA 1ZB1A 2PL2A 3ASOE 3FUKA 4BX8A 2P9LG 4JXTA 3JQ0A 2LNIA 2DZNA 3JUIA 1U2VG 4F3VA 5KBAA 2L6JA 5KJKA 5LP0A 4U7EB 1MX2A 3BUAA 3OXGA 3TAXA 3ZHEA 2IFUA 1PC2A 2LAIA 4N3CA 3IKOB 5EIBE 3FTSA 4J8FA 2VQ2A 4RG9A 5D66A 3DSVA 1OT8A 4NURA 5ENTD 4GZ5A 1E7VA 1QZ2A 3WG7E 2AXVA 2WXKA 3V79K 3QOUA 4FU3A 3ZGQA 2VTBA 4FHKA 4KMOA 1L5JA 4LCTA 2IEJA 3U66A 5CCLA 4XX5A 1OWMA 4GMJA 3MJWA 3Q15A 3Q4AB 4JEUA 3J5PA 1OWNA 5FZRA 2NYJA 4BSZB 1KLXA 2QFCA 4HS2A 3RJVA 2ZISA 2LAHA 5EKQD 1H0AA 4UI9J 1MZCA 4FLHA 5EIDA 3GZ2A 4I6JA 2CHZA 3CVQA 4YDWA 3VLDA 2A4ZA 2X6FA 3KSLA 3NB2A 2F8YA 1LD8A 3EUVA 1BLXB 2YHEA 4EZLA 3G2SA 2C0MA 5KJMA 4XI0A 4WNGA 2VYIA 2J9QA 4CRWA 4J8SA 3ZFWA 3MKQB 3CVLA 3I4RB 4RLYA 4MLPA 2F37A 1KZOA 3PNLB 3G2TA 1JCQA 2XRZA 4IRUA 2P58C 3IXEA 3UKRG 2E2EA 3UXGA 1H2UA 5T4YA 2DYRE 3DSXA 3L22A 3E4BA 4G24A 1A17A 1YMPA 4HORA 4HRNA 1OUVA 3U64A 3MKRA 3GYZA 2PNNA 3SBSA 5B1BE 4JHJA 1E96B 5JMND 3DEPA 3B95A 1TNOA 4AY5A 2AVPA 2X6HA 4TRQA 1MQSA 2WXNA 3RO2A 4N5CA 3PZ4A 3SBTB 4W9RA 5EN5D 5KNGA 1O1SA 3OXLA 3TWVA 2OOEA 3I3NA 1ZBPA 4EECA 3PDNA 2GRMA 4AEZC 3CQCB 4IYPA 4J8EA 4GA1A 5BUZA 1G3NB 2P9UG 2WMOA 4K03A 1N0QA 2X38A 4D10C 4MRUA 3AJIA 5JJTA 5B3SE 3UQ3A 3ZEFA 2M63A 2Y4UA 2FO1E 2QZAA 4GA2A 3ESLA 2FF4A 5J90A 3LPZA 3S7DA 3R9AB 3Q9UC 2V5FA 3UM3A 3QKYA 3D3MA 5CERB 2XEHA 3DSWA 2AXUA 5BXUA 4WAFA 4LEUA 3Q7AA 2R05A 3U9WA 1HXIA 3KEZA 3LXUX 2X6IA 2B6CA 1QYMA 4GZ6A 3JQ1A 2OV8A 5FZQA 3ZRHA 4M3OA 1N54A 3OAWA 3SI5A 3QJZA 4RG6A 2XRYA 4U0SA 5HKPA 4J7WA 4FHJA 4GZ3A 3DRAA 3MX3A 1KT0A 3SFYA 4J8YA 3S7FA 5JJ6A 1Y6IA 1FVFA 3QARA 5B1AE 3NF1A 4ATGA 3UINC 3EU5A 4HXIA 4KZCA 3IHVA 3G2UA 3FUDA 4B8AA 3E34A 2VSXE 4I1OB 2VGXA 3JYSA 3AG1E 3PZ3A 4H7XA 1PY1A 1FPPA 2A5EA 3SF4A 3V31A 4L9PA 3E33A 3AG3E 3R7QA 3K9IA 2LXMA 4LUNU 2HM8A 4G8LA 1A5EA 3Q79A 4AXHA 4AIFA 2IO3C 5FINA 3ZNGA 3B7RL 3O4ZA 4JVSA 2J4BA 2XPYA 3EHMA 1H6KA 1JWFA 3FUNA 2WQ6A 2P9PG 2RFMA 2GGFA 5HI7A 3SFZA 4AOFA 2F8XK 3ZYQA 2BKKB 5D0QD 2KCLA 4AV7A 3EDTB 1NFIE 2I6HA 3HVEA 2X6JA 3TWQA 1TYQG 1ELRA 3CKCA 3CKBA 1WDYA 3LY7A 2P9IG 1Q2ZA 4KBQA 5G04J 3T5VA 3PE3A 3BQOA 2LSVA 4B89A 1DNPA 3L13A 1RW2A 4HFGA 3TWRA 1TN7A 2WM9A 4WWNA 3KAEA 5KWDA 2V8SE 3OXFA 3DSTA 4U07A 1UOHA 4BFRA 3P1UA 2XGOA 3UT8A 1OCZE 3FP3A 4DX5D 1UJKA 4U0UA 3CK7A 5AQ9A 4BETA 1SA5A 3FHEA 3ASNE 4GA0A 1TEZA 5BW8C 3B7TA 3FTXA 3MCXA 2I1JA 3HXCA 2EIJE 3QAQA 3T8KA 3E30A 1JUQA 2MOWA 3EJNA 3TG4A 3ULEG 3TL5A 2R59A 3ASGA 1AWCB 1XNFA 2EINE 4N39A 2VJ8A 3Q5MA 2KZTA 3IBEA 3NOCD 2AXZA 4ABNA 1SVXA 5ENOD 2YQ8A 3PZ1A 5G55A 3LKUA 4GZCA 5T8IA 3URZA 5AQ7A 4C9BB 3HHMA 4BEPA 1K3ZD 4BSXA 4JW1A 3FH5A 3CK9A 1GW6A 1DCQA 4CGVA 4UI9K 4TXRA 2XZDG 3SFXA 3IV0A 2GW1A 2V0PA 3RU0A 4A63B 1IXVA 4GAAA 3EU9A 3LYAA 4G11A 3CHOA 1QQEA 1Z5SC 3CVWA 4GTRA 5C1DA 3DSUA 5C2YA 3D9NA 3AAAC 1FT1A 3UMVA 3HDXA 3Q47B 4ANVA 4FC8A 4AM9A 4DUIA 2VSYA 3KEAA 2R2LA 2OVBA 4A1SA 4HOQA 2GRRB 4DLQA 1RZ4A 3QDNA 4UI9C 2BTDA 1E7UA 4ACKA 4GTQA 2P9NG 3SY2A 2IONA 1UN8A 4ILHB 4HQDA 3ABKE 2OCCE 3F6QA 4B8CB 3NZUA 4G2VA 1N11A 4X8QA 4LG6A 2UWJG 4F7AA 3C3RA 1UJJA 3EIQC 4HVBA 3IHYA 3I5PA 5HS0A 3FTWA 1EYHA 1E8YA 3FUHA 4GB9A 2JABA 1SA4A 2CHXA 2ONDA 5FQ4A 2DVWA 4GCOA 5FZSA 5T3RA 4J0UA 2ZGGA 1HG2A 3JXJA 3ZXSA 5CEAA 1BI7B 4HLEA 3DXMG 3S7BA 3UI2A 3NBNB 2KATA 2PM7A 2RKKA 4I9EA 5BT1A 4WWPA 1SQMA 4KZ0A 1N4QA 4APFA 5KCMA 3IEGA 3ZW3A 2J8SD 3HG0D 4G23A 1TN6A 4LERA 3DSSA 4YDEA 4I43A 2WXFA 3CVXA 4GTPA 2IOLA 2UY1A 2Y1LE 2H6HA 1U3DA 5EX0A 1JWGA 3MGBA 3SNXA 2J07A 2Y3AA 1TJFA 3VTYA 2P9SG 3N71A 4O60A 5ENQD 1JCRA 5LOZA 2H6IA 4LNBA 1H19A 1LTXA 3FTZA 4EZJA 2JLBA 4PS7A 1N52A 4BERA 5ANLA 2Y0BG 4N2QA 3CVVA 2OEVA 4I6EA 3ML8A 5FJYA 3PZDA 3ZN3A 5E75A 4YVOA 5BPPA 1KT1A 2WXHA 3MZLB 1IQRA 5BV1A 1E90A 5FQ6A 4CDNA 3ABLE 3W9GA 4OAUC 3CEQA 1V55E 5DBKA 1Z3XA 3ESKA 3PEUB 1MX6A 3APFA 3FTYA 1BD8A 2VSNA 3O48A 4LNUD 4GTOA 1YYHA 3EIJA 2GRNB 2Q7FA 5AENA 1TN8A 1Y8MA 5ENRD 2WXLA 2IJGX 2EIME 3UT4A 3UM0A 2ZU6B 1TR4A 3L08A 2GRQB 4JB8P 2PZIA 4GTMA 1H6OA 3VTXA 2AWIA 3FFLA 4Q96A 2LO6A 4LRZA 3QB2A 1WM5A 2WXQA 1EDUA 2OVFA 3AS4A 3FU6A 4GTSA 4IN3B 4KXKB 3MV3B 4EHMA 1EPUA 1S70B 3SQVA 1JCSA 4U0ZA 4P29A 3Q7FA 3CHSA 1SZ9A 3TWWA 2I9CA 2ETAA 2I1KA 1HFAA 3U3WA 4J8DA 1OWPA 5EX3A 4CDRA 1AP7A 3WXXA 4DRXE 3L16A 2XENA 2CG3A 4YVQC 5ENSD 4ILIA 1NI1A 3NZSA 5M72A 5HRYA 2NXPA 3DEOA 4I9CA 4G26A 4GTTA 3TXNA 1TNYA 4DX1A 3HXBA 1OXJA 2CG2A 3AS8A 1BPOA 4AY6A 1TNUA 1HO8A 4APOA 4C0MA 2FO7A 3B7UX 1N95A 4FJYA 2CHWA 2HO1A 3ZVVA 3CHMA 3TJPA 2DIWA 2E0IA 1K8KG 3HXFA 1S64A 2XCBA 2AJAA 3V2OA 4B94A 4HBDA 5G04C 2VGYA 1D8EA 4ANXA 5A7DB 2MYOA 1MYOA 3VLFA 2VSOE 3G2WA 2FI7A 3AU4A 3UPVA 4FJZA 1QNFA 1ELWA 4UQZA 1Z3YA 3UIPC 4XKCA 1WY6A 3RAUA 3CLJA 2DWZA 3CK8A 3FEYA 2PQNA 3UTMA 3FUJA 4BX9A 3FEXA 3TWTA 3UKUG 3MYVA 4AJWA 4N3BA 2ZIRA 5CMYA 3ZYKA 3HYMB 4U63A 3RSEG 2Y69E 4HRMB 2VGXB 4JZYA 5G2NA 5AQBA 4JD2G 4IULA 3FUEA 4AVXA 1KPSB 3BG1B 3VLEA 3DXKG 4TXQA 4HOSA 1NZNA 4E6HA 4A1GA 2C0LA 3CIAA 5LCWJ 1O1RA 5G05J 3DPYA 3C98A 3PNTB 5ARFA 3ZU7B 4DPRA 4K0RA 4EZKA 4E85A 5KJNA 3ULQA 2IOSA 3Q78A 2F0YA 5H7PA 3DPDA 4RQIA 4GPKA 4NQ0A 5EYLA 2EIKE 1ZU2A 3D9OA 4I1AA 3RO3A 4GTVA 4OVUA 3SO8A 3C5RA 4ANWA 5BXOA 1O5MA 2KM4A 4HI8A 2C2LA 5AN8A 4G8KA 4TUMA 4WNEA 5ARGA 3HVEB 4GMLA 2MHKA 4ATZD 4UWGA 3L9TA 3AU5A 2DZOA 3X2QE 4GPMA 3UT7A 1X5BA 2KCKA 1N4RA 3EHNA 4UQYA 2ZGDA 1E8XA 2B0OE 3MV2B 3E32A 1SW6A 1W3BA 2HE0A 2WXGA 1OWOA 3D9KA 2XGSA 4ANUA 2AW6A 3EHRA 3L82A 4CDMA 3Q73A 1IYGA 2XPIA 2R5SA 2FEZA 3LEWA 4L1BA 2I2OA 4R7LA 2WQHA 3QWVA 1X81A 3DWLG 1IQUA 4M7CA 4C48B 3BG0B 3AS5A 4PDXA 4B0ZA 1NL4A 1S0PA 1H2VC 2ETCA 2LXLA 1KZPA 4NRHB 3UX4A 3RIBA 3HXDA 4BTBA 3ONLA 1DC2A 3NOGD 2KCVA 4JC8A 5FWQA 3CGHA 2GROB 3LS8A 1OY3D 2XZTG 2KZTB 2OEWA 1E8ZA 2XS8A 1DCEA 4GYOA 4LNGA 4JEHA 3T9KA 1JPLA 3C3QA 1BI8B 1P5QA 1WG0A 3SZ7A 2IQCA 4I6GA 4U8VD 4CT0A 1D9SA 4A55A 1MHQA 1N4SA 3RK6A 5CMWA 1O1TA 3UM1A 3HXEA 3QNKA 1E8WA 3FUIA 4CCAA 4HOTA 2PM6A 2FBNA 3PRZA 4XZ4A 1S63A 3V30A 5FT9A 4BT8A 4GMRA 4F1SA 1FVHA 3U4TA 2V4LA 3MA5A 3T5XA 3JCKC 3HIZA 4JHKA 5EILA 1SZAA 4MS6A 3CHPA 3W9FA 3J5QB 4UWHA 2KBXA 5CECB 3RKVA 2R03A 4GCNA 2NSZA 2DBAA 2FULA 4U04A 4N2SA 4PS3A 1H6PA 2BUGA 3L54A 2YINA 4ACLA 2LUHA 5BV0A 1HZ4A 4Z68A 3ZHEB 3CHQA 2XEVA 2DCPA 1VDYA 3LY9A 4U95D 5EDSA 3FDHA 1TNZA 2V4HC 2XHEA 5KNHD 2R17C 4GYWA 4DX6D 3B7SA 1IHGA 4KVMA 2A5UA 1INZA 4L7TA 4HOUA 4BT9A 1DVPA 4WNDA 3FUMA 3ULYA 2VTBB 3ISMC 3ZIMA 4DK5A 4HNAD 4OYSA 1OCCE 1UN9A 4FLBA 3TXMA 3V2XA 3FTVA 4YDYA 1HE8A 3T8MA 2WXPA 2RFAA 5KJLA 4WUYA 3I4GA 4UWFA 4JA7A 3MKQA 1K1AA 3LVQE 4HLLA 2QYJA 2L9BA 3C3OA 4URKA 4YNDA 4OAVB 4XEIG 3L6AA 4CT4A 5AYWD 1UW4B 2UY1B 2KC7A 3QK0A 1ELKA 2HYZA 1B89A 3MEKA 1HS6A 2XQ0A 2J08A 1HH8A 1TNBA 5FQ7A 4ZFHA 4G1TA 4TUUA 3ZYLA 3D9HA 3RRMB 3ENEA 3SD5A 1NA0A 3ASFA 4I2WA 1WAO1 4JA9A 2X3MA 2ZXWE 4B93B 4EBAA 4XI9A 5HQ8A 1U3CA 4V3IA 3ABME 4O1PA 3HRAA 4F53A 3LJNA 5FQ8A 5D0OD 4Q94A 3B7BA 3D9LA 4H7YA 4DX2A 4K5BA 3QWPA 5AIJA 5AAOA 2RD0A 2CFZA 4NACA 4CGWA 5J08A 3PEVB 2BEDA 3FU3A 2WMNA 4WWOA 3LVRE 4BTAA 4NIKA 2EILE 3FH8A 2BKGA 1N94A 3LY8A 2L0IA 2EQXA 1PAQA 5AQAA 5CRUA 3ASDA 1NP7A 3PUJA 4HI9A 3G2VA 5ANRA 2WB2A 4U8YD 3TWSA 4MKTA 4TV3A 4FADA 1D8DA 2L0TB 4MBGA 5AARA 5AJLA 4OVVA 4EBAG 2Y4TA 3CV0A 4U96D 3R9MA 2XPZA 4C0EA 3Q9NC 1HG5A 2DYSE 3LCAA 3LJ3A 4CZ2D 4PUCA 2WXIA 2LSUA 2HR2A 5AJDA 5CBNA 2WXMA 5CBOA 4L23A 3S2AA 5A23A 2XEEA 4F6RD 3RRUA 1IKND 3SHFA 2RG8A 5FTPA 3CQGB 3D9PA 3B13A 2JEKA 4O1OA 3PVLA 3KSQA 3D9IA 5LCWC 4F1PA 3TWXA 2J09A 4JL0A 4O6FA 2YHCA 3R7RA 5G05C 3FULA 2WVIA 4AP2A 2XS1A 3AG4E 1MX4A 4DX7D 2GRLA 3CVNA 4KYOB 3PH0C 2BF0X 1H2TC 3LDZA 4N3AA 4UWLA 4YDOA 2PQRA 3KD7A 3CR3A 4Y6WA 1QBQA 2J49A 5CCMA 4UQXA 2IF4A 3GW4A 1FCHA 3PE4A 1LF8A 3NQPA 5JHBA 3PZ2A 3TGOA 3UIOC 2IO2C 3FUFA 5ENPD 3FU0A 2GRPB 4ME2A 1UG3A 3Q49B 4GU5A 3TWUA 3OTNA 2ETBA 4K5AB 1MJ0A 3UUXA 2QY7A 4HRLA 3NAWA 1XGWA 2CFUA 2WXOA 4BESA 3ZUVB 4I17A 4DLOA 1IHBA 2L6BA 4WNFA 3ZYMA 4ZHBA 4TXPA 4PH4B 2XGMA 2ILRA 2QYUA 2V5QC 2J4DA 1N4PA 4QQIA 3L17A 3FH7A 5FIOA 4KT6B 2P2CP 2XCCA 5D2MC 3QWWA 2WXJA 1OCOE 4BY6A 2X6KA 3FTUA 1HU3A 1N9AA 4FP7A 5JHAA 4PS8A 4K5CA 5EYPF 5IY5E 4EQFA 2WXRA 3AG2E 4DI3A 3KS2A 1YCSB 2NC9A 3JXIA 1YA0A 1N0RA 4FULA 5JA4D 3TG5A 3C72A 1Z6TA 5LFAA 4UWKA
chains in the Genus database with same CATH topology
3V30A 5AQ7A 4DRXE 5JMND 3TWQA 2XENA 1K3ZD 3DEPA 4GMRA 5AQBA 4BEPA 4C48B 1K1AA 2JABA 5HKPA 5ENSD 4J7WA 2VGEA 3B95A 2QYJA 4HLLA 2DVWA 2KXPC 3EHQA 3DEOA 5HRYA 3J5PA 4UUCA 5ENPD 2NYJA 1WDYA 1DCQA 5AARA 4BSZB 5EILA 1BU9A 2ZGGA 4OAVB 2XZDG 4J8YA 4DX1A 5ITZF 2ETCA 3JXJA 3W9FA 5EN5D 3W9GA 5KNGA 4OAUC 4U96D 3TWUA 3TWVA 5CEAA 1BI7B 3J5QB 3Q9NC 3TWRA 2KBXA 5CECB 1DC2A 3NOGD 3UI2A 2ETBA 3ZU7B 4CZ2D 3NBNB 4CYMD 4K5AB 4A63B 4ZFHA 1MJ0A 5KWDA 3D9HA 1IXVA 1MX6A 5EIDA 1K1BA 3EU9A 5CBNA 2XZTG 1OY3D 4HRLA 1G3NB 5CBOA 1BD8A 1UOHA 5EYLA 4BESA 3ZKJA 4YDWA 1N0QA 2XEEA 4LNUD 4B93B 2J8SD 5CEDB 3HG0D 3ZUVB 4F6RD 1YYHA 4N5QA 1IHBA 2L6BA 1IKND 2F8YA 4ZHBA 3SO8A 2DZNA 3AJIA 4Z68A 3C5RA 4O1PA 1BLXB 2A5EA 4QFVA 4DX5D 3HRAA 2V5QC 5KBAA 3V31A 5BXOA 5AQ9A 3T9KA 3AAAC 4HI8A 2AJAA 1MX2A 5AN8A 3LJNA 4U95D 3V2OA 4BETA 4O1OA 4QQIA 5ENRD 2FO1E 4G8KA 1BI8B 4HBDA 3B7BA 4G8LA 1WG0A 4TUMA 5FIOA 2V4HC 1A5EA 5KNHD 4DX2A 4DX6D 4K5BA 2P2CP 4DUIA 2Y1LE 5AAOA 1TR4A 3T8KA 2MYOA 4U8VD 3KEAA 3TWXA 4F1PA 1MYOA 4ATZD 4JB8P 5FINA 3ZNGA 5EIBE 1D9SA 3Q9UC 5D66A 4RLYA 1OT8A 4O60A 2DZOA 4NIKA 2F37A 5ENQD 4GPMA 5ENTD 1MX4A 5CERB 4K5CA 4DX7D 2XEHA 1AWCB 2BKGA 5EYPF 4HNAD 2DWZA 2QC9A 4HQDA 3IXEA 2RFMA 3UXGA 4HB5A 2F8XK 5AQAA 2ZGDA 5BXUA 3NOCD 3UTMA 3F6QA 3V79K 2B0OE 1S70B 3TWTA 1SW6A 3V2XA 2HE0A 4BERA 4HI9A 1N11A 2BKKB 4YDYA 1YCSB 3JXIA 1SVXA 4U8YD 5ENOD 1YMPA 3TWWA 2Y0BG 2RFAA 1N0RA 4LG6A 3EHRA 4HRNA 3TWSA 1QYMA 2ETAA 5JA4D 1NFIE 2PNNA 4LSZE 5HS0A 4HRMB 3JUEA 1AP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V30 A;  5AQ7 A;  4DRX E;  5JMN D;  3TWQ A;  2XEN A;  1K3Z D;  3DEP A;  4GMR A;  5AQB A;  4BEP A;  4C48 B;  1K1A A;  2JAB A;  5HKP A;  5ENS D;  4J7W A;  2VGE A;  3B95 A;  2QYJ A;  4HLL A;  2DVW A;  2KXP C;  3EHQ A;  3DEO A;  5HRY A;  3J5P A;  4UUC A;  5ENP D;  2NYJ A;  1WDY A;  1DCQ A;  5AAR A;  4BSZ B;  5EIL A;  1BU9 A;  2ZGG A;  4OAV B;  2XZD G;  4J8Y A;  4DX1 A;  5ITZ F;  2ETC A;  3JXJ A;  3W9F A;  5EN5 D;  3W9G A;  5KNG A;  4OAU C;  4U96 D;  3TWU A;  3TWV A;  5CEA A;  1BI7 B;  3J5Q B;  3Q9N C;  3TWR A;  2KBX A;  5CEC B;  1DC2 A;  3NOG D;  3UI2 A;  2ETB A;  3ZU7 B;  4CZ2 D;  3NBN B;  4CYM D;  4K5A B;  4A63 B;  4ZFH A;  1MJ0 A;  5KWD A;  3D9H A;  1IXV A;  1MX6 A;  5EID A;  1K1B A;  3EU9 A;  5CBN A;  2XZT G;  1OY3 D;  4HRL A;  1G3N B;  5CBO A;  1BD8 A;  1UOH A;  5EYL A;  4BES A;  3ZKJ A;  4YDW A;  1N0Q A;  2XEE A;  4LNU D;  4B93 B;  2J8S D;  5CED B;  3HG0 D;  3ZUV B;  4F6R D;  1YYH A;  4N5Q A;  1IHB A;  2L6B A;  1IKN D;  2F8Y A;  4ZHB A;  3SO8 A;  2DZN A;  3AJI A;  4Z68 A;  3C5R A;  4O1P A;  1BLX B;  2A5E A;  4QFV A;  4DX5 D;  3HRA A;  2V5Q C;  5KBA A;  3V31 A;  5BXO A;  5AQ9 A;  3T9K A;  3AAA C;  4HI8 A;  2AJA A;  1MX2 A;  5AN8 A;  3LJN A;  4U95 D;  3V2O A;  4BET A;  4O1O A;  4QQI A;  5ENR D;  2FO1 E;  4G8K A;  1BI8 B;  4HBD A;  3B7B A;  4G8L A;  1WG0 A;  4TUM A;  5FIO A;  2V4H C;  1A5E A;  5KNH D;  4DX2 A;  4DX6 D;  4K5B A;  2P2C P;  4DUI A;  2Y1L E;  5AAO A;  1TR4 A;  3T8K A;  2MYO A;  4U8V D;  3KEA A;  3TWX A;  4F1P A;  1MYO A;  4ATZ D;  4JB8 P;  5FIN A;  3ZNG A;  5EIB E;  1D9S A;  3Q9U C;  5D66 A;  4RLY A;  1OT8 A;  4O60 A;  2DZO A;  4NIK A;  2F37 A;  5ENQ D;  4GPM A;  5ENT D;  1MX4 A;  5CER B;  4K5C A;  4DX7 D;  2XEH A;  1AWC B;  2BKG A;  5EYP F;  4HNA D;  2DWZ A;  2QC9 A;  4HQD A;  3IXE A;  2RFM A;  3UXG A;  4HB5 A;  2F8X K;  5AQA A;  2ZGD A;  5BXU A;  3NOC D;  3UTM A;  3F6Q A;  3V79 K;  2B0O E;  1S70 B;  3TWT A;  1SW6 A;  3V2X A;  2HE0 A;  4BER A;  4HI9 A;  1N11 A;  2BKK B;  4YDY A;  1YCS B;  3JXI A;  1SVX A;  4U8Y D;  5ENO D;  1YMP A;  3TWW A;  2Y0B G;  2RFA A;  1N0R A;  4LG6 A;  3EHR A;  4HRN A;  3TWS A;  1QYM A;  2ETA A;  5JA4 D;  1NFI E;  2PNN A;  4LSZ E;  5HS0 A;  4HRM B;  3JUE A;  1AP7 A; 
#chains in the Genus database with same CATH topology
 5JJ7 A;  2H6G A;  3DBS A;  3CHR A;  2P9K G;  4BWR A;  3BU8 A;  5ENN A;  4A3T A;  4GZD A;  2KXP C;  4UUC A;  4JPS A;  4Y6C A;  5ITZ F;  1TJC A;  4CEM A;  3ONK A;  4KVO A;  3PRE A;  3ZXP A;  3CVU A;  4L2Y A;  3APC A;  3ZKJ A;  5CED B;  4U8H A;  4N5Q A;  2WQ7 A;  3CVP A;  4QFV A;  3SGH A;  1HX8 A;  2H6F A;  3RRN B;  3ML9 A;  5LX8 A;  1OCR E;  5A6C A;  4G25 A;  1LD7 A;  2R02 A;  2IY0 C;  4GYY A;  5CRV A;  4I2Z A;  4DI4 A;  5BNW A;  3QC1 A;  4L2L A;  2QC9 A;  4HB5 A;  3BEE A;  2IU1 A;  4JHR A;  3D9J A;  4XE0 A;  3FU5 A;  4I1M A;  1EF1 C;  3FWV A;  1NA3 A;  5CHE E;  3Q75 A;  3D9M A;  3CST A;  5DIZ A;  3ZPJ A;  3APD A;  4LSZ E;  3E37 A;  4RVB A;  1HF8 A;  2WPV A;  1V54 E;  3PUK A;  3JUE A;  3S7J A;  1OWL A;  3UM2 A;  4J6I A;  2MRI A;  3CVY A;  4FA6 A;  4XKB A;  3ASH A;  4XIF A;  2VGE A;  3EHQ A;  3FY4 A;  1BU9 A;  1FT2 A;  2YNQ A;  5E76 A;  3CSF A;  4ILG A;  4RSY A;  4A3V A;  4DJA A;  4Q69 A;  4CYM D;  1K1B A;  3PS6 A;  3P2B A;  3GZ1 A;  3GZS A;  4EPZ A;  1ZB1 A;  2PL2 A;  3ASO E;  3FUK A;  4BX8 A;  2P9L G;  4JXT A;  3JQ0 A;  2LNI A;  2DZN A;  3JUI A;  1U2V G;  4F3V A;  5KBA A;  2L6J A;  5KJK A;  5LP0 A;  4U7E B;  1MX2 A;  3BUA A;  3OXG A;  3TAX A;  3ZHE A;  2IFU A;  1PC2 A;  2LAI A;  4N3C A;  3IKO B;  5EIB E;  3FTS A;  4J8F A;  2VQ2 A;  4RG9 A;  5D66 A;  3DSV A;  1OT8 A;  4NUR A;  5ENT D;  4GZ5 A;  1E7V A;  1QZ2 A;  3WG7 E;  2AXV A;  2WXK A;  3V79 K;  3QOU A;  4FU3 A;  3ZGQ A;  2VTB A;  4FHK A;  4KMO A;  1L5J A;  4LCT A;  2IEJ A;  3U66 A;  5CCL A;  4XX5 A;  1OWM A;  4GMJ A;  3MJW A;  3Q15 A;  3Q4A B;  4JEU A;  3J5P A;  1OWN A;  5FZR A;  2NYJ A;  4BSZ B;  1KLX A;  2QFC A;  4HS2 A;  3RJV A;  2ZIS A;  2LAH A;  5EKQ D;  1H0A A;  4UI9 J;  1MZC A;  4FLH A;  5EID A;  3GZ2 A;  4I6J A;  2CHZ A;  3CVQ A;  4YDW A;  3VLD A;  2A4Z A;  2X6F A;  3KSL A;  3NB2 A;  2F8Y A;  1LD8 A;  3EUV A;  1BLX B;  2YHE A;  4EZL A;  3G2S A;  2C0M A;  5KJM A;  4XI0 A;  4WNG A;  2VYI A;  2J9Q A;  4CRW A;  4J8S A;  3ZFW A;  3MKQ B;  3CVL A;  3I4R B;  4RLY A;  4MLP A;  2F37 A;  1KZO A;  3PNL B;  3G2T A;  1JCQ A;  2XRZ A;  4IRU A;  2P58 C;  3IXE A;  3UKR G;  2E2E A;  3UXG A;  1H2U A;  5T4Y A;  2DYR E;  3DSX A;  3L22 A;  3E4B A;  4G24 A;  1A17 A;  1YMP A;  4HOR A;  4HRN A;  1OUV A;  3U64 A;  3MKR A;  3GYZ A;  2PNN A;  3SBS A;  5B1B E;  4JHJ A;  1E96 B;  5JMN D;  3DEP A;  3B95 A;  1TNO A;  4AY5 A;  2AVP A;  2X6H A;  4TRQ A;  1MQS A;  2WXN A;  3RO2 A;  4N5C A;  3PZ4 A;  3SBT B;  4W9R A;  5EN5 D;  5KNG A;  1O1S A;  3OXL A;  3TWV A;  2OOE A;  3I3N A;  1ZBP A;  4EEC A;  3PDN A;  2GRM A;  4AEZ C;  3CQC B;  4IYP A;  4J8E A;  4GA1 A;  5BUZ A;  1G3N B;  2P9U G;  2WMO A;  4K03 A;  1N0Q A;  2X38 A;  4D10 C;  4MRU A;  3AJI A;  5JJT A;  5B3S E;  3UQ3 A;  3ZEF A;  2M63 A;  2Y4U A;  2FO1 E;  2QZA A;  4GA2 A;  3ESL A;  2FF4 A;  5J90 A;  3LPZ A;  3S7D A;  3R9A B;  3Q9U C;  2V5F A;  3UM3 A;  3QKY A;  3D3M A;  5CER B;  2XEH A;  3DSW A;  2AXU A;  5BXU A;  4WAF A;  4LEU A;  3Q7A A;  2R05 A;  3U9W A;  1HXI A;  3KEZ A;  3LXU X;  2X6I A;  2B6C A;  1QYM A;  4GZ6 A;  3JQ1 A;  2OV8 A;  5FZQ A;  3ZRH A;  4M3O A;  1N54 A;  3OAW A;  3SI5 A;  3QJZ A;  4RG6 A;  2XRY A;  4U0S A;  5HKP A;  4J7W A;  4FHJ A;  4GZ3 A;  3DRA A;  3MX3 A;  1KT0 A;  3SFY A;  4J8Y A;  3S7F A;  5JJ6 A;  1Y6I A;  1FVF A;  3QAR A;  5B1A E;  3NF1 A;  4ATG A;  3UIN C;  3EU5 A;  4HXI A;  4KZC A;  3IHV A;  3G2U A;  3FUD A;  4B8A A;  3E34 A;  2VSX E;  4I1O B;  2VGX A;  3JYS A;  3AG1 E;  3PZ3 A;  4H7X A;  1PY1 A;  1FPP A;  2A5E A;  3SF4 A;  3V31 A;  4L9P A;  3E33 A;  3AG3 E;  3R7Q A;  3K9I A;  2LXM A;  4LUN U;  2HM8 A;  4G8L A;  1A5E A;  3Q79 A;  4AXH A;  4AIF A;  2IO3 C;  5FIN A;  3ZNG A;  3B7R L;  3O4Z A;  4JVS A;  2J4B A;  2XPY A;  3EHM A;  1H6K A;  1JWF A;  3FUN A;  2WQ6 A;  2P9P G;  2RFM A;  2GGF A;  5HI7 A;  3SFZ A;  4AOF A;  2F8X K;  3ZYQ A;  2BKK B;  5D0Q D;  2KCL A;  4AV7 A;  3EDT B;  1NFI E;  2I6H A;  3HVE A;  2X6J A;  3TWQ A;  1TYQ G;  1ELR A;  3CKC A;  3CKB A;  1WDY A;  3LY7 A;  2P9I G;  1Q2Z A;  4KBQ A;  5G04 J;  3T5V A;  3PE3 A;  3BQO A;  2LSV A;  4B89 A;  1DNP A;  3L13 A;  1RW2 A;  4HFG A;  3TWR A;  1TN7 A;  2WM9 A;  4WWN A;  3KAE A;  5KWD A;  2V8S E;  3OXF A;  3DST A;  4U07 A;  1UOH A;  4BFR A;  3P1U A;  2XGO A;  3UT8 A;  1OCZ E;  3FP3 A;  4DX5 D;  1UJK A;  4U0U A;  3CK7 A;  5AQ9 A;  4BET A;  1SA5 A;  3FHE A;  3ASN E;  4GA0 A;  1TEZ A;  5BW8 C;  3B7T A;  3FTX A;  3MCX A;  2I1J A;  3HXC A;  2EIJ E;  3QAQ A;  3T8K A;  3E30 A;  1JUQ A;  2MOW A;  3EJN A;  3TG4 A;  3ULE G;  3TL5 A;  2R59 A;  3ASG A;  1AWC B;  1XNF A;  2EIN E;  4N39 A;  2VJ8 A;  3Q5M A;  2KZT A;  3IBE A;  3NOC D;  2AXZ A;  4ABN A;  1SVX A;  5ENO D;  2YQ8 A;  3PZ1 A;  5G55 A;  3LKU A;  4GZC A;  5T8I A;  3URZ A;  5AQ7 A;  4C9B B;  3HHM A;  4BEP A;  1K3Z D;  4BSX A;  4JW1 A;  3FH5 A;  3CK9 A;  1GW6 A;  1DCQ A;  4CGV A;  4UI9 K;  4TXR A;  2XZD G;  3SFX A;  3IV0 A;  2GW1 A;  2V0P A;  3RU0 A;  4A63 B;  1IXV A;  4GAA A;  3EU9 A;  3LYA A;  4G11 A;  3CHO A;  1QQE A;  1Z5S C;  3CVW A;  4GTR A;  5C1D A;  3DSU A;  5C2Y A;  3D9N A;  3AAA C;  1FT1 A;  3UMV A;  3HDX A;  3Q47 B;  4ANV A;  4FC8 A;  4AM9 A;  4DUI A;  2VSY A;  3KEA A;  2R2L A;  2OVB A;  4A1S A;  4HOQ A;  2GRR B;  4DLQ A;  1RZ4 A;  3QDN A;  4UI9 C;  2BTD A;  1E7U A;  4ACK A;  4GTQ A;  2P9N G;  3SY2 A;  2ION A;  1UN8 A;  4ILH B;  4HQD A;  3ABK E;  2OCC E;  3F6Q A;  4B8C B;  3NZU A;  4G2V A;  1N11 A;  4X8Q A;  4LG6 A;  2UWJ G;  4F7A A;  3C3R A;  1UJJ A;  3EIQ C;  4HVB A;  3IHY A;  3I5P A;  5HS0 A;  3FTW A;  1EYH A;  1E8Y A;  3FUH A;  4GB9 A;  2JAB A;  1SA4 A;  2CHX A;  2OND A;  5FQ4 A;  2DVW A;  4GCO A;  5FZS A;  5T3R A;  4J0U A;  2ZGG A;  1HG2 A;  3JXJ A;  3ZXS A;  5CEA A;  1BI7 B;  4HLE A;  3DXM G;  3S7B A;  3UI2 A;  3NBN B;  2KAT A;  2PM7 A;  2RKK A;  4I9E A;  5BT1 A;  4WWP A;  1SQM A;  4KZ0 A;  1N4Q A;  4APF A;  5KCM A;  3IEG A;  3ZW3 A;  2J8S D;  3HG0 D;  4G23 A;  1TN6 A;  4LER A;  3DSS A;  4YDE A;  4I43 A;  2WXF A;  3CVX A;  4GTP A;  2IOL A;  2UY1 A;  2Y1L E;  2H6H A;  1U3D A;  5EX0 A;  1JWG A;  3MGB A;  3SNX A;  2J07 A;  2Y3A A;  1TJF A;  3VTY A;  2P9S G;  3N71 A;  4O60 A;  5ENQ D;  1JCR A;  5LOZ A;  2H6I A;  4LNB A;  1H19 A;  1LTX A;  3FTZ A;  4EZJ A;  2JLB A;  4PS7 A;  1N52 A;  4BER A;  5ANL A;  2Y0B G;  4N2Q A;  3CVV A;  2OEV A;  4I6E A;  3ML8 A;  5FJY A;  3PZD A;  3ZN3 A;  5E75 A;  4YVO A;  5BPP A;  1KT1 A;  2WXH A;  3MZL B;  1IQR A;  5BV1 A;  1E90 A;  5FQ6 A;  4CDN A;  3ABL E;  3W9G A;  4OAU C;  3CEQ A;  1V55 E;  5DBK A;  1Z3X A;  3ESK A;  3PEU B;  1MX6 A;  3APF A;  3FTY A;  1BD8 A;  2VSN A;  3O48 A;  4LNU D;  4GTO A;  1YYH A;  3EIJ A;  2GRN B;  2Q7F A;  5AEN A;  1TN8 A;  1Y8M A;  5ENR D;  2WXL A;  2IJG X;  2EIM E;  3UT4 A;  3UM0 A;  2ZU6 B;  1TR4 A;  3L08 A;  2GRQ B;  4JB8 P;  2PZI A;  4GTM A;  1H6O A;  3VTX A;  2AWI A;  3FFL A;  4Q96 A;  2LO6 A;  4LRZ A;  3QB2 A;  1WM5 A;  2WXQ A;  1EDU A;  2OVF A;  3AS4 A;  3FU6 A;  4GTS A;  4IN3 B;  4KXK B;  3MV3 B;  4EHM A;  1EPU A;  1S70 B;  3SQV A;  1JCS A;  4U0Z A;  4P29 A;  3Q7F A;  3CHS A;  1SZ9 A;  3TWW A;  2I9C A;  2ETA A;  2I1K A;  1HFA A;  3U3W A;  4J8D A;  1OWP A;  5EX3 A;  4CDR A;  1AP7 A;  3WXX A;  4DRX E;  3L16 A;  2XEN A;  2CG3 A;  4YVQ C;  5ENS D;  4ILI A;  1NI1 A;  3NZS A;  5M72 A;  5HRY A;  2NXP A;  3DEO A;  4I9C A;  4G26 A;  4GTT A;  3TXN A;  1TNY A;  4DX1 A;  3HXB A;  1OXJ A;  2CG2 A;  3AS8 A;  1BPO A;  4AY6 A;  1TNU A;  1HO8 A;  4APO A;  4C0M A;  2FO7 A;  3B7U X;  1N95 A;  4FJY A;  2CHW A;  2HO1 A;  3ZVV A;  3CHM A;  3TJP A;  2DIW A;  2E0I A;  1K8K G;  3HXF A;  1S64 A;  2XCB A;  2AJA A;  3V2O A;  4B94 A;  4HBD A;  5G04 C;  2VGY A;  1D8E A;  4ANX A;  5A7D B;  2MYO A;  1MYO A;  3VLF A;  2VSO E;  3G2W A;  2FI7 A;  3AU4 A;  3UPV A;  4FJZ A;  1QNF A;  1ELW A;  4UQZ A;  1Z3Y A;  3UIP C;  4XKC A;  1WY6 A;  3RAU A;  3CLJ A;  2DWZ A;  3CK8 A;  3FEY A;  2PQN A;  3UTM A;  3FUJ A;  4BX9 A;  3FEX A;  3TWT A;  3UKU G;  3MYV A;  4AJW A;  4N3B A;  2ZIR A;  5CMY A;  3ZYK A;  3HYM B;  4U63 A;  3RSE G;  2Y69 E;  4HRM B;  2VGX B;  4JZY A;  5G2N A;  5AQB A;  4JD2 G;  4IUL A;  3FUE A;  4AVX A;  1KPS B;  3BG1 B;  3VLE A;  3DXK G;  4TXQ A;  4HOS A;  1NZN A;  4E6H A;  4A1G A;  2C0L A;  3CIA A;  5LCW J;  1O1R A;  5G05 J;  3DPY A;  3C98 A;  3PNT B;  5ARF A;  3ZU7 B;  4DPR A;  4K0R A;  4EZK A;  4E85 A;  5KJN A;  3ULQ A;  2IOS A;  3Q78 A;  2F0Y A;  5H7P A;  3DPD A;  4RQI A;  4GPK A;  4NQ0 A;  5EYL A;  2EIK E;  1ZU2 A;  3D9O A;  4I1A A;  3RO3 A;  4GTV A;  4OVU A;  3SO8 A;  3C5R A;  4ANW A;  5BXO A;  1O5M A;  2KM4 A;  4HI8 A;  2C2L A;  5AN8 A;  4G8K A;  4TUM A;  4WNE A;  5ARG A;  3HVE B;  4GML A;  2MHK A;  4ATZ D;  4UWG A;  3L9T A;  3AU5 A;  2DZO A;  3X2Q E;  4GPM A;  3UT7 A;  1X5B A;  2KCK A;  1N4R A;  3EHN A;  4UQY A;  2ZGD A;  1E8X A;  2B0O E;  3MV2 B;  3E32 A;  1SW6 A;  1W3B A;  2HE0 A;  2WXG A;  1OWO A;  3D9K A;  2XGS A;  4ANU A;  2AW6 A;  3EHR A;  3L82 A;  4CDM A;  3Q73 A;  1IYG A;  2XPI A;  2R5S A;  2FEZ A;  3LEW A;  4L1B A;  2I2O A;  4R7L A;  2WQH A;  3QWV A;  1X81 A;  3DWL G;  1IQU A;  4M7C A;  4C48 B;  3BG0 B;  3AS5 A;  4PDX A;  4B0Z A;  1NL4 A;  1S0P A;  1H2V C;  2ETC A;  2LXL A;  1KZP A;  4NRH B;  3UX4 A;  3RIB A;  3HXD A;  4BTB A;  3ONL A;  1DC2 A;  3NOG D;  2KCV A;  4JC8 A;  5FWQ A;  3CGH A;  2GRO B;  3LS8 A;  1OY3 D;  2XZT G;  2KZT B;  2OEW A;  1E8Z A;  2XS8 A;  1DCE A;  4GYO A;  4LNG A;  4JEH A;  3T9K A;  1JPL A;  3C3Q A;  1BI8 B;  1P5Q A;  1WG0 A;  3SZ7 A;  2IQC A;  4I6G A;  4U8V D;  4CT0 A;  1D9S A;  4A55 A;  1MHQ A;  1N4S A;  3RK6 A;  5CMW A;  1O1T A;  3UM1 A;  3HXE A;  3QNK A;  1E8W A;  3FUI A;  4CCA A;  4HOT A;  2PM6 A;  2FBN A;  3PRZ A;  4XZ4 A;  1S63 A;  3V30 A;  5FT9 A;  4BT8 A;  4GMR A;  4F1S A;  1FVH A;  3U4T A;  2V4L A;  3MA5 A;  3T5X A;  3JCK C;  3HIZ A;  4JHK A;  5EIL A;  1SZA A;  4MS6 A;  3CHP A;  3W9F A;  3J5Q B;  4UWH A;  2KBX A;  5CEC B;  3RKV A;  2R03 A;  4GCN A;  2NSZ A;  2DBA A;  2FUL A;  4U04 A;  4N2S A;  4PS3 A;  1H6P A;  2BUG A;  3L54 A;  2YIN A;  4ACL A;  2LUH A;  5BV0 A;  1HZ4 A;  4Z68 A;  3ZHE B;  3CHQ A;  2XEV A;  2DCP A;  1VDY A;  3LY9 A;  4U95 D;  5EDS A;  3FDH A;  1TNZ A;  2V4H C;  2XHE A;  5KNH D;  2R17 C;  4GYW A;  4DX6 D;  3B7S A;  1IHG A;  4KVM A;  2A5U A;  1INZ A;  4L7T A;  4HOU A;  4BT9 A;  1DVP A;  4WND A;  3FUM A;  3ULY A;  2VTB B;  3ISM C;  3ZIM A;  4DK5 A;  4HNA D;  4OYS A;  1OCC E;  1UN9 A;  4FLB A;  3TXM A;  3V2X A;  3FTV A;  4YDY A;  1HE8 A;  3T8M A;  2WXP A;  2RFA A;  5KJL A;  4WUY A;  3I4G A;  4UWF A;  4JA7 A;  3MKQ A;  1K1A A;  3LVQ E;  4HLL A;  2QYJ A;  2L9B A;  3C3O A;  4URK A;  4YND A;  4OAV B;  4XEI G;  3L6A A;  4CT4 A;  5AYW D;  1UW4 B;  2UY1 B;  2KC7 A;  3QK0 A;  1ELK A;  2HYZ A;  1B89 A;  3MEK A;  1HS6 A;  2XQ0 A;  2J08 A;  1HH8 A;  1TNB A;  5FQ7 A;  4ZFH A;  4G1T A;  4TUU A;  3ZYL A;  3D9H A;  3RRM B;  3ENE A;  3SD5 A;  1NA0 A;  3ASF A;  4I2W A;  1WAO 1;  4JA9 A;  2X3M A;  2ZXW E;  4B93 B;  4EBA A;  4XI9 A;  5HQ8 A;  1U3C A;  4V3I A;  3ABM E;  4O1P A;  3HRA A;  4F53 A;  3LJN A;  5FQ8 A;  5D0O D;  4Q94 A;  3B7B A;  3D9L A;  4H7Y A;  4DX2 A;  4K5B A;  3QWP A;  5AIJ A;  5AAO A;  2RD0 A;  2CFZ A;  4NAC A;  4CGW A;  5J08 A;  3PEV B;  2BED A;  3FU3 A;  2WMN A;  4WWO A;  3LVR E;  4BTA A;  4NIK A;  2EIL E;  3FH8 A;  2BKG A;  1N94 A;  3LY8 A;  2L0I A;  2EQX A;  1PAQ A;  5AQA A;  5CRU A;  3ASD A;  1NP7 A;  3PUJ A;  4HI9 A;  3G2V A;  5ANR A;  2WB2 A;  4U8Y D;  3TWS A;  4MKT A;  4TV3 A;  4FAD A;  1D8D A;  2L0T B;  4MBG A;  5AAR A;  5AJL A;  4OVV A;  4EBA G;  2Y4T A;  3CV0 A;  4U96 D;  3R9M A;  2XPZ A;  4C0E A;  3Q9N C;  1HG5 A;  2DYS E;  3LCA A;  3LJ3 A;  4CZ2 D;  4PUC A;  2WXI A;  2LSU A;  2HR2 A;  5AJD A;  5CBN A;  2WXM A;  5CBO A;  4L23 A;  3S2A A;  5A23 A;  2XEE A;  4F6R D;  3RRU A;  1IKN D;  3SHF A;  2RG8 A;  5FTP A;  3CQG B;  3D9P A;  3B13 A;  2JEK A;  4O1O A;  3PVL A;  3KSQ A;  3D9I A;  5LCW C;  4F1P A;  3TWX A;  2J09 A;  4JL0 A;  4O6F A;  2YHC A;  3R7R A;  5G05 C;  3FUL A;  2WVI A;  4AP2 A;  2XS1 A;  3AG4 E;  1MX4 A;  4DX7 D;  2GRL A;  3CVN A;  4KYO B;  3PH0 C;  2BF0 X;  1H2T C;  3LDZ A;  4N3A A;  4UWL A;  4YDO A;  2PQR A;  3KD7 A;  3CR3 A;  4Y6W A;  1QBQ A;  2J49 A;  5CCM A;  4UQX A;  2IF4 A;  3GW4 A;  1FCH A;  3PE4 A;  1LF8 A;  3NQP A;  5JHB A;  3PZ2 A;  3TGO A;  3UIO C;  2IO2 C;  3FUF A;  5ENP D;  3FU0 A;  2GRP B;  4ME2 A;  1UG3 A;  3Q49 B;  4GU5 A;  3TWU A;  3OTN A;  2ETB A;  4K5A B;  1MJ0 A;  3UUX A;  2QY7 A;  4HRL A;  3NAW A;  1XGW A;  2CFU A;  2WXO A;  4BES A;  3ZUV B;  4I17 A;  4DLO A;  1IHB A;  2L6B A;  4WNF A;  3ZYM A;  4ZHB A;  4TXP A;  4PH4 B;  2XGM A;  2ILR A;  2QYU A;  2V5Q C;  2J4D A;  1N4P A;  4QQI A;  3L17 A;  3FH7 A;  5FIO A;  4KT6 B;  2P2C P;  2XCC A;  5D2M C;  3QWW A;  2WXJ A;  1OCO E;  4BY6 A;  2X6K A;  3FTU A;  1HU3 A;  1N9A A;  4FP7 A;  5JHA A;  4PS8 A;  4K5C A;  5EYP F;  5IY5 E;  4EQF A;  2WXR A;  3AG2 E;  4DI3 A;  3KS2 A;  1YCS B;  2NC9 A;  3JXI A;  1YA0 A;  1N0R A;  4FUL A;  5JA4 D;  3TG5 A;  3C72 A;  1Z6T A;  5LFA A;  4UWK A; 
#chains in the Genus database with same CATH homology
 3V30 A;  5AQ7 A;  4DRX E;  5JMN D;  3TWQ A;  2XEN A;  1K3Z D;  3DEP A;  4GMR A;  5AQB A;  4BEP A;  4C48 B;  1K1A A;  2JAB A;  5HKP A;  5ENS D;  4J7W A;  2VGE A;  3B95 A;  2QYJ A;  4HLL A;  2DVW A;  2KXP C;  3EHQ A;  3DEO A;  5HRY A;  3J5P A;  4UUC A;  5ENP D;  2NYJ A;  1WDY A;  1DCQ A;  5AAR A;  4BSZ B;  5EIL A;  1BU9 A;  2ZGG A;  4OAV B;  2XZD G;  4J8Y A;  4DX1 A;  5ITZ F;  2ETC A;  3JXJ A;  3W9F A;  5EN5 D;  3W9G A;  5KNG A;  4OAU C;  4U96 D;  3TWU A;  3TWV A;  5CEA A;  1BI7 B;  3J5Q B;  3Q9N C;  3TWR A;  2KBX A;  5CEC B;  1DC2 A;  3NOG D;  3UI2 A;  2ETB A;  3ZU7 B;  4CZ2 D;  3NBN B;  4CYM D;  4K5A B;  4A63 B;  4ZFH A;  1MJ0 A;  5KWD A;  3D9H A;  1IXV A;  1MX6 A;  5EID A;  1K1B A;  3EU9 A;  5CBN A;  2XZT G;  1OY3 D;  4HRL A;  1G3N B;  5CBO A;  1BD8 A;  1UOH A;  5EYL A;  4BES A;  3ZKJ A;  4YDW A;  1N0Q A;  2XEE A;  4LNU D;  4B93 B;  2J8S D;  5CED B;  3HG0 D;  3ZUV B;  4F6R D;  1YYH A;  4N5Q A;  1IHB A;  2L6B A;  1IKN D;  2F8Y A;  4ZHB A;  3SO8 A;  2DZN A;  3AJI A;  4Z68 A;  3C5R A;  4O1P A;  1BLX B;  2A5E A;  4QFV A;  4DX5 D;  3HRA A;  2V5Q C;  5KBA A;  3V31 A;  5BXO A;  5AQ9 A;  3T9K A;  3AAA C;  4HI8 A;  2AJA A;  1MX2 A;  5AN8 A;  3LJN A;  4U95 D;  3V2O A;  4BET A;  4O1O A;  4QQI A;  5ENR D;  2FO1 E;  4G8K A;  1BI8 B;  4HBD A;  3B7B A;  4G8L A;  1WG0 A;  4TUM A;  5FIO A;  2V4H C;  1A5E A;  5KNH D;  4DX2 A;  4DX6 D;  4K5B A;  2P2C P;  4DUI A;  2Y1L E;  5AAO A;  1TR4 A;  3T8K A;  2MYO A;  4U8V D;  3KEA A;  3TWX A;  4F1P A;  1MYO A;  4ATZ D;  4JB8 P;  5FIN A;  3ZNG A;  5EIB E;  1D9S A;  3Q9U C;  5D66 A;  4RLY A;  1OT8 A;  4O60 A;  2DZO A;  4NIK A;  2F37 A;  5ENQ D;  4GPM A;  5ENT D;  1MX4 A;  5CER B;  4K5C A;  4DX7 D;  2XEH A;  1AWC B;  2BKG A;  5EYP F;  4HNA D;  2DWZ A;  2QC9 A;  4HQD A;  3IXE A;  2RFM A;  3UXG A;  4HB5 A;  2F8X K;  5AQA A;  2ZGD A;  5BXU A;  3NOC D;  3UTM A;  3F6Q A;  3V79 K;  2B0O E;  1S70 B;  3TWT A;  1SW6 A;  3V2X A;  2HE0 A;  4BER A;  4HI9 A;  1N11 A;  2BKK B;  4YDY A;  1YCS B;  3JXI A;  1SVX A;  4U8Y D;  5ENO D;  1YMP A;  3TWW A;  2Y0B G;  2RFA A;  1N0R A;  4LG6 A;  3EHR A;  4HRN A;  3TWS A;  1QYM A;  2ETA A;  5JA4 D;  1NFI E;  2PNN A;  4LSZ E;  5HS0 A;  4HRM B;  3JUE A;  1AP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...