1O5MA

Structure of fpt bound to the inhibitor sch66336
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
315
structure length
315
Chain Sequence
b'GFLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase alpha subunit
publication title Tricyclic Farnesyl Protein Transferase Inhibitors: Crystallographic and Calorimetric Studies of Structure-Activity Relationships
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
total genus 125
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2003-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1o5mA00
1NI1A 2H6HA 1TNYA 2ZISA 1TN8A 3Q79A 3KSQA 3SFYA 4GTTA 4GTOA 3DSSA 1JCQA 4GTPA 1DCEA 1KZOA 1TN7A 3HXEA 1D8DA 1FT2A 3HXFA 3KSLA 4GTVA 2F0YA 1QBQA 1KZPA 1LD7A 3Q73A 1FPPA 3DRAA 3Q7FA 3PZ1A 4GTSA 4LNBA 4MBGA 3Q78A 3EUVA 2H6IA 4YDOA 3PZ3A 1LD8A 1N4SA 1O1RA 1S64A 4GTMA 1O5MA 1SA5A 3E32A 3PZ4A 3E30A 4L9PA 1N95A 1O1TA 4EHMA 1TN6A 1X81A 2IEJA 3Q7AA 3DSVA 1TNBA 1SA4A 3EU5A 1O1SA 1D8EA 4LNGA 4GTQA 3DPYA 2BEDA 1S63A 1TNOA 1N4PA 2H6FA 1N4RA 3C72A 2ZIRA 2R2LA 2H6GA 1N4QA 3DSTA 1MZCA 1N9AA 1TNZA 3SFXA 1JCRA 1TNUA 3HXCA 1NL4A 3DSXA 3PZ2A 3Q75A 4YDEA 3E34A 3HXDA 3HXBA 3DSUA 1N94A 3E37A 1JCSA 3E33A 3DSWA 1LTXA 1FT1A 4GTRA
chains in the Genus database with same CATH superfamily
4A1SA 3FDHA 5G05C 2RD0A 5EKQD 2CFUA 3FU3A 3CSTA 2P9SG 4WNEA 4YVOA 4CEMA 4AY6A 4IULA 3QOUA 5EDSA 3KSLA 4Q69A 4JEUA 3ZYQA 3EJNA 2KATA 3L82A 2I1KA 2DZOA 3RO3A 4ZHBA 4MBGA 5M72A 3PRZA 2HM8A 2P9KG 5LP0A 3ZEFA 4KT6B 4YNDA 3SBSA 4I6GA 3TG5A 3JUIA 5HI7A 2V5QC 2KC7A 5E76A 1JWFA 1N11A 3C3OA 3AJIA 4LUNU 2EIKE 2DYRE 4J6IA 1HXIA 5FINA 3ONKA 4HVBA 2OVBA 5CMWA 4PS8A 3FUHA 3LEWA 2UY1B 1UG3A 4BSXA 4FP7A 2DYSE 1ELRA 2A5EA 1H2UA 3HXBA 1DNPA 3S7DA 1QNFA 1LTXA 1IQRA 3UUXA 2XZDG 1FT1A 4JHJA 3ZYMA 3UQ3A 1YMPA 4GPMA 5AYWD 1ELWA 2ETBA 4FU3A 4JHKA 5ENOD 2AW6A 3QC1A 4O1OA 4LCTA 3D9HA 4HRLA 3VLEA 4I6JA 3K9IA 4J0UA 1U3DA 3ZVVA 1E7UA 4G1TA 4GCNA 1H6KA 5AJDA 4ACLA 2ETAA 1OCCE 2P9NG 4G2VA 1Z5SC 2QFCA 4QFVA 4URKA 4QQIA 2R59A 2WXKA 4O6FA 2I9CA 2GROB 2X6FA 2GRLA 3RU0A 3R7RA 3CIAA 3B7UX 3DXKG 4LRZA 3RJVA 4K5BA 4AY5A 4DX7D 2EIME 2QYUA 4AIFA 3HVEA 1MX4A 2XZTG 3EHMA 3UPVA 2CHWA 3T8MA 3TXNA 2J8SD 1OY3D 3MJWA 2WXLA 4YVQC 3RO2A 4NQ0A 4J8EA 4ANWA 2C0MA 5FT9A 3ZRHA 4GYWA 2R02A 3S7FA 2F8XK 4DPRA 1OWNA 1XNFA 3D3MA 2XPZA 2WM9A 4JC8A 2AWIA 4B0ZA 3DEOA 3ZN3A 2L6JA 3TWVA 1IXVA 3AAAC 3U3WA 3Q15A 3V79K 3PEUB 3CQCB 4DI3A 1FT2A 3IHVA 5FWQA 1KZPA 3AS4A 3LKUA 2GRNB 4AEZC 1L5JA 3PZ1A 3MV2B 5G04J 4G23A 1H6OA 3GYZA 2WXIA 2H6IA 4N5QA 4WUYA 3SNXA 3JYSA 1O1RA 4OVVA 5B1BE 1H0AA 5DIZA 4I9CA 3DXMG 4DX1A 3D9IA 3D9JA 5KBAA 1TNBA 2ZU6B 2QYJA 4HNAD 2VTBB 3UT7A 2J08A 4CZ2D 4LNGA 2XCBA 3RIBA 1S63A 5G04C 5ENPD 1IYGA 2XRYA 5CBOA 3UT8A 3ABME 4N39A 4TRQA 1XGWA 4X8QA 1TJCA 3W9GA 3SBTB 3HXDA 1JCSA 2IOSA 2Y3AA 2DWZA 5FTPA 1PAQA 4BETA 3UM3A 4GA1A 2IFUA 2XEVA 3SI5A 4L2YA 3MEKA 4TUMA 3JQ1A 3PREA 4PS3A 5T3RA 4I1OB 2ETCA 1TN7A 3BG0B 2Y69E 3CVUA 2L0TB 3FUNA 3G2SA 3L08A 4PUCA 3BUAA 3UKUG 1H6PA 2KZTB 3UIOC 3CK7A 2KXPC 3DRAA 4LNBA 4EBAA 2IU1A 4J8FA 1V55E 2UY1A 4YDOA 1B89A 2R17C 1SA5A 1ZB1A 3BQOA 1X81A 4HORA 4WNDA 1NFIE 4L7TA 1BD8A 4CRWA 1PC2A 1TJFA 2XRZA 4UWGA 3T5VA 2BF0X 3FY4A 2F8YA 1KPSB 4B89A 1IHGA 3OAWA 4E6HA 5BV1A 4F3VA 2VSYA 1TR4A 4HLLA 3D9NA 1HO8A 5KWDA 3SHFA 3RK6A 1WDYA 3O48A 1BPOA 3APFA 4N2QA 1NA0A 4K0RA 3OXFA 1AP7A 2FI7A 2XGOA 4GTRA 3GZSA 4GZCA 4APFA 1MHQA 2R03A 4LEUA 3NF1A 2AVPA 2R05A 2L9BA 2LSUA 2BUGA 1MYOA 3CKCA 5FJYA 4RG9A 3ZGQA 4B94A 2VSXE 2MRIA 3FU6A 4GZ5A 4WWPA 2GRRB 3G2VA 4GTVA 3DBSA 4U7EB 3S7BA 4I2WA 3CHMA 5JJTA 3VLDA 5LCWC 3PZ4A 4HI8A 5ENTD 5HKPA 4AP2A 4B93B 2J07A 4FHJA 3BU8A 3EU5A 1K3ZD 2CHZA 2OOEA 3EIJA 4J8DA 4OVUA 3TGOA 3AU5A 4EZJA 3HRAA 3SY2A 2ZIRA 3CK8A 3ESLA 3HDXA 4JHRA 5AQAA 3CVNA 2VGXA 2CHXA 2OEVA 4NIKA 3EHQA 5DBKA 1Q2ZA 4RG6A 4UWFA 2YINA 2XS1A 3QNKA 3JQ0A 3FU0A 3B7TA 4U8YD 3HYMB 3AS8A 4U07A 2P9UG 2M63A 4GTTA 2R5SA 4ILIA 4KZCA 4GAAA 4HLEA 3HG0D 5G55A 4U96D 3CVLA 5T4YA 1N0QA 4OAVB 2MHKA 2ILRA 5D0OD 4BEPA 5D0QD 2VTBA 4K5CA 4DX5D 2FO1E 5JJ6A 3L22A 3Q73A 3CHPA 2DBAA 3CHSA 5CEAA 1FCHA 1JUQA 2X6JA 3ASHA 1IKND 3PH0C 3V2XA 3NOCD 4U63A 5ANLA 3IHYA 1MQSA 2LUHA 4KXKB 2ZGGA 2J4BA 2WXGA 4DLOA 3L54A 3QWPA 3I4GA 3ZNGA 1D8EA 3B7SA 5CRUA 4BESA 3JXIA 3SFZA 5CCMA 2QY7A 4I1MA 3UI2A 1H19A 2J9QA 3ZKJA 3FHEA 5CECB 4F6RD 3FTYA 3BEEA 4AVXA 3FFLA 3UIPC 4F53A 3PUKA 5JA4D 2EILE 4I6EA 5ANRA 3FTUA 1UJKA 5AQBA 3LY7A 4DX2A 3PE3A 3EHRA 2CG2A 4WWOA 4ILHB 1SZ9A 4UQZA 2V5FA 2XQ0A 4AOFA 1QBQA 3RSEG 3HHMA 4JEHA 4N3CA 4WWNA 1YYHA 3FWVA 3Q78A 1BLXB 2GW1A 4A3TA 2Q7FA 3KS2A 3U4TA 2HE0A 3LYAA 2VGEA 4UWLA 3SF4A 3CQGB 2OVFA 2XPYA 4TXPA 2J4DA 4HB5A 2IJGX 2IQCA 2Y4TA 4WNFA 5HQ8A 4AJWA 5BV0A 5JHBA 2XS8A 2VSNA 3FUFA 1WY6A 1ZU2A 3CVVA 2DVWA 4FLBA 3CEQA 4I9EA 5C1DA 3SFXA 4KBQA 4RLYA 3HXCA 1NL4A 1D9SA 1KT0A 1INZA 2X38A 4XE0A 4HS2A 3ISMC 2E2EA 2H6HA 4HI9A 2V4HC 3I4RB 1OT8A 2X3MA 2ZISA 5C2YA 1WG0A 2EINE 1ZBPA 2WXQA 2XCCA 5FZSA 1Z6TA 4TV3A 3FTSA 1DCQA 3T9KA 2IY0C 3CVYA 4H7YA 3APDA 3D9KA 5EIBE 3ML8A 3G2WA 4U0UA 3LCAA 1S70B 3UX4A 3MKQB 4G8LA 4LG6A 2ONDA 3KEZA 2WXMA 3Q49B 3P1UA 4BERA 4C0EA 5FZRA 4L1BA 3QK0A 5AARA 5ENSD 1N95A 3I5PA 5EX3A 4BY6A 3FH5A 4EZKA 4XIFA 3CHOA 4LNUD 2WXHA 2WXRA 1N4PA 4UUCA 2WPVA 2VYIA 1OCRE 2C2LA 1HH8A 3KD7A 4FA6A 3FUIA 4BTAA 3ZYKA 3CV0A 5AIJA 4BFRA 2GRMA 1W3BA 4ZFHA 4I43A 1K1BA 1Y6IA 2IF4A 3PDNA 4HOQA 4DJAA 4IN3B 3QWVA 3AU4A 3S7JA 3IKOB 3B7BA 1E8ZA 3ZW3A 1RZ4A 3SGHA 3MYVA 5J08A 1DC2A 4GTPA 3G2TA 3LDZA 5H7PA 4OYSA 4C48B 4GMLA 3C3QA 3ULYA 1D8DA 5AQ7A 1YA0A 2L6BA 3L6AA 4I1AA 4KMOA 3GW4A 3FTZA 1BU9A 5FQ7A 5EX0A 3ULQA 3Q7FA 2FEZA 4U95D 4UI9K 2XEHA 2J09A 3ESKA 3RKVA 4R7LA 3E32A 4JD2G 2KBXA 3CVPA 3EIQC 2RFMA 3UKRG 1A17A 3C3RA 4AM9A 5E75A 4P29A 3C72A 4UI9J 4MS6A 1EF1C 4U04A 4V3IA 3ZXPA 2BKGA 1OXJA 3ZXSA 3ASDA 1MJ0A 3AG1E 4G11A 4EZLA 4JL0A 5B1AE 4A3VA 4YDEA 2WB2A 2HO1A 4ILGA 4FC8A 4BT9A 2WXJA 4HQDA 2BTDA 3D9LA 3ZHEB 4UI9C 4GA0A 1QQEA 1GW6A 1EYHA 2I2OA 4A55A 1UN9A 1UOHA 3L13A 1WAO1 2AJAA 5KJLA 3UMVA 2ZXWE 5ENRD 3EU9A 1WM5A 4GZ3A 5CCLA 3T8KA 1E8YA 4JVSA 4I2ZA 5EN5D 2CFZA 4AV7A 3IBEA 4BWRA 3NOGD 4HOUA 3TAXA 3FUJA 5LCWJ 2WVIA 4G8KA 2Y1LE 3VTYA 1MX6A 3NBNB 1N4SA 4FJZA 1S64A 3FTXA 4CGWA 1O5MA 3JCKC 4L9PA 2X6HA 4Q96A 3TWTA 3NZUA 3Q4AB 3B7RL 4O60A 4WAFA 1H2VC 5B3SE 2BEDA 3ENEA 4LSZE 1TNOA 2YNQA 4JB8P 3MCXA 5EIDA 3MGBA 1VDYA 1K1AA 4PDXA 3HVEB 4FHKA 2C0LA 3FUEA 3QARA 4XEIG 3OXLA 4JXTA 1QYMA 3I3NA 4HXIA 2XENA 5ARFA 4LERA 5BPPA 3DSXA 2Y0BG 4HRNA 4A1GA 3FUMA 3AS5A 1TYQG 4F1SA 3E37A 3LXUX 3E33A 3UTMA 2I1JA 4UQYA 1QZ2A 4I17A 3TWWA 3ASNE 2LAIA 3QAQA 5LOZA 3LY8A 2FO7A 4GCOA 4Q94A 4TUUA 4GZ6A 2OEWA 2IONA 2OCCE 4M7CA 4BSZB 2MOWA 5FZQA 4K03A 3D9MA 2FULA 4Y6WA 4BT8A 2PL2A 2FF4A 3KAEA 4L2LA 5KJKA 1LD7A 2PQRA 1FPPA 4GYYA 4GTSA 3LS8A 3PVLA 2V0PA 1X5BA 3Q9NC 1HFAA 1HE8A 5EYPF 4Y6CA 5JMND 4H7XA 2E0IA 5KJMA 4YDYA 4CCAA 1P5QA 4PS7A 3UT4A 5KCMA 2IOLA 2LO6A 4UWHA 4GTQA 4OAUC 2H6FA 2RFAA 1N4RA 5FQ6A 2H6GA 2L0IA 3NB2A 1N9AA 2WMOA 2WXPA 4KYOB 4KZ0A 2RKKA 1OWOA 4CT4A 4F1PA 2AXUA 1JCRA 3FU5A 3JXJA 3UXGA 3U9WA 2YQ8A 3MV3B 2KCLA 1N94A 3PUJA 2WQHA 3CVXA 3B13A 3TG4A 3Q79A 2PNNA 3VLFA 3C5RA 4Z68A 1N0RA 4GTOA 5D66A 3TXMA 1SVXA 3DSSA 3UM2A 2KZTA 4U8VD 3C98A 2V4LA 2KCKA 4B8CB 2JLBA 4N2SA 4DX6D 3QDNA 3FEXA 1IHBA 2DZNA 1OUVA 5BT1A 4F7AA 5ENQD 3RAUA 2DCPA 2HR2A 2PZIA 4IRUA 3FP3A 2WXOA 4C9BB 3RRMB 4ME2A 3L9TA 3UINC 2PM7A 1UW4B 3ASFA 2WXFA 1HX8A 3FH8A 4CDMA 1U3CA 5G2NA 3S2AA 3ZHEA 1O1SA 4HOSA 5FQ8A 1G3NB 2ZGDA 4FADA 5FIOA 1UJJA 2PQNA 3T5XA 2BKKB 1N54A 1N4QA 4XX5A 4L23A 3LVRE 5ARGA 2WQ6A 1MZCA 4C0MA 1FVHA 3SD5A 1UN8A 3FUDA 5KNHD 4N3BA 4AXHA 3Q75A 3FEYA 4DRXE 3E34A 3GZ1A 5AN8A 5ENNA 3DSUA 3QJZA 2JABA 4CDNA 4IYPA 2DIWA 4J8SA 3P2BA 2VSOE 1HU3A 4GMJA 3FTVA 5AENA 1TN8A 3NAWA 3SO8A 1EDUA 2RG8A 4NRHB 2XGSA 4ATZD 3SFYA 4M3OA 3ONLA 1IQUA 2LNIA 4GU5A 1HF8A 1KZOA 3ZUVB 4HRMB 1E90A 3HXFA 4J7WA 3QKYA 1E96B 3GZ2A 4A63B 2EIJE 3Q5MA 3LJ3A 4CYMD 2WXNA 3L17A 2XPIA 1FVFA 3DWLG 3EUVA 1YCSB 3OXGA 3SZ7A 2VJ8A 3O4ZA 1KT1A 3PZDA 4GTMA 4KVMA 2LXMA 3NZSA 2J49A 4EHMA 4J8YA 2VGYA 3KEAA 4O1PA 2IEJA 3V31A 1LF8A 3J5QB 1U2VG 2NC9A 2JEKA 3ZPJA 3LJNA 1SW6A 2B6CA 1S0PA 3U64A 4HFGA 3IXEA 3AG3E 3CVWA 4N3AA 5BXUA 2KM4A 5AJLA 2UWJG 5HRYA 4MKTA 3AG4E 5KJNA 2A4ZA 3WG7E 2XEEA 5IY5E 4DK5A 1OWLA 3PNLB 2P58C 4TXQA 3V30A 3PZ2A 4CGVA 4G26A 2VGXB 2A5UA 2VQ2A 4ACKA 4DLQA 4GZDA 2OV8A 3PS6A 5A6CA 4YDWA 5BUZA 4APOA 3OTNA 4JW1A 1N52A 2LAHA 5KNGA 5CMYA 4ANUA 2X6IA 3IEGA 3LPZA 3R9AB 1JPLA 4EPZA 1TEZA 4UWKA 5J90A 3CK9A 2WMNA 1HZ4A 2LSVA 4PH4B 5JJ7A 3AG2E 4ANVA 1AWCB 2F0YA 4NURA 3R7QA 4TXRA 5EILA 3PEVB 4U0ZA 2XGMA 1OWMA 4EECA 1K8KG 3CHRA 3WXXA 3B95A 2IO3C 3MA5A 1E8WA 3CSFA 1LD8A 5ITZF 3D9OA 2NXPA 1HG5A 3PE4A 3E30A 2P9LG 5D2MC 1TN6A 3LVQE 3F6QA 3FTWA 3ABLE 4XI9A 2YHEA 1SA4A 5AAOA 5CEDB 4JA7A 4CDRA 2NSZA 2IO2C 3TWXA 4FULA 3CHQA 2R2LA 2KCVA 3ZYLA 2QZAA 4ATGA 3ULEG 1OCZE 5BNWA 4B8AA 4MLPA 1V54E 4DUIA 2PM6A 4EBAG 4U8HA 5T8IA 4RSYA 4BX9A 3CLJA 2GGFA 3APCA 5JHAA 1HG2A 5CERB 1NA3A 1PY1A 3IV0A 4BX8A 1H2TC 4EQFA 3DPDA 4G25A 3DSWA 5HS0A 1NI1A 3JUEA 1E8XA 1TNYA 3KSQA 2NYJA 1RW2A 4XI0A 3BG1B 4E85A 1DCEA 4U0SA 4GMRA 4GB9A 3HXEA 3QWWA 3R9MA 1KLXA 3ZIMA 3D9PA 3FH7A 3FUKA 4BTBA 3DEPA 5CBNA 3UM0A 3ASGA 5BXOA 3N71A 2WQ7A 3MZLB 2CG3A 3VTXA 2X6KA 4JZYA 3Q9UC 3LY9A 3PZ3A 3PNTB 2EQXA 1SZAA 4GA2A 1EPUA 3TWSA 3EDTB 3X2QE 3W9FA 1NZNA 3DSVA 5CHEE 3URZA 4RVBA 5CRVA 2AXVA 4HBDA 3ABKE 4WNGA 3DPYA 4N5CA 2HYZA 3CR3A 3EHNA 4FJYA 4ANXA 2GRQB 1A5EA 5EYLA 2P9PG 2YHCA 4CT0A 3CKBA 1TNZA 1E7VA 1OWPA 4W9RA 1TNUA 2QC9A 3L16A 2I6HA 3G2UA 4NACA 2B0OE 4XKBA 2AXZA 4DI4A 5A7DB 2FBNA 1ELKA 5LFAA 3ASOE 3TWQA 1Y8MA 3NQPA 3E4BA 4MRUA 1JCQA 1SQMA 3MKQA 1DVPA 4JA9A 3RRNB 1OCOE 4FLHA 2P2CP 3ML9A 3TWRA 3U66A 4KVOA 3UM1A 1BI8B 4G24A 3SQVA 2LXLA 3CVQA 1JWGA 3MX3A 3MKRA 5LX8A 3J5PA 5A23A 1BI7B 4K5AB 3ZFWA 4ABNA 4D10C 1Z3YA 1NP7A 1O1TA 2V8SE 2F37A 3ZU7B 4UQXA 3Q7AA 2Y4UA 2MYOA 3TJPA 2GRPB 1HS6A 3Q47B 4JPSA 4XZ4A 3FULA 5FQ4A 2XHEA 5G05J 1Z3XA 3DSTA 5AQ9A 3CGHA 5BW8C 4HOTA 4XKCA 2P9IG 3TL5A 3RRUA 3V2OA 4GYOA 4GPKA 3QB2A 1MX2A 3HIZA 4RQIA 3TWUA
chains in the Genus database with same CATH topology
1NI1A 2H6HA 1TNYA 2ZISA 1TN8A 3Q79A 3KSQA 3SFYA 4GTTA 4GTOA 3DSSA 1JCQA 4GTPA 1DCEA 1KZOA 1TN7A 3HXEA 1D8DA 1FT2A 3HXFA 3KSLA 4GTVA 2F0YA 1QBQA 1KZPA 1LD7A 3Q73A 1FPPA 3DRAA 3Q7FA 3PZ1A 4GTSA 4LNBA 4MBGA 3Q78A 3EUVA 2H6IA 4YDOA 3PZ3A 1LD8A 1N4SA 1O1RA 1S64A 4GTMA 1O5MA 1SA5A 3E32A 3PZ4A 3E30A 4L9PA 1N95A 1O1TA 4EHMA 1TN6A 1X81A 2IEJA 3Q7AA 3DSVA 1TNBA 1SA4A 3EU5A 1O1SA 1D8EA 4LNGA 4GTQA 3DPYA 2BEDA 1S63A 1TNOA 1N4PA 2H6FA 1N4RA 3C72A 2ZIRA 2R2LA 2H6GA 1N4QA 3DSTA 1MZCA 1N9AA 1TNZA 3SFXA 1JCRA 1TNUA 3HXCA 1NL4A 3DSXA 3PZ2A 3Q75A 4YDEA 3E34A 3HXDA 3HXBA 3DSUA 1N94A 3E37A 1JCSA 3E33A 3DSWA 1LTXA 1FT1A 4GTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NI1 A;  2H6H A;  1TNY A;  2ZIS A;  1TN8 A;  3Q79 A;  3KSQ A;  3SFY A;  4GTT A;  4GTO A;  3DSS A;  1JCQ A;  4GTP A;  1DCE A;  1KZO A;  1TN7 A;  3HXE A;  1D8D A;  1FT2 A;  3HXF A;  3KSL A;  4GTV A;  2F0Y A;  1QBQ A;  1KZP A;  1LD7 A;  3Q73 A;  1FPP A;  3DRA A;  3Q7F A;  3PZ1 A;  4GTS A;  4LNB A;  4MBG A;  3Q78 A;  3EUV A;  2H6I A;  4YDO A;  3PZ3 A;  1LD8 A;  1N4S A;  1O1R A;  1S64 A;  4GTM A;  1O5M A;  1SA5 A;  3E32 A;  3PZ4 A;  3E30 A;  4L9P A;  1N95 A;  1O1T A;  4EHM A;  1TN6 A;  1X81 A;  2IEJ A;  3Q7A A;  3DSV A;  1TNB A;  1SA4 A;  3EU5 A;  1O1S A;  1D8E A;  4LNG A;  4GTQ A;  3DPY A;  2BED A;  1S63 A;  1TNO A;  1N4P A;  2H6F A;  1N4R A;  3C72 A;  2ZIR A;  2R2L A;  2H6G A;  1N4Q A;  3DST A;  1MZC A;  1N9A A;  1TNZ A;  3SFX A;  1JCR A;  1TNU A;  3HXC A;  1NL4 A;  3DSX A;  3PZ2 A;  3Q75 A;  4YDE A;  3E34 A;  3HXD A;  3HXB A;  3DSU A;  1N94 A;  3E37 A;  1JCS A;  3E33 A;  3DSW A;  1LTX A;  1FT1 A;  4GTR A; 
#chains in the Genus database with same CATH topology
 4A1S A;  3FDH A;  5G05 C;  2RD0 A;  5EKQ D;  2CFU A;  3FU3 A;  3CST A;  2P9S G;  4WNE A;  4YVO A;  4CEM A;  4AY6 A;  4IUL A;  3QOU A;  5EDS A;  3KSL A;  4Q69 A;  4JEU A;  3ZYQ A;  3EJN A;  2KAT A;  3L82 A;  2I1K A;  2DZO A;  3RO3 A;  4ZHB A;  4MBG A;  5M72 A;  3PRZ A;  2HM8 A;  2P9K G;  5LP0 A;  3ZEF A;  4KT6 B;  4YND A;  3SBS A;  4I6G A;  3TG5 A;  3JUI A;  5HI7 A;  2V5Q C;  2KC7 A;  5E76 A;  1JWF A;  1N11 A;  3C3O A;  3AJI A;  4LUN U;  2EIK E;  2DYR E;  4J6I A;  1HXI A;  5FIN A;  3ONK A;  4HVB A;  2OVB A;  5CMW A;  4PS8 A;  3FUH A;  3LEW A;  2UY1 B;  1UG3 A;  4BSX A;  4FP7 A;  2DYS E;  1ELR A;  2A5E A;  1H2U A;  3HXB A;  1DNP A;  3S7D A;  1QNF A;  1LTX A;  1IQR A;  3UUX A;  2XZD G;  1FT1 A;  4JHJ A;  3ZYM A;  3UQ3 A;  1YMP A;  4GPM A;  5AYW D;  1ELW A;  2ETB A;  4FU3 A;  4JHK A;  5ENO D;  2AW6 A;  3QC1 A;  4O1O A;  4LCT A;  3D9H A;  4HRL A;  3VLE A;  4I6J A;  3K9I A;  4J0U A;  1U3D A;  3ZVV A;  1E7U A;  4G1T A;  4GCN A;  1H6K A;  5AJD A;  4ACL A;  2ETA A;  1OCC E;  2P9N G;  4G2V A;  1Z5S C;  2QFC A;  4QFV A;  4URK A;  4QQI A;  2R59 A;  2WXK A;  4O6F A;  2I9C A;  2GRO B;  2X6F A;  2GRL A;  3RU0 A;  3R7R A;  3CIA A;  3B7U X;  3DXK G;  4LRZ A;  3RJV A;  4K5B A;  4AY5 A;  4DX7 D;  2EIM E;  2QYU A;  4AIF A;  3HVE A;  1MX4 A;  2XZT G;  3EHM A;  3UPV A;  2CHW A;  3T8M A;  3TXN A;  2J8S D;  1OY3 D;  3MJW A;  2WXL A;  4YVQ C;  3RO2 A;  4NQ0 A;  4J8E A;  4ANW A;  2C0M A;  5FT9 A;  3ZRH A;  4GYW A;  2R02 A;  3S7F A;  2F8X K;  4DPR A;  1OWN A;  1XNF A;  3D3M A;  2XPZ A;  2WM9 A;  4JC8 A;  2AWI A;  4B0Z A;  3DEO A;  3ZN3 A;  2L6J A;  3TWV A;  1IXV A;  3AAA C;  3U3W A;  3Q15 A;  3V79 K;  3PEU B;  3CQC B;  4DI3 A;  1FT2 A;  3IHV A;  5FWQ A;  1KZP A;  3AS4 A;  3LKU A;  2GRN B;  4AEZ C;  1L5J A;  3PZ1 A;  3MV2 B;  5G04 J;  4G23 A;  1H6O A;  3GYZ A;  2WXI A;  2H6I A;  4N5Q A;  4WUY A;  3SNX A;  3JYS A;  1O1R A;  4OVV A;  5B1B E;  1H0A A;  5DIZ A;  4I9C A;  3DXM G;  4DX1 A;  3D9I A;  3D9J A;  5KBA A;  1TNB A;  2ZU6 B;  2QYJ A;  4HNA D;  2VTB B;  3UT7 A;  2J08 A;  4CZ2 D;  4LNG A;  2XCB A;  3RIB A;  1S63 A;  5G04 C;  5ENP D;  1IYG A;  2XRY A;  5CBO A;  3UT8 A;  3ABM E;  4N39 A;  4TRQ A;  1XGW A;  4X8Q A;  1TJC A;  3W9G A;  3SBT B;  3HXD A;  1JCS A;  2IOS A;  2Y3A A;  2DWZ A;  5FTP A;  1PAQ A;  4BET A;  3UM3 A;  4GA1 A;  2IFU A;  2XEV A;  3SI5 A;  4L2Y A;  3MEK A;  4TUM A;  3JQ1 A;  3PRE A;  4PS3 A;  5T3R A;  4I1O B;  2ETC A;  1TN7 A;  3BG0 B;  2Y69 E;  3CVU A;  2L0T B;  3FUN A;  3G2S A;  3L08 A;  4PUC A;  3BUA A;  3UKU G;  1H6P A;  2KZT B;  3UIO C;  3CK7 A;  2KXP C;  3DRA A;  4LNB A;  4EBA A;  2IU1 A;  4J8F A;  1V55 E;  2UY1 A;  4YDO A;  1B89 A;  2R17 C;  1SA5 A;  1ZB1 A;  3BQO A;  1X81 A;  4HOR A;  4WND A;  1NFI E;  4L7T A;  1BD8 A;  4CRW A;  1PC2 A;  1TJF A;  2XRZ A;  4UWG A;  3T5V A;  2BF0 X;  3FY4 A;  2F8Y A;  1KPS B;  4B89 A;  1IHG A;  3OAW A;  4E6H A;  5BV1 A;  4F3V A;  2VSY A;  1TR4 A;  4HLL A;  3D9N A;  1HO8 A;  5KWD A;  3SHF A;  3RK6 A;  1WDY A;  3O48 A;  1BPO A;  3APF A;  4N2Q A;  1NA0 A;  4K0R A;  3OXF A;  1AP7 A;  2FI7 A;  2XGO A;  4GTR A;  3GZS A;  4GZC A;  4APF A;  1MHQ A;  2R03 A;  4LEU A;  3NF1 A;  2AVP A;  2R05 A;  2L9B A;  2LSU A;  2BUG A;  1MYO A;  3CKC A;  5FJY A;  4RG9 A;  3ZGQ A;  4B94 A;  2VSX E;  2MRI A;  3FU6 A;  4GZ5 A;  4WWP A;  2GRR B;  3G2V A;  4GTV A;  3DBS A;  4U7E B;  3S7B A;  4I2W A;  3CHM A;  5JJT A;  3VLD A;  5LCW C;  3PZ4 A;  4HI8 A;  5ENT D;  5HKP A;  4AP2 A;  4B93 B;  2J07 A;  4FHJ A;  3BU8 A;  3EU5 A;  1K3Z D;  2CHZ A;  2OOE A;  3EIJ A;  4J8D A;  4OVU A;  3TGO A;  3AU5 A;  4EZJ A;  3HRA A;  3SY2 A;  2ZIR A;  3CK8 A;  3ESL A;  3HDX A;  4JHR A;  5AQA A;  3CVN A;  2VGX A;  2CHX A;  2OEV A;  4NIK A;  3EHQ A;  5DBK A;  1Q2Z A;  4RG6 A;  4UWF A;  2YIN A;  2XS1 A;  3QNK A;  3JQ0 A;  3FU0 A;  3B7T A;  4U8Y D;  3HYM B;  3AS8 A;  4U07 A;  2P9U G;  2M63 A;  4GTT A;  2R5S A;  4ILI A;  4KZC A;  4GAA A;  4HLE A;  3HG0 D;  5G55 A;  4U96 D;  3CVL A;  5T4Y A;  1N0Q A;  4OAV B;  2MHK A;  2ILR A;  5D0O D;  4BEP A;  5D0Q D;  2VTB A;  4K5C A;  4DX5 D;  2FO1 E;  5JJ6 A;  3L22 A;  3Q73 A;  3CHP A;  2DBA A;  3CHS A;  5CEA A;  1FCH A;  1JUQ A;  2X6J A;  3ASH A;  1IKN D;  3PH0 C;  3V2X A;  3NOC D;  4U63 A;  5ANL A;  3IHY A;  1MQS A;  2LUH A;  4KXK B;  2ZGG A;  2J4B A;  2WXG A;  4DLO A;  3L54 A;  3QWP A;  3I4G A;  3ZNG A;  1D8E A;  3B7S A;  5CRU A;  4BES A;  3JXI A;  3SFZ A;  5CCM A;  2QY7 A;  4I1M A;  3UI2 A;  1H19 A;  2J9Q A;  3ZKJ A;  3FHE A;  5CEC B;  4F6R D;  3FTY A;  3BEE A;  4AVX A;  3FFL A;  3UIP C;  4F53 A;  3PUK A;  5JA4 D;  2EIL E;  4I6E A;  5ANR A;  3FTU A;  1UJK A;  5AQB A;  3LY7 A;  4DX2 A;  3PE3 A;  3EHR A;  2CG2 A;  4WWO A;  4ILH B;  1SZ9 A;  4UQZ A;  2V5F A;  2XQ0 A;  4AOF A;  1QBQ A;  3RSE G;  3HHM A;  4JEH A;  4N3C A;  4WWN A;  1YYH A;  3FWV A;  3Q78 A;  1BLX B;  2GW1 A;  4A3T A;  2Q7F A;  3KS2 A;  3U4T A;  2HE0 A;  3LYA A;  2VGE A;  4UWL A;  3SF4 A;  3CQG B;  2OVF A;  2XPY A;  4TXP A;  2J4D A;  4HB5 A;  2IJG X;  2IQC A;  2Y4T A;  4WNF A;  5HQ8 A;  4AJW A;  5BV0 A;  5JHB A;  2XS8 A;  2VSN A;  3FUF A;  1WY6 A;  1ZU2 A;  3CVV A;  2DVW A;  4FLB A;  3CEQ A;  4I9E A;  5C1D A;  3SFX A;  4KBQ A;  4RLY A;  3HXC A;  1NL4 A;  1D9S A;  1KT0 A;  1INZ A;  2X38 A;  4XE0 A;  4HS2 A;  3ISM C;  2E2E A;  2H6H A;  4HI9 A;  2V4H C;  3I4R B;  1OT8 A;  2X3M A;  2ZIS A;  5C2Y A;  1WG0 A;  2EIN E;  1ZBP A;  2WXQ A;  2XCC A;  5FZS A;  1Z6T A;  4TV3 A;  3FTS A;  1DCQ A;  3T9K A;  2IY0 C;  3CVY A;  4H7Y A;  3APD A;  3D9K A;  5EIB E;  3ML8 A;  3G2W A;  4U0U A;  3LCA A;  1S70 B;  3UX4 A;  3MKQ B;  4G8L A;  4LG6 A;  2OND A;  3KEZ A;  2WXM A;  3Q49 B;  3P1U A;  4BER A;  4C0E A;  5FZR A;  4L1B A;  3QK0 A;  5AAR A;  5ENS D;  1N95 A;  3I5P A;  5EX3 A;  4BY6 A;  3FH5 A;  4EZK A;  4XIF A;  3CHO A;  4LNU D;  2WXH A;  2WXR A;  1N4P A;  4UUC A;  2WPV A;  2VYI A;  1OCR E;  2C2L A;  1HH8 A;  3KD7 A;  4FA6 A;  3FUI A;  4BTA A;  3ZYK A;  3CV0 A;  5AIJ A;  4BFR A;  2GRM A;  1W3B A;  4ZFH A;  4I43 A;  1K1B A;  1Y6I A;  2IF4 A;  3PDN A;  4HOQ A;  4DJA A;  4IN3 B;  3QWV A;  3AU4 A;  3S7J A;  3IKO B;  3B7B A;  1E8Z A;  3ZW3 A;  1RZ4 A;  3SGH A;  3MYV A;  5J08 A;  1DC2 A;  4GTP A;  3G2T A;  3LDZ A;  5H7P A;  4OYS A;  4C48 B;  4GML A;  3C3Q A;  3ULY A;  1D8D A;  5AQ7 A;  1YA0 A;  2L6B A;  3L6A A;  4I1A A;  4KMO A;  3GW4 A;  3FTZ A;  1BU9 A;  5FQ7 A;  5EX0 A;  3ULQ A;  3Q7F A;  2FEZ A;  4U95 D;  4UI9 K;  2XEH A;  2J09 A;  3ESK A;  3RKV A;  4R7L A;  3E32 A;  4JD2 G;  2KBX A;  3CVP A;  3EIQ C;  2RFM A;  3UKR G;  1A17 A;  3C3R A;  4AM9 A;  5E75 A;  4P29 A;  3C72 A;  4UI9 J;  4MS6 A;  1EF1 C;  4U04 A;  4V3I A;  3ZXP A;  2BKG A;  1OXJ A;  3ZXS A;  3ASD A;  1MJ0 A;  3AG1 E;  4G11 A;  4EZL A;  4JL0 A;  5B1A E;  4A3V A;  4YDE A;  2WB2 A;  2HO1 A;  4ILG A;  4FC8 A;  4BT9 A;  2WXJ A;  4HQD A;  2BTD A;  3D9L A;  3ZHE B;  4UI9 C;  4GA0 A;  1QQE A;  1GW6 A;  1EYH A;  2I2O A;  4A55 A;  1UN9 A;  1UOH A;  3L13 A;  1WAO 1;  2AJA A;  5KJL A;  3UMV A;  2ZXW E;  5ENR D;  3EU9 A;  1WM5 A;  4GZ3 A;  5CCL A;  3T8K A;  1E8Y A;  4JVS A;  4I2Z A;  5EN5 D;  2CFZ A;  4AV7 A;  3IBE A;  4BWR A;  3NOG D;  4HOU A;  3TAX A;  3FUJ A;  5LCW J;  2WVI A;  4G8K A;  2Y1L E;  3VTY A;  1MX6 A;  3NBN B;  1N4S A;  4FJZ A;  1S64 A;  3FTX A;  4CGW A;  1O5M A;  3JCK C;  4L9P A;  2X6H A;  4Q96 A;  3TWT A;  3NZU A;  3Q4A B;  3B7R L;  4O60 A;  4WAF A;  1H2V C;  5B3S E;  2BED A;  3ENE A;  4LSZ E;  1TNO A;  2YNQ A;  4JB8 P;  3MCX A;  5EID A;  3MGB A;  1VDY A;  1K1A A;  4PDX A;  3HVE B;  4FHK A;  2C0L A;  3FUE A;  3QAR A;  4XEI G;  3OXL A;  4JXT A;  1QYM A;  3I3N A;  4HXI A;  2XEN A;  5ARF A;  4LER A;  5BPP A;  3DSX A;  2Y0B G;  4HRN A;  4A1G A;  3FUM A;  3AS5 A;  1TYQ G;  4F1S A;  3E37 A;  3LXU X;  3E33 A;  3UTM A;  2I1J A;  4UQY A;  1QZ2 A;  4I17 A;  3TWW A;  3ASN E;  2LAI A;  3QAQ A;  5LOZ A;  3LY8 A;  2FO7 A;  4GCO A;  4Q94 A;  4TUU A;  4GZ6 A;  2OEW A;  2ION A;  2OCC E;  4M7C A;  4BSZ B;  2MOW A;  5FZQ A;  4K03 A;  3D9M A;  2FUL A;  4Y6W A;  4BT8 A;  2PL2 A;  2FF4 A;  3KAE A;  4L2L A;  5KJK A;  1LD7 A;  2PQR A;  1FPP A;  4GYY A;  4GTS A;  3LS8 A;  3PVL A;  2V0P A;  1X5B A;  3Q9N C;  1HFA A;  1HE8 A;  5EYP F;  4Y6C A;  5JMN D;  4H7X A;  2E0I A;  5KJM A;  4YDY A;  4CCA A;  1P5Q A;  4PS7 A;  3UT4 A;  5KCM A;  2IOL A;  2LO6 A;  4UWH A;  4GTQ A;  4OAU C;  2H6F A;  2RFA A;  1N4R A;  5FQ6 A;  2H6G A;  2L0I A;  3NB2 A;  1N9A A;  2WMO A;  2WXP A;  4KYO B;  4KZ0 A;  2RKK A;  1OWO A;  4CT4 A;  4F1P A;  2AXU A;  1JCR A;  3FU5 A;  3JXJ A;  3UXG A;  3U9W A;  2YQ8 A;  3MV3 B;  2KCL A;  1N94 A;  3PUJ A;  2WQH A;  3CVX A;  3B13 A;  3TG4 A;  3Q79 A;  2PNN A;  3VLF A;  3C5R A;  4Z68 A;  1N0R A;  4GTO A;  5D66 A;  3TXM A;  1SVX A;  3DSS A;  3UM2 A;  2KZT A;  4U8V D;  3C98 A;  2V4L A;  2KCK A;  4B8C B;  2JLB A;  4N2S A;  4DX6 D;  3QDN A;  3FEX A;  1IHB A;  2DZN A;  1OUV A;  5BT1 A;  4F7A A;  5ENQ D;  3RAU A;  2DCP A;  2HR2 A;  2PZI A;  4IRU A;  3FP3 A;  2WXO A;  4C9B B;  3RRM B;  4ME2 A;  3L9T A;  3UIN C;  2PM7 A;  1UW4 B;  3ASF A;  2WXF A;  1HX8 A;  3FH8 A;  4CDM A;  1U3C A;  5G2N A;  3S2A A;  3ZHE A;  1O1S A;  4HOS A;  5FQ8 A;  1G3N B;  2ZGD A;  4FAD A;  5FIO A;  1UJJ A;  2PQN A;  3T5X A;  2BKK B;  1N54 A;  1N4Q A;  4XX5 A;  4L23 A;  3LVR E;  5ARG A;  2WQ6 A;  1MZC A;  4C0M A;  1FVH A;  3SD5 A;  1UN8 A;  3FUD A;  5KNH D;  4N3B A;  4AXH A;  3Q75 A;  3FEY A;  4DRX E;  3E34 A;  3GZ1 A;  5AN8 A;  5ENN A;  3DSU A;  3QJZ A;  2JAB A;  4CDN A;  4IYP A;  2DIW A;  4J8S A;  3P2B A;  2VSO E;  1HU3 A;  4GMJ A;  3FTV A;  5AEN A;  1TN8 A;  3NAW A;  3SO8 A;  1EDU A;  2RG8 A;  4NRH B;  2XGS A;  4ATZ D;  3SFY A;  4M3O A;  3ONL A;  1IQU A;  2LNI A;  4GU5 A;  1HF8 A;  1KZO A;  3ZUV B;  4HRM B;  1E90 A;  3HXF A;  4J7W A;  3QKY A;  1E96 B;  3GZ2 A;  4A63 B;  2EIJ E;  3Q5M A;  3LJ3 A;  4CYM D;  2WXN A;  3L17 A;  2XPI A;  1FVF A;  3DWL G;  3EUV A;  1YCS B;  3OXG A;  3SZ7 A;  2VJ8 A;  3O4Z A;  1KT1 A;  3PZD A;  4GTM A;  4KVM A;  2LXM A;  3NZS A;  2J49 A;  4EHM A;  4J8Y A;  2VGY A;  3KEA A;  4O1P A;  2IEJ A;  3V31 A;  1LF8 A;  3J5Q B;  1U2V G;  2NC9 A;  2JEK A;  3ZPJ A;  3LJN A;  1SW6 A;  2B6C A;  1S0P A;  3U64 A;  4HFG A;  3IXE A;  3AG3 E;  3CVW A;  4N3A A;  5BXU A;  2KM4 A;  5AJL A;  2UWJ G;  5HRY A;  4MKT A;  3AG4 E;  5KJN A;  2A4Z A;  3WG7 E;  2XEE A;  5IY5 E;  4DK5 A;  1OWL A;  3PNL B;  2P58 C;  4TXQ A;  3V30 A;  3PZ2 A;  4CGV A;  4G26 A;  2VGX B;  2A5U A;  2VQ2 A;  4ACK A;  4DLQ A;  4GZD A;  2OV8 A;  3PS6 A;  5A6C A;  4YDW A;  5BUZ A;  4APO A;  3OTN A;  4JW1 A;  1N52 A;  2LAH A;  5KNG A;  5CMY A;  4ANU A;  2X6I A;  3IEG A;  3LPZ A;  3R9A B;  1JPL A;  4EPZ A;  1TEZ A;  4UWK A;  5J90 A;  3CK9 A;  2WMN A;  1HZ4 A;  2LSV A;  4PH4 B;  5JJ7 A;  3AG2 E;  4ANV A;  1AWC B;  2F0Y A;  4NUR A;  3R7Q A;  4TXR A;  5EIL A;  3PEV B;  4U0Z A;  2XGM A;  1OWM A;  4EEC A;  1K8K G;  3CHR A;  3WXX A;  3B95 A;  2IO3 C;  3MA5 A;  1E8W A;  3CSF A;  1LD8 A;  5ITZ F;  3D9O A;  2NXP A;  1HG5 A;  3PE4 A;  3E30 A;  2P9L G;  5D2M C;  1TN6 A;  3LVQ E;  3F6Q A;  3FTW A;  3ABL E;  4XI9 A;  2YHE A;  1SA4 A;  5AAO A;  5CED B;  4JA7 A;  4CDR A;  2NSZ A;  2IO2 C;  3TWX A;  4FUL A;  3CHQ A;  2R2L A;  2KCV A;  3ZYL A;  2QZA A;  4ATG A;  3ULE G;  1OCZ E;  5BNW A;  4B8A A;  4MLP A;  1V54 E;  4DUI A;  2PM6 A;  4EBA G;  4U8H A;  5T8I A;  4RSY A;  4BX9 A;  3CLJ A;  2GGF A;  3APC A;  5JHA A;  1HG2 A;  5CER B;  1NA3 A;  1PY1 A;  3IV0 A;  4BX8 A;  1H2T C;  4EQF A;  3DPD A;  4G25 A;  3DSW A;  5HS0 A;  1NI1 A;  3JUE A;  1E8X A;  1TNY A;  3KSQ A;  2NYJ A;  1RW2 A;  4XI0 A;  3BG1 B;  4E85 A;  1DCE A;  4U0S A;  4GMR A;  4GB9 A;  3HXE A;  3QWW A;  3R9M A;  1KLX A;  3ZIM A;  3D9P A;  3FH7 A;  3FUK A;  4BTB A;  3DEP A;  5CBN A;  3UM0 A;  3ASG A;  5BXO A;  3N71 A;  2WQ7 A;  3MZL B;  2CG3 A;  3VTX A;  2X6K A;  4JZY A;  3Q9U C;  3LY9 A;  3PZ3 A;  3PNT B;  2EQX A;  1SZA A;  4GA2 A;  1EPU A;  3TWS A;  3EDT B;  3X2Q E;  3W9F A;  1NZN A;  3DSV A;  5CHE E;  3URZ A;  4RVB A;  5CRV A;  2AXV A;  4HBD A;  3ABK E;  4WNG A;  3DPY A;  4N5C A;  2HYZ A;  3CR3 A;  3EHN A;  4FJY A;  4ANX A;  2GRQ B;  1A5E A;  5EYL A;  2P9P G;  2YHC A;  4CT0 A;  3CKB A;  1TNZ A;  1E7V A;  1OWP A;  4W9R A;  1TNU A;  2QC9 A;  3L16 A;  2I6H A;  3G2U A;  4NAC A;  2B0O E;  4XKB A;  2AXZ A;  4DI4 A;  5A7D B;  2FBN A;  1ELK A;  5LFA A;  3ASO E;  3TWQ A;  1Y8M A;  3NQP A;  3E4B A;  4MRU A;  1JCQ A;  1SQM A;  3MKQ A;  1DVP A;  4JA9 A;  3RRN B;  1OCO E;  4FLH A;  2P2C P;  3ML9 A;  3TWR A;  3U66 A;  4KVO A;  3UM1 A;  1BI8 B;  4G24 A;  3SQV A;  2LXL A;  3CVQ A;  1JWG A;  3MX3 A;  3MKR A;  5LX8 A;  3J5P A;  5A23 A;  1BI7 B;  4K5A B;  3ZFW A;  4ABN A;  4D10 C;  1Z3Y A;  1NP7 A;  1O1T A;  2V8S E;  2F37 A;  3ZU7 B;  4UQX A;  3Q7A A;  2Y4U A;  2MYO A;  3TJP A;  2GRP B;  1HS6 A;  3Q47 B;  4JPS A;  4XZ4 A;  3FUL A;  5FQ4 A;  2XHE A;  5G05 J;  1Z3X A;  3DST A;  5AQ9 A;  3CGH A;  5BW8 C;  4HOT A;  4XKC A;  2P9I G;  3TL5 A;  3RRU A;  3V2O A;  4GYO A;  4GPK A;  3QB2 A;  1MX2 A;  3HIZ A;  4RQI A;  3TWU A; 
#chains in the Genus database with same CATH homology
 1NI1 A;  2H6H A;  1TNY A;  2ZIS A;  1TN8 A;  3Q79 A;  3KSQ A;  3SFY A;  4GTT A;  4GTO A;  3DSS A;  1JCQ A;  4GTP A;  1DCE A;  1KZO A;  1TN7 A;  3HXE A;  1D8D A;  1FT2 A;  3HXF A;  3KSL A;  4GTV A;  2F0Y A;  1QBQ A;  1KZP A;  1LD7 A;  3Q73 A;  1FPP A;  3DRA A;  3Q7F A;  3PZ1 A;  4GTS A;  4LNB A;  4MBG A;  3Q78 A;  3EUV A;  2H6I A;  4YDO A;  3PZ3 A;  1LD8 A;  1N4S A;  1O1R A;  1S64 A;  4GTM A;  1O5M A;  1SA5 A;  3E32 A;  3PZ4 A;  3E30 A;  4L9P A;  1N95 A;  1O1T A;  4EHM A;  1TN6 A;  1X81 A;  2IEJ A;  3Q7A A;  3DSV A;  1TNB A;  1SA4 A;  3EU5 A;  1O1S A;  1D8E A;  4LNG A;  4GTQ A;  3DPY A;  2BED A;  1S63 A;  1TNO A;  1N4P A;  2H6F A;  1N4R A;  3C72 A;  2ZIR A;  2R2L A;  2H6G A;  1N4Q A;  3DST A;  1MZC A;  1N9A A;  1TNZ A;  3SFX A;  1JCR A;  1TNU A;  3HXC A;  1NL4 A;  3DSX A;  3PZ2 A;  3Q75 A;  4YDE A;  3E34 A;  3HXD A;  3HXB A;  3DSU A;  1N94 A;  3E37 A;  1JCS A;  3E33 A;  3DSW A;  1LTX A;  1FT1 A;  4GTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...