1O5MA

Structure of fpt bound to the inhibitor sch66336
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
315
structure length
315
Chain Sequence
GFLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase alpha subunit
publication title Tricyclic Farnesyl Protein Transferase Inhibitors: Crystallographic and Calorimetric Studies of Structure-Activity Relationships
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
total genus 125
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2003-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1o5mA00
1FT2A 4GTQA 1LTXA 4L9PA 2BEDA 3E33A 1JCQA 3HXBA 1KZPA 3DSXA 1JCSA 1TNOA 3DSSA 3EUVA 4GTOA 4GTVA 3DSWA 1N94A 2R2LA 3HXFA 3Q7FA 1LD8A 3SFXA 1TNZA 1FPPA 2IEJA 1O1SA 3SFYA 1KZOA 4GTRA 3DSUA 4GTTA 4GTPA 1N4QA 1X81A 1TN7A 3DPYA 4LNGA 1NL4A 1S64A 3PZ1A 1O5MA 1JCRA 3DRAA 3DSVA 3E30A 2F0YA 1TN8A 2H6HA 3HXDA 1NI1A 3Q79A 1DCEA 4LNBA 3C72A 3KSQA 4GTSA 3PZ4A 1O1TA 2ZIRA 1SA4A 3HXCA 4YDOA 1N4RA 3Q75A 1N4SA 1N95A 1SA5A 1TN6A 4GTMA 4YDEA 3PZ3A 1TNYA 3PZ2A 1FT1A 3DSTA 3Q73A 1MZCA 1S63A 2H6FA 1D8DA 1TNBA 1TNUA 2H6GA 3Q78A 1N9AA 4MBGA 4EHMA 1LD7A 3Q7AA 3HXEA 3E34A 1D8EA 1O1RA 1QBQA 2ZISA 3E32A 3EU5A 1N4PA 3KSLA 2H6IA 3E37A
chains in the Genus database with same CATH superfamily
3HYMB 1QQEA 3PEUB 3V30A 1P5QA 5CMYA 5G04C 3LPZA 2LSUA 4GPMA 3ESKA 4A55A 2EIME 5A6CA 1YYHA 2L0TB 3FWVA 1IXVA 2P9KG 1KZOA 3KD7A 4UQXA 3ZU7B 3AU5A 3V79K 2J09A 4GTPA 3EHRA 5CMWA 4UUCA 2WQHA 2P9LG 3MKRA 1BD8A 4CDNA 3T9KA 3CKBA 5EYPF 4F7AA 2J07A 1BPOA 5HS0A 5JJ7A 3CVLA 2ILRA 1U3CA 4EECA 2MHKA 5EILA 2XCCA 2HYZA 1O1TA 5J90A 4UQZA 5G05C 3ULYA 3LS8A 3IBEA 5FQ7A 4DX5D 1X5BA 4GCNA 4BX9A 4PUCA 3Q9UC 3P1UA 4U95D 2FO7A 3MKQA 1NFIE 2M63A 1OWLA 2RD0A 3E4BA 3GZ2A 4HOUA 3MZLB 1AWCB 1Z6TA 1RZ4A 4Y6CA 3ML8A 3PNTB 5G55A 4M7CA 1JCQA 3FTUA 3PZDA 3NZSA 3DSSA 2X3MA 5LCWC 2IY0C 3R7RA 1UJKA 2VTBB 3CHRA 4AJWA 3HHMA 3V31A 3UIOC 4HXIA 1TN7A 4CYMD 3NOCD 3PEVB 3IXEA 3R7QA 4TXPA 2XS8A 5B1BE 3TG5A 4BEPA 1PAQA 3ZIMA 1RW2A 3CHQA 2GGFA 3C72A 1OUVA 2UY1B 2L6JA 3ZFWA 2PQNA 2R05A 3R9AB 4W9RA 3PRZA 4ANUA 4BSZB 1H19A 2XZDG 3EU9A 1TNYA 4FU3A 5BXUA 3TWVA 1JPLA 2YHEA 1H6OA 4G23A 4B8CB 2XRZA 1DNPA 3IHYA 3BQOA 2ETBA 3OTNA 4CZ2D 1JUQA 3L82A 4IN3B 5FWQA 3J5PA 3RSEG 5A23A 4I1AA 3U64A 5CCLA 4UWFA 3ZGQA 3QOUA 5FQ6A 3AS5A 1IYGA 3KS2A 3K9IA 3ASHA 3MV2B 3HXFA 3LDZA 5LX8A 1DCQA 3ULQA 4TXRA 3ZN3A 2PQRA 4Z68A 1K1AA 3U3WA 4TUUA 3QJZA 3CHOA 2B0OE 3TL5A 3CSFA 3L22A 4PS7A 4CT0A 2LNIA 3JCKC 4GMJA 1OWNA 3AS4A 3QWWA 4LNBA 5KNHD 2PM7A 3C98A 3TWUA 2AJAA 3N71A 1JWFA 1WDYA 4I6EA 2YNQA 5B3SE 3JQ0A 1E8YA 3FH7A 5ENSD 3ZRHA 3TWWA 1N95A 4RG6A 2AWIA 2FO1E 4H7XA 2RFAA 3Q4AB 2LXMA 3LY7A 2H6FA 2LAHA 1HXIA 4CT4A 4K5BA 5CERB 4N39A 2OEVA 4BERA 2GW1A 2KZTB 2A5UA 2H6IA 3MV3B 3SZ7A 5ENOD 3VLDA 4FC8A 4AY5A 2DYSE 3D9HA 3APDA 4AXHA 3SBTB 4EZKA 5LOZA 2V5QC 5FT9A 1SQMA 3LXUX 3PUJA 2WXLA 3B7RL 2GRPB 4N3CA 2Y4UA 1LD8A 1FCHA 3QARA 2E2EA 3CSTA 3D9OA 4IRUA 3PNLB 4HRLA 3U4TA 4ABNA 3UM3A 4ATGA 4I43A 2E0IA 4H7YA 5BV1A 2Y1LE 3T5XA 4C0MA 4XZ4A 4L2LA 4U8YD 3TWRA 5JHBA 3VTXA 4MS6A 1K8KG 2KC7A 3CQCB 4GZ6A 4U7EB 4FA6A 4JHJA 2NC9A 3ASNE 1ZBPA 3EIJA 4N3BA 3G2WA 2DIWA 2WVIA 2YQ8A 4RG9A 4YDEA 2ZU6B 3LCAA 2FEZA 4QFVA 4F1SA 5BW8C 2KATA 3ONKA 1TR4A 4O1OA 3JQ1A 3B7TA 3UINC 3Q78A 1EDUA 4MBGA 2GRRB 5CHEE 3UUXA 3HXEA 3TAXA 3E32A 4DX7D 1H6PA 5CECB 3E37A 3RO2A 4FULA 4AVXA 1SW6A 2VTBA 2FF4A 2R17C 4C9BB 4JC8A 2DVWA 3ESLA 4K0RA 1Z5SC 4RSYA 2ETAA 4WUYA 4GZ3A 1N94A 3JXIA 3U66A 3C3QA 3FY4A 3ZW3A 2XHEA 5EIDA 4PS3A 3L9TA 5T3RA 5EYLA 1H2TC 2XPYA 1Q2ZA 4X8QA 3SFYA 3LY8A 1IQUA 1QNFA 2AW6A 2L6BA 3L17A 5JA4D 4NACA 1PY1A 3ZUVB 1JCRA 2I6HA 4DX6D 4LEUA 4FLBA 1U3DA 5AQBA 4ILIA 4CDRA 3MJWA 2VGXB 4DX2A 1H6KA 1YCSB 3FU0A 2MOWA 4BY6A 3PZ4A 3ASGA 3T8MA 3LY9A 1OWOA 4WNFA 4BSXA 3O48A 3UT7A 3FUIA 1QZ2A 1UOHA 5FQ8A 5FZRA 3SNXA 2PM6A 5G2NA 2B6CA 3FUMA 1TYQG 2VGYA 4DPRA 4U07A 1TNUA 3QNKA 1XNFA 1EF1C 2F8XK 2QZAA 4PS8A 2DYRE 2P58C 3ONLA 3EIQC 3FUKA 2XS1A 3Q9NC 1SZ9A 5B1AE 3LVRE 4L9PA 1OY3D 5EKQD 2RG8A 2GRNB 3EUVA 4RLYA 1UG3A 3FDHA 2WXGA 3QAQA 1A17A 1NZNA 3B7UX 3FU5A 4R7LA 2HM8A 3EHMA 3NZUA 2OOEA 2Y0BG 3SF4A 3PREA 1HU3A 1U2VG 4FLHA 3HG0D 4GA1A 5FZQA 2NXPA 3ZPJA 4AV7A 1Z3XA 2H6HA 4JHKA 2XEHA 1K3ZD 3IKOB 4UWHA 2CHZA 3FUJA 1MHQA 3FUDA 2YHCA 3ASFA 5KJMA 3D9LA 3KEAA 4B0ZA 3T5VA 2OCCE 1H0AA 1YMPA 5EIBE 4Q96A 4NURA 4I1OB 2ZIRA 4TUMA 3TWXA 4JA9A 1N11A 2KZTA 2HE0A 2IO3C 3DSTA 3Q73A 3R9MA 3CGHA 3GYZA 4HI8A 1H2UA 2F37A 2R5SA 3TXNA 3FEXA 4APOA 5AQ9A 4BTBA 1OT8A 4YDYA 5HQ8A 2EIJE 4P29A 1QBQA 3VLFA 4BETA 4EZLA 4N5CA 2OV8A 2PNNA 2C0LA 4JHRA 4GTQA 1LTXA 4WWPA 2JABA 3ZYQA 2GROB 5EX0A 2BEDA 1S70B 5BXOA 1BI7B 2J9QA 3D9KA 1FVFA 2QYJA 3L6AA 4JD2G 1O1SA 3AJIA 3D9MA 2J08A 4BWRA 1WY6A 3CK8A 5D0OD 5LP0A 4FADA 4BX8A 2XEEA 4NQ0A 5HKPA 2F8YA 4KYOB 3DRAA 4G25A 4Q94A 5ENRD 5KJLA 2FULA 2KCLA 4YVQC 4JZYA 4RQIA 4L23A 4PH4B 2Y69E 4J7WA 3FTSA 3I4GA 3Q49B 5C1DA 3AS8A 3HRAA 1K1BA 3CHSA 3F6QA 3KSQA 4A63B 3UM0A 1N0RA 1HS6A 2VYIA 2ZGDA 3UXGA 4ME2A 1ELKA 5CRUA 3Q75A 3NAWA 1TN6A 2IF4A 3OAWA 5H7PA 4I6JA 3FH8A 1MX2A 2H6GA 4EZJA 1EYHA 1ZB1A 4CGVA 2VQ2A 3Q7AA 3P2BA 5HI7A 3LVQE 3EU5A 3ZEFA 3ZXSA 3ZHEA 4DJAA 3ASDA 4B89A 1ZU2A 3SGHA 3RJVA 4MRUA 4J6IA 2VGEA 4FJYA 4IYPA 4EQFA 4OVUA 3E33A 3FEYA 2WMOA 3PUKA 4Q69A 5DBKA 1TNOA 3RKVA 4JXTA 4PDXA 3DSWA 4YDWA 4L1BA 4N5QA 3FTYA 4XE0A 3SFXA 2CG2A 3HVEB 3FUEA 5BUZA 1NA3A 2VGXA 5CRVA 2WXIA 3PS6A 2WXMA 4URKA 3UQ3A 2X38A 3TXMA 4JB8P 4KZCA 5BV0A 3ABKE 4U0ZA 1HO8A 3QWPA 3LJNA 4GU5A 4KBQA 2DWZA 3T8KA 5EDSA 4GTSA 1UW4B 2LSVA 4U0UA 4OAVB 4L2YA 2BKKB 4AY6A 1N4RA 5AQAA 4LG6A 5AJDA 2YINA 3PZ3A 3L54A 2X6KA 3NOGD 3SHFA 3ZYKA 3FTZA 5AJLA 2VSXE 4J0UA 1HFAA 4G26A 5BPPA 1KPSB 2FI7A 2KXPC 3I4RB 3EJNA 3G2TA 4GZDA 4UI9K 3DEPA 2VSOE 2OVBA 2MRIA 1FT2A 5C2YA 1SVXA 5BNWA 2LUHA 1BI8B 1VDYA 2X6JA 3S2AA 3UT4A 3QK0A 3MEKA 3Q47B 1WM5A 4K03A 3DEOA 4UWLA 4KZ0A 4K5AB 4TRQA 3MGBA 5D0QD 1V55E 4G8KA 3FULA 4AP2A 1N4QA 3OXFA 4TXQA 4D10C 2LAIA 4HS2A 4KXKB 5KJKA 4JPSA 1S64A 3ISMC 4JW1A 4IULA 3PH0C 1TN8A 3CVUA 4HRNA 3UTMA 3C3RA 3C5RA 3CHPA 3LYAA 2V4HC 1G3NB 2DZNA 2WQ7A 1OCCE 3G2SA 4XKBA 3TWSA 3V2XA 3D9PA 1N52A 5AARA 3CVPA 3SY2A 4G1TA 4AEZC 3Q15A 4MKTA 2Q7FA 2XQ0A 4Y6WA 2LO6A 5A7DB 3RAUA 1D8DA 4JA7A 2HR2A 5ARGA 5ENPD 4CEMA 4DUIA 2VJ8A 2CHXA 5KCMA 2BKGA 3SFZA 1UJJA 4HOTA 3Q5MA 4ZHBA 3J5QB 4WWNA 1N54A 4U96D 5ENTD 3V2OA 3GZSA 4KT6B 3FU3A 4LSZE 2XCBA 3DSXA 4A3VA 1JCSA 2R03A 3B13A 4GZ5A 4ZFHA 2DZOA 2JEKA 4GTVA 3QB2A 2R2LA 3TJPA 2WQ6A 2IEJA 2BUGA 3DSUA 4N2QA 4B8AA 4CCAA 4G2VA 2CG3A 4ANVA 1TEZA 4FJZA 2HO1A 4L7TA 1B89A 4AOFA 1E96B 3DSVA 3CQGB 4HNAD 4DK5A 1IKND 3HXDA 2J49A 3Q79A 1DCEA 4ATZD 1IHGA 2J8SD 2AVPA 2BTDA 4O60A 1HH8A 5KNGA 2UY1A 3SD5A 5D2MC 1E7UA 3JYSA 3TWTA 4NRHB 2Y3AA 1SA5A 3AG4E 1MYOA 4U0SA 3FUFA 4JVSA 3CHMA 5HRYA 1KT0A 3X2QE 4E6HA 4U04A 3W9FA 2OEWA 4LERA 3DPDA 5FQ4A 2ZGGA 2ZXWE 4BESA 4WWOA 4DLOA 4CRWA 4I2ZA 2BF0X 2IOSA 4J8FA 3UKRG 2L9BA 3OXLA 1N4PA 5JJ6A 5FTPA 1MX4A 3W9GA 3D9IA 3APCA 3HVEA 2P2CP 4GZCA 1HF8A 1KZPA 5CBOA 2XPZA 4GA2A 2OVFA 4I9CA 3PVLA 5CEDB 1V54E 3ABME 4B93B 4ILHB 4I6GA 3ULEG 3SI5A 4HVBA 3ZVVA 3RO3A 3VLEA 3CR3A 3BU8A 3UPVA 2I1KA 3PDNA 4F3VA 2IJGX 4B94A 3E30A 3EHQA 4JL0A 2KM4A 3AG3E 2WXKA 4O1PA 3L08A 2WXJA 5DIZA 3QC1A 4U8VD 2A5EA 2XRYA 4GA0A 3FH5A 2EQXA 3FHEA 5ANRA 4DX1A 4KVMA 3UM2A 4XX5A 2WM9A 3UIPC 2X6IA 1S63A 3S7BA 1OCRE 3NF1A 3AU4A 3CV0A 2WMNA 4U63A 3ZYMA 4JEHA 5ITZF 4OYSA 2ZISA 1PC2A 5T4YA 4ACLA 1WG0A 5CCMA 2AXZA 3S7JA 4XIFA 3JUEA 1HX8A 1WAO1 1TJFA 3CK9A 3CVYA 2AXUA 1MX6A 2C2LA 2PZIA 5AYWD 1H2VC 4K5CA 3FTWA 2V8SE 3AAAC 5KBAA 2XGMA 3KAEA 4BTAA 4GCOA 1DVPA 3CVQA 2QFCA 2RFMA 5EN5D 4GTTA 2IQCA 5LFAA 2DBAA 3O4ZA 4C0EA 5FIOA 4KMOA 4J8SA 2XENA 3UI2A 4G8LA 1NI1A 5AAOA 3QDNA 1QYMA 2WXNA 2I1JA 2NSZA 4GMLA 4OAUC 4NIKA 5JHAA 1NP7A 3SO8A 1SA4A 3FTXA 3ZYLA 2QC9A 5KJNA 4I1MA 3EHNA 3AG1E 3CLJA 4V3IA 1AP7A 2WPVA 1TNBA 5FJYA 3APFA 3CKCA 2P9SG 3G2VA 1LD7A 2RKKA 5JJTA 2P9PG 2VSNA 4CGWA 4G24A 3GW4A 5J08A 1BLXB 3D3MA 3DXKG 3TGOA 4N2SA 4A1GA 4GB9A 2XGOA 2WXRA 4LUNU 3AG2E 3B95A 2FBNA 3TWQA 4DI3A 5KWDA 3C3OA 4ILGA 5ENNA 4F1PA 1FPPA 4I9EA 2X6HA 2WB2A 4BT9A 2VSYA 1FVHA 2C0MA 1HE8A 4FHKA 3RU0A 2WXFA 4LRZA 2L0IA 3DPYA 4LNGA 3CEQA 3PZ1A 3GZ1A 4GPKA 4J8YA 3CVWA 3ZNGA 2IU1A 4J8EA 4TV3A 4I17A 2ONDA 3UM1A 5G04J 1INZA 3G2UA 3FUNA 3CIAA 5E76A 3UKUG 4E85A 3DWLG 4XEIG 3RRUA 3UT8A 2IO2C 4GYYA 3MYVA 3OXGA 3BG1B 3ZKJA 5AENA 2V4LA 3UX4A 4WNDA 3B7BA 4XI0A 3VTYA 2XPIA 3BG0B 1ELWA 3E34A 1NA0A 2A4ZA 2GRQB 3IEGA 4DRXE 4GYOA 2MYOA 4ANWA 3FUHA 3TG4A 4YVOA 4DI4A 1TJCA 5AN8A 4JEUA 4WNGA 1OCZE 4APFA 3UMVA 2V0PA 5G05J 2KBXA 3MCXA 4I2WA 3RRMB 1HG2A 4HRMB 3Q7FA 4F6RD 4N3AA 1TNZA 4G11A 2P9NG 3HDXA 4UWGA 4MLPA 1ELRA 2I2OA 1OCOE 1X81A 4HORA 1E7VA 3S7DA 1NL4A 4QQIA 4ANXA 4DLQA 1O5MA 4UQYA 3QWVA 2F0YA 5CBNA 3IHVA 2V5FA 4UI9C 2P9UG 4GAAA 4AM9A 5LCWJ 3BEEA 3LEWA 4HB5A 2J4BA 1UN8A 4XI9A 1MJ0A 4HLEA 1E8WA 3HXCA 1E8ZA 4YDOA 2IFUA 1XGWA 3PZ2A 1FT1A 1D9SA 2EINE 3I5PA 2XEVA 4KVOA 1N9AA 4ACKA 1SZAA 3ASOE 2R02A 4HQDA 2EILE 1YA0A 3FFLA 1O1RA 3L13A 2QY7A 2R59A 5FZSA 3LJ3A 3KSLA 1S0PA 3FTVA 4OVVA 4O6FA 3SQVA 3MKQB 1EPUA 1Y6IA 5E75A 1OWPA 2WXQA 2IOLA 1HZ4A 4GTOA 1OWMA 3BUAA 3ENEA 2KCKA 4HI9A 4YNDA 1KT1A 1LF8A 5M72A 4GTRA 4XKCA 3B7SA 4HFGA 2I9CA 3MA5A 5T8IA 3CVVA 2WXPA 3ABLE 2UWJG 2AXVA 2CFZA 3U9WA 3NQPA 3L16A 2NYJA 2X6FA 3RIBA 2J4DA 2WXHA 2JLBA 1BU9A 4GYWA 4M3OA 4EPZA 3RK6A 4WAFA 1OXJA 3FP3A 4LNUD 3DBSA 3ML9A 1IQRA 4BT8A 2XZTG 1KLXA 1MZCA 5JMND 4C48B 1DC2A 3URZA 2XGSA 3PE4A 4GMRA 1D8EA 3ZHEB 3D9NA 3CK7A 4EBAA 2LXLA 3EDTB 2PL2A 4HOSA 1A5EA 3LKUA 3QKYA 3RRNB 4HLLA 1N0QA 2KCVA 1MQSA 3HXBA 3PE3A 3CVXA 3KEZA 1Y8MA 1GW6A 4CDMA 4UI9J 2Y4TA 2ETCA 5AIJA 2CFUA 3HIZA 5ENQD 4A1SA 1UN9A 2WXOA 1IHBA 5BT1A 3SBSA 3MX3A 3WXXA 5EX3A 4A3TA 3S7FA 3CVNA 4F53A 3I3NA 2GRMA 3DXMG 4J8DA 5IY5E 2CHWA 4EBAG 3NBNB 2QYUA 5D66A 3NB2A 2DCPA 1E90A 4AIFA 1N4SA 4GTMA 5ANLA 1E8XA 3WG7E 5CEAA 3JXJA 4BFRA 1W3BA 1Z3YA 2EIKE 5AQ7A 4RVBA 3IV0A 2P9IG 4U8HA 4UWKA 2IONA 5FINA 3FU6A 1HG5A 4HOQA 3D9JA 4EHMA 2GRLA 4FP7A 4FHJA 3JUIA 1L5JA 4WNEA 3ZXPA 4LCTA 4HBDA 1JWGA 5ARFA
chains in the Genus database with same CATH topology
1FT2A 4GTQA 1LTXA 4L9PA 2BEDA 3E33A 1JCQA 3HXBA 1KZPA 3DSXA 1JCSA 1TNOA 3DSSA 3EUVA 4GTOA 4GTVA 3DSWA 1N94A 2R2LA 3HXFA 3Q7FA 1LD8A 3SFXA 1TNZA 1FPPA 2IEJA 1O1SA 3SFYA 1KZOA 4GTRA 3DSUA 4GTTA 4GTPA 1N4QA 1X81A 1TN7A 3DPYA 4LNGA 1NL4A 1S64A 3PZ1A 1O5MA 1JCRA 3DRAA 3DSVA 3E30A 2F0YA 1TN8A 2H6HA 3HXDA 1NI1A 3Q79A 1DCEA 4LNBA 3C72A 3KSQA 4GTSA 3PZ4A 1O1TA 2ZIRA 1SA4A 3HXCA 4YDOA 1N4RA 3Q75A 1N4SA 1N95A 1SA5A 1TN6A 4GTMA 4YDEA 3PZ3A 1TNYA 3PZ2A 1FT1A 3DSTA 3Q73A 1MZCA 1S63A 2H6FA 1D8DA 1TNBA 1TNUA 2H6GA 3Q78A 1N9AA 4MBGA 4EHMA 1LD7A 3Q7AA 3HXEA 3E34A 1D8EA 1O1RA 1QBQA 2ZISA 3E32A 3EU5A 1N4PA 3KSLA 2H6IA 3E37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FT2 A;  4GTQ A;  1LTX A;  4L9P A;  2BED A;  3E33 A;  1JCQ A;  3HXB A;  1KZP A;  3DSX A;  1JCS A;  1TNO A;  3DSS A;  3EUV A;  4GTO A;  4GTV A;  3DSW A;  1N94 A;  2R2L A;  3HXF A;  3Q7F A;  1LD8 A;  3SFX A;  1TNZ A;  1FPP A;  2IEJ A;  1O1S A;  3SFY A;  1KZO A;  4GTR A;  3DSU A;  4GTT A;  4GTP A;  1N4Q A;  1X81 A;  1TN7 A;  3DPY A;  4LNG A;  1NL4 A;  1S64 A;  3PZ1 A;  1O5M A;  1JCR A;  3DRA A;  3DSV A;  3E30 A;  2F0Y A;  1TN8 A;  2H6H A;  3HXD A;  1NI1 A;  3Q79 A;  1DCE A;  4LNB A;  3C72 A;  3KSQ A;  4GTS A;  3PZ4 A;  1O1T A;  2ZIR A;  1SA4 A;  3HXC A;  4YDO A;  1N4R A;  3Q75 A;  1N4S A;  1N95 A;  1SA5 A;  1TN6 A;  4GTM A;  4YDE A;  3PZ3 A;  1TNY A;  3PZ2 A;  1FT1 A;  3DST A;  3Q73 A;  1MZC A;  1S63 A;  2H6F A;  1D8D A;  1TNB A;  1TNU A;  2H6G A;  3Q78 A;  1N9A A;  4MBG A;  4EHM A;  1LD7 A;  3Q7A A;  3HXE A;  3E34 A;  1D8E A;  1O1R A;  1QBQ A;  2ZIS A;  3E32 A;  3EU5 A;  1N4P A;  3KSL A;  2H6I A;  3E37 A; 
#chains in the Genus database with same CATH topology
 3HYM B;  1QQE A;  3PEU B;  3V30 A;  1P5Q A;  5CMY A;  5G04 C;  3LPZ A;  2LSU A;  4GPM A;  3ESK A;  4A55 A;  2EIM E;  5A6C A;  1YYH A;  2L0T B;  3FWV A;  1IXV A;  2P9K G;  1KZO A;  3KD7 A;  4UQX A;  3ZU7 B;  3AU5 A;  3V79 K;  2J09 A;  4GTP A;  3EHR A;  5CMW A;  4UUC A;  2WQH A;  2P9L G;  3MKR A;  1BD8 A;  4CDN A;  3T9K A;  3CKB A;  5EYP F;  4F7A A;  2J07 A;  1BPO A;  5HS0 A;  5JJ7 A;  3CVL A;  2ILR A;  1U3C A;  4EEC A;  2MHK A;  5EIL A;  2XCC A;  2HYZ A;  1O1T A;  5J90 A;  4UQZ A;  5G05 C;  3ULY A;  3LS8 A;  3IBE A;  5FQ7 A;  4DX5 D;  1X5B A;  4GCN A;  4BX9 A;  4PUC A;  3Q9U C;  3P1U A;  4U95 D;  2FO7 A;  3MKQ A;  1NFI E;  2M63 A;  1OWL A;  2RD0 A;  3E4B A;  3GZ2 A;  4HOU A;  3MZL B;  1AWC B;  1Z6T A;  1RZ4 A;  4Y6C A;  3ML8 A;  3PNT B;  5G55 A;  4M7C A;  1JCQ A;  3FTU A;  3PZD A;  3NZS A;  3DSS A;  2X3M A;  5LCW C;  2IY0 C;  3R7R A;  1UJK A;  2VTB B;  3CHR A;  4AJW A;  3HHM A;  3V31 A;  3UIO C;  4HXI A;  1TN7 A;  4CYM D;  3NOC D;  3PEV B;  3IXE A;  3R7Q A;  4TXP A;  2XS8 A;  5B1B E;  3TG5 A;  4BEP A;  1PAQ A;  3ZIM A;  1RW2 A;  3CHQ A;  2GGF A;  3C72 A;  1OUV A;  2UY1 B;  2L6J A;  3ZFW A;  2PQN A;  2R05 A;  3R9A B;  4W9R A;  3PRZ A;  4ANU A;  4BSZ B;  1H19 A;  2XZD G;  3EU9 A;  1TNY A;  4FU3 A;  5BXU A;  3TWV A;  1JPL A;  2YHE A;  1H6O A;  4G23 A;  4B8C B;  2XRZ A;  1DNP A;  3IHY A;  3BQO A;  2ETB A;  3OTN A;  4CZ2 D;  1JUQ A;  3L82 A;  4IN3 B;  5FWQ A;  3J5P A;  3RSE G;  5A23 A;  4I1A A;  3U64 A;  5CCL A;  4UWF A;  3ZGQ A;  3QOU A;  5FQ6 A;  3AS5 A;  1IYG A;  3KS2 A;  3K9I A;  3ASH A;  3MV2 B;  3HXF A;  3LDZ A;  5LX8 A;  1DCQ A;  3ULQ A;  4TXR A;  3ZN3 A;  2PQR A;  4Z68 A;  1K1A A;  3U3W A;  4TUU A;  3QJZ A;  3CHO A;  2B0O E;  3TL5 A;  3CSF A;  3L22 A;  4PS7 A;  4CT0 A;  2LNI A;  3JCK C;  4GMJ A;  1OWN A;  3AS4 A;  3QWW A;  4LNB A;  5KNH D;  2PM7 A;  3C98 A;  3TWU A;  2AJA A;  3N71 A;  1JWF A;  1WDY A;  4I6E A;  2YNQ A;  5B3S E;  3JQ0 A;  1E8Y A;  3FH7 A;  5ENS D;  3ZRH A;  3TWW A;  1N95 A;  4RG6 A;  2AWI A;  2FO1 E;  4H7X A;  2RFA A;  3Q4A B;  2LXM A;  3LY7 A;  2H6F A;  2LAH A;  1HXI A;  4CT4 A;  4K5B A;  5CER B;  4N39 A;  2OEV A;  4BER A;  2GW1 A;  2KZT B;  2A5U A;  2H6I A;  3MV3 B;  3SZ7 A;  5ENO D;  3VLD A;  4FC8 A;  4AY5 A;  2DYS E;  3D9H A;  3APD A;  4AXH A;  3SBT B;  4EZK A;  5LOZ A;  2V5Q C;  5FT9 A;  1SQM A;  3LXU X;  3PUJ A;  2WXL A;  3B7R L;  2GRP B;  4N3C A;  2Y4U A;  1LD8 A;  1FCH A;  3QAR A;  2E2E A;  3CST A;  3D9O A;  4IRU A;  3PNL B;  4HRL A;  3U4T A;  4ABN A;  3UM3 A;  4ATG A;  4I43 A;  2E0I A;  4H7Y A;  5BV1 A;  2Y1L E;  3T5X A;  4C0M A;  4XZ4 A;  4L2L A;  4U8Y D;  3TWR A;  5JHB A;  3VTX A;  4MS6 A;  1K8K G;  2KC7 A;  3CQC B;  4GZ6 A;  4U7E B;  4FA6 A;  4JHJ A;  2NC9 A;  3ASN E;  1ZBP A;  3EIJ A;  4N3B A;  3G2W A;  2DIW A;  2WVI A;  2YQ8 A;  4RG9 A;  4YDE A;  2ZU6 B;  3LCA A;  2FEZ A;  4QFV A;  4F1S A;  5BW8 C;  2KAT A;  3ONK A;  1TR4 A;  4O1O A;  3JQ1 A;  3B7T A;  3UIN C;  3Q78 A;  1EDU A;  4MBG A;  2GRR B;  5CHE E;  3UUX A;  3HXE A;  3TAX A;  3E32 A;  4DX7 D;  1H6P A;  5CEC B;  3E37 A;  3RO2 A;  4FUL A;  4AVX A;  1SW6 A;  2VTB A;  2FF4 A;  2R17 C;  4C9B B;  4JC8 A;  2DVW A;  3ESL A;  4K0R A;  1Z5S C;  4RSY A;  2ETA A;  4WUY A;  4GZ3 A;  1N94 A;  3JXI A;  3U66 A;  3C3Q A;  3FY4 A;  3ZW3 A;  2XHE A;  5EID A;  4PS3 A;  3L9T A;  5T3R A;  5EYL A;  1H2T C;  2XPY A;  1Q2Z A;  4X8Q A;  3SFY A;  3LY8 A;  1IQU A;  1QNF A;  2AW6 A;  2L6B A;  3L17 A;  5JA4 D;  4NAC A;  1PY1 A;  3ZUV B;  1JCR A;  2I6H A;  4DX6 D;  4LEU A;  4FLB A;  1U3D A;  5AQB A;  4ILI A;  4CDR A;  3MJW A;  2VGX B;  4DX2 A;  1H6K A;  1YCS B;  3FU0 A;  2MOW A;  4BY6 A;  3PZ4 A;  3ASG A;  3T8M A;  3LY9 A;  1OWO A;  4WNF A;  4BSX A;  3O48 A;  3UT7 A;  3FUI A;  1QZ2 A;  1UOH A;  5FQ8 A;  5FZR A;  3SNX A;  2PM6 A;  5G2N A;  2B6C A;  3FUM A;  1TYQ G;  2VGY A;  4DPR A;  4U07 A;  1TNU A;  3QNK A;  1XNF A;  1EF1 C;  2F8X K;  2QZA A;  4PS8 A;  2DYR E;  2P58 C;  3ONL A;  3EIQ C;  3FUK A;  2XS1 A;  3Q9N C;  1SZ9 A;  5B1A E;  3LVR E;  4L9P A;  1OY3 D;  5EKQ D;  2RG8 A;  2GRN B;  3EUV A;  4RLY A;  1UG3 A;  3FDH A;  2WXG A;  3QAQ A;  1A17 A;  1NZN A;  3B7U X;  3FU5 A;  4R7L A;  2HM8 A;  3EHM A;  3NZU A;  2OOE A;  2Y0B G;  3SF4 A;  3PRE A;  1HU3 A;  1U2V G;  4FLH A;  3HG0 D;  4GA1 A;  5FZQ A;  2NXP A;  3ZPJ A;  4AV7 A;  1Z3X A;  2H6H A;  4JHK A;  2XEH A;  1K3Z D;  3IKO B;  4UWH A;  2CHZ A;  3FUJ A;  1MHQ A;  3FUD A;  2YHC A;  3ASF A;  5KJM A;  3D9L A;  3KEA A;  4B0Z A;  3T5V A;  2OCC E;  1H0A A;  1YMP A;  5EIB E;  4Q96 A;  4NUR A;  4I1O B;  2ZIR A;  4TUM A;  3TWX A;  4JA9 A;  1N11 A;  2KZT A;  2HE0 A;  2IO3 C;  3DST A;  3Q73 A;  3R9M A;  3CGH A;  3GYZ A;  4HI8 A;  1H2U A;  2F37 A;  2R5S A;  3TXN A;  3FEX A;  4APO A;  5AQ9 A;  4BTB A;  1OT8 A;  4YDY A;  5HQ8 A;  2EIJ E;  4P29 A;  1QBQ A;  3VLF A;  4BET A;  4EZL A;  4N5C A;  2OV8 A;  2PNN A;  2C0L A;  4JHR A;  4GTQ A;  1LTX A;  4WWP A;  2JAB A;  3ZYQ A;  2GRO B;  5EX0 A;  2BED A;  1S70 B;  5BXO A;  1BI7 B;  2J9Q A;  3D9K A;  1FVF A;  2QYJ A;  3L6A A;  4JD2 G;  1O1S A;  3AJI A;  3D9M A;  2J08 A;  4BWR A;  1WY6 A;  3CK8 A;  5D0O D;  5LP0 A;  4FAD A;  4BX8 A;  2XEE A;  4NQ0 A;  5HKP A;  2F8Y A;  4KYO B;  3DRA A;  4G25 A;  4Q94 A;  5ENR D;  5KJL A;  2FUL A;  2KCL A;  4YVQ C;  4JZY A;  4RQI A;  4L23 A;  4PH4 B;  2Y69 E;  4J7W A;  3FTS A;  3I4G A;  3Q49 B;  5C1D A;  3AS8 A;  3HRA A;  1K1B A;  3CHS A;  3F6Q A;  3KSQ A;  4A63 B;  3UM0 A;  1N0R A;  1HS6 A;  2VYI A;  2ZGD A;  3UXG A;  4ME2 A;  1ELK A;  5CRU A;  3Q75 A;  3NAW A;  1TN6 A;  2IF4 A;  3OAW A;  5H7P A;  4I6J A;  3FH8 A;  1MX2 A;  2H6G A;  4EZJ A;  1EYH A;  1ZB1 A;  4CGV A;  2VQ2 A;  3Q7A A;  3P2B A;  5HI7 A;  3LVQ E;  3EU5 A;  3ZEF A;  3ZXS A;  3ZHE A;  4DJA A;  3ASD A;  4B89 A;  1ZU2 A;  3SGH A;  3RJV A;  4MRU A;  4J6I A;  2VGE A;  4FJY A;  4IYP A;  4EQF A;  4OVU A;  3E33 A;  3FEY A;  2WMO A;  3PUK A;  4Q69 A;  5DBK A;  1TNO A;  3RKV A;  4JXT A;  4PDX A;  3DSW A;  4YDW A;  4L1B A;  4N5Q A;  3FTY A;  4XE0 A;  3SFX A;  2CG2 A;  3HVE B;  3FUE A;  5BUZ A;  1NA3 A;  2VGX A;  5CRV A;  2WXI A;  3PS6 A;  2WXM A;  4URK A;  3UQ3 A;  2X38 A;  3TXM A;  4JB8 P;  4KZC A;  5BV0 A;  3ABK E;  4U0Z A;  1HO8 A;  3QWP A;  3LJN A;  4GU5 A;  4KBQ A;  2DWZ A;  3T8K A;  5EDS A;  4GTS A;  1UW4 B;  2LSV A;  4U0U A;  4OAV B;  4L2Y A;  2BKK B;  4AY6 A;  1N4R A;  5AQA A;  4LG6 A;  5AJD A;  2YIN A;  3PZ3 A;  3L54 A;  2X6K A;  3NOG D;  3SHF A;  3ZYK A;  3FTZ A;  5AJL A;  2VSX E;  4J0U A;  1HFA A;  4G26 A;  5BPP A;  1KPS B;  2FI7 A;  2KXP C;  3I4R B;  3EJN A;  3G2T A;  4GZD A;  4UI9 K;  3DEP A;  2VSO E;  2OVB A;  2MRI A;  1FT2 A;  5C2Y A;  1SVX A;  5BNW A;  2LUH A;  1BI8 B;  1VDY A;  2X6J A;  3S2A A;  3UT4 A;  3QK0 A;  3MEK A;  3Q47 B;  1WM5 A;  4K03 A;  3DEO A;  4UWL A;  4KZ0 A;  4K5A B;  4TRQ A;  3MGB A;  5D0Q D;  1V55 E;  4G8K A;  3FUL A;  4AP2 A;  1N4Q A;  3OXF A;  4TXQ A;  4D10 C;  2LAI A;  4HS2 A;  4KXK B;  5KJK A;  4JPS A;  1S64 A;  3ISM C;  4JW1 A;  4IUL A;  3PH0 C;  1TN8 A;  3CVU A;  4HRN A;  3UTM A;  3C3R A;  3C5R A;  3CHP A;  3LYA A;  2V4H C;  1G3N B;  2DZN A;  2WQ7 A;  1OCC E;  3G2S A;  4XKB A;  3TWS A;  3V2X A;  3D9P A;  1N52 A;  5AAR A;  3CVP A;  3SY2 A;  4G1T A;  4AEZ C;  3Q15 A;  4MKT A;  2Q7F A;  2XQ0 A;  4Y6W A;  2LO6 A;  5A7D B;  3RAU A;  1D8D A;  4JA7 A;  2HR2 A;  5ARG A;  5ENP D;  4CEM A;  4DUI A;  2VJ8 A;  2CHX A;  5KCM A;  2BKG A;  3SFZ A;  1UJJ A;  4HOT A;  3Q5M A;  4ZHB A;  3J5Q B;  4WWN A;  1N54 A;  4U96 D;  5ENT D;  3V2O A;  3GZS A;  4KT6 B;  3FU3 A;  4LSZ E;  2XCB A;  3DSX A;  4A3V A;  1JCS A;  2R03 A;  3B13 A;  4GZ5 A;  4ZFH A;  2DZO A;  2JEK A;  4GTV A;  3QB2 A;  2R2L A;  3TJP A;  2WQ6 A;  2IEJ A;  2BUG A;  3DSU A;  4N2Q A;  4B8A A;  4CCA A;  4G2V A;  2CG3 A;  4ANV A;  1TEZ A;  4FJZ A;  2HO1 A;  4L7T A;  1B89 A;  4AOF A;  1E96 B;  3DSV A;  3CQG B;  4HNA D;  4DK5 A;  1IKN D;  3HXD A;  2J49 A;  3Q79 A;  1DCE A;  4ATZ D;  1IHG A;  2J8S D;  2AVP A;  2BTD A;  4O60 A;  1HH8 A;  5KNG A;  2UY1 A;  3SD5 A;  5D2M C;  1E7U A;  3JYS A;  3TWT A;  4NRH B;  2Y3A A;  1SA5 A;  3AG4 E;  1MYO A;  4U0S A;  3FUF A;  4JVS A;  3CHM A;  5HRY A;  1KT0 A;  3X2Q E;  4E6H A;  4U04 A;  3W9F A;  2OEW A;  4LER A;  3DPD A;  5FQ4 A;  2ZGG A;  2ZXW E;  4BES A;  4WWO A;  4DLO A;  4CRW A;  4I2Z A;  2BF0 X;  2IOS A;  4J8F A;  3UKR G;  2L9B A;  3OXL A;  1N4P A;  5JJ6 A;  5FTP A;  1MX4 A;  3W9G A;  3D9I A;  3APC A;  3HVE A;  2P2C P;  4GZC A;  1HF8 A;  1KZP A;  5CBO A;  2XPZ A;  4GA2 A;  2OVF A;  4I9C A;  3PVL A;  5CED B;  1V54 E;  3ABM E;  4B93 B;  4ILH B;  4I6G A;  3ULE G;  3SI5 A;  4HVB A;  3ZVV A;  3RO3 A;  3VLE A;  3CR3 A;  3BU8 A;  3UPV A;  2I1K A;  3PDN A;  4F3V A;  2IJG X;  4B94 A;  3E30 A;  3EHQ A;  4JL0 A;  2KM4 A;  3AG3 E;  2WXK A;  4O1P A;  3L08 A;  2WXJ A;  5DIZ A;  3QC1 A;  4U8V D;  2A5E A;  2XRY A;  4GA0 A;  3FH5 A;  2EQX A;  3FHE A;  5ANR A;  4DX1 A;  4KVM A;  3UM2 A;  4XX5 A;  2WM9 A;  3UIP C;  2X6I A;  1S63 A;  3S7B A;  1OCR E;  3NF1 A;  3AU4 A;  3CV0 A;  2WMN A;  4U63 A;  3ZYM A;  4JEH A;  5ITZ F;  4OYS A;  2ZIS A;  1PC2 A;  5T4Y A;  4ACL A;  1WG0 A;  5CCM A;  2AXZ A;  3S7J A;  4XIF A;  3JUE A;  1HX8 A;  1WAO 1;  1TJF A;  3CK9 A;  3CVY A;  2AXU A;  1MX6 A;  2C2L A;  2PZI A;  5AYW D;  1H2V C;  4K5C A;  3FTW A;  2V8S E;  3AAA C;  5KBA A;  2XGM A;  3KAE A;  4BTA A;  4GCO A;  1DVP A;  3CVQ A;  2QFC A;  2RFM A;  5EN5 D;  4GTT A;  2IQC A;  5LFA A;  2DBA A;  3O4Z A;  4C0E A;  5FIO A;  4KMO A;  4J8S A;  2XEN A;  3UI2 A;  4G8L A;  1NI1 A;  5AAO A;  3QDN A;  1QYM A;  2WXN A;  2I1J A;  2NSZ A;  4GML A;  4OAU C;  4NIK A;  5JHA A;  1NP7 A;  3SO8 A;  1SA4 A;  3FTX A;  3ZYL A;  2QC9 A;  5KJN A;  4I1M A;  3EHN A;  3AG1 E;  3CLJ A;  4V3I A;  1AP7 A;  2WPV A;  1TNB A;  5FJY A;  3APF A;  3CKC A;  2P9S G;  3G2V A;  1LD7 A;  2RKK A;  5JJT A;  2P9P G;  2VSN A;  4CGW A;  4G24 A;  3GW4 A;  5J08 A;  1BLX B;  3D3M A;  3DXK G;  3TGO A;  4N2S A;  4A1G A;  4GB9 A;  2XGO A;  2WXR A;  4LUN U;  3AG2 E;  3B95 A;  2FBN A;  3TWQ A;  4DI3 A;  5KWD A;  3C3O A;  4ILG A;  5ENN A;  4F1P A;  1FPP A;  4I9E A;  2X6H A;  2WB2 A;  4BT9 A;  2VSY A;  1FVH A;  2C0M A;  1HE8 A;  4FHK A;  3RU0 A;  2WXF A;  4LRZ A;  2L0I A;  3DPY A;  4LNG A;  3CEQ A;  3PZ1 A;  3GZ1 A;  4GPK A;  4J8Y A;  3CVW A;  3ZNG A;  2IU1 A;  4J8E A;  4TV3 A;  4I17 A;  2OND A;  3UM1 A;  5G04 J;  1INZ A;  3G2U A;  3FUN A;  3CIA A;  5E76 A;  3UKU G;  4E85 A;  3DWL G;  4XEI G;  3RRU A;  3UT8 A;  2IO2 C;  4GYY A;  3MYV A;  3OXG A;  3BG1 B;  3ZKJ A;  5AEN A;  2V4L A;  3UX4 A;  4WND A;  3B7B A;  4XI0 A;  3VTY A;  2XPI A;  3BG0 B;  1ELW A;  3E34 A;  1NA0 A;  2A4Z A;  2GRQ B;  3IEG A;  4DRX E;  4GYO A;  2MYO A;  4ANW A;  3FUH A;  3TG4 A;  4YVO A;  4DI4 A;  1TJC A;  5AN8 A;  4JEU A;  4WNG A;  1OCZ E;  4APF A;  3UMV A;  2V0P A;  5G05 J;  2KBX A;  3MCX A;  4I2W A;  3RRM B;  1HG2 A;  4HRM B;  3Q7F A;  4F6R D;  4N3A A;  1TNZ A;  4G11 A;  2P9N G;  3HDX A;  4UWG A;  4MLP A;  1ELR A;  2I2O A;  1OCO E;  1X81 A;  4HOR A;  1E7V A;  3S7D A;  1NL4 A;  4QQI A;  4ANX A;  4DLQ A;  1O5M A;  4UQY A;  3QWV A;  2F0Y A;  5CBN A;  3IHV A;  2V5F A;  4UI9 C;  2P9U G;  4GAA A;  4AM9 A;  5LCW J;  3BEE A;  3LEW A;  4HB5 A;  2J4B A;  1UN8 A;  4XI9 A;  1MJ0 A;  4HLE A;  1E8W A;  3HXC A;  1E8Z A;  4YDO A;  2IFU A;  1XGW A;  3PZ2 A;  1FT1 A;  1D9S A;  2EIN E;  3I5P A;  2XEV A;  4KVO A;  1N9A A;  4ACK A;  1SZA A;  3ASO E;  2R02 A;  4HQD A;  2EIL E;  1YA0 A;  3FFL A;  1O1R A;  3L13 A;  2QY7 A;  2R59 A;  5FZS A;  3LJ3 A;  3KSL A;  1S0P A;  3FTV A;  4OVV A;  4O6F A;  3SQV A;  3MKQ B;  1EPU A;  1Y6I A;  5E75 A;  1OWP A;  2WXQ A;  2IOL A;  1HZ4 A;  4GTO A;  1OWM A;  3BUA A;  3ENE A;  2KCK A;  4HI9 A;  4YND A;  1KT1 A;  1LF8 A;  5M72 A;  4GTR A;  4XKC A;  3B7S A;  4HFG A;  2I9C A;  3MA5 A;  5T8I A;  3CVV A;  2WXP A;  3ABL E;  2UWJ G;  2AXV A;  2CFZ A;  3U9W A;  3NQP A;  3L16 A;  2NYJ A;  2X6F A;  3RIB A;  2J4D A;  2WXH A;  2JLB A;  1BU9 A;  4GYW A;  4M3O A;  4EPZ A;  3RK6 A;  4WAF A;  1OXJ A;  3FP3 A;  4LNU D;  3DBS A;  3ML9 A;  1IQR A;  4BT8 A;  2XZT G;  1KLX A;  1MZC A;  5JMN D;  4C48 B;  1DC2 A;  3URZ A;  2XGS A;  3PE4 A;  4GMR A;  1D8E A;  3ZHE B;  3D9N A;  3CK7 A;  4EBA A;  2LXL A;  3EDT B;  2PL2 A;  4HOS A;  1A5E A;  3LKU A;  3QKY A;  3RRN B;  4HLL A;  1N0Q A;  2KCV A;  1MQS A;  3HXB A;  3PE3 A;  3CVX A;  3KEZ A;  1Y8M A;  1GW6 A;  4CDM A;  4UI9 J;  2Y4T A;  2ETC A;  5AIJ A;  2CFU A;  3HIZ A;  5ENQ D;  4A1S A;  1UN9 A;  2WXO A;  1IHB A;  5BT1 A;  3SBS A;  3MX3 A;  3WXX A;  5EX3 A;  4A3T A;  3S7F A;  3CVN A;  4F53 A;  3I3N A;  2GRM A;  3DXM G;  4J8D A;  5IY5 E;  2CHW A;  4EBA G;  3NBN B;  2QYU A;  5D66 A;  3NB2 A;  2DCP A;  1E90 A;  4AIF A;  1N4S A;  4GTM A;  5ANL A;  1E8X A;  3WG7 E;  5CEA A;  3JXJ A;  4BFR A;  1W3B A;  1Z3Y A;  2EIK E;  5AQ7 A;  4RVB A;  3IV0 A;  2P9I G;  4U8H A;  4UWK A;  2ION A;  5FIN A;  3FU6 A;  1HG5 A;  4HOQ A;  3D9J A;  4EHM A;  2GRL A;  4FP7 A;  4FHJ A;  3JUI A;  1L5J A;  4WNE A;  3ZXP A;  4LCT A;  4HBD A;  1JWG A;  5ARF A; 
#chains in the Genus database with same CATH homology
 1FT2 A;  4GTQ A;  1LTX A;  4L9P A;  2BED A;  3E33 A;  1JCQ A;  3HXB A;  1KZP A;  3DSX A;  1JCS A;  1TNO A;  3DSS A;  3EUV A;  4GTO A;  4GTV A;  3DSW A;  1N94 A;  2R2L A;  3HXF A;  3Q7F A;  1LD8 A;  3SFX A;  1TNZ A;  1FPP A;  2IEJ A;  1O1S A;  3SFY A;  1KZO A;  4GTR A;  3DSU A;  4GTT A;  4GTP A;  1N4Q A;  1X81 A;  1TN7 A;  3DPY A;  4LNG A;  1NL4 A;  1S64 A;  3PZ1 A;  1O5M A;  1JCR A;  3DRA A;  3DSV A;  3E30 A;  2F0Y A;  1TN8 A;  2H6H A;  3HXD A;  1NI1 A;  3Q79 A;  1DCE A;  4LNB A;  3C72 A;  3KSQ A;  4GTS A;  3PZ4 A;  1O1T A;  2ZIR A;  1SA4 A;  3HXC A;  4YDO A;  1N4R A;  3Q75 A;  1N4S A;  1N95 A;  1SA5 A;  1TN6 A;  4GTM A;  4YDE A;  3PZ3 A;  1TNY A;  3PZ2 A;  1FT1 A;  3DST A;  3Q73 A;  1MZC A;  1S63 A;  2H6F A;  1D8D A;  1TNB A;  1TNU A;  2H6G A;  3Q78 A;  1N9A A;  4MBG A;  4EHM A;  1LD7 A;  3Q7A A;  3HXE A;  3E34 A;  1D8E A;  1O1R A;  1QBQ A;  2ZIS A;  3E32 A;  3EU5 A;  1N4P A;  3KSL A;  2H6I A;  3E37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...