1O5MA

Structure of fpt bound to the inhibitor sch66336
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
315
structure length
315
Chain Sequence
GFLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Protein farnesyltransferase alpha subunit
publication title Tricyclic Farnesyl Protein Transferase Inhibitors: Crystallographic and Calorimetric Studies of Structure-Activity Relationships
pubmed doi rcsb
source organism Rattus norvegicus
total genus 125
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2003-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1o5mA00
3HXCA 3Q75A 1JCSA 4GTTA 3HXDA 1O1RA 4L9PA 1SA4A 3HXEA 1NL4A 2F0YA 2R2LA 3DSXA 4YDEA 3C72A 1TNYA 3SFXA 3E32A 1O1SA 1QBQA 3DRAA 3HXFA 3PZ1A 3E34A 1TNZA 1O5MA 3EU5A 4GTMA 3SFYA 3PZ4A 1KZPA 1TN7A 3Q7FA 1TN8A 3HXBA 4LNGA 1N4SA 4GTRA 1JCQA 3Q7AA 2ZIRA 3E37A 1NI1A 1X81A 4GTVA 3DSVA 4GTOA 4YDOA 2H6FA 1KZOA 3PZ3A 3DSTA 3KSQA 2H6GA 3Q78A 1FPPA 1JCRA 1TNBA 3DSWA 1N95A 1O1TA 1TN6A 1TNOA 4MBGA 1D8EA 1DCEA 2IEJA 3Q79A 1SA5A 3DPYA 1N94A 2H6IA 3EUVA 4GTQA 1MZCA 4EHMA 1FT1A 3Q73A 1FT2A 1N9AA 1LD7A 2BEDA 1N4QA 4GTPA 2ZISA 1LD8A 2H6HA 1TNUA 3KSLA 1S63A 1N4PA 1S64A 1LTXA 3PZ2A 1N4RA 4LNBA 3DSSA 3E33A 3E30A 4GTSA 1D8DA 3DSUA
chains in the Genus database with same CATH superfamily
3ZXSA 2IF4A 1NZNA 1EF1C 5ITZF 2WMOA 5CCLA 2WB2A 1WY6A 4DRXE 3GW4A 4G25A 1WM5A 3VLDA 3PVLA 1HE8A 5BT1A 2V8SE 3LXUX 2E2EA 4QQIA 3SD5A 3L08A 5D0OD 4EECA 2DZNA 3ZPJA 2GRLA 4UQZA 3QNKA 2L0IA 3CVPA 4KYOB 3ASDA 5BW8C 1AWCB 3L22A 4UWLA 1V54E 3UT4A 3IV0A 1Z3YA 3PE3A 3UIOC 4GZ6A 3UIPC 4AY5A 4UUCA 4JVSA 5EIBE 4U63A 1S0PA 1KPSB 4CYMD 2GRMA 4U7EB 3APDA 4B0ZA 2BF0X 3JQ1A 1EDUA 3TXMA 3G2UA 4J8FA 1HU3A 2P9LG 1MZCA 3FUDA 4I17A 4CDNA 4KVMA 4IRUA 2MHKA 3CGHA 1FT1A 2QY7A 3JXIA 1U2VG 5KNGA 2RG8A 1SZAA 3DSSA 3D9OA 5T8IA 1DCQA 5DBKA 3HXCA 4U8YD 3QJZA 4H7YA 4BT9A 4I1OB 2RD0A 2LAHA 4FJZA 3ZXPA 3KEAA 4C48B 2LSUA 4U8VD 4ANXA 3ABME 3K9IA 4XIFA 3DXMG 4EZJA 3B95A 1O5MA 3B7UX 5HKPA 2GRPB 2P9UG 2IO2C 4FLBA 4J8EA 1HG5A 5EKQD 2WXGA 3SO8A 4BSZB 1Z3XA 4HXIA 1BU9A 4TXQA 1H19A 4URKA 1UN9A 3B7BA 3EIQC 4GTOA 4WNEA 4LUNU 1IYGA 4JW1A 3CV0A 3AG1E 1YYHA 3QOUA 1FPPA 1YMPA 2XS1A 5E76A 2L6BA 2Y69E 3FUJA 3VLEA 2KZTA 2OVFA 3EDTB 3OAWA 1NA0A 4C0MA 1XGWA 4HFGA 2JEKA 3GZ2A 3VTYA 4KZCA 1BI7B 1INZA 3E33A 2WXNA 3W9FA 4JHKA 3C3RA 4GMRA 1MX6A 4GTTA 2DWZA 3N71A 4PS7A 3RAUA 1NL4A 4X8QA 3TWUA 3FTWA 3IKOB 3ZHEA 3NAWA 3D9PA 5KCMA 4AV7A 3DRAA 4PH4B 4APOA 1E8WA 4UWKA 2CHXA 4O1PA 2DCPA 2LAIA 3ABLE 1H6OA 1U3DA 5JHBA 5CECB 2DYSE 4CGVA 3E37A 4GTVA 4TUMA 3T8MA 3U66A 3SFZA 1KT1A 4BSXA 1OXJA 4G2VA 4I1MA 1TN6A 3UX4A 1DCEA 4L1BA 4EQFA 2E0IA 4AY6A 5CCMA 1K3ZD 5EDSA 1HF8A 1U3CA 4A55A 3NZUA 5HS0A 3MA5A 4HRMB 2B6CA 1WDYA 4MKTA 4F53A 3PDNA 3QDNA 2R02A 2P2CP 4GAAA 3LY7A 3NQPA 3ESKA 5JHAA 3NOGD 3QB2A 2XPYA 1OWNA 4DI4A 4UI9J 1H2TC 3FUKA 4GCOA 4GA1A 1O1RA 4JB8P 3CVNA 3IHYA 3ZFWA 4I6EA 3HDXA 3SFXA 5G05C 2ONDA 1QBQA 4Z68A 3TXNA 3F6QA 5FT9A 4DX7D 4ANVA 5KJMA 1IHBA 4ZHBA 2FF4A 1TN8A 3AG2E 1QNFA 1W3BA 1N52A 2M63A 1RW2A 1TEZA 4FJYA 2VGEA 3L13A 2IQCA 4I1AA 3C98A 4AJWA 2DYRE 3ASHA 4XKBA 2XCBA 4HOSA 1P5QA 1A17A 1TNBA 4OAVB 4J7WA 1N95A 3CHRA 3CHOA 1UOHA 4U04A 2RFMA 4DX5D 4AXHA 3ASNE 3AG3E 4HRNA 2VSOE 5CRVA 1E8YA 2HYZA 3EU9A 4A3TA 1LD8A 4V3IA 3IBEA 2WXFA 3ZYKA 4L2LA 3TL5A 4PUCA 4QFVA 5B1BE 2WXRA 3MV2B 4HVBA 2WXHA 2AW6A 3FY4A 3OXLA 4F1PA 3MKRA 2GGFA 3ZGQA 3RSEG 2AWIA 1H6PA 3BQOA 4FULA 4NACA 3CVXA 3RIBA 4F3VA 2LO6A 3V2OA 1OWMA 4JHRA 3ML9A 3AS5A 4HS2A 1TNZA 3ZN3A 3CHPA 2XZDG 3L82A 5LCWC 2AXZA 1TN7A 3Q7FA 2OV8A 3PZDA 4IN3B 3Q7AA 1UN8A 3CHMA 4LRZA 1AP7A 1E96B 4IULA 1UW4B 4U0UA 2WQ7A 2NYJA 2PM6A 3Q78A 3JUEA 3VLFA 1L5JA 4ILIA 5CEAA 2WXKA 4EBAA 4L23A 2A4ZA 3T9KA 2KBXA 3LYAA 1E90A 4DPRA 2XENA 5FQ4A 1QYMA 3LDZA 4PS8A 4GZ5A 3EHNA 3CK8A 1B89A 3JYSA 3AAAC 4LNBA 3VTXA 4GA0A 3T5XA 1A5EA 3OTNA 2VGXA 1LF8A 1JCSA 2UY1B 2WXMA 2Y0BG 3MX3A 4DI3A 2HE0A 4OVVA 3PRZA 5KNHD 4HRLA 5EN5D 4GZ3A 3ULYA 1Z6TA 2C0LA 4BX8A 2V4LA 4HQDA 4HI9A 3E32A 3MKQB 2PZIA 3U4TA 2BKGA 2QC9A 3B7RL 4C0EA 1OY3D 3EU5A 3KEZA 1SVXA 1SW6A 4DX2A 2P9IG 3CIAA 4XZ4A 4K0RA 2EIJE 3TG4A 4DLOA 3D9IA 4ACKA 3I4GA 4ANWA 3LVRE 1KZOA 4GB9A 2XZTG 1O1TA 5JMND 2XGMA 1NFIE 3FUIA 2IEJA 4XI9A 3AJIA 1HX8A 2OEVA 1N94A 2X6IA 3D9JA 3HVEB 5M72A 1FVFA 1JPLA 5EYPF 4ATZD 4HOUA 3IHVA 2NSZA 3FTSA 5HQ8A 5KJNA 3FH7A 2H6HA 3GZSA 2P9SG 4HI8A 3JQ0A 2EILE 2WQHA 3JXJA 3CHQA 2CHZA 1ELRA 4BY6A 3E30A 4TRQA 4NIKA 1H2UA 1H2VC 1NP7A 2DBAA 2KM4A 3WXXA 4BWRA 3IEGA 3DWLG 4A1SA 4ILGA 4L9PA 1SA4A 3NBNB 3G2WA 3V30A 5ENRD 3KAEA 4J6IA 2VTBB 3ZYLA 4U95D 3UM2A 5FJYA 3SF4A 2I6HA 3FEXA 4FP7A 5G04C 5EIDA 2CG2A 3TWXA 2Y4UA 3LY9A 4GTRA 3AS4A 2X38A 3G2TA 2X6JA 3PEVB 4RG9A 5G55A 1NI1A 3DSVA 5FWQA 1K1AA 4GMJA 2H6GA 5J90A 1VDYA 4N2QA 3SHFA 3FDHA 3CK7A 4BETA 4C9BB 3C3QA 3Q79A 4TXRA 4JEHA 1RZ4A 5H7PA 2UWJG 5LP0A 4ILHB 4WNGA 2EINE 2L6JA 5A7DB 4LERA 2I9CA 4N5QA 1S63A 3CSFA 3UI2A 4FA6A 3PZ2A 3IXEA 5A6CA 1IKND 1IQRA 1N11A 2F8XK 1MJ0A 5D2MC 3D9LA 4GU5A 5ENPD 2L0TB 2KC7A 3BG1B 4JA7A 5KJLA 3ZYMA 5CEDB 4U0ZA 1TYQG 2IFUA 1OWPA 1FCHA 3KD7A 3UTMA 4I2ZA 4AEZC 3CVLA 4ACLA 3HXFA 1PY1A 4WAFA 2J8SD 1SQMA 1TJCA 4I6JA 3ZIMA 2F37A 2GROB 5AIJA 5FQ6A 3PS6A 5BUZA 3FH8A 2AXUA 3CVYA 2ETAA 1DC2A 4YVQC 2FI7A 3LJ3A 3Q49B 2OOEA 5D66A 4FHJA 2J08A 3HHMA 4G8LA 3CSTA 3SZ7A 4N3BA 4YDYA 1JCRA 2Y1LE 4OYSA 3PH0C 1BLXB 5EILA 1UJJA 4U8HA 5FINA 5D0QD 2NXPA 3CHSA 3ENEA 4GCNA 3BEEA 3D9MA 5FTPA 2WXQA 3LVQE 3ZRHA 2CFZA 2F8YA 3FTUA 4J0UA 3FU5A 4HBDA 3LJNA 4EZLA 4CGWA 4GTQA 4K5CA 2ILRA 3ASOE 3ZEFA 1LD7A 1JUQA 2GRNB 3BG0B 3ONKA 4GYWA 2XGOA 3MGBA 1N4PA 4G26A 1LTXA 3URZA 1OWOA 2YNQA 4PS3A 1TR4A 1TJFA 3Q75A 3HXDA 4FADA 5AQ7A 3LEWA 4AM9A 3NB2A 3SBSA 4L7TA 2F0YA 3QK0A 2NC9A 3R9MA 4PDXA 4GYOA 4RQIA 3U9WA 4LG6A 3C72A 3QWPA 4GA2A 4WWNA 3RO3A 5AYWD 2WMNA 3JCKC 3E34A 1FVHA 1V55E 4LCTA 2AJAA 4I6GA 2IO3C 3PE4A 3HG0D 1MHQA 4CRWA 4JD2G 2JLBA 4JEUA 1N4SA 4BEPA 2R17C 4KVOA 1Q2ZA 5HRYA 1X81A 3S7BA 4AIFA 4J8DA 4CEMA 2XEVA 3R9AB 4U0SA 3UT7A 4GPKA 2KXPC 4G24A 3KSQA 4KZ0A 3LKUA 3DSWA 3FTVA 4WNDA 5C2YA 2KCKA 3UQ3A 2PQRA 2LNIA 2EIKE 2WXPA 3FHEA 3FH5A 2WQ6A 3ULQA 3EHQA 3WG7E 2WXOA 3Q5MA 1H0AA 4H7XA 2LXMA 3DEOA 2YINA 1OCOE 2HO1A 3KS2A 4IYPA 4GTSA 5ANRA 3TWRA 4M7CA 3RRNB 3QKYA 4HNAD 2XCCA 4E6HA 3APCA 4I2WA 3Q15A 3C5RA 4BESA 2J07A 2R2LA 3DSXA 4TUUA 2GRQB 1K8KG 2CG3A 3TWTA 2VGYA 2WXLA 1KLXA 4LEUA 2DZOA 3PUJA 4Y6CA 4TV3A 5G05J 4FHKA 4G11A 4LSZE 4P29A 3J5QB 5ARGA 1QZ2A 2A5UA 5AN8A 1UJKA 1OCCE 4B93B 5ENOD 3OXGA 3R7RA 4ZFHA 4B8AA 3GZ1A 4JPSA 3C3OA 3UT8A 3MCXA 3AG4E 1PC2A 2WVIA 4HORA 1Y6IA 3GYZA 5AQAA 1YCSB 3I3NA 2JABA 3APFA 3V79K 2VSXE 5C1DA 2V0PA 3X2QE 3FTZA 5JA4D 5EYLA 1FT2A 2BTDA 4BTBA 4GTPA 4CZ2D 4NRHB 3EHMA 2XGSA 3KSLA 4OVUA 1MQSA 3CR3A 5BNWA 4W9RA 3UPVA 3TWSA 2VJ8A 5KWDA 2KZTB 1QQEA 2R05A 4A1GA 5FQ7A 3ZW3A 4HOQA 2WXIA 3CVWA 3QC1A 5B3SE 3PNLB 2HR2A 2MYOA 3EIJA 4JA9A 5BXOA 1HZ4A 3CVQA 1O1SA 1MYOA 3TG5A 3QAQA 3RKVA 4CCAA 1HG2A 4GYYA 4WUYA 3PNTB 4GZDA 3FUMA 2DVWA 3DPDA 4I9EA 3TJPA 4ME2A 3ZHEB 2ZIRA 5LCWJ 1ZB1A 3UXGA 1JWGA 1JWFA 1UG3A 4U07A 3JUIA 3LY8A 4HLLA 4EZKA 3DSTA 4F6RD 2IOLA 2V5FA 2VYIA 4I9CA 3RJVA 3FUHA 4K5BA 2AXVA 4UWGA 1SA5A 2FBNA 2LXLA 5EX3A 4J8SA 3EUVA 4FU3A 4RLYA 3L17A 3V2XA 2PNNA 5AAOA 3ZYQA 4XE0A 3RK6A 3UM0A 1E8XA 1K1BA 1IQUA 1N4RA 1MX2A 5CBOA 5FQ8A 4L2YA 1D8DA 2XEEA 1E8ZA 3B7SA 2QZAA 4CDRA 2CFUA 4B94A 4DJAA 4GMLA 5CMWA 3HXEA 4A63B 4RVBA 5A23A 2IOSA 2Q7FA 5FIOA 4OAUC 4A3VA 2BUGA 2PM7A 3UKRG 3BU8A 3ULEG 4ANUA 3OXFA 3FULA 1KZPA 3CQCB 5JJ6A 3FU3A 3ZNGA 3W9GA 3FTXA 2YHEA 3FU0A 2IU1A 1IHGA 4YDOA 4F7AA 2QYUA 4TXPA 3RRMB 1Y8MA 2P9NG 3ABKE 5BV0A 3J5PA 3ML8A 2VSYA 3CEQA 5ENQD 1E7UA 3U64A 1D8EA 1HXIA 4UQXA 5LOZA 1HH8A 2PQNA 3CLJA 2V4HC 3MEKA 4JXTA 2VQ2A 4HOTA 1G3NB 3Q9UC 3Q4AB 5CRUA 3S7DA 2I1KA 1N54A 3ASGA 1OCRE 2KCLA 3QWWA 1DNPA 1BI8B 3FUEA 3MYVA 3LPZA 3PREA 3CVVA 5T4YA 5AARA 3SI5A 1ELWA 2EQXA 2ETBA 3NZSA 4RSYA 3FP3A 1OWLA 1TNYA 3G2VA 5ENNA 4F1SA 3BUAA 2LSVA 4G1TA 3ZVVA 3V31A 3TGOA 4GTMA 1H6KA 2XRYA 5BPPA 3Q9NC 2MOWA 5LX8A 4LNGA 4MS6A 4FC8A 3ZUVB 3TWWA 4YNDA 3L54A 3CQGB 2ZU6B 1OT8A 4YVOA 5G04J 2XS8A 4HB5A 4J8YA 4B8CB 3S7JA 1HFAA 3AU5A 4KXKB 4KBQA 5CHEE 3DBSA 4N5CA 3D9NA 4CT4A 2DIWA 1IXVA 3FWVA 5AQ9A 3I4RB 3MZLB 4Q69A 3CVUA 4JZYA 2KATA 1BPOA 4UWFA 2BKKB 5CERB 4XEIG 4CT0A 2UY1A 3Q73A 4XKCA 1N0RA 2BEDA 3RU0A 3SGHA 5J08A 4K03A 5JJTA 3TWQA 4UI9C 1Z5SC 5FZQA 3FUNA 3DXKG 4WNFA 4BFRA 4R7LA 4I43A 3DSUA 3FFLA 3HIZA 3T8KA 4NURA 3MKQA 5T3RA 3UUXA 3NF1A 2EIME 3TWVA 5AJLA 5JJ7A 5AQBA 2IJGX 2YHCA 1N0QA 3D9KA 2B0OE 4WWOA 2ZXWE 4YDEA 2VGXB 4BTAA 3SY2A 2GRRB 2C2LA 2OCCE 2A5EA 4NQ0A 2R03A 1WG0A 3E4BA 4GPMA 2MRIA 1ZU2A 2LUHA 2XQ0A 5FZSA 5LFAA 4EPZA 3RO2A 4AOFA 3HXBA 1X5BA 2I1JA 5CBNA 3AU4A 3DEPA 4RG6A 2IONA 4DK5A 2P9PG 2VSNA 3S2AA 5BV1A 4KT6B 2H6FA 3PZ3A 2XRZA 3HVEA 3CKBA 3B7TA 1DVPA 3ASFA 4M3OA 4MBGA 3RRUA 3NOCD 1SZ9A 2ZGGA 1EPUA 2R59A 3DPYA 3CK9A 1HO8A 3MV3B 4JC8A 4EHMA 2X6FA 4B89A 4UWHA 2RFAA 1N4QA 4ATGA 1TNUA 2X6KA 2HM8A 1S64A 2ETCA 4U96D 4KMOA 4UQYA 1ZBPA 3UINC 5ARFA 2VTBA 3O48A 4DLQA 4XX5A 5KBAA 3UMVA 5ANLA 4D10C 3L9TA 4O1OA 1EYHA 3I5PA 2J09A 3FU6A 4DX6D 5IY5E 3U3WA 4HLEA 4N2SA 3T5VA 3L16A 2P9KG 2WM9A 4O6FA 2C0MA 2Y4TA 2CHWA 3SBTB 4BT8A 1XNFA 4EBAG 4Q96A 4JL0A 3SFYA 3UKUG 4N3AA 1S70B 5AENA 2J4DA 3EJNA 3LS8A 5DIZA 3EHRA 4ABNA 3D3MA 2QYJA 3FTYA 4MRUA 1YA0A 4E85A 3ZKJA 3D9HA 2XPIA 3UM1A 4AVXA 2X6HA 1OCZE 4O60A 1TNOA 4CDMA 3S7FA 2J4BA 1E7VA 3Q47B 2GW1A 3CKCA 4GZCA 3LCAA 4K5AB 4BERA 2X3MA 3FEYA 2FULA 5KJKA 5EX0A 1NA3A 2L9BA 2AVPA 2J49A 4G8KA 4DUIA 4Y6WA 5B1AE 3O4ZA 4YDWA 4G23A 3QWVA 3B13A 2FO7A 2QFCA 3ONLA 2OVBA 3P1UA 2OEWA 2WPVA 4LNUD 2J9QA 5E75A 3AS8A 3P2BA 5G2NA 4N3CA 1ELKA 1D9SA 3HRAA 1GW6A 3MJWA 3PUKA 2XHEA 2P58C 3UM3A 2Y3AA 3ISMC 3SNXA 3ESLA 4JHJA 3PZ1A 4APFA 5HI7A 4Q94A 5ENTD 3PZ4A 1MX4A 4AP2A 2V5QC 2XEHA 3L6AA 4BX9A 4DX1A 1WAO1 1JCQA 2RKKA 5AJDA 5BXUA 2FEZA 2YQ8A 2XPZA 1BD8A 3TAXA 2I2OA 3PEUB 4FLHA 4WWPA 3G2SA 3QARA 4XI0A 5ENSD 5FZRA 2KCVA 5CMYA 2H6IA 2IY0C 3FUFA 3ZU7B 2WXJA 3SQVA 2R5SA 1N9AA 1PAQA 2ZGDA 1KT0A 2PL2A 4UI9K 2ZISA 3R7QA 4N39A 1HS6A 2FO1E 3HYMB 1OUVA 4MLPA
chains in the Genus database with same CATH topology
3HXCA 3Q75A 1JCSA 4GTTA 3HXDA 1O1RA 4L9PA 1SA4A 3HXEA 1NL4A 2F0YA 2R2LA 3DSXA 4YDEA 3C72A 1TNYA 3SFXA 3E32A 1O1SA 1QBQA 3DRAA 3HXFA 3PZ1A 3E34A 1TNZA 1O5MA 3EU5A 4GTMA 3SFYA 3PZ4A 1KZPA 1TN7A 3Q7FA 1TN8A 3HXBA 4LNGA 1N4SA 4GTRA 1JCQA 3Q7AA 2ZIRA 3E37A 1NI1A 1X81A 4GTVA 3DSVA 4GTOA 4YDOA 2H6FA 1KZOA 3PZ3A 3DSTA 3KSQA 2H6GA 3Q78A 1FPPA 1JCRA 1TNBA 3DSWA 1N95A 1O1TA 1TN6A 1TNOA 4MBGA 1D8EA 1DCEA 2IEJA 3Q79A 1SA5A 3DPYA 1N94A 2H6IA 3EUVA 4GTQA 1MZCA 4EHMA 1FT1A 3Q73A 1FT2A 1N9AA 1LD7A 2BEDA 1N4QA 4GTPA 2ZISA 1LD8A 2H6HA 1TNUA 3KSLA 1S63A 1N4PA 1S64A 1LTXA 3PZ2A 1N4RA 4LNBA 3DSSA 3E33A 3E30A 4GTSA 1D8DA 3DSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HXC A;  3Q75 A;  1JCS A;  4GTT A;  3HXD A;  1O1R A;  4L9P A;  1SA4 A;  3HXE A;  1NL4 A;  2F0Y A;  2R2L A;  3DSX A;  4YDE A;  3C72 A;  1TNY A;  3SFX A;  3E32 A;  1O1S A;  1QBQ A;  3DRA A;  3HXF A;  3PZ1 A;  3E34 A;  1TNZ A;  1O5M A;  3EU5 A;  4GTM A;  3SFY A;  3PZ4 A;  1KZP A;  1TN7 A;  3Q7F A;  1TN8 A;  3HXB A;  4LNG A;  1N4S A;  4GTR A;  1JCQ A;  3Q7A A;  2ZIR A;  3E37 A;  1NI1 A;  1X81 A;  4GTV A;  3DSV A;  4GTO A;  4YDO A;  2H6F A;  1KZO A;  3PZ3 A;  3DST A;  3KSQ A;  2H6G A;  3Q78 A;  1FPP A;  1JCR A;  1TNB A;  3DSW A;  1N95 A;  1O1T A;  1TN6 A;  1TNO A;  4MBG A;  1D8E A;  1DCE A;  2IEJ A;  3Q79 A;  1SA5 A;  3DPY A;  1N94 A;  2H6I A;  3EUV A;  4GTQ A;  1MZC A;  4EHM A;  1FT1 A;  3Q73 A;  1FT2 A;  1N9A A;  1LD7 A;  2BED A;  1N4Q A;  4GTP A;  2ZIS A;  1LD8 A;  2H6H A;  1TNU A;  3KSL A;  1S63 A;  1N4P A;  1S64 A;  1LTX A;  3PZ2 A;  1N4R A;  4LNB A;  3DSS A;  3E33 A;  3E30 A;  4GTS A;  1D8D A;  3DSU A; 
#chains in the Genus database with same CATH topology
 3ZXS A;  2IF4 A;  1NZN A;  1EF1 C;  5ITZ F;  2WMO A;  5CCL A;  2WB2 A;  1WY6 A;  4DRX E;  3GW4 A;  4G25 A;  1WM5 A;  3VLD A;  3PVL A;  1HE8 A;  5BT1 A;  2V8S E;  3LXU X;  2E2E A;  4QQI A;  3SD5 A;  3L08 A;  5D0O D;  4EEC A;  2DZN A;  3ZPJ A;  2GRL A;  4UQZ A;  3QNK A;  2L0I A;  3CVP A;  4KYO B;  3ASD A;  5BW8 C;  1AWC B;  3L22 A;  4UWL A;  1V54 E;  3UT4 A;  3IV0 A;  1Z3Y A;  3PE3 A;  3UIO C;  4GZ6 A;  3UIP C;  4AY5 A;  4UUC A;  4JVS A;  5EIB E;  4U63 A;  1S0P A;  1KPS B;  4CYM D;  2GRM A;  4U7E B;  3APD A;  4B0Z A;  2BF0 X;  3JQ1 A;  1EDU A;  3TXM A;  3G2U A;  4J8F A;  1HU3 A;  2P9L G;  1MZC A;  3FUD A;  4I17 A;  4CDN A;  4KVM A;  4IRU A;  2MHK A;  3CGH A;  1FT1 A;  2QY7 A;  3JXI A;  1U2V G;  5KNG A;  2RG8 A;  1SZA A;  3DSS A;  3D9O A;  5T8I A;  1DCQ A;  5DBK A;  3HXC A;  4U8Y D;  3QJZ A;  4H7Y A;  4BT9 A;  4I1O B;  2RD0 A;  2LAH A;  4FJZ A;  3ZXP A;  3KEA A;  4C48 B;  2LSU A;  4U8V D;  4ANX A;  3ABM E;  3K9I A;  4XIF A;  3DXM G;  4EZJ A;  3B95 A;  1O5M A;  3B7U X;  5HKP A;  2GRP B;  2P9U G;  2IO2 C;  4FLB A;  4J8E A;  1HG5 A;  5EKQ D;  2WXG A;  3SO8 A;  4BSZ B;  1Z3X A;  4HXI A;  1BU9 A;  4TXQ A;  1H19 A;  4URK A;  1UN9 A;  3B7B A;  3EIQ C;  4GTO A;  4WNE A;  4LUN U;  1IYG A;  4JW1 A;  3CV0 A;  3AG1 E;  1YYH A;  3QOU A;  1FPP A;  1YMP A;  2XS1 A;  5E76 A;  2L6B A;  2Y69 E;  3FUJ A;  3VLE A;  2KZT A;  2OVF A;  3EDT B;  3OAW A;  1NA0 A;  4C0M A;  1XGW A;  4HFG A;  2JEK A;  3GZ2 A;  3VTY A;  4KZC A;  1BI7 B;  1INZ A;  3E33 A;  2WXN A;  3W9F A;  4JHK A;  3C3R A;  4GMR A;  1MX6 A;  4GTT A;  2DWZ A;  3N71 A;  4PS7 A;  3RAU A;  1NL4 A;  4X8Q A;  3TWU A;  3FTW A;  3IKO B;  3ZHE A;  3NAW A;  3D9P A;  5KCM A;  4AV7 A;  3DRA A;  4PH4 B;  4APO A;  1E8W A;  4UWK A;  2CHX A;  4O1P A;  2DCP A;  2LAI A;  3ABL E;  1H6O A;  1U3D A;  5JHB A;  5CEC B;  2DYS E;  4CGV A;  3E37 A;  4GTV A;  4TUM A;  3T8M A;  3U66 A;  3SFZ A;  1KT1 A;  4BSX A;  1OXJ A;  4G2V A;  4I1M A;  1TN6 A;  3UX4 A;  1DCE A;  4L1B A;  4EQF A;  2E0I A;  4AY6 A;  5CCM A;  1K3Z D;  5EDS A;  1HF8 A;  1U3C A;  4A55 A;  3NZU A;  5HS0 A;  3MA5 A;  4HRM B;  2B6C A;  1WDY A;  4MKT A;  4F53 A;  3PDN A;  3QDN A;  2R02 A;  2P2C P;  4GAA A;  3LY7 A;  3NQP A;  3ESK A;  5JHA A;  3NOG D;  3QB2 A;  2XPY A;  1OWN A;  4DI4 A;  4UI9 J;  1H2T C;  3FUK A;  4GCO A;  4GA1 A;  1O1R A;  4JB8 P;  3CVN A;  3IHY A;  3ZFW A;  4I6E A;  3HDX A;  3SFX A;  5G05 C;  2OND A;  1QBQ A;  4Z68 A;  3TXN A;  3F6Q A;  5FT9 A;  4DX7 D;  4ANV A;  5KJM A;  1IHB A;  4ZHB A;  2FF4 A;  1TN8 A;  3AG2 E;  1QNF A;  1W3B A;  1N52 A;  2M63 A;  1RW2 A;  1TEZ A;  4FJY A;  2VGE A;  3L13 A;  2IQC A;  4I1A A;  3C98 A;  4AJW A;  2DYR E;  3ASH A;  4XKB A;  2XCB A;  4HOS A;  1P5Q A;  1A17 A;  1TNB A;  4OAV B;  4J7W A;  1N95 A;  3CHR A;  3CHO A;  1UOH A;  4U04 A;  2RFM A;  4DX5 D;  4AXH A;  3ASN E;  3AG3 E;  4HRN A;  2VSO E;  5CRV A;  1E8Y A;  2HYZ A;  3EU9 A;  4A3T A;  1LD8 A;  4V3I A;  3IBE A;  2WXF A;  3ZYK A;  4L2L A;  3TL5 A;  4PUC A;  4QFV A;  5B1B E;  2WXR A;  3MV2 B;  4HVB A;  2WXH A;  2AW6 A;  3FY4 A;  3OXL A;  4F1P A;  3MKR A;  2GGF A;  3ZGQ A;  3RSE G;  2AWI A;  1H6P A;  3BQO A;  4FUL A;  4NAC A;  3CVX A;  3RIB A;  4F3V A;  2LO6 A;  3V2O A;  1OWM A;  4JHR A;  3ML9 A;  3AS5 A;  4HS2 A;  1TNZ A;  3ZN3 A;  3CHP A;  2XZD G;  3L82 A;  5LCW C;  2AXZ A;  1TN7 A;  3Q7F A;  2OV8 A;  3PZD A;  4IN3 B;  3Q7A A;  1UN8 A;  3CHM A;  4LRZ A;  1AP7 A;  1E96 B;  4IUL A;  1UW4 B;  4U0U A;  2WQ7 A;  2NYJ A;  2PM6 A;  3Q78 A;  3JUE A;  3VLF A;  1L5J A;  4ILI A;  5CEA A;  2WXK A;  4EBA A;  4L23 A;  2A4Z A;  3T9K A;  2KBX A;  3LYA A;  1E90 A;  4DPR A;  2XEN A;  5FQ4 A;  1QYM A;  3LDZ A;  4PS8 A;  4GZ5 A;  3EHN A;  3CK8 A;  1B89 A;  3JYS A;  3AAA C;  4LNB A;  3VTX A;  4GA0 A;  3T5X A;  1A5E A;  3OTN A;  2VGX A;  1LF8 A;  1JCS A;  2UY1 B;  2WXM A;  2Y0B G;  3MX3 A;  4DI3 A;  2HE0 A;  4OVV A;  3PRZ A;  5KNH D;  4HRL A;  5EN5 D;  4GZ3 A;  3ULY A;  1Z6T A;  2C0L A;  4BX8 A;  2V4L A;  4HQD A;  4HI9 A;  3E32 A;  3MKQ B;  2PZI A;  3U4T A;  2BKG A;  2QC9 A;  3B7R L;  4C0E A;  1OY3 D;  3EU5 A;  3KEZ A;  1SVX A;  1SW6 A;  4DX2 A;  2P9I G;  3CIA A;  4XZ4 A;  4K0R A;  2EIJ E;  3TG4 A;  4DLO A;  3D9I A;  4ACK A;  3I4G A;  4ANW A;  3LVR E;  1KZO A;  4GB9 A;  2XZT G;  1O1T A;  5JMN D;  2XGM A;  1NFI E;  3FUI A;  2IEJ A;  4XI9 A;  3AJI A;  1HX8 A;  2OEV A;  1N94 A;  2X6I A;  3D9J A;  3HVE B;  5M72 A;  1FVF A;  1JPL A;  5EYP F;  4ATZ D;  4HOU A;  3IHV A;  2NSZ A;  3FTS A;  5HQ8 A;  5KJN A;  3FH7 A;  2H6H A;  3GZS A;  2P9S G;  4HI8 A;  3JQ0 A;  2EIL E;  2WQH A;  3JXJ A;  3CHQ A;  2CHZ A;  1ELR A;  4BY6 A;  3E30 A;  4TRQ A;  4NIK A;  1H2U A;  1H2V C;  1NP7 A;  2DBA A;  2KM4 A;  3WXX A;  4BWR A;  3IEG A;  3DWL G;  4A1S A;  4ILG A;  4L9P A;  1SA4 A;  3NBN B;  3G2W A;  3V30 A;  5ENR D;  3KAE A;  4J6I A;  2VTB B;  3ZYL A;  4U95 D;  3UM2 A;  5FJY A;  3SF4 A;  2I6H A;  3FEX A;  4FP7 A;  5G04 C;  5EID A;  2CG2 A;  3TWX A;  2Y4U A;  3LY9 A;  4GTR A;  3AS4 A;  2X38 A;  3G2T A;  2X6J A;  3PEV B;  4RG9 A;  5G55 A;  1NI1 A;  3DSV A;  5FWQ A;  1K1A A;  4GMJ A;  2H6G A;  5J90 A;  1VDY A;  4N2Q A;  3SHF A;  3FDH A;  3CK7 A;  4BET A;  4C9B B;  3C3Q A;  3Q79 A;  4TXR A;  4JEH A;  1RZ4 A;  5H7P A;  2UWJ G;  5LP0 A;  4ILH B;  4WNG A;  2EIN E;  2L6J A;  5A7D B;  4LER A;  2I9C A;  4N5Q A;  1S63 A;  3CSF A;  3UI2 A;  4FA6 A;  3PZ2 A;  3IXE A;  5A6C A;  1IKN D;  1IQR A;  1N11 A;  2F8X K;  1MJ0 A;  5D2M C;  3D9L A;  4GU5 A;  5ENP D;  2L0T B;  2KC7 A;  3BG1 B;  4JA7 A;  5KJL A;  3ZYM A;  5CED B;  4U0Z A;  1TYQ G;  2IFU A;  1OWP A;  1FCH A;  3KD7 A;  3UTM A;  4I2Z A;  4AEZ C;  3CVL A;  4ACL A;  3HXF A;  1PY1 A;  4WAF A;  2J8S D;  1SQM A;  1TJC A;  4I6J A;  3ZIM A;  2F37 A;  2GRO B;  5AIJ A;  5FQ6 A;  3PS6 A;  5BUZ A;  3FH8 A;  2AXU A;  3CVY A;  2ETA A;  1DC2 A;  4YVQ C;  2FI7 A;  3LJ3 A;  3Q49 B;  2OOE A;  5D66 A;  4FHJ A;  2J08 A;  3HHM A;  4G8L A;  3CST A;  3SZ7 A;  4N3B A;  4YDY A;  1JCR A;  2Y1L E;  4OYS A;  3PH0 C;  1BLX B;  5EIL A;  1UJJ A;  4U8H A;  5FIN A;  5D0Q D;  2NXP A;  3CHS A;  3ENE A;  4GCN A;  3BEE A;  3D9M A;  5FTP A;  2WXQ A;  3LVQ E;  3ZRH A;  2CFZ A;  2F8Y A;  3FTU A;  4J0U A;  3FU5 A;  4HBD A;  3LJN A;  4EZL A;  4CGW A;  4GTQ A;  4K5C A;  2ILR A;  3ASO E;  3ZEF A;  1LD7 A;  1JUQ A;  2GRN B;  3BG0 B;  3ONK A;  4GYW A;  2XGO A;  3MGB A;  1N4P A;  4G26 A;  1LTX A;  3URZ A;  1OWO A;  2YNQ A;  4PS3 A;  1TR4 A;  1TJF A;  3Q75 A;  3HXD A;  4FAD A;  5AQ7 A;  3LEW A;  4AM9 A;  3NB2 A;  3SBS A;  4L7T A;  2F0Y A;  3QK0 A;  2NC9 A;  3R9M A;  4PDX A;  4GYO A;  4RQI A;  3U9W A;  4LG6 A;  3C72 A;  3QWP A;  4GA2 A;  4WWN A;  3RO3 A;  5AYW D;  2WMN A;  3JCK C;  3E34 A;  1FVH A;  1V55 E;  4LCT A;  2AJA A;  4I6G A;  2IO3 C;  3PE4 A;  3HG0 D;  1MHQ A;  4CRW A;  4JD2 G;  2JLB A;  4JEU A;  1N4S A;  4BEP A;  2R17 C;  4KVO A;  1Q2Z A;  5HRY A;  1X81 A;  3S7B A;  4AIF A;  4J8D A;  4CEM A;  2XEV A;  3R9A B;  4U0S A;  3UT7 A;  4GPK A;  2KXP C;  4G24 A;  3KSQ A;  4KZ0 A;  3LKU A;  3DSW A;  3FTV A;  4WND A;  5C2Y A;  2KCK A;  3UQ3 A;  2PQR A;  2LNI A;  2EIK E;  2WXP A;  3FHE A;  3FH5 A;  2WQ6 A;  3ULQ A;  3EHQ A;  3WG7 E;  2WXO A;  3Q5M A;  1H0A A;  4H7X A;  2LXM A;  3DEO A;  2YIN A;  1OCO E;  2HO1 A;  3KS2 A;  4IYP A;  4GTS A;  5ANR A;  3TWR A;  4M7C A;  3RRN B;  3QKY A;  4HNA D;  2XCC A;  4E6H A;  3APC A;  4I2W A;  3Q15 A;  3C5R A;  4BES A;  2J07 A;  2R2L A;  3DSX A;  4TUU A;  2GRQ B;  1K8K G;  2CG3 A;  3TWT A;  2VGY A;  2WXL A;  1KLX A;  4LEU A;  2DZO A;  3PUJ A;  4Y6C A;  4TV3 A;  5G05 J;  4FHK A;  4G11 A;  4LSZ E;  4P29 A;  3J5Q B;  5ARG A;  1QZ2 A;  2A5U A;  5AN8 A;  1UJK A;  1OCC E;  4B93 B;  5ENO D;  3OXG A;  3R7R A;  4ZFH A;  4B8A A;  3GZ1 A;  4JPS A;  3C3O A;  3UT8 A;  3MCX A;  3AG4 E;  1PC2 A;  2WVI A;  4HOR A;  1Y6I A;  3GYZ A;  5AQA A;  1YCS B;  3I3N A;  2JAB A;  3APF A;  3V79 K;  2VSX E;  5C1D A;  2V0P A;  3X2Q E;  3FTZ A;  5JA4 D;  5EYL A;  1FT2 A;  2BTD A;  4BTB A;  4GTP A;  4CZ2 D;  4NRH B;  3EHM A;  2XGS A;  3KSL A;  4OVU A;  1MQS A;  3CR3 A;  5BNW A;  4W9R A;  3UPV A;  3TWS A;  2VJ8 A;  5KWD A;  2KZT B;  1QQE A;  2R05 A;  4A1G A;  5FQ7 A;  3ZW3 A;  4HOQ A;  2WXI A;  3CVW A;  3QC1 A;  5B3S E;  3PNL B;  2HR2 A;  2MYO A;  3EIJ A;  4JA9 A;  5BXO A;  1HZ4 A;  3CVQ A;  1O1S A;  1MYO A;  3TG5 A;  3QAQ A;  3RKV A;  4CCA A;  1HG2 A;  4GYY A;  4WUY A;  3PNT B;  4GZD A;  3FUM A;  2DVW A;  3DPD A;  4I9E A;  3TJP A;  4ME2 A;  3ZHE B;  2ZIR A;  5LCW J;  1ZB1 A;  3UXG A;  1JWG A;  1JWF A;  1UG3 A;  4U07 A;  3JUI A;  3LY8 A;  4HLL A;  4EZK A;  3DST A;  4F6R D;  2IOL A;  2V5F A;  2VYI A;  4I9C A;  3RJV A;  3FUH A;  4K5B A;  2AXV A;  4UWG A;  1SA5 A;  2FBN A;  2LXL A;  5EX3 A;  4J8S A;  3EUV A;  4FU3 A;  4RLY A;  3L17 A;  3V2X A;  2PNN A;  5AAO A;  3ZYQ A;  4XE0 A;  3RK6 A;  3UM0 A;  1E8X A;  1K1B A;  1IQU A;  1N4R A;  1MX2 A;  5CBO A;  5FQ8 A;  4L2Y A;  1D8D A;  2XEE A;  1E8Z A;  3B7S A;  2QZA A;  4CDR A;  2CFU A;  4B94 A;  4DJA A;  4GML A;  5CMW A;  3HXE A;  4A63 B;  4RVB A;  5A23 A;  2IOS A;  2Q7F A;  5FIO A;  4OAU C;  4A3V A;  2BUG A;  2PM7 A;  3UKR G;  3BU8 A;  3ULE G;  4ANU A;  3OXF A;  3FUL A;  1KZP A;  3CQC B;  5JJ6 A;  3FU3 A;  3ZNG A;  3W9G A;  3FTX A;  2YHE A;  3FU0 A;  2IU1 A;  1IHG A;  4YDO A;  4F7A A;  2QYU A;  4TXP A;  3RRM B;  1Y8M A;  2P9N G;  3ABK E;  5BV0 A;  3J5P A;  3ML8 A;  2VSY A;  3CEQ A;  5ENQ D;  1E7U A;  3U64 A;  1D8E A;  1HXI A;  4UQX A;  5LOZ A;  1HH8 A;  2PQN A;  3CLJ A;  2V4H C;  3MEK A;  4JXT A;  2VQ2 A;  4HOT A;  1G3N B;  3Q9U C;  3Q4A B;  5CRU A;  3S7D A;  2I1K A;  1N54 A;  3ASG A;  1OCR E;  2KCL A;  3QWW A;  1DNP A;  1BI8 B;  3FUE A;  3MYV A;  3LPZ A;  3PRE A;  3CVV A;  5T4Y A;  5AAR A;  3SI5 A;  1ELW A;  2EQX A;  2ETB A;  3NZS A;  4RSY A;  3FP3 A;  1OWL A;  1TNY A;  3G2V A;  5ENN A;  4F1S A;  3BUA A;  2LSV A;  4G1T A;  3ZVV A;  3V31 A;  3TGO A;  4GTM A;  1H6K A;  2XRY A;  5BPP A;  3Q9N C;  2MOW A;  5LX8 A;  4LNG A;  4MS6 A;  4FC8 A;  3ZUV B;  3TWW A;  4YND A;  3L54 A;  3CQG B;  2ZU6 B;  1OT8 A;  4YVO A;  5G04 J;  2XS8 A;  4HB5 A;  4J8Y A;  4B8C B;  3S7J A;  1HFA A;  3AU5 A;  4KXK B;  4KBQ A;  5CHE E;  3DBS A;  4N5C A;  3D9N A;  4CT4 A;  2DIW A;  1IXV A;  3FWV A;  5AQ9 A;  3I4R B;  3MZL B;  4Q69 A;  3CVU A;  4JZY A;  2KAT A;  1BPO A;  4UWF A;  2BKK B;  5CER B;  4XEI G;  4CT0 A;  2UY1 A;  3Q73 A;  4XKC A;  1N0R A;  2BED A;  3RU0 A;  3SGH A;  5J08 A;  4K03 A;  5JJT A;  3TWQ A;  4UI9 C;  1Z5S C;  5FZQ A;  3FUN A;  3DXK G;  4WNF A;  4BFR A;  4R7L A;  4I43 A;  3DSU A;  3FFL A;  3HIZ A;  3T8K A;  4NUR A;  3MKQ A;  5T3R A;  3UUX A;  3NF1 A;  2EIM E;  3TWV A;  5AJL A;  5JJ7 A;  5AQB A;  2IJG X;  2YHC A;  1N0Q A;  3D9K A;  2B0O E;  4WWO A;  2ZXW E;  4YDE A;  2VGX B;  4BTA A;  3SY2 A;  2GRR B;  2C2L A;  2OCC E;  2A5E A;  4NQ0 A;  2R03 A;  1WG0 A;  3E4B A;  4GPM A;  2MRI A;  1ZU2 A;  2LUH A;  2XQ0 A;  5FZS A;  5LFA A;  4EPZ A;  3RO2 A;  4AOF A;  3HXB A;  1X5B A;  2I1J A;  5CBN A;  3AU4 A;  3DEP A;  4RG6 A;  2ION A;  4DK5 A;  2P9P G;  2VSN A;  3S2A A;  5BV1 A;  4KT6 B;  2H6F A;  3PZ3 A;  2XRZ A;  3HVE A;  3CKB A;  3B7T A;  1DVP A;  3ASF A;  4M3O A;  4MBG A;  3RRU A;  3NOC D;  1SZ9 A;  2ZGG A;  1EPU A;  2R59 A;  3DPY A;  3CK9 A;  1HO8 A;  3MV3 B;  4JC8 A;  4EHM A;  2X6F A;  4B89 A;  4UWH A;  2RFA A;  1N4Q A;  4ATG A;  1TNU A;  2X6K A;  2HM8 A;  1S64 A;  2ETC A;  4U96 D;  4KMO A;  4UQY A;  1ZBP A;  3UIN C;  5ARF A;  2VTB A;  3O48 A;  4DLQ A;  4XX5 A;  5KBA A;  3UMV A;  5ANL A;  4D10 C;  3L9T A;  4O1O A;  1EYH A;  3I5P A;  2J09 A;  3FU6 A;  4DX6 D;  5IY5 E;  3U3W A;  4HLE A;  4N2S A;  3T5V A;  3L16 A;  2P9K G;  2WM9 A;  4O6F A;  2C0M A;  2Y4T A;  2CHW A;  3SBT B;  4BT8 A;  1XNF A;  4EBA G;  4Q96 A;  4JL0 A;  3SFY A;  3UKU G;  4N3A A;  1S70 B;  5AEN A;  2J4D A;  3EJN A;  3LS8 A;  5DIZ A;  3EHR A;  4ABN A;  3D3M A;  2QYJ A;  3FTY A;  4MRU A;  1YA0 A;  4E85 A;  3ZKJ A;  3D9H A;  2XPI A;  3UM1 A;  4AVX A;  2X6H A;  1OCZ E;  4O60 A;  1TNO A;  4CDM A;  3S7F A;  2J4B A;  1E7V A;  3Q47 B;  2GW1 A;  3CKC A;  4GZC A;  3LCA A;  4K5A B;  4BER A;  2X3M A;  3FEY A;  2FUL A;  5KJK A;  5EX0 A;  1NA3 A;  2L9B A;  2AVP A;  2J49 A;  4G8K A;  4DUI A;  4Y6W A;  5B1A E;  3O4Z A;  4YDW A;  4G23 A;  3QWV A;  3B13 A;  2FO7 A;  2QFC A;  3ONL A;  2OVB A;  3P1U A;  2OEW A;  2WPV A;  4LNU D;  2J9Q A;  5E75 A;  3AS8 A;  3P2B A;  5G2N A;  4N3C A;  1ELK A;  1D9S A;  3HRA A;  1GW6 A;  3MJW A;  3PUK A;  2XHE A;  2P58 C;  3UM3 A;  2Y3A A;  3ISM C;  3SNX A;  3ESL A;  4JHJ A;  3PZ1 A;  4APF A;  5HI7 A;  4Q94 A;  5ENT D;  3PZ4 A;  1MX4 A;  4AP2 A;  2V5Q C;  2XEH A;  3L6A A;  4BX9 A;  4DX1 A;  1WAO 1;  1JCQ A;  2RKK A;  5AJD A;  5BXU A;  2FEZ A;  2YQ8 A;  2XPZ A;  1BD8 A;  3TAX A;  2I2O A;  3PEU B;  4FLH A;  4WWP A;  3G2S A;  3QAR A;  4XI0 A;  5ENS D;  5FZR A;  2KCV A;  5CMY A;  2H6I A;  2IY0 C;  3FUF A;  3ZU7 B;  2WXJ A;  3SQV A;  2R5S A;  1N9A A;  1PAQ A;  2ZGD A;  1KT0 A;  2PL2 A;  4UI9 K;  2ZIS A;  3R7Q A;  4N39 A;  1HS6 A;  2FO1 E;  3HYM B;  1OUV A;  4MLP A; 
#chains in the Genus database with same CATH homology
 3HXC A;  3Q75 A;  1JCS A;  4GTT A;  3HXD A;  1O1R A;  4L9P A;  1SA4 A;  3HXE A;  1NL4 A;  2F0Y A;  2R2L A;  3DSX A;  4YDE A;  3C72 A;  1TNY A;  3SFX A;  3E32 A;  1O1S A;  1QBQ A;  3DRA A;  3HXF A;  3PZ1 A;  3E34 A;  1TNZ A;  1O5M A;  3EU5 A;  4GTM A;  3SFY A;  3PZ4 A;  1KZP A;  1TN7 A;  3Q7F A;  1TN8 A;  3HXB A;  4LNG A;  1N4S A;  4GTR A;  1JCQ A;  3Q7A A;  2ZIR A;  3E37 A;  1NI1 A;  1X81 A;  4GTV A;  3DSV A;  4GTO A;  4YDO A;  2H6F A;  1KZO A;  3PZ3 A;  3DST A;  3KSQ A;  2H6G A;  3Q78 A;  1FPP A;  1JCR A;  1TNB A;  3DSW A;  1N95 A;  1O1T A;  1TN6 A;  1TNO A;  4MBG A;  1D8E A;  1DCE A;  2IEJ A;  3Q79 A;  1SA5 A;  3DPY A;  1N94 A;  2H6I A;  3EUV A;  4GTQ A;  1MZC A;  4EHM A;  1FT1 A;  3Q73 A;  1FT2 A;  1N9A A;  1LD7 A;  2BED A;  1N4Q A;  4GTP A;  2ZIS A;  1LD8 A;  2H6H A;  1TNU A;  3KSL A;  1S63 A;  1N4P A;  1S64 A;  1LTX A;  3PZ2 A;  1N4R A;  4LNB A;  3DSS A;  3E33 A;  3E30 A;  4GTS A;  1D8D A;  3DSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...