3U4TA

Crystal structure of the c-terminal part of the tpr repeat-containing protein q11ti6_cyth3 from cytophaga hutchinsonii. northeast structural genomics consortium target chr11b.
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
258
structure length
258
Chain Sequence
VEFRYADFLFKNNNYAEAIEVFNKLEAKKYNSPYIYNRRAVCYYELAKYDLAQKDIETYFSKVNATKAKSADFEYYGKILMKKGQDSLAIQQYQAAVDRDTTRLDMYGQIGSYFYNKGNFPLAIQYMEKQIRPTTTDPKVFYELGQAYYYNKEYVKADSSFVKVLELKPNIYIGYLWRARANAAQDPDTKQGLAKPYYEKLIEVCAPGGAKYKDELIEANEYIAYYYTINRDKVKADAAWKNILALDPTNKKAIDGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TPR repeat-containing protein
publication title Crystal Structure of the C-terminal part of the TPR repeat-containing protein Q11TI6_CYTH3 from Cytophaga hutchinsonii.
rcsb
source organism Cytophaga hutchinsonii
molecule tags Structural genomics, unknown function
total genus 95
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07719 TPR_2 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3u4tA00
3RO2A 4AM9A 3K9IA 4N3BA 1XNFA 2ONDA 4KBQA 3QDNA 3URZA 4G1TA 3UQ3A 4UI9J 1FCHA 2C0MA 3Q47B 5D0QD 2OOEA 3ZN3A 4YVQC 3LY9A 3UPVA 2C0LA 3GW4A 2MHKA 1HZ4A 1OUVA 3LYAA 2IFUA 3CVLA 2FI7A 4GPKA 5JJ7A 2LNIA 2XEVA 3FP3A 4I9EA 5KJNA 4G26A 4GYOA 2NC9A 4N3CA 3PE3A 3MEKA 3LY7A 5CCLA 2R5SA 3N71A 3LY8A 4BT9A 1W3BA 4UQYA 1IYGA 4Y6CA 4GYYA 4RG9A 2BUGA 2XGOA 3CK8A 4H7XA 3AS8A 3EDTB 2UY1B 4GA1A 3MA5A 5FZRA 2GW1A 2KCVA 4WNEA 4I17A 4NQ0A 2XCCA 5FT9A 4JL0A 5G05J 3OXGA 3ZGQA 5EKQD 2J9QA 3FFLA 4G25A 3LPZA 4BTBA 3CVQA 2FEZA 4HORA 5A6CA 3S7FA 2VGYA 5FZSA 4I1AA 2UWJG 5D0OD 3CVNA 3AS4A 1KLXA 4YNDA 4U07A 4F3VA 4GCNA 4O6FA 3QWWA 2VGXA 4W9RA 4KXKB 4I9CA 5HI7A 1ZBPA 4BTAA 5C1DA 2DBAA 5ARGA 3LCAA 4JA7A 4N3AA 4KYOB 2VSYA 4AY5A 5EX3A 4J8EA 3QOUA 1TJCA 2FBNA 3U3WA 4IN3B 2KCLA 3CKBA 3TAXA 3ZFWA 5LCWC 4UQZA 2PL2A 3RIBA 3QWPA 3PE4A 4H7YA 4HOQA 5M72A 3CK9A 3O48A 5BW8C 2E2EA 4YVOA 2VQ2A 2HYZA 3ASFA 4WNFA 3ZHEA 5KJMA 2XPIA 4JHRA 2LSVA 2KC7A 3IEGA 5FTPA 3S7BA 3ASHA 3NF1A 4WNGA 5A7DB 3CV0A 3ASDA 4XIFA 2PQRA 4GYWA 3VTXA 4JA9A 4U0SA 3KD7A 2VYIA 5KJKA 3HYMB 2FF4A 5JJ6A 2YQ8A 1WAO1 3MV3B 2XGMA 2WPVA 4CDRA 2LSUA 3RJVA 2Q7FA 1QQEA 2AVPA 2VSNA 4HOTA 5DBKA 2KCKA 2XGSA 3JYSA 3UUXA 4N2SA 3QWVA 3PDNA 3ZPJA 4Y6WA 2L6JA 3QKYA 3KAEA 4J8FA 3ULQA 4LEUA 2IF4A 4U0UA 5LCWJ 4N39A 1KT1A 3TG5A 3CK7A 4UQXA 4WNDA 1HH8A 5BNWA 3GZ1A 3E4BA 2YHCA 1P5QA 5AYWD 4B94A 3KS2A 1E96B 1KT0A 4APOA 3Q49B 4HOSA 1ELWA 3ZHEB 1B89A 2Y4UA 5EX0A 3TGOA 1PC2A 5BT1A 1IHGA 4ABNA 3Q5MA 4UI9K 3SZ7A 2KATA 2FO7A 4NRHB 3VTYA 3ESKA 1HXIA 4RG6A 3FWVA 4GA2A 4N5CA 1NA3A 2C2LA 3LKUA 5G04C 4A1SA 4XI0A 4GZ6A 5HQ8A 3Q4AB 3GYZA 1YA0A 1WM5A 3R9AB 1NZNA 4WUYA 1NA0A 4BT8A 3MV2B 4J8DA 3CEQA 3BEEA 3GZ2A 4UI9C 3CVPA 3S7JA 5FJYA 2PQNA 3MKRA 5DIZA 4U0ZA 2HR2A 4U04A 2VGXB 1ZU2A 1QZ2A 3CKCA 4I2ZA 3OXLA 4XI9A 4BWRA 3U4TA 2XCBA 2PZIA 2V5FA 2P58C 4CGWA 4GCOA 5FZQA 4G24A 1ELRA 3SF4A 5CHEE 2I6HA 3WXXA 3S7DA 1A17A 4GZ3A 2QFCA 4GA0A 5CCMA 4N2QA 4EQFA 3AS5A 2Y4TA 3RKVA 4I2WA 4ME2A 5KJLA 3OXFA 1Y8MA 4J0UA 4CGVA 5G04J 5ARFA 4G2VA 2WQHA 2UY1A 4HOUA 3ASGA 3Q15A 4GZ5A 5JJTA 3TG4A 4AY6A 4AIFA 2HO1A 5G05C 4G23A 3RO3A 2JLBA 3RU0A
chains in the Genus database with same CATH superfamily
3CVWA 3RO2A 4AM9A 4WWOA 3K9IA 1H6KA 3EIJA 4BETA 4CCAA 4G11A 3FEXA 4G8LA 2WXFA 3UQ3A 2H6HA 3QB2A 3Q47B 3I5PA 2OOEA 4ATZD 3LY9A 3UPVA 1N11A 2C0LA 4J8YA 4BERA 1DNPA 1MJ0A 1UW4B 4DK5A 2FI7A 4TUUA 5JJ7A 4A3TA 2VTBA 1N54A 2XEVA 4YDWA 3FP3A 4G26A 3JXIA 2XEHA 2OV8A 3L22A 4EBAA 3T9KA 3LY7A 2E0IA 2X38A 3PNTB 2CHXA 4MS6A 2DVWA 2PM6A 2F37A 3LJ3A 3PRZA 3C98A 1JWGA 4XE0A 5ENQD 3CK8A 3I4GA 3BU8A 4H7XA 1O1RA 3AS8A 4Q96A 5FZRA 3IHYA 4J7WA 3MYVA 3UTMA 3T8MA 1TNOA 1SA5A 4QFVA 4JXTA 2EIME 3KEZA 4HI8A 1H2TC 3RRNB 4GB9A 5G05J 3ZGQA 2J9QA 3B7SA 4PS8A 3C3QA 4G25A 2DCPA 4ACKA 1N0RA 3ZU7B 3CVQA 2DIWA 3GZSA 5CBNA 2VSOE 2IEJA 3JCKC 1N4RA 1O1SA 3VLDA 4KT6B 5FZSA 3MGBA 4FHJA 4DX7D 3EUVA 3D9PA 3G2WA 1KLXA 2Y3AA 4JC8A 4YNDA 4BX9A 4U8VD 1TN6A 4FP7A 1OWNA 4GCNA 5KNHD 3QWWA 3CHRA 2XZTG 4W9RA 1AWCB 1SQMA 2OEWA 3ML9A 1BD8A 4BTAA 1ELKA 3CLJA 1H6PA 4HRNA 3KSLA 4JA7A 4N3AA 4HBDA 4FLBA 4PDXA 4WAFA 1S70B 1UJJA 4J8EA 3QOUA 3TAXA 3ZFWA 1OT8A 3E37A 2PL2A 3QWPA 4BESA 3FH5A 2XPYA 5M72A 5BW8C 3PS6A 2VQ2A 1UJKA 2HYZA 1LF8A 5KJMA 4NURA 2JEKA 2I1KA 2GRPB 4JHRA 2LSVA 5FTPA 2CHZA 3AG3E 3S7BA 3ASHA 3G2SA 1TYQG 2ZIRA 2WXLA 2PQRA 4JA9A 3KD7A 2VYIA 4NIKA 3HYMB 2FF4A 2XENA 3AG1E 4RSYA 3HVEB 5HS0A 4GTRA 4GMLA 4RLYA 1N94A 5B1AE 4GZDA 2ZU6B 4UWHA 2AVPA 3HXDA 3SFYA 4A3VA 4X8QA 1NFIE 5DBKA 5KCMA 3QWVA 3ZXSA 2MYOA 4CDNA 3QKYA 4L7TA 5B1BE 2X6HA 1Y6IA 2IF4A 1INZA 3FTWA 3HXFA 4U0UA 3OTNA 3CK7A 3E32A 3SBTB 5EYPF 2WQ6A 5CMWA 2RFMA 2RFAA 3E4BA 2WB2A 1TEZA 3EHRA 1D8EA 5AYWD 3KS2A 3ZKJA 1FVFA 4APOA 2YINA 2KZTB 1LD8A 3ZHEB 3BUAA 3FH8A 2J8SD 1SVXA 4B89A 1SA4A 1JWFA 1OY3D 3V31A 4DX1A 2B0OE 2DZNA 4YDOA 2RG8A 4HVBA 3G2UA 5LOZA 4ABNA 3Q5MA 1E7VA 5BUZA 3MKQA 2WVIA 1OWMA 3BG0B 4OAVB 4RG6A 3FWVA 4GA2A 2Y69E 2ZGDA 3L17A 2C2LA 3Q7AA 3SD5A 4A1SA 4LG6A 5ITZF 3Q4AB 3GYZA 4OVVA 2IOSA 1WM5A 3R9AB 4BSXA 5EIBE 1BU9A 1NZNA 4K5CA 5D66A 1WDYA 2XZDG 1Z3XA 2EQXA 2EINE 2PNNA 4HI9A 4CZ2D 3DSXA 3UXGA 3QAQA 5AQAA 3D9NA 2LUHA 4L2YA 4O1PA 4LUNU 3DPYA 4K5AB 3MZLB 1N0QA 3O4ZA 3B95A 4CYMD 4U0ZA 4EZKA 5EILA 3QC1A 1ZU2A 3CKCA 3ZNGA 3UIPC 4XI9A 3U4TA 4LNGA 3FUHA 1TNYA 4GCOA 4A1GA 4G24A 5EN5D 3PZDA 1ELRA 4GAAA 4KZCA 4GZ3A 5LP0A 2VJ8A 1K3ZD 3SBSA 5CCMA 4DPRA 5E76A 4EQFA 2NXPA 3AS5A 3APDA 4UWGA 1N52A 3RKVA 4ME2A 3CSTA 3E30A 5FQ6A 5KJLA 4EBAG 1MX2A 1Y8MA 4HRMB 1BLXB 5ARFA 4HOUA 3TXNA 2L0IA 3Q15A 4J6IA 3TG4A 2Y0BG 1FVHA 4AIFA 2I2OA 1X81A 4G23A 2X6FA 4DX2A 4JD2G 3MCXA 3RU0A 4EPZA 2WXHA 1N4SA 2ONDA 4KBQA 3ZRHA 3QDNA 2LXMA 3U9WA 3URZA 2WXKA 3NZSA 3PZ1A 4G1TA 5BXOA 4MLPA 1EDUA 2C0MA 5CEDB 1E8XA 4M7CA 5D0QD 4YVQC 2R02A 3GW4A 4JEHA 3UKRG 3CR3A 2MHKA 1HZ4A 1OUVA 3FUIA 3LYAA 5JHAA 2IFUA 4DI4A 3CVLA 1U3DA 1OCRE 1JUQA 4N3CA 1TR4A 3PE3A 2CFZA 4R7LA 5AN8A 5B3SE 4YDYA 3AAAC 3TXMA 3LY8A 3AU5A 3TWUA 4UQYA 3EHQA 2WXJA 4Y6CA 3ZYMA 3G2VA 3NZUA 2XGOA 2F8XK 3AJIA 3UM0A 3E34A 4XX5A 3DBSA 3SQVA 2AWIA 4K0RA 3EDTB 2UY1B 4GA1A 4I6GA 2ZXWE 4WNEA 3EJNA 2GROB 2QC9A 4F7AA 1EYHA 3OXGA 1OWPA 4JHKA 4XKCA 1MX6A 4TXPA 2I1JA 4AXHA 4GMRA 3LVRE 3S7FA 2XRYA 1HF8A 2P9LG 3D9OA 4MBGA 4I1AA 1H0AA 1N4QA 4K03A 4CT4A 1H2VC 3HVEA 4C0EA 5ENNA 3CHOA 4F3VA 2GRNB 2VGXA 1N9AA 4KXKB 2LXLA 1IKND 2P9UG 2RD0A 3UT8A 4GTTA 1E8ZA 4IYPA 5ARGA 3TWQA 2VSYA 2P9PG 1YMPA 3ENEA 1H6OA 2YNQA 1TJCA 3LJNA 5D2MC 2KCLA 3CKBA 4HS2A 5LCWC 2B6CA 4UQZA 2NYJA 2OVFA 4HRLA 1JPLA 3IV0A 4AVXA 3HXBA 2E2EA 2KZTA 2P9SG 4ATGA 3ASFA 4WNFA 1V55E 3ZHEA 3FEYA 3J5PA 4GZCA 5AENA 2YHEA 2V4HC 5A7DB 3FUDA 4N5QA 3UMVA 5ENPD 3ASDA 4XIFA 3PEVB 4U0SA 3ABLE 3VLEA 4C9BB 5JJ6A 5CERB 3MV3B 2XGMA 1BI7B 4CDRA 1Z5SC 2OEVA 5FQ8A 2X3MA 4URKA 2A5UA 3CQGB 4OYSA 5CBOA 3UUXA 4B93B 2V0PA 3C5RA 3APCA 3PNLB 2IJGX 4PH4B 3FH7A 1O5MA 3ASNE 4LERA 1HO8A 3JXJA 4ZFHA 4DLOA 2AW6A 4B0ZA 4HXIA 2V4LA 2MRIA 5LCWJ 1KT1A 3TG5A 2ETAA 4F1PA 4WNDA 2V8SE 3DSTA 3DSWA 3GZ1A 1PY1A 5LX8A 4CEMA 4U8HA 3EU9A 1KT0A 4HOSA 3HRAA 3HXCA 1ELWA 1MQSA 3X2QE 4CDMA 2KBXA 2Y4UA 4I1OB 2L6BA 3Q73A 2QYJA 3FUFA 3TGOA 1DCEA 4FJYA 1HG5A 4XZ4A 2P2CP 1PC2A 5BT1A 1IHGA 4GTVA 4UI9K 2KATA 2FO7A 1TNUA 3W9GA 2CG2A 2WXGA 2EIKE 4NRHB 4I6EA 3B7TA 3E33A 1S0PA 2P9NG 4RQIA 3SI5A 3LKUA 5AARA 3ASOE 4XI0A 5ANLA 1E90A 4GZ6A 3TJPA 4XEIG 2AJAA 3C3OA 5H7PA 4ILIA 3IXEA 1NA0A 3IKOB 3L16A 5EDSA 4J8DA 3DWLG 4DX5D 4FJZA 3QARA 3P1UA 3T8KA 1HG2A 3GZ2A 4UI9C 2H6FA 3DSVA 1KZPA 3D9IA 2XS1A 5AIJA 1QYMA 4TV3A 5C2YA 3MKRA 1K8KG 5DIZA 2VGXB 1QZ2A 3SY2A 2WMOA 1QBQA 2WXRA 3C72A 3L13A 2GRLA 1JCQA 4BWRA 4GTPA 2XCBA 2PZIA 2LO6A 3LEWA 4UUCA 3CGHA 2P58C 5FZQA 3V2OA 2J4BA 3VLFA 4J8SA 2IONA 3PUJA 4JVSA 4JZYA 3RSEG 1FT2A 1SZAA 2I6HA 3WXXA 2QFCA 1MX4A 2A4ZA 4N2QA 5AJLA 2WXNA 4U8YD 1GW6A 1N95A 1HS6A 4BFRA 4I2WA 4EHMA 3NBNB 3ZUVB 4L2LA 4J0UA 2MOWA 2UY1A 2JABA 3CVUA 4ANUA 5JJTA 5BV1A 4AY6A 3R7QA 3FU6A 3CHSA 3CQCB 4U7EB 4AOFA 1UOHA 1XNFA 3FTUA 5ENOD 3LDZA 1MHQA 3UT7A 4UI9J 1FCHA 1IXVA 4GTQA 1SW6A 3SFZA 3UI2A 3ZYLA 4Z68A 5E75A 1H2UA 3D9KA 4EZJA 4GPKA 4ZHBA 2F0YA 4GYOA 4L23A 2J4DA 1Q2ZA 2R5SA 4O60A 4BT9A 2I9CA 4RG9A 3PZ2A 3CIAA 3MA5A 3NB2A 4D10C 4NQ0A 3L08A 2R17C 1D9SA 5FT9A 1OXJA 4OVUA 4JL0A 2WMNA 2EIJE 3ESLA 4JPSA 2CHWA 2IOLA 4HORA 2BTDA 1WG0A 4MRUA 1VDYA 2VGYA 4DRXE 4BEPA 2DYRE 2R03A 3CVNA 4ANWA 3UM2A 2L0TB 5CECB 2R2LA 2X6KA 1NL4A 4I43A 4L1BA 4O6FA 3T5XA 3B7UX 1S63A 4AV7A 4I1MA 4U95D 5HI7A 3QNKA 3HIZA 5HKPA 4DJAA 2QY7A 3ZEFA 2DBAA 3B13A 1TN8A 2XS8A 3LCAA 5ENTD 5EX3A 3PUKA 1NP7A 1QNFA 4NACA 3DEOA 3I4RB 3SNXA 5JMND 3JUEA 3FTYA 3EHNA 3DSUA 3P2BA 5T8IA 2EILE 5AAOA 4H7YA 4HOQA 3CK9A 3O48A 2M63A 5AQBA 4KMOA 2KC7A 3ONLA 4DLQA 4WNGA 4UWLA 4APFA 4HLLA 5AQ9A 4M3OA 4GYWA 3Q7FA 3VTXA 1OCOE 3APFA 3TWXA 2YQ8A 3U66A 4FULA 5G2NA 1E8YA 2HM8A 2FO1E 2LSUA 4Q69A 2Q7FA 2ETCA 3F6QA 1QQEA 2WXPA 3UT4A 4HLEA 2IO2C 3ISMC 3PDNA 3L82A 3ZPJA 3DRAA 2L6JA 3PREA 4GTSA 3FTSA 4U96D 4J8FA 5CEAA 3ULQA 3AU4A 1E7UA 4JHJA 4IULA 4WWNA 5IY5E 2RKKA 4UQXA 3L9TA 1HH8A 5A23A 2DYSE 1KPSB 1XGWA 3CHPA 4LNUD 1E96B 4DI3A 5ENSD 3Q49B 4TUMA 2Y1LE 3FU3A 4CT0A 4HNAD 3AG4E 4FHKA 1ZB1A 2IU1A 4OAUC 4G8KA 2HE0A 3ABKE 4TXQA 3MX3A 2QZAA 1X5BA 2XEEA 3TWSA 3OAWA 4KVMA 1HXIA 3TWVA 3BQOA 3FULA 1TNBA 3ABME 5ANRA 5G04C 4GU5A 3FU5A 1OWLA 4GMJA 1K1BA 4FADA 1HX8A 3TWRA 3V30A 4XKBA 3L54A 2WM9A 4FC8A 4HFGA 1LTXA 4A63B 4LRZA 1S64A 3CEQA 2WXIA 3BEEA 3SGHA 3AG2E 3HHMA 3FTXA 1K1AA 4LNBA 4E6HA 1BI8B 5BPPA 3LVQE 1MZCA 3FUKA 3CVVA 4LSZE 3IBEA 3KEAA 5FQ4A 4FA6A 2BF0X 3UINC 4AP2A 2AXVA 4MKTA 3NOCD 5LFAA 3CVYA 3W9FA 1H19A 3SF4A 3ZW3A 3S7DA 1A17A 4GA0A 3HXEA 4ANVA 1UN8A 5T3RA 1O1TA 1IQUA 4F6RD 2KXPC 2KM4A 2IY0C 3OXFA 4CGVA 5G04J 1UN9A 4IRUA 1Z6TA 2J49A 2WQHA 3JQ0A 3C3RA 4GZ5A 3R7RA 2L9BA 2OCCE 2HO1A 2VGEA 3RO3A 4C0MA 1RZ4A 4BY6A 1UG3A 4N3BA 1DC2A 4K5BA 3I3NA 3ULYA 1EF1C 1MYOA 4B8CB 3ZN3A 3PVLA 3IHVA 4BSZB 2ETBA 4GTOA 4P29A 3BG1B 3RAUA 4KZ0A 2ZGGA 4UWKA 2LNIA 5T4YA 4WWPA 4I9EA 5KJNA 2NC9A 2FULA 3Q78A 2F8YA 3MEKA 5CRVA 5CCLA 3N71A 1HU3A 4QQIA 2J07A 2GRRB 1W3BA 1IYGA 4GYYA 1V54E 3FTVA 2BUGA 2XRZA 3T5VA 4PUCA 4GPMA 3RRUA 5HRYA 1DVPA 4UWFA 5JHBA 1AP7A 2GW1A 3PZ4A 4YDEA 2XPZA 2KCVA 4DUIA 4I17A 3LS8A 2P9KG 2XCCA 3FUMA 3NAWA 5ENRD 5EKQD 3FFLA 3DXMG 3LPZA 4BTBA 1TJFA 1JCRA 2FEZA 4TRQA 2DWZA 4HQDA 5A6CA 4RVBA 3ZVVA 3DXKG 3RRMB 2WQ7A 2UWJG 1IHBA 5D0OD 4EZLA 4O1OA 5J08A 2XQ0A 3AS4A 3SFXA 3KSQA 4U07A 4Q94A 4PS7A 3CHMA 4I9CA 3V2XA 1ZBPA 2VTBB 4U63A 5C1DA 4ACLA 3FUJA 4BX8A 3RK6A 1HE8A 2QYUA 3HG0D 4KVOA 3QK0A 4KYOB 1SZ9A 4AY5A 1YCSB 3WG7E 4JEUA 2FBNA 2LAHA 3U3WA 4IN3B 4I6JA 1HFAA 1U2VG 3RIBA 4CRWA 5J90A 3PE4A 2GRMA 2GRQB 3ZIMA 4YVOA 3FY4A 3ZYQA 2R05A 5FWQA 2XPIA 4FU3A 3TL5A 1L5JA 3IEGA 3DPDA 5KWDA 1KZOA 3B7RL 3NF1A 1NI1A 2GGFA 1TN7A 3CV0A 3DSSA 5KBAA 3NQPA 3ZYKA 1D8DA 4C48B 5KJKA 4A55A 2OVBA 3UM1A 5FQ7A 1N4PA 1WAO1 2BKGA 3UX4A 2WPVA 3RJVA 2AXZA 2VSNA 2WXMA 3TWWA 4HOTA 4PS3A 3ONKA 3EU5A 3Q75A 3SHFA 2KCKA 4JB8P 5AJDA 3ZXPA 4F1SA 2XGSA 3JYSA 5CRUA 4ANXA 4N2SA 5EIDA 1LD7A 2WXOA 4ILGA 4Y6WA 2IO3C 5JA4D 3KAEA 4DX6D 4GTMA 3UKUG 4LEUA 2VSXE 4B8AA 3G2TA 2IQCA 3J5QB 2ZISA 3JUIA 3PZ3A 4EECA 4N39A 2BEDA 5BNWA 5CMYA 4AEZC 4E85A 3R9MA 2YHCA 2J09A 1P5QA 5FINA 3B7BA 4V3IA 4B94A 5AQ7A 2A5EA 4JW1A 3FUNA 4HB5A 1JCSA 3V79K 1B89A 5FIOA 3CHQA 1A5EA 5EX0A 3Q9UC 2X6IA 3FUEA 3DEPA 3SZ7A 4F53A 4LCTA 3S2AA 3ULEG 3VTYA 3ESKA 3U64A 2NSZA 3PH0C 3QJZA 3NOGD 3D3MA 4N5CA 1NA3A 5KNGA 4AJWA 2J08A 2LAIA 3L6AA 2PM7A 1PAQA 3JQ1A 1EPUA 3ML8A 5HQ8A 3Q9NC 5BV0A 1YA0A 3CVXA 3PEUB 3FU0A 3D9JA 1FT1A 3D9HA 2CFUA 2AXUA 4WUYA 1DCQA 1TNZA 4BT8A 3UM3A 2BKKB 3MV2B 2H6GA 4ILHB 2P9IG 4TXRA 3SO8A 3CVPA 3S7JA 5FJYA 2PQNA 1G3NB 3CSFA 1BPOA 1FPPA 3MJWA 2HR2A 4U04A 3HDXA 3EIQC 1Z3YA 3Q79A 4I2ZA 4L9PA 3OXLA 1WY6A 3TWTA 2CG3A 5EYLA 1RW2A 2V5FA 4CGWA 3D9LA 2H6IA 4FLHA 1OCZE 2WXQA 5CHEE 2XHEA 3FHEA 3MKQB 5G55A 2Y4TA 1IQRA 1OWOA 2R59A 2DZOA 3EHMA 1YYHA 3FTZA 1E8WA 4G2VA 3ASGA 2ILRA 1U3CA 2V5QC 3D9MA 5BXUA 3UIOC 1OCCE 5G05C 3LXUX 2X6JA 2JLBA 3FDHA
chains in the Genus database with same CATH topology
3CVWA 3CQCB 3RO2A 4AM9A 1UG3A 4WWOA 4AOFA 4BY6A 2WXHA 4EPZA 3K9IA 4N3BA 1XNFA 1H6KA 2ONDA 3EIJA 4KBQA 3ZRHA 4CCAA 3FTUA 3QDNA 4G11A 3FEXA 3LDZA 3I3NA 3U9WA 2WXFA 3URZA 1EF1C 2WXKA 3NZSA 4G1TA 1MHQA 3UQ3A 3UT7A 4MLPA 4UI9J 1EDUA 1FCHA 2C0MA 4B8CB 3QB2A 1E8XA 3Q47B 3I5PA 2OOEA 5D0QD 3ZN3A 3PVLA 3SFZA 3ZYLA 4YVQC 3LY9A 3IHVA 3UPVA 5E75A 2C0LA 3GW4A 4JEHA 1H2UA 3CR3A 2MHKA 1DNPA 1HZ4A 1OUVA 3FUIA 3LYAA 1UW4B 5JHAA 4P29A 2IFUA 4DK5A 3BG1B 4DI4A 3D9KA 4KZ0A 3CVLA 1U3DA 4EZJA 2FI7A 4GPKA 4TUUA 5JJ7A 4A3TA 2VTBA 4UWKA 2LNIA 1N54A 5T4YA 2XEVA 4WWPA 3FP3A 4I9EA 1JUQA 5KJNA 4G26A 4GYOA 4CGVA 2NC9A 4L23A 2FULA 4N3CA 2OV8A 3L22A 3PE3A 3MEKA 4EBAA 2CFZA 3LY7A 4R7LA 2J4DA 2E0IA 2X38A 3PNTB 5CCLA 2CHXA 2R5SA 4MS6A 3N71A 1HU3A 3TXMA 2J07A 3LY8A 4BT9A 3AU5A 2I9CA 2PM6A 1W3BA 4UQYA 1IYGA 3LJ3A 2WXJA 3PRZA 4Y6CA 3C98A 3ZYMA 4GYYA 4RG9A 3G2VA 3NZUA 1JWGA 3FTVA 4XE0A 2BUGA 2XRZA 2XGOA 3T5VA 3CK8A 3I4GA 4PUCA 4H7XA 3RRUA 4XX5A 3DBSA 1DVPA 3AS8A 4UWFA 3CIAA 2AWIA 4Q96A 4K0RA 5JHBA 3EDTB 2UY1B 4GA1A 3MA5A 5FZRA 2GW1A 4I6GA 3IHYA 2XPZA 2KCVA 3MYVA 3T8MA 4D10C 4WNEA 4I17A 3EJNA 4NQ0A 3L08A 2R17C 3LS8A 4QFVA 2XCCA 3FUMA 4JXTA 3KEZA 5FT9A 4OVUA 1H2TC 4JL0A 3RRNB 4F7AA 4GB9A 5G05J 1EYHA 3OXGA 3ZGQA 5EKQD 2J9QA 3B7SA 2WMNA 3FFLA 4PS8A 3ESLA 1OWPA 4G25A 2DCPA 4JHKA 3LPZA 4XKCA 4ACKA 4BTBA 4JPSA 2CHWA 2IOLA 1TJFA 3CVQA 2DIWA 2FEZA 2I1JA 4TRQA 3GZSA 4HORA 2BTDA 2VSOE 5A6CA 4MRUA 4AXHA 3JCKC 3LVRE 3S7FA 4RVBA 1VDYA 2VGYA 2XRYA 3ZVVA 1HF8A 3VLDA 3D9OA 3RRMB 4KT6B 5FZSA 2WQ7A 4I1AA 2UWJG 1H0AA 5D0OD 3MGBA 4FHJA 4EZLA 4K03A 4CT4A 5J08A 1H2VC 2XQ0A 3CVNA 3D9PA 3G2WA 3AS4A 3HVEA 4ANWA 4C0EA 1KLXA 2L0TB 2Y3AA 4JC8A 4YNDA 4BX9A 2X6KA 5ENNA 3CHOA 4U07A 4I43A 4FP7A 4L1BA 1OWNA 4Q94A 4F3VA 4GCNA 4O6FA 3T5XA 3QWWA 3CHRA 2VGXA 3B7UX 4W9RA 4PS7A 4AV7A 4I1MA 3CHMA 4KXKB 4I9CA 5HI7A 1SQMA 3ML9A 3QNKA 1ZBPA 2VTBB 4BTAA 1ELKA 3CLJA 3HIZA 4U63A 4DJAA 5C1DA 2QY7A 3ZEFA 2DBAA 3B13A 2RD0A 3UT8A 3FUJA 1E8ZA 4ACLA 4BX8A 4IYPA 1HE8A 5ARGA 3RK6A 3LCAA 4JA7A 4N3AA 4FLBA 4KVOA 3QK0A 4PDXA 4WAFA 4KYOB 2VSYA 1SZ9A 4AY5A 5EX3A 1UJJA 4J8EA 3PUKA 3QOUA 3ENEA 1NP7A 2YNQA 1TJCA 1QNFA 4JEUA 4NACA 2FBNA 2LAHA 3U3WA 4IN3B 2KCLA 3CKBA 4HS2A 4I6JA 3I4RB 3SNXA 3TAXA 3ZFWA 3FTYA 1HFAA 5LCWC 3EHNA 3P2BA 4UQZA 5T8IA 2OVFA 1JPLA 2PL2A 3RIBA 4CRWA 3QWPA 5J90A 3PE4A 3FH5A 2GRMA 4H7YA 2XPYA 4HOQA 3IV0A 5M72A 3CK9A 3O48A 5BW8C 3PS6A 3ZIMA 4AVXA 2E2EA 4YVOA 2KZTA 3FY4A 2VQ2A 1UJKA 2HYZA 4ATGA 3ZYQA 3ASFA 4WNFA 1LF8A 2M63A 3ZHEA 4KMOA 5KJMA 5FWQA 4NURA 2JEKA 2XPIA 3FEYA 4FU3A 2I1KA 3TL5A 4JHRA 2LSVA 1L5JA 2KC7A 3DPDA 3IEGA 4GZCA 5AENA 2YHEA 3B7RL 3ONLA 5FTPA 4DLQA 2CHZA 3S7BA 3ASHA 3G2SA 3NF1A 4WNGA 5A7DB 3FUDA 4UWLA 4APFA 2GGFA 3CV0A 3UMVA 3NQPA 3ZYKA 4M3OA 3ASDA 4XIFA 2WXLA 2PQRA 4GYWA 3VTXA 4JA9A 3PEVB 4U0SA 3KD7A 3APFA 2VYIA 5KJKA 4A55A 3HYMB 3VLEA 2OVBA 2FF4A 5JJ6A 2YQ8A 4C9BB 5FQ7A 4RSYA 3U66A 3HVEB 1WAO1 4FULA 5G2NA 1E8YA 2HM8A 4GMLA 3MV3B 2XGMA 3UX4A 2WPVA 4CDRA 2LSUA 4GZDA 3RJVA 4Q69A 2Q7FA 1QQEA 2ZU6B 4UWHA 2WXPA 2AXZA 5FQ8A 3UT4A 2AVPA 2VSNA 4A3VA 2WXMA 4HOTA 4HLEA 2X3MA 4PS3A 5ARFA 3ONKA 5DBKA 3SHFA 2A5UA 2KCKA 5AJDA 4F1SA 4URKA 2XGSA 3JYSA 3CQGB 4OYSA 5KCMA 4ANXA 3UUXA 4N2SA 3QWVA 3PDNA 3ZXSA 2V0PA 3ZPJA 2WXOA 3APCA 4ILGA 2L6JA 3PNLB 4Y6WA 3PREA 2IJGX 4CDNA 4PH4B 3FH7A 3QKYA 4L7TA 3KAEA 2X6HA 3FTSA 4LERA 4J8FA 3ULQA 1Y6IA 1HO8A 4LEUA 4DLOA 2AW6A 2VSXE 2IF4A 4B0ZA 4B8AA 3FTWA 3G2TA 1INZA 2IQCA 3AU4A 4HXIA 4U0UA 2V4LA 1E7UA 4JHJA 4IULA 3JUIA 2MRIA 4EECA 3OTNA 4N39A 5LCWJ 1KT1A 4WWNA 3TG5A 3CK7A 3SBTB 4UQXA 4WNDA 1HH8A 5A23A 2V8SE 5BNWA 2WQ6A 5CMYA 4AEZC 4E85A 5CMWA 1XGWA 3GZ1A 3E4BA 2WB2A 2YHCA 2J09A 1TEZA 1PY1A 1P5QA 5LX8A 4CEMA 4U8HA 3CHPA 4V3IA 5AYWD 4B94A 3KS2A 1E96B 1KT0A 1FVFA 4DI3A 4APOA 2YINA 3Q49B 4JW1A 2KZTB 4HOSA 3FU3A 3FUNA 1ELWA 1MQSA 4CDMA 4CT0A 3ZHEB 1B89A 3FH8A 2Y4UA 4B89A 1JWFA 3CHQA 4I1OB 4FHKA 3FUFA 5EX0A 3TGOA 4FJYA 1HG5A 2IU1A 4XZ4A 2RG8A 4HVBA 2X6IA 3FUEA 1PC2A 5BT1A 1IHGA 3G2UA 5LOZA 4ABNA 3Q5MA 3MX3A 4UI9K 3SZ7A 2KATA 1E7VA 4F53A 3MKQA 5BUZA 2FO7A 1X5BA 2WVIA 3OAWA 1OWMA 4LCTA 2CG2A 2WXGA 3S2AA 4NRHB 4I6EA 4KVMA 3VTYA 3B7TA 3BG0B 1S0PA 3ESKA 1HXIA 3U64A 2NSZA 4RG6A 3FWVA 3PH0C 4GA2A 3L17A 3QJZA 3D3MA 4N5CA 1NA3A 2C2LA 3FULA 3SI5A 4AJWA 3LKUA 5ANRA 5G04C 2J08A 3SD5A 2LAIA 4A1SA 4GU5A 3L6AA 3FU5A 1OWLA 4XI0A 2PM7A 4GMJA 5ANLA 1E90A 1PAQA 3JQ1A 4GZ6A 1EPUA 3ML8A 5HQ8A 4FADA 3TJPA 3Q4AB 1HX8A 3GYZA 4OVVA 5BV0A 1YA0A 1WM5A 2IOSA 4XKBA 3R9AB 3L54A 4BSXA 3CVXA 1NZNA 3PEUB 3FU0A 3D9JA 2WM9A 4FC8A 4ILIA 2CFUA 1Z3XA 2EQXA 4HFGA 2AXUA 4WUYA 1NA0A 3IKOB 4BT8A 3L16A 3MV2B 4LRZA 5EDSA 4J8DA 4ILHB 4FJZA 3CEQA 3QAQA 3QARA 3P1UA 2WXIA 1HG2A 3BEEA 3D9NA 3GZ2A 4UI9C 3SGHA 4L2YA 3D9IA 5AIJA 4LUNU 3CVPA 3HHMA 3FTXA 4TV3A 3MZLB 5FJYA 3S7JA 2PQNA 5C2YA 3MKRA 3O4ZA 4E6HA 3CSFA 1BPOA 5DIZA 3MJWA 5BPPA 4U0ZA 2HR2A 4U04A 3HDXA 3LVQE 4EZKA 3EIQC 2VGXB 3FUKA 1Z3YA 3CVVA 3QC1A 1ZU2A 1QZ2A 2WMOA 3CKCA 4I2ZA 3IBEA 2WXRA 3L13A 3OXLA 2GRLA 4XI9A 4BWRA 3U4TA 5FQ4A 4FA6A 1WY6A 2CG3A 3FUHA 2BF0X 2XCBA 2PZIA 2LO6A 3LEWA 4AP2A 2V5FA 3CGHA 2P58C 2AXVA 4CGWA 3D9LA 4GCOA 5FZQA 4A1GA 4MKTA 2J4BA 3VLFA 4J8SA 5LFAA 4FLHA 4G24A 3CVYA 2IONA 1H19A 3PZDA 3PUJA 4JVSA 1ELRA 3SF4A 2WXQA 4JZYA 5CHEE 3ZW3A 4GAAA 1SZAA 2I6HA 3WXXA 3S7DA 1A17A 4KZCA 4GZ3A 2QFCA 2XHEA 5LP0A 2VJ8A 3SBSA 3FHEA 3MKQB 4GA0A 5CCMA 4DPRA 2A4ZA 5E76A 4ANVA 5G55A 4EQFA 1UN8A 4N2QA 2NXPA 5T3RA 5AJLA 2WXNA 3APDA 3AS5A 4UWGA 1GW6A 1IQUA 1HS6A 1N52A 4BFRA 2Y4TA 3RKVA 4I2WA 1IQRA 4ME2A 3CSTA 1OWOA 2KM4A 5FQ6A 5KJLA 3OXFA 4EBAG 2R59A 1Y8MA 3EHMA 2MOWA 4J0UA 3FTZA 4L2LA 5G04J 1E8WA 1UN9A 1Z6TA 2J49A 2UY1A 2WQHA 3JQ0A 3ASGA 2L0IA 4G2VA 4HOUA 4IRUA 3TXNA 2ILRA 1U3CA 3Q15A 4GZ5A 3R7RA 2L9BA 3CVUA 4ANUA 4J6IA 5JJTA 5BV1A 3TG4A 3D9MA 4AY6A 1FVHA 3R7QA 4AIFA 2I2OA 2HO1A 5G05C 3LXUX 4G23A 2X6JA 2X6FA 3RO3A 4C0MA 3FU6A 2JLBA 3FDHA 3MCXA 3CHSA 3RU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RO2 A;  4AM9 A;  3K9I A;  4N3B A;  1XNF A;  2OND A;  4KBQ A;  3QDN A;  3URZ A;  4G1T A;  3UQ3 A;  4UI9 J;  1FCH A;  2C0M A;  3Q47 B;  5D0Q D;  2OOE A;  3ZN3 A;  4YVQ C;  3LY9 A;  3UPV A;  2C0L A;  3GW4 A;  2MHK A;  1HZ4 A;  1OUV A;  3LYA A;  2IFU A;  3CVL A;  2FI7 A;  4GPK A;  5JJ7 A;  2LNI A;  2XEV A;  3FP3 A;  4I9E A;  5KJN A;  4G26 A;  4GYO A;  2NC9 A;  4N3C A;  3PE3 A;  3MEK A;  3LY7 A;  5CCL A;  2R5S A;  3N71 A;  3LY8 A;  4BT9 A;  1W3B A;  4UQY A;  1IYG A;  4Y6C A;  4GYY A;  4RG9 A;  2BUG A;  2XGO A;  3CK8 A;  4H7X A;  3AS8 A;  3EDT B;  2UY1 B;  4GA1 A;  3MA5 A;  5FZR A;  2GW1 A;  2KCV A;  4WNE A;  4I17 A;  4NQ0 A;  2XCC A;  5FT9 A;  4JL0 A;  5G05 J;  3OXG A;  3ZGQ A;  5EKQ D;  2J9Q A;  3FFL A;  4G25 A;  3LPZ A;  4BTB A;  3CVQ A;  2FEZ A;  4HOR A;  5A6C A;  3S7F A;  2VGY A;  5FZS A;  4I1A A;  2UWJ G;  5D0O D;  3CVN A;  3AS4 A;  1KLX A;  4YND A;  4U07 A;  4F3V A;  4GCN A;  4O6F A;  3QWW A;  2VGX A;  4W9R A;  4KXK B;  4I9C A;  5HI7 A;  1ZBP A;  4BTA A;  5C1D A;  2DBA A;  5ARG A;  3LCA A;  4JA7 A;  4N3A A;  4KYO B;  2VSY A;  4AY5 A;  5EX3 A;  4J8E A;  3QOU A;  1TJC A;  2FBN A;  3U3W A;  4IN3 B;  2KCL A;  3CKB A;  3TAX A;  3ZFW A;  5LCW C;  4UQZ A;  2PL2 A;  3RIB A;  3QWP A;  3PE4 A;  4H7Y A;  4HOQ A;  5M72 A;  3CK9 A;  3O48 A;  5BW8 C;  2E2E A;  4YVO A;  2VQ2 A;  2HYZ A;  3ASF A;  4WNF A;  3ZHE A;  5KJM A;  2XPI A;  4JHR A;  2LSV A;  2KC7 A;  3IEG A;  5FTP A;  3S7B A;  3ASH A;  3NF1 A;  4WNG A;  5A7D B;  3CV0 A;  3ASD A;  4XIF A;  2PQR A;  4GYW A;  3VTX A;  4JA9 A;  4U0S A;  3KD7 A;  2VYI A;  5KJK A;  3HYM B;  2FF4 A;  5JJ6 A;  2YQ8 A;  1WAO 1;  3MV3 B;  2XGM A;  2WPV A;  4CDR A;  2LSU A;  3RJV A;  2Q7F A;  1QQE A;  2AVP A;  2VSN A;  4HOT A;  5DBK A;  2KCK A;  2XGS A;  3JYS A;  3UUX A;  4N2S A;  3QWV A;  3PDN A;  3ZPJ A;  4Y6W A;  2L6J A;  3QKY A;  3KAE A;  4J8F A;  3ULQ A;  4LEU A;  2IF4 A;  4U0U A;  5LCW J;  4N39 A;  1KT1 A;  3TG5 A;  3CK7 A;  4UQX A;  4WND A;  1HH8 A;  5BNW A;  3GZ1 A;  3E4B A;  2YHC A;  1P5Q A;  5AYW D;  4B94 A;  3KS2 A;  1E96 B;  1KT0 A;  4APO A;  3Q49 B;  4HOS A;  1ELW A;  3ZHE B;  1B89 A;  2Y4U A;  5EX0 A;  3TGO A;  1PC2 A;  5BT1 A;  1IHG A;  4ABN A;  3Q5M A;  4UI9 K;  3SZ7 A;  2KAT A;  2FO7 A;  4NRH B;  3VTY A;  3ESK A;  1HXI A;  4RG6 A;  3FWV A;  4GA2 A;  4N5C A;  1NA3 A;  2C2L A;  3LKU A;  5G04 C;  4A1S A;  4XI0 A;  4GZ6 A;  5HQ8 A;  3Q4A B;  3GYZ A;  1YA0 A;  1WM5 A;  3R9A B;  1NZN A;  4WUY A;  1NA0 A;  4BT8 A;  3MV2 B;  4J8D A;  3CEQ A;  3BEE A;  3GZ2 A;  4UI9 C;  3CVP A;  3S7J A;  5FJY A;  2PQN A;  3MKR A;  5DIZ A;  4U0Z A;  2HR2 A;  4U04 A;  2VGX B;  1ZU2 A;  1QZ2 A;  3CKC A;  4I2Z A;  3OXL A;  4XI9 A;  4BWR A;  3U4T A;  2XCB A;  2PZI A;  2V5F A;  2P58 C;  4CGW A;  4GCO A;  5FZQ A;  4G24 A;  1ELR A;  3SF4 A;  5CHE E;  2I6H A;  3WXX A;  3S7D A;  1A17 A;  4GZ3 A;  2QFC A;  4GA0 A;  5CCM A;  4N2Q A;  4EQF A;  3AS5 A;  2Y4T A;  3RKV A;  4I2W A;  4ME2 A;  5KJL A;  3OXF A;  1Y8M A;  4J0U A;  4CGV A;  5G04 J;  5ARF A;  4G2V A;  2WQH A;  2UY1 A;  4HOU A;  3ASG A;  3Q15 A;  4GZ5 A;  5JJT A;  3TG4 A;  4AY6 A;  4AIF A;  2HO1 A;  5G05 C;  4G23 A;  3RO3 A;  2JLB A;  3RU0 A; 
#chains in the Genus database with same CATH topology
 3CVW A;  3RO2 A;  4AM9 A;  4WWO A;  3K9I A;  1H6K A;  3EIJ A;  4BET A;  4CCA A;  4G11 A;  3FEX A;  4G8L A;  2WXF A;  3UQ3 A;  2H6H A;  3QB2 A;  3Q47 B;  3I5P A;  2OOE A;  4ATZ D;  3LY9 A;  3UPV A;  1N11 A;  2C0L A;  4J8Y A;  4BER A;  1DNP A;  1MJ0 A;  1UW4 B;  4DK5 A;  2FI7 A;  4TUU A;  5JJ7 A;  4A3T A;  2VTB A;  1N54 A;  2XEV A;  4YDW A;  3FP3 A;  4G26 A;  3JXI A;  2XEH A;  2OV8 A;  3L22 A;  4EBA A;  3T9K A;  3LY7 A;  2E0I A;  2X38 A;  3PNT B;  2CHX A;  4MS6 A;  2DVW A;  2PM6 A;  2F37 A;  3LJ3 A;  3PRZ A;  3C98 A;  1JWG A;  4XE0 A;  5ENQ D;  3CK8 A;  3I4G A;  3BU8 A;  4H7X A;  1O1R A;  3AS8 A;  4Q96 A;  5FZR A;  3IHY A;  4J7W A;  3MYV A;  3UTM A;  3T8M A;  1TNO A;  1SA5 A;  4QFV A;  4JXT A;  2EIM E;  3KEZ A;  4HI8 A;  1H2T C;  3RRN B;  4GB9 A;  5G05 J;  3ZGQ A;  2J9Q A;  3B7S A;  4PS8 A;  3C3Q A;  4G25 A;  2DCP A;  4ACK A;  1N0R A;  3ZU7 B;  3CVQ A;  2DIW A;  3GZS A;  5CBN A;  2VSO E;  2IEJ A;  3JCK C;  1N4R A;  1O1S A;  3VLD A;  4KT6 B;  5FZS A;  3MGB A;  4FHJ A;  4DX7 D;  3EUV A;  3D9P A;  3G2W A;  1KLX A;  2Y3A A;  4JC8 A;  4YND A;  4BX9 A;  4U8V D;  1TN6 A;  4FP7 A;  1OWN A;  4GCN A;  5KNH D;  3QWW A;  3CHR A;  2XZT G;  4W9R A;  1AWC B;  1SQM A;  2OEW A;  3ML9 A;  1BD8 A;  4BTA A;  1ELK A;  3CLJ A;  1H6P A;  4HRN A;  3KSL A;  4JA7 A;  4N3A A;  4HBD A;  4FLB A;  4PDX A;  4WAF A;  1S70 B;  1UJJ A;  4J8E A;  3QOU A;  3TAX A;  3ZFW A;  1OT8 A;  3E37 A;  2PL2 A;  3QWP A;  4BES A;  3FH5 A;  2XPY A;  5M72 A;  5BW8 C;  3PS6 A;  2VQ2 A;  1UJK A;  2HYZ A;  1LF8 A;  5KJM A;  4NUR A;  2JEK A;  2I1K A;  2GRP B;  4JHR A;  2LSV A;  5FTP A;  2CHZ A;  3AG3 E;  3S7B A;  3ASH A;  3G2S A;  1TYQ G;  2ZIR A;  2WXL A;  2PQR A;  4JA9 A;  3KD7 A;  2VYI A;  4NIK A;  3HYM B;  2FF4 A;  2XEN A;  3AG1 E;  4RSY A;  3HVE B;  5HS0 A;  4GTR A;  4GML A;  4RLY A;  1N94 A;  5B1A E;  4GZD A;  2ZU6 B;  4UWH A;  2AVP A;  3HXD A;  3SFY A;  4A3V A;  4X8Q A;  1NFI E;  5DBK A;  5KCM A;  3QWV A;  3ZXS A;  2MYO A;  4CDN A;  3QKY A;  4L7T A;  5B1B E;  2X6H A;  1Y6I A;  2IF4 A;  1INZ A;  3FTW A;  3HXF A;  4U0U A;  3OTN A;  3CK7 A;  3E32 A;  3SBT B;  5EYP F;  2WQ6 A;  5CMW A;  2RFM A;  2RFA A;  3E4B A;  2WB2 A;  1TEZ A;  3EHR A;  1D8E A;  5AYW D;  3KS2 A;  3ZKJ A;  1FVF A;  4APO A;  2YIN A;  2KZT B;  1LD8 A;  3ZHE B;  3BUA A;  3FH8 A;  2J8S D;  1SVX A;  4B89 A;  1SA4 A;  1JWF A;  1OY3 D;  3V31 A;  4DX1 A;  2B0O E;  2DZN A;  4YDO A;  2RG8 A;  4HVB A;  3G2U A;  5LOZ A;  4ABN A;  3Q5M A;  1E7V A;  5BUZ A;  3MKQ A;  2WVI A;  1OWM A;  3BG0 B;  4OAV B;  4RG6 A;  3FWV A;  4GA2 A;  2Y69 E;  2ZGD A;  3L17 A;  2C2L A;  3Q7A A;  3SD5 A;  4A1S A;  4LG6 A;  5ITZ F;  3Q4A B;  3GYZ A;  4OVV A;  2IOS A;  1WM5 A;  3R9A B;  4BSX A;  5EIB E;  1BU9 A;  1NZN A;  4K5C A;  5D66 A;  1WDY A;  2XZD G;  1Z3X A;  2EQX A;  2EIN E;  2PNN A;  4HI9 A;  4CZ2 D;  3DSX A;  3UXG A;  3QAQ A;  5AQA A;  3D9N A;  2LUH A;  4L2Y A;  4O1P A;  4LUN U;  3DPY A;  4K5A B;  3MZL B;  1N0Q A;  3O4Z A;  3B95 A;  4CYM D;  4U0Z A;  4EZK A;  5EIL A;  3QC1 A;  1ZU2 A;  3CKC A;  3ZNG A;  3UIP C;  4XI9 A;  3U4T A;  4LNG A;  3FUH A;  1TNY A;  4GCO A;  4A1G A;  4G24 A;  5EN5 D;  3PZD A;  1ELR A;  4GAA A;  4KZC A;  4GZ3 A;  5LP0 A;  2VJ8 A;  1K3Z D;  3SBS A;  5CCM A;  4DPR A;  5E76 A;  4EQF A;  2NXP A;  3AS5 A;  3APD A;  4UWG A;  1N52 A;  3RKV A;  4ME2 A;  3CST A;  3E30 A;  5FQ6 A;  5KJL A;  4EBA G;  1MX2 A;  1Y8M A;  4HRM B;  1BLX B;  5ARF A;  4HOU A;  3TXN A;  2L0I A;  3Q15 A;  4J6I A;  3TG4 A;  2Y0B G;  1FVH A;  4AIF A;  2I2O A;  1X81 A;  4G23 A;  2X6F A;  4DX2 A;  4JD2 G;  3MCX A;  3RU0 A;  4EPZ A;  2WXH A;  1N4S A;  2OND A;  4KBQ A;  3ZRH A;  3QDN A;  2LXM A;  3U9W A;  3URZ A;  2WXK A;  3NZS A;  3PZ1 A;  4G1T A;  5BXO A;  4MLP A;  1EDU A;  2C0M A;  5CED B;  1E8X A;  4M7C A;  5D0Q D;  4YVQ C;  2R02 A;  3GW4 A;  4JEH A;  3UKR G;  3CR3 A;  2MHK A;  1HZ4 A;  1OUV A;  3FUI A;  3LYA A;  5JHA A;  2IFU A;  4DI4 A;  3CVL A;  1U3D A;  1OCR E;  1JUQ A;  4N3C A;  1TR4 A;  3PE3 A;  2CFZ A;  4R7L A;  5AN8 A;  5B3S E;  4YDY A;  3AAA C;  3TXM A;  3LY8 A;  3AU5 A;  3TWU A;  4UQY A;  3EHQ A;  2WXJ A;  4Y6C A;  3ZYM A;  3G2V A;  3NZU A;  2XGO A;  2F8X K;  3AJI A;  3UM0 A;  3E34 A;  4XX5 A;  3DBS A;  3SQV A;  2AWI A;  4K0R A;  3EDT B;  2UY1 B;  4GA1 A;  4I6G A;  2ZXW E;  4WNE A;  3EJN A;  2GRO B;  2QC9 A;  4F7A A;  1EYH A;  3OXG A;  1OWP A;  4JHK A;  4XKC A;  1MX6 A;  4TXP A;  2I1J A;  4AXH A;  4GMR A;  3LVR E;  3S7F A;  2XRY A;  1HF8 A;  2P9L G;  3D9O A;  4MBG A;  4I1A A;  1H0A A;  1N4Q A;  4K03 A;  4CT4 A;  1H2V C;  3HVE A;  4C0E A;  5ENN A;  3CHO A;  4F3V A;  2GRN B;  2VGX A;  1N9A A;  4KXK B;  2LXL A;  1IKN D;  2P9U G;  2RD0 A;  3UT8 A;  4GTT A;  1E8Z A;  4IYP A;  5ARG A;  3TWQ A;  2VSY A;  2P9P G;  1YMP A;  3ENE A;  1H6O A;  2YNQ A;  1TJC A;  3LJN A;  5D2M C;  2KCL A;  3CKB A;  4HS2 A;  5LCW C;  2B6C A;  4UQZ A;  2NYJ A;  2OVF A;  4HRL A;  1JPL A;  3IV0 A;  4AVX A;  3HXB A;  2E2E A;  2KZT A;  2P9S G;  4ATG A;  3ASF A;  4WNF A;  1V55 E;  3ZHE A;  3FEY A;  3J5P A;  4GZC A;  5AEN A;  2YHE A;  2V4H C;  5A7D B;  3FUD A;  4N5Q A;  3UMV A;  5ENP D;  3ASD A;  4XIF A;  3PEV B;  4U0S A;  3ABL E;  3VLE A;  4C9B B;  5JJ6 A;  5CER B;  3MV3 B;  2XGM A;  1BI7 B;  4CDR A;  1Z5S C;  2OEV A;  5FQ8 A;  2X3M A;  4URK A;  2A5U A;  3CQG B;  4OYS A;  5CBO A;  3UUX A;  4B93 B;  2V0P A;  3C5R A;  3APC A;  3PNL B;  2IJG X;  4PH4 B;  3FH7 A;  1O5M A;  3ASN E;  4LER A;  1HO8 A;  3JXJ A;  4ZFH A;  4DLO A;  2AW6 A;  4B0Z A;  4HXI A;  2V4L A;  2MRI A;  5LCW J;  1KT1 A;  3TG5 A;  2ETA A;  4F1P A;  4WND A;  2V8S E;  3DST A;  3DSW A;  3GZ1 A;  1PY1 A;  5LX8 A;  4CEM A;  4U8H A;  3EU9 A;  1KT0 A;  4HOS A;  3HRA A;  3HXC A;  1ELW A;  1MQS A;  3X2Q E;  4CDM A;  2KBX A;  2Y4U A;  4I1O B;  2L6B A;  3Q73 A;  2QYJ A;  3FUF A;  3TGO A;  1DCE A;  4FJY A;  1HG5 A;  4XZ4 A;  2P2C P;  1PC2 A;  5BT1 A;  1IHG A;  4GTV A;  4UI9 K;  2KAT A;  2FO7 A;  1TNU A;  3W9G A;  2CG2 A;  2WXG A;  2EIK E;  4NRH B;  4I6E A;  3B7T A;  3E33 A;  1S0P A;  2P9N G;  4RQI A;  3SI5 A;  3LKU A;  5AAR A;  3ASO E;  4XI0 A;  5ANL A;  1E90 A;  4GZ6 A;  3TJP A;  4XEI G;  2AJA A;  3C3O A;  5H7P A;  4ILI A;  3IXE A;  1NA0 A;  3IKO B;  3L16 A;  5EDS A;  4J8D A;  3DWL G;  4DX5 D;  4FJZ A;  3QAR A;  3P1U A;  3T8K A;  1HG2 A;  3GZ2 A;  4UI9 C;  2H6F A;  3DSV A;  1KZP A;  3D9I A;  2XS1 A;  5AIJ A;  1QYM A;  4TV3 A;  5C2Y A;  3MKR A;  1K8K G;  5DIZ A;  2VGX B;  1QZ2 A;  3SY2 A;  2WMO A;  1QBQ A;  2WXR A;  3C72 A;  3L13 A;  2GRL A;  1JCQ A;  4BWR A;  4GTP A;  2XCB A;  2PZI A;  2LO6 A;  3LEW A;  4UUC A;  3CGH A;  2P58 C;  5FZQ A;  3V2O A;  2J4B A;  3VLF A;  4J8S A;  2ION A;  3PUJ A;  4JVS A;  4JZY A;  3RSE G;  1FT2 A;  1SZA A;  2I6H A;  3WXX A;  2QFC A;  1MX4 A;  2A4Z A;  4N2Q A;  5AJL A;  2WXN A;  4U8Y D;  1GW6 A;  1N95 A;  1HS6 A;  4BFR A;  4I2W A;  4EHM A;  3NBN B;  3ZUV B;  4L2L A;  4J0U A;  2MOW A;  2UY1 A;  2JAB A;  3CVU A;  4ANU A;  5JJT A;  5BV1 A;  4AY6 A;  3R7Q A;  3FU6 A;  3CHS A;  3CQC B;  4U7E B;  4AOF A;  1UOH A;  1XNF A;  3FTU A;  5ENO D;  3LDZ A;  1MHQ A;  3UT7 A;  4UI9 J;  1FCH A;  1IXV A;  4GTQ A;  1SW6 A;  3SFZ A;  3UI2 A;  3ZYL A;  4Z68 A;  5E75 A;  1H2U A;  3D9K A;  4EZJ A;  4GPK A;  4ZHB A;  2F0Y A;  4GYO A;  4L23 A;  2J4D A;  1Q2Z A;  2R5S A;  4O60 A;  4BT9 A;  2I9C A;  4RG9 A;  3PZ2 A;  3CIA A;  3MA5 A;  3NB2 A;  4D10 C;  4NQ0 A;  3L08 A;  2R17 C;  1D9S A;  5FT9 A;  1OXJ A;  4OVU A;  4JL0 A;  2WMN A;  2EIJ E;  3ESL A;  4JPS A;  2CHW A;  2IOL A;  4HOR A;  2BTD A;  1WG0 A;  4MRU A;  1VDY A;  2VGY A;  4DRX E;  4BEP A;  2DYR E;  2R03 A;  3CVN A;  4ANW A;  3UM2 A;  2L0T B;  5CEC B;  2R2L A;  2X6K A;  1NL4 A;  4I43 A;  4L1B A;  4O6F A;  3T5X A;  3B7U X;  1S63 A;  4AV7 A;  4I1M A;  4U95 D;  5HI7 A;  3QNK A;  3HIZ A;  5HKP A;  4DJA A;  2QY7 A;  3ZEF A;  2DBA A;  3B13 A;  1TN8 A;  2XS8 A;  3LCA A;  5ENT D;  5EX3 A;  3PUK A;  1NP7 A;  1QNF A;  4NAC A;  3DEO A;  3I4R B;  3SNX A;  5JMN D;  3JUE A;  3FTY A;  3EHN A;  3DSU A;  3P2B A;  5T8I A;  2EIL E;  5AAO A;  4H7Y A;  4HOQ A;  3CK9 A;  3O48 A;  2M63 A;  5AQB A;  4KMO A;  2KC7 A;  3ONL A;  4DLQ A;  4WNG A;  4UWL A;  4APF A;  4HLL A;  5AQ9 A;  4M3O A;  4GYW A;  3Q7F A;  3VTX A;  1OCO E;  3APF A;  3TWX A;  2YQ8 A;  3U66 A;  4FUL A;  5G2N A;  1E8Y A;  2HM8 A;  2FO1 E;  2LSU A;  4Q69 A;  2Q7F A;  2ETC A;  3F6Q A;  1QQE A;  2WXP A;  3UT4 A;  4HLE A;  2IO2 C;  3ISM C;  3PDN A;  3L82 A;  3ZPJ A;  3DRA A;  2L6J A;  3PRE A;  4GTS A;  3FTS A;  4U96 D;  4J8F A;  5CEA A;  3ULQ A;  3AU4 A;  1E7U A;  4JHJ A;  4IUL A;  4WWN A;  5IY5 E;  2RKK A;  4UQX A;  3L9T A;  1HH8 A;  5A23 A;  2DYS E;  1KPS B;  1XGW A;  3CHP A;  4LNU D;  1E96 B;  4DI3 A;  5ENS D;  3Q49 B;  4TUM A;  2Y1L E;  3FU3 A;  4CT0 A;  4HNA D;  3AG4 E;  4FHK A;  1ZB1 A;  2IU1 A;  4OAU C;  4G8K A;  2HE0 A;  3ABK E;  4TXQ A;  3MX3 A;  2QZA A;  1X5B A;  2XEE A;  3TWS A;  3OAW A;  4KVM A;  1HXI A;  3TWV A;  3BQO A;  3FUL A;  1TNB A;  3ABM E;  5ANR A;  5G04 C;  4GU5 A;  3FU5 A;  1OWL A;  4GMJ A;  1K1B A;  4FAD A;  1HX8 A;  3TWR A;  3V30 A;  4XKB A;  3L54 A;  2WM9 A;  4FC8 A;  4HFG A;  1LTX A;  4A63 B;  4LRZ A;  1S64 A;  3CEQ A;  2WXI A;  3BEE A;  3SGH A;  3AG2 E;  3HHM A;  3FTX A;  1K1A A;  4LNB A;  4E6H A;  1BI8 B;  5BPP A;  3LVQ E;  1MZC A;  3FUK A;  3CVV A;  4LSZ E;  3IBE A;  3KEA A;  5FQ4 A;  4FA6 A;  2BF0 X;  3UIN C;  4AP2 A;  2AXV A;  4MKT A;  3NOC D;  5LFA A;  3CVY A;  3W9F A;  1H19 A;  3SF4 A;  3ZW3 A;  3S7D A;  1A17 A;  4GA0 A;  3HXE A;  4ANV A;  1UN8 A;  5T3R A;  1O1T A;  1IQU A;  4F6R D;  2KXP C;  2KM4 A;  2IY0 C;  3OXF A;  4CGV A;  5G04 J;  1UN9 A;  4IRU A;  1Z6T A;  2J49 A;  2WQH A;  3JQ0 A;  3C3R A;  4GZ5 A;  3R7R A;  2L9B A;  2OCC E;  2HO1 A;  2VGE A;  3RO3 A;  4C0M A;  1RZ4 A;  4BY6 A;  1UG3 A;  4N3B A;  1DC2 A;  4K5B A;  3I3N A;  3ULY A;  1EF1 C;  1MYO A;  4B8C B;  3ZN3 A;  3PVL A;  3IHV A;  4BSZ B;  2ETB A;  4GTO A;  4P29 A;  3BG1 B;  3RAU A;  4KZ0 A;  2ZGG A;  4UWK A;  2LNI A;  5T4Y A;  4WWP A;  4I9E A;  5KJN A;  2NC9 A;  2FUL A;  3Q78 A;  2F8Y A;  3MEK A;  5CRV A;  5CCL A;  3N71 A;  1HU3 A;  4QQI A;  2J07 A;  2GRR B;  1W3B A;  1IYG A;  4GYY A;  1V54 E;  3FTV A;  2BUG A;  2XRZ A;  3T5V A;  4PUC A;  4GPM A;  3RRU A;  5HRY A;  1DVP A;  4UWF A;  5JHB A;  1AP7 A;  2GW1 A;  3PZ4 A;  4YDE A;  2XPZ A;  2KCV A;  4DUI A;  4I17 A;  3LS8 A;  2P9K G;  2XCC A;  3FUM A;  3NAW A;  5ENR D;  5EKQ D;  3FFL A;  3DXM G;  3LPZ A;  4BTB A;  1TJF A;  1JCR A;  2FEZ A;  4TRQ A;  2DWZ A;  4HQD A;  5A6C A;  4RVB A;  3ZVV A;  3DXK G;  3RRM B;  2WQ7 A;  2UWJ G;  1IHB A;  5D0O D;  4EZL A;  4O1O A;  5J08 A;  2XQ0 A;  3AS4 A;  3SFX A;  3KSQ A;  4U07 A;  4Q94 A;  4PS7 A;  3CHM A;  4I9C A;  3V2X A;  1ZBP A;  2VTB B;  4U63 A;  5C1D A;  4ACL A;  3FUJ A;  4BX8 A;  3RK6 A;  1HE8 A;  2QYU A;  3HG0 D;  4KVO A;  3QK0 A;  4KYO B;  1SZ9 A;  4AY5 A;  1YCS B;  3WG7 E;  4JEU A;  2FBN A;  2LAH A;  3U3W A;  4IN3 B;  4I6J A;  1HFA A;  1U2V G;  3RIB A;  4CRW A;  5J90 A;  3PE4 A;  2GRM A;  2GRQ B;  3ZIM A;  4YVO A;  3FY4 A;  3ZYQ A;  2R05 A;  5FWQ A;  2XPI A;  4FU3 A;  3TL5 A;  1L5J A;  3IEG A;  3DPD A;  5KWD A;  1KZO A;  3B7R L;  3NF1 A;  1NI1 A;  2GGF A;  1TN7 A;  3CV0 A;  3DSS A;  5KBA A;  3NQP A;  3ZYK A;  1D8D A;  4C48 B;  5KJK A;  4A55 A;  2OVB A;  3UM1 A;  5FQ7 A;  1N4P A;  1WAO 1;  2BKG A;  3UX4 A;  2WPV A;  3RJV A;  2AXZ A;  2VSN A;  2WXM A;  3TWW A;  4HOT A;  4PS3 A;  3ONK A;  3EU5 A;  3Q75 A;  3SHF A;  2KCK A;  4JB8 P;  5AJD A;  3ZXP A;  4F1S A;  2XGS A;  3JYS A;  5CRU A;  4ANX A;  4N2S A;  5EID A;  1LD7 A;  2WXO A;  4ILG A;  4Y6W A;  2IO3 C;  5JA4 D;  3KAE A;  4DX6 D;  4GTM A;  3UKU G;  4LEU A;  2VSX E;  4B8A A;  3G2T A;  2IQC A;  3J5Q B;  2ZIS A;  3JUI A;  3PZ3 A;  4EEC A;  4N39 A;  2BED A;  5BNW A;  5CMY A;  4AEZ C;  4E85 A;  3R9M A;  2YHC A;  2J09 A;  1P5Q A;  5FIN A;  3B7B A;  4V3I A;  4B94 A;  5AQ7 A;  2A5E A;  4JW1 A;  3FUN A;  4HB5 A;  1JCS A;  3V79 K;  1B89 A;  5FIO A;  3CHQ A;  1A5E A;  5EX0 A;  3Q9U C;  2X6I A;  3FUE A;  3DEP A;  3SZ7 A;  4F53 A;  4LCT A;  3S2A A;  3ULE G;  3VTY A;  3ESK A;  3U64 A;  2NSZ A;  3PH0 C;  3QJZ A;  3NOG D;  3D3M A;  4N5C A;  1NA3 A;  5KNG A;  4AJW A;  2J08 A;  2LAI A;  3L6A A;  2PM7 A;  1PAQ A;  3JQ1 A;  1EPU A;  3ML8 A;  5HQ8 A;  3Q9N C;  5BV0 A;  1YA0 A;  3CVX A;  3PEU B;  3FU0 A;  3D9J A;  1FT1 A;  3D9H A;  2CFU A;  2AXU A;  4WUY A;  1DCQ A;  1TNZ A;  4BT8 A;  3UM3 A;  2BKK B;  3MV2 B;  2H6G A;  4ILH B;  2P9I G;  4TXR A;  3SO8 A;  3CVP A;  3S7J A;  5FJY A;  2PQN A;  1G3N B;  3CSF A;  1BPO A;  1FPP A;  3MJW A;  2HR2 A;  4U04 A;  3HDX A;  3EIQ C;  1Z3Y A;  3Q79 A;  4I2Z A;  4L9P A;  3OXL A;  1WY6 A;  3TWT A;  2CG3 A;  5EYL A;  1RW2 A;  2V5F A;  4CGW A;  3D9L A;  2H6I A;  4FLH A;  1OCZ E;  2WXQ A;  5CHE E;  2XHE A;  3FHE A;  3MKQ B;  5G55 A;  2Y4T A;  1IQR A;  1OWO A;  2R59 A;  2DZO A;  3EHM A;  1YYH A;  3FTZ A;  1E8W A;  4G2V A;  3ASG A;  2ILR A;  1U3C A;  2V5Q C;  3D9M A;  5BXU A;  3UIO C;  1OCC E;  5G05 C;  3LXU X;  2X6J A;  2JLB A;  3FDH A; 
#chains in the Genus database with same CATH homology
 3CVW A;  3CQC B;  3RO2 A;  4AM9 A;  1UG3 A;  4WWO A;  4AOF A;  4BY6 A;  2WXH A;  4EPZ A;  3K9I A;  4N3B A;  1XNF A;  1H6K A;  2OND A;  3EIJ A;  4KBQ A;  3ZRH A;  4CCA A;  3FTU A;  3QDN A;  4G11 A;  3FEX A;  3LDZ A;  3I3N A;  3U9W A;  2WXF A;  3URZ A;  1EF1 C;  2WXK A;  3NZS A;  4G1T A;  1MHQ A;  3UQ3 A;  3UT7 A;  4MLP A;  4UI9 J;  1EDU A;  1FCH A;  2C0M A;  4B8C B;  3QB2 A;  1E8X A;  3Q47 B;  3I5P A;  2OOE A;  5D0Q D;  3ZN3 A;  3PVL A;  3SFZ A;  3ZYL A;  4YVQ C;  3LY9 A;  3IHV A;  3UPV A;  5E75 A;  2C0L A;  3GW4 A;  4JEH A;  1H2U A;  3CR3 A;  2MHK A;  1DNP A;  1HZ4 A;  1OUV A;  3FUI A;  3LYA A;  1UW4 B;  5JHA A;  4P29 A;  2IFU A;  4DK5 A;  3BG1 B;  4DI4 A;  3D9K A;  4KZ0 A;  3CVL A;  1U3D A;  4EZJ A;  2FI7 A;  4GPK A;  4TUU A;  5JJ7 A;  4A3T A;  2VTB A;  4UWK A;  2LNI A;  1N54 A;  5T4Y A;  2XEV A;  4WWP A;  3FP3 A;  4I9E A;  1JUQ A;  5KJN A;  4G26 A;  4GYO A;  4CGV A;  2NC9 A;  4L23 A;  2FUL A;  4N3C A;  2OV8 A;  3L22 A;  3PE3 A;  3MEK A;  4EBA A;  2CFZ A;  3LY7 A;  4R7L A;  2J4D A;  2E0I A;  2X38 A;  3PNT B;  5CCL A;  2CHX A;  2R5S A;  4MS6 A;  3N71 A;  1HU3 A;  3TXM A;  2J07 A;  3LY8 A;  4BT9 A;  3AU5 A;  2I9C A;  2PM6 A;  1W3B A;  4UQY A;  1IYG A;  3LJ3 A;  2WXJ A;  3PRZ A;  4Y6C A;  3C98 A;  3ZYM A;  4GYY A;  4RG9 A;  3G2V A;  3NZU A;  1JWG A;  3FTV A;  4XE0 A;  2BUG A;  2XRZ A;  2XGO A;  3T5V A;  3CK8 A;  3I4G A;  4PUC A;  4H7X A;  3RRU A;  4XX5 A;  3DBS A;  1DVP A;  3AS8 A;  4UWF A;  3CIA A;  2AWI A;  4Q96 A;  4K0R A;  5JHB A;  3EDT B;  2UY1 B;  4GA1 A;  3MA5 A;  5FZR A;  2GW1 A;  4I6G A;  3IHY A;  2XPZ A;  2KCV A;  3MYV A;  3T8M A;  4D10 C;  4WNE A;  4I17 A;  3EJN A;  4NQ0 A;  3L08 A;  2R17 C;  3LS8 A;  4QFV A;  2XCC A;  3FUM A;  4JXT A;  3KEZ A;  5FT9 A;  4OVU A;  1H2T C;  4JL0 A;  3RRN B;  4F7A A;  4GB9 A;  5G05 J;  1EYH A;  3OXG A;  3ZGQ A;  5EKQ D;  2J9Q A;  3B7S A;  2WMN A;  3FFL A;  4PS8 A;  3ESL A;  1OWP A;  4G25 A;  2DCP A;  4JHK A;  3LPZ A;  4XKC A;  4ACK A;  4BTB A;  4JPS A;  2CHW A;  2IOL A;  1TJF A;  3CVQ A;  2DIW A;  2FEZ A;  2I1J A;  4TRQ A;  3GZS A;  4HOR A;  2BTD A;  2VSO E;  5A6C A;  4MRU A;  4AXH A;  3JCK C;  3LVR E;  3S7F A;  4RVB A;  1VDY A;  2VGY A;  2XRY A;  3ZVV A;  1HF8 A;  3VLD A;  3D9O A;  3RRM B;  4KT6 B;  5FZS A;  2WQ7 A;  4I1A A;  2UWJ G;  1H0A A;  5D0O D;  3MGB A;  4FHJ A;  4EZL A;  4K03 A;  4CT4 A;  5J08 A;  1H2V C;  2XQ0 A;  3CVN A;  3D9P A;  3G2W A;  3AS4 A;  3HVE A;  4ANW A;  4C0E A;  1KLX A;  2L0T B;  2Y3A A;  4JC8 A;  4YND A;  4BX9 A;  2X6K A;  5ENN A;  3CHO A;  4U07 A;  4I43 A;  4FP7 A;  4L1B A;  1OWN A;  4Q94 A;  4F3V A;  4GCN A;  4O6F A;  3T5X A;  3QWW A;  3CHR A;  2VGX A;  3B7U X;  4W9R A;  4PS7 A;  4AV7 A;  4I1M A;  3CHM A;  4KXK B;  4I9C A;  5HI7 A;  1SQM A;  3ML9 A;  3QNK A;  1ZBP A;  2VTB B;  4BTA A;  1ELK A;  3CLJ A;  3HIZ A;  4U63 A;  4DJA A;  5C1D A;  2QY7 A;  3ZEF A;  2DBA A;  3B13 A;  2RD0 A;  3UT8 A;  3FUJ A;  1E8Z A;  4ACL A;  4BX8 A;  4IYP A;  1HE8 A;  5ARG A;  3RK6 A;  3LCA A;  4JA7 A;  4N3A A;  4FLB A;  4KVO A;  3QK0 A;  4PDX A;  4WAF A;  4KYO B;  2VSY A;  1SZ9 A;  4AY5 A;  5EX3 A;  1UJJ A;  4J8E A;  3PUK A;  3QOU A;  3ENE A;  1NP7 A;  2YNQ A;  1TJC A;  1QNF A;  4JEU A;  4NAC A;  2FBN A;  2LAH A;  3U3W A;  4IN3 B;  2KCL A;  3CKB A;  4HS2 A;  4I6J A;  3I4R B;  3SNX A;  3TAX A;  3ZFW A;  3FTY A;  1HFA A;  5LCW C;  3EHN A;  3P2B A;  4UQZ A;  5T8I A;  2OVF A;  1JPL A;  2PL2 A;  3RIB A;  4CRW A;  3QWP A;  5J90 A;  3PE4 A;  3FH5 A;  2GRM A;  4H7Y A;  2XPY A;  4HOQ A;  3IV0 A;  5M72 A;  3CK9 A;  3O48 A;  5BW8 C;  3PS6 A;  3ZIM A;  4AVX A;  2E2E A;  4YVO A;  2KZT A;  3FY4 A;  2VQ2 A;  1UJK A;  2HYZ A;  4ATG A;  3ZYQ A;  3ASF A;  4WNF A;  1LF8 A;  2M63 A;  3ZHE A;  4KMO A;  5KJM A;  5FWQ A;  4NUR A;  2JEK A;  2XPI A;  3FEY A;  4FU3 A;  2I1K A;  3TL5 A;  4JHR A;  2LSV A;  1L5J A;  2KC7 A;  3DPD A;  3IEG A;  4GZC A;  5AEN A;  2YHE A;  3B7R L;  3ONL A;  5FTP A;  4DLQ A;  2CHZ A;  3S7B A;  3ASH A;  3G2S A;  3NF1 A;  4WNG A;  5A7D B;  3FUD A;  4UWL A;  4APF A;  2GGF A;  3CV0 A;  3UMV A;  3NQP A;  3ZYK A;  4M3O A;  3ASD A;  4XIF A;  2WXL A;  2PQR A;  4GYW A;  3VTX A;  4JA9 A;  3PEV B;  4U0S A;  3KD7 A;  3APF A;  2VYI A;  5KJK A;  4A55 A;  3HYM B;  3VLE A;  2OVB A;  2FF4 A;  5JJ6 A;  2YQ8 A;  4C9B B;  5FQ7 A;  4RSY A;  3U66 A;  3HVE B;  1WAO 1;  4FUL A;  5G2N A;  1E8Y A;  2HM8 A;  4GML A;  3MV3 B;  2XGM A;  3UX4 A;  2WPV A;  4CDR A;  2LSU A;  4GZD A;  3RJV A;  4Q69 A;  2Q7F A;  1QQE A;  2ZU6 B;  4UWH A;  2WXP A;  2AXZ A;  5FQ8 A;  3UT4 A;  2AVP A;  2VSN A;  4A3V A;  2WXM A;  4HOT A;  4HLE A;  2X3M A;  4PS3 A;  5ARF A;  3ONK A;  5DBK A;  3SHF A;  2A5U A;  2KCK A;  5AJD A;  4F1S A;  4URK A;  2XGS A;  3JYS A;  3CQG B;  4OYS A;  5KCM A;  4ANX A;  3UUX A;  4N2S A;  3QWV A;  3PDN A;  3ZXS A;  2V0P A;  3ZPJ A;  2WXO A;  3APC A;  4ILG A;  2L6J A;  3PNL B;  4Y6W A;  3PRE A;  2IJG X;  4CDN A;  4PH4 B;  3FH7 A;  3QKY A;  4L7T A;  3KAE A;  2X6H A;  3FTS A;  4LER A;  4J8F A;  3ULQ A;  1Y6I A;  1HO8 A;  4LEU A;  4DLO A;  2AW6 A;  2VSX E;  2IF4 A;  4B0Z A;  4B8A A;  3FTW A;  3G2T A;  1INZ A;  2IQC A;  3AU4 A;  4HXI A;  4U0U A;  2V4L A;  1E7U A;  4JHJ A;  4IUL A;  3JUI A;  2MRI A;  4EEC A;  3OTN A;  4N39 A;  5LCW J;  1KT1 A;  4WWN A;  3TG5 A;  3CK7 A;  3SBT B;  4UQX A;  4WND A;  1HH8 A;  5A23 A;  2V8S E;  5BNW A;  2WQ6 A;  5CMY A;  4AEZ C;  4E85 A;  5CMW A;  1XGW A;  3GZ1 A;  3E4B A;  2WB2 A;  2YHC A;  2J09 A;  1TEZ A;  1PY1 A;  1P5Q A;  5LX8 A;  4CEM A;  4U8H A;  3CHP A;  4V3I A;  5AYW D;  4B94 A;  3KS2 A;  1E96 B;  1KT0 A;  1FVF A;  4DI3 A;  4APO A;  2YIN A;  3Q49 B;  4JW1 A;  2KZT B;  4HOS A;  3FU3 A;  3FUN A;  1ELW A;  1MQS A;  4CDM A;  4CT0 A;  3ZHE B;  1B89 A;  3FH8 A;  2Y4U A;  4B89 A;  1JWF A;  3CHQ A;  4I1O B;  4FHK A;  3FUF A;  5EX0 A;  3TGO A;  4FJY A;  1HG5 A;  2IU1 A;  4XZ4 A;  2RG8 A;  4HVB A;  2X6I A;  3FUE A;  1PC2 A;  5BT1 A;  1IHG A;  3G2U A;  5LOZ A;  4ABN A;  3Q5M A;  3MX3 A;  4UI9 K;  3SZ7 A;  2KAT A;  1E7V A;  4F53 A;  3MKQ A;  5BUZ A;  2FO7 A;  1X5B A;  2WVI A;  3OAW A;  1OWM A;  4LCT A;  2CG2 A;  2WXG A;  3S2A A;  4NRH B;  4I6E A;  4KVM A;  3VTY A;  3B7T A;  3BG0 B;  1S0P A;  3ESK A;  1HXI A;  3U64 A;  2NSZ A;  4RG6 A;  3FWV A;  3PH0 C;  4GA2 A;  3L17 A;  3QJZ A;  3D3M A;  4N5C A;  1NA3 A;  2C2L A;  3FUL A;  3SI5 A;  4AJW A;  3LKU A;  5ANR A;  5G04 C;  2J08 A;  3SD5 A;  2LAI A;  4A1S A;  4GU5 A;  3L6A A;  3FU5 A;  1OWL A;  4XI0 A;  2PM7 A;  4GMJ A;  5ANL A;  1E90 A;  1PAQ A;  3JQ1 A;  4GZ6 A;  1EPU A;  3ML8 A;  5HQ8 A;  4FAD A;  3TJP A;  3Q4A B;  1HX8 A;  3GYZ A;  4OVV A;  5BV0 A;  1YA0 A;  1WM5 A;  2IOS A;  4XKB A;  3R9A B;  3L54 A;  4BSX A;  3CVX A;  1NZN A;  3PEU B;  3FU0 A;  3D9J A;  2WM9 A;  4FC8 A;  4ILI A;  2CFU A;  1Z3X A;  2EQX A;  4HFG A;  2AXU A;  4WUY A;  1NA0 A;  3IKO B;  4BT8 A;  3L16 A;  3MV2 B;  4LRZ A;  5EDS A;  4J8D A;  4ILH B;  4FJZ A;  3CEQ A;  3QAQ A;  3QAR A;  3P1U A;  2WXI A;  1HG2 A;  3BEE A;  3D9N A;  3GZ2 A;  4UI9 C;  3SGH A;  4L2Y A;  3D9I A;  5AIJ A;  4LUN U;  3CVP A;  3HHM A;  3FTX A;  4TV3 A;  3MZL B;  5FJY A;  3S7J A;  2PQN A;  5C2Y A;  3MKR A;  3O4Z A;  4E6H A;  3CSF A;  1BPO A;  5DIZ A;  3MJW A;  5BPP A;  4U0Z A;  2HR2 A;  4U04 A;  3HDX A;  3LVQ E;  4EZK A;  3EIQ C;  2VGX B;  3FUK A;  1Z3Y A;  3CVV A;  3QC1 A;  1ZU2 A;  1QZ2 A;  2WMO A;  3CKC A;  4I2Z A;  3IBE A;  2WXR A;  3L13 A;  3OXL A;  2GRL A;  4XI9 A;  4BWR A;  3U4T A;  5FQ4 A;  4FA6 A;  1WY6 A;  2CG3 A;  3FUH A;  2BF0 X;  2XCB A;  2PZI A;  2LO6 A;  3LEW A;  4AP2 A;  2V5F A;  3CGH A;  2P58 C;  2AXV A;  4CGW A;  3D9L A;  4GCO A;  5FZQ A;  4A1G A;  4MKT A;  2J4B A;  3VLF A;  4J8S A;  5LFA A;  4FLH A;  4G24 A;  3CVY A;  2ION A;  1H19 A;  3PZD A;  3PUJ A;  4JVS A;  1ELR A;  3SF4 A;  2WXQ A;  4JZY A;  5CHE E;  3ZW3 A;  4GAA A;  1SZA A;  2I6H A;  3WXX A;  3S7D A;  1A17 A;  4KZC A;  4GZ3 A;  2QFC A;  2XHE A;  5LP0 A;  2VJ8 A;  3SBS A;  3FHE A;  3MKQ B;  4GA0 A;  5CCM A;  4DPR A;  2A4Z A;  5E76 A;  4ANV A;  5G55 A;  4EQF A;  1UN8 A;  4N2Q A;  2NXP A;  5T3R A;  5AJL A;  2WXN A;  3APD A;  3AS5 A;  4UWG A;  1GW6 A;  1IQU A;  1HS6 A;  1N52 A;  4BFR A;  2Y4T A;  3RKV A;  4I2W A;  1IQR A;  4ME2 A;  3CST A;  1OWO A;  2KM4 A;  5FQ6 A;  5KJL A;  3OXF A;  4EBA G;  2R59 A;  1Y8M A;  3EHM A;  2MOW A;  4J0U A;  3FTZ A;  4L2L A;  5G04 J;  1E8W A;  1UN9 A;  1Z6T A;  2J49 A;  2UY1 A;  2WQH A;  3JQ0 A;  3ASG A;  2L0I A;  4G2V A;  4HOU A;  4IRU A;  3TXN A;  2ILR A;  1U3C A;  3Q15 A;  4GZ5 A;  3R7R A;  2L9B A;  3CVU A;  4ANU A;  4J6I A;  5JJT A;  5BV1 A;  3TG4 A;  3D9M A;  4AY6 A;  1FVH A;  3R7Q A;  4AIF A;  2I2O A;  2HO1 A;  5G05 C;  3LXU X;  4G23 A;  2X6J A;  2X6F A;  3RO3 A;  4C0M A;  3FU6 A;  2JLB A;  3FDH A;  3MCX A;  3CHS A;  3RU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...