1O5MA

Structure of fpt bound to the inhibitor sch66336
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
315
structure length
315
Chain Sequence
GFLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tricyclic Farnesyl Protein Transferase Inhibitors: Crystallographic and Calorimetric Studies of Structure-Activity Relationships
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
molecule keywords Protein farnesyltransferase alpha subunit
total genus 125
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2003-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1o5mA00
3Q7FA 1TN6A 1O1TA 3SFYA 1S64A 1DCEA 2ZISA 1X81A 3E32A 3PZ2A 3E33A 2F0YA 1FT1A 4GTSA 3PZ3A 2H6GA 4GTTA 3EUVA 1N4PA 1LD8A 1O1RA 3DSWA 2R2LA 3HXCA 1LD7A 3HXFA 3Q73A 3EU5A 3Q75A 1N9AA 4LNBA 3DPYA 2BEDA 3Q79A 3E30A 1NL4A 4L9PA 4YDOA 1TN8A 4GTRA 1TNBA 3KSLA 1N94A 4MBGA 3E34A 3Q7AA 4EHMA 3PZ1A 3SFXA 1D8EA 3E37A 3HXEA 1N95A 1S63A 1JCSA 1O1SA 4GTVA 1MZCA 1KZPA 1TNYA 4GTMA 1N4RA 3PZ4A 1SA5A 2H6IA 4GTOA 3DSXA 3DSUA 4LNGA 3DSVA 1FT2A 3DSTA 1JCRA 3C72A 3DSSA 3DRAA 1FPPA 4GTQA 3Q78A 4YDEA 1TNOA 2H6HA 2ZIRA 3KSQA 1N4SA 1KZOA 2H6FA 1TNUA 1TNZA 3HXDA 1N4QA 2IEJA 1TN7A 1O5MA 3HXBA 1D8DA 1NI1A 4GTPA 1SA4A 1JCQA 1LTXA 1QBQA
chains in the Genus database with same CATH superfamily
3ZYQA 2ETBA 1X81A 4N2QA 2MHKA 1IQRA 3E33A 1IXVA 2XPIA 4I9EA 4NURA 4O6FA 4YDWA 4KMOA 3CQGB 4J8EA 3RK6A 4JA9A 4DX5D 4DX2A 5B1AE 2L0IA 1SQMA 3L13A 3NZUA 3LVQE 3DPDA 1RZ4A 4Q69A 4FP7A 1BU9A 2XGMA 3WG7E 4JZYA 2BEDA 2OOEA 3E30A 3TL5A 1IHBA 2HE0A 2FBNA 2P2CP 4G8LA 4GMLA 3D9NA 3MA5A 3SNXA 3I5PA 4G2VA 4CZ2D 4HRLA 4GTVA 5FJYA 5ENNA 1BI8B 2EINE 4QFVA 3FU3A 2VQ2A 4GMJA 3GZ1A 4XKBA 1JCRA 3Q78A 3VLFA 3FTWA 3EHNA 5ENRD 3VLEA 5BV1A 4WNDA 2L9BA 2PQRA 2J9QA 5CMWA 4J8DA 2KCKA 1QZ2A 2DYSE 1TN7A 4G23A 5FQ7A 1IKND 2Y4TA 4Q96A 3QK0A 3HG0D 1DNPA 4JW1A 1OUVA 1OCCE 3R9AB 4UWLA 3FUKA 1FVFA 1H2VC 5AN8A 2XS1A 3L9TA 3N71A 3QARA 2MOWA 3Q73A 5JJTA 4L7TA 1N0QA 3FDHA 1E96B 4L23A 2B0OE 3FH7A 2ETCA 3CVPA 5LCWJ 3AG1E 4PDXA 4I2WA 1TNBA 4EBAA 3E34A 3L22A 3B7BA 2B6CA 5T8IA 2OEVA 1JCSA 3PE4A 1SZAA 4H7XA 1G3NB 2YHCA 4GMRA 3B7TA 2XEEA 4I17A 1TJFA 4IULA 2WQ7A 4I1MA 4JL0A 4BT8A 3S7BA 2VJ8A 4NACA 2LSVA 4BESA 3FH5A 3MV3B 2V5FA 4ZFHA 2BF0X 4CEMA 4LNUD 4LG6A 2X6JA 2H6FA 4JPSA 4BY6A 2I6HA 2WXNA 5EIDA 1JCQA 2WQHA 4U07A 2A4ZA 3UKRG 1IYGA 5CCLA 3PZ2A 2IQCA 4UQXA 3MYVA 2KC7A 3NQPA 4ATGA 3Q15A 3HVEA 4RQIA 1E8WA 5AQ9A 1EYHA 2XHEA 4UWGA 2AXVA 1OWLA 5C1DA 3FTVA 3B95A 3CR3A 2EILE 1PY1A 1BD8A 3KEAA 3HDXA 4X8QA 4L9PA 4GCNA 4YDOA 1Q2ZA 4JVSA 4G8KA 3FU0A 3T5VA 3URZA 4C0EA 2KZTB 2FULA 3LS8A 2AJAA 3FFLA 1OWNA 2XRZA 3ZPJA 4NQ0A 4RG6A 2C0MA 4B89A 3PZ4A 2GROB 4FC8A 5KWDA 3FH8A 4U0UA 3CK9A 3B13A 4HVBA 3S7DA 1FVHA 3S7FA 3KD7A 1K1BA 3TGOA 4O1PA 1FPPA 4YDEA 5BW8C 4XE0A 3ASDA 4WWPA 1N11A 3NOCD 3TWUA 2GRMA 4FU3A 4YVOA 4AM9A 3AS4A 4MLPA 4U8HA 1O5MA 5ANLA 4B8CB 4BFRA 5ENOD 2OEWA 3CV0A 5EYPF 3UKUG 3MKQB 1ZBPA 2FI7A 3CSFA 3ESLA 5G04J 2I1KA 2NSZA 4HORA 2WMNA 4AEZC 4CT0A 2Y4UA 2FO7A 3CHQA 2VGYA 2Y69E 3UM2A 5AJLA 2DYRE 2ZU6B 5JA4D 3HXCA 1MJ0A 1Y6IA 5CBNA 4XX5A 3AG2E 2AW6A 3Q79A 4MS6A 5FINA 3U9WA 1TN8A 3UPVA 1FCHA 5FZRA 4LSZE 4DLOA 2IJGX 5FIOA 1GW6A 1H2TC 2C0LA 1YCSB 3TWWA 4DLQA 2F37A 2X3MA 4GU5A 2VTBB 3ASHA 3RJVA 4K5CA 4JXTA 2PZIA 3NZSA 4Q94A 4APFA 2JEKA 3DSXA 4GCOA 4A1SA 3FUDA 3QC1A 3EHMA 5CEAA 3KSQA 3CQCB 3C5RA 2YNQA 4L2LA 1H19A 2YQ8A 1N4QA 1XNFA 1XGWA 3LVRE 3PNTB 3HXBA 1D8DA 4GTPA 5C2YA 3IXEA 2J08A 5AIJA 4AY5A 4W9RA 3IKOB 4K5BA 3ZVVA 2WXKA 3LY7A 3UMVA 3QWVA 3OTNA 5G2NA 1WG0A 4RVBA 1E90A 2RD0A 1Z5SC 1X5BA 4N3AA 2XZDG 3HXFA 3OXGA 4HBDA 2WXIA 2LO6A 3T8KA 1JUQA 1S70B 3B7RL 2WXQA 5KCMA 3LXUX 4GYYA 3KSLA 1OXJA 2RG8A 3CK7A 1HFAA 4AJWA 4TXRA 4I6GA 1N52A 4FA6A 3ZHEA 2I1JA 4JEHA 1HG2A 3QNKA 4R7LA 4M7CA 4AP2A 5CMYA 3NAWA 4U96D 4TUMA 4ILIA 3CKCA 2AVPA 3AG4E 5DBKA 3UIOC 4DPRA 2WXLA 2XQ0A 3PEUB 3QDNA 2KM4A 1ZU2A 3B7SA 5AARA 3BUAA 3CVQA 1P5QA 1HE8A 3QJZA 4E6HA 4L1BA 4RSYA 3RRMB 3HHMA 1YA0A 4CDMA 4U0SA 4ANVA 2FF4A 1Z6TA 2VSOE 2WM9A 4GTRA 3SBSA 2JLBA 1EF1C 3PEVB 1L5JA 2VSYA 3Q7AA 3CVWA 3SFXA 2HR2A 4HOSA 4ABNA 2J07A 1E7VA 4WAFA 3EIJA 1KZPA 3PE3A 1Y8MA 2WXFA 4ANXA 4I2ZA 3QAQA 2AXUA 3ZGQA 5FQ8A 5EX0A 2GRQB 1JWFA 5H7PA 2L6BA 3MEKA 1EPUA 4BETA 4UWHA 3L82A 4DX1A 5CRUA 1OCOE 1UG3A 4J7WA 3PNLB 2J4BA 3L6AA 2V4LA 2LUHA 2KZTA 3W9FA 3CVNA 2QY7A 1NI1A 3C3OA 5FZQA 1S64A 3E32A 1Z3XA 4BEPA 1MHQA 3TJPA 3QWPA 1LF8A 1KLXA 3ONLA 4AVXA 1QQEA 5JMND 5FTPA 4MKTA 2WPVA 4L2YA 3UX4A 4EZJA 2JABA 3FP3A 5AJDA 3TWRA 4JA7A 2XPYA 5T3RA 1SZ9A 4JHRA 3ZU7B 5BXUA 4I6JA 4JHKA 1HX8A 4TXQA 4PS7A 3AS8A 4EPZA 2P9IG 3LEWA 3I4RB 4G24A 2P9NG 3UT4A 2J49A 5AAOA 4GTMA 3FHEA 1MQSA 2X6KA 3O4ZA 3BG1B 2WB2A 1H0AA 2FO1E 4WNFA 2H6IA 4K5AB 4AV7A 3Q47B 2LSUA 5D2MC 4UI9J 4FHJA 3FUMA 3DSSA 2Y1LE 4XEIG 4DX6D 3PUKA 4LRZA 3UI2A 1MX2A 2X6HA 2Y0BG 5ARGA 1WY6A 1OWPA 3CEQA 3R7QA 4CT4A 4XIFA 4LEUA 3ABLE 3R7RA 1QBQA 3LJNA 2P9KG 4UQYA 4AY6A 2EIME 3RSEG 4UUCA 3W9GA 4DRXE 5LP0A 2WXHA 5J08A 2UY1B 2C2LA 1OCRE 1OWMA 5IY5E 3GZSA 2DWZA 4IN3B 4BTBA 3J5QB 1KT0A 4FULA 4OAUC 4ANUA 4F6RD 2HO1A 5HS0A 3V2OA 3CIAA 2HM8A 3D9HA 1E8ZA 3LJ3A 5AYWD 3EJNA 2NYJA 4Z68A 3RO3A 2VTBA 3PVLA 1EDUA 5EIBE 3V30A 5D0OD 5JHAA 1WDYA 4EZKA 1HO8A 5BNWA 3AU5A 3LKUA 1OWOA 2XGOA 3VTYA 1U3DA 2GRPB 3OAWA 3E37A 4I1AA 2PM6A 1S63A 1U3CA 3AU4A 3ABKE 3Q4AB 2VYIA 1MZCA 2J8SD 5ENTD 2KCLA 4B0ZA 3DEOA 3FUFA 4BERA 2QFCA 3U3WA 3MX3A 4B94A 4LNGA 3QB2A 3UM3A 2CHZA 3V79K 3DEPA 3BG0B 2IFUA 5CECB 1TNOA 3V31A 4U0ZA 2GRNB 4HLLA 3UQ3A 5AQ7A 4XI9A 4JD2G 3G2VA 3C3RA 3LCAA 1HU3A 3ZRHA 2R02A 5ENPD 3Q7FA 4DX7D 2IOLA 2Q7FA 1HZ4A 2WMOA 5BPPA 2F0YA 2XS8A 4URKA 3UT8A 1N54A 1LD8A 3GZ2A 3TWVA 4WNEA 4CCAA 3IEGA 3FTYA 1LD7A 2CG3A 3ZN3A 5LFAA 4KXKB 4A3TA 3SHFA 4FADA 3HYMB 3RO2A 4BWRA 3TG4A 2WQ6A 3JYSA 4BX9A 3TWQA 3PZ1A 2F8YA 2YHEA 3D3MA 5HKPA 4GPMA 5ENSD 3IHVA 1YYHA 2BTDA 3U4TA 1AP7A 3CHPA 3ASFA 4U8YD 3ML9A 2V5QC 4G1TA 3APDA 2EIJE 3LYAA 5KJLA 3SQVA 4GTOA 1A5EA 4NIKA 2M63A 2GW1A 2ONDA 3IBEA 2R5SA 3HIZA 4GB9A 2XEHA 1V54E 3EU9A 2P9LG 1NA3A 1UN9A 3ENEA 4TUUA 2WXPA 1HF8A 4A1GA 2V4HC 3FUIA 1K1AA 3KAEA 3HXDA 4U95D 4CRWA 2KBXA 4GZDA 1SW6A 3CSTA 3CHMA 1TR4A 3G2UA 4DJAA 2ZGGA 3APFA 3UXGA 5T4YA 1FT1A 4OVUA 4DK5A 2OV8A 3I4GA 1O1RA 4KVMA 2XGSA 5B3SE 2IONA 3ZUVB 3D9MA 3JCKC 5KNHD 4D10C 3ZYKA 4E85A 5A6CA 3ULYA 4HOQA 2CHXA 4UI9C 3ZNGA 3RRNB 2ZXWE 2RFMA 2IF4A 2LXLA 4MBGA 3LY9A 3HXEA 2LXMA 4OAVB 2VGEA 2EIKE 2AXZA 4J8FA 3CVXA 2QC9A 3ESKA 1UJJA 2KCVA 4J6IA 1SA5A 4DI4A 4BX8A 3ASGA 2A5UA 3TWTA 4ANWA 2J09A 4KVOA 5G55A 3FUJA 3S2AA 2J4DA 3G2SA 3J5PA 3MZLB 5D66A 4JB8P 3CVYA 2NC9A 3C98A 4UWKA 4TXPA 2CHWA 1ZB1A 3AS5A 5KJMA 4UQZA 3CHOA 3QOUA 5KJKA 3DWLG 5E75A 4DI3A 1H6PA 3RIBA 3O48A 4PS3A 4RLYA 1KPSB 2R59A 2OVBA 4U04A 3ZIMA 4KYOB 5B1BE 4QQIA 1K3ZD 2GGFA 4CGVA 3TWXA 4ILGA 1JPLA 2CFZA 2RKKA 2QYJA 4GZ6A 4N2SA 3EU5A 3SGHA 1SVXA 4LNBA 4WNGA 4HI8A 4HB5A 5ARFA 4J8SA 3P1UA 4NRHB 3FEYA 5M72A 3JQ0A 4PS8A 1V55E 2IY0C 1YMPA 4EHMA 4UWFA 1D8EA 3BQOA 3FWVA 2DBAA 4I43A 1O1SA 1H6OA 3FUEA 2XENA 1TNYA 3TXNA 2UY1A 3UTMA 4N39A 1BI7B 1OY3D 3NF1A 4K03A 3UIPC 3DSVA 3U66A 1FT2A 3UUXA 3C72A 3ISMC 3DRAA 4GTQA 1TYQG 3P2BA 4CDRA 1PAQA 4LERA 1Z3YA 4N5CA 1MYOA 2DIWA 5AQAA 3ASOE 3ZW3A 3D9JA 4AOFA 5BT1A 4HOUA 4FJZA 5CEDB 2X6IA 3RU0A 5ITZF 4GPKA 3DXKG 4LUNU 2GRRB 3BU8A 2WXMA 2WXOA 3FULA 5DIZA 3R9MA 4CDNA 2F8XK 1ELKA 4IYPA 3SY2A 3Q9UC 4ZHBA 4PUCA 3T8MA 1QNFA 3EHRA 5G05C 4DUIA 4G26A 1TJCA 5A23A 4LCTA 3CHSA 4GYOA 2IOSA 4P29A 1MX4A 3G2WA 4HRMB 4CYMD 3LPZA 1UOHA 1B89A 4HNAD 3SD5A 2DZNA 1VDYA 3V2XA 1DCQA 4J8YA 3ULEG 1DC2A 3PH0C 5CERB 4C9BB 4B93B 4GA2A 1H2UA 3TXMA 3SBTB 4XZ4A 4F3VA 3WXXA 1HXIA 5LOZA 4GA0A 2WXGA 3Q49B 3CGHA 3FU6A 5FQ6A 4V3IA 3I3NA 2V0PA 3L16A 4OYSA 3C3QA 3CKBA 2KATA 2VGXA 3DSUA 2R05A 3LDZA 3DSTA 3S7JA 5HRYA 3SO8A 4A3VA 1ELRA 4HS2A 4I9CA 4HOTA 3MKQA 4JC8A 4BSZB 4WWOA 1E8YA 1WAO1 3CHRA 3MGBA 4MRUA 1INZA 4GZCA 3GYZA 1TN6A 1O1TA 2XCCA 3SFYA 4Y6WA 5JJ6A 2RFAA 4I1OB 3ZKJA 4AIFA 2DZOA 4B8AA 1NP7A 2GRLA 3L17A 1A17A 4GTTA 3D9KA 5BUZA 4KZCA 3PUJA 1E7UA 1N0RA 2QYUA 4FLHA 1OT8A 2L0TB 3ML8A 2I9CA 4ACKA 4F1SA 3U64A 3AG3E 2BKGA 1BPOA 5FQ4A 1RW2A 2A5EA 3ZXSA 5KNGA 3D9PA 4YVQC 3B7UX 4M3OA 2BUGA 3JXJA 3KEZA 2XEVA 5JJ7A 1NA0A 1UJKA 3AAAC 5EX3A 3VTXA 3QKYA 1PC2A 3FU5A 2E0IA 3L08A 4KBQA 3JQ1A 4GYWA 3MCXA 4A63B 3EIQC 4HQDA 5J90A 2PQNA 3ULQA 1IHGA 3IV0A 3JUEA 1AWCB 2Y3AA 3UINC 5CHEE 4YNDA 3ZYLA 2H6HA 4O1OA 2XCBA 1KZOA 3D9LA 1HG5A 3RRUA 4HLEA 1HS6A 5BXOA 4GZ5A 1OCZE 3CVVA 3FTXA 5FZSA 3EHQA 2IO3C 1DCEA 2ZISA 3LY8A 2X6FA 4KT6B 1D9SA 3TWSA 4PH4B 1W3BA 5ANRA 1UW4B 2H6GA 3FTUA 3SI5A 3MJWA 5A7DB 4EBAG 5G04C 3NB2A 2X38A 4U63A 2LNIA 3CK8A 5BV0A 3Q75A 2XZTG 3ZXPA 4BTAA 3DPYA 4FJYA 1K8KG 3RKVA 1NL4A 4HI9A 3CVLA 1MX6A 3SZ7A 3UT7A 3ZHEB 4CGWA 3PS6A 2P9PG 4XKCA 3ONKA 4APOA 4GA1A 5KBAA 1NZNA 3MKRA 4HRNA 4I6EA 3JXIA 3TAXA 3OXLA 1N4RA 3FEXA 4BSXA 3DBSA 3K9IA 3AJIA 4IRUA 3F6QA 2BKKB 3PRZA 1HH8A 3TG5A 5EDSA 4FLBA 1NFIE 3VLDA 3MV2B 3GW4A 2ETAA 1TNUA 4A55A 2ZGDA 2VGXB 4F1PA 5HQ8A 3BEEA 4N3BA 3APCA 2I2OA 3SFZA 3CLJA 2WXRA 4OVVA 4ME2A 3FTZA 3X2QE 5CRVA 3D9IA 4ATZD 3PZDA 5LCWC 3FUNA 2VSNA 5KJNA 4EZLA 5EYLA 2AWIA 5CBOA 3EUVA 1N4PA 2XRYA 3ABME 3QWWA 4C48B 3PDNA 3DSWA 1E8XA 1QYMA 5FT9A 2OCCE 5EILA 2R17C 4YDYA 2PNNA 3EDTB 4U7EB 2R03A 3NBNB 2V8SE 4U8VD 3Q9NC 3UM1A 3ASNE 4ACLA 1N95A 3OXFA 4GZ3A 5D0QD 2IO2C 1JWGA 5ENQD 2CG2A 5LX8A 3FUHA 2LAHA 5HI7A 3ZYMA 3JUIA 1KT1A 1TEZA 3NOGD 2WVIA 2ZIRA 4XI0A 3T5XA 5AQBA 2IEJA 3UM0A 4O60A 2XPZA 1WM5A 1SA4A 1LTXA 4HXIA 2UWJG 2MYOA 4J0UA 4JHJA 2P9SG 3PREA 2DVWA 4WWNA 4GTSA 4ILHB 3PZ3A 1IQUA 1S0PA 4AXHA 2ILRA 2R2LA 5E76A 2EQXA 2IU1A 5EN5D 4K0RA 2LAIA 1N9AA 4BT9A 2OVFA 2HYZA 3SF4A 4JEUA 3Q5MA 2CFUA 3L54A 1N94A 3ZEFA 1UN8A 5EKQD 3E4BA 4G11A 1U2VG 4RG9A 2WXJA 4HFGA 4F7AA 2PM7A 2VSXE 4N5QA 4C0MA 4Y6CA 1H6KA 3DXMG 3KS2A 4WUYA 3IHYA 4G25A 4TV3A 4EECA 2YINA 5G05J 2NXPA 2E2EA 2P9UG 1BLXB 2PL2A 5FWQA 4H7YA 2QZAA 4EQFA 3D9OA 4UI9K 2DCPA 1ELWA 4F53A 4FHKA 2MRIA 3FTSA 3G2TA 4KZ0A 5CCMA 1N4SA 3HRAA 5AENA 3CVUA 1DVPA 2KXPC 4TRQA 3T9KA 2P58C 2L6JA 1TNZA 5JHBA 3RAUA 4GAAA 4N3CA 3FY4A 3ZFWA 2FEZA 3HVEB
chains in the Genus database with same CATH topology
3Q7FA 1TN6A 1O1TA 3SFYA 1S64A 1DCEA 2ZISA 1X81A 3E32A 3PZ2A 3E33A 2F0YA 1FT1A 4GTSA 3PZ3A 2H6GA 4GTTA 3EUVA 1N4PA 1LD8A 1O1RA 3DSWA 2R2LA 3HXCA 1LD7A 3HXFA 3Q73A 3EU5A 3Q75A 1N9AA 4LNBA 3DPYA 2BEDA 3Q79A 3E30A 1NL4A 4L9PA 4YDOA 1TN8A 4GTRA 1TNBA 3KSLA 1N94A 4MBGA 3E34A 3Q7AA 4EHMA 3PZ1A 3SFXA 1D8EA 3E37A 3HXEA 1N95A 1S63A 1JCSA 1O1SA 4GTVA 1MZCA 1KZPA 1TNYA 4GTMA 1N4RA 3PZ4A 1SA5A 2H6IA 4GTOA 3DSXA 3DSUA 4LNGA 3DSVA 1FT2A 3DSTA 1JCRA 3C72A 3DSSA 3DRAA 1FPPA 4GTQA 3Q78A 4YDEA 1TNOA 2H6HA 2ZIRA 3KSQA 1N4SA 1KZOA 2H6FA 1TNUA 1TNZA 3HXDA 1N4QA 2IEJA 1TN7A 1O5MA 3HXBA 1D8DA 1NI1A 4GTPA 1SA4A 1JCQA 1LTXA 1QBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q7F A;  1TN6 A;  1O1T A;  3SFY A;  1S64 A;  1DCE A;  2ZIS A;  1X81 A;  3E32 A;  3PZ2 A;  3E33 A;  2F0Y A;  1FT1 A;  4GTS A;  3PZ3 A;  2H6G A;  4GTT A;  3EUV A;  1N4P A;  1LD8 A;  1O1R A;  3DSW A;  2R2L A;  3HXC A;  1LD7 A;  3HXF A;  3Q73 A;  3EU5 A;  3Q75 A;  1N9A A;  4LNB A;  3DPY A;  2BED A;  3Q79 A;  3E30 A;  1NL4 A;  4L9P A;  4YDO A;  1TN8 A;  4GTR A;  1TNB A;  3KSL A;  1N94 A;  4MBG A;  3E34 A;  3Q7A A;  4EHM A;  3PZ1 A;  3SFX A;  1D8E A;  3E37 A;  3HXE A;  1N95 A;  1S63 A;  1JCS A;  1O1S A;  4GTV A;  1MZC A;  1KZP A;  1TNY A;  4GTM A;  1N4R A;  3PZ4 A;  1SA5 A;  2H6I A;  4GTO A;  3DSX A;  3DSU A;  4LNG A;  3DSV A;  1FT2 A;  3DST A;  1JCR A;  3C72 A;  3DSS A;  3DRA A;  1FPP A;  4GTQ A;  3Q78 A;  4YDE A;  1TNO A;  2H6H A;  2ZIR A;  3KSQ A;  1N4S A;  1KZO A;  2H6F A;  1TNU A;  1TNZ A;  3HXD A;  1N4Q A;  2IEJ A;  1TN7 A;  1O5M A;  3HXB A;  1D8D A;  1NI1 A;  4GTP A;  1SA4 A;  1JCQ A;  1LTX A;  1QBQ A; 
#chains in the Genus database with same CATH topology
 3ZYQ A;  2ETB A;  1X81 A;  4N2Q A;  2MHK A;  1IQR A;  3E33 A;  1IXV A;  2XPI A;  4I9E A;  4NUR A;  4O6F A;  4YDW A;  4KMO A;  3CQG B;  4J8E A;  3RK6 A;  4JA9 A;  4DX5 D;  4DX2 A;  5B1A E;  2L0I A;  1SQM A;  3L13 A;  3NZU A;  3LVQ E;  3DPD A;  1RZ4 A;  4Q69 A;  4FP7 A;  1BU9 A;  2XGM A;  3WG7 E;  4JZY A;  2BED A;  2OOE A;  3E30 A;  3TL5 A;  1IHB A;  2HE0 A;  2FBN A;  2P2C P;  4G8L A;  4GML A;  3D9N A;  3MA5 A;  3SNX A;  3I5P A;  4G2V A;  4CZ2 D;  4HRL A;  4GTV A;  5FJY A;  5ENN A;  1BI8 B;  2EIN E;  4QFV A;  3FU3 A;  2VQ2 A;  4GMJ A;  3GZ1 A;  4XKB A;  1JCR A;  3Q78 A;  3VLF A;  3FTW A;  3EHN A;  5ENR D;  3VLE A;  5BV1 A;  4WND A;  2L9B A;  2PQR A;  2J9Q A;  5CMW A;  4J8D A;  2KCK A;  1QZ2 A;  2DYS E;  1TN7 A;  4G23 A;  5FQ7 A;  1IKN D;  2Y4T A;  4Q96 A;  3QK0 A;  3HG0 D;  1DNP A;  4JW1 A;  1OUV A;  1OCC E;  3R9A B;  4UWL A;  3FUK A;  1FVF A;  1H2V C;  5AN8 A;  2XS1 A;  3L9T A;  3N71 A;  3QAR A;  2MOW A;  3Q73 A;  5JJT A;  4L7T A;  1N0Q A;  3FDH A;  1E96 B;  4L23 A;  2B0O E;  3FH7 A;  2ETC A;  3CVP A;  5LCW J;  3AG1 E;  4PDX A;  4I2W A;  1TNB A;  4EBA A;  3E34 A;  3L22 A;  3B7B A;  2B6C A;  5T8I A;  2OEV A;  1JCS A;  3PE4 A;  1SZA A;  4H7X A;  1G3N B;  2YHC A;  4GMR A;  3B7T A;  2XEE A;  4I17 A;  1TJF A;  4IUL A;  2WQ7 A;  4I1M A;  4JL0 A;  4BT8 A;  3S7B A;  2VJ8 A;  4NAC A;  2LSV A;  4BES A;  3FH5 A;  3MV3 B;  2V5F A;  4ZFH A;  2BF0 X;  4CEM A;  4LNU D;  4LG6 A;  2X6J A;  2H6F A;  4JPS A;  4BY6 A;  2I6H A;  2WXN A;  5EID A;  1JCQ A;  2WQH A;  4U07 A;  2A4Z A;  3UKR G;  1IYG A;  5CCL A;  3PZ2 A;  2IQC A;  4UQX A;  3MYV A;  2KC7 A;  3NQP A;  4ATG A;  3Q15 A;  3HVE A;  4RQI A;  1E8W A;  5AQ9 A;  1EYH A;  2XHE A;  4UWG A;  2AXV A;  1OWL A;  5C1D A;  3FTV A;  3B95 A;  3CR3 A;  2EIL E;  1PY1 A;  1BD8 A;  3KEA A;  3HDX A;  4X8Q A;  4L9P A;  4GCN A;  4YDO A;  1Q2Z A;  4JVS A;  4G8K A;  3FU0 A;  3T5V A;  3URZ A;  4C0E A;  2KZT B;  2FUL A;  3LS8 A;  2AJA A;  3FFL A;  1OWN A;  2XRZ A;  3ZPJ A;  4NQ0 A;  4RG6 A;  2C0M A;  4B89 A;  3PZ4 A;  2GRO B;  4FC8 A;  5KWD A;  3FH8 A;  4U0U A;  3CK9 A;  3B13 A;  4HVB A;  3S7D A;  1FVH A;  3S7F A;  3KD7 A;  1K1B A;  3TGO A;  4O1P A;  1FPP A;  4YDE A;  5BW8 C;  4XE0 A;  3ASD A;  4WWP A;  1N11 A;  3NOC D;  3TWU A;  2GRM A;  4FU3 A;  4YVO A;  4AM9 A;  3AS4 A;  4MLP A;  4U8H A;  1O5M A;  5ANL A;  4B8C B;  4BFR A;  5ENO D;  2OEW A;  3CV0 A;  5EYP F;  3UKU G;  3MKQ B;  1ZBP A;  2FI7 A;  3CSF A;  3ESL A;  5G04 J;  2I1K A;  2NSZ A;  4HOR A;  2WMN A;  4AEZ C;  4CT0 A;  2Y4U A;  2FO7 A;  3CHQ A;  2VGY A;  2Y69 E;  3UM2 A;  5AJL A;  2DYR E;  2ZU6 B;  5JA4 D;  3HXC A;  1MJ0 A;  1Y6I A;  5CBN A;  4XX5 A;  3AG2 E;  2AW6 A;  3Q79 A;  4MS6 A;  5FIN A;  3U9W A;  1TN8 A;  3UPV A;  1FCH A;  5FZR A;  4LSZ E;  4DLO A;  2IJG X;  5FIO A;  1GW6 A;  1H2T C;  2C0L A;  1YCS B;  3TWW A;  4DLQ A;  2F37 A;  2X3M A;  4GU5 A;  2VTB B;  3ASH A;  3RJV A;  4K5C A;  4JXT A;  2PZI A;  3NZS A;  4Q94 A;  4APF A;  2JEK A;  3DSX A;  4GCO A;  4A1S A;  3FUD A;  3QC1 A;  3EHM A;  5CEA A;  3KSQ A;  3CQC B;  3C5R A;  2YNQ A;  4L2L A;  1H19 A;  2YQ8 A;  1N4Q A;  1XNF A;  1XGW A;  3LVR E;  3PNT B;  3HXB A;  1D8D A;  4GTP A;  5C2Y A;  3IXE A;  2J08 A;  5AIJ A;  4AY5 A;  4W9R A;  3IKO B;  4K5B A;  3ZVV A;  2WXK A;  3LY7 A;  3UMV A;  3QWV A;  3OTN A;  5G2N A;  1WG0 A;  4RVB A;  1E90 A;  2RD0 A;  1Z5S C;  1X5B A;  4N3A A;  2XZD G;  3HXF A;  3OXG A;  4HBD A;  2WXI A;  2LO6 A;  3T8K A;  1JUQ A;  1S70 B;  3B7R L;  2WXQ A;  5KCM A;  3LXU X;  4GYY A;  3KSL A;  1OXJ A;  2RG8 A;  3CK7 A;  1HFA A;  4AJW A;  4TXR A;  4I6G A;  1N52 A;  4FA6 A;  3ZHE A;  2I1J A;  4JEH A;  1HG2 A;  3QNK A;  4R7L A;  4M7C A;  4AP2 A;  5CMY A;  3NAW A;  4U96 D;  4TUM A;  4ILI A;  3CKC A;  2AVP A;  3AG4 E;  5DBK A;  3UIO C;  4DPR A;  2WXL A;  2XQ0 A;  3PEU B;  3QDN A;  2KM4 A;  1ZU2 A;  3B7S A;  5AAR A;  3BUA A;  3CVQ A;  1P5Q A;  1HE8 A;  3QJZ A;  4E6H A;  4L1B A;  4RSY A;  3RRM B;  3HHM A;  1YA0 A;  4CDM A;  4U0S A;  4ANV A;  2FF4 A;  1Z6T A;  2VSO E;  2WM9 A;  4GTR A;  3SBS A;  2JLB A;  1EF1 C;  3PEV B;  1L5J A;  2VSY A;  3Q7A A;  3CVW A;  3SFX A;  2HR2 A;  4HOS A;  4ABN A;  2J07 A;  1E7V A;  4WAF A;  3EIJ A;  1KZP A;  3PE3 A;  1Y8M A;  2WXF A;  4ANX A;  4I2Z A;  3QAQ A;  2AXU A;  3ZGQ A;  5FQ8 A;  5EX0 A;  2GRQ B;  1JWF A;  5H7P A;  2L6B A;  3MEK A;  1EPU A;  4BET A;  4UWH A;  3L82 A;  4DX1 A;  5CRU A;  1OCO E;  1UG3 A;  4J7W A;  3PNL B;  2J4B A;  3L6A A;  2V4L A;  2LUH A;  2KZT A;  3W9F A;  3CVN A;  2QY7 A;  1NI1 A;  3C3O A;  5FZQ A;  1S64 A;  3E32 A;  1Z3X A;  4BEP A;  1MHQ A;  3TJP A;  3QWP A;  1LF8 A;  1KLX A;  3ONL A;  4AVX A;  1QQE A;  5JMN D;  5FTP A;  4MKT A;  2WPV A;  4L2Y A;  3UX4 A;  4EZJ A;  2JAB A;  3FP3 A;  5AJD A;  3TWR A;  4JA7 A;  2XPY A;  5T3R A;  1SZ9 A;  4JHR A;  3ZU7 B;  5BXU A;  4I6J A;  4JHK A;  1HX8 A;  4TXQ A;  4PS7 A;  3AS8 A;  4EPZ A;  2P9I G;  3LEW A;  3I4R B;  4G24 A;  2P9N G;  3UT4 A;  2J49 A;  5AAO A;  4GTM A;  3FHE A;  1MQS A;  2X6K A;  3O4Z A;  3BG1 B;  2WB2 A;  1H0A A;  2FO1 E;  4WNF A;  2H6I A;  4K5A B;  4AV7 A;  3Q47 B;  2LSU A;  5D2M C;  4UI9 J;  4FHJ A;  3FUM A;  3DSS A;  2Y1L E;  4XEI G;  4DX6 D;  3PUK A;  4LRZ A;  3UI2 A;  1MX2 A;  2X6H A;  2Y0B G;  5ARG A;  1WY6 A;  1OWP A;  3CEQ A;  3R7Q A;  4CT4 A;  4XIF A;  4LEU A;  3ABL E;  3R7R A;  1QBQ A;  3LJN A;  2P9K G;  4UQY A;  4AY6 A;  2EIM E;  3RSE G;  4UUC A;  3W9G A;  4DRX E;  5LP0 A;  2WXH A;  5J08 A;  2UY1 B;  2C2L A;  1OCR E;  1OWM A;  5IY5 E;  3GZS A;  2DWZ A;  4IN3 B;  4BTB A;  3J5Q B;  1KT0 A;  4FUL A;  4OAU C;  4ANU A;  4F6R D;  2HO1 A;  5HS0 A;  3V2O A;  3CIA A;  2HM8 A;  3D9H A;  1E8Z A;  3LJ3 A;  5AYW D;  3EJN A;  2NYJ A;  4Z68 A;  3RO3 A;  2VTB A;  3PVL A;  1EDU A;  5EIB E;  3V30 A;  5D0O D;  5JHA A;  1WDY A;  4EZK A;  1HO8 A;  5BNW A;  3AU5 A;  3LKU A;  1OWO A;  2XGO A;  3VTY A;  1U3D A;  2GRP B;  3OAW A;  3E37 A;  4I1A A;  2PM6 A;  1S63 A;  1U3C A;  3AU4 A;  3ABK E;  3Q4A B;  2VYI A;  1MZC A;  2J8S D;  5ENT D;  2KCL A;  4B0Z A;  3DEO A;  3FUF A;  4BER A;  2QFC A;  3U3W A;  3MX3 A;  4B94 A;  4LNG A;  3QB2 A;  3UM3 A;  2CHZ A;  3V79 K;  3DEP A;  3BG0 B;  2IFU A;  5CEC B;  1TNO A;  3V31 A;  4U0Z A;  2GRN B;  4HLL A;  3UQ3 A;  5AQ7 A;  4XI9 A;  4JD2 G;  3G2V A;  3C3R A;  3LCA A;  1HU3 A;  3ZRH A;  2R02 A;  5ENP D;  3Q7F A;  4DX7 D;  2IOL A;  2Q7F A;  1HZ4 A;  2WMO A;  5BPP A;  2F0Y A;  2XS8 A;  4URK A;  3UT8 A;  1N54 A;  1LD8 A;  3GZ2 A;  3TWV A;  4WNE A;  4CCA A;  3IEG A;  3FTY A;  1LD7 A;  2CG3 A;  3ZN3 A;  5LFA A;  4KXK B;  4A3T A;  3SHF A;  4FAD A;  3HYM B;  3RO2 A;  4BWR A;  3TG4 A;  2WQ6 A;  3JYS A;  4BX9 A;  3TWQ A;  3PZ1 A;  2F8Y A;  2YHE A;  3D3M A;  5HKP A;  4GPM A;  5ENS D;  3IHV A;  1YYH A;  2BTD A;  3U4T A;  1AP7 A;  3CHP A;  3ASF A;  4U8Y D;  3ML9 A;  2V5Q C;  4G1T A;  3APD A;  2EIJ E;  3LYA A;  5KJL A;  3SQV A;  4GTO A;  1A5E A;  4NIK A;  2M63 A;  2GW1 A;  2OND A;  3IBE A;  2R5S A;  3HIZ A;  4GB9 A;  2XEH A;  1V54 E;  3EU9 A;  2P9L G;  1NA3 A;  1UN9 A;  3ENE A;  4TUU A;  2WXP A;  1HF8 A;  4A1G A;  2V4H C;  3FUI A;  1K1A A;  3KAE A;  3HXD A;  4U95 D;  4CRW A;  2KBX A;  4GZD A;  1SW6 A;  3CST A;  3CHM A;  1TR4 A;  3G2U A;  4DJA A;  2ZGG A;  3APF A;  3UXG A;  5T4Y A;  1FT1 A;  4OVU A;  4DK5 A;  2OV8 A;  3I4G A;  1O1R A;  4KVM A;  2XGS A;  5B3S E;  2ION A;  3ZUV B;  3D9M A;  3JCK C;  5KNH D;  4D10 C;  3ZYK A;  4E85 A;  5A6C A;  3ULY A;  4HOQ A;  2CHX A;  4UI9 C;  3ZNG A;  3RRN B;  2ZXW E;  2RFM A;  2IF4 A;  2LXL A;  4MBG A;  3LY9 A;  3HXE A;  2LXM A;  4OAV B;  2VGE A;  2EIK E;  2AXZ A;  4J8F A;  3CVX A;  2QC9 A;  3ESK A;  1UJJ A;  2KCV A;  4J6I A;  1SA5 A;  4DI4 A;  4BX8 A;  3ASG A;  2A5U A;  3TWT A;  4ANW A;  2J09 A;  4KVO A;  5G55 A;  3FUJ A;  3S2A A;  2J4D A;  3G2S A;  3J5P A;  3MZL B;  5D66 A;  4JB8 P;  3CVY A;  2NC9 A;  3C98 A;  4UWK A;  4TXP A;  2CHW A;  1ZB1 A;  3AS5 A;  5KJM A;  4UQZ A;  3CHO A;  3QOU A;  5KJK A;  3DWL G;  5E75 A;  4DI3 A;  1H6P A;  3RIB A;  3O48 A;  4PS3 A;  4RLY A;  1KPS B;  2R59 A;  2OVB A;  4U04 A;  3ZIM A;  4KYO B;  5B1B E;  4QQI A;  1K3Z D;  2GGF A;  4CGV A;  3TWX A;  4ILG A;  1JPL A;  2CFZ A;  2RKK A;  2QYJ A;  4GZ6 A;  4N2S A;  3EU5 A;  3SGH A;  1SVX A;  4LNB A;  4WNG A;  4HI8 A;  4HB5 A;  5ARF A;  4J8S A;  3P1U A;  4NRH B;  3FEY A;  5M72 A;  3JQ0 A;  4PS8 A;  1V55 E;  2IY0 C;  1YMP A;  4EHM A;  4UWF A;  1D8E A;  3BQO A;  3FWV A;  2DBA A;  4I43 A;  1O1S A;  1H6O A;  3FUE A;  2XEN A;  1TNY A;  3TXN A;  2UY1 A;  3UTM A;  4N39 A;  1BI7 B;  1OY3 D;  3NF1 A;  4K03 A;  3UIP C;  3DSV A;  3U66 A;  1FT2 A;  3UUX A;  3C72 A;  3ISM C;  3DRA A;  4GTQ A;  1TYQ G;  3P2B A;  4CDR A;  1PAQ A;  4LER A;  1Z3Y A;  4N5C A;  1MYO A;  2DIW A;  5AQA A;  3ASO E;  3ZW3 A;  3D9J A;  4AOF A;  5BT1 A;  4HOU A;  4FJZ A;  5CED B;  2X6I A;  3RU0 A;  5ITZ F;  4GPK A;  3DXK G;  4LUN U;  2GRR B;  3BU8 A;  2WXM A;  2WXO A;  3FUL A;  5DIZ A;  3R9M A;  4CDN A;  2F8X K;  1ELK A;  4IYP A;  3SY2 A;  3Q9U C;  4ZHB A;  4PUC A;  3T8M A;  1QNF A;  3EHR A;  5G05 C;  4DUI A;  4G26 A;  1TJC A;  5A23 A;  4LCT A;  3CHS A;  4GYO A;  2IOS A;  4P29 A;  1MX4 A;  3G2W A;  4HRM B;  4CYM D;  3LPZ A;  1UOH A;  1B89 A;  4HNA D;  3SD5 A;  2DZN A;  1VDY A;  3V2X A;  1DCQ A;  4J8Y A;  3ULE G;  1DC2 A;  3PH0 C;  5CER B;  4C9B B;  4B93 B;  4GA2 A;  1H2U A;  3TXM A;  3SBT B;  4XZ4 A;  4F3V A;  3WXX A;  1HXI A;  5LOZ A;  4GA0 A;  2WXG A;  3Q49 B;  3CGH A;  3FU6 A;  5FQ6 A;  4V3I A;  3I3N A;  2V0P A;  3L16 A;  4OYS A;  3C3Q A;  3CKB A;  2KAT A;  2VGX A;  3DSU A;  2R05 A;  3LDZ A;  3DST A;  3S7J A;  5HRY A;  3SO8 A;  4A3V A;  1ELR A;  4HS2 A;  4I9C A;  4HOT A;  3MKQ A;  4JC8 A;  4BSZ B;  4WWO A;  1E8Y A;  1WAO 1;  3CHR A;  3MGB A;  4MRU A;  1INZ A;  4GZC A;  3GYZ A;  1TN6 A;  1O1T A;  2XCC A;  3SFY A;  4Y6W A;  5JJ6 A;  2RFA A;  4I1O B;  3ZKJ A;  4AIF A;  2DZO A;  4B8A A;  1NP7 A;  2GRL A;  3L17 A;  1A17 A;  4GTT A;  3D9K A;  5BUZ A;  4KZC A;  3PUJ A;  1E7U A;  1N0R A;  2QYU A;  4FLH A;  1OT8 A;  2L0T B;  3ML8 A;  2I9C A;  4ACK A;  4F1S A;  3U64 A;  3AG3 E;  2BKG A;  1BPO A;  5FQ4 A;  1RW2 A;  2A5E A;  3ZXS A;  5KNG A;  3D9P A;  4YVQ C;  3B7U X;  4M3O A;  2BUG A;  3JXJ A;  3KEZ A;  2XEV A;  5JJ7 A;  1NA0 A;  1UJK A;  3AAA C;  5EX3 A;  3VTX A;  3QKY A;  1PC2 A;  3FU5 A;  2E0I A;  3L08 A;  4KBQ A;  3JQ1 A;  4GYW A;  3MCX A;  4A63 B;  3EIQ C;  4HQD A;  5J90 A;  2PQN A;  3ULQ A;  1IHG A;  3IV0 A;  3JUE A;  1AWC B;  2Y3A A;  3UIN C;  5CHE E;  4YND A;  3ZYL A;  2H6H A;  4O1O A;  2XCB A;  1KZO A;  3D9L A;  1HG5 A;  3RRU A;  4HLE A;  1HS6 A;  5BXO A;  4GZ5 A;  1OCZ E;  3CVV A;  3FTX A;  5FZS A;  3EHQ A;  2IO3 C;  1DCE A;  2ZIS A;  3LY8 A;  2X6F A;  4KT6 B;  1D9S A;  3TWS A;  4PH4 B;  1W3B A;  5ANR A;  1UW4 B;  2H6G A;  3FTU A;  3SI5 A;  3MJW A;  5A7D B;  4EBA G;  5G04 C;  3NB2 A;  2X38 A;  4U63 A;  2LNI A;  3CK8 A;  5BV0 A;  3Q75 A;  2XZT G;  3ZXP A;  4BTA A;  3DPY A;  4FJY A;  1K8K G;  3RKV A;  1NL4 A;  4HI9 A;  3CVL A;  1MX6 A;  3SZ7 A;  3UT7 A;  3ZHE B;  4CGW A;  3PS6 A;  2P9P G;  4XKC A;  3ONK A;  4APO A;  4GA1 A;  5KBA A;  1NZN A;  3MKR A;  4HRN A;  4I6E A;  3JXI A;  3TAX A;  3OXL A;  1N4R A;  3FEX A;  4BSX A;  3DBS A;  3K9I A;  3AJI A;  4IRU A;  3F6Q A;  2BKK B;  3PRZ A;  1HH8 A;  3TG5 A;  5EDS A;  4FLB A;  1NFI E;  3VLD A;  3MV2 B;  3GW4 A;  2ETA A;  1TNU A;  4A55 A;  2ZGD A;  2VGX B;  4F1P A;  5HQ8 A;  3BEE A;  4N3B A;  3APC A;  2I2O A;  3SFZ A;  3CLJ A;  2WXR A;  4OVV A;  4ME2 A;  3FTZ A;  3X2Q E;  5CRV A;  3D9I A;  4ATZ D;  3PZD A;  5LCW C;  3FUN A;  2VSN A;  5KJN A;  4EZL A;  5EYL A;  2AWI A;  5CBO A;  3EUV A;  1N4P A;  2XRY A;  3ABM E;  3QWW A;  4C48 B;  3PDN A;  3DSW A;  1E8X A;  1QYM A;  5FT9 A;  2OCC E;  5EIL A;  2R17 C;  4YDY A;  2PNN A;  3EDT B;  4U7E B;  2R03 A;  3NBN B;  2V8S E;  4U8V D;  3Q9N C;  3UM1 A;  3ASN E;  4ACL A;  1N95 A;  3OXF A;  4GZ3 A;  5D0Q D;  2IO2 C;  1JWG A;  5ENQ D;  2CG2 A;  5LX8 A;  3FUH A;  2LAH A;  5HI7 A;  3ZYM A;  3JUI A;  1KT1 A;  1TEZ A;  3NOG D;  2WVI A;  2ZIR A;  4XI0 A;  3T5X A;  5AQB A;  2IEJ A;  3UM0 A;  4O60 A;  2XPZ A;  1WM5 A;  1SA4 A;  1LTX A;  4HXI A;  2UWJ G;  2MYO A;  4J0U A;  4JHJ A;  2P9S G;  3PRE A;  2DVW A;  4WWN A;  4GTS A;  4ILH B;  3PZ3 A;  1IQU A;  1S0P A;  4AXH A;  2ILR A;  2R2L A;  5E76 A;  2EQX A;  2IU1 A;  5EN5 D;  4K0R A;  2LAI A;  1N9A A;  4BT9 A;  2OVF A;  2HYZ A;  3SF4 A;  4JEU A;  3Q5M A;  2CFU A;  3L54 A;  1N94 A;  3ZEF A;  1UN8 A;  5EKQ D;  3E4B A;  4G11 A;  1U2V G;  4RG9 A;  2WXJ A;  4HFG A;  4F7A A;  2PM7 A;  2VSX E;  4N5Q A;  4C0M A;  4Y6C A;  1H6K A;  3DXM G;  3KS2 A;  4WUY A;  3IHY A;  4G25 A;  4TV3 A;  4EEC A;  2YIN A;  5G05 J;  2NXP A;  2E2E A;  2P9U G;  1BLX B;  2PL2 A;  5FWQ A;  4H7Y A;  2QZA A;  4EQF A;  3D9O A;  4UI9 K;  2DCP A;  1ELW A;  4F53 A;  4FHK A;  2MRI A;  3FTS A;  3G2T A;  4KZ0 A;  5CCM A;  1N4S A;  3HRA A;  5AEN A;  3CVU A;  1DVP A;  2KXP C;  4TRQ A;  3T9K A;  2P58 C;  2L6J A;  1TNZ A;  5JHB A;  3RAU A;  4GAA A;  4N3C A;  3FY4 A;  3ZFW A;  2FEZ A;  3HVE B; 
#chains in the Genus database with same CATH homology
 3Q7F A;  1TN6 A;  1O1T A;  3SFY A;  1S64 A;  1DCE A;  2ZIS A;  1X81 A;  3E32 A;  3PZ2 A;  3E33 A;  2F0Y A;  1FT1 A;  4GTS A;  3PZ3 A;  2H6G A;  4GTT A;  3EUV A;  1N4P A;  1LD8 A;  1O1R A;  3DSW A;  2R2L A;  3HXC A;  1LD7 A;  3HXF A;  3Q73 A;  3EU5 A;  3Q75 A;  1N9A A;  4LNB A;  3DPY A;  2BED A;  3Q79 A;  3E30 A;  1NL4 A;  4L9P A;  4YDO A;  1TN8 A;  4GTR A;  1TNB A;  3KSL A;  1N94 A;  4MBG A;  3E34 A;  3Q7A A;  4EHM A;  3PZ1 A;  3SFX A;  1D8E A;  3E37 A;  3HXE A;  1N95 A;  1S63 A;  1JCS A;  1O1S A;  4GTV A;  1MZC A;  1KZP A;  1TNY A;  4GTM A;  1N4R A;  3PZ4 A;  1SA5 A;  2H6I A;  4GTO A;  3DSX A;  3DSU A;  4LNG A;  3DSV A;  1FT2 A;  3DST A;  1JCR A;  3C72 A;  3DSS A;  3DRA A;  1FPP A;  4GTQ A;  3Q78 A;  4YDE A;  1TNO A;  2H6H A;  2ZIR A;  3KSQ A;  1N4S A;  1KZO A;  2H6F A;  1TNU A;  1TNZ A;  3HXD A;  1N4Q A;  2IEJ A;  1TN7 A;  1O5M A;  3HXB A;  1D8D A;  1NI1 A;  4GTP A;  1SA4 A;  1JCQ A;  1LTX A;  1QBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...