3U4TA

Crystal structure of the c-terminal part of the tpr repeat-containing protein q11ti6_cyth3 from cytophaga hutchinsonii. northeast structural genomics consortium target chr11b.
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
258
structure length
258
Chain Sequence
VEFRYADFLFKNNNYAEAIEVFNKLEAKKYNSPYIYNRRAVCYYELAKYDLAQKDIETYFSKVNATKAKSADFEYYGKILMKKGQDSLAIQQYQAAVDRDTTRLDMYGQIGSYFYNKGNFPLAIQYMEKQIRPTTTDPKVFYELGQAYYYNKEYVKADSSFVKVLELKPNIYIGYLWRARANAAQDPDTKQGLAKPYYEKLIEVCAPGGAKYKDELIEANEYIAYYYTINRDKVKADAAWKNILALDPTNKKAIDGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords TPR repeat-containing protein
publication title Crystal Structure of the C-terminal part of the TPR repeat-containing protein Q11TI6_CYTH3 from Cytophaga hutchinsonii.
rcsb
source organism Cytophaga hutchinsonii
total genus 95
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07719 TPR_2 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3u4tA00
3ULQA 1ELRA 3CV0A 2GW1A 3LY8A 2FO7A 5BW8C 5BT1A 5D0QD 3TG4A 4YNDA 3FP3A 3N71A 2XEVA 4U07A 5AYWD 3CVLA 3LYAA 4BT8A 1A17A 4WNFA 5FZQA 4N3BA 3OXGA 4XI0A 2PQNA 3PDNA 4WNDA 2QFCA 4NQ0A 3ESKA 3Q47B 4G1TA 2FI7A 4HOSA 3Q49B 5CCLA 4O6FA 3SF4A 4JA9A 5CCMA 3LY9A 3OXLA 4I2ZA 1NA3A 3AS8A 2WPVA 4XI9A 1YA0A 4GA0A 2VGYA 2LNIA 4HOUA 3ZGQA 4U04A 3QOUA 4I17A 3U3WA 1FCHA 3LY7A 2L6JA 3VTXA 2LSUA 4HOTA 4GZ3A 5D0OD 4F3VA 4B94A 2PL2A 2P58C 5ARFA 1ZU2A 4G25A 4CGWA 1B89A 4GCOA 2HO1A 2OOEA 2R5SA 3AS4A 5G04J 3RU0A 4RG9A 4IN3B 4U0SA 1HZ4A 3ASDA 4BT9A 3S7DA 5LCWC 3QDNA 2XGSA 3CVPA 3CEQA 2BUGA 5HI7A 4G26A 5KJMA 3RIBA 2XPIA 4UQYA 3KD7A 5FT9A 3UPVA 4JA7A 1WAO1 4LEUA 1PC2A 4GYWA 4A1SA 5KJLA 2ONDA 5EKQD 4EQFA 4I2WA 4W9RA 2VGXB 2WQHA 4GZ6A 4N39A 2VSYA 3VTYA 1W3BA 1IHGA 5CHEE 1OUVA 1P5QA 4U0ZA 3U4TA 4AY6A 2C2LA 3ZHEA 2YHCA 2KATA 5JJ7A 2VYIA 1HXIA 4UQZA 3ZFWA 4UI9C 4N2QA 2XGMA 4I9EA 3RJVA 2FBNA 4N5CA 3TAXA 4H7XA 3ASGA 2HYZA 3OXFA 2J9QA 4KYOB 2VQ2A 3QWPA 2DBAA 5G05C 3KAEA 3UUXA 2KC7A 2VSNA 5M72A 3GYZA 3NF1A 3TGOA 3ASFA 4WUYA 3GZ1A 2V5FA 4GA1A 5KJKA 2FEZA 1ELWA 2FF4A 2AVPA 5C1DA 2XGOA 4APOA 3RKVA 4BWRA 4J8FA 1QQEA 3S7FA 2LSVA 1HH8A 4J8EA 3RO3A 4ME2A 1Y8MA 3PE4A 3WXXA 4Y6CA 4RG6A 5BNWA 1WM5A 2KCLA 4HOQA 3R9AB 5DBKA 1NZNA 4KXKB 5A7DB 2NC9A 4G2VA 3Q15A 2IF4A 1XNFA 2YQ8A 2KCKA 4CGVA 3CK8A 2UY1B 5DIZA 3AS5A 3LPZA 3CKBA 4GYYA 5KJNA 3KS2A 4BTBA 2MHKA 3MEKA 3E4BA 2PQRA 3FFLA 3IEGA 1KT1A 3RO2A 5G04C 4AIFA 3MA5A 2UY1A 4NRHB 1KT0A 3TG5A 2E2EA 3ZPJA 4N3AA 3QWWA 3GZ2A 3ZN3A 4N3CA 4GCNA 4I9CA 4YVOA 2VGXA 3BEEA 3UQ3A 3K9IA 1NA0A 4CDRA 5JJTA 4HORA 5EX0A 5FZRA 5FTPA 2XCCA 4YVQC 4AM9A 5HQ8A 4U0UA 4H7YA 4ABNA 4N2SA 4UQXA 4JL0A 3CK9A 3QWVA 2KCVA 3SZ7A 3QKYA 5FZSA 4J8DA 4GPKA 4BTAA 3CKCA 5JJ6A 1E96B 2Y4TA 3Q4AB 4WNGA 4GYOA 4J0UA 2JLBA 2HR2A 3URZA 5ARGA 3LCAA 4JHRA 3MV2B 5EX3A 3CVQA 3S7JA 3ASHA 3O48A 5LCWJ 1QZ2A 3S7BA 2PZIA 4Y6WA 3JYSA 3Q5MA 5FJYA 3MV3B 2Q7FA 1KLXA 4GZ5A 3PE3A 4G23A 3LKUA 4KBQA 3HYMB 1IYGA 3GW4A 2Y4UA 4UI9K 4I1AA 4AY5A 2XCBA 3CVNA 3EDTB 3FWVA 2IFUA 1TJCA 2C0LA 3ZHEB 4UI9J 4XIFA 2UWJG 2I6HA 4G24A 1ZBPA 3MKRA 3CK7A 5G05J 4WNEA 5A6CA 2C0MA 4GA2A
chains in the Genus database with same CATH superfamily
2WQ7A 2FO7A 3CIAA 3L13A 4G8LA 2XRZA 4KMOA 3UM3A 3TG4A 2H6FA 5ANRA 4ANXA 4XE0A 4EHMA 3I3NA 4DPRA 2IOLA 2KZTB 4N3BA 2DZNA 2EIJE 4D10C 1TN8A 3IHYA 3UT7A 1N0QA 2LUHA 3KSQA 4A63B 2QFCA 2Y3AA 3IHVA 4NQ0A 4AJWA 3TWQA 2B0OE 1K8KG 3Q49B 5CCLA 4Q69A 4QFVA 4I6GA 2X6KA 4JA9A 3C3QA 2KM4A 3ONLA 2IU1A 4KT6B 1JCQA 2CHZA 3G2WA 3U64A 4BX8A 2OVFA 4HRLA 4U04A 4KZ0A 3U3WA 3EU9A 3SO8A 3DSSA 3CVUA 3FU5A 4GZ3A 4K0RA 3AJIA 4B94A 1ZU2A 4CGWA 1B89A 5FQ6A 1G3NB 1TNYA 4HI9A 2QY7A 1H19A 1DCEA 3TXMA 3S7DA 1N11A 2R02A 5LCWC 4YDEA 3QDNA 3CVPA 3ZYLA 3RIBA 3UM1A 1N95A 4UQYA 3ZYKA 4JA7A 3MKQB 5FIOA 2IEJA 4GTQA 1BD8A 1PC2A 2X6JA 4AXHA 1BI8B 3PZ1A 1TR4A 5KCMA 2HE0A 2WMOA 3I4RB 3FTWA 4N39A 3B95A 2CFUA 4NURA 5EN5D 1H2TC 3ZEFA 4BESA 3QJZA 4U0ZA 4C0EA 2C2LA 3ZHEA 3MKQA 4MLPA 2YHCA 3B7RL 4FC8A 3RRUA 2FBNA 4DX5D 5BUZA 4H7XA 3ASGA 3X2QE 4TXQA 2HYZA 4KYOB 1JWGA 1LF8A 2VQ2A 2V4LA 5FINA 3QWPA 2DBAA 1N4QA 5CEDB 5D66A 3UI2A 5B3SE 4RVBA 1AWCB 3UUXA 1E8YA 2KC7A 5BXOA 4QQIA 2XHEA 3L82A 3GYZA 3NF1A 2GRNB 3GZ1A 4URKA 2WQ6A 4U8YD 2YNQA 3DEPA 2A5UA 3PNLB 2XGOA 3E30A 3RKVA 3ZXPA 3UT8A 4BY6A 3C3RA 5KNHD 3R7RA 4P29A 1JCSA 4AVXA 4J8EA 4BETA 3PE4A 3WXXA 4XEIG 2GRLA 2A4ZA 3TWUA 1WM5A 2X38A 2A5EA 5C2YA 4HOQA 5T3RA 1AP7A 1VDYA 1V55E 1NZNA 4ANUA 3GZSA 3FEYA 3FUMA 1SW6A 4OAVB 3V30A 3T8MA 5ENSD 1K3ZD 4XKCA 4GTPA 4HNAD 2MYOA 1E8WA 1FT1A 4UWFA 3CKBA 3C3OA 1SA4A 3QAQA 2MHKA 1NP7A 1OWMA 3MEKA 3E4BA 5HS0A 3IXEA 3FUNA 1KT1A 2DYSE 4AIFA 4DI4A 4EZKA 4B8AA 2E2EA 4ZFHA 4GTRA 3FUFA 3ZPJA 2BEDA 3QWWA 1OCZE 3APFA 3NZSA 4N3CA 5CMYA 2RFAA 3MCXA 3MYVA 3JQ0A 2Y0BG 4HORA 4J8SA 4FA6A 1LD8A 3DSTA 3LDZA 1V54E 5ENQD 1IXVA 1OWNA 4AM9A 3PEUB 2L9BA 5HQ8A 4U0UA 3D3MA 3R7QA 3PS6A 2RG8A 5T8IA 3D9MA 2DYRE 3D9IA 4JL0A 2KCVA 2J07A 3QKYA 2I1KA 4J8DA 1WG0A 1OWOA 4L23A 3UM0A 5JJ6A 1PAQA 4GTOA 3HVEB 2JLBA 2HR2A 3URZA 2PM6A 5LP0A 4LCTA 4IULA 5FQ7A 3CVQA 3RRNB 1O1SA 2I1JA 3S7JA 2L0TB 2LAIA 3O48A 3UIPC 1N52A 2PZIA 3DSWA 3Q5MA 5FJYA 3CHRA 1UN8A 3ABME 2LXLA 4PS8A 3LKUA 3HYMB 3BG0B 4CDMA 3JCKC 1IYGA 4K03A 4RLYA 3GW4A 4Q96A 3HHMA 4UWHA 5LX8A 3SBSA 3CHSA 3CSTA 5AAOA 4APFA 2XCBA 2QC9A 1BU9A 3E32A 3E37A 4WWNA 5EIDA 4DUIA 4B8CB 4LRZA 2CG3A 4DJAA 4PUCA 3D9KA 3ASOE 3LXUX 3U9WA 3Q73A 5G05J 3UIOC 1N4SA 2X6FA 3ULQA 2GW1A 3Q7FA 3QNKA 4XKBA 4OVUA 5D0QD 4AP2A 4YNDA 2XPZA 2XEEA 2PNNA 2XEVA 4U07A 1D8EA 4BT8A 1A17A 3OXGA 4EZJA 3QK0A 3AG4E 1DVPA 4C0MA 4GTTA 4JHJA 2IQCA 3B13A 3OXLA 3P1UA 2KXPC 2WPVA 3AS8A 4XI9A 1YA0A 3AU4A 4AEZC 2L6BA 2LNIA 4U63A 3W9FA 3SFZA 4UWKA 3LY7A 5AIJA 5G2NA 4HOTA 5LOZA 3J5PA 5D0OD 4DRXE 5HRYA 4KVMA 2PL2A 3G2VA 2P58C 5ARFA 2GRMA 4F7AA 1ZB1A 3L54A 4DI3A 4G25A 1NFIE 4GCOA 3JUEA 4L9PA 3FEXA 3AS4A 3RU0A 4RG9A 4U0SA 3ASDA 4BT9A 1MHQA 2V0PA 4G26A 2H6IA 2XPIA 5CBOA 1WAO1 4BFRA 5KJLA 1HS6A 3HRAA 1SVXA 2KBXA 2WQHA 2X3MA 3VLEA 1WY6A 3NAWA 2E0IA 2VSYA 1N4RA 2AXZA 1HO8A 4FJYA 4I6JA 1FT2A 4AY6A 4NACA 2PM7A 5CBNA 2ILRA 3APDA 5CRUA 1QNFA 4UQZA 5EYPF 1Z5SC 2YHEA 3ZFWA 3TWWA 3LJ3A 4UI9C 1N9AA 3EIJA 4TXPA 3TAXA 4JB8P 1MX2A 4HI8A 4IYPA 3FTVA 2V4HC 1MX4A 4DX1A 4YDYA 2J09A 3HIZA 3TGOA 4FLBA 4DLQA 4GZDA 3ASFA 4O60A 4FADA 2V5FA 2XENA 4GA1A 3DXKG 3FTSA 3ULEG 1ELWA 2AVPA 2KZTA 1L5JA 4APOA 3KEAA 5KWDA 1OCRE 3RRMB 2M63A 4HVBA 4BWRA 2NSZA 1E8ZA 1QQEA 3AG3E 1UJKA 3S7FA 2LSVA 4K5CA 1HH8A 1N54A 3L6AA 2GRPB 1NI1A 4FLHA 3ONKA 4OYSA 1H2VC 4ME2A 2B6CA 2QYJA 1Y8MA 1IKND 4V3IA 4RG6A 4MRUA 3R9AB 3ASNE 1S0PA 4CYMD 3DSUA 4KXKB 3NZUA 2ZU6B 5ENTD 3SY2A 1TYQG 2NC9A 3D9JA 2XS1A 2HM8A 4G2VA 3Q15A 2IF4A 3D9HA 2KCKA 2OV8A 4CGVA 2UY1B 3DPDA 3AS5A 2OEWA 3SFXA 3OTNA 3TL5A 4RSYA 2R03A 1H6PA 3V79K 4X8QA 1MYOA 1TNBA 4JPSA 5JMND 3UKRG 3PZ3A 3QB2A 2BKKB 5J90A 1NL4A 3EUVA 1N0RA 1QBQA 2DZOA 1K1BA 3DPYA 2P9KG 2UY1A 1KT0A 4KZCA 4N3AA 4IRUA 4ATGA 3MZLB 1FPPA 5G55A 2ETBA 4YVOA 4BSZB 2EIKE 2IO2C 1H2UA 3UQ3A 1NA0A 1JPLA 5JJTA 4BERA 4GMLA 4MS6A 4PS7A 3AG2E 2ETCA 3L16A 1OCCE 3FU0A 2X6IA 5EIBE 2VSXE 4CCAA 2IONA 4H7YA 3L17A 4N2SA 2WXHA 2OEVA 2H6HA 3SI5A 5FZSA 1OCOE 5LFAA 3SGHA 4A3TA 1SA5A 3CKCA 3LVQE 1E96B 2Y4TA 2WXKA 4EZLA 2P9IG 3T5XA 4TXRA 4GB9A 1O5MA 2XEHA 5JHBA 3TWSA 2LAHA 1E8XA 2Y69E 3ABLE 2H6GA 4LNUD 5EX3A 2MOWA 3E33A 2FULA 3CSFA 1HG5A 4DX6D 3FUDA 3KSLA 3Q75A 4Y6WA 1D8DA 3EHRA 3I4GA 5BPPA 2DCPA 1KLXA 2F0YA 3PE3A 3EHMA 3CQGB 3BQOA 3FUEA 3BG1B 1X5BA 2WXGA 1Z6TA 4HLLA 3MJWA 2Y4UA 4BX9A 2XPYA 4B89A 4JZYA 4I1AA 4GTVA 3CVNA 2CFZA 3EDTB 5EDSA 1FVHA 3Q9UC 1TJCA 1HX8A 4DX2A 3CGHA 4K5AB 3CVXA 1OWLA 4G11A 5A6CA 2FO1E 2C0MA 4FULA 1ELRA 3CV0A 2BKGA 1E7VA 3Q78A 1RW2A 4MKTA 5BT1A 2R17C 3TJPA 3AG1E 4GU5A 3FP3A 4J6IA 4FJZA 3L9TA 3LYAA 3RSEG 4ANVA 1Q2ZA 5FZQA 1DCQA 2OCCE 3FH5A 3CHPA 1JUQA 4XI0A 3PDNA 4CT0A 4WNDA 3PRZA 2I9CA 3ESKA 3FUJA 3Q47B 4G1TA 4A3VA 1DC2A 4O6FA 1EPUA 3SF4A 3TXNA 2EIME 4ILIA 4HBDA 3UM2A 3TWTA 5KBAA 2ZGDA 4I2ZA 2LXMA 1NA3A 3DRAA 1PY1A 2XS8A 4GA0A 2VGYA 1D9SA 3HVEA 3SBTB 1EF1C 3ZGQA 4CZ2D 1A5EA 3QOUA 2WVIA 4I17A 1Z3XA 4A1GA 3ZVVA 4TRQA 2L6JA 3UXGA 4F3VA 4F53A 1SQMA 5FQ8A 2HO1A 2OOEA 4F6RD 2WXMA 2R5SA 3PREA 5G04J 4HXIA 3FDHA 5KNGA 1RZ4A 4IN3B 1HZ4A 1Y6IA 3TWRA 3PZ4A 2XGSA 3CEQA 5HI7A 5ANLA 1E7UA 2EINE 3JUIA 5KJMA 1SZ9A 2WXLA 4LEUA 5ENNA 3NQPA 4CDNA 3SFYA 4HRMB 4LUNU 4OAUC 4GYWA 3SNXA 1TNUA 4A1SA 1INZA 2XRYA 2ONDA 5EKQD 4EQFA 4W9RA 2VGXB 3UX4A 3LJNA 4GZ6A 3C5RA 3WG7E 4NIKA 1HFAA 3FUIA 2VTBB 4HQDA 1MX6A 4LERA 1P5QA 3VLDA 5EYLA 3U4TA 4DK5A 3ZU7B 1QYMA 5JJ7A 2KATA 2VSOE 2VYIA 1HG2A 2DVWA 1EDUA 3V2OA 4BSXA 3ABKE 3T5VA 4XZ4A 4JXTA 3PUKA 3SHFA 3HXFA 4L2YA 4U95D 2J9QA 3FU3A 2WXQA 5G05C 3APCA 2J4BA 1BLXB 5M72A 2GRQB 5HKPA 1DNPA 4WUYA 2IOSA 1X81A 1S64A 2WXFA 2FEZA 4JC8A 2ZISA 2FF4A 3OAWA 2LO6A 1OY3D 3FH7A 3HXEA 4U96D 3ZYMA 3LS8A 2VJ8A 3EIQC 5JA4D 3C98A 1S63A 3ZKJA 4GMRA 4UWLA 2IO3C 5FQ4A 3IBEA 3FULA 5AQ7A 2DIWA 1OWPA 3MX3A 3FTYA 5BNWA 5JHAA 1HE8A 1XGWA 4JW1A 2ZGGA 2GROB 3QC1A 5BXUA 4L2LA 5A7DB 4JEUA 3HXDA 1MZCA 2YQ8A 4L7TA 3BUAA 3CK8A 5DIZA 3C72A 1OXJA 3LPZA 3PZDA 3V31A 4J7WA 4M3OA 3KS2A 2WXOA 4XX5A 5A23A 3R9MA 3FFLA 3RO2A 2V5QC 4HFGA 1JWFA 3MA5A 3PNTB 5E75A 3ZXSA 3L08A 1KZPA 3JQ1A 3CHQA 2WXPA 3ESLA 4I9CA 1MQSA 4C48B 3BEEA 4RQIA 3K9IA 4U7EB 2J08A 4E6HA 1S70B 4CDRA 5EX0A 3FU6A 2XCCA 4YVQC 4LNGA 3UINC 3CVYA 4ABNA 2J8SD 2QYUA 2AW6A 2MRIA 4BTAA 3QARA 1ELKA 5AARA 5ENOD 3Q4AB 3CQCB 5AQBA 3EHNA 2GRRB 4GYOA 4CT4A 3NB2A 5ARGA 3Q9NC 4JHRA 3MV2B 5EILA 3EHQA 3IKOB 3JXJA 3ASHA 5LCWJ 3RK6A 3FY4A 4UWGA 1HF8A 4Q94A 3EJNA 3JXIA 4B93B 1FVFA 2Q7FA 3LEWA 2DWZA 1YMPA 4G23A 4GZCA 1GW6A 4L1BA 1UOHA 1HU3A 4UI9K 3PZ2A 2RD0A 5E76A 3CVWA 2IFUA 4PS3A 3ZHEB 2IJGX 3UTMA 3FUKA 2BF0X 3FTXA 3G2UA 4G24A 4PDXA 4M7CA 2ZIRA 5H7PA 3MKRA 2IY0C 2JABA 3CK7A 3RAUA 4GPMA 3B7TA 4C9BB 2J4DA 4HS2A 3LY8A 3DSXA 4GTSA 3L22A 5BW8C 4ANWA 3D9OA 5AJLA 2QZAA 3N71A 4FHKA 5AYWD 3CVLA 1TNOA 3FTZA 4WNFA 4DLOA 5BV0A 5AQAA 3PEVB 4Z68A 3ZIMA 4AOFA 2R05A 2PQNA 3ZW3A 4EPZA 1O1TA 4K5BA 1O1RA 1UW4B 5ENPD 2FI7A 4ZHBA 4HOSA 4ACKA 5CERB 2WB2A 1U3DA 5CCMA 3LY9A 2NXPA 1WDYA 3CR3A 3PVLA 4HOUA 3FUHA 1FCHA 2EQXA 3VTXA 3Q7AA 2LSUA 3ML8A 2XQ0A 3ZYQA 5AQ9A 3TWXA 3UMVA 3ZNGA 4ATZD 4U8VD 3G2SA 3V2XA 5J08A 3LVRE 5BV1A 3Q79A 1TEZA 4TUUA 2WXNA 2BUGA 2P9NG 4O1PA 2P9UG 4HB5A 3KD7A 5FT9A 3UPVA 2CHXA 1H6OA 3UKUG 3CLJA 2JEKA 1TN7A 1OT8A 3B7SA 5AJDA 2L0IA 4I2WA 4AV7A 3CHMA 5B1AE 4TV3A 2EILE 3VTYA 1W3BA 1IHGA 5CHEE 3SD5A 3DWLG 1OUVA 4UUCA 3F6QA 2I2OA 2AXVA 1HXIA 3HG0D 2P9SG 1JCRA 2F8XK 3I5PA 4N2QA 2XGMA 4I9EA 3RJVA 4CRWA 4KVOA 3B7BA 2X6HA 4N5CA 2ETAA 2R2LA 3OXFA 3HXCA 4ILGA 5FWQA 3TWVA 4YDWA 2AXUA 3KAEA 4JVSA 3ML9A 2VSNA 5AN8A 1UJJA 5KJKA 3PUJA 2WMNA 4JEHA 5C1DA 3CVVA 3DSVA 2XZTG 3ZRHA 2F8YA 4YDOA 4ACLA 4J8FA 2WXJA 3G2TA 2F37A 2P2CP 3AAAC 4I43A 3RO3A 4WWPA 3ENEA 4Y6CA 1H6KA 3J5QB 2CHWA 3B7UX 2KCLA 5DBKA 5T4YA 2Y1LE 4EBAG 2R59A 1N4PA 2V8SE 1XNFA 4HLEA 3D9NA 3FH8A 4R7LA 4O1OA 3HDXA 4GYYA 4I1OB 5KJNA 3VLFA 4BTBA 4LSZE 1TN6A 4TUMA 4JD2G 2PQRA 1UG3A 1IHBA 3IEGA 1H0AA 4EBAA 4FHJA 5G04C 3ZUVB 5IY5E 4WWOA 4FP7A 4NRHB 3TG5A 4GAAA 2VGEA 5CMWA 3GZ2A 3ZN3A 1E90A 4GCNA 4I6EA 3BU8A 1MJ0A 1YYHA 1U3CA 2WXRA 2VGXA 4U8HA 5ITZF 4F1SA 4WAFA 4N5QA 5FZRA 3AU5A 2VTBA 5FTPA 2GGFA 2NYJA 3ISMC 1KPSB 3S2AA 4DX7D 4BEPA 1U2VG 1TNZA 4UQXA 4B0ZA 3DXMG 2YINA 3CK9A 3QWVA 3NOGD 3SZ7A 3ULYA 3FHEA 4GPKA 4GMJA 1YCSB 4LG6A 1BPOA 2CG2A 3W9GA 3P2BA 1EYHA 4WNGA 4J0UA 1KZOA 2AWIA 1UN9A 4A55A 3LCAA 3CHOA 4MBGA 5AENA 2AJAA 2P9PG 4I1MA 1LTXA 2OVBA 5B1BE 2XZDG 2J49A 3E34A 1BI7B 1TJFA 4FU3A 3D9PA 4J8YA 1N94A 4OVVA 1QZ2A 3PH0C 3S7BA 5ENRD 3JYSA 3NBNB 3DBSA 1K1AA 3MV3B 5D2MC 3T8KA 1IQUA 4GZ5A 4JHKA 2P9LG 3HXBA 2RKKA 4E85A 4G8KA 4KBQA 2WXIA 3DEOA 3SQVA 1IQRA 4GTMA 3T9KA 2RFMA 4F1PA 3NOCD 2BTDA 4LNBA 4PH4B 4AY5A 3U66A 3FWVA 1Z3YA 2C0LA 3O4ZA 4UI9J 4XIFA 1LD7A 2ZXWE 4HRNA 2UWJG 5CRVA 4ILHB 3UT4A 4CEMA 2I6HA 5CEAA 3MGBA 3FTUA 4EECA 2WM9A 1ZBPA 3D9LA 4WNEA 5CECB 1SZAA 3IV0A 3KEZA 3EU5A 4GA2A
chains in the Genus database with same CATH topology
4C9BB 3ULQA 4FULA 1ELRA 3CV0A 2GW1A 1E7VA 3QNKA 2J4DA 4HS2A 3LY8A 2WQ7A 2FO7A 3CIAA 3L13A 4XKBA 2XRZA 4KMOA 4OVUA 3L22A 4MKTA 5BW8C 4ANWA 5D0QD 4AP2A 5BT1A 3TG4A 5ANRA 4ANXA 4YNDA 4XE0A 2R17C 3D9OA 3TJPA 2XPZA 5AJLA 4GU5A 3I3NA 3FP3A 4DPRA 4J6IA 3N71A 4FJZA 2XEVA 4U07A 4FHKA 5AYWD 2IOLA 2KZTB 3CVLA 3LYAA 4ANVA 4BT8A 1A17A 4WNFA 3FTZA 4DLOA 5BV0A 5FZQA 3PEVB 4N3BA 3FH5A 3CHPA 3OXGA 4D10C 1JUQA 3ZIMA 4AOFA 4XI0A 4EZJA 2PQNA 3PDNA 3ZW3A 4CT0A 3QK0A 4WNDA 3IHYA 3PRZA 3UT7A 4EPZA 2I9CA 1UW4B 2QFCA 2Y3AA 3IHVA 4NQ0A 3ESKA 4AJWA 3FUJA 3Q47B 4G1TA 2FI7A 4A3VA 1DVPA 4C0MA 4HOSA 3Q49B 4ACKA 5CCLA 4O6FA 1EPUA 3SF4A 4Q69A 1U3DA 2WB2A 4QFVA 3TXNA 4I6GA 4JHJA 4ILIA 2X6KA 2IQCA 3B13A 4JA9A 5CCMA 2KM4A 3LY9A 3ONLA 2NXPA 2IU1A 4KT6B 3OXLA 4I2ZA 2CHZA 3G2WA 1NA3A 3P1UA 1PY1A 3U64A 3AS8A 2WPVA 3CR3A 4XI9A 1YA0A 3AU4A 4AEZC 4GA0A 4BX8A 2VGYA 2OVFA 3HVEA 2LNIA 1EF1C 3PVLA 3SBTB 4HOUA 4U63A 3ZGQA 4U04A 3FUHA 4KZ0A 3QOUA 2WVIA 4I17A 1Z3XA 3SFZA 3U3WA 4A1GA 1FCHA 4UWKA 3LY7A 4TRQA 3ZVVA 2EQXA 2L6JA 3VTXA 5AIJA 3CVUA 2LSUA 3FU5A 5G2NA 4HOTA 4GZ3A 5LOZA 4K0RA 5D0OD 4F3VA 3ML8A 4KVMA 4B94A 2PL2A 4F53A 3G2VA 2P58C 5ARFA 1SQMA 2GRMA 4AV7A 1ZU2A 4F7AA 2XQ0A 3ZYQA 3L54A 4DI3A 4G25A 5FQ8A 4CGWA 1B89A 4GCOA 2HO1A 5FQ6A 2OOEA 3UMVA 3FEXA 2WXMA 2R5SA 3AS4A 3PREA 4HXIA 5G04J 3FDHA 3RU0A 3G2SA 4RG9A 4IN3B 4U0SA 1HZ4A 2QY7A 3ASDA 4BT9A 3LVRE 1H19A 1Y6IA 5J08A 3TXMA 5BV1A 3S7DA 1TEZA 5LCWC 4TUUA 3QDNA 2XGSA 1MHQA 3CVPA 2V0PA 2WXNA 3CEQA 2BUGA 5HI7A 3ZYLA 4G26A 1E7UA 3JUIA 5ANLA 3RIBA 5KJMA 1SZ9A 2XPIA 4UQYA 3KD7A 5FT9A 3ZYKA 3UPVA 4JA7A 1WAO1 2CHXA 2WXLA 3MKQB 4LEUA 5ENNA 3NQPA 3CLJA 2JEKA 4CDNA 4LUNU 1PC2A 4GYWA 3SNXA 4BFRA 3B7SA 2X6JA 4A1SA 1INZA 2XRYA 4AXHA 5KJLA 2ONDA 5EKQD 4EQFA 5AJDA 1HS6A 5KCMA 2L0IA 4I2WA 4W9RA 2VGXB 2WMOA 2WQHA 2X3MA 3CHMA 3I4RB 3FTWA 1WY6A 4GZ6A 3UX4A 3VLEA 2E0IA 4TV3A 4N39A 2C0MA 2VSYA 3VTYA 1W3BA 1IHGA 2CFUA 2AXZA 4NURA 1HFAA 1H2TC 1HO8A 3FUIA 3ZEFA 2VTBB 5CHEE 3QJZA 3SD5A 1OUVA 4FJYA 4LERA 1P5QA 3VLDA 4I6JA 4U0ZA 4C0EA 3U4TA 4DK5A 4AY6A 4NACA 2C2LA 2PM7A 3MKQA 4MLPA 3ZHEA 2YHCA 2KATA 2VSOE 2I2OA 5JJ7A 2VYIA 2AXVA 2ILRA 3APDA 1HG2A 3B7RL 1HXIA 1QNFA 4UQZA 2YHEA 3ZFWA 1EDUA 3I5PA 3LJ3A 4UI9C 4N2QA 2XGMA 4FC8A 4I9EA 3RJVA 3RRUA 4CRWA 3EIJA 4KVOA 4BSXA 3T5VA 2FBNA 4XZ4A 4JXTA 2X6HA 4N5CA 3TAXA 3PUKA 4H7XA 3SHFA 5BUZA 3ASGA 4IYPA 2HYZA 4L2YA 3OXFA 2J9QA 3FTVA 3FU3A 4KYOB 1JWGA 1LF8A 2VQ2A 2V4LA 3QWPA 4ILGA 2DBAA 2WXQA 5FWQA 5G05C 3APCA 2AXUA 3KAEA 4JVSA 2J4BA 4RVBA 3UUXA 1E8YA 3ML9A 5BNWA 2KC7A 2VSNA 5M72A 2XHEA 2J09A 3GYZA 3HIZA 3NF1A 3TGOA 4FLBA 4DLQA 4GZDA 1DNPA 3ASFA 4FADA 4WUYA 3GZ1A 2IOSA 4URKA 2V5FA 1UJJA 2WXFA 4GA1A 5KJKA 2FEZA 3PUJA 4JC8A 3FTSA 2WMNA 1ELWA 2FF4A 3OAWA 2WQ6A 2LO6A 4JEHA 2AVPA 2YNQA 5C1DA 2KZTA 1L5JA 2A5UA 3FH7A 3PNLB 3CVVA 2XGOA 4APOA 3RKVA 3ZRHA 3RRMB 3ZYMA 2M63A 3LS8A 4HVBA 3UT8A 4BY6A 4BWRA 2VJ8A 4ACLA 3EIQC 2NSZA 3C98A 4J8FA 2WXJA 3G2TA 1E8ZA 3R7RA 1QQEA 1UJKA 3S7FA 2LSVA 1HH8A 1N54A 3L6AA 4P29A 4I43A 4UWLA 4FLHA 4AVXA 3ONKA 4J8EA 1H2VC 4ME2A 4OYSA 5FQ4A 3RO3A 4WWPA 3IBEA 1Y8MA 3FULA 3ENEA 3PE4A 2DIWA 3WXXA 4Y6CA 1OWPA 2GRLA 2A4ZA 1H6KA 3MX3A 4V3IA 3FTYA 4MRUA 1WM5A 2CHWA 2X38A 3B7UX 2KCLA 4HOQA 4RG6A 1HE8A 5C2YA 5T3RA 3R9AB 1XGWA 5DBKA 1VDYA 1NZNA 5T4YA 4JW1A 4ANUA 1S0PA 3QC1A 3GZSA 4EBAG 3FEYA 4L2LA 4KXKB 3NZUA 2ZU6B 5A7DB 2R59A 3FUMA 2NC9A 3D9JA 3T8MA 4JEUA 2HM8A 4G2VA 3Q15A 2IF4A 2V8SE 4XKCA 1XNFA 4HLEA 2YQ8A 2KCKA 2OV8A 4L7TA 4CGVA 3CK8A 3D9NA 2UY1B 3DPDA 5DIZA 1E8WA 3AS5A 3FH8A 4R7LA 4UWFA 3LPZA 3PZDA 3CKBA 3HDXA 4GYYA 3OTNA 3TL5A 4I1OB 4M3OA 4RSYA 5KJNA 3KS2A 3VLFA 3QAQA 4BTBA 2MHKA 1NP7A 2WXOA 4XX5A 1OWMA 5A23A 3MEKA 3E4BA 2PQRA 1UG3A 3FFLA 3FUNA 3IEGA 1H0AA 4EBAA 4JPSA 1KT1A 4FHJA 3QB2A 5J90A 3RO2A 5G04C 4AIFA 4HFGA 4DI4A 4WWOA 1JWFA 4EZKA 4FP7A 3MA5A 3PNTB 2UY1A 4NRHB 1KT0A 3TG5A 2E2EA 5E75A 4B8AA 3FUFA 4KZCA 3ZPJA 3L08A 4GAAA 4N3AA 3ZXSA 4IRUA 4ATGA 3QWWA 5CMWA 3JQ1A 3MZLB 3CHQA 3GZ2A 3ZN3A 3APFA 1E90A 2WXPA 3NZSA 4N3CA 5CMYA 4GCNA 3ESLA 4I9CA 1MQSA 3MCXA 4I6EA 4YVOA 5G55A 3MYVA 1U3CA 2WXRA 2VGXA 3BEEA 4U8HA 1H2UA 3JQ0A 3UQ3A 4F1SA 3K9IA 1NA0A 1JPLA 2J08A 4E6HA 4CDRA 5JJTA 4HORA 4GMLA 4J8SA 4WAFA 5EX0A 4FA6A 4MS6A 3FU6A 3LDZA 5FZRA 3AU5A 2VTBA 5FTPA 4PS7A 2XCCA 2GGFA 4YVQC 3L16A 1OWNA 3FU0A 4AM9A 3PEUB 3S2AA 2X6IA 3CVYA 2L9BA 2VSXE 5HQ8A 4U0UA 3D3MA 2IONA 4CCAA 3R7QA 4H7YA 3L17A 4ABNA 4N2SA 3PS6A 4UQXA 2RG8A 2WXHA 5T8IA 4B0ZA 3D9MA 2YINA 3D9IA 3CK9A 4JL0A 3QWVA 2KCVA 2J07A 3SZ7A 3QKYA 2I1KA 3FHEA 4J8DA 5FZSA 2AW6A 3SI5A 3SGHA 5LFAA 4GPKA 1OWOA 4GMJA 4L23A 2MRIA 4A3TA 4BTAA 3CKCA 5JJ6A 3QARA 1ELKA 3LVQE 1E96B 1BPOA 2Y4TA 3Q4AB 1PAQA 3CQCB 2WXKA 4EZLA 2CG2A 3T5XA 3EHNA 3HVEB 3P2BA 1EYHA 4WNGA 4GYOA 4J0UA 4CT4A 2JLBA 2HR2A 4GB9A 3URZA 2AWIA 5ARGA 5JHBA 1UN9A 4A55A 3LCAA 3CHOA 2PM6A 5AENA 5LP0A 4LCTA 2LAHA 1E8XA 4IULA 4JHRA 4I1MA 5FQ7A 2OVBA 3MV2B 5EX3A 3CVQA 2MOWA 3RRNB 3IKOB 2I1JA 2J49A 3S7JA 2FULA 3CSFA 1TJFA 2L0TB 4FU3A 2LAIA 3ASHA 3O48A 3D9PA 5LCWJ 1HG5A 4OVVA 1QZ2A 1N52A 3FUDA 3PH0C 3S7BA 3RK6A 2PZIA 3FY4A 4UWGA 1HF8A 3JYSA 4Y6WA 3Q5MA 5FJYA 4Q94A 3EJNA 3CHRA 3DBSA 1UN8A 3MV3B 3I4GA 1IQUA 5BPPA 1FVFA 2DCPA 1KLXA 2Q7FA 4GZ5A 3LEWA 4JHKA 3PE3A 3EHMA 4E85A 3CQGB 4PS8A 4G23A 3FUEA 3LKUA 4GZCA 3BG1B 4KBQA 1X5BA 3HYMB 2WXIA 2WXGA 3BG0B 1GW6A 1IQRA 4CDMA 3JCKC 4L1BA 1IYGA 4K03A 1Z6TA 3GW4A 4Q96A 5JHAA 1HU3A 3MJWA 2Y4UA 4BX9A 3HHMA 2XPYA 4UI9K 4UWHA 5LX8A 3SBSA 3CHSA 3CSTA 4B89A 4JZYA 4APFA 4I1AA 2RD0A 2BTDA 4PH4B 5E76A 4AY5A 3U66A 2XCBA 3CVNA 2CFZA 3EDTB 3CVWA 3FWVA 5EDSA 2IFUA 1FVHA 4WWNA 1Z3YA 4PS3A 1TJCA 2C0LA 2IJGX 3O4ZA 3FUKA 4UI9J 4XIFA 3ZHEB 4B8CB 4LRZA 2UWJG 1HX8A 4ILHB 3CGHA 3UT4A 2CG3A 4CEMA 4DJAA 2BF0X 3FTXA 3G2UA 2I6HA 4G24A 4PUCA 4PDXA 3MGBA 3FTUA 1OWLA 3D9KA 3CVXA 4EECA 3LXUX 2WM9A 3U9WA 1ZBPA 3D9LA 3MKRA 3CK7A 5G05J 4WNEA 4G11A 5A6CA 1SZAA 3IV0A 3KEZA 3B7TA 2X6FA 4GA2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ULQ A;  1ELR A;  3CV0 A;  2GW1 A;  3LY8 A;  2FO7 A;  5BW8 C;  5BT1 A;  5D0Q D;  3TG4 A;  4YND A;  3FP3 A;  3N71 A;  2XEV A;  4U07 A;  5AYW D;  3CVL A;  3LYA A;  4BT8 A;  1A17 A;  4WNF A;  5FZQ A;  4N3B A;  3OXG A;  4XI0 A;  2PQN A;  3PDN A;  4WND A;  2QFC A;  4NQ0 A;  3ESK A;  3Q47 B;  4G1T A;  2FI7 A;  4HOS A;  3Q49 B;  5CCL A;  4O6F A;  3SF4 A;  4JA9 A;  5CCM A;  3LY9 A;  3OXL A;  4I2Z A;  1NA3 A;  3AS8 A;  2WPV A;  4XI9 A;  1YA0 A;  4GA0 A;  2VGY A;  2LNI A;  4HOU A;  3ZGQ A;  4U04 A;  3QOU A;  4I17 A;  3U3W A;  1FCH A;  3LY7 A;  2L6J A;  3VTX A;  2LSU A;  4HOT A;  4GZ3 A;  5D0O D;  4F3V A;  4B94 A;  2PL2 A;  2P58 C;  5ARF A;  1ZU2 A;  4G25 A;  4CGW A;  1B89 A;  4GCO A;  2HO1 A;  2OOE A;  2R5S A;  3AS4 A;  5G04 J;  3RU0 A;  4RG9 A;  4IN3 B;  4U0S A;  1HZ4 A;  3ASD A;  4BT9 A;  3S7D A;  5LCW C;  3QDN A;  2XGS A;  3CVP A;  3CEQ A;  2BUG A;  5HI7 A;  4G26 A;  5KJM A;  3RIB A;  2XPI A;  4UQY A;  3KD7 A;  5FT9 A;  3UPV A;  4JA7 A;  1WAO 1;  4LEU A;  1PC2 A;  4GYW A;  4A1S A;  5KJL A;  2OND A;  5EKQ D;  4EQF A;  4I2W A;  4W9R A;  2VGX B;  2WQH A;  4GZ6 A;  4N39 A;  2VSY A;  3VTY A;  1W3B A;  1IHG A;  5CHE E;  1OUV A;  1P5Q A;  4U0Z A;  3U4T A;  4AY6 A;  2C2L A;  3ZHE A;  2YHC A;  2KAT A;  5JJ7 A;  2VYI A;  1HXI A;  4UQZ A;  3ZFW A;  4UI9 C;  4N2Q A;  2XGM A;  4I9E A;  3RJV A;  2FBN A;  4N5C A;  3TAX A;  4H7X A;  3ASG A;  2HYZ A;  3OXF A;  2J9Q A;  4KYO B;  2VQ2 A;  3QWP A;  2DBA A;  5G05 C;  3KAE A;  3UUX A;  2KC7 A;  2VSN A;  5M72 A;  3GYZ A;  3NF1 A;  3TGO A;  3ASF A;  4WUY A;  3GZ1 A;  2V5F A;  4GA1 A;  5KJK A;  2FEZ A;  1ELW A;  2FF4 A;  2AVP A;  5C1D A;  2XGO A;  4APO A;  3RKV A;  4BWR A;  4J8F A;  1QQE A;  3S7F A;  2LSV A;  1HH8 A;  4J8E A;  3RO3 A;  4ME2 A;  1Y8M A;  3PE4 A;  3WXX A;  4Y6C A;  4RG6 A;  5BNW A;  1WM5 A;  2KCL A;  4HOQ A;  3R9A B;  5DBK A;  1NZN A;  4KXK B;  5A7D B;  2NC9 A;  4G2V A;  3Q15 A;  2IF4 A;  1XNF A;  2YQ8 A;  2KCK A;  4CGV A;  3CK8 A;  2UY1 B;  5DIZ A;  3AS5 A;  3LPZ A;  3CKB A;  4GYY A;  5KJN A;  3KS2 A;  4BTB A;  2MHK A;  3MEK A;  3E4B A;  2PQR A;  3FFL A;  3IEG A;  1KT1 A;  3RO2 A;  5G04 C;  4AIF A;  3MA5 A;  2UY1 A;  4NRH B;  1KT0 A;  3TG5 A;  2E2E A;  3ZPJ A;  4N3A A;  3QWW A;  3GZ2 A;  3ZN3 A;  4N3C A;  4GCN A;  4I9C A;  4YVO A;  2VGX A;  3BEE A;  3UQ3 A;  3K9I A;  1NA0 A;  4CDR A;  5JJT A;  4HOR A;  5EX0 A;  5FZR A;  5FTP A;  2XCC A;  4YVQ C;  4AM9 A;  5HQ8 A;  4U0U A;  4H7Y A;  4ABN A;  4N2S A;  4UQX A;  4JL0 A;  3CK9 A;  3QWV A;  2KCV A;  3SZ7 A;  3QKY A;  5FZS A;  4J8D A;  4GPK A;  4BTA A;  3CKC A;  5JJ6 A;  1E96 B;  2Y4T A;  3Q4A B;  4WNG A;  4GYO A;  4J0U A;  2JLB A;  2HR2 A;  3URZ A;  5ARG A;  3LCA A;  4JHR A;  3MV2 B;  5EX3 A;  3CVQ A;  3S7J A;  3ASH A;  3O48 A;  5LCW J;  1QZ2 A;  3S7B A;  2PZI A;  4Y6W A;  3JYS A;  3Q5M A;  5FJY A;  3MV3 B;  2Q7F A;  1KLX A;  4GZ5 A;  3PE3 A;  4G23 A;  3LKU A;  4KBQ A;  3HYM B;  1IYG A;  3GW4 A;  2Y4U A;  4UI9 K;  4I1A A;  4AY5 A;  2XCB A;  3CVN A;  3EDT B;  3FWV A;  2IFU A;  1TJC A;  2C0L A;  3ZHE B;  4UI9 J;  4XIF A;  2UWJ G;  2I6H A;  4G24 A;  1ZBP A;  3MKR A;  3CK7 A;  5G05 J;  4WNE A;  5A6C A;  2C0M A;  4GA2 A; 
#chains in the Genus database with same CATH topology
 2WQ7 A;  2FO7 A;  3CIA A;  3L13 A;  4G8L A;  2XRZ A;  4KMO A;  3UM3 A;  3TG4 A;  2H6F A;  5ANR A;  4ANX A;  4XE0 A;  4EHM A;  3I3N A;  4DPR A;  2IOL A;  2KZT B;  4N3B A;  2DZN A;  2EIJ E;  4D10 C;  1TN8 A;  3IHY A;  3UT7 A;  1N0Q A;  2LUH A;  3KSQ A;  4A63 B;  2QFC A;  2Y3A A;  3IHV A;  4NQ0 A;  4AJW A;  3TWQ A;  2B0O E;  1K8K G;  3Q49 B;  5CCL A;  4Q69 A;  4QFV A;  4I6G A;  2X6K A;  4JA9 A;  3C3Q A;  2KM4 A;  3ONL A;  2IU1 A;  4KT6 B;  1JCQ A;  2CHZ A;  3G2W A;  3U64 A;  4BX8 A;  2OVF A;  4HRL A;  4U04 A;  4KZ0 A;  3U3W A;  3EU9 A;  3SO8 A;  3DSS A;  3CVU A;  3FU5 A;  4GZ3 A;  4K0R A;  3AJI A;  4B94 A;  1ZU2 A;  4CGW A;  1B89 A;  5FQ6 A;  1G3N B;  1TNY A;  4HI9 A;  2QY7 A;  1H19 A;  1DCE A;  3TXM A;  3S7D A;  1N11 A;  2R02 A;  5LCW C;  4YDE A;  3QDN A;  3CVP A;  3ZYL A;  3RIB A;  3UM1 A;  1N95 A;  4UQY A;  3ZYK A;  4JA7 A;  3MKQ B;  5FIO A;  2IEJ A;  4GTQ A;  1BD8 A;  1PC2 A;  2X6J A;  4AXH A;  1BI8 B;  3PZ1 A;  1TR4 A;  5KCM A;  2HE0 A;  2WMO A;  3I4R B;  3FTW A;  4N39 A;  3B95 A;  2CFU A;  4NUR A;  5EN5 D;  1H2T C;  3ZEF A;  4BES A;  3QJZ A;  4U0Z A;  4C0E A;  2C2L A;  3ZHE A;  3MKQ A;  4MLP A;  2YHC A;  3B7R L;  4FC8 A;  3RRU A;  2FBN A;  4DX5 D;  5BUZ A;  4H7X A;  3ASG A;  3X2Q E;  4TXQ A;  2HYZ A;  4KYO B;  1JWG A;  1LF8 A;  2VQ2 A;  2V4L A;  5FIN A;  3QWP A;  2DBA A;  1N4Q A;  5CED B;  5D66 A;  3UI2 A;  5B3S E;  4RVB A;  1AWC B;  3UUX A;  1E8Y A;  2KC7 A;  5BXO A;  4QQI A;  2XHE A;  3L82 A;  3GYZ A;  3NF1 A;  2GRN B;  3GZ1 A;  4URK A;  2WQ6 A;  4U8Y D;  2YNQ A;  3DEP A;  2A5U A;  3PNL B;  2XGO A;  3E30 A;  3RKV A;  3ZXP A;  3UT8 A;  4BY6 A;  3C3R A;  5KNH D;  3R7R A;  4P29 A;  1JCS A;  4AVX A;  4J8E A;  4BET A;  3PE4 A;  3WXX A;  4XEI G;  2GRL A;  2A4Z A;  3TWU A;  1WM5 A;  2X38 A;  2A5E A;  5C2Y A;  4HOQ A;  5T3R A;  1AP7 A;  1VDY A;  1V55 E;  1NZN A;  4ANU A;  3GZS A;  3FEY A;  3FUM A;  1SW6 A;  4OAV B;  3V30 A;  3T8M A;  5ENS D;  1K3Z D;  4XKC A;  4GTP A;  4HNA D;  2MYO A;  1E8W A;  1FT1 A;  4UWF A;  3CKB A;  3C3O A;  1SA4 A;  3QAQ A;  2MHK A;  1NP7 A;  1OWM A;  3MEK A;  3E4B A;  5HS0 A;  3IXE A;  3FUN A;  1KT1 A;  2DYS E;  4AIF A;  4DI4 A;  4EZK A;  4B8A A;  2E2E A;  4ZFH A;  4GTR A;  3FUF A;  3ZPJ A;  2BED A;  3QWW A;  1OCZ E;  3APF A;  3NZS A;  4N3C A;  5CMY A;  2RFA A;  3MCX A;  3MYV A;  3JQ0 A;  2Y0B G;  4HOR A;  4J8S A;  4FA6 A;  1LD8 A;  3DST A;  3LDZ A;  1V54 E;  5ENQ D;  1IXV A;  1OWN A;  4AM9 A;  3PEU B;  2L9B A;  5HQ8 A;  4U0U A;  3D3M A;  3R7Q A;  3PS6 A;  2RG8 A;  5T8I A;  3D9M A;  2DYR E;  3D9I A;  4JL0 A;  2KCV A;  2J07 A;  3QKY A;  2I1K A;  4J8D A;  1WG0 A;  1OWO A;  4L23 A;  3UM0 A;  5JJ6 A;  1PAQ A;  4GTO A;  3HVE B;  2JLB A;  2HR2 A;  3URZ A;  2PM6 A;  5LP0 A;  4LCT A;  4IUL A;  5FQ7 A;  3CVQ A;  3RRN B;  1O1S A;  2I1J A;  3S7J A;  2L0T B;  2LAI A;  3O48 A;  3UIP C;  1N52 A;  2PZI A;  3DSW A;  3Q5M A;  5FJY A;  3CHR A;  1UN8 A;  3ABM E;  2LXL A;  4PS8 A;  3LKU A;  3HYM B;  3BG0 B;  4CDM A;  3JCK C;  1IYG A;  4K03 A;  4RLY A;  3GW4 A;  4Q96 A;  3HHM A;  4UWH A;  5LX8 A;  3SBS A;  3CHS A;  3CST A;  5AAO A;  4APF A;  2XCB A;  2QC9 A;  1BU9 A;  3E32 A;  3E37 A;  4WWN A;  5EID A;  4DUI A;  4B8C B;  4LRZ A;  2CG3 A;  4DJA A;  4PUC A;  3D9K A;  3ASO E;  3LXU X;  3U9W A;  3Q73 A;  5G05 J;  3UIO C;  1N4S A;  2X6F A;  3ULQ A;  2GW1 A;  3Q7F A;  3QNK A;  4XKB A;  4OVU A;  5D0Q D;  4AP2 A;  4YND A;  2XPZ A;  2XEE A;  2PNN A;  2XEV A;  4U07 A;  1D8E A;  4BT8 A;  1A17 A;  3OXG A;  4EZJ A;  3QK0 A;  3AG4 E;  1DVP A;  4C0M A;  4GTT A;  4JHJ A;  2IQC A;  3B13 A;  3OXL A;  3P1U A;  2KXP C;  2WPV A;  3AS8 A;  4XI9 A;  1YA0 A;  3AU4 A;  4AEZ C;  2L6B A;  2LNI A;  4U63 A;  3W9F A;  3SFZ A;  4UWK A;  3LY7 A;  5AIJ A;  5G2N A;  4HOT A;  5LOZ A;  3J5P A;  5D0O D;  4DRX E;  5HRY A;  4KVM A;  2PL2 A;  3G2V A;  2P58 C;  5ARF A;  2GRM A;  4F7A A;  1ZB1 A;  3L54 A;  4DI3 A;  4G25 A;  1NFI E;  4GCO A;  3JUE A;  4L9P A;  3FEX A;  3AS4 A;  3RU0 A;  4RG9 A;  4U0S A;  3ASD A;  4BT9 A;  1MHQ A;  2V0P A;  4G26 A;  2H6I A;  2XPI A;  5CBO A;  1WAO 1;  4BFR A;  5KJL A;  1HS6 A;  3HRA A;  1SVX A;  2KBX A;  2WQH A;  2X3M A;  3VLE A;  1WY6 A;  3NAW A;  2E0I A;  2VSY A;  1N4R A;  2AXZ A;  1HO8 A;  4FJY A;  4I6J A;  1FT2 A;  4AY6 A;  4NAC A;  2PM7 A;  5CBN A;  2ILR A;  3APD A;  5CRU A;  1QNF A;  4UQZ A;  5EYP F;  1Z5S C;  2YHE A;  3ZFW A;  3TWW A;  3LJ3 A;  4UI9 C;  1N9A A;  3EIJ A;  4TXP A;  3TAX A;  4JB8 P;  1MX2 A;  4HI8 A;  4IYP A;  3FTV A;  2V4H C;  1MX4 A;  4DX1 A;  4YDY A;  2J09 A;  3HIZ A;  3TGO A;  4FLB A;  4DLQ A;  4GZD A;  3ASF A;  4O60 A;  4FAD A;  2V5F A;  2XEN A;  4GA1 A;  3DXK G;  3FTS A;  3ULE G;  1ELW A;  2AVP A;  2KZT A;  1L5J A;  4APO A;  3KEA A;  5KWD A;  1OCR E;  3RRM B;  2M63 A;  4HVB A;  4BWR A;  2NSZ A;  1E8Z A;  1QQE A;  3AG3 E;  1UJK A;  3S7F A;  2LSV A;  4K5C A;  1HH8 A;  1N54 A;  3L6A A;  2GRP B;  1NI1 A;  4FLH A;  3ONK A;  4OYS A;  1H2V C;  4ME2 A;  2B6C A;  2QYJ A;  1Y8M A;  1IKN D;  4V3I A;  4RG6 A;  4MRU A;  3R9A B;  3ASN E;  1S0P A;  4CYM D;  3DSU A;  4KXK B;  3NZU A;  2ZU6 B;  5ENT D;  3SY2 A;  1TYQ G;  2NC9 A;  3D9J A;  2XS1 A;  2HM8 A;  4G2V A;  3Q15 A;  2IF4 A;  3D9H A;  2KCK A;  2OV8 A;  4CGV A;  2UY1 B;  3DPD A;  3AS5 A;  2OEW A;  3SFX A;  3OTN A;  3TL5 A;  4RSY A;  2R03 A;  1H6P A;  3V79 K;  4X8Q A;  1MYO A;  1TNB A;  4JPS A;  5JMN D;  3UKR G;  3PZ3 A;  3QB2 A;  2BKK B;  5J90 A;  1NL4 A;  3EUV A;  1N0R A;  1QBQ A;  2DZO A;  1K1B A;  3DPY A;  2P9K G;  2UY1 A;  1KT0 A;  4KZC A;  4N3A A;  4IRU A;  4ATG A;  3MZL B;  1FPP A;  5G55 A;  2ETB A;  4YVO A;  4BSZ B;  2EIK E;  2IO2 C;  1H2U A;  3UQ3 A;  1NA0 A;  1JPL A;  5JJT A;  4BER A;  4GML A;  4MS6 A;  4PS7 A;  3AG2 E;  2ETC A;  3L16 A;  1OCC E;  3FU0 A;  2X6I A;  5EIB E;  2VSX E;  4CCA A;  2ION A;  4H7Y A;  3L17 A;  4N2S A;  2WXH A;  2OEV A;  2H6H A;  3SI5 A;  5FZS A;  1OCO E;  5LFA A;  3SGH A;  4A3T A;  1SA5 A;  3CKC A;  3LVQ E;  1E96 B;  2Y4T A;  2WXK A;  4EZL A;  2P9I G;  3T5X A;  4TXR A;  4GB9 A;  1O5M A;  2XEH A;  5JHB A;  3TWS A;  2LAH A;  1E8X A;  2Y69 E;  3ABL E;  2H6G A;  4LNU D;  5EX3 A;  2MOW A;  3E33 A;  2FUL A;  3CSF A;  1HG5 A;  4DX6 D;  3FUD A;  3KSL A;  3Q75 A;  4Y6W A;  1D8D A;  3EHR A;  3I4G A;  5BPP A;  2DCP A;  1KLX A;  2F0Y A;  3PE3 A;  3EHM A;  3CQG B;  3BQO A;  3FUE A;  3BG1 B;  1X5B A;  2WXG A;  1Z6T A;  4HLL A;  3MJW A;  2Y4U A;  4BX9 A;  2XPY A;  4B89 A;  4JZY A;  4I1A A;  4GTV A;  3CVN A;  2CFZ A;  3EDT B;  5EDS A;  1FVH A;  3Q9U C;  1TJC A;  1HX8 A;  4DX2 A;  3CGH A;  4K5A B;  3CVX A;  1OWL A;  4G11 A;  5A6C A;  2FO1 E;  2C0M A;  4FUL A;  1ELR A;  3CV0 A;  2BKG A;  1E7V A;  3Q78 A;  1RW2 A;  4MKT A;  5BT1 A;  2R17 C;  3TJP A;  3AG1 E;  4GU5 A;  3FP3 A;  4J6I A;  4FJZ A;  3L9T A;  3LYA A;  3RSE G;  4ANV A;  1Q2Z A;  5FZQ A;  1DCQ A;  2OCC E;  3FH5 A;  3CHP A;  1JUQ A;  4XI0 A;  3PDN A;  4CT0 A;  4WND A;  3PRZ A;  2I9C A;  3ESK A;  3FUJ A;  3Q47 B;  4G1T A;  4A3V A;  1DC2 A;  4O6F A;  1EPU A;  3SF4 A;  3TXN A;  2EIM E;  4ILI A;  4HBD A;  3UM2 A;  3TWT A;  5KBA A;  2ZGD A;  4I2Z A;  2LXM A;  1NA3 A;  3DRA A;  1PY1 A;  2XS8 A;  4GA0 A;  2VGY A;  1D9S A;  3HVE A;  3SBT B;  1EF1 C;  3ZGQ A;  4CZ2 D;  1A5E A;  3QOU A;  2WVI A;  4I17 A;  1Z3X A;  4A1G A;  3ZVV A;  4TRQ A;  2L6J A;  3UXG A;  4F3V A;  4F53 A;  1SQM A;  5FQ8 A;  2HO1 A;  2OOE A;  4F6R D;  2WXM A;  2R5S A;  3PRE A;  5G04 J;  4HXI A;  3FDH A;  5KNG A;  1RZ4 A;  4IN3 B;  1HZ4 A;  1Y6I A;  3TWR A;  3PZ4 A;  2XGS A;  3CEQ A;  5HI7 A;  5ANL A;  1E7U A;  2EIN E;  3JUI A;  5KJM A;  1SZ9 A;  2WXL A;  4LEU A;  5ENN A;  3NQP A;  4CDN A;  3SFY A;  4HRM B;  4LUN U;  4OAU C;  4GYW A;  3SNX A;  1TNU A;  4A1S A;  1INZ A;  2XRY A;  2OND A;  5EKQ D;  4EQF A;  4W9R A;  2VGX B;  3UX4 A;  3LJN A;  4GZ6 A;  3C5R A;  3WG7 E;  4NIK A;  1HFA A;  3FUI A;  2VTB B;  4HQD A;  1MX6 A;  4LER A;  1P5Q A;  3VLD A;  5EYL A;  3U4T A;  4DK5 A;  3ZU7 B;  1QYM A;  5JJ7 A;  2KAT A;  2VSO E;  2VYI A;  1HG2 A;  2DVW A;  1EDU A;  3V2O A;  4BSX A;  3ABK E;  3T5V A;  4XZ4 A;  4JXT A;  3PUK A;  3SHF A;  3HXF A;  4L2Y A;  4U95 D;  2J9Q A;  3FU3 A;  2WXQ A;  5G05 C;  3APC A;  2J4B A;  1BLX B;  5M72 A;  2GRQ B;  5HKP A;  1DNP A;  4WUY A;  2IOS A;  1X81 A;  1S64 A;  2WXF A;  2FEZ A;  4JC8 A;  2ZIS A;  2FF4 A;  3OAW A;  2LO6 A;  1OY3 D;  3FH7 A;  3HXE A;  4U96 D;  3ZYM A;  3LS8 A;  2VJ8 A;  3EIQ C;  5JA4 D;  3C98 A;  1S63 A;  3ZKJ A;  4GMR A;  4UWL A;  2IO3 C;  5FQ4 A;  3IBE A;  3FUL A;  5AQ7 A;  2DIW A;  1OWP A;  3MX3 A;  3FTY A;  5BNW A;  5JHA A;  1HE8 A;  1XGW A;  4JW1 A;  2ZGG A;  2GRO B;  3QC1 A;  5BXU A;  4L2L A;  5A7D B;  4JEU A;  3HXD A;  1MZC A;  2YQ8 A;  4L7T A;  3BUA A;  3CK8 A;  5DIZ A;  3C72 A;  1OXJ A;  3LPZ A;  3PZD A;  3V31 A;  4J7W A;  4M3O A;  3KS2 A;  2WXO A;  4XX5 A;  5A23 A;  3R9M A;  3FFL A;  3RO2 A;  2V5Q C;  4HFG A;  1JWF A;  3MA5 A;  3PNT B;  5E75 A;  3ZXS A;  3L08 A;  1KZP A;  3JQ1 A;  3CHQ A;  2WXP A;  3ESL A;  4I9C A;  1MQS A;  4C48 B;  3BEE A;  4RQI A;  3K9I A;  4U7E B;  2J08 A;  4E6H A;  1S70 B;  4CDR A;  5EX0 A;  3FU6 A;  2XCC A;  4YVQ C;  4LNG A;  3UIN C;  3CVY A;  4ABN A;  2J8S D;  2QYU A;  2AW6 A;  2MRI A;  4BTA A;  3QAR A;  1ELK A;  5AAR A;  5ENO D;  3Q4A B;  3CQC B;  5AQB A;  3EHN A;  2GRR B;  4GYO A;  4CT4 A;  3NB2 A;  5ARG A;  3Q9N C;  4JHR A;  3MV2 B;  5EIL A;  3EHQ A;  3IKO B;  3JXJ A;  3ASH A;  5LCW J;  3RK6 A;  3FY4 A;  4UWG A;  1HF8 A;  4Q94 A;  3EJN A;  3JXI A;  4B93 B;  1FVF A;  2Q7F A;  3LEW A;  2DWZ A;  1YMP A;  4G23 A;  4GZC A;  1GW6 A;  4L1B A;  1UOH A;  1HU3 A;  4UI9 K;  3PZ2 A;  2RD0 A;  5E76 A;  3CVW A;  2IFU A;  4PS3 A;  3ZHE B;  2IJG X;  3UTM A;  3FUK A;  2BF0 X;  3FTX A;  3G2U A;  4G24 A;  4PDX A;  4M7C A;  2ZIR A;  5H7P A;  3MKR A;  2IY0 C;  2JAB A;  3CK7 A;  3RAU A;  4GPM A;  3B7T A;  4C9B B;  2J4D A;  4HS2 A;  3LY8 A;  3DSX A;  4GTS A;  3L22 A;  5BW8 C;  4ANW A;  3D9O A;  5AJL A;  2QZA A;  3N71 A;  4FHK A;  5AYW D;  3CVL A;  1TNO A;  3FTZ A;  4WNF A;  4DLO A;  5BV0 A;  5AQA A;  3PEV B;  4Z68 A;  3ZIM A;  4AOF A;  2R05 A;  2PQN A;  3ZW3 A;  4EPZ A;  1O1T A;  4K5B A;  1O1R A;  1UW4 B;  5ENP D;  2FI7 A;  4ZHB A;  4HOS A;  4ACK A;  5CER B;  2WB2 A;  1U3D A;  5CCM A;  3LY9 A;  2NXP A;  1WDY A;  3CR3 A;  3PVL A;  4HOU A;  3FUH A;  1FCH A;  2EQX A;  3VTX A;  3Q7A A;  2LSU A;  3ML8 A;  2XQ0 A;  3ZYQ A;  5AQ9 A;  3TWX A;  3UMV A;  3ZNG A;  4ATZ D;  4U8V D;  3G2S A;  3V2X A;  5J08 A;  3LVR E;  5BV1 A;  3Q79 A;  1TEZ A;  4TUU A;  2WXN A;  2BUG A;  2P9N G;  4O1P A;  2P9U G;  4HB5 A;  3KD7 A;  5FT9 A;  3UPV A;  2CHX A;  1H6O A;  3UKU G;  3CLJ A;  2JEK A;  1TN7 A;  1OT8 A;  3B7S A;  5AJD A;  2L0I A;  4I2W A;  4AV7 A;  3CHM A;  5B1A E;  4TV3 A;  2EIL E;  3VTY A;  1W3B A;  1IHG A;  5CHE E;  3SD5 A;  3DWL G;  1OUV A;  4UUC A;  3F6Q A;  2I2O A;  2AXV A;  1HXI A;  3HG0 D;  2P9S G;  1JCR A;  2F8X K;  3I5P A;  4N2Q A;  2XGM A;  4I9E A;  3RJV A;  4CRW A;  4KVO A;  3B7B A;  2X6H A;  4N5C A;  2ETA A;  2R2L A;  3OXF A;  3HXC A;  4ILG A;  5FWQ A;  3TWV A;  4YDW A;  2AXU A;  3KAE A;  4JVS A;  3ML9 A;  2VSN A;  5AN8 A;  1UJJ A;  5KJK A;  3PUJ A;  2WMN A;  4JEH A;  5C1D A;  3CVV A;  3DSV A;  2XZT G;  3ZRH A;  2F8Y A;  4YDO A;  4ACL A;  4J8F A;  2WXJ A;  3G2T A;  2F37 A;  2P2C P;  3AAA C;  4I43 A;  3RO3 A;  4WWP A;  3ENE A;  4Y6C A;  1H6K A;  3J5Q B;  2CHW A;  3B7U X;  2KCL A;  5DBK A;  5T4Y A;  2Y1L E;  4EBA G;  2R59 A;  1N4P A;  2V8S E;  1XNF A;  4HLE A;  3D9N A;  3FH8 A;  4R7L A;  4O1O A;  3HDX A;  4GYY A;  4I1O B;  5KJN A;  3VLF A;  4BTB A;  4LSZ E;  1TN6 A;  4TUM A;  4JD2 G;  2PQR A;  1UG3 A;  1IHB A;  3IEG A;  1H0A A;  4EBA A;  4FHJ A;  5G04 C;  3ZUV B;  5IY5 E;  4WWO A;  4FP7 A;  4NRH B;  3TG5 A;  4GAA A;  2VGE A;  5CMW A;  3GZ2 A;  3ZN3 A;  1E90 A;  4GCN A;  4I6E A;  3BU8 A;  1MJ0 A;  1YYH A;  1U3C A;  2WXR A;  2VGX A;  4U8H A;  5ITZ F;  4F1S A;  4WAF A;  4N5Q A;  5FZR A;  3AU5 A;  2VTB A;  5FTP A;  2GGF A;  2NYJ A;  3ISM C;  1KPS B;  3S2A A;  4DX7 D;  4BEP A;  1U2V G;  1TNZ A;  4UQX A;  4B0Z A;  3DXM G;  2YIN A;  3CK9 A;  3QWV A;  3NOG D;  3SZ7 A;  3ULY A;  3FHE A;  4GPK A;  4GMJ A;  1YCS B;  4LG6 A;  1BPO A;  2CG2 A;  3W9G A;  3P2B A;  1EYH A;  4WNG A;  4J0U A;  1KZO A;  2AWI A;  1UN9 A;  4A55 A;  3LCA A;  3CHO A;  4MBG A;  5AEN A;  2AJA A;  2P9P G;  4I1M A;  1LTX A;  2OVB A;  5B1B E;  2XZD G;  2J49 A;  3E34 A;  1BI7 B;  1TJF A;  4FU3 A;  3D9P A;  4J8Y A;  1N94 A;  4OVV A;  1QZ2 A;  3PH0 C;  3S7B A;  5ENR D;  3JYS A;  3NBN B;  3DBS A;  1K1A A;  3MV3 B;  5D2M C;  3T8K A;  1IQU A;  4GZ5 A;  4JHK A;  2P9L G;  3HXB A;  2RKK A;  4E85 A;  4G8K A;  4KBQ A;  2WXI A;  3DEO A;  3SQV A;  1IQR A;  4GTM A;  3T9K A;  2RFM A;  4F1P A;  3NOC D;  2BTD A;  4LNB A;  4PH4 B;  4AY5 A;  3U66 A;  3FWV A;  1Z3Y A;  2C0L A;  3O4Z A;  4UI9 J;  4XIF A;  1LD7 A;  2ZXW E;  4HRN A;  2UWJ G;  5CRV A;  4ILH B;  3UT4 A;  4CEM A;  2I6H A;  5CEA A;  3MGB A;  3FTU A;  4EEC A;  2WM9 A;  1ZBP A;  3D9L A;  4WNE A;  5CEC B;  1SZA A;  3IV0 A;  3KEZ A;  3EU5 A;  4GA2 A; 
#chains in the Genus database with same CATH homology
 4C9B B;  3ULQ A;  4FUL A;  1ELR A;  3CV0 A;  2GW1 A;  1E7V A;  3QNK A;  2J4D A;  4HS2 A;  3LY8 A;  2WQ7 A;  2FO7 A;  3CIA A;  3L13 A;  4XKB A;  2XRZ A;  4KMO A;  4OVU A;  3L22 A;  4MKT A;  5BW8 C;  4ANW A;  5D0Q D;  4AP2 A;  5BT1 A;  3TG4 A;  5ANR A;  4ANX A;  4YND A;  4XE0 A;  2R17 C;  3D9O A;  3TJP A;  2XPZ A;  5AJL A;  4GU5 A;  3I3N A;  3FP3 A;  4DPR A;  4J6I A;  3N71 A;  4FJZ A;  2XEV A;  4U07 A;  4FHK A;  5AYW D;  2IOL A;  2KZT B;  3CVL A;  3LYA A;  4ANV A;  4BT8 A;  1A17 A;  4WNF A;  3FTZ A;  4DLO A;  5BV0 A;  5FZQ A;  3PEV B;  4N3B A;  3FH5 A;  3CHP A;  3OXG A;  4D10 C;  1JUQ A;  3ZIM A;  4AOF A;  4XI0 A;  4EZJ A;  2PQN A;  3PDN A;  3ZW3 A;  4CT0 A;  3QK0 A;  4WND A;  3IHY A;  3PRZ A;  3UT7 A;  4EPZ A;  2I9C A;  1UW4 B;  2QFC A;  2Y3A A;  3IHV A;  4NQ0 A;  3ESK A;  4AJW A;  3FUJ A;  3Q47 B;  4G1T A;  2FI7 A;  4A3V A;  1DVP A;  4C0M A;  4HOS A;  3Q49 B;  4ACK A;  5CCL A;  4O6F A;  1EPU A;  3SF4 A;  4Q69 A;  1U3D A;  2WB2 A;  4QFV A;  3TXN A;  4I6G A;  4JHJ A;  4ILI A;  2X6K A;  2IQC A;  3B13 A;  4JA9 A;  5CCM A;  2KM4 A;  3LY9 A;  3ONL A;  2NXP A;  2IU1 A;  4KT6 B;  3OXL A;  4I2Z A;  2CHZ A;  3G2W A;  1NA3 A;  3P1U A;  1PY1 A;  3U64 A;  3AS8 A;  2WPV A;  3CR3 A;  4XI9 A;  1YA0 A;  3AU4 A;  4AEZ C;  4GA0 A;  4BX8 A;  2VGY A;  2OVF A;  3HVE A;  2LNI A;  1EF1 C;  3PVL A;  3SBT B;  4HOU A;  4U63 A;  3ZGQ A;  4U04 A;  3FUH A;  4KZ0 A;  3QOU A;  2WVI A;  4I17 A;  1Z3X A;  3SFZ A;  3U3W A;  4A1G A;  1FCH A;  4UWK A;  3LY7 A;  4TRQ A;  3ZVV A;  2EQX A;  2L6J A;  3VTX A;  5AIJ A;  3CVU A;  2LSU A;  3FU5 A;  5G2N A;  4HOT A;  4GZ3 A;  5LOZ A;  4K0R A;  5D0O D;  4F3V A;  3ML8 A;  4KVM A;  4B94 A;  2PL2 A;  4F53 A;  3G2V A;  2P58 C;  5ARF A;  1SQM A;  2GRM A;  4AV7 A;  1ZU2 A;  4F7A A;  2XQ0 A;  3ZYQ A;  3L54 A;  4DI3 A;  4G25 A;  5FQ8 A;  4CGW A;  1B89 A;  4GCO A;  2HO1 A;  5FQ6 A;  2OOE A;  3UMV A;  3FEX A;  2WXM A;  2R5S A;  3AS4 A;  3PRE A;  4HXI A;  5G04 J;  3FDH A;  3RU0 A;  3G2S A;  4RG9 A;  4IN3 B;  4U0S A;  1HZ4 A;  2QY7 A;  3ASD A;  4BT9 A;  3LVR E;  1H19 A;  1Y6I A;  5J08 A;  3TXM A;  5BV1 A;  3S7D A;  1TEZ A;  5LCW C;  4TUU A;  3QDN A;  2XGS A;  1MHQ A;  3CVP A;  2V0P A;  2WXN A;  3CEQ A;  2BUG A;  5HI7 A;  3ZYL A;  4G26 A;  1E7U A;  3JUI A;  5ANL A;  3RIB A;  5KJM A;  1SZ9 A;  2XPI A;  4UQY A;  3KD7 A;  5FT9 A;  3ZYK A;  3UPV A;  4JA7 A;  1WAO 1;  2CHX A;  2WXL A;  3MKQ B;  4LEU A;  5ENN A;  3NQP A;  3CLJ A;  2JEK A;  4CDN A;  4LUN U;  1PC2 A;  4GYW A;  3SNX A;  4BFR A;  3B7S A;  2X6J A;  4A1S A;  1INZ A;  2XRY A;  4AXH A;  5KJL A;  2OND A;  5EKQ D;  4EQF A;  5AJD A;  1HS6 A;  5KCM A;  2L0I A;  4I2W A;  4W9R A;  2VGX B;  2WMO A;  2WQH A;  2X3M A;  3CHM A;  3I4R B;  3FTW A;  1WY6 A;  4GZ6 A;  3UX4 A;  3VLE A;  2E0I A;  4TV3 A;  4N39 A;  2C0M A;  2VSY A;  3VTY A;  1W3B A;  1IHG A;  2CFU A;  2AXZ A;  4NUR A;  1HFA A;  1H2T C;  1HO8 A;  3FUI A;  3ZEF A;  2VTB B;  5CHE E;  3QJZ A;  3SD5 A;  1OUV A;  4FJY A;  4LER A;  1P5Q A;  3VLD A;  4I6J A;  4U0Z A;  4C0E A;  3U4T A;  4DK5 A;  4AY6 A;  4NAC A;  2C2L A;  2PM7 A;  3MKQ A;  4MLP A;  3ZHE A;  2YHC A;  2KAT A;  2VSO E;  2I2O A;  5JJ7 A;  2VYI A;  2AXV A;  2ILR A;  3APD A;  1HG2 A;  3B7R L;  1HXI A;  1QNF A;  4UQZ A;  2YHE A;  3ZFW A;  1EDU A;  3I5P A;  3LJ3 A;  4UI9 C;  4N2Q A;  2XGM A;  4FC8 A;  4I9E A;  3RJV A;  3RRU A;  4CRW A;  3EIJ A;  4KVO A;  4BSX A;  3T5V A;  2FBN A;  4XZ4 A;  4JXT A;  2X6H A;  4N5C A;  3TAX A;  3PUK A;  4H7X A;  3SHF A;  5BUZ A;  3ASG A;  4IYP A;  2HYZ A;  4L2Y A;  3OXF A;  2J9Q A;  3FTV A;  3FU3 A;  4KYO B;  1JWG A;  1LF8 A;  2VQ2 A;  2V4L A;  3QWP A;  4ILG A;  2DBA A;  2WXQ A;  5FWQ A;  5G05 C;  3APC A;  2AXU A;  3KAE A;  4JVS A;  2J4B A;  4RVB A;  3UUX A;  1E8Y A;  3ML9 A;  5BNW A;  2KC7 A;  2VSN A;  5M72 A;  2XHE A;  2J09 A;  3GYZ A;  3HIZ A;  3NF1 A;  3TGO A;  4FLB A;  4DLQ A;  4GZD A;  1DNP A;  3ASF A;  4FAD A;  4WUY A;  3GZ1 A;  2IOS A;  4URK A;  2V5F A;  1UJJ A;  2WXF A;  4GA1 A;  5KJK A;  2FEZ A;  3PUJ A;  4JC8 A;  3FTS A;  2WMN A;  1ELW A;  2FF4 A;  3OAW A;  2WQ6 A;  2LO6 A;  4JEH A;  2AVP A;  2YNQ A;  5C1D A;  2KZT A;  1L5J A;  2A5U A;  3FH7 A;  3PNL B;  3CVV A;  2XGO A;  4APO A;  3RKV A;  3ZRH A;  3RRM B;  3ZYM A;  2M63 A;  3LS8 A;  4HVB A;  3UT8 A;  4BY6 A;  4BWR A;  2VJ8 A;  4ACL A;  3EIQ C;  2NSZ A;  3C98 A;  4J8F A;  2WXJ A;  3G2T A;  1E8Z A;  3R7R A;  1QQE A;  1UJK A;  3S7F A;  2LSV A;  1HH8 A;  1N54 A;  3L6A A;  4P29 A;  4I43 A;  4UWL A;  4FLH A;  4AVX A;  3ONK A;  4J8E A;  1H2V C;  4ME2 A;  4OYS A;  5FQ4 A;  3RO3 A;  4WWP A;  3IBE A;  1Y8M A;  3FUL A;  3ENE A;  3PE4 A;  2DIW A;  3WXX A;  4Y6C A;  1OWP A;  2GRL A;  2A4Z A;  1H6K A;  3MX3 A;  4V3I A;  3FTY A;  4MRU A;  1WM5 A;  2CHW A;  2X38 A;  3B7U X;  2KCL A;  4HOQ A;  4RG6 A;  1HE8 A;  5C2Y A;  5T3R A;  3R9A B;  1XGW A;  5DBK A;  1VDY A;  1NZN A;  5T4Y A;  4JW1 A;  4ANU A;  1S0P A;  3QC1 A;  3GZS A;  4EBA G;  3FEY A;  4L2L A;  4KXK B;  3NZU A;  2ZU6 B;  5A7D B;  2R59 A;  3FUM A;  2NC9 A;  3D9J A;  3T8M A;  4JEU A;  2HM8 A;  4G2V A;  3Q15 A;  2IF4 A;  2V8S E;  4XKC A;  1XNF A;  4HLE A;  2YQ8 A;  2KCK A;  2OV8 A;  4L7T A;  4CGV A;  3CK8 A;  3D9N A;  2UY1 B;  3DPD A;  5DIZ A;  1E8W A;  3AS5 A;  3FH8 A;  4R7L A;  4UWF A;  3LPZ A;  3PZD A;  3CKB A;  3HDX A;  4GYY A;  3OTN A;  3TL5 A;  4I1O B;  4M3O A;  4RSY A;  5KJN A;  3KS2 A;  3VLF A;  3QAQ A;  4BTB A;  2MHK A;  1NP7 A;  2WXO A;  4XX5 A;  1OWM A;  5A23 A;  3MEK A;  3E4B A;  2PQR A;  1UG3 A;  3FFL A;  3FUN A;  3IEG A;  1H0A A;  4EBA A;  4JPS A;  1KT1 A;  4FHJ A;  3QB2 A;  5J90 A;  3RO2 A;  5G04 C;  4AIF A;  4HFG A;  4DI4 A;  4WWO A;  1JWF A;  4EZK A;  4FP7 A;  3MA5 A;  3PNT B;  2UY1 A;  4NRH B;  1KT0 A;  3TG5 A;  2E2E A;  5E75 A;  4B8A A;  3FUF A;  4KZC A;  3ZPJ A;  3L08 A;  4GAA A;  4N3A A;  3ZXS A;  4IRU A;  4ATG A;  3QWW A;  5CMW A;  3JQ1 A;  3MZL B;  3CHQ A;  3GZ2 A;  3ZN3 A;  3APF A;  1E90 A;  2WXP A;  3NZS A;  4N3C A;  5CMY A;  4GCN A;  3ESL A;  4I9C A;  1MQS A;  3MCX A;  4I6E A;  4YVO A;  5G55 A;  3MYV A;  1U3C A;  2WXR A;  2VGX A;  3BEE A;  4U8H A;  1H2U A;  3JQ0 A;  3UQ3 A;  4F1S A;  3K9I A;  1NA0 A;  1JPL A;  2J08 A;  4E6H A;  4CDR A;  5JJT A;  4HOR A;  4GML A;  4J8S A;  4WAF A;  5EX0 A;  4FA6 A;  4MS6 A;  3FU6 A;  3LDZ A;  5FZR A;  3AU5 A;  2VTB A;  5FTP A;  4PS7 A;  2XCC A;  2GGF A;  4YVQ C;  3L16 A;  1OWN A;  3FU0 A;  4AM9 A;  3PEU B;  3S2A A;  2X6I A;  3CVY A;  2L9B A;  2VSX E;  5HQ8 A;  4U0U A;  3D3M A;  2ION A;  4CCA A;  3R7Q A;  4H7Y A;  3L17 A;  4ABN A;  4N2S A;  3PS6 A;  4UQX A;  2RG8 A;  2WXH A;  5T8I A;  4B0Z A;  3D9M A;  2YIN A;  3D9I A;  3CK9 A;  4JL0 A;  3QWV A;  2KCV A;  2J07 A;  3SZ7 A;  3QKY A;  2I1K A;  3FHE A;  4J8D A;  5FZS A;  2AW6 A;  3SI5 A;  3SGH A;  5LFA A;  4GPK A;  1OWO A;  4GMJ A;  4L23 A;  2MRI A;  4A3T A;  4BTA A;  3CKC A;  5JJ6 A;  3QAR A;  1ELK A;  3LVQ E;  1E96 B;  1BPO A;  2Y4T A;  3Q4A B;  1PAQ A;  3CQC B;  2WXK A;  4EZL A;  2CG2 A;  3T5X A;  3EHN A;  3HVE B;  3P2B A;  1EYH A;  4WNG A;  4GYO A;  4J0U A;  4CT4 A;  2JLB A;  2HR2 A;  4GB9 A;  3URZ A;  2AWI A;  5ARG A;  5JHB A;  1UN9 A;  4A55 A;  3LCA A;  3CHO A;  2PM6 A;  5AEN A;  5LP0 A;  4LCT A;  2LAH A;  1E8X A;  4IUL A;  4JHR A;  4I1M A;  5FQ7 A;  2OVB A;  3MV2 B;  5EX3 A;  3CVQ A;  2MOW A;  3RRN B;  3IKO B;  2I1J A;  2J49 A;  3S7J A;  2FUL A;  3CSF A;  1TJF A;  2L0T B;  4FU3 A;  2LAI A;  3ASH A;  3O48 A;  3D9P A;  5LCW J;  1HG5 A;  4OVV A;  1QZ2 A;  1N52 A;  3FUD A;  3PH0 C;  3S7B A;  3RK6 A;  2PZI A;  3FY4 A;  4UWG A;  1HF8 A;  3JYS A;  4Y6W A;  3Q5M A;  5FJY A;  4Q94 A;  3EJN A;  3CHR A;  3DBS A;  1UN8 A;  3MV3 B;  3I4G A;  1IQU A;  5BPP A;  1FVF A;  2DCP A;  1KLX A;  2Q7F A;  4GZ5 A;  3LEW A;  4JHK A;  3PE3 A;  3EHM A;  4E85 A;  3CQG B;  4PS8 A;  4G23 A;  3FUE A;  3LKU A;  4GZC A;  3BG1 B;  4KBQ A;  1X5B A;  3HYM B;  2WXI A;  2WXG A;  3BG0 B;  1GW6 A;  1IQR A;  4CDM A;  3JCK C;  4L1B A;  1IYG A;  4K03 A;  1Z6T A;  3GW4 A;  4Q96 A;  5JHA A;  1HU3 A;  3MJW A;  2Y4U A;  4BX9 A;  3HHM A;  2XPY A;  4UI9 K;  4UWH A;  5LX8 A;  3SBS A;  3CHS A;  3CST A;  4B89 A;  4JZY A;  4APF A;  4I1A A;  2RD0 A;  2BTD A;  4PH4 B;  5E76 A;  4AY5 A;  3U66 A;  2XCB A;  3CVN A;  2CFZ A;  3EDT B;  3CVW A;  3FWV A;  5EDS A;  2IFU A;  1FVH A;  4WWN A;  1Z3Y A;  4PS3 A;  1TJC A;  2C0L A;  2IJG X;  3O4Z A;  3FUK A;  4UI9 J;  4XIF A;  3ZHE B;  4B8C B;  4LRZ A;  2UWJ G;  1HX8 A;  4ILH B;  3CGH A;  3UT4 A;  2CG3 A;  4CEM A;  4DJA A;  2BF0 X;  3FTX A;  3G2U A;  2I6H A;  4G24 A;  4PUC A;  4PDX A;  3MGB A;  3FTU A;  1OWL A;  3D9K A;  3CVX A;  4EEC A;  3LXU X;  2WM9 A;  3U9W A;  1ZBP A;  3D9L A;  3MKR A;  3CK7 A;  5G05 J;  4WNE A;  4G11 A;  5A6C A;  1SZA A;  3IV0 A;  3KEZ A;  3B7T A;  2X6F A;  4GA2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...