3U4TA

Crystal structure of the c-terminal part of the tpr repeat-containing protein q11ti6_cyth3 from cytophaga hutchinsonii. northeast structural genomics consortium target chr11b.
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
258
structure length
258
Chain Sequence
VEFRYADFLFKNNNYAEAIEVFNKLEAKKYNSPYIYNRRAVCYYELAKYDLAQKDIETYFSKVNATKAKSADFEYYGKILMKKGQDSLAIQQYQAAVDRDTTRLDMYGQIGSYFYNKGNFPLAIQYMEKQIRPTTTDPKVFYELGQAYYYNKEYVKADSSFVKVLELKPNIYIGYLWRARANAAQDPDTKQGLAKPYYEKLIEVCAPGGAKYKDELIEANEYIAYYYTINRDKVKADAAWKNILALDPTNKKAIDGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the C-terminal part of the TPR repeat-containing protein Q11TI6_CYTH3 from Cytophaga hutchinsonii.
rcsb
source organism Cytophaga hutchinsonii
molecule tags Structural genomics, unknown function
molecule keywords TPR repeat-containing protein
total genus 95
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07719 TPR_2 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3u4tA00
1QQEA 2XGMA 3U3WA 2XPIA 3SF4A 4J0UA 5G05J 1IYGA 5AYWD 4JL0A 1FCHA 5G04J 1WAO1 3MV2B 4W9RA 3O48A 1ZU2A 4JA9A 4U0UA 4UI9J 5HI7A 5CCMA 3QWVA 1KLXA 2LSUA 4I1AA 4CGWA 3ULQA 4I9CA 5CCLA 2R5SA 2VGXB 1KT1A 2FBNA 2UWJG 3AS4A 3CVPA 3MEKA 3MV3B 3PDNA 4KBQA 3UUXA 4ABNA 4GPKA 4B94A 1OUVA 4HORA 3VTYA 4ME2A 4H7YA 4G26A 3UQ3A 3GZ1A 3Q4AB 3RU0A 2IF4A 3JYSA 3ASGA 2KATA 4GZ5A 1NA0A 5BW8C 4G25A 2HR2A 3CK8A 3QWPA 3QWWA 2NC9A 2VSNA 3RJVA 3QDNA 4BWRA 3LKUA 5D0QD 3RKVA 2I6HA 3CKCA 3OXLA 3ASDA 1B89A 4O6FA 4HOTA 2FEZA 1QZ2A 3CK7A 2FO7A 5A6CA 3EDTB 4CGVA 3RIBA 3CKBA 4GCOA 3FP3A 2VGYA 1W3BA 4G2VA 4JHRA 2VGXA 2Q7FA 4YVOA 3MKRA 5ARFA 2MHKA 4YNDA 3LY7A 3Q47B 3TG5A 5ARGA 5FJYA 2HO1A 2XCBA 4BTAA 4J8FA 2UY1B 4N2SA 4GA0A 4I17A 2XCCA 4GYWA 5BT1A 3S7FA 2WPVA 2LSVA 1HZ4A 3CVNA 3LY8A 3ZN3A 4N2QA 1NA3A 4XI0A 2GW1A 2PQNA 4UI9C 5EX3A 2Y4UA 5JJ7A 4I9EA 1P5QA 5D0OD 5KJNA 5KJMA 1ZBPA 3Q49B 4AY6A 1KT0A 2C0MA 3ZHEB 4G24A 2XGSA 5EKQD 2YQ8A 4GZ6A 3PE3A 3KAEA 4Y6CA 3AS5A 3E4BA 2BUGA 1PC2A 4WNGA 3ASFA 2XEVA 3N71A 3QKYA 4J8EA 4GA2A 2ONDA 3LY9A 4NRHB 4Y6WA 3VTXA 3FFLA 3ZPJA 5FT9A 3HYMB 2PZIA 4H7XA 4WUYA 2KCVA 5FZSA 3S7BA 3GYZA 1HH8A 4UI9K 4IN3B 1YA0A 4XIFA 3NF1A 3K9IA 4YVQC 5A7DB 3WXXA 4HOUA 2C0LA 1E96B 1Y8MA 4HOQA 3GZ2A 4BTBA 2L6JA 1WM5A 2AVPA 3OXFA 5G05C 3LCAA 4UQZA 2VYIA 5LCWJ 5DBKA 4AY5A 3CEQA 2HYZA 4UQYA 4LEUA 4CDRA 3CVLA 4I2WA 3RO2A 5KJLA 2VQ2A 3BEEA 3FWVA 1ELRA 2FF4A 4APOA 2QFCA 4N5CA 4A1SA 4EQFA 3KD7A 4GYOA 5M72A 4N3AA 4N3BA 5KJKA 3TGOA 4RG9A 1ELWA 4G1TA 2E2EA 5G04C 4JA7A 4HOSA 1XNFA 4F3VA 4WNEA 5EX0A 4N3CA 5BNWA 3U4TA 2UY1A 4WNFA 3ZFWA 3UPVA 2FI7A 4U07A 1HXIA 2DBAA 3URZA 2PL2A 5C1DA 2Y4TA 2J9QA 2JLBA 5LCWC 2XGOA 4G23A 2VSYA 2YHCA 4U04A 4AIFA 3PE4A 4KYOB 4AM9A 5DIZA 4N39A 4GZ3A 4U0ZA 5FTPA 5HQ8A 4XI9A 3LYAA 3Q5MA 2OOEA 3CVQA 3Q15A 1IHGA 3CV0A 3KS2A 4NQ0A 1A17A 5JJ6A 2KCLA 2KC7A 4J8DA 3QOUA 2KCKA 3AS8A 1NZNA 4RG6A 4UQXA 5FZRA 3S7JA 4U0SA 4BT8A 2P58C 3ZGQA 3TG4A 4I2ZA 4BT9A 3TAXA 1TJCA 3R9AB 3ESKA 3GW4A 4GCNA 4WNDA 2C2LA 2LNIA 3OXGA 4GA1A 5CHEE 5FZQA 3RO3A 2PQRA 3LPZA 5JJTA 2WQHA 3MA5A 3CK9A 3SZ7A 2V5FA 3ASHA 4KXKB 3S7DA 3ZHEA 2IFUA 3IEGA 4GYYA
chains in the Genus database with same CATH superfamily
4L7TA 4DK5A 3TL5A 5AQ7A 2J49A 3DSTA 3AS4A 4YDOA 2MRIA 4A55A 4PUCA 3ABLE 4B8CB 5CBNA 4YDWA 2L6BA 4AP2A 4G25A 3RJVA 2J8SD 3RSEG 1V55E 2AXZA 2HM8A 1MX6A 5EYLA 2LXMA 1N0RA 5G2NA 3S7FA 3BG0B 5LFAA 5KJNA 3R7QA 2X3MA 1OCZE 2YQ8A 2WXRA 1EF1C 1NL4A 1JPLA 3HYMB 4GTPA 4ANUA 3ABME 1YA0A 3L82A 3FUDA 3ZXSA 4UQZA 5HS0A 5KJLA 3BEEA 2AWIA 1JUQA 3IKOB 5HRYA 3SBTB 2WXLA 3CVVA 4JXTA 1XNFA 2KBXA 3RRMB 1S64A 5BXOA 2FI7A 4DRXE 2QC9A 4GZCA 2XGOA 4BSXA 3Q5MA 1D9SA 2XEHA 3CV0A 4U0SA 3ZGQA 1TN8A 4GTQA 4BT9A 1HF8A 1Z3YA 5CEDB 1VDYA 3FTVA 4DX1A 4HXIA 4HRMB 5ITZF 5G04J 3CHSA 4W9RA 4JA9A 3T5XA 2R03A 4ILGA 4I9CA 2FBNA 4KBQA 5ENQD 2BEDA 1H0AA 2H6IA 2I6HA 4O1PA 1MYOA 3NAWA 2VTBB 3EDTB 1E8YA 4I1MA 5ARGA 2XCBA 3MCXA 2NYJA 1HZ4A 2DYRE 4URKA 4EHMA 3I3NA 4E85A 2V4HC 2ZU6B 5AJDA 2CHZA 3OXFA 4HB5A 4YDEA 3ENEA 3ZYLA 3D9JA 1ELRA 3VLEA 3HXEA 2P9LG 5ENNA 2PM7A 5C1DA 4C9BB 3E34A 4AM9A 3HXBA 3LYAA 3QB2A 3KS2A 4JW1A 4XX5A 1O1TA 3QK0A 3HHMA 4BX9A 1PAQA 3AG1E 3FDHA 3ZYQA 2P2CP 4L1BA 4B8AA 1FCHA 4B0ZA 2AW6A 4CGWA 2FULA 4IRUA 4U8YD 3ZU7B 5C2YA 4HORA 5IY5E 4LRZA 4TXPA 2IOSA 3PZ2A 5E76A 4FJZA 3KSQA 3D3MA 3FP3A 1KPSB 3LY7A 3B7UX 4V3IA 3JQ0A 1MHQA 3ZIMA 4XI0A 2GW1A 5T3RA 2Y4UA 3FULA 4I1OB 4DPRA 2XRYA 3U64A 1G3NB 3BG1B 3FFLA 1AWCB 4TXQA 2YINA 2KM4A 3CIAA 3PZ4A 5ENTD 3MJWA 5EILA 4BSZB 2AVPA 2VYIA 4MLPA 2WXPA 4KZ0A 2ETBA 4GYOA 2IEJA 2BKGA 1TNZA 3D9NA 4BETA 4JZYA 2ZIRA 3MKQB 3CQGB 2GRLA 3MX3A 3RK6A 3IHVA 3FEYA 1XGWA 2XQ0A 4L9PA 4XKCA 4OAUC 5ENSD 4N39A 3DPYA 2OOEA 4CZ2D 2KC7A 2V8SE 4I2ZA 5FQ7A 2PQRA 3SZ7A 2H6HA 4JL0A 2OVBA 1ZU2A 1TN6A 3UT4A 5EIDA 1BI7B 1TYQG 2EINE 3CVPA 4K5CA 1RZ4A 3TJPA 4GZ5A 2KATA 3ULYA 3D9LA 1H6KA 3OXLA 4O6FA 5KWDA 2IONA 3D9MA 4DX7D 4F1SA 4DX5D 3Q47B 3C3OA 4I17A 5JJ7A 4JVSA 2H6FA 3UXGA 3PNLB 3TWTA 3KAEA 3FTXA 3EHNA 4HQDA 4GA2A 4GTVA 3VTXA 3S7BA 1K8KG 4KT6B 1HH8A 3FTWA 3V30A 2EQXA 2XEEA 3TXNA 2WXIA 3LVQE 3R7RA 2FF4A 3ZVVA 4CCAA 3DSSA 4EQFA 4GTMA 2M63A 4PS7A 3R9MA 2VSOE 3IXEA 4BEPA 2F8XK 2EIKE 4J7WA 2AXVA 2PL2A 3SD5A 3APCA 2LAHA 2F0YA 4UWLA 3FUIA 3S7JA 1SZAA 3FU3A 4XKBA 4DX6D 4U96D 3RO3A 1SZ9A 2I1JA 3HDXA 3CLJA 2X6JA 2IFUA 3FUMA 3Q78A 1N11A 5CCMA 1LD8A 3QWVA 3DXKG 4A63B 4GPKA 2R2LA 1MJ0A 3PZ1A 4WAFA 3TWVA 5D0QD 3APDA 4ATZD 4FC8A 4TUMA 3SGHA 3SNXA 4HVBA 4HOTA 4GPMA 3T8KA 4G2VA 4HS2A 3NOCD 4HI8A 1NI1A 4G24A 5EKQD 3CSTA 2R59A 4ANVA 4WNGA 2ZISA 3ML8A 4BY6A 3B7RL 2Y0BG 3GYZA 4YVQC 5AIJA 2MOWA 1IKND 5FQ6A 4JD2G 2ZXWE 3CEQA 3JCKC 4CDRA 3P2BA 3ML9A 3EIQC 4N3BA 1OWOA 4GAAA 4JPSA 3UT7A 4EZLA 3BU8A 3U4TA 4YDYA 2XS1A 3QC1A 4PDXA 2XPYA 3L16A 2J08A 3QNKA 2RFMA 4ILHB 1O1SA 3JUEA 2KCKA 5FZRA 3TWSA 4BT8A 2P58C 1N94A 5CHEE 4ACKA 4DLOA 3CVUA 4FHJA 3SY2A 3ZHEA 3ASHA 2GRQB 4WWPA 1N4SA 2WQ6A 4AV7A 3Q79A 3P1UA 3Q7FA 4I1AA 4GTOA 4DI4A 1H19A 2OEVA 2R5SA 3ZEFA 3DBSA 2IF4A 3ZYMA 1N52A 2WXGA 2HR2A 3ZXPA 3CVYA 4U95D 2CHXA 2DVWA 3ASDA 4DUIA 4LNGA 3CK7A 5D66A 4GCOA 4YVOA 1MZCA 4GTTA 4OYSA 2GRNB 1AP7A 3LEWA 2GRMA 1P5QA 5KJMA 5LX8A 3Q49B 2WXFA 3ZHEB 2XGSA 2P9SG 3PE3A 2Y3AA 3E30A 3FHEA 4EECA 3X2QE 3CVWA 5FIOA 4H7XA 3Q7AA 3PUJA 4HBDA 1LF8A 5BXUA 5LCWJ 2RFAA 1HU3A 3SHFA 2VQ2A 3J5QB 2IJGX 5M72A 1ELWA 5J08A 4HOSA 4FHKA 4F3VA 1OWMA 5EX0A 1DCQA 2DCPA 4CRWA 1UG3A 4FULA 3URZA 3CVXA 4MBGA 3FU0A 4Q94A 5D2MC 2Y69E 3IBEA 1NZNA 3AG2E 1N9AA 5JA4D 1DCEA 1UN8A 3MKQA 1PY1A 2LNIA 3LJNA 2XS8A 2IY0C 5G55A 4FP7A 4AOFA 3UM3A 3NB2A 3T9KA 4AEZC 3G2WA 1WAO1 1E7UA 3MEKA 1OUVA 4OVVA 5KBAA 3UQ3A 2VSNA 3C5RA 3SQVA 2X6FA 4ZHBA 3LXUX 2XZTG 4EBAG 3UKUG 3FTUA 3CKBA 1HG2A 3MKRA 1L5JA 4MKTA 2UY1B 4IYPA 4JEHA 2XCCA 5BT1A 5AARA 2DZNA 5AENA 5D0OD 4AY6A 3ZRHA 3JXIA 5FINA 3G2VA 2P9KG 4Y6CA 2WXQA 3ASFA 3ZYKA 2KCVA 2FO1E 1N4QA 2GROB 3LCAA 1OWNA 3UMVA 4I2WA 1N95A 1JWGA 4R7LA 2QZAA 5EN5D 3SFZA 4LNBA 3QJZA 4QQIA 2UY1A 3EHMA 5CEAA 4Q69A 5DIZA 2WM9A 5JJ6A 2KCLA 3DSWA 4RG6A 4UQXA 2V5QC 3D9PA 1K1AA 5J90A 3UINC 2V5FA 3S7DA 3QAQA 4FLHA 3NQPA 3U3WA 3CGHA 2IOLA 5HI7A 1OCRE 4EZKA 3DSVA 3V31A 2UWJG 4GB9A 1EDUA 4TUUA 3PVLA 2NC9A 2MYOA 3PZ3A 3QDNA 3RKVA 3TWXA 3CKCA 3KSLA 3SBSA 4HNAD 4KVMA 2DZOA 3UX4A 1HFAA 3UI2A 3TWQA 1W3BA 2LAIA 1OXJA 2F8YA 4N2SA 2R05A 5HKPA 5EX3A 3Q73A 1KT0A 4DLQA 3AS5A 3E4BA 1PC2A 2JABA 2WMNA 3ZPJA 3UTMA 4KZCA 2B0OE 5CECB 3QARA 2B6CA 2YNQA 1IQUA 4CYMD 3S2AA 4M7CA 4LNUD 1DC2A 3CVLA 3G2UA 3L17A 3LDZA 4CDNA 2QFCA 4N5CA 2L0IA 1S70B 3RRNB 3AU4A 3FUHA 3FUKA 4ILIA 2L0TB 3BQOA 4U07A 2ETCA 1TJFA 4U0ZA 2GGFA 3RAUA 2BKKB 3UIOC 3B7BA 2EIJE 3TAXA 1TJCA 4TV3A 3OXGA 1FPPA 3CK9A 3V2XA 3SO8A 4DJAA 2XGMA 1EPUA 1Y6IA 2WXOA 3CHQA 4EBAA 3FH5A 1KLXA 1H6PA 2H6GA 3JXJA 2ZGDA 3TWRA 1IQRA 3ASGA 4RSYA 1QBQA 4B89A 4BWRA 3B7TA 5CERB 2VGYA 1U3DA 4BTAA 1K3ZD 3D9KA 2HE0A 4G11A 4O1OA 5KCMA 1QYMA 4FADA 3DSXA 2A4ZA 2VTBA 4EPZA 2XEVA 2VSXE 4LG6A 5JHBA 5B1BE 3DWLG 4IN3B 3WXXA 4HOUA 4DI3A 1E96B 1TNBA 3GZ2A 1ELKA 1NFIE 1UJJA 2HYZA 4U8HA 3D9OA 5EDSA 5AQBA 4CDMA 4GTSA 4OVUA 5BV0A 4RG9A 4G1TA 2E2EA 5G04C 1Z5SC 1YCSB 1K1BA 3Q75A 3CHPA 2LXLA 4AJWA 4LSZE 4U63A 2AJAA 1S63A 4XI9A 3T8MA 1IHGA 4NQ0A 4I6GA 2OVFA 2DIWA 4G8KA 3OTNA 3TG4A 3W9GA 1YYHA 5JJTA 2J09A 3CHRA 3O4ZA 4UWFA 3IEGA 3B13A 4C0EA 2LO6A 3FH8A 3DEOA 4UI9J 1TN7A 3FY4A 4GZDA 4L2LA 3RU0A 4LCTA 1NA0A 4A3TA 3LKUA 4ANXA 4CT0A 3L22A 1A5EA 2LUHA 5E75A 3EHQA 1YMPA 1SVXA 3TG5A 5AAOA 1E8ZA 4I6JA 4UUCA 2PQNA 4GU5A 1UN9A 5AJLA 4BX8A 2ONDA 3ASNE 3D9HA 5FZSA 3PH0C 3K9IA 4P29A 4BTBA 5DBKA 2WMOA 2WXJA 1GW6A 3C72A 4C0MA 1N0QA 4FJYA 3TGOA 2I9CA 4ATGA 4JA7A 2EIME 4L2YA 1BU9A 5CBOA 3FUFA 2VSYA 5KNGA 5FTPA 2R17C 1S0PA 1TNUA 1E8XA 2OCCE 3QOUA 3CQCB 4I43A 4BERA 3CR3A 2C2LA 2DWZA 2ZGGA 2AXUA 4J0UA 2P9UG 3FTYA 4F6RD 4FA6A 5ENOD 3KEAA 3E32A 5EYPF 3JYSA 2KZTA 3QWWA 4HRNA 5BV1A 4AXHA 1HG5A 2WXHA 4RLYA 2OEWA 1N54A 3OAWA 4DX2A 4CGVA 2CFZA 4JHRA 2XRZA 5ARFA 3FTZA 1IHBA 4D10C 2HO1A 3PEUB 3HRAA 4PS3A 3FTSA 3CVNA 3HIZA 1OCCE 3B95A 4OAVB 4FLBA 1H2VC 3NBNB 2VGEA 3ISMC 4WUYA 4WWNA 1SQMA 1Q2ZA 4XIFA 3NF1A 2NXPA 3L08A 1HE8A 1MX4A 2QYJA 4UQYA 3TWWA 3RO2A 4JC8A 3G2TA 5CRUA 4LUNU 4N3AA 4L23A 4HRLA 1BPOA 2RKKA 3NOGD 4JEUA 4N3CA 1N4PA 4WNFA 3UPVA 1UJKA 1HO8A 1HXIA 2J9QA 2RD0A 2WXNA 3EJNA 3NZSA 3SI5A 4QFVA 5KNHD 4KXKB 2OV8A 1D8EA 4MS6A 3NZUA 3Q9NC 4MRUA 5CCLA 2VGXB 1KT1A 2IU1A 1X81A 4BFRA 1JCRA 4IULA 3QWPA 3J5PA 1X5BA 1SA4A 3RIBA 3TXMA 1OY3D 4YNDA 2ILRA 1ZB1A 3C98A 3PNTB 4GA0A 2WPVA 4N2QA 1NA3A 5FQ8A 1ZBPA 5AN8A 5ANRA 3KEZA 4K03A 5T4YA 4NURA 4CT4A 3AU5A 2BUGA 3APFA 1FT1A 2BTDA 4RVBA 3PREA 5ENRD 3LJ3A 4PS8A 1N4RA 3L9TA 1Y8MA 2L6JA 2IO3C 5JHAA 3AG4E 1DVPA 4G8LA 3FUEA 1WY6A 3FWVA 3V79K 3KD7A 4NIKA 2XPZA 1H6OA 3L6AA 2I1KA 3I4RB 3ZFWA 2Y4TA 4G23A 2I2OA 1D8DA 2QY7A 1JCSA 4C48B 3AJIA 1U3CA 2QYUA 4J6IA 1QNFA 4J8SA 3C3QA 4GYYA 1IYGA 1IXVA 4LERA 3ZKJA 5A23A 2Y1LE 4U0UA 3ULQA 3MV3B 3GZSA 4UWKA 3VTYA 3FH7A 4ANWA 3EU9A 1E8WA 1HX8A 2JEKA 5B1AE 3SFXA 3EU5A 5H7PA 3B7SA 3LS8A 2CG2A 3PEVB 4XEIG 3PUKA 3Q9UC 3ZW3A 2LSVA 3ZNGA 4UI9C 4I9EA 3IHYA 3I4GA 3PRZA 5CMWA 5CMYA 1E7VA 2IO2C 3LY9A 4NRHB 3DXMG 1INZA 3UKRG 3HG0D 2J4BA 3FU5A 3CHOA 5A7DB 1WM5A 5G05C 4AY5A 2YHEA 4XZ4A 1FVHA 4A1SA 2J4DA 4APFA 3HXDA 5KJKA 2A5UA 1OWPA 2BF0X 5BNWA 1FT2A 2DBAA 4U8VD 5LCWC 2YHCA 4AIFA 4KYOB 4GZ3A 5T8IA 1A17A 2J07A 2A5EA 3JUIA 3ESKA 4WNDA 3MA5A 4F1PA 3HXFA 2P9NG 1UW4B 1MX2A 2X38A 2XPIA 3O48A 3HVEA 3UM1A 4ABNA 5CRVA 3I5PA 2P9PG 3UT8A 3G2SA 1B89A 2FO7A 2X6IA 4WWOA 3W9FA 2PM6A 2XENA 1OWLA 3EUVA 4J8FA 3FEXA 4GYWA 3PS6A 3V2OA 2KZTB 4JHJA 3HXCA 2IQCA 2C0MA 4JB8P 4O60A 4GZ6A 4U7EB 4E6HA 2RG8A 1E90A 3N71A 3HVEB 4BESA 4Y6WA 2CG3A 2WXMA 3DSUA 2GRPB 2GRRB 4UI9K 2E0IA 2X6HA 3L13A 4HOQA 4LEUA 3ABKE 4N5QA 4EZJA 5LP0A 1BLXB 2F37A 1BI8B 4B93B 1HS6A 2WB2A 4WNEA 4KVOA 3ONLA 4M3OA 1JCQA 3D9IA 4U04A 2WQ7A 4TRQA 4CEMA 3FU6A 3CVQA 3Q15A 1U2VG 3AS8A 3T5VA 3EIJA 3RRUA 3E33A 4UWGA 3VLFA 2KXPC 1WDYA 1QQEA 1OCOE 4K0RA 3AG3E 3MV2B 2LSUA 1OT8A 3UUXA 4B94A 3IV0A 4ME2A 4G26A 1H2TC 2CHWA 1TNOA 1O1RA 5BW8C 3CK8A 3F6QA 4HLEA 2X6KA 3FUNA 4GTRA 4UWHA 3SFYA 3EHRA 4GMLA 4TXRA 2VGXA 2MHKA 5FJYA 4JHKA 4F7AA 1FVFA 2CFUA 4GMRA 3LY8A 4RQIA 5B3SE 3TWUA 1EYHA 3MGBA 4ZFHA 3C3RA 2ETAA 4Q96A 4J8EA 1UOHA 2PNNA 3JQ1A 5ENPD 2L9BA 3UM2A 4I6EA 4F53A 2C0LA 3PZDA 3DRAA 4APOA 1JWFA 5EIBE 3UIPC 2P9IG 1NP7A 5AQ9A 3ONKA 4HLLA 3CHMA 2JLBA 2V0PA 2XZDG 3PE4A 3E37A 5HQ8A 4ACLA 4J8DA 5JMND 1RW2A 3CSFA 4Z68A 3R9AB 4GCNA 3LPZA 1Z3XA 2R02A 4A3VA 5BUZA 1TEZA 4PH4B 1Z6TA 1TNYA 3DEPA 4HI9A 4GMJA 5FWQA 3SF4A 5G05J 2V4LA 5AYWD 4AVXA 2DYSE 5ANLA 2WVIA 5FZQA 4A1GA 3PDNA 5FQ4A 3VLDA 4H7YA 3GZ1A 1KZOA 3Q4AB 3U9WA 1DNPA 3U66A 1TR4A 2FEZA 1QZ2A 4X8QA 5A6CA 3L54A 3WG7E 2Q7FA 2XHEA 5BPPA 1O5MA 3ZN3A 1MQSA 3ULEG 3DPDA 4K5AB 2VJ8A 3MZLB 3ZUVB 3QKYA 3ESLA 3FUJA 3MYVA 5LOZA 5FT9A 1LD7A 2PZIA 1SW6A 5AQAA 4HFGA 4K5BA 3UM0A 3BUAA 1H2UA 2EILE 1SA5A 2WXKA 1BD8A 4XE0A 1V54E 1LTXA 4KMOA 1WG0A 4J8YA 4NACA 1KZPA 3LVRE 3GW4A 4GA1A 3ASOE 4FU3A 2WQHA 2NSZA 3AAAC
chains in the Genus database with same CATH topology
2XGMA 4L7TA 1EPUA 1Y6IA 3FUMA 2WXOA 3CHQA 1IYGA 4LERA 4DK5A 5A23A 4U0UA 4EBAA 5CCMA 3QWVA 3FH5A 1KLXA 3TL5A 2J49A 3ULQA 3MV3B 3GZSA 3AS4A 4UWKA 2MRIA 4A55A 4PUCA 4GPKA 3VTYA 4B8CB 1IQRA 3ASGA 4RSYA 4AP2A 4B89A 4G25A 3FH7A 4WAFA 3RJVA 4ANWA 4BWRA 5D0QD 3APDA 1E8WA 3B7TA 4FC8A 1HX8A 2AXZA 2JEKA 3SGHA 3SNXA 4HVBA 4HOTA 2HM8A 4G2VA 2VGYA 4HS2A 1U3DA 3B7SA 3LS8A 2CG2A 3PEVB 4BTAA 3PUKA 3ZW3A 5G2NA 3S7FA 2LSVA 3BG0B 3D9KA 5LFAA 4UI9C 4G11A 4I9EA 5KCMA 3R7QA 2X3MA 5KJNA 3IHYA 4FADA 3I4GA 4G24A 5EKQD 3PRZA 2YQ8A 2A4ZA 3CSTA 5CMWA 2R59A 2WXRA 4ANVA 4WNGA 4EPZA 2VTBA 5CMYA 2XEVA 1EF1C 1E7VA 2VSXE 1JPLA 3ML8A 4BY6A 3LY9A 4NRHB 1INZA 3B7RL 3HYMB 2J4BA 3FU5A 4ANUA 5JHBA 3CHOA 3GYZA 4YVQC 4IN3B 1YA0A 2MOWA 5A7DB 5AIJA 3WXXA 4HOUA 4DI3A 1E96B 3FUDA 3GZ2A 1ELKA 5FQ6A 1WM5A 3ZXSA 5G05C 4UQZA 1UJJA 4AY5A 3CEQA 2HYZA 2YHEA 4U8HA 3D9OA 3JCKC 4CDRA 3P2BA 5EDSA 3ML9A 5KJLA 3BEEA 2AWIA 3EIQC 4XZ4A 1JUQA 3IKOB 1FVHA 4A1SA 4CDMA 4OVUA 2J4DA 4APFA 5BV0A 4N3BA 5KJKA 4RG9A 3SBTB 4G1TA 1OWOA 2E2EA 2WXLA 4JXTA 5G04C 3CVVA 4GAAA 2A5UA 1OWPA 1XNFA 2BF0X 4JPSA 3UT7A 4EZLA 5BNWA 3RRMB 3U4TA 3QC1A 4PDXA 2XPYA 2FI7A 2DBAA 3CHPA 4GZCA 5LCWC 2XGOA 3L16A 4AJWA 2YHCA 4AIFA 2J08A 4KYOB 4U63A 4BSXA 3QNKA 4GZ3A 4XI9A 3Q5MA 4ILHB 3T8MA 1IHGA 3CV0A 5T8IA 4NQ0A 1A17A 2KCKA 2J07A 2OVFA 2DIWA 4I6GA 5FZRA 4BT8A 4U0SA 3OTNA 2P58C 3ZGQA 3TG4A 4BT9A 3JUIA 3ESKA 4WNDA 5CHEE 4ACKA 4DLOA 5JJTA 3CVUA 1HF8A 2J09A 3CHRA 4FHJA 3MA5A 3O4ZA 4UWFA 1Z3YA 1UW4B 3ASHA 3ZHEA 4WWPA 1VDYA 3FTVA 3IEGA 3B13A 4AV7A 2WQ6A 2X38A 4C0EA 2XPIA 4HXIA 5G04J 2LO6A 3CHSA 3FH8A 4W9RA 3O48A 4JA9A 3HVEA 3P1UA 4UI9J 3T5XA 4I1AA 4DI4A 1H19A 4ILGA 4I9CA 2R5SA 3ZEFA 2FBNA 4KBQA 3DBSA 4ABNA 3FY4A 4GZDA 3I5PA 4L2LA 3RU0A 2IF4A 4LCTA 3UT8A 1NA0A 1N52A 3ZYMA 2WXGA 2HR2A 3G2SA 4A3TA 3CVYA 1H0AA 3LKUA 2CHXA 2I6HA 3ASDA 1B89A 4ANXA 4CT0A 2VTBB 3L22A 3CK7A 2FO7A 3EDTB 2X6IA 4GCOA 4YVOA 4WWOA 1E8YA 4I1MA 5E75A 2PM6A 1OWLA 3TG5A 5ARGA 4OYSA 2XCBA 3MCXA 4J8FA 1E8ZA 3FEXA 4I6JA 4GYWA 3PS6A 1HZ4A 2KZTB 3LEWA 4JHJA 2PQNA 2GRMA 1P5QA 5KJMA 2IQCA 3Q49B 2WXFA 5LX8A 3ZHEB 2C0MA 2XGSA 4GU5A 4GZ6A 3PE3A 2Y3AA 4URKA 1UN9A 4E6HA 2RG8A 1E90A 3I3NA 3N71A 5AJLA 4BX8A 3FHEA 4EECA 2ONDA 3HVEB 4Y6WA 3CVWA 4E85A 2CG3A 2WXMA 4H7XA 5FZSA 2ZU6B 5AJDA 3PH0C 2CHZA 3PUJA 4UI9K 2E0IA 2X6HA 3K9IA 3L13A 1LF8A 4P29A 4HOQA 4BTBA 5LCWJ 3OXFA 5DBKA 2WMOA 3ENEA 1HU3A 3ZYLA 2WXJA 4LEUA 3D9JA 3SHFA 1GW6A 2VQ2A 1ELRA 4EZJA 5LP0A 4C0MA 2IJGX 5M72A 3VLEA 4FJYA 3TGOA 2I9CA 1ELWA 4ATGA 5J08A 4JA7A 4HOSA 4FHKA 1HS6A 2WB2A 4L2YA 4F3VA 1OWMA 4WNEA 5EX0A 4KVOA 5ENNA 2DCPA 4CRWA 3FUFA 2PM7A 1UG3A 3ONLA 4FULA 3URZA 4C9BB 5C1DA 4M3OA 3CVXA 2VSYA 3D9IA 4U04A 2WQ7A 4TRQA 4AM9A 4CEMA 3FU0A 5FTPA 4Q94A 3FU6A 3LYAA 3CVQA 2R17C 3Q15A 3QB2A 1S0PA 3IBEA 3KS2A 4JW1A 1E8XA 4XX5A 3QOUA 3AS8A 3T5VA 1NZNA 3CQCB 3EIJA 1UN8A 3QK0A 3MKQA 4I43A 3RRUA 1PY1A 3CR3A 2C2LA 2LNIA 3HHMA 4BX9A 1PAQA 4UWGA 3FDHA 5G55A 3VLFA 3ZYQA 4FP7A 2AXUA 4AOFA 4L1BA 1QQEA 4B8AA 4J0UA 4K0RA 4AEZC 1FCHA 3G2WA 1WAO1 3HDXA 3MV2B 4B0ZA 2AW6A 3FTYA 2LSUA 4CGWA 2FULA 4IRUA 5C2YA 1E7UA 3MEKA 3UUXA 4FA6A 4B94A 1OUVA 3IV0A 4OVVA 4HORA 4ME2A 3UQ3A 4G26A 1H2TC 2CHWA 3JYSA 2KZTA 5BW8C 3CK8A 3QWWA 4LRZA 4HLEA 2IOSA 2VSNA 2X6KA 5E76A 5BV1A 2X6FA 4AXHA 1HG5A 2WXHA 3LXUX 3FUNA 4UWHA 4EBAG 1N54A 3OAWA 4GMLA 4CGVA 4FJZA 3FTUA 2CFZA 3CKBA 3D3MA 3FP3A 4JHRA 2XRZA 2VGXA 1HG2A 3MKRA 2MHKA 3FTZA 3LY7A 5ARFA 4D10C 3B7UX 5FJYA 2HO1A 1L5JA 3PEUB 4MKTA 4V3IA 2UY1B 3JQ0A 1MHQA 4IYPA 4JHKA 2XCCA 3FTSA 4JEHA 4PS3A 1FVFA 2CFUA 3CVNA 3HIZA 3LY8A 4F7AA 5BT1A 1TEZA 3ZIMA 1EYHA 2GW1A 4XI0A 5T3RA 5AENA 2Y4UA 3FULA 3MGBA 5D0OD 4AY6A 3ZRHA 3G2VA 4FLBA 4I1OB 4DPRA 4Y6CA 1H2VC 2WXQA 4Q96A 3ASFA 2XRYA 3U64A 4J8EA 3BG1B 3FFLA 3ZYKA 2YINA 2KM4A 3CIAA 4WUYA 3JQ1A 2KCVA 4WWNA 2L9BA 1SQMA 4XIFA 3NF1A 4I6EA 2NXPA 3MJWA 3L08A 2C0LA 1HE8A 4F53A 2AVPA 3LCAA 2VYIA 4MLPA 2WXPA 1OWNA 4UQYA 3UMVA 3RO2A 4I2WA 4KZ0A 3PZDA 4APOA 4JC8A 1JWFA 3G2TA 1JWGA 4R7LA 4GYOA 4LUNU 4N3AA 4L23A 3SFZA 3D9NA 4JZYA 3MKQB 3CQGB 1NP7A 1BPOA 2GRLA 3MX3A 3RK6A 3QJZA 4JEUA 3IHVA 3ONKA 4N3CA 3EHMA 3CHMA 2UY1A 1XGWA 3FEYA 2XQ0A 4WNFA 1UJKA 1HO8A 1HXIA 3UPVA 4XKCA 2J9QA 2JLBA 2V0PA 3PE4A 4Q69A 5DIZA 4N39A 2RD0A 5HQ8A 2OOEA 4ACLA 2WXNA 2WM9A 3EJNA 5JJ6A 2KCLA 2KC7A 4J8DA 4RG6A 4UQXA 3NZSA 2V8SE 3CSFA 4I2ZA 3R9AB 4GCNA 3D9PA 5FQ7A 2PQRA 3LPZA 5J90A 1Z3XA 3SI5A 4QFVA 4A3VA 5BUZA 3SZ7A 2V5FA 3QAQA 4KXKB 4PH4B 1Z6TA 4FLHA 2OV8A 3NQPA 3S7DA 4GMJA 4MS6A 5FWQA 3NZUA 3U3WA 3SF4A 5G05J 2V4LA 5AYWD 4JL0A 3CGHA 2IOLA 5HI7A 2OVBA 1ZU2A 4AVXA 4EZKA 4MRUA 5ANLA 3UT4A 2WVIA 5CCLA 2VGXB 1KT1A 3CVPA 2UWJG 3PDNA 5FZQA 2IU1A 4A1GA 5FQ4A 4GB9A 3VLDA 4BFRA 4H7YA 3TJPA 3GZ1A 1EDUA 3Q4AB 4IULA 4TUUA 3U9WA 4GZ5A 2KATA 3D9LA 3PVLA 3QWPA 2NC9A 1DNPA 3QDNA 3RKVA 1H6KA 3U66A 3CKCA 3OXLA 1X5BA 3SBSA 4O6FA 4KVMA 2FEZA 1QZ2A 3UX4A 5A6CA 3L54A 2IONA 1HFAA 3RIBA 3TXMA 3D9MA 1W3BA 4F1SA 2Q7FA 2LAIA 4YNDA 3Q47B 2XHEA 2ILRA 5BPPA 4N2SA 3C98A 3PNTB 4GA0A 4I17A 2WPVA 4N2QA 3ZN3A 1NA3A 5JJ7A 5EX3A 5FQ8A 1MQSA 1ZBPA 3DPDA 5ANRA 4JVSA 1KT0A 2VJ8A 3KEZA 4K03A 3MZLB 4NURA 3PNLB 5T4YA 4CT4A 3KAEA 4DLQA 3AS5A 3E4BA 3AU5A 3FTXA 3APFA 2BUGA 1PC2A 3QKYA 3EHNA 2WMNA 3ESLA 4GA2A 3FUJA 3MYVA 2BTDA 4RVBA 5LOZA 3VTXA 3PREA 5FT9A 3ZPJA 4KZCA 2PZIA 3S7BA 3LJ3A 4PS8A 4KT6B 1HH8A 3FTWA 4HFGA 3QARA 1H2UA 1IQUA 1Y8MA 2EQXA 2L6JA 2YNQA 3TXNA 3S2AA 5JHAA 2WXIA 1DVPA 3LVQE 3CVLA 3G2UA 3L17A 3LDZA 3R7RA 2WXKA 3FUEA 1WY6A 3FWVA 4CDNA 2FF4A 2QFCA 3ZVVA 4CCAA 4N5CA 2L0IA 4EQFA 3KD7A 4XE0A 3RRNB 2M63A 4PS7A 3AU4A 2XPZA 3FUHA 2VSOE 3FUKA 3L6AA 2I1KA 4KMOA 3I4RB 4ILIA 2L0TB 3ZFWA 4U07A 2AXVA 2PL2A 2Y4TA 3SD5A 4G23A 1TJFA 2I2OA 3APCA 4U0ZA 2GGFA 4NACA 2QY7A 2LAHA 4UWLA 3FUIA 3S7JA 1SZAA 3LVRE 1U3CA 3FU3A 4XKBA 3TAXA 1TJCA 4TV3A 3GW4A 3RO3A 3OXGA 4GA1A 4FU3A 2WQHA 4J6IA 3CK9A 1QNFA 1SZ9A 4J8SA 2I1JA 3CLJA 2X6JA 2IFUA 2NSZA 4DJAA 4GYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QQE A;  2XGM A;  3U3W A;  2XPI A;  3SF4 A;  4J0U A;  5G05 J;  1IYG A;  5AYW D;  4JL0 A;  1FCH A;  5G04 J;  1WAO 1;  3MV2 B;  4W9R A;  3O48 A;  1ZU2 A;  4JA9 A;  4U0U A;  4UI9 J;  5HI7 A;  5CCM A;  3QWV A;  1KLX A;  2LSU A;  4I1A A;  4CGW A;  3ULQ A;  4I9C A;  5CCL A;  2R5S A;  2VGX B;  1KT1 A;  2FBN A;  2UWJ G;  3AS4 A;  3CVP A;  3MEK A;  3MV3 B;  3PDN A;  4KBQ A;  3UUX A;  4ABN A;  4GPK A;  4B94 A;  1OUV A;  4HOR A;  3VTY A;  4ME2 A;  4H7Y A;  4G26 A;  3UQ3 A;  3GZ1 A;  3Q4A B;  3RU0 A;  2IF4 A;  3JYS A;  3ASG A;  2KAT A;  4GZ5 A;  1NA0 A;  5BW8 C;  4G25 A;  2HR2 A;  3CK8 A;  3QWP A;  3QWW A;  2NC9 A;  2VSN A;  3RJV A;  3QDN A;  4BWR A;  3LKU A;  5D0Q D;  3RKV A;  2I6H A;  3CKC A;  3OXL A;  3ASD A;  1B89 A;  4O6F A;  4HOT A;  2FEZ A;  1QZ2 A;  3CK7 A;  2FO7 A;  5A6C A;  3EDT B;  4CGV A;  3RIB A;  3CKB A;  4GCO A;  3FP3 A;  2VGY A;  1W3B A;  4G2V A;  4JHR A;  2VGX A;  2Q7F A;  4YVO A;  3MKR A;  5ARF A;  2MHK A;  4YND A;  3LY7 A;  3Q47 B;  3TG5 A;  5ARG A;  5FJY A;  2HO1 A;  2XCB A;  4BTA A;  4J8F A;  2UY1 B;  4N2S A;  4GA0 A;  4I17 A;  2XCC A;  4GYW A;  5BT1 A;  3S7F A;  2WPV A;  2LSV A;  1HZ4 A;  3CVN A;  3LY8 A;  3ZN3 A;  4N2Q A;  1NA3 A;  4XI0 A;  2GW1 A;  2PQN A;  4UI9 C;  5EX3 A;  2Y4U A;  5JJ7 A;  4I9E A;  1P5Q A;  5D0O D;  5KJN A;  5KJM A;  1ZBP A;  3Q49 B;  4AY6 A;  1KT0 A;  2C0M A;  3ZHE B;  4G24 A;  2XGS A;  5EKQ D;  2YQ8 A;  4GZ6 A;  3PE3 A;  3KAE A;  4Y6C A;  3AS5 A;  3E4B A;  2BUG A;  1PC2 A;  4WNG A;  3ASF A;  2XEV A;  3N71 A;  3QKY A;  4J8E A;  4GA2 A;  2OND A;  3LY9 A;  4NRH B;  4Y6W A;  3VTX A;  3FFL A;  3ZPJ A;  5FT9 A;  3HYM B;  2PZI A;  4H7X A;  4WUY A;  2KCV A;  5FZS A;  3S7B A;  3GYZ A;  1HH8 A;  4UI9 K;  4IN3 B;  1YA0 A;  4XIF A;  3NF1 A;  3K9I A;  4YVQ C;  5A7D B;  3WXX A;  4HOU A;  2C0L A;  1E96 B;  1Y8M A;  4HOQ A;  3GZ2 A;  4BTB A;  2L6J A;  1WM5 A;  2AVP A;  3OXF A;  5G05 C;  3LCA A;  4UQZ A;  2VYI A;  5LCW J;  5DBK A;  4AY5 A;  3CEQ A;  2HYZ A;  4UQY A;  4LEU A;  4CDR A;  3CVL A;  4I2W A;  3RO2 A;  5KJL A;  2VQ2 A;  3BEE A;  3FWV A;  1ELR A;  2FF4 A;  4APO A;  2QFC A;  4N5C A;  4A1S A;  4EQF A;  3KD7 A;  4GYO A;  5M72 A;  4N3A A;  4N3B A;  5KJK A;  3TGO A;  4RG9 A;  1ELW A;  4G1T A;  2E2E A;  5G04 C;  4JA7 A;  4HOS A;  1XNF A;  4F3V A;  4WNE A;  5EX0 A;  4N3C A;  5BNW A;  3U4T A;  2UY1 A;  4WNF A;  3ZFW A;  3UPV A;  2FI7 A;  4U07 A;  1HXI A;  2DBA A;  3URZ A;  2PL2 A;  5C1D A;  2Y4T A;  2J9Q A;  2JLB A;  5LCW C;  2XGO A;  4G23 A;  2VSY A;  2YHC A;  4U04 A;  4AIF A;  3PE4 A;  4KYO B;  4AM9 A;  5DIZ A;  4N39 A;  4GZ3 A;  4U0Z A;  5FTP A;  5HQ8 A;  4XI9 A;  3LYA A;  3Q5M A;  2OOE A;  3CVQ A;  3Q15 A;  1IHG A;  3CV0 A;  3KS2 A;  4NQ0 A;  1A17 A;  5JJ6 A;  2KCL A;  2KC7 A;  4J8D A;  3QOU A;  2KCK A;  3AS8 A;  1NZN A;  4RG6 A;  4UQX A;  5FZR A;  3S7J A;  4U0S A;  4BT8 A;  2P58 C;  3ZGQ A;  3TG4 A;  4I2Z A;  4BT9 A;  3TAX A;  1TJC A;  3R9A B;  3ESK A;  3GW4 A;  4GCN A;  4WND A;  2C2L A;  2LNI A;  3OXG A;  4GA1 A;  5CHE E;  5FZQ A;  3RO3 A;  2PQR A;  3LPZ A;  5JJT A;  2WQH A;  3MA5 A;  3CK9 A;  3SZ7 A;  2V5F A;  3ASH A;  4KXK B;  3S7D A;  3ZHE A;  2IFU A;  3IEG A;  4GYY A; 
#chains in the Genus database with same CATH topology
 4L7T A;  4DK5 A;  3TL5 A;  5AQ7 A;  2J49 A;  3DST A;  3AS4 A;  4YDO A;  2MRI A;  4A55 A;  4PUC A;  3ABL E;  4B8C B;  5CBN A;  4YDW A;  2L6B A;  4AP2 A;  4G25 A;  3RJV A;  2J8S D;  3RSE G;  1V55 E;  2AXZ A;  2HM8 A;  1MX6 A;  5EYL A;  2LXM A;  1N0R A;  5G2N A;  3S7F A;  3BG0 B;  5LFA A;  5KJN A;  3R7Q A;  2X3M A;  1OCZ E;  2YQ8 A;  2WXR A;  1EF1 C;  1NL4 A;  1JPL A;  3HYM B;  4GTP A;  4ANU A;  3ABM E;  1YA0 A;  3L82 A;  3FUD A;  3ZXS A;  4UQZ A;  5HS0 A;  5KJL A;  3BEE A;  2AWI A;  1JUQ A;  3IKO B;  5HRY A;  3SBT B;  2WXL A;  3CVV A;  4JXT A;  1XNF A;  2KBX A;  3RRM B;  1S64 A;  5BXO A;  2FI7 A;  4DRX E;  2QC9 A;  4GZC A;  2XGO A;  4BSX A;  3Q5M A;  1D9S A;  2XEH A;  3CV0 A;  4U0S A;  3ZGQ A;  1TN8 A;  4GTQ A;  4BT9 A;  1HF8 A;  1Z3Y A;  5CED B;  1VDY A;  3FTV A;  4DX1 A;  4HXI A;  4HRM B;  5ITZ F;  5G04 J;  3CHS A;  4W9R A;  4JA9 A;  3T5X A;  2R03 A;  4ILG A;  4I9C A;  2FBN A;  4KBQ A;  5ENQ D;  2BED A;  1H0A A;  2H6I A;  2I6H A;  4O1P A;  1MYO A;  3NAW A;  2VTB B;  3EDT B;  1E8Y A;  4I1M A;  5ARG A;  2XCB A;  3MCX A;  2NYJ A;  1HZ4 A;  2DYR E;  4URK A;  4EHM A;  3I3N A;  4E85 A;  2V4H C;  2ZU6 B;  5AJD A;  2CHZ A;  3OXF A;  4HB5 A;  4YDE A;  3ENE A;  3ZYL A;  3D9J A;  1ELR A;  3VLE A;  3HXE A;  2P9L G;  5ENN A;  2PM7 A;  5C1D A;  4C9B B;  3E34 A;  4AM9 A;  3HXB A;  3LYA A;  3QB2 A;  3KS2 A;  4JW1 A;  4XX5 A;  1O1T A;  3QK0 A;  3HHM A;  4BX9 A;  1PAQ A;  3AG1 E;  3FDH A;  3ZYQ A;  2P2C P;  4L1B A;  4B8A A;  1FCH A;  4B0Z A;  2AW6 A;  4CGW A;  2FUL A;  4IRU A;  4U8Y D;  3ZU7 B;  5C2Y A;  4HOR A;  5IY5 E;  4LRZ A;  4TXP A;  2IOS A;  3PZ2 A;  5E76 A;  4FJZ A;  3KSQ A;  3D3M A;  3FP3 A;  1KPS B;  3LY7 A;  3B7U X;  4V3I A;  3JQ0 A;  1MHQ A;  3ZIM A;  4XI0 A;  2GW1 A;  5T3R A;  2Y4U A;  3FUL A;  4I1O B;  4DPR A;  2XRY A;  3U64 A;  1G3N B;  3BG1 B;  3FFL A;  1AWC B;  4TXQ A;  2YIN A;  2KM4 A;  3CIA A;  3PZ4 A;  5ENT D;  3MJW A;  5EIL A;  4BSZ B;  2AVP A;  2VYI A;  4MLP A;  2WXP A;  4KZ0 A;  2ETB A;  4GYO A;  2IEJ A;  2BKG A;  1TNZ A;  3D9N A;  4BET A;  4JZY A;  2ZIR A;  3MKQ B;  3CQG B;  2GRL A;  3MX3 A;  3RK6 A;  3IHV A;  3FEY A;  1XGW A;  2XQ0 A;  4L9P A;  4XKC A;  4OAU C;  5ENS D;  4N39 A;  3DPY A;  2OOE A;  4CZ2 D;  2KC7 A;  2V8S E;  4I2Z A;  5FQ7 A;  2PQR A;  3SZ7 A;  2H6H A;  4JL0 A;  2OVB A;  1ZU2 A;  1TN6 A;  3UT4 A;  5EID A;  1BI7 B;  1TYQ G;  2EIN E;  3CVP A;  4K5C A;  1RZ4 A;  3TJP A;  4GZ5 A;  2KAT A;  3ULY A;  3D9L A;  1H6K A;  3OXL A;  4O6F A;  5KWD A;  2ION A;  3D9M A;  4DX7 D;  4F1S A;  4DX5 D;  3Q47 B;  3C3O A;  4I17 A;  5JJ7 A;  4JVS A;  2H6F A;  3UXG A;  3PNL B;  3TWT A;  3KAE A;  3FTX A;  3EHN A;  4HQD A;  4GA2 A;  4GTV A;  3VTX A;  3S7B A;  1K8K G;  4KT6 B;  1HH8 A;  3FTW A;  3V30 A;  2EQX A;  2XEE A;  3TXN A;  2WXI A;  3LVQ E;  3R7R A;  2FF4 A;  3ZVV A;  4CCA A;  3DSS A;  4EQF A;  4GTM A;  2M63 A;  4PS7 A;  3R9M A;  2VSO E;  3IXE A;  4BEP A;  2F8X K;  2EIK E;  4J7W A;  2AXV A;  2PL2 A;  3SD5 A;  3APC A;  2LAH A;  2F0Y A;  4UWL A;  3FUI A;  3S7J A;  1SZA A;  3FU3 A;  4XKB A;  4DX6 D;  4U96 D;  3RO3 A;  1SZ9 A;  2I1J A;  3HDX A;  3CLJ A;  2X6J A;  2IFU A;  3FUM A;  3Q78 A;  1N11 A;  5CCM A;  1LD8 A;  3QWV A;  3DXK G;  4A63 B;  4GPK A;  2R2L A;  1MJ0 A;  3PZ1 A;  4WAF A;  3TWV A;  5D0Q D;  3APD A;  4ATZ D;  4FC8 A;  4TUM A;  3SGH A;  3SNX A;  4HVB A;  4HOT A;  4GPM A;  3T8K A;  4G2V A;  4HS2 A;  3NOC D;  4HI8 A;  1NI1 A;  4G24 A;  5EKQ D;  3CST A;  2R59 A;  4ANV A;  4WNG A;  2ZIS A;  3ML8 A;  4BY6 A;  3B7R L;  2Y0B G;  3GYZ A;  4YVQ C;  5AIJ A;  2MOW A;  1IKN D;  5FQ6 A;  4JD2 G;  2ZXW E;  3CEQ A;  3JCK C;  4CDR A;  3P2B A;  3ML9 A;  3EIQ C;  4N3B A;  1OWO A;  4GAA A;  4JPS A;  3UT7 A;  4EZL A;  3BU8 A;  3U4T A;  4YDY A;  2XS1 A;  3QC1 A;  4PDX A;  2XPY A;  3L16 A;  2J08 A;  3QNK A;  2RFM A;  4ILH B;  1O1S A;  3JUE A;  2KCK A;  5FZR A;  3TWS A;  4BT8 A;  2P58 C;  1N94 A;  5CHE E;  4ACK A;  4DLO A;  3CVU A;  4FHJ A;  3SY2 A;  3ZHE A;  3ASH A;  2GRQ B;  4WWP A;  1N4S A;  2WQ6 A;  4AV7 A;  3Q79 A;  3P1U A;  3Q7F A;  4I1A A;  4GTO A;  4DI4 A;  1H19 A;  2OEV A;  2R5S A;  3ZEF A;  3DBS A;  2IF4 A;  3ZYM A;  1N52 A;  2WXG A;  2HR2 A;  3ZXP A;  3CVY A;  4U95 D;  2CHX A;  2DVW A;  3ASD A;  4DUI A;  4LNG A;  3CK7 A;  5D66 A;  4GCO A;  4YVO A;  1MZC A;  4GTT A;  4OYS A;  2GRN B;  1AP7 A;  3LEW A;  2GRM A;  1P5Q A;  5KJM A;  5LX8 A;  3Q49 B;  2WXF A;  3ZHE B;  2XGS A;  2P9S G;  3PE3 A;  2Y3A A;  3E30 A;  3FHE A;  4EEC A;  3X2Q E;  3CVW A;  5FIO A;  4H7X A;  3Q7A A;  3PUJ A;  4HBD A;  1LF8 A;  5BXU A;  5LCW J;  2RFA A;  1HU3 A;  3SHF A;  2VQ2 A;  3J5Q B;  2IJG X;  5M72 A;  1ELW A;  5J08 A;  4HOS A;  4FHK A;  4F3V A;  1OWM A;  5EX0 A;  1DCQ A;  2DCP A;  4CRW A;  1UG3 A;  4FUL A;  3URZ A;  3CVX A;  4MBG A;  3FU0 A;  4Q94 A;  5D2M C;  2Y69 E;  3IBE A;  1NZN A;  3AG2 E;  1N9A A;  5JA4 D;  1DCE A;  1UN8 A;  3MKQ A;  1PY1 A;  2LNI A;  3LJN A;  2XS8 A;  2IY0 C;  5G55 A;  4FP7 A;  4AOF A;  3UM3 A;  3NB2 A;  3T9K A;  4AEZ C;  3G2W A;  1WAO 1;  1E7U A;  3MEK A;  1OUV A;  4OVV A;  5KBA A;  3UQ3 A;  2VSN A;  3C5R A;  3SQV A;  2X6F A;  4ZHB A;  3LXU X;  2XZT G;  4EBA G;  3UKU G;  3FTU A;  3CKB A;  1HG2 A;  3MKR A;  1L5J A;  4MKT A;  2UY1 B;  4IYP A;  4JEH A;  2XCC A;  5BT1 A;  5AAR A;  2DZN A;  5AEN A;  5D0O D;  4AY6 A;  3ZRH A;  3JXI A;  5FIN A;  3G2V A;  2P9K G;  4Y6C A;  2WXQ A;  3ASF A;  3ZYK A;  2KCV A;  2FO1 E;  1N4Q A;  2GRO B;  3LCA A;  1OWN A;  3UMV A;  4I2W A;  1N95 A;  1JWG A;  4R7L A;  2QZA A;  5EN5 D;  3SFZ A;  4LNB A;  3QJZ A;  4QQI A;  2UY1 A;  3EHM A;  5CEA A;  4Q69 A;  5DIZ A;  2WM9 A;  5JJ6 A;  2KCL A;  3DSW A;  4RG6 A;  4UQX A;  2V5Q C;  3D9P A;  1K1A A;  5J90 A;  3UIN C;  2V5F A;  3S7D A;  3QAQ A;  4FLH A;  3NQP A;  3U3W A;  3CGH A;  2IOL A;  5HI7 A;  1OCR E;  4EZK A;  3DSV A;  3V31 A;  2UWJ G;  4GB9 A;  1EDU A;  4TUU A;  3PVL A;  2NC9 A;  2MYO A;  3PZ3 A;  3QDN A;  3RKV A;  3TWX A;  3CKC A;  3KSL A;  3SBS A;  4HNA D;  4KVM A;  2DZO A;  3UX4 A;  1HFA A;  3UI2 A;  3TWQ A;  1W3B A;  2LAI A;  1OXJ A;  2F8Y A;  4N2S A;  2R05 A;  5HKP A;  5EX3 A;  3Q73 A;  1KT0 A;  4DLQ A;  3AS5 A;  3E4B A;  1PC2 A;  2JAB A;  2WMN A;  3ZPJ A;  3UTM A;  4KZC A;  2B0O E;  5CEC B;  3QAR A;  2B6C A;  2YNQ A;  1IQU A;  4CYM D;  3S2A A;  4M7C A;  4LNU D;  1DC2 A;  3CVL A;  3G2U A;  3L17 A;  3LDZ A;  4CDN A;  2QFC A;  4N5C A;  2L0I A;  1S70 B;  3RRN B;  3AU4 A;  3FUH A;  3FUK A;  4ILI A;  2L0T B;  3BQO A;  4U07 A;  2ETC A;  1TJF A;  4U0Z A;  2GGF A;  3RAU A;  2BKK B;  3UIO C;  3B7B A;  2EIJ E;  3TAX A;  1TJC A;  4TV3 A;  3OXG A;  1FPP A;  3CK9 A;  3V2X A;  3SO8 A;  4DJA A;  2XGM A;  1EPU A;  1Y6I A;  2WXO A;  3CHQ A;  4EBA A;  3FH5 A;  1KLX A;  1H6P A;  2H6G A;  3JXJ A;  2ZGD A;  3TWR A;  1IQR A;  3ASG A;  4RSY A;  1QBQ A;  4B89 A;  4BWR A;  3B7T A;  5CER B;  2VGY A;  1U3D A;  4BTA A;  1K3Z D;  3D9K A;  2HE0 A;  4G11 A;  4O1O A;  5KCM A;  1QYM A;  4FAD A;  3DSX A;  2A4Z A;  2VTB A;  4EPZ A;  2XEV A;  2VSX E;  4LG6 A;  5JHB A;  5B1B E;  3DWL G;  4IN3 B;  3WXX A;  4HOU A;  4DI3 A;  1E96 B;  1TNB A;  3GZ2 A;  1ELK A;  1NFI E;  1UJJ A;  2HYZ A;  4U8H A;  3D9O A;  5EDS A;  5AQB A;  4CDM A;  4GTS A;  4OVU A;  5BV0 A;  4RG9 A;  4G1T A;  2E2E A;  5G04 C;  1Z5S C;  1YCS B;  1K1B A;  3Q75 A;  3CHP A;  2LXL A;  4AJW A;  4LSZ E;  4U63 A;  2AJA A;  1S63 A;  4XI9 A;  3T8M A;  1IHG A;  4NQ0 A;  4I6G A;  2OVF A;  2DIW A;  4G8K A;  3OTN A;  3TG4 A;  3W9G A;  1YYH A;  5JJT A;  2J09 A;  3CHR A;  3O4Z A;  4UWF A;  3IEG A;  3B13 A;  4C0E A;  2LO6 A;  3FH8 A;  3DEO A;  4UI9 J;  1TN7 A;  3FY4 A;  4GZD A;  4L2L A;  3RU0 A;  4LCT A;  1NA0 A;  4A3T A;  3LKU A;  4ANX A;  4CT0 A;  3L22 A;  1A5E A;  2LUH A;  5E75 A;  3EHQ A;  1YMP A;  1SVX A;  3TG5 A;  5AAO A;  1E8Z A;  4I6J A;  4UUC A;  2PQN A;  4GU5 A;  1UN9 A;  5AJL A;  4BX8 A;  2OND A;  3ASN E;  3D9H A;  5FZS A;  3PH0 C;  3K9I A;  4P29 A;  4BTB A;  5DBK A;  2WMO A;  2WXJ A;  1GW6 A;  3C72 A;  4C0M A;  1N0Q A;  4FJY A;  3TGO A;  2I9C A;  4ATG A;  4JA7 A;  2EIM E;  4L2Y A;  1BU9 A;  5CBO A;  3FUF A;  2VSY A;  5KNG A;  5FTP A;  2R17 C;  1S0P A;  1TNU A;  1E8X A;  2OCC E;  3QOU A;  3CQC B;  4I43 A;  4BER A;  3CR3 A;  2C2L A;  2DWZ A;  2ZGG A;  2AXU A;  4J0U A;  2P9U G;  3FTY A;  4F6R D;  4FA6 A;  5ENO D;  3KEA A;  3E32 A;  5EYP F;  3JYS A;  2KZT A;  3QWW A;  4HRN A;  5BV1 A;  4AXH A;  1HG5 A;  2WXH A;  4RLY A;  2OEW A;  1N54 A;  3OAW A;  4DX2 A;  4CGV A;  2CFZ A;  4JHR A;  2XRZ A;  5ARF A;  3FTZ A;  1IHB A;  4D10 C;  2HO1 A;  3PEU B;  3HRA A;  4PS3 A;  3FTS A;  3CVN A;  3HIZ A;  1OCC E;  3B95 A;  4OAV B;  4FLB A;  1H2V C;  3NBN B;  2VGE A;  3ISM C;  4WUY A;  4WWN A;  1SQM A;  1Q2Z A;  4XIF A;  3NF1 A;  2NXP A;  3L08 A;  1HE8 A;  1MX4 A;  2QYJ A;  4UQY A;  3TWW A;  3RO2 A;  4JC8 A;  3G2T A;  5CRU A;  4LUN U;  4N3A A;  4L23 A;  4HRL A;  1BPO A;  2RKK A;  3NOG D;  4JEU A;  4N3C A;  1N4P A;  4WNF A;  3UPV A;  1UJK A;  1HO8 A;  1HXI A;  2J9Q A;  2RD0 A;  2WXN A;  3EJN A;  3NZS A;  3SI5 A;  4QFV A;  5KNH D;  4KXK B;  2OV8 A;  1D8E A;  4MS6 A;  3NZU A;  3Q9N C;  4MRU A;  5CCL A;  2VGX B;  1KT1 A;  2IU1 A;  1X81 A;  4BFR A;  1JCR A;  4IUL A;  3QWP A;  3J5P A;  1X5B A;  1SA4 A;  3RIB A;  3TXM A;  1OY3 D;  4YND A;  2ILR A;  1ZB1 A;  3C98 A;  3PNT B;  4GA0 A;  2WPV A;  4N2Q A;  1NA3 A;  5FQ8 A;  1ZBP A;  5AN8 A;  5ANR A;  3KEZ A;  4K03 A;  5T4Y A;  4NUR A;  4CT4 A;  3AU5 A;  2BUG A;  3APF A;  1FT1 A;  2BTD A;  4RVB A;  3PRE A;  5ENR D;  3LJ3 A;  4PS8 A;  1N4R A;  3L9T A;  1Y8M A;  2L6J A;  2IO3 C;  5JHA A;  3AG4 E;  1DVP A;  4G8L A;  3FUE A;  1WY6 A;  3FWV A;  3V79 K;  3KD7 A;  4NIK A;  2XPZ A;  1H6O A;  3L6A A;  2I1K A;  3I4R B;  3ZFW A;  2Y4T A;  4G23 A;  2I2O A;  1D8D A;  2QY7 A;  1JCS A;  4C48 B;  3AJI A;  1U3C A;  2QYU A;  4J6I A;  1QNF A;  4J8S A;  3C3Q A;  4GYY A;  1IYG A;  1IXV A;  4LER A;  3ZKJ A;  5A23 A;  2Y1L E;  4U0U A;  3ULQ A;  3MV3 B;  3GZS A;  4UWK A;  3VTY A;  3FH7 A;  4ANW A;  3EU9 A;  1E8W A;  1HX8 A;  2JEK A;  5B1A E;  3SFX A;  3EU5 A;  5H7P A;  3B7S A;  3LS8 A;  2CG2 A;  3PEV B;  4XEI G;  3PUK A;  3Q9U C;  3ZW3 A;  2LSV A;  3ZNG A;  4UI9 C;  4I9E A;  3IHY A;  3I4G A;  3PRZ A;  5CMW A;  5CMY A;  1E7V A;  2IO2 C;  3LY9 A;  4NRH B;  3DXM G;  1INZ A;  3UKR G;  3HG0 D;  2J4B A;  3FU5 A;  3CHO A;  5A7D B;  1WM5 A;  5G05 C;  4AY5 A;  2YHE A;  4XZ4 A;  1FVH A;  4A1S A;  2J4D A;  4APF A;  3HXD A;  5KJK A;  2A5U A;  1OWP A;  2BF0 X;  5BNW A;  1FT2 A;  2DBA A;  4U8V D;  5LCW C;  2YHC A;  4AIF A;  4KYO B;  4GZ3 A;  5T8I A;  1A17 A;  2J07 A;  2A5E A;  3JUI A;  3ESK A;  4WND A;  3MA5 A;  4F1P A;  3HXF A;  2P9N G;  1UW4 B;  1MX2 A;  2X38 A;  2XPI A;  3O48 A;  3HVE A;  3UM1 A;  4ABN A;  5CRV A;  3I5P A;  2P9P G;  3UT8 A;  3G2S A;  1B89 A;  2FO7 A;  2X6I A;  4WWO A;  3W9F A;  2PM6 A;  2XEN A;  1OWL A;  3EUV A;  4J8F A;  3FEX A;  4GYW A;  3PS6 A;  3V2O A;  2KZT B;  4JHJ A;  3HXC A;  2IQC A;  2C0M A;  4JB8 P;  4O60 A;  4GZ6 A;  4U7E B;  4E6H A;  2RG8 A;  1E90 A;  3N71 A;  3HVE B;  4BES A;  4Y6W A;  2CG3 A;  2WXM A;  3DSU A;  2GRP B;  2GRR B;  4UI9 K;  2E0I A;  2X6H A;  3L13 A;  4HOQ A;  4LEU A;  3ABK E;  4N5Q A;  4EZJ A;  5LP0 A;  1BLX B;  2F37 A;  1BI8 B;  4B93 B;  1HS6 A;  2WB2 A;  4WNE A;  4KVO A;  3ONL A;  4M3O A;  1JCQ A;  3D9I A;  4U04 A;  2WQ7 A;  4TRQ A;  4CEM A;  3FU6 A;  3CVQ A;  3Q15 A;  1U2V G;  3AS8 A;  3T5V A;  3EIJ A;  3RRU A;  3E33 A;  4UWG A;  3VLF A;  2KXP C;  1WDY A;  1QQE A;  1OCO E;  4K0R A;  3AG3 E;  3MV2 B;  2LSU A;  1OT8 A;  3UUX A;  4B94 A;  3IV0 A;  4ME2 A;  4G26 A;  1H2T C;  2CHW A;  1TNO A;  1O1R A;  5BW8 C;  3CK8 A;  3F6Q A;  4HLE A;  2X6K A;  3FUN A;  4GTR A;  4UWH A;  3SFY A;  3EHR A;  4GML A;  4TXR A;  2VGX A;  2MHK A;  5FJY A;  4JHK A;  4F7A A;  1FVF A;  2CFU A;  4GMR A;  3LY8 A;  4RQI A;  5B3S E;  3TWU A;  1EYH A;  3MGB A;  4ZFH A;  3C3R A;  2ETA A;  4Q96 A;  4J8E A;  1UOH A;  2PNN A;  3JQ1 A;  5ENP D;  2L9B A;  3UM2 A;  4I6E A;  4F53 A;  2C0L A;  3PZD A;  3DRA A;  4APO A;  1JWF A;  5EIB E;  3UIP C;  2P9I G;  1NP7 A;  5AQ9 A;  3ONK A;  4HLL A;  3CHM A;  2JLB A;  2V0P A;  2XZD G;  3PE4 A;  3E37 A;  5HQ8 A;  4ACL A;  4J8D A;  5JMN D;  1RW2 A;  3CSF A;  4Z68 A;  3R9A B;  4GCN A;  3LPZ A;  1Z3X A;  2R02 A;  4A3V A;  5BUZ A;  1TEZ A;  4PH4 B;  1Z6T A;  1TNY A;  3DEP A;  4HI9 A;  4GMJ A;  5FWQ A;  3SF4 A;  5G05 J;  2V4L A;  5AYW D;  4AVX A;  2DYS E;  5ANL A;  2WVI A;  5FZQ A;  4A1G A;  3PDN A;  5FQ4 A;  3VLD A;  4H7Y A;  3GZ1 A;  1KZO A;  3Q4A B;  3U9W A;  1DNP A;  3U66 A;  1TR4 A;  2FEZ A;  1QZ2 A;  4X8Q A;  5A6C A;  3L54 A;  3WG7 E;  2Q7F A;  2XHE A;  5BPP A;  1O5M A;  3ZN3 A;  1MQS A;  3ULE G;  3DPD A;  4K5A B;  2VJ8 A;  3MZL B;  3ZUV B;  3QKY A;  3ESL A;  3FUJ A;  3MYV A;  5LOZ A;  5FT9 A;  1LD7 A;  2PZI A;  1SW6 A;  5AQA A;  4HFG A;  4K5B A;  3UM0 A;  3BUA A;  1H2U A;  2EIL E;  1SA5 A;  2WXK A;  1BD8 A;  4XE0 A;  1V54 E;  1LTX A;  4KMO A;  1WG0 A;  4J8Y A;  4NAC A;  1KZP A;  3LVR E;  3GW4 A;  4GA1 A;  3ASO E;  4FU3 A;  2WQH A;  2NSZ A;  3AAA C; 
#chains in the Genus database with same CATH homology
 2XGM A;  4L7T A;  1EPU A;  1Y6I A;  3FUM A;  2WXO A;  3CHQ A;  1IYG A;  4LER A;  4DK5 A;  5A23 A;  4U0U A;  4EBA A;  5CCM A;  3QWV A;  3FH5 A;  1KLX A;  3TL5 A;  2J49 A;  3ULQ A;  3MV3 B;  3GZS A;  3AS4 A;  4UWK A;  2MRI A;  4A55 A;  4PUC A;  4GPK A;  3VTY A;  4B8C B;  1IQR A;  3ASG A;  4RSY A;  4AP2 A;  4B89 A;  4G25 A;  3FH7 A;  4WAF A;  3RJV A;  4ANW A;  4BWR A;  5D0Q D;  3APD A;  1E8W A;  3B7T A;  4FC8 A;  1HX8 A;  2AXZ A;  2JEK A;  3SGH A;  3SNX A;  4HVB A;  4HOT A;  2HM8 A;  4G2V A;  2VGY A;  4HS2 A;  1U3D A;  3B7S A;  3LS8 A;  2CG2 A;  3PEV B;  4BTA A;  3PUK A;  3ZW3 A;  5G2N A;  3S7F A;  2LSV A;  3BG0 B;  3D9K A;  5LFA A;  4UI9 C;  4G11 A;  4I9E A;  5KCM A;  3R7Q A;  2X3M A;  5KJN A;  3IHY A;  4FAD A;  3I4G A;  4G24 A;  5EKQ D;  3PRZ A;  2YQ8 A;  2A4Z A;  3CST A;  5CMW A;  2R59 A;  2WXR A;  4ANV A;  4WNG A;  4EPZ A;  2VTB A;  5CMY A;  2XEV A;  1EF1 C;  1E7V A;  2VSX E;  1JPL A;  3ML8 A;  4BY6 A;  3LY9 A;  4NRH B;  1INZ A;  3B7R L;  3HYM B;  2J4B A;  3FU5 A;  4ANU A;  5JHB A;  3CHO A;  3GYZ A;  4YVQ C;  4IN3 B;  1YA0 A;  2MOW A;  5A7D B;  5AIJ A;  3WXX A;  4HOU A;  4DI3 A;  1E96 B;  3FUD A;  3GZ2 A;  1ELK A;  5FQ6 A;  1WM5 A;  3ZXS A;  5G05 C;  4UQZ A;  1UJJ A;  4AY5 A;  3CEQ A;  2HYZ A;  2YHE A;  4U8H A;  3D9O A;  3JCK C;  4CDR A;  3P2B A;  5EDS A;  3ML9 A;  5KJL A;  3BEE A;  2AWI A;  3EIQ C;  4XZ4 A;  1JUQ A;  3IKO B;  1FVH A;  4A1S A;  4CDM A;  4OVU A;  2J4D A;  4APF A;  5BV0 A;  4N3B A;  5KJK A;  4RG9 A;  3SBT B;  4G1T A;  1OWO A;  2E2E A;  2WXL A;  4JXT A;  5G04 C;  3CVV A;  4GAA A;  2A5U A;  1OWP A;  1XNF A;  2BF0 X;  4JPS A;  3UT7 A;  4EZL A;  5BNW A;  3RRM B;  3U4T A;  3QC1 A;  4PDX A;  2XPY A;  2FI7 A;  2DBA A;  3CHP A;  4GZC A;  5LCW C;  2XGO A;  3L16 A;  4AJW A;  2YHC A;  4AIF A;  2J08 A;  4KYO B;  4U63 A;  4BSX A;  3QNK A;  4GZ3 A;  4XI9 A;  3Q5M A;  4ILH B;  3T8M A;  1IHG A;  3CV0 A;  5T8I A;  4NQ0 A;  1A17 A;  2KCK A;  2J07 A;  2OVF A;  2DIW A;  4I6G A;  5FZR A;  4BT8 A;  4U0S A;  3OTN A;  2P58 C;  3ZGQ A;  3TG4 A;  4BT9 A;  3JUI A;  3ESK A;  4WND A;  5CHE E;  4ACK A;  4DLO A;  5JJT A;  3CVU A;  1HF8 A;  2J09 A;  3CHR A;  4FHJ A;  3MA5 A;  3O4Z A;  4UWF A;  1Z3Y A;  1UW4 B;  3ASH A;  3ZHE A;  4WWP A;  1VDY A;  3FTV A;  3IEG A;  3B13 A;  4AV7 A;  2WQ6 A;  2X38 A;  4C0E A;  2XPI A;  4HXI A;  5G04 J;  2LO6 A;  3CHS A;  3FH8 A;  4W9R A;  3O48 A;  4JA9 A;  3HVE A;  3P1U A;  4UI9 J;  3T5X A;  4I1A A;  4DI4 A;  1H19 A;  4ILG A;  4I9C A;  2R5S A;  3ZEF A;  2FBN A;  4KBQ A;  3DBS A;  4ABN A;  3FY4 A;  4GZD A;  3I5P A;  4L2L A;  3RU0 A;  2IF4 A;  4LCT A;  3UT8 A;  1NA0 A;  1N52 A;  3ZYM A;  2WXG A;  2HR2 A;  3G2S A;  4A3T A;  3CVY A;  1H0A A;  3LKU A;  2CHX A;  2I6H A;  3ASD A;  1B89 A;  4ANX A;  4CT0 A;  2VTB B;  3L22 A;  3CK7 A;  2FO7 A;  3EDT B;  2X6I A;  4GCO A;  4YVO A;  4WWO A;  1E8Y A;  4I1M A;  5E75 A;  2PM6 A;  1OWL A;  3TG5 A;  5ARG A;  4OYS A;  2XCB A;  3MCX A;  4J8F A;  1E8Z A;  3FEX A;  4I6J A;  4GYW A;  3PS6 A;  1HZ4 A;  2KZT B;  3LEW A;  4JHJ A;  2PQN A;  2GRM A;  1P5Q A;  5KJM A;  2IQC A;  3Q49 B;  2WXF A;  5LX8 A;  3ZHE B;  2C0M A;  2XGS A;  4GU5 A;  4GZ6 A;  3PE3 A;  2Y3A A;  4URK A;  1UN9 A;  4E6H A;  2RG8 A;  1E90 A;  3I3N A;  3N71 A;  5AJL A;  4BX8 A;  3FHE A;  4EEC A;  2OND A;  3HVE B;  4Y6W A;  3CVW A;  4E85 A;  2CG3 A;  2WXM A;  4H7X A;  5FZS A;  2ZU6 B;  5AJD A;  3PH0 C;  2CHZ A;  3PUJ A;  4UI9 K;  2E0I A;  2X6H A;  3K9I A;  3L13 A;  1LF8 A;  4P29 A;  4HOQ A;  4BTB A;  5LCW J;  3OXF A;  5DBK A;  2WMO A;  3ENE A;  1HU3 A;  3ZYL A;  2WXJ A;  4LEU A;  3D9J A;  3SHF A;  1GW6 A;  2VQ2 A;  1ELR A;  4EZJ A;  5LP0 A;  4C0M A;  2IJG X;  5M72 A;  3VLE A;  4FJY A;  3TGO A;  2I9C A;  1ELW A;  4ATG A;  5J08 A;  4JA7 A;  4HOS A;  4FHK A;  1HS6 A;  2WB2 A;  4L2Y A;  4F3V A;  1OWM A;  4WNE A;  5EX0 A;  4KVO A;  5ENN A;  2DCP A;  4CRW A;  3FUF A;  2PM7 A;  1UG3 A;  3ONL A;  4FUL A;  3URZ A;  4C9B B;  5C1D A;  4M3O A;  3CVX A;  2VSY A;  3D9I A;  4U04 A;  2WQ7 A;  4TRQ A;  4AM9 A;  4CEM A;  3FU0 A;  5FTP A;  4Q94 A;  3FU6 A;  3LYA A;  3CVQ A;  2R17 C;  3Q15 A;  3QB2 A;  1S0P A;  3IBE A;  3KS2 A;  4JW1 A;  1E8X A;  4XX5 A;  3QOU A;  3AS8 A;  3T5V A;  1NZN A;  3CQC B;  3EIJ A;  1UN8 A;  3QK0 A;  3MKQ A;  4I43 A;  3RRU A;  1PY1 A;  3CR3 A;  2C2L A;  2LNI A;  3HHM A;  4BX9 A;  1PAQ A;  4UWG A;  3FDH A;  5G55 A;  3VLF A;  3ZYQ A;  4FP7 A;  2AXU A;  4AOF A;  4L1B A;  1QQE A;  4B8A A;  4J0U A;  4K0R A;  4AEZ C;  1FCH A;  3G2W A;  1WAO 1;  3HDX A;  3MV2 B;  4B0Z A;  2AW6 A;  3FTY A;  2LSU A;  4CGW A;  2FUL A;  4IRU A;  5C2Y A;  1E7U A;  3MEK A;  3UUX A;  4FA6 A;  4B94 A;  1OUV A;  3IV0 A;  4OVV A;  4HOR A;  4ME2 A;  3UQ3 A;  4G26 A;  1H2T C;  2CHW A;  3JYS A;  2KZT A;  5BW8 C;  3CK8 A;  3QWW A;  4LRZ A;  4HLE A;  2IOS A;  2VSN A;  2X6K A;  5E76 A;  5BV1 A;  2X6F A;  4AXH A;  1HG5 A;  2WXH A;  3LXU X;  3FUN A;  4UWH A;  4EBA G;  1N54 A;  3OAW A;  4GML A;  4CGV A;  4FJZ A;  3FTU A;  2CFZ A;  3CKB A;  3D3M A;  3FP3 A;  4JHR A;  2XRZ A;  2VGX A;  1HG2 A;  3MKR A;  2MHK A;  3FTZ A;  3LY7 A;  5ARF A;  4D10 C;  3B7U X;  5FJY A;  2HO1 A;  1L5J A;  3PEU B;  4MKT A;  4V3I A;  2UY1 B;  3JQ0 A;  1MHQ A;  4IYP A;  4JHK A;  2XCC A;  3FTS A;  4JEH A;  4PS3 A;  1FVF A;  2CFU A;  3CVN A;  3HIZ A;  3LY8 A;  4F7A A;  5BT1 A;  1TEZ A;  3ZIM A;  1EYH A;  2GW1 A;  4XI0 A;  5T3R A;  5AEN A;  2Y4U A;  3FUL A;  3MGB A;  5D0O D;  4AY6 A;  3ZRH A;  3G2V A;  4FLB A;  4I1O B;  4DPR A;  4Y6C A;  1H2V C;  2WXQ A;  4Q96 A;  3ASF A;  2XRY A;  3U64 A;  4J8E A;  3BG1 B;  3FFL A;  3ZYK A;  2YIN A;  2KM4 A;  3CIA A;  4WUY A;  3JQ1 A;  2KCV A;  4WWN A;  2L9B A;  1SQM A;  4XIF A;  3NF1 A;  4I6E A;  2NXP A;  3MJW A;  3L08 A;  2C0L A;  1HE8 A;  4F53 A;  2AVP A;  3LCA A;  2VYI A;  4MLP A;  2WXP A;  1OWN A;  4UQY A;  3UMV A;  3RO2 A;  4I2W A;  4KZ0 A;  3PZD A;  4APO A;  4JC8 A;  1JWF A;  3G2T A;  1JWG A;  4R7L A;  4GYO A;  4LUN U;  4N3A A;  4L23 A;  3SFZ A;  3D9N A;  4JZY A;  3MKQ B;  3CQG B;  1NP7 A;  1BPO A;  2GRL A;  3MX3 A;  3RK6 A;  3QJZ A;  4JEU A;  3IHV A;  3ONK A;  4N3C A;  3EHM A;  3CHM A;  2UY1 A;  1XGW A;  3FEY A;  2XQ0 A;  4WNF A;  1UJK A;  1HO8 A;  1HXI A;  3UPV A;  4XKC A;  2J9Q A;  2JLB A;  2V0P A;  3PE4 A;  4Q69 A;  5DIZ A;  4N39 A;  2RD0 A;  5HQ8 A;  2OOE A;  4ACL A;  2WXN A;  2WM9 A;  3EJN A;  5JJ6 A;  2KCL A;  2KC7 A;  4J8D A;  4RG6 A;  4UQX A;  3NZS A;  2V8S E;  3CSF A;  4I2Z A;  3R9A B;  4GCN A;  3D9P A;  5FQ7 A;  2PQR A;  3LPZ A;  5J90 A;  1Z3X A;  3SI5 A;  4QFV A;  4A3V A;  5BUZ A;  3SZ7 A;  2V5F A;  3QAQ A;  4KXK B;  4PH4 B;  1Z6T A;  4FLH A;  2OV8 A;  3NQP A;  3S7D A;  4GMJ A;  4MS6 A;  5FWQ A;  3NZU A;  3U3W A;  3SF4 A;  5G05 J;  2V4L A;  5AYW D;  4JL0 A;  3CGH A;  2IOL A;  5HI7 A;  2OVB A;  1ZU2 A;  4AVX A;  4EZK A;  4MRU A;  5ANL A;  3UT4 A;  2WVI A;  5CCL A;  2VGX B;  1KT1 A;  3CVP A;  2UWJ G;  3PDN A;  5FZQ A;  2IU1 A;  4A1G A;  5FQ4 A;  4GB9 A;  3VLD A;  4BFR A;  4H7Y A;  3TJP A;  3GZ1 A;  1EDU A;  3Q4A B;  4IUL A;  4TUU A;  3U9W A;  4GZ5 A;  2KAT A;  3D9L A;  3PVL A;  3QWP A;  2NC9 A;  1DNP A;  3QDN A;  3RKV A;  1H6K A;  3U66 A;  3CKC A;  3OXL A;  1X5B A;  3SBS A;  4O6F A;  4KVM A;  2FEZ A;  1QZ2 A;  3UX4 A;  5A6C A;  3L54 A;  2ION A;  1HFA A;  3RIB A;  3TXM A;  3D9M A;  1W3B A;  4F1S A;  2Q7F A;  2LAI A;  4YND A;  3Q47 B;  2XHE A;  2ILR A;  5BPP A;  4N2S A;  3C98 A;  3PNT B;  4GA0 A;  4I17 A;  2WPV A;  4N2Q A;  3ZN3 A;  1NA3 A;  5JJ7 A;  5EX3 A;  5FQ8 A;  1MQS A;  1ZBP A;  3DPD A;  5ANR A;  4JVS A;  1KT0 A;  2VJ8 A;  3KEZ A;  4K03 A;  3MZL B;  4NUR A;  3PNL B;  5T4Y A;  4CT4 A;  3KAE A;  4DLQ A;  3AS5 A;  3E4B A;  3AU5 A;  3FTX A;  3APF A;  2BUG A;  1PC2 A;  3QKY A;  3EHN A;  2WMN A;  3ESL A;  4GA2 A;  3FUJ A;  3MYV A;  2BTD A;  4RVB A;  5LOZ A;  3VTX A;  3PRE A;  5FT9 A;  3ZPJ A;  4KZC A;  2PZI A;  3S7B A;  3LJ3 A;  4PS8 A;  4KT6 B;  1HH8 A;  3FTW A;  4HFG A;  3QAR A;  1H2U A;  1IQU A;  1Y8M A;  2EQX A;  2L6J A;  2YNQ A;  3TXN A;  3S2A A;  5JHA A;  2WXI A;  1DVP A;  3LVQ E;  3CVL A;  3G2U A;  3L17 A;  3LDZ A;  3R7R A;  2WXK A;  3FUE A;  1WY6 A;  3FWV A;  4CDN A;  2FF4 A;  2QFC A;  3ZVV A;  4CCA A;  4N5C A;  2L0I A;  4EQF A;  3KD7 A;  4XE0 A;  3RRN B;  2M63 A;  4PS7 A;  3AU4 A;  2XPZ A;  3FUH A;  2VSO E;  3FUK A;  3L6A A;  2I1K A;  4KMO A;  3I4R B;  4ILI A;  2L0T B;  3ZFW A;  4U07 A;  2AXV A;  2PL2 A;  2Y4T A;  3SD5 A;  4G23 A;  1TJF A;  2I2O A;  3APC A;  4U0Z A;  2GGF A;  4NAC A;  2QY7 A;  2LAH A;  4UWL A;  3FUI A;  3S7J A;  1SZA A;  3LVR E;  1U3C A;  3FU3 A;  4XKB A;  3TAX A;  1TJC A;  4TV3 A;  3GW4 A;  3RO3 A;  3OXG A;  4GA1 A;  4FU3 A;  2WQH A;  4J6I A;  3CK9 A;  1QNF A;  1SZ9 A;  4J8S A;  2I1J A;  3CLJ A;  2X6J A;  2IFU A;  2NSZ A;  4DJA A;  4GYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...