1U2VG

Crystal structure of arp2/3 complex with bound adp and calcium
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
135
Chain Sequence
ARFRKVDVDEYDENKFVDAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-Related Protein 3
publication title Crystal structures of actin-related protein 2/3 complex with bound ATP or ADP
pubmed doi rcsb
molecule tags Structural protein
total genus 46
structure length 135
sequence length 143
ec nomenclature
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 1u2vG00
3DWLG 4XEIG 3UKUG 2P9SG 2P9KG 2P9IG 3DXKG 3ULEG 3UKRG 3RSEG 2P9UG 2P9PG 1U2VG 3DXMG 1TYQG 2P9NG 2P9LG 1K8KG 4JD2G
chains in the Genus database with same CATH superfamily
3QNKA 4XEIG 4GPKA 3JCKC 3PE4A 3Q15A 3AJIA 4DI4A 3HXDA 4K03A 1JWGA 3FUEA 2XENA 1D8EA 4UI9J 4PUCA 5EKQD 4CGWA 4KBQA 4JEUA 2I1KA 5KCMA 4CEMA 3C3RA 3SQVA 4GTRA 2FO7A 5KWDA 4EPZA 5HRYA 1RW2A 1S63A 2WQ6A 5JJ6A 2PZIA 3VLDA 4E6HA 2A4ZA 4L1BA 4IYPA 1UJKA 4URKA 2IOLA 3GZ1A 5ARFA 4HOQA 3R7QA 3FUNA 5FQ7A 4OVVA 4PS3A 5HS0A 4K5BA 5EX0A 2FO1E 4N5QA 2QZAA 2FBNA 4O1OA 3BG0B 1OXJA 1OUVA 4G11A 4NACA 1NA3A 2NXPA 3OXGA 2J8SD 4RQIA 3O48A 4BT8A 1ZBPA 4AJWA 2L9BA 1HE8A 3URZA 3J5QB 3EHRA 3DXMG 5FZQA 2YHCA 3FDHA 4YDOA 2PQRA 1HF8A 2WXKA 1S64A 1HG2A 1QQEA 2H6FA 5J90A 2HE0A 3BQOA 2IQCA 3JUEA 3DSVA 4AEZC 2WMOA 1IHGA 4GTSA 3L13A 4FJYA 3FWVA 1Z3XA 3L6AA 1EPUA 4GZCA 2KXPC 4J7WA 1HG5A 2F0YA 3NZSA 1E7UA 4DX5D 4G24A 3S2AA 2XZTG 3T5XA 5H7PA 3ZNGA 5ITZF 2P9SG 1TN7A 3U66A 4CT4A 4I17A 1HXIA 5BUZA 5JJ7A 2FI7A 3I4GA 1JCSA 3T8KA 4WWOA 1KZOA 1O5MA 3KSQA 5AIJA 5B1AE 4NURA 4GPMA 2ZIRA 4EECA 3APDA 4J6IA 5HQ8A 4C48B 5D0QD 3ASGA 5KJMA 3QWVA 2F8XK 3FU5A 4GB9A 2QFCA 4YDEA 2XZDG 5B3SE 3ONLA 2LAIA 4BT9A 3SBSA 2J49A 3CSFA 2ZGGA 1JPLA 4LSZE 3AG3E 2WXGA 3P1UA 2P9PG 4U8HA 1QBQA 3CIAA 4BSXA 3D9OA 4APFA 2V5QC 5CEDB 3DEOA 2J08A 4UWHA 1N11A 3FULA 4C0EA 2IFUA 2XEVA 4GZ5A 2WXOA 1UG3A 1JUQA 5CRVA 3QK0A 4CGVA 3UM1A 4W9RA 2WMNA 1MJ0A 1TNBA 1Y6IA 3QKYA 1Z6TA 4ANXA 3CGHA 2GRPB 4MKTA 3TXMA 1JWFA 2I9CA 2EQXA 3LVRE 4HB5A 4JHJA 5EILA 3PS6A 3SFYA 2GRLA 3AAAC 5CBOA 4CDRA 2V8SE 1JCRA 3FY4A 4A55A 2PNNA 4I43A 3BEEA 4WNFA 4YVOA 3TJPA 1MX4A 3EU5A 2IONA 4LCTA 3B7UX 3SD5A 3ISMC 5D2MC 4B8AA 2KCKA 4U8VD 3D9LA 3EJNA 4UWFA 2BEDA 1SA4A 2ZXWE 4GA1A 3B95A 4WNEA 3ESLA 3LJ3A 5EYLA 3UTMA 2F8YA 3CK9A 1MX2A 2EIJE 1OCCE 3UIOC 3RRNB 3OXFA 4F1PA 1BI7B 2I2OA 1X5BA 3D9NA 2A5UA 4E85A 5KJKA 5FZRA 3G2TA 4IN3B 4UI9C 3B13A 2IOSA 1SA5A 3PZDA 4EBAA 3L9TA 4AY5A 4HFGA 2DBAA 4CDNA 4U96D 3SY2A 3SHFA 1A5EA 4RG6A 2ETCA 3KAEA 3CVVA 2XHEA 3LEWA 1OCZE 2BKKB 4JD2G 4IULA 4L7TA 4GTPA 2Y0BG 4CZ2D 5E75A 2C2LA 1TN6A 4NRHB 1TNYA 2LNIA 2GRRB 4AY6A 2LO6A 4JZYA 3BUAA 3CVXA 1H6PA 1K3ZD 3C72A 3FU6A 5FJYA 2WXPA 4A3TA 3IKOB 1KPSB 3U9WA 2RFAA 3MA5A 2DYRE 3HVEB 5AJLA 4GMJA 5FQ4A 3FTVA 4LNBA 4ILHB 1DNPA 3TL5A 3HXFA 5G05J 1OWMA 4OAVB 1N0QA 5ENRD 1Q2ZA 2L6JA 4ATZD 3ASDA 5A6CA 4JEHA 3HG0D 3FTUA 3UX4A 3FTXA 4I1MA 3Q7FA 2WXQA 4B94A 1BD8A 2AWIA 1IHBA 3LYAA 2V4HC 5ENPD 3CVPA 1U3CA 3LPZA 2IO3C 1K1AA 2XCCA 2X6HA 4XX5A 3HYMB 3SI5A 3FTSA 4GU5A 4HS2A 3IV0A 1P5QA 4ABNA 3LXUX 4HOUA 4GYYA 2DYSE 2J07A 2KCVA 3V2XA 3HXBA 3E30A 1V55E 3HXEA 5ENSD 4XE0A 5AQ9A 4RG9A 3Q78A 1DC2A 3CQGB 3O4ZA 5FIOA 5BXOA 3FTWA 3B7SA 3SNXA 3RO3A 2OEWA 1N4SA 3UKUG 1NI1A 2PM7A 1L5JA 5BV0A 4A63B 3HXCA 4AOFA 5JHBA 3UIPC 3E33A 2Y4UA 2I6HA 3DRAA 4GCNA 4F3VA 4RLYA 1HX8A 1PY1A 3DEPA 1UW4B 3VTXA 5LX8A 3L08A 2L6BA 4G8LA 3RO2A 3FH7A 1KZPA 3Q73A 3EIQC 3VLFA 5EIDA 2CHZA 3I5PA 4JHKA 3Q5MA 3ONKA 4BX8A 3UM3A 5AQBA 3E34A 2BKGA 2A5EA 2P9KG 3E37A 3ZN3A 2QY7A 5LP0A 1YCSB 2J09A 5BT1A 4FHJA 2VSXE 4A1GA 4I1AA 3JQ1A 5LFAA 1H6KA 4UWKA 4TRQA 4CCAA 4BTBA 2DCPA 4UQYA 2X6KA 4JC8A 5CHEE 2WXHA 3V31A 5G55A 2XPIA 3ZYKA 4U04A 1E96B 1MZCA 1FCHA 4I6JA 3HVEA 2Y69E 3FUFA 2P9LG 5JJTA 3FUKA 3MJWA 2P58C 3FH8A 3HDXA 2KM4A 2BTDA 3P2BA 4FA6A 3B7BA 2V5FA 3QARA 1TEZA 1OY3D 5CMYA 3BG1B 4U7EB 4HOTA 5E76A 5D66A 1NL4A 3R9MA 4ANWA 3T8MA 5CEAA 3CVLA 5AYWD 4LG6A 3FFLA 4EHMA 3TWVA 3ESKA 1UOHA 1E8YA 3L82A 1E8ZA 2XQ0A 2X6JA 2VGXB 4BSZB 3UPVA 4FU3A 3PZ1A 3S7FA 2RD0A 5FWQA 5AAOA 2VYIA 3ASHA 1NP7A 3NZUA 3W9FA 3TWWA 3NBNB 3B7TA 1Z5SC 4G1TA 4ILGA 5ANLA 1D9SA 2X6FA 3SGHA 3WXXA 3CK8A 4KT6B 3D9PA 4DJAA 1AWCB 3IXEA 3UM2A 3UXGA 3ZUVB 2YNQA 4ZHBA 1MX6A 1NZNA 1H19A 3QAQA 3EHMA 5C1DA 4UQXA 4LERA 3ZXPA 3AG4E 3MGBA 4M3OA 4O6FA 5AN8A 1B89A 2WXRA 2P9NG 2OVBA 3DSTA 5ENTD 5BXUA 5G05C 1N52A 3I3NA 4CDMA 3MZLB 3PZ2A 2ETBA 2GRQB 3FU0A 3PUJA 1HFAA 2R05A 3Q79A 4TXPA 5EIBE 1H0AA 1H2VC 2J4DA 5ENNA 2Y4TA 1EYHA 3E4BA 3NOGD 5DBKA 1QZ2A 2WPVA 3E32A 3PH0C 3SBTB 3Q9UC 2RG8A 1FT1A 4L2LA 1LF8A 4ACKA 4BWRA 1TJCA 2R2LA 1UN9A 4LEUA 3AS4A 1OCOE 3R9AB 2R03A 1FT2A 2IO2C 3RRUA 4HBDA 4I6GA 3S7JA 2X38A 2LUHA 4WNGA 4WAFA 3FH5A 2OV8A 3ML9A 3CHQA 3ABKE 5T3RA 3HRAA 3TG4A 4KXKB 2VSOE 3B7RL 4B8CB 1YYHA 1QNFA 5A23A 4BX9A 1KT1A 2EIME 2J4BA 4N2QA 5C2YA 2X3MA 2V4LA 4DLOA 3IEGA 3AU4A 1DVPA 3NOCD 1TNZA 3C3OA 4AXHA 4Y6WA 1XGWA 4BFRA 3UI2A 3ZIMA 3Q47B 2MOWA 4L2YA 4Z68A 3G2SA 3CKCA 1QYMA 3AS5A 1OWLA 3TWQA 3ZYQA 1N4QA 5EX3A 1N4RA 4MRUA 5CERB 4JVSA 4ATGA 5FINA 3CHOA 4O1PA 5FT9A 3FHEA 4HLLA 4HLEA 3U3WA 3CQCB 3DPYA 1IXVA 4BY6A 3FTZA 3UT8A 2XGOA 1DCQA 3LJNA 3FUDA 3R7RA 2GRMA 3NB2A 2MRIA 3Q75A 3ZHEB 2R5SA 5CRUA 3LS8A 2XRYA 1HU3A 4U0UA 1N54A 1JCQA 4GTQA 2VQ2A 2VGXA 2IF4A 2Q7FA 3RJVA 5DIZA 3PVLA 5EYPF 1TNUA 4N39A 3RSEG 2R59A 3CK7A 2ETAA 4AM9A 3PNTB 4TUUA 3BU8A 4ZFHA 1D8DA 1N9AA 2JEKA 3ZRHA 1FVFA 3KD7A 4ME2A 1O1SA 4WWNA 4D10C 4N5CA 4G2VA 4F1SA 2CFZA 4KZCA 3DWLG 3NF1A 2FEZA 2XEEA 3LY9A 3PNLB 3QJZA 1EDUA 3L16A 3DBSA 2UY1B 3CHSA 1EF1C 1ELWA 3UM0A 5CBNA 2YHEA 2FULA 3CVNA 2LAHA 3ULYA 4U95D 3D9MA 4DX1A 1IKND 4K5CA 4B0ZA 2ZGDA 5EN5D 4N2SA 3ULEG 2P2CP 1XNFA 1V54E 1BLXB 1O1TA 2KZTB 4F6RD 1E8WA 3Q49B 4FULA 2XEHA 2AVPA 4O60A 3JUIA 4KMOA 5CCLA 3PZ4A 4CYMD 5LCWJ 3CHMA 3L22A 3ABLE 3CVWA 2WQ7A 3GW4A 4CRWA 3EDTB 3GYZA 4G8KA 1HO8A 2GW1A 5BV1A 2X6IA 4GTOA 4WUYA 5IY5E 2FF4A 5JMND 3EU9A 4X8QA 2V0PA 3D9KA 3D9IA 2WXJA 3LY7A 5JA4D 1K8KG 1YMPA 2AJAA 4DLQA 2H6GA 3F6QA 3D9HA 2E0IA 2EILE 1FVHA 4BEPA 4J8FA 3FUJA 5T4YA 3UQ3A 1TNOA 4I9EA 3V2OA 3X2QE 4J8DA 4IRUA 4LNUD 4I9CA 4JB8P 5J08A 3SZ7A 1HZ4A 4UWLA 2QYJA 4Q94A 3HHMA 2MHKA 4AIFA 3MV3B 3QC1A 2WXFA 4BERA 3HIZA 4N3AA 3MYVA 5KBAA 4QFVA 3APCA 4DX6D 4XKBA 4TV3A 3LDZA 2CHXA 5CCMA 4HRNA 3TWUA 1OCRE 1MYOA 3DSSA 4I2ZA 4KYOB 3ASOE 2KATA 4FHKA 4GYOA 4JL0A 4APOA 2L0IA 5B1BE 4TXQA 2NC9A 3ML8A 4F7AA 3RRMB 3FEYA 4V3IA 3C98A 1IQRA 2IEJA 4NIKA 2HR2A 2ONDA 3ZHEA 3CSTA 2LXLA 2H6IA 3Q9NC 4OYSA 2LXMA 2WVIA 2GRNB 3FU3A 4EBAG 2OCCE 4LRZA 4HORA 4DI3A 3VLEA 2YQ8A 3UMVA 5FQ6A 3IHYA 4J8SA 2OVFA 4MS6A 3OXLA 2AXVA 4XI0A 3AG1E 3ZU7B 3ZYMA 2UY1A 2OEVA 1BU9A 4H7XA 3ASNE 5T8IA 3N71A 3PE3A 2WXLA 1KT0A 2DIWA 4HVBA 4XIFA 4GTTA 1KLXA 1H6OA 5G2NA 3TWTA 1LTXA 2BF0X 3ZXSA 4EZKA 4L9PA 3ASFA 4A1SA 3W9GA 4J0UA 5LOZA 2UWJG 2XRZA 2GGFA 4U0ZA 2KZTA 3TAXA 2IJGX 2RFMA 3MX3A 2WXNA 1S0PA 4AV7A 1SVXA 5KNHD 2B6CA 3RK6A 1TR4A 3DSXA 4N3CA 2DWZA 1WY6A 2IU1A 2QC9A 3EHNA 1O1RA 5KJNA 2GROB 1Z3YA 4OVUA 2NYJA 5AQAA 2HO1A 3GZSA 3QWWA 2WXIA 4RVBA 5JHAA 2C0MA 4XI9A 2I1JA 4UWGA 3ZYLA 4Q69A 1W3BA 2QYUA 4J8EA 3MKRA 1FPPA 1OWOA 3KS2A 3OAWA 2C0LA 4G26A 4GMRA 4KZ0A 4ANUA 5A7DB 4JPSA 1WG0A 1N95A 3CV0A 1U3DA 2CHWA 1LD7A 2VSNA 3L54A 3MCXA 4N3BA 4YNDA 3AU5A 2OOEA 3WG7E 4GAAA 3QOUA 1SZAA 4C9BB 2VTBB 4PH4B 2AXUA 4Y6CA 3G2UA 5KJLA 1E8XA 4UQZA 3DSWA 3IHVA 2MYOA 5AARA 4GA0A 4XKCA 3Q4AB 5CMWA 3QB2A 3ABME 4U8YD 2YINA 3T5VA 1WAO1 1HH8A 1UJJA 3I4RB 3QWPA 3FUMA 4L23A 3JQ0A 5ENQD 4GYWA 4J8YA 3ENEA 4BESA 5G04J 2VGYA 3S7BA 3TWRA 2XPZA 3UT7A 4GZDA 5LCWC 4PDXA 5ENOD 4DPRA 1MQSA 2LSUA 3PDNA 3JXJA 4I1OB 5D0OD 1OT8A 4EZJA 2CG3A 5FTPA 4GZ6A 2PL2A 1E7VA 3TGOA 5AQ7A 5FZSA 1INZA 3G2VA 4JW1A 4C0MA 2M63A 1IQUA 4GTVA 4BETA 2R02A 4CT0A 2ZU6B 4WWPA 1AP7A 4FLHA 3C3QA 4GZ3A 3PZ3A 2JABA 1N0RA 4K5AB 1SZ9A 3ZW3A 3J5PA 4EQFA 5BPPA 2WM9A 3SO8A 1DCEA 3G2WA 2WQHA 1N94A 2EINE 1VDYA 2ILRA 3CEQA 1G3NB 3DXKG 2LSVA 3CVYA 4U63A 1H2TC 1BI8B 3LCAA 4MBGA 1N4PA 3RIBA 3LVQE 3D3MA 3MEKA 2CG2A 3TWXA 2DZOA 2DZNA 4U0SA 4H7YA 2KBXA 1X81A 1WDYA 3CKBA 3ULQA 4P29A 2L0TB 2VGEA 3MKQB 2JLBA 3RU0A 2NSZA 1UN8A 2E2EA 1SQMA 2HYZA 4JA9A 4EZLA 4I2WA 5BW8C 3FTYA 3QDNA 2ZISA 5HKPA 3FEXA 1Y8MA 2XGSA 4A3VA 4B89A 2KC7A 4YVQC 4HRLA 3L17A 1ELRA 4RSYA 1GW6A 2WXMA 2AXZA 4JXTA 1TJFA 4PS8A 3SFXA 1S70B 1A17A 4BTAA 4GTMA 1NFIE 3AS8A 3MV2B 4U07A 1LD8A 3CVQA 4JHRA 1IYGA 4FADA 4HNAD 4G23A 3UINC 3JYSA 3UT4A 2PM6A 3EHQA 2VTBA 4UI9K 4ANVA 2WB2A 3U64A 4R7LA 2IY0C 3D9JA 3K9IA 2VJ8A 3LKUA 3V79K 3KSLA 4KVOA 1H2UA 5AENA 1MHQA 2R17C 4DX7D 2XS8A 3LY8A 4HI8A 4I6EA 4AVXA 3AG2E 3TXNA 3OTNA 1RZ4A 1ZU2A 2CFUA 3CHRA 2KCLA 5KNGA 2EIKE 4LUNU 4HXIA 4HQDA 4G25A 2XCBA 3CLJA 1K1BA 4MLPA 3VTYA 4JA7A 1BPOA 4ILIA 2F37A 4GA2A 1HS6A 4TXRA 5EDSA 3APFA 3UKRG 2RKKA 4FLBA 2VSYA 1WM5A 1NA0A 3FUIA 3TWSA 4LNGA 3U4TA 2B0OE 2XS1A 4NQ0A 1PAQA 4FJZA 3CHPA 1OWNA 3DPDA 3NQPA 2Y3AA 3EUVA 3S7DA 1U2VG 3Q7AA 3ZKJA 3DSUA 3UUXA 3KEZA 3CVUA 2DVWA 4Q96A 3PRZA 1ZB1A 2Y1LE 3RKVA 5ANRA 5BNWA 4F53A 3KEAA 3SF4A 3RAUA 3SFZA 4GMLA 4PS7A 1PC2A 3ZVVA 4FP7A 3ZGQA 5G04C 3PUKA 4OAUC 4B93B 3V30A 2HM8A 2J9QA 2P9UG 3JXIA 4YDYA 2AW6A 3GZ2A 3CR3A 4AP2A 3MKQA 5FQ8A 4HRMB 5AJDA 2XGMA 3T9KA 4DUIA 1ELKA 5CECB 4YDWA 1YA0A 4DRXE 2P9IG 3ZFWA 4KVMA 2XPYA 4HOSA 2H6HA 4TUMA 3ZPJA 3NAWA 4DX2A 5M72A 5HI7A 4WNDA 4QQIA 3TG5A 3C5RA 4K0RA 3PREA 1E90A 3EIJA 1SW6A 4M7CA 4UUCA 3IBEA 5ARGA 2BUGA 3PEVB 4HI9A 1TYQG 4DK5A 4GCOA 3FP3A 3FUHA 1OWPA 2PQNA 4XZ4A 1TN8A 3ZEFA 4ACLA 3PEUB 4FC8A
chains in the Genus database with same CATH topology
3DWLG 4XEIG 3UKUG 2P9SG 2P9KG 2P9IG 3DXKG 3ULEG 3UKRG 3RSEG 2P9UG 2P9PG 1U2VG 3DXMG 1TYQG 2P9NG 2P9LG 1K8KG 4JD2G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DWL G;  4XEI G;  3UKU G;  2P9S G;  2P9K G;  2P9I G;  3DXK G;  3ULE G;  3UKR G;  3RSE G;  2P9U G;  2P9P G;  1U2V G;  3DXM G;  1TYQ G;  2P9N G;  2P9L G;  1K8K G;  4JD2 G; 
#chains in the Genus database with same CATH topology
 3QNK A;  4XEI G;  4GPK A;  3JCK C;  3PE4 A;  3Q15 A;  3AJI A;  4DI4 A;  3HXD A;  4K03 A;  1JWG A;  3FUE A;  2XEN A;  1D8E A;  4UI9 J;  4PUC A;  5EKQ D;  4CGW A;  4KBQ A;  4JEU A;  2I1K A;  5KCM A;  4CEM A;  3C3R A;  3SQV A;  4GTR A;  2FO7 A;  5KWD A;  4EPZ A;  5HRY A;  1RW2 A;  1S63 A;  2WQ6 A;  5JJ6 A;  2PZI A;  3VLD A;  4E6H A;  2A4Z A;  4L1B A;  4IYP A;  1UJK A;  4URK A;  2IOL A;  3GZ1 A;  5ARF A;  4HOQ A;  3R7Q A;  3FUN A;  5FQ7 A;  4OVV A;  4PS3 A;  5HS0 A;  4K5B A;  5EX0 A;  2FO1 E;  4N5Q A;  2QZA A;  2FBN A;  4O1O A;  3BG0 B;  1OXJ A;  1OUV A;  4G11 A;  4NAC A;  1NA3 A;  2NXP A;  3OXG A;  2J8S D;  4RQI A;  3O48 A;  4BT8 A;  1ZBP A;  4AJW A;  2L9B A;  1HE8 A;  3URZ A;  3J5Q B;  3EHR A;  3DXM G;  5FZQ A;  2YHC A;  3FDH A;  4YDO A;  2PQR A;  1HF8 A;  2WXK A;  1S64 A;  1HG2 A;  1QQE A;  2H6F A;  5J90 A;  2HE0 A;  3BQO A;  2IQC A;  3JUE A;  3DSV A;  4AEZ C;  2WMO A;  1IHG A;  4GTS A;  3L13 A;  4FJY A;  3FWV A;  1Z3X A;  3L6A A;  1EPU A;  4GZC A;  2KXP C;  4J7W A;  1HG5 A;  2F0Y A;  3NZS A;  1E7U A;  4DX5 D;  4G24 A;  3S2A A;  2XZT G;  3T5X A;  5H7P A;  3ZNG A;  5ITZ F;  2P9S G;  1TN7 A;  3U66 A;  4CT4 A;  4I17 A;  1HXI A;  5BUZ A;  5JJ7 A;  2FI7 A;  3I4G A;  1JCS A;  3T8K A;  4WWO A;  1KZO A;  1O5M A;  3KSQ A;  5AIJ A;  5B1A E;  4NUR A;  4GPM A;  2ZIR A;  4EEC A;  3APD A;  4J6I A;  5HQ8 A;  4C48 B;  5D0Q D;  3ASG A;  5KJM A;  3QWV A;  2F8X K;  3FU5 A;  4GB9 A;  2QFC A;  4YDE A;  2XZD G;  5B3S E;  3ONL A;  2LAI A;  4BT9 A;  3SBS A;  2J49 A;  3CSF A;  2ZGG A;  1JPL A;  4LSZ E;  3AG3 E;  2WXG A;  3P1U A;  2P9P G;  4U8H A;  1QBQ A;  3CIA A;  4BSX A;  3D9O A;  4APF A;  2V5Q C;  5CED B;  3DEO A;  2J08 A;  4UWH A;  1N11 A;  3FUL A;  4C0E A;  2IFU A;  2XEV A;  4GZ5 A;  2WXO A;  1UG3 A;  1JUQ A;  5CRV A;  3QK0 A;  4CGV A;  3UM1 A;  4W9R A;  2WMN A;  1MJ0 A;  1TNB A;  1Y6I A;  3QKY A;  1Z6T A;  4ANX A;  3CGH A;  2GRP B;  4MKT A;  3TXM A;  1JWF A;  2I9C A;  2EQX A;  3LVR E;  4HB5 A;  4JHJ A;  5EIL A;  3PS6 A;  3SFY A;  2GRL A;  3AAA C;  5CBO A;  4CDR A;  2V8S E;  1JCR A;  3FY4 A;  4A55 A;  2PNN A;  4I43 A;  3BEE A;  4WNF A;  4YVO A;  3TJP A;  1MX4 A;  3EU5 A;  2ION A;  4LCT A;  3B7U X;  3SD5 A;  3ISM C;  5D2M C;  4B8A A;  2KCK A;  4U8V D;  3D9L A;  3EJN A;  4UWF A;  2BED A;  1SA4 A;  2ZXW E;  4GA1 A;  3B95 A;  4WNE A;  3ESL A;  3LJ3 A;  5EYL A;  3UTM A;  2F8Y A;  3CK9 A;  1MX2 A;  2EIJ E;  1OCC E;  3UIO C;  3RRN B;  3OXF A;  4F1P A;  1BI7 B;  2I2O A;  1X5B A;  3D9N A;  2A5U A;  4E85 A;  5KJK A;  5FZR A;  3G2T A;  4IN3 B;  4UI9 C;  3B13 A;  2IOS A;  1SA5 A;  3PZD A;  4EBA A;  3L9T A;  4AY5 A;  4HFG A;  2DBA A;  4CDN A;  4U96 D;  3SY2 A;  3SHF A;  1A5E A;  4RG6 A;  2ETC A;  3KAE A;  3CVV A;  2XHE A;  3LEW A;  1OCZ E;  2BKK B;  4JD2 G;  4IUL A;  4L7T A;  4GTP A;  2Y0B G;  4CZ2 D;  5E75 A;  2C2L A;  1TN6 A;  4NRH B;  1TNY A;  2LNI A;  2GRR B;  4AY6 A;  2LO6 A;  4JZY A;  3BUA A;  3CVX A;  1H6P A;  1K3Z D;  3C72 A;  3FU6 A;  5FJY A;  2WXP A;  4A3T A;  3IKO B;  1KPS B;  3U9W A;  2RFA A;  3MA5 A;  2DYR E;  3HVE B;  5AJL A;  4GMJ A;  5FQ4 A;  3FTV A;  4LNB A;  4ILH B;  1DNP A;  3TL5 A;  3HXF A;  5G05 J;  1OWM A;  4OAV B;  1N0Q A;  5ENR D;  1Q2Z A;  2L6J A;  4ATZ D;  3ASD A;  5A6C A;  4JEH A;  3HG0 D;  3FTU A;  3UX4 A;  3FTX A;  4I1M A;  3Q7F A;  2WXQ A;  4B94 A;  1BD8 A;  2AWI A;  1IHB A;  3LYA A;  2V4H C;  5ENP D;  3CVP A;  1U3C A;  3LPZ A;  2IO3 C;  1K1A A;  2XCC A;  2X6H A;  4XX5 A;  3HYM B;  3SI5 A;  3FTS A;  4GU5 A;  4HS2 A;  3IV0 A;  1P5Q A;  4ABN A;  3LXU X;  4HOU A;  4GYY A;  2DYS E;  2J07 A;  2KCV A;  3V2X A;  3HXB A;  3E30 A;  1V55 E;  3HXE A;  5ENS D;  4XE0 A;  5AQ9 A;  4RG9 A;  3Q78 A;  1DC2 A;  3CQG B;  3O4Z A;  5FIO A;  5BXO A;  3FTW A;  3B7S A;  3SNX A;  3RO3 A;  2OEW A;  1N4S A;  3UKU G;  1NI1 A;  2PM7 A;  1L5J A;  5BV0 A;  4A63 B;  3HXC A;  4AOF A;  5JHB A;  3UIP C;  3E33 A;  2Y4U A;  2I6H A;  3DRA A;  4GCN A;  4F3V A;  4RLY A;  1HX8 A;  1PY1 A;  3DEP A;  1UW4 B;  3VTX A;  5LX8 A;  3L08 A;  2L6B A;  4G8L A;  3RO2 A;  3FH7 A;  1KZP A;  3Q73 A;  3EIQ C;  3VLF A;  5EID A;  2CHZ A;  3I5P A;  4JHK A;  3Q5M A;  3ONK A;  4BX8 A;  3UM3 A;  5AQB A;  3E34 A;  2BKG A;  2A5E A;  2P9K G;  3E37 A;  3ZN3 A;  2QY7 A;  5LP0 A;  1YCS B;  2J09 A;  5BT1 A;  4FHJ A;  2VSX E;  4A1G A;  4I1A A;  3JQ1 A;  5LFA A;  1H6K A;  4UWK A;  4TRQ A;  4CCA A;  4BTB A;  2DCP A;  4UQY A;  2X6K A;  4JC8 A;  5CHE E;  2WXH A;  3V31 A;  5G55 A;  2XPI A;  3ZYK A;  4U04 A;  1E96 B;  1MZC A;  1FCH A;  4I6J A;  3HVE A;  2Y69 E;  3FUF A;  2P9L G;  5JJT A;  3FUK A;  3MJW A;  2P58 C;  3FH8 A;  3HDX A;  2KM4 A;  2BTD A;  3P2B A;  4FA6 A;  3B7B A;  2V5F A;  3QAR A;  1TEZ A;  1OY3 D;  5CMY A;  3BG1 B;  4U7E B;  4HOT A;  5E76 A;  5D66 A;  1NL4 A;  3R9M A;  4ANW A;  3T8M A;  5CEA A;  3CVL A;  5AYW D;  4LG6 A;  3FFL A;  4EHM A;  3TWV A;  3ESK A;  1UOH A;  1E8Y A;  3L82 A;  1E8Z A;  2XQ0 A;  2X6J A;  2VGX B;  4BSZ B;  3UPV A;  4FU3 A;  3PZ1 A;  3S7F A;  2RD0 A;  5FWQ A;  5AAO A;  2VYI A;  3ASH A;  1NP7 A;  3NZU A;  3W9F A;  3TWW A;  3NBN B;  3B7T A;  1Z5S C;  4G1T A;  4ILG A;  5ANL A;  1D9S A;  2X6F A;  3SGH A;  3WXX A;  3CK8 A;  4KT6 B;  3D9P A;  4DJA A;  1AWC B;  3IXE A;  3UM2 A;  3UXG A;  3ZUV B;  2YNQ A;  4ZHB A;  1MX6 A;  1NZN A;  1H19 A;  3QAQ A;  3EHM A;  5C1D A;  4UQX A;  4LER A;  3ZXP A;  3AG4 E;  3MGB A;  4M3O A;  4O6F A;  5AN8 A;  1B89 A;  2WXR A;  2P9N G;  2OVB A;  3DST A;  5ENT D;  5BXU A;  5G05 C;  1N52 A;  3I3N A;  4CDM A;  3MZL B;  3PZ2 A;  2ETB A;  2GRQ B;  3FU0 A;  3PUJ A;  1HFA A;  2R05 A;  3Q79 A;  4TXP A;  5EIB E;  1H0A A;  1H2V C;  2J4D A;  5ENN A;  2Y4T A;  1EYH A;  3E4B A;  3NOG D;  5DBK A;  1QZ2 A;  2WPV A;  3E32 A;  3PH0 C;  3SBT B;  3Q9U C;  2RG8 A;  1FT1 A;  4L2L A;  1LF8 A;  4ACK A;  4BWR A;  1TJC A;  2R2L A;  1UN9 A;  4LEU A;  3AS4 A;  1OCO E;  3R9A B;  2R03 A;  1FT2 A;  2IO2 C;  3RRU A;  4HBD A;  4I6G A;  3S7J A;  2X38 A;  2LUH A;  4WNG A;  4WAF A;  3FH5 A;  2OV8 A;  3ML9 A;  3CHQ A;  3ABK E;  5T3R A;  3HRA A;  3TG4 A;  4KXK B;  2VSO E;  3B7R L;  4B8C B;  1YYH A;  1QNF A;  5A23 A;  4BX9 A;  1KT1 A;  2EIM E;  2J4B A;  4N2Q A;  5C2Y A;  2X3M A;  2V4L A;  4DLO A;  3IEG A;  3AU4 A;  1DVP A;  3NOC D;  1TNZ A;  3C3O A;  4AXH A;  4Y6W A;  1XGW A;  4BFR A;  3UI2 A;  3ZIM A;  3Q47 B;  2MOW A;  4L2Y A;  4Z68 A;  3G2S A;  3CKC A;  1QYM A;  3AS5 A;  1OWL A;  3TWQ A;  3ZYQ A;  1N4Q A;  5EX3 A;  1N4R A;  4MRU A;  5CER B;  4JVS A;  4ATG A;  5FIN A;  3CHO A;  4O1P A;  5FT9 A;  3FHE A;  4HLL A;  4HLE A;  3U3W A;  3CQC B;  3DPY A;  1IXV A;  4BY6 A;  3FTZ A;  3UT8 A;  2XGO A;  1DCQ A;  3LJN A;  3FUD A;  3R7R A;  2GRM A;  3NB2 A;  2MRI A;  3Q75 A;  3ZHE B;  2R5S A;  5CRU A;  3LS8 A;  2XRY A;  1HU3 A;  4U0U A;  1N54 A;  1JCQ A;  4GTQ A;  2VQ2 A;  2VGX A;  2IF4 A;  2Q7F A;  3RJV A;  5DIZ A;  3PVL A;  5EYP F;  1TNU A;  4N39 A;  3RSE G;  2R59 A;  3CK7 A;  2ETA A;  4AM9 A;  3PNT B;  4TUU A;  3BU8 A;  4ZFH A;  1D8D A;  1N9A A;  2JEK A;  3ZRH A;  1FVF A;  3KD7 A;  4ME2 A;  1O1S A;  4WWN A;  4D10 C;  4N5C A;  4G2V A;  4F1S A;  2CFZ A;  4KZC A;  3DWL G;  3NF1 A;  2FEZ A;  2XEE A;  3LY9 A;  3PNL B;  3QJZ A;  1EDU A;  3L16 A;  3DBS A;  2UY1 B;  3CHS A;  1EF1 C;  1ELW A;  3UM0 A;  5CBN A;  2YHE A;  2FUL A;  3CVN A;  2LAH A;  3ULY A;  4U95 D;  3D9M A;  4DX1 A;  1IKN D;  4K5C A;  4B0Z A;  2ZGD A;  5EN5 D;  4N2S A;  3ULE G;  2P2C P;  1XNF A;  1V54 E;  1BLX B;  1O1T A;  2KZT B;  4F6R D;  1E8W A;  3Q49 B;  4FUL A;  2XEH A;  2AVP A;  4O60 A;  3JUI A;  4KMO A;  5CCL A;  3PZ4 A;  4CYM D;  5LCW J;  3CHM A;  3L22 A;  3ABL E;  3CVW A;  2WQ7 A;  3GW4 A;  4CRW A;  3EDT B;  3GYZ A;  4G8K A;  1HO8 A;  2GW1 A;  5BV1 A;  2X6I A;  4GTO A;  4WUY A;  5IY5 E;  2FF4 A;  5JMN D;  3EU9 A;  4X8Q A;  2V0P A;  3D9K A;  3D9I A;  2WXJ A;  3LY7 A;  5JA4 D;  1K8K G;  1YMP A;  2AJA A;  4DLQ A;  2H6G A;  3F6Q A;  3D9H A;  2E0I A;  2EIL E;  1FVH A;  4BEP A;  4J8F A;  3FUJ A;  5T4Y A;  3UQ3 A;  1TNO A;  4I9E A;  3V2O A;  3X2Q E;  4J8D A;  4IRU A;  4LNU D;  4I9C A;  4JB8 P;  5J08 A;  3SZ7 A;  1HZ4 A;  4UWL A;  2QYJ A;  4Q94 A;  3HHM A;  2MHK A;  4AIF A;  3MV3 B;  3QC1 A;  2WXF A;  4BER A;  3HIZ A;  4N3A A;  3MYV A;  5KBA A;  4QFV A;  3APC A;  4DX6 D;  4XKB A;  4TV3 A;  3LDZ A;  2CHX A;  5CCM A;  4HRN A;  3TWU A;  1OCR E;  1MYO A;  3DSS A;  4I2Z A;  4KYO B;  3ASO E;  2KAT A;  4FHK A;  4GYO A;  4JL0 A;  4APO A;  2L0I A;  5B1B E;  4TXQ A;  2NC9 A;  3ML8 A;  4F7A A;  3RRM B;  3FEY A;  4V3I A;  3C98 A;  1IQR A;  2IEJ A;  4NIK A;  2HR2 A;  2OND A;  3ZHE A;  3CST A;  2LXL A;  2H6I A;  3Q9N C;  4OYS A;  2LXM A;  2WVI A;  2GRN B;  3FU3 A;  4EBA G;  2OCC E;  4LRZ A;  4HOR A;  4DI3 A;  3VLE A;  2YQ8 A;  3UMV A;  5FQ6 A;  3IHY A;  4J8S A;  2OVF A;  4MS6 A;  3OXL A;  2AXV A;  4XI0 A;  3AG1 E;  3ZU7 B;  3ZYM A;  2UY1 A;  2OEV A;  1BU9 A;  4H7X A;  3ASN E;  5T8I A;  3N71 A;  3PE3 A;  2WXL A;  1KT0 A;  2DIW A;  4HVB A;  4XIF A;  4GTT A;  1KLX A;  1H6O A;  5G2N A;  3TWT A;  1LTX A;  2BF0 X;  3ZXS A;  4EZK A;  4L9P A;  3ASF A;  4A1S A;  3W9G A;  4J0U A;  5LOZ A;  2UWJ G;  2XRZ A;  2GGF A;  4U0Z A;  2KZT A;  3TAX A;  2IJG X;  2RFM A;  3MX3 A;  2WXN A;  1S0P A;  4AV7 A;  1SVX A;  5KNH D;  2B6C A;  3RK6 A;  1TR4 A;  3DSX A;  4N3C A;  2DWZ A;  1WY6 A;  2IU1 A;  2QC9 A;  3EHN A;  1O1R A;  5KJN A;  2GRO B;  1Z3Y A;  4OVU A;  2NYJ A;  5AQA A;  2HO1 A;  3GZS A;  3QWW A;  2WXI A;  4RVB A;  5JHA A;  2C0M A;  4XI9 A;  2I1J A;  4UWG A;  3ZYL A;  4Q69 A;  1W3B A;  2QYU A;  4J8E A;  3MKR A;  1FPP A;  1OWO A;  3KS2 A;  3OAW A;  2C0L A;  4G26 A;  4GMR A;  4KZ0 A;  4ANU A;  5A7D B;  4JPS A;  1WG0 A;  1N95 A;  3CV0 A;  1U3D A;  2CHW A;  1LD7 A;  2VSN A;  3L54 A;  3MCX A;  4N3B A;  4YND A;  3AU5 A;  2OOE A;  3WG7 E;  4GAA A;  3QOU A;  1SZA A;  4C9B B;  2VTB B;  4PH4 B;  2AXU A;  4Y6C A;  3G2U A;  5KJL A;  1E8X A;  4UQZ A;  3DSW A;  3IHV A;  2MYO A;  5AAR A;  4GA0 A;  4XKC A;  3Q4A B;  5CMW A;  3QB2 A;  3ABM E;  4U8Y D;  2YIN A;  3T5V A;  1WAO 1;  1HH8 A;  1UJJ A;  3I4R B;  3QWP A;  3FUM A;  4L23 A;  3JQ0 A;  5ENQ D;  4GYW A;  4J8Y A;  3ENE A;  4BES A;  5G04 J;  2VGY A;  3S7B A;  3TWR A;  2XPZ A;  3UT7 A;  4GZD A;  5LCW C;  4PDX A;  5ENO D;  4DPR A;  1MQS A;  2LSU A;  3PDN A;  3JXJ A;  4I1O B;  5D0O D;  1OT8 A;  4EZJ A;  2CG3 A;  5FTP A;  4GZ6 A;  2PL2 A;  1E7V A;  3TGO A;  5AQ7 A;  5FZS A;  1INZ A;  3G2V A;  4JW1 A;  4C0M A;  2M63 A;  1IQU A;  4GTV A;  4BET A;  2R02 A;  4CT0 A;  2ZU6 B;  4WWP A;  1AP7 A;  4FLH A;  3C3Q A;  4GZ3 A;  3PZ3 A;  2JAB A;  1N0R A;  4K5A B;  1SZ9 A;  3ZW3 A;  3J5P A;  4EQF A;  5BPP A;  2WM9 A;  3SO8 A;  1DCE A;  3G2W A;  2WQH A;  1N94 A;  2EIN E;  1VDY A;  2ILR A;  3CEQ A;  1G3N B;  3DXK G;  2LSV A;  3CVY A;  4U63 A;  1H2T C;  1BI8 B;  3LCA A;  4MBG A;  1N4P A;  3RIB A;  3LVQ E;  3D3M A;  3MEK A;  2CG2 A;  3TWX A;  2DZO A;  2DZN A;  4U0S A;  4H7Y A;  2KBX A;  1X81 A;  1WDY A;  3CKB A;  3ULQ A;  4P29 A;  2L0T B;  2VGE A;  3MKQ B;  2JLB A;  3RU0 A;  2NSZ A;  1UN8 A;  2E2E A;  1SQM A;  2HYZ A;  4JA9 A;  4EZL A;  4I2W A;  5BW8 C;  3FTY A;  3QDN A;  2ZIS A;  5HKP A;  3FEX A;  1Y8M A;  2XGS A;  4A3V A;  4B89 A;  2KC7 A;  4YVQ C;  4HRL A;  3L17 A;  1ELR A;  4RSY A;  1GW6 A;  2WXM A;  2AXZ A;  4JXT A;  1TJF A;  4PS8 A;  3SFX A;  1S70 B;  1A17 A;  4BTA A;  4GTM A;  1NFI E;  3AS8 A;  3MV2 B;  4U07 A;  1LD8 A;  3CVQ A;  4JHR A;  1IYG A;  4FAD A;  4HNA D;  4G23 A;  3UIN C;  3JYS A;  3UT4 A;  2PM6 A;  3EHQ A;  2VTB A;  4UI9 K;  4ANV A;  2WB2 A;  3U64 A;  4R7L A;  2IY0 C;  3D9J A;  3K9I A;  2VJ8 A;  3LKU A;  3V79 K;  3KSL A;  4KVO A;  1H2U A;  5AEN A;  1MHQ A;  2R17 C;  4DX7 D;  2XS8 A;  3LY8 A;  4HI8 A;  4I6E A;  4AVX A;  3AG2 E;  3TXN A;  3OTN A;  1RZ4 A;  1ZU2 A;  2CFU A;  3CHR A;  2KCL A;  5KNG A;  2EIK E;  4LUN U;  4HXI A;  4HQD A;  4G25 A;  2XCB A;  3CLJ A;  1K1B A;  4MLP A;  3VTY A;  4JA7 A;  1BPO A;  4ILI A;  2F37 A;  4GA2 A;  1HS6 A;  4TXR A;  5EDS A;  3APF A;  3UKR G;  2RKK A;  4FLB A;  2VSY A;  1WM5 A;  1NA0 A;  3FUI A;  3TWS A;  4LNG A;  3U4T A;  2B0O E;  2XS1 A;  4NQ0 A;  1PAQ A;  4FJZ A;  3CHP A;  1OWN A;  3DPD A;  3NQP A;  2Y3A A;  3EUV A;  3S7D A;  1U2V G;  3Q7A A;  3ZKJ A;  3DSU A;  3UUX A;  3KEZ A;  3CVU A;  2DVW A;  4Q96 A;  3PRZ A;  1ZB1 A;  2Y1L E;  3RKV A;  5ANR A;  5BNW A;  4F53 A;  3KEA A;  3SF4 A;  3RAU A;  3SFZ A;  4GML A;  4PS7 A;  1PC2 A;  3ZVV A;  4FP7 A;  3ZGQ A;  5G04 C;  3PUK A;  4OAU C;  4B93 B;  3V30 A;  2HM8 A;  2J9Q A;  2P9U G;  3JXI A;  4YDY A;  2AW6 A;  3GZ2 A;  3CR3 A;  4AP2 A;  3MKQ A;  5FQ8 A;  4HRM B;  5AJD A;  2XGM A;  3T9K A;  4DUI A;  1ELK A;  5CEC B;  4YDW A;  1YA0 A;  4DRX E;  2P9I G;  3ZFW A;  4KVM A;  2XPY A;  4HOS A;  2H6H A;  4TUM A;  3ZPJ A;  3NAW A;  4DX2 A;  5M72 A;  5HI7 A;  4WND A;  4QQI A;  3TG5 A;  3C5R A;  4K0R A;  3PRE A;  1E90 A;  3EIJ A;  1SW6 A;  4M7C A;  4UUC A;  3IBE A;  5ARG A;  2BUG A;  3PEV B;  4HI9 A;  1TYQ G;  4DK5 A;  4GCO A;  3FP3 A;  3FUH A;  1OWP A;  2PQN A;  4XZ4 A;  1TN8 A;  3ZEF A;  4ACL A;  3PEU B;  4FC8 A; 
#chains in the Genus database with same CATH homology
 3DWL G;  4XEI G;  3UKU G;  2P9S G;  2P9K G;  2P9I G;  3DXK G;  3ULE G;  3UKR G;  3RSE G;  2P9U G;  2P9P G;  1U2V G;  3DXM G;  1TYQ G;  2P9N G;  2P9L G;  1K8K G;  4JD2 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...