1U2VG

Crystal structure of arp2/3 complex with bound adp and calcium
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
135
Chain Sequence
ARFRKVDVDEYDENKFVDAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Actin-Related Protein 3
publication title Crystal structures of actin-related protein 2/3 complex with bound ATP or ADP
pubmed doi rcsb
total genus 46
structure length 135
sequence length 143
ec nomenclature
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 1u2vG00
2P9NG 2P9LG 2P9KG 2P9IG 1TYQG 3DXKG 3DWLG 1K8KG 2P9PG 3UKUG 1U2VG 3RSEG 2P9UG 2P9SG 3UKRG 3DXMG 3ULEG 4XEIG 4JD2G
chains in the Genus database with same CATH superfamily
1X5BA 3MX3A 3I5PA 5JJTA 3Q75A 4H7XA 3APCA 3QC1A 4HOUA 3UM2A 2X6IA 3GZ1A 3C98A 3CKCA 3ASOE 1IHGA 4J8EA 1Z3YA 4YDYA 3VLFA 1KT0A 3NOCD 4C9BB 3KSLA 4G26A 2FO7A 4HXIA 5JHAA 5CECB 5LCWC 4J8YA 4LEUA 3ZGQA 1DNPA 3ZHEA 3LY7A 3JCKC 3FH5A 3ZRHA 2F37A 3FUMA 1N4SA 4GZ5A 3TG4A 5C1DA 4F53A 1SVXA 4M3OA 1H0AA 3RIBA 3TWXA 3PUKA 1H6OA 4CDMA 2ONDA 2VYIA 3EHMA 2RD0A 3DEOA 2OEVA 2J9QA 3RO2A 5AARA 2J4DA 1N4PA 1N0QA 2WXIA 1WG0A 3BG0B 4CGVA 3FWVA 4LSZE 4U8HA 2I1JA 3CSTA 1FT1A 3OXFA 4JVSA 4C0MA 4OAVB 3PDNA 3ZNGA 1HF8A 1NZNA 3MKRA 3AG4E 4NRHB 3D9IA 3SNXA 1D9SA 4YVQC 4GZCA 4LCTA 4N3AA 1K3ZD 3FTXA 3QKYA 5ANLA 5ENSD 5FZSA 4NACA 5CEAA 2VSYA 3ZHEB 3Q47B 3TG5A 4C48B 3QARA 4GZDA 3O4ZA 4HRLA 4UI9K 4MLPA 3S7BA 5A7DB 5LP0A 1YYHA 3Q49B 2IOSA 4WNGA 1OWNA 5AQBA 1U3DA 3RRUA 3LPZA 1IXVA 4JL0A 3L82A 1OCOE 2XGMA 3ZYQA 1K8KG 3EDTB 3URZA 3OXLA 3FH8A 4HORA 2EINE 2RG8A 3ESLA 3MZLB 4GPMA 5ENOD 4N5QA 2IEJA 4HLLA 2WXQA 3FEXA 3LY8A 4B89A 2E2EA 2GROB 2V4HC 3TL5A 4HOTA 1DCEA 4PS7A 2AJAA 2A4ZA 1D8DA 2ETCA 2V0PA 1E8XA 3B7SA 3ZKJA 3DSWA 4GA0A 4Z68A 4RSYA 4N2SA 5CERB 3NBNB 4I43A 1JWFA 4HVBA 3Q78A 2I2OA 1AWCB 1X81A 3BEEA 1NI1A 3FEYA 3C5RA 4O1OA 3RRMB 2R17C 1OT8A 4GYWA 5BPPA 2PL2A 4BFRA 1QBQA 4ME2A 3TWRA 4EQFA 2ZIRA 4JHJA 4Q96A 2EILE 4G8KA 2HR2A 4C0EA 3HXDA 2WQHA 2VGEA 4AVXA 2A5EA 1U3CA 1Z3XA 1HG2A 1MX2A 4F7AA 1YMPA 4JHKA 4BY6A 4OVVA 2PZIA 3HDXA 3IHYA 3CQCB 1MX4A 4CZ2D 5FQ8A 1H2UA 4U0ZA 3UI2A 1WM5A 4DUIA 2F8XK 2HO1A 4L2LA 3SI5A 2OVBA 5EILA 5ARGA 3IXEA 5H7PA 2J4BA 2Y1LE 4G8LA 4DI4A 1WAO1 2QFCA 2LSUA 4NQ0A 3NZSA 5EX3A 4JZYA 5BNWA 4I9EA 4KZCA 2BUGA 2WB2A 3FUFA 2GRLA 3QOUA 4J8FA 4TUUA 2BKGA 3FTUA 1SA4A 1O1SA 2FO1E 4NIKA 4A3VA 3BU8A 3V79K 2ZISA 4K0RA 4URKA 3CHOA 5G05J 3MA5A 4HRMB 3E37A 3UQ3A 5KJLA 1OUVA 2PM7A 3L6AA 5AYWD 3TAXA 1IYGA 1ELWA 3AJIA 2J8SD 4U8VD 2VGXA 2NYJA 3QAQA 1S70B 3LJ3A 2V8SE 4GA2A 4ILIA 3HIZA 3CHMA 1EDUA 2V5FA 3OXGA 3WG7E 2CHXA 1YA0A 2J08A 2YQ8A 3L22A 1IQRA 2LO6A 1WY6A 3TWQA 2R59A 5KCMA 3Q15A 5ITZF 3ML8A 3G2VA 4X8QA 1BLXB 5CRUA 4BX8A 1H2VC 5AJDA 1O5MA 1E96B 5JHBA 4BX9A 3UX4A 1G3NB 3KD7A 2VQ2A 5KBAA 2BTDA 3AG3E 3ISMC 3CVWA 1FPPA 3KAEA 2XEEA 3PZ1A 5G04J 4KVOA 2R05A 5AIJA 3FH7A 2LSVA 1U2VG 3UT4A 3I3NA 4LERA 3CVNA 2VGXB 3SFYA 4GPKA 3PE3A 1EPUA 3V31A 4FHKA 5A23A 1UN9A 2DYSE 3DPYA 3S2AA 2CHZA 4GYYA 2P58C 3Q9NC 4DJAA 4CDNA 4BEPA 4F1SA 4HNAD 3DEPA 3ZUVB 2XZDG 1NP7A 3D9HA 3R9AB 3MYVA 1V54E 4GZ6A 3VTYA 3NAWA 4YVOA 4U04A 1TR4A 3FP3A 5EYPF 2UY1A 1SZ9A 1IHBA 2WXLA 2QY7A 3TWSA 3D9MA 1N9AA 4DX7D 3VTXA 4FULA 3AS5A 4Q69A 4UI9J 3L16A 3GZ2A 3LJNA 2EIME 3PH0C 1V55E 4N3CA 4BESA 5KNHD 4UUCA 3MCXA 4BTBA 2WXOA 3MKQA 3G2UA 1K1AA 3L17A 3U64A 4LNGA 2I1KA 3PZDA 3ULEG 3KS2A 3W9GA 4GMRA 3HRAA 4NURA 2R02A 2WXNA 2XGOA 3Q9UC 4G1TA 3E4BA 4UQZA 4E85A 2UWJG 4KXKB 3HHMA 3G2WA 3I4RB 4O60A 1UJKA 4EPZA 5M72A 2XS8A 3B7BA 5ARFA 3E30A 1TN7A 1E7UA 1PY1A 3PZ4A 4N3BA 3JUIA 4GTSA 5AQ9A 4DX5D 3DSUA 2GRRB 1Q2ZA 1MYOA 3LKUA 5JMND 4N5CA 3SBSA 2OCCE 4JA9A 1HH8A 3DRAA 1N95A 2AWIA 3CHSA 2KM4A 4K5AB 4IN3B 1UN8A 4YDWA 4K03A 4AY5A 3CK7A 4APFA 2IJGX 2PQRA 2HYZA 3VLEA 2BEDA 4TXPA 2H6IA 3G2TA 3PEUB 1TNYA 4ATZD 4L2YA 1MHQA 2Y3AA 2EIJE 4CRWA 4HLEA 3FU6A 1GW6A 4PS8A 2HE0A 3Q4AB 3HXCA 3AU4A 5BXUA 2LXMA 1TNUA 4GTMA 4EBAG 3RU0A 3CSFA 5IY5E 2FEZA 3PVLA 3DBSA 3UM3A 3ZW3A 3TXNA 4AY6A 3FUHA 5ENRD 2X6KA 4N39A 1W3BA 5G05C 3KEZA 1OY3D 4GCOA 5DBKA 2LUHA 2IONA 1KPSB 1BD8A 5J08A 4GCNA 4I6JA 3QJZA 3JQ0A 3KEAA 3V2XA 1Y6IA 2CHWA 5FT9A 5AQ7A 2KZTA 3UKUG 2C0LA 4DLOA 2IO2C 2L6JA 5HKPA 3PZ3A 2R2LA 3X2QE 3J5PA 3SFXA 3B7RL 4WWOA 2GGFA 4DRXE 1N94A 4HFGA 3D9KA 5EN5D 4GYOA 1P5QA 4G23A 3ENEA 4XE0A 3UMVA 4U07A 4RG6A 4XX5A 1N4RA 4GTRA 1FVFA 3SO8A 4MS6A 2KCKA 3FFLA 3IBEA 3P1UA 3TXMA 4O1PA 2MRIA 2ILRA 1HXIA 3P2BA 3RSEG 3CVPA 5G04C 4BTAA 3HVEA 2KCLA 3ZYKA 3CVVA 3DWLG 3FDHA 3RK6A 2ZGGA 5HRYA 5BV1A 3ASFA 2IQCA 3BG1B 1E8YA 4HB5A 5AQAA 1L5JA 2KBXA 2AW6A 3QDNA 4B94A 1SW6A 4Y6CA 3CEQA 2RFMA 2H6GA 1EF1C 4PDXA 3LEWA 1RW2A 5FQ7A 4PUCA 5BXOA 2RFAA 3C3RA 4MKTA 3MJWA 3CK8A 4G25A 1SZAA 4UQXA 3T5VA 2CG2A 4ANXA 3ASHA 5ENPD 4J6IA 2AVPA 3EHNA 3GZSA 3HVEB 1SA5A 1NA3A 4BETA 3D9JA 3D9LA 4QFVA 4UI9C 2LNIA 2E0IA 4G2VA 2FF4A 2XPIA 3ZU7B 4OVUA 5LFAA 3Q79A 3OTNA 2DIWA 2P9SG 2GRNB 3DSSA 5AAOA 3N71A 4U95D 2X38A 2IF4A 2QZAA 2R5SA 2AXUA 4KMOA 1D8EA 2OOEA 3UIPC 1H19A 4GMJA 2MOWA 4Q94A 3BUAA 3IKOB 2WXKA 3PS6A 5DIZA 4MRUA 1Z6TA 3IV0A 4WNFA 2GRQB 1O1RA 3UT7A 5CEDB 3R7RA 1A17A 2J09A 4JEHA 3ESKA 3ZXPA 3UTMA 4BT8A 1UJJA 4RQIA 2XCBA 3FY4A 2VJ8A 3MGBA 1KZOA 3CHRA 2F0YA 4R7LA 5CMYA 4D10C 2X6FA 3ASGA 3CR3A 4MBGA 1FCHA 3V30A 1OWPA 4GMLA 3ONLA 2P9PG 3SY2A 4CDRA 1VDYA 3L13A 4DPRA 5KJMA 2XHEA 3EJNA 3WXXA 1ELKA 3EU5A 1TNOA 3PUJA 2DBAA 1PAQA 2PM6A 3R9MA 3FULA 2EQXA 3MV3B 3RKVA 4K5BA 4B8AA 2P9KG 3S7FA 4AM9A 3J5QB 4DK5A 3MEKA 4UWHA 5CMWA 5HQ8A 2VSXE 4UWFA 5EIBE 1OCRE 4HS2A 2AXVA 4OYSA 2KCVA 1S0PA 4XEIG 5EX0A 3UM0A 2M63A 4DX2A 1TYQG 1OCCE 4CT0A 2IY0C 1NFIE 3LYAA 3SHFA 2YNQA 1JCSA 1UG3A 4A3TA 3DSXA 2XRYA 5T3RA 3IHVA 3D3MA 3APDA 2CG3A 3E33A 3CIAA 2XQ0A 3T5XA 5JJ6A 3CVXA 3RRNB 1YCSB 2VTBA 3FTWA 2F8YA 4JHRA 5G2NA 4I17A 2ZGDA 1UW4B 2ZU6B 4JB8P 2GW1A 2WXRA 4GZ3A 1INZA 4AXHA 4UWGA 2MHKA 4ANUA 1DVPA 2VSNA 1DCQA 3RO3A 3FUDA 2DVWA 2ETAA 4FLHA 3KSQA 3T8KA 2J07A 3AS8A 2WMNA 1MQSA 1EYHA 5T4YA 5B1BE 4GTOA 4CGWA 3B7TA 1KLXA 2GRPB 4UQYA 1TJCA 5ENQD 4QQIA 3HXBA 5AJLA 2KC7A 2GRMA 3PZ2A 1JCRA 4TRQA 3QWPA 4I6EA 4K5CA 2P9LG 5AENA 4IYPA 3CLJA 5E76A 4Y6WA 4PS3A 4J8SA 3L9TA 4CEMA 4JA7A 3TWUA 5FZQA 3PE4A 2WXHA 4U7EB 4A55A 1WDYA 4JW1A 4LRZA 3R7QA 3U9WA 4L9PA 5CCLA 4KT6B 3FU3A 4YDEA 2IFUA 3QWWA 3LVQE 2ZXWE 4U63A 4KVMA 1S64A 1TN6A 2IU1A 2UY1B 4I1OB 4KYOB 5CBOA 4L7TA 3NZUA 2B0OE 5FWQA 1NA0A 3ML9A 2Q7FA 3CVUA 3ULYA 1LD8A 3CK9A 4EECA 2WVIA 5FQ6A 2OEWA 1MJ0A 3APFA 3CHQA 4HBDA 3HYMB 3FUIA 4GA1A 4HQDA 3ZYMA 2RKKA 1N0RA 1HO8A 4G11A 3ASDA 4FHJA 1H6KA 4AIFA 4RVBA 1SQMA 1QQEA 5LX8A 4BWRA 3MKQB 2OVFA 4E6HA 1OWLA 1PC2A 2HM8A 3EU9A 4LUNU 4TV3A 4XZ4A 3FUNA 4P29A 2VSOE 3QWVA 5ENNA 5BV0A 3LVRE 3AS4A 3K9IA 3NOGD 2LXLA 3UT8A 2Y4TA 2Y69E 2FULA 3D9NA 3HXFA 1ZBPA 2WXJA 3ZXSA 3SQVA 2DWZA 1JCQA 1FT2A 4U8YD 4DX1A 3LXUX 2KATA 3B95A 5KJKA 4N2QA 4LNBA 1TN8A 2WPVA 3E32A 3UM1A 3ABLE 3TWVA 2XS1A 3DPDA 3S7JA 3AAAC 2IOLA 4CT4A 2EIKE 4ILGA 4DLQA 1N52A 3G2SA 2OV8A 2QYJA 4XI0A 4F1PA 3FU0A 1QNFA 4AOFA 2NC9A 1HE8A 4L1BA 5FZRA 1MX6A 3QK0A 3ONKA 2QYUA 1BPOA 2L0IA 2X6HA 4XI9A 3DSVA 4ANVA 4BT9A 1JUQA 1ZU2A 4FC8A 2PQNA 3L54A 3CVLA 4U0UA 4OAUC 3ZEFA 4U0SA 3B13A 4I2ZA 3EHRA 4I2WA 2WXPA 1KZPA 2BF0X 2FI7A 1K1BA 3L08A 4APOA 4ATGA 3U3WA 1HG5A 2P9UG 4KBQA 2L0TB 5FJYA 4WWNA 1OXJA 4AEZC 4UWLA 2CFUA 3ZPJA 1BU9A 4JXTA 2KZTB 3V2OA 3ULQA 3FTVA 3FU5A 3UINC 2DCPA 4I1MA 3DXMG 4ZHBA 3UUXA 4AP2A 5CRVA 4JPSA 4B93B 1MZCA 4HOSA 3ZN3A 1O1TA 4YNDA 5CHEE 3PEVB 2WMOA 1Z5SC 3NQPA 4ACLA 2XCCA 1HX8A 4CYMD 1S63A 4YDOA 4GTQA 2WXGA 2X6JA 3CVQA 3E34A 3JQ1A 3PRZA 3W9FA 4RLYA 4HI9A 1LTXA 5D0QD 1N11A 3CQGB 2WM9A 3EIQC 4GTTA 2Y0BG 2BKKB 2L6BA 4B8CB 2VGYA 2V4LA 3ZVVA 3Q7FA 4GTPA 4BSZB 3DSTA 5ANRA 1OWOA 2NSZA 5FQ4A 3TJPA 3DXKG 4FJZA 3TWWA 1TNZA 4ZFHA 3ZIMA 4HRNA 4TXRA 4ABNA 1E90A 2ETBA 4WAFA 5EDSA 4GB9A 5CBNA 3FTZA 1ZB1A 4XKCA 5LCWJ 1TNBA 2XGSA 3RAUA 4EZKA 3FHEA 3RJVA 4F3VA 3IEGA 2XPZA 4JD2G 5E75A 4WNDA 1RZ4A 1QZ2A 5FINA 4GU5A 5B3SE 1AP7A 1HS6A 5FTPA 4L23A 3ZFWA 4AJWA 4TUMA 3GW4A 3JYSA 4XKBA 1HZ4A 4PH4B 2CFZA 4FLBA 4DI3A 1JWGA 1IKND 3JUEA 4EBAA 4BERA 3U4TA 4AV7A 3I4GA 3UIOC 3UKRG 4B0ZA 5KJNA 4M7CA 4WUYA 4FJYA 5T8IA 3AU5A 2P9NG 3LDZA 1UOHA 1B89A 2XPYA 4A1GA 5EIDA 3CHPA 3JXJA 3B7UX 4I9CA 5D0OD 4EZJA 4F6RD 3FUEA 3ASNE 5CCMA 2WQ6A 3S7DA 3PREA 2YHCA 3QB2A 3CVYA 2P9IG 3NB2A 3QNKA 3PNTB 3HG0D 4U96D 1HU3A 3SFZA 3UXGA 4EZLA 2MYOA 1H6PA 4J0UA 3SGHA 5D2MC 5J90A 4O6FA 4DX6D 4HOQA 3UPVA 1XNFA 3SZ7A 3ABME 4A63B 4GTVA 5AN8A 3MV2B 4J8DA 4CCAA 4G24A 2V5QC 5KWDA 4V3IA 3O48A 1KT1A 1TEZA 1BI8B 1OWMA 4HI8A 3ZYLA 2A5UA 3D9PA 3C3OA 3GYZA 2XEHA 5LOZA 3SBTB 4FP7A 2WQ7A 1E8WA 3JXIA 1IQUA 3LCAA 1XGWA 3T9KA 2WXFA 2IO3C 3SF4A 5FIOA 3PNLB 5D66A 3F6QA 4JC8A 1DC2A 4WNEA 1TJFA 3AG1E 2X3MA 2H6HA 2H6FA 5HI7A 1E7VA 4A1SA 1BI7B 3LS8A 4TXQA 2DZNA 2XENA 3CV0A 5B1AE 2WXMA 4EHMA 1A5EA 3FUJA 4H7YA 3U66A 3OAWA 4ILHB 5ENTD 2Y4UA 4FA6A 1JPLA 5EKQD 3FTSA 1N4QA 2JLBA 2FBNA 3SD5A 3CGHA 1NL4A 3ABKE 2J49A 5HS0A 2LAIA 4J7WA 5JJ7A 4LNUD 4GAAA 2C2LA 2P2CP 1QYMA 2L9BA 5A6CA 3BQOA 3Q7AA 4IRUA 5KNGA 2YINA 1HFAA 2VTBB 4BSXA 4ANWA 3FUKA 3EUVA 1FVHA 3Q5MA 2QC9A 4JEUA 2YHEA 3Q73A 2JABA 2NXPA 2LAHA 2XEVA 5G55A 2B6CA 3EHQA 2AXZA 4RG9A 4W9RA 2XZTG 3TWTA 4ACKA 1H2TC 2I9CA 4XIFA 2XRZA 3LY9A 4KZ0A 5C2YA 2R03A 5JA4D 2JEKA 5BT1A 4IULA 3NF1A 5BUZA 3D9OA 2C0MA 4UWKA 4FU3A 2KXPC 3EIJA 3T8MA 1E8ZA 3C72A 4LG6A 2PNNA 4WWPA 3C3QA 1LF8A 1Y8MA 3HXEA 2DZOA 2I6HA 4I6GA 5EYLA 1OCZE 1N54A 2DYRE 1ELRA 5BW8C 1LD7A 3AG2E 4FADA 3TGOA 3CKBA 3FTYA 4I1AA 3VLDA
chains in the Genus database with same CATH topology
2P9NG 2P9LG 2P9KG 2P9IG 1TYQG 3DXKG 3DWLG 1K8KG 2P9PG 3UKUG 1U2VG 3RSEG 2P9UG 2P9SG 3UKRG 3DXMG 3ULEG 4XEIG 4JD2G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9N G;  2P9L G;  2P9K G;  2P9I G;  1TYQ G;  3DXK G;  3DWL G;  1K8K G;  2P9P G;  3UKU G;  1U2V G;  3RSE G;  2P9U G;  2P9S G;  3UKR G;  3DXM G;  3ULE G;  4XEI G;  4JD2 G; 
#chains in the Genus database with same CATH topology
 1X5B A;  3MX3 A;  3I5P A;  5JJT A;  3Q75 A;  4H7X A;  3APC A;  3QC1 A;  4HOU A;  3UM2 A;  2X6I A;  3GZ1 A;  3C98 A;  3CKC A;  3ASO E;  1IHG A;  4J8E A;  1Z3Y A;  4YDY A;  3VLF A;  1KT0 A;  3NOC D;  4C9B B;  3KSL A;  4G26 A;  2FO7 A;  4HXI A;  5JHA A;  5CEC B;  5LCW C;  4J8Y A;  4LEU A;  3ZGQ A;  1DNP A;  3ZHE A;  3LY7 A;  3JCK C;  3FH5 A;  3ZRH A;  2F37 A;  3FUM A;  1N4S A;  4GZ5 A;  3TG4 A;  5C1D A;  4F53 A;  1SVX A;  4M3O A;  1H0A A;  3RIB A;  3TWX A;  3PUK A;  1H6O A;  4CDM A;  2OND A;  2VYI A;  3EHM A;  2RD0 A;  3DEO A;  2OEV A;  2J9Q A;  3RO2 A;  5AAR A;  2J4D A;  1N4P A;  1N0Q A;  2WXI A;  1WG0 A;  3BG0 B;  4CGV A;  3FWV A;  4LSZ E;  4U8H A;  2I1J A;  3CST A;  1FT1 A;  3OXF A;  4JVS A;  4C0M A;  4OAV B;  3PDN A;  3ZNG A;  1HF8 A;  1NZN A;  3MKR A;  3AG4 E;  4NRH B;  3D9I A;  3SNX A;  1D9S A;  4YVQ C;  4GZC A;  4LCT A;  4N3A A;  1K3Z D;  3FTX A;  3QKY A;  5ANL A;  5ENS D;  5FZS A;  4NAC A;  5CEA A;  2VSY A;  3ZHE B;  3Q47 B;  3TG5 A;  4C48 B;  3QAR A;  4GZD A;  3O4Z A;  4HRL A;  4UI9 K;  4MLP A;  3S7B A;  5A7D B;  5LP0 A;  1YYH A;  3Q49 B;  2IOS A;  4WNG A;  1OWN A;  5AQB A;  1U3D A;  3RRU A;  3LPZ A;  1IXV A;  4JL0 A;  3L82 A;  1OCO E;  2XGM A;  3ZYQ A;  1K8K G;  3EDT B;  3URZ A;  3OXL A;  3FH8 A;  4HOR A;  2EIN E;  2RG8 A;  3ESL A;  3MZL B;  4GPM A;  5ENO D;  4N5Q A;  2IEJ A;  4HLL A;  2WXQ A;  3FEX A;  3LY8 A;  4B89 A;  2E2E A;  2GRO B;  2V4H C;  3TL5 A;  4HOT A;  1DCE A;  4PS7 A;  2AJA A;  2A4Z A;  1D8D A;  2ETC A;  2V0P A;  1E8X A;  3B7S A;  3ZKJ A;  3DSW A;  4GA0 A;  4Z68 A;  4RSY A;  4N2S A;  5CER B;  3NBN B;  4I43 A;  1JWF A;  4HVB A;  3Q78 A;  2I2O A;  1AWC B;  1X81 A;  3BEE A;  1NI1 A;  3FEY A;  3C5R A;  4O1O A;  3RRM B;  2R17 C;  1OT8 A;  4GYW A;  5BPP A;  2PL2 A;  4BFR A;  1QBQ A;  4ME2 A;  3TWR A;  4EQF A;  2ZIR A;  4JHJ A;  4Q96 A;  2EIL E;  4G8K A;  2HR2 A;  4C0E A;  3HXD A;  2WQH A;  2VGE A;  4AVX A;  2A5E A;  1U3C A;  1Z3X A;  1HG2 A;  1MX2 A;  4F7A A;  1YMP A;  4JHK A;  4BY6 A;  4OVV A;  2PZI A;  3HDX A;  3IHY A;  3CQC B;  1MX4 A;  4CZ2 D;  5FQ8 A;  1H2U A;  4U0Z A;  3UI2 A;  1WM5 A;  4DUI A;  2F8X K;  2HO1 A;  4L2L A;  3SI5 A;  2OVB A;  5EIL A;  5ARG A;  3IXE A;  5H7P A;  2J4B A;  2Y1L E;  4G8L A;  4DI4 A;  1WAO 1;  2QFC A;  2LSU A;  4NQ0 A;  3NZS A;  5EX3 A;  4JZY A;  5BNW A;  4I9E A;  4KZC A;  2BUG A;  2WB2 A;  3FUF A;  2GRL A;  3QOU A;  4J8F A;  4TUU A;  2BKG A;  3FTU A;  1SA4 A;  1O1S A;  2FO1 E;  4NIK A;  4A3V A;  3BU8 A;  3V79 K;  2ZIS A;  4K0R A;  4URK A;  3CHO A;  5G05 J;  3MA5 A;  4HRM B;  3E37 A;  3UQ3 A;  5KJL A;  1OUV A;  2PM7 A;  3L6A A;  5AYW D;  3TAX A;  1IYG A;  1ELW A;  3AJI A;  2J8S D;  4U8V D;  2VGX A;  2NYJ A;  3QAQ A;  1S70 B;  3LJ3 A;  2V8S E;  4GA2 A;  4ILI A;  3HIZ A;  3CHM A;  1EDU A;  2V5F A;  3OXG A;  3WG7 E;  2CHX A;  1YA0 A;  2J08 A;  2YQ8 A;  3L22 A;  1IQR A;  2LO6 A;  1WY6 A;  3TWQ A;  2R59 A;  5KCM A;  3Q15 A;  5ITZ F;  3ML8 A;  3G2V A;  4X8Q A;  1BLX B;  5CRU A;  4BX8 A;  1H2V C;  5AJD A;  1O5M A;  1E96 B;  5JHB A;  4BX9 A;  3UX4 A;  1G3N B;  3KD7 A;  2VQ2 A;  5KBA A;  2BTD A;  3AG3 E;  3ISM C;  3CVW A;  1FPP A;  3KAE A;  2XEE A;  3PZ1 A;  5G04 J;  4KVO A;  2R05 A;  5AIJ A;  3FH7 A;  2LSV A;  1U2V G;  3UT4 A;  3I3N A;  4LER A;  3CVN A;  2VGX B;  3SFY A;  4GPK A;  3PE3 A;  1EPU A;  3V31 A;  4FHK A;  5A23 A;  1UN9 A;  2DYS E;  3DPY A;  3S2A A;  2CHZ A;  4GYY A;  2P58 C;  3Q9N C;  4DJA A;  4CDN A;  4BEP A;  4F1S A;  4HNA D;  3DEP A;  3ZUV B;  2XZD G;  1NP7 A;  3D9H A;  3R9A B;  3MYV A;  1V54 E;  4GZ6 A;  3VTY A;  3NAW A;  4YVO A;  4U04 A;  1TR4 A;  3FP3 A;  5EYP F;  2UY1 A;  1SZ9 A;  1IHB A;  2WXL A;  2QY7 A;  3TWS A;  3D9M A;  1N9A A;  4DX7 D;  3VTX A;  4FUL A;  3AS5 A;  4Q69 A;  4UI9 J;  3L16 A;  3GZ2 A;  3LJN A;  2EIM E;  3PH0 C;  1V55 E;  4N3C A;  4BES A;  5KNH D;  4UUC A;  3MCX A;  4BTB A;  2WXO A;  3MKQ A;  3G2U A;  1K1A A;  3L17 A;  3U64 A;  4LNG A;  2I1K A;  3PZD A;  3ULE G;  3KS2 A;  3W9G A;  4GMR A;  3HRA A;  4NUR A;  2R02 A;  2WXN A;  2XGO A;  3Q9U C;  4G1T A;  3E4B A;  4UQZ A;  4E85 A;  2UWJ G;  4KXK B;  3HHM A;  3G2W A;  3I4R B;  4O60 A;  1UJK A;  4EPZ A;  5M72 A;  2XS8 A;  3B7B A;  5ARF A;  3E30 A;  1TN7 A;  1E7U A;  1PY1 A;  3PZ4 A;  4N3B A;  3JUI A;  4GTS A;  5AQ9 A;  4DX5 D;  3DSU A;  2GRR B;  1Q2Z A;  1MYO A;  3LKU A;  5JMN D;  4N5C A;  3SBS A;  2OCC E;  4JA9 A;  1HH8 A;  3DRA A;  1N95 A;  2AWI A;  3CHS A;  2KM4 A;  4K5A B;  4IN3 B;  1UN8 A;  4YDW A;  4K03 A;  4AY5 A;  3CK7 A;  4APF A;  2IJG X;  2PQR A;  2HYZ A;  3VLE A;  2BED A;  4TXP A;  2H6I A;  3G2T A;  3PEU B;  1TNY A;  4ATZ D;  4L2Y A;  1MHQ A;  2Y3A A;  2EIJ E;  4CRW A;  4HLE A;  3FU6 A;  1GW6 A;  4PS8 A;  2HE0 A;  3Q4A B;  3HXC A;  3AU4 A;  5BXU A;  2LXM A;  1TNU A;  4GTM A;  4EBA G;  3RU0 A;  3CSF A;  5IY5 E;  2FEZ A;  3PVL A;  3DBS A;  3UM3 A;  3ZW3 A;  3TXN A;  4AY6 A;  3FUH A;  5ENR D;  2X6K A;  4N39 A;  1W3B A;  5G05 C;  3KEZ A;  1OY3 D;  4GCO A;  5DBK A;  2LUH A;  2ION A;  1KPS B;  1BD8 A;  5J08 A;  4GCN A;  4I6J A;  3QJZ A;  3JQ0 A;  3KEA A;  3V2X A;  1Y6I A;  2CHW A;  5FT9 A;  5AQ7 A;  2KZT A;  3UKU G;  2C0L A;  4DLO A;  2IO2 C;  2L6J A;  5HKP A;  3PZ3 A;  2R2L A;  3X2Q E;  3J5P A;  3SFX A;  3B7R L;  4WWO A;  2GGF A;  4DRX E;  1N94 A;  4HFG A;  3D9K A;  5EN5 D;  4GYO A;  1P5Q A;  4G23 A;  3ENE A;  4XE0 A;  3UMV A;  4U07 A;  4RG6 A;  4XX5 A;  1N4R A;  4GTR A;  1FVF A;  3SO8 A;  4MS6 A;  2KCK A;  3FFL A;  3IBE A;  3P1U A;  3TXM A;  4O1P A;  2MRI A;  2ILR A;  1HXI A;  3P2B A;  3RSE G;  3CVP A;  5G04 C;  4BTA A;  3HVE A;  2KCL A;  3ZYK A;  3CVV A;  3DWL G;  3FDH A;  3RK6 A;  2ZGG A;  5HRY A;  5BV1 A;  3ASF A;  2IQC A;  3BG1 B;  1E8Y A;  4HB5 A;  5AQA A;  1L5J A;  2KBX A;  2AW6 A;  3QDN A;  4B94 A;  1SW6 A;  4Y6C A;  3CEQ A;  2RFM A;  2H6G A;  1EF1 C;  4PDX A;  3LEW A;  1RW2 A;  5FQ7 A;  4PUC A;  5BXO A;  2RFA A;  3C3R A;  4MKT A;  3MJW A;  3CK8 A;  4G25 A;  1SZA A;  4UQX A;  3T5V A;  2CG2 A;  4ANX A;  3ASH A;  5ENP D;  4J6I A;  2AVP A;  3EHN A;  3GZS A;  3HVE B;  1SA5 A;  1NA3 A;  4BET A;  3D9J A;  3D9L A;  4QFV A;  4UI9 C;  2LNI A;  2E0I A;  4G2V A;  2FF4 A;  2XPI A;  3ZU7 B;  4OVU A;  5LFA A;  3Q79 A;  3OTN A;  2DIW A;  2P9S G;  2GRN B;  3DSS A;  5AAO A;  3N71 A;  4U95 D;  2X38 A;  2IF4 A;  2QZA A;  2R5S A;  2AXU A;  4KMO A;  1D8E A;  2OOE A;  3UIP C;  1H19 A;  4GMJ A;  2MOW A;  4Q94 A;  3BUA A;  3IKO B;  2WXK A;  3PS6 A;  5DIZ A;  4MRU A;  1Z6T A;  3IV0 A;  4WNF A;  2GRQ B;  1O1R A;  3UT7 A;  5CED B;  3R7R A;  1A17 A;  2J09 A;  4JEH A;  3ESK A;  3ZXP A;  3UTM A;  4BT8 A;  1UJJ A;  4RQI A;  2XCB A;  3FY4 A;  2VJ8 A;  3MGB A;  1KZO A;  3CHR A;  2F0Y A;  4R7L A;  5CMY A;  4D10 C;  2X6F A;  3ASG A;  3CR3 A;  4MBG A;  1FCH A;  3V30 A;  1OWP A;  4GML A;  3ONL A;  2P9P G;  3SY2 A;  4CDR A;  1VDY A;  3L13 A;  4DPR A;  5KJM A;  2XHE A;  3EJN A;  3WXX A;  1ELK A;  3EU5 A;  1TNO A;  3PUJ A;  2DBA A;  1PAQ A;  2PM6 A;  3R9M A;  3FUL A;  2EQX A;  3MV3 B;  3RKV A;  4K5B A;  4B8A A;  2P9K G;  3S7F A;  4AM9 A;  3J5Q B;  4DK5 A;  3MEK A;  4UWH A;  5CMW A;  5HQ8 A;  2VSX E;  4UWF A;  5EIB E;  1OCR E;  4HS2 A;  2AXV A;  4OYS A;  2KCV A;  1S0P A;  4XEI G;  5EX0 A;  3UM0 A;  2M63 A;  4DX2 A;  1TYQ G;  1OCC E;  4CT0 A;  2IY0 C;  1NFI E;  3LYA A;  3SHF A;  2YNQ A;  1JCS A;  1UG3 A;  4A3T A;  3DSX A;  2XRY A;  5T3R A;  3IHV A;  3D3M A;  3APD A;  2CG3 A;  3E33 A;  3CIA A;  2XQ0 A;  3T5X A;  5JJ6 A;  3CVX A;  3RRN B;  1YCS B;  2VTB A;  3FTW A;  2F8Y A;  4JHR A;  5G2N A;  4I17 A;  2ZGD A;  1UW4 B;  2ZU6 B;  4JB8 P;  2GW1 A;  2WXR A;  4GZ3 A;  1INZ A;  4AXH A;  4UWG A;  2MHK A;  4ANU A;  1DVP A;  2VSN A;  1DCQ A;  3RO3 A;  3FUD A;  2DVW A;  2ETA A;  4FLH A;  3KSQ A;  3T8K A;  2J07 A;  3AS8 A;  2WMN A;  1MQS A;  1EYH A;  5T4Y A;  5B1B E;  4GTO A;  4CGW A;  3B7T A;  1KLX A;  2GRP B;  4UQY A;  1TJC A;  5ENQ D;  4QQI A;  3HXB A;  5AJL A;  2KC7 A;  2GRM A;  3PZ2 A;  1JCR A;  4TRQ A;  3QWP A;  4I6E A;  4K5C A;  2P9L G;  5AEN A;  4IYP A;  3CLJ A;  5E76 A;  4Y6W A;  4PS3 A;  4J8S A;  3L9T A;  4CEM A;  4JA7 A;  3TWU A;  5FZQ A;  3PE4 A;  2WXH A;  4U7E B;  4A55 A;  1WDY A;  4JW1 A;  4LRZ A;  3R7Q A;  3U9W A;  4L9P A;  5CCL A;  4KT6 B;  3FU3 A;  4YDE A;  2IFU A;  3QWW A;  3LVQ E;  2ZXW E;  4U63 A;  4KVM A;  1S64 A;  1TN6 A;  2IU1 A;  2UY1 B;  4I1O B;  4KYO B;  5CBO A;  4L7T A;  3NZU A;  2B0O E;  5FWQ A;  1NA0 A;  3ML9 A;  2Q7F A;  3CVU A;  3ULY A;  1LD8 A;  3CK9 A;  4EEC A;  2WVI A;  5FQ6 A;  2OEW A;  1MJ0 A;  3APF A;  3CHQ A;  4HBD A;  3HYM B;  3FUI A;  4GA1 A;  4HQD A;  3ZYM A;  2RKK A;  1N0R A;  1HO8 A;  4G11 A;  3ASD A;  4FHJ A;  1H6K A;  4AIF A;  4RVB A;  1SQM A;  1QQE A;  5LX8 A;  4BWR A;  3MKQ B;  2OVF A;  4E6H A;  1OWL A;  1PC2 A;  2HM8 A;  3EU9 A;  4LUN U;  4TV3 A;  4XZ4 A;  3FUN A;  4P29 A;  2VSO E;  3QWV A;  5ENN A;  5BV0 A;  3LVR E;  3AS4 A;  3K9I A;  3NOG D;  2LXL A;  3UT8 A;  2Y4T A;  2Y69 E;  2FUL A;  3D9N A;  3HXF A;  1ZBP A;  2WXJ A;  3ZXS A;  3SQV A;  2DWZ A;  1JCQ A;  1FT2 A;  4U8Y D;  4DX1 A;  3LXU X;  2KAT A;  3B95 A;  5KJK A;  4N2Q A;  4LNB A;  1TN8 A;  2WPV A;  3E32 A;  3UM1 A;  3ABL E;  3TWV A;  2XS1 A;  3DPD A;  3S7J A;  3AAA C;  2IOL A;  4CT4 A;  2EIK E;  4ILG A;  4DLQ A;  1N52 A;  3G2S A;  2OV8 A;  2QYJ A;  4XI0 A;  4F1P A;  3FU0 A;  1QNF A;  4AOF A;  2NC9 A;  1HE8 A;  4L1B A;  5FZR A;  1MX6 A;  3QK0 A;  3ONK A;  2QYU A;  1BPO A;  2L0I A;  2X6H A;  4XI9 A;  3DSV A;  4ANV A;  4BT9 A;  1JUQ A;  1ZU2 A;  4FC8 A;  2PQN A;  3L54 A;  3CVL A;  4U0U A;  4OAU C;  3ZEF A;  4U0S A;  3B13 A;  4I2Z A;  3EHR A;  4I2W A;  2WXP A;  1KZP A;  2BF0 X;  2FI7 A;  1K1B A;  3L08 A;  4APO A;  4ATG A;  3U3W A;  1HG5 A;  2P9U G;  4KBQ A;  2L0T B;  5FJY A;  4WWN A;  1OXJ A;  4AEZ C;  4UWL A;  2CFU A;  3ZPJ A;  1BU9 A;  4JXT A;  2KZT B;  3V2O A;  3ULQ A;  3FTV A;  3FU5 A;  3UIN C;  2DCP A;  4I1M A;  3DXM G;  4ZHB A;  3UUX A;  4AP2 A;  5CRV A;  4JPS A;  4B93 B;  1MZC A;  4HOS A;  3ZN3 A;  1O1T A;  4YND A;  5CHE E;  3PEV B;  2WMO A;  1Z5S C;  3NQP A;  4ACL A;  2XCC A;  1HX8 A;  4CYM D;  1S63 A;  4YDO A;  4GTQ A;  2WXG A;  2X6J A;  3CVQ A;  3E34 A;  3JQ1 A;  3PRZ A;  3W9F A;  4RLY A;  4HI9 A;  1LTX A;  5D0Q D;  1N11 A;  3CQG B;  2WM9 A;  3EIQ C;  4GTT A;  2Y0B G;  2BKK B;  2L6B A;  4B8C B;  2VGY A;  2V4L A;  3ZVV A;  3Q7F A;  4GTP A;  4BSZ B;  3DST A;  5ANR A;  1OWO A;  2NSZ A;  5FQ4 A;  3TJP A;  3DXK G;  4FJZ A;  3TWW A;  1TNZ A;  4ZFH A;  3ZIM A;  4HRN A;  4TXR A;  4ABN A;  1E90 A;  2ETB A;  4WAF A;  5EDS A;  4GB9 A;  5CBN A;  3FTZ A;  1ZB1 A;  4XKC A;  5LCW J;  1TNB A;  2XGS A;  3RAU A;  4EZK A;  3FHE A;  3RJV A;  4F3V A;  3IEG A;  2XPZ A;  4JD2 G;  5E75 A;  4WND A;  1RZ4 A;  1QZ2 A;  5FIN A;  4GU5 A;  5B3S E;  1AP7 A;  1HS6 A;  5FTP A;  4L23 A;  3ZFW A;  4AJW A;  4TUM A;  3GW4 A;  3JYS A;  4XKB A;  1HZ4 A;  4PH4 B;  2CFZ A;  4FLB A;  4DI3 A;  1JWG A;  1IKN D;  3JUE A;  4EBA A;  4BER A;  3U4T A;  4AV7 A;  3I4G A;  3UIO C;  3UKR G;  4B0Z A;  5KJN A;  4M7C A;  4WUY A;  4FJY A;  5T8I A;  3AU5 A;  2P9N G;  3LDZ A;  1UOH A;  1B89 A;  2XPY A;  4A1G A;  5EID A;  3CHP A;  3JXJ A;  3B7U X;  4I9C A;  5D0O D;  4EZJ A;  4F6R D;  3FUE A;  3ASN E;  5CCM A;  2WQ6 A;  3S7D A;  3PRE A;  2YHC A;  3QB2 A;  3CVY A;  2P9I G;  3NB2 A;  3QNK A;  3PNT B;  3HG0 D;  4U96 D;  1HU3 A;  3SFZ A;  3UXG A;  4EZL A;  2MYO A;  1H6P A;  4J0U A;  3SGH A;  5D2M C;  5J90 A;  4O6F A;  4DX6 D;  4HOQ A;  3UPV A;  1XNF A;  3SZ7 A;  3ABM E;  4A63 B;  4GTV A;  5AN8 A;  3MV2 B;  4J8D A;  4CCA A;  4G24 A;  2V5Q C;  5KWD A;  4V3I A;  3O48 A;  1KT1 A;  1TEZ A;  1BI8 B;  1OWM A;  4HI8 A;  3ZYL A;  2A5U A;  3D9P A;  3C3O A;  3GYZ A;  2XEH A;  5LOZ A;  3SBT B;  4FP7 A;  2WQ7 A;  1E8W A;  3JXI A;  1IQU A;  3LCA A;  1XGW A;  3T9K A;  2WXF A;  2IO3 C;  3SF4 A;  5FIO A;  3PNL B;  5D66 A;  3F6Q A;  4JC8 A;  1DC2 A;  4WNE A;  1TJF A;  3AG1 E;  2X3M A;  2H6H A;  2H6F A;  5HI7 A;  1E7V A;  4A1S A;  1BI7 B;  3LS8 A;  4TXQ A;  2DZN A;  2XEN A;  3CV0 A;  5B1A E;  2WXM A;  4EHM A;  1A5E A;  3FUJ A;  4H7Y A;  3U66 A;  3OAW A;  4ILH B;  5ENT D;  2Y4U A;  4FA6 A;  1JPL A;  5EKQ D;  3FTS A;  1N4Q A;  2JLB A;  2FBN A;  3SD5 A;  3CGH A;  1NL4 A;  3ABK E;  2J49 A;  5HS0 A;  2LAI A;  4J7W A;  5JJ7 A;  4LNU D;  4GAA A;  2C2L A;  2P2C P;  1QYM A;  2L9B A;  5A6C A;  3BQO A;  3Q7A A;  4IRU A;  5KNG A;  2YIN A;  1HFA A;  2VTB B;  4BSX A;  4ANW A;  3FUK A;  3EUV A;  1FVH A;  3Q5M A;  2QC9 A;  4JEU A;  2YHE A;  3Q73 A;  2JAB A;  2NXP A;  2LAH A;  2XEV A;  5G55 A;  2B6C A;  3EHQ A;  2AXZ A;  4RG9 A;  4W9R A;  2XZT G;  3TWT A;  4ACK A;  1H2T C;  2I9C A;  4XIF A;  2XRZ A;  3LY9 A;  4KZ0 A;  5C2Y A;  2R03 A;  5JA4 D;  2JEK A;  5BT1 A;  4IUL A;  3NF1 A;  5BUZ A;  3D9O A;  2C0M A;  4UWK A;  4FU3 A;  2KXP C;  3EIJ A;  3T8M A;  1E8Z A;  3C72 A;  4LG6 A;  2PNN A;  4WWP A;  3C3Q A;  1LF8 A;  1Y8M A;  3HXE A;  2DZO A;  2I6H A;  4I6G A;  5EYL A;  1OCZ E;  1N54 A;  2DYR E;  1ELR A;  5BW8 C;  1LD7 A;  3AG2 E;  4FAD A;  3TGO A;  3CKB A;  3FTY A;  4I1A A;  3VLD A; 
#chains in the Genus database with same CATH homology
 2P9N G;  2P9L G;  2P9K G;  2P9I G;  1TYQ G;  3DXK G;  3DWL G;  1K8K G;  2P9P G;  3UKU G;  1U2V G;  3RSE G;  2P9U G;  2P9S G;  3UKR G;  3DXM G;  3ULE G;  4XEI G;  4JD2 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...