4U95D

Coupling of remote alternating-access transport mechanisms for protons and substrates in the multidrug efflux pump acrb
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
156
structure length
156
Chain Sequence
b'GSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug efflux pump subunit AcrB
publication title Coupling of remote alternating-access transport mechanisms for protons and substrates in the multidrug efflux pump AcrB
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 53
structure length 156
sequence length 156
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4u95D00
2ZGDA 2XEHA 3V31A 2XEEA 3ZUVB 3UI2A 2DVWA 4CYMD 2Y0BG 4Z68A 5AQBA 2DZNA 2VGEA 5KNGA 4ZFHA 1S70B 1BLXB 4DUIA 3KEAA 3D9HA 3DEPA 5ENOD 3NOGD 1YCSB 2L6BA 2Y1LE 3Q9UC 4F1PA 4BESA 4HRLA 2DZOA 4DX2A 1BU9A 4K5AB 1MX2A 3B95A 4U95D 3SO8A 1UOHA 2P2CP 3TWWA 4HRNA 3TWXA 5JA4D 3C5RA 1MYOA 4YDYA 3UXGA 4O1PA 4QFVA 4C48B 4LG6A 3HRAA 4BERA 2JABA 4HI9A 1SW6A 4U8YD 1BI8B 4NIKA 2MYOA 4J8YA 5FIOA 4CZ2D 3AAAC 3W9GA 5CBOA 4K5CA 4LSZE 3IXEA 2F37A 1OY3D 5ENPD 1A5EA 1BI7B 2AJAA 5KWDA 4UUCA 3TWUA 1MX4A 3B7BA 3Q9NC 1OT8A 2XZTG 4ZHBA 3LJNA 2A5EA 3JXJA 5FINA 4GPMA 3TWQA 5EILA 3JUEA 5ENSD 3V30A 5BXUA 4DX1A 5ENTD 3AJIA 3T8KA 4JB8P 3EU9A 3TWTA 5EIDA 3J5QB 2KXPC 3ZU7B 4A63B 3ZNGA 4G8KA 4O1OA 5CERB 5AQ7A 1D9SA 2NYJA 3UTMA 5AAOA 1DCQA 5HRYA 3NBNB 4G8LA 2KBXA 1WG0A 5BXOA 3V79K 2F8YA 1BD8A 5AQAA 4HI8A 3V2XA 1K3ZD 4HRMB 2J8SD 2F8XK 3J5PA 1N0RA 3DEOA 1AWCB 2B0OE 3T9KA 1WDYA 2HE0A 5AQ9A 4LNUD 3TWVA 1K1BA 1N0QA 2ETBA 4DX6D 2XENA 5CECB 4HB5A 2ETAA 3NOCD 5CEDB 1G3NB 1IHBA 1YYHA 3F6QA 5EN5D 5CBNA 3EHRA 4DRXE 4OAVB 4DX5D 4DX7D 1YMPA 2V5QC 1DC2A 2ETCA 4QQIA 4ATZD 4U96D 3V2OA 2BKGA 3W9FA 3TWRA 4O60A 5AARA 5EYLA 5CEAA 1NFIE 1AP7A 1SVXA 4YDWA 5EYPF 4B93B 4BETA 5ITZF 4TUMA 2V4HC 3ZKJA 1QYMA 2QC9A 4HQDA 1IKND 4HNAD 4GMRA 5JMND 3TWSA 2RFAA 1N11A 3JXIA 4K5BA 2ZGGA 4BEPA 4J7WA 2PNNA 3HG0D 5D66A 5AN8A 4HBDA 5HS0A 5KNHD 5EIBE 1K1AA 4BSZB 1MJ0A 4OAUC 5KBAA 4N5QA 4RLYA 4HLLA 4U8VD 5HKPA 1IXVA 1TR4A 2BKKB 5ENQD 2FO1E 2DWZA 1MX6A 2RFMA 2XZDG 3EHQA 5ENRD 2QYJA 4F6RD
chains in the Genus database with same CATH superfamily
3LJ3A 4XEIG 5FQ7A 3CR3A 5EKQD 2BTDA 3B7SA 4ZFHA 3D9HA 5ENOD 2Y1LE 1NA3A 2I9CA 3CHSA 1MYOA 4W9RA 3CVXA 5E76A 2ZXWE 5M72A 1HFAA 2ILRA 4JEUA 3BU8A 3K9IA 3B7BA 4FLBA 4TRQA 5FINA 1UJKA 4G23A 4JHRA 3EU9A 3IHYA 1HO8A 1LF8A 3PE3A 4Q94A 5CERB 1H2TC 3S7BA 4CEMA 2NYJA 5CCMA 3ASNE 5AQAA 1K3ZD 3AS8A 4WAFA 5FT9A 1N0RA 3P1UA 4YDEA 4RVBA 1HZ4A 3G2UA 4EECA 4G2VA 2ETAA 3F6QA 2XQ0A 4OAVB 3SHFA 4NRHB 2J4BA 1H2UA 3ESLA 3E4BA 3KD7A 4J8EA 4I6JA 5G55A 4TUMA 1LD7A 2J4DA 1SA4A 4GZ3A 4M3OA 4N3BA 2CHXA 2CG3A 5HS0A 4APFA 2J08A 1KT0A 4RLYA 2FO1E 4FJYA 4WNFA 4F6RD 3V31A 2J49A 4AV7A 1HS6A 3UI2A 3ZVVA 3D9IA 1N4QA 1S70B 1BLXB 3TXMA 2FI7A 3JYSA 2IF4A 3ULEG 4HXIA 3MX3A 1Y8MA 2KCKA 4U63A 2BEDA 4DX2A 3PZ3A 4PS8A 4K5AB 4UQXA 2I1KA 3SO8A 4C48B 3LXUX 4FULA 2IONA 4CGWA 4FADA 3QAQA 4R7LA 4LEUA 3S7JA 1BI7B 3FTZA 2NSZA 4U8HA 3LJNA 5EILA 4ILGA 5IY5E 2LO6A 4RSYA 2VQ2A 2V4LA 5EIDA 4BX8A 1DCQA 4GTTA 2UY1A 3Q75A 4DLOA 2AXUA 5EX0A 4J8SA 2J8SD 3SBTB 4JL0A 3T9KA 5J90A 4UQYA 4L9PA 2A4ZA 4WNDA 3LY9A 1G3NB 3FEYA 2MHKA 2V5QC 2ETCA 2BKGA 4DLQA 4FHKA 1NFIE 1H19A 3L9TA 3OXGA 4HNAD 4GZDA 3P2BA 2RFAA 1H6PA 2AVPA 4PS3A 3LY8A 2FEZA 4PH4B 1TR4A 1ZB1A 3ZUVB 3LPZA 3GYZA 4DUIA 1SA5A 4BT9A 1NI1A 1Z3XA 3R9MA 4TUUA 4AP2A 4C0EA 2QFCA 1PC2A 4DI3A 5T4YA 1N54A 3L54A 1NZNA 2JABA 4N2QA 2CFZA 4J8YA 3KEZA 5KJNA 3BQOA 3C72A 3ZHEA 4NQ0A 3CVNA 2XGOA 4ACKA 3CQCB 4HFGA 1MX4A 3JQ1A 4U07A 4XI0A 3FTSA 1TNUA 2PM7A 4G25A 2H6IA 4KZCA 2J09A 3S7DA 3OAWA 3J5QB 4JA7A 1OCCE 5AAOA 3LS8A 2XCCA 4B8AA 3EHMA 3FTYA 2WB2A 5FZSA 3KS2A 4U0SA 1YMPA 2X6KA 1EDUA 3ZIMA 3V2OA 1UJJA 4AIFA 4YVOA 4YDWA 4BETA 2GRLA 5ITZF 1ELKA 4DK5A 3HXBA 3KAEA 2X6FA 4DJAA 2BKKB 1KZOA 2YNQA 1SZ9A 3Q78A 3EHQA 3ZFWA 2OCCE 1ELRA 2Y0BG 3DSXA 4GTMA 3LCAA 2VSYA 2WXGA 3NOGD 4KVOA 3B95A 3UM0A 4A55A 1UOHA 3TWWA 3ASDA 3CQGB 1JPLA 3UXGA 4GYYA 2R2LA 3D9JA 1E8XA 3G2WA 2AXZA 5FIOA 2GGFA 1WY6A 2IEJA 5FQ6A 3I5PA 4KMOA 4HLEA 1W3BA 1X5BA 4Q96A 3CHQA 4GMJA 5HI7A 1TJCA 2XPYA 2PQRA 4UWLA 4J8DA 3C3QA 3TWTA 4G8KA 2H6FA 2KBXA 3SBSA 2F8YA 4CRWA 3MJWA 2RD0A 3HXFA 4TXPA 1TN7A 3UM2A 3BEEA 2YHCA 3B13A 4LNUD 1B89A 4GYOA 3MYVA 4F7AA 1YYHA 3FWVA 5EN5D 3RJVA 3MKRA 1BPOA 3RK6A 3ULQA 2X6JA 4RG6A 4B8CB 5LP0A 3GZ2A 1UG3A 4HQDA 3PNTB 3ASOE 3G2SA 4Y6WA 4J7WA 1N4SA 3MZLB 2QZAA 1MJ0A 4JHKA 5KBAA 4YNDA 2HO1A 4GCOA 4AEZC 2GRMA 3I4RB 1UN9A 4HVBA 3DSUA 5KNGA 4IYPA 2XEHA 3C98A 1TNOA 2DVWA 4Z68A 4AY6A 3PZDA 3LYAA 2GRNB 4HORA 2WM9A 3FUDA 3NF1A 2P9SG 4H7YA 5LOZA 2FULA 2WXMA 3EIJA 3CHMA 1MX2A 2I2OA 3DSTA 4B89A 1Z3YA 3C5RA 1SQMA 1KPSB 2VSNA 1O1RA 1V54E 3DRAA 4I43A 3VLDA 4GZ6A 4MRUA 3FUMA 3IV0A 1OT8A 1Z6TA 2R03A 3JXJA 3RO3A 1XNFA 2XRZA 4NACA 1ZBPA 1EF1C 2R5SA 4XI9A 2C0MA 1BD8A 1OWMA 3G2TA 1OWNA 4O6FA 2Y4TA 2IOSA 1JCRA 3PZ2A 3UT7A 2LSVA 4L23A 1JCQA 4CT0A 2XGSA 3ABLE 1FPPA 3PE4A 3ASHA 1HF8A 5CEDB 3NOCD 1IHBA 3CHPA 1TNBA 2WVIA 3E30A 1KZPA 1PY1A 2J9QA 4G26A 4RG9A 1E7VA 3L17A 2VTBA 2P9PG 1SVXA 3VLFA 1TEZA 2P9NG 2OEVA 5ANLA 1VDYA 3CVWA 2IO3C 4HBDA 4APOA 3FTUA 3FH7A 3QK0A 1MQSA 3CVUA 3PNLB 1OWPA 2OVBA 3GZSA 1FVHA 4EBAG 2XS8A 3SI5A 5EX3A 1GW6A 3FH5A 3UIPC 3Q5MA 1N52A 2LAIA 3PREA 1S64A 3QJZA 3AS4A 2WQ7A 4ILIA 3B7RL 2EIKE 2F0YA 3ZRHA 3R9AB 4IRUA 3LVRE 5ENPD 4ANXA 3NQPA 1OWOA 3AS5A 3FUEA 1HXIA 3RAUA 5D0OD 4DX1A 1ZU2A 3VTXA 1E8ZA 3QWPA 4BT8A 3L6AA 4HOTA 2B0OE 2YHEA 1WDYA 4I6GA 2WXNA 4ACLA 3UM1A 4GA1A 3FU0A 4PDXA 2UY1B 2WMOA 3FTWA 4ATZD 2LSUA 1HG2A 3PEVB 3DPDA 4A1GA 3MKQB 1OXJA 4OYSA 2ZGGA 2PNNA 3ENEA 1K1AA 3KSLA 3CLJA 3FP3A 3IEGA 2XEEA 5BNWA 2CHZA 2JLBA 4G11A 3U3WA 1JWFA 4E6HA 4EBAA 3Q9UC 3HVEA 4HRLA 2P2CP 4L2LA 4GB9A 5JA4D 3O48A 1ELWA 1EYHA 3ZYQA 4FJZA 5EDSA 1QZ2A 4BY6A 2WXOA 3BG0B 4JVSA 1MHQA 4H7XA 3W9GA 1SZAA 2KZTA 5KWDA 2LAHA 1E7UA 1DCEA 4N5CA 2GROB 3PDNA 3DPYA 4GA0A 3T8KA 3PVLA 3ZHEB 3ABKE 4EHMA 1HE8A 1KT1A 4HRMB 4FHJA 3I4GA 3R7QA 4UI9C 1QQEA 5AQ9A 3UKUG 3TJPA 1JCSA 3EDTB 3CVYA 3EU5A 4DRXE 5JJ7A 4DX7D 2HM8A 4LERA 3Q4AB 1DVPA 3FUJA 3UT8A 4G24A 4GTSA 4ANUA 3CHOA 3IKOB 5AARA 2WQHA 3Q49B 3FUNA 3UM3A 1O5MA 1IKND 4ILHB 5AJDA 3D9KA 2XEVA 4X8QA 4N39A 2X3MA 2FF4A 3B7TA 5ENQD 3E32A 2QYJA 5ARFA 3RRMB 3HYMB 4XIFA 2VGEA 2YQ8A 4LRZA 4KVMA 4EPZA 3RRNB 3AU4A 1HU3A 2Y69E 3TWXA 4BWRA 4GTPA 4MS6A 4L2YA 4XKCA 4NIKA 2FO7A 1Z5SC 4CZ2D 5G05C 3SFXA 3ZXSA 4K5CA 4MKTA 3CK9A 3ZW3A 3QB2A 2DYRE 3QARA 4I9EA 4OVVA 3ZU7B 4G1TA 3IBEA 3NBNB 2WXPA 4G8LA 2VJ8A 4GZCA 2PQNA 4IN3B 3OTNA 3TXNA 4IULA 4DX6D 4ATGA 4WUYA 3FULA 3D9MA 1NL4A 4TXRA 2J07A 3B7UX 4O60A 3AG1E 1OUVA 4KBQA 3T5XA 1H2VC 1N11A 3FUFA 2IFUA 5EIBE 2P9IG 3U9WA 2NC9A 1YA0A 5JJTA 4C0MA 2A5UA 5LCWC 4UI9K 2OOEA 5JJ6A 4DI4A 2L0IA 4ME2A 2H6HA 1U3DA 4BX9A 5JHBA 3N71A 3UQ3A 4U95D 4F3VA 3CKBA 4HS2A 5KJMA 4HRNA 1PAQA 4JHJA 4CDNA 4N3AA 3CVQA 3ASFA 1H0AA 5CBOA 3CSTA 1A5EA 4PUCA 5B3SE 1N4PA 1FCHA 2VGXB 4A3TA 3FHEA 4FP7A 4URKA 3SQVA 3SD5A 3WXXA 1WG0A 2XPZA 2LUHA 5JHAA 3E37A 1FT1A 3DXMG 1RW2A 2V5FA 3R7RA 4WNGA 2NXPA 3T8MA 2XRYA 1WAO1 4JZYA 3D9PA 2LXMA 3Q7FA 3LKUA 3L82A 4JC8A 5AIJA 2UWJG 1JWGA 3NZSA 3GW4A 3ZEFA 3ESKA 5BT1A 4PS7A 4OAUC 2JEKA 3LDZA 4I9CA 3U4TA 5J08A 3QNKA 2VTBB 4GTOA 1KLXA 5AQBA 3L08A 5CHEE 5C1DA 3FUIA 4K03A 1WM5A 3CKCA 3AG3E 3LEWA 4M7CA 3APFA 4F53A 2KC7A 2P9LG 4GZ5A 4LSZE 3AU5A 2YINA 5FQ4A 3TG4A 4B94A 3C3OA 3T5VA 2KXPC 3URZA 4O1OA 2HR2A 1D9SA 3MA5A 4GAAA 1OCOE 3ZXPA 4WWPA 4BTBA 3U64A 3TAXA 4BSXA 3BG1B 4BFRA 4EZJA 3E33A 1N0QA 2ETBA 1P5QA 3SFYA 4TXQA 1NA0A 3EIQC 4EZLA 1OWLA 4V3IA 4ABNA 1N4RA 2L9BA 4B93B 4AXHA 3D3MA 3ZYKA 2IO2C 4K5BA 2PM6A 4I2WA 3RU0A 3SZ7A 5A6CA 4BSZB 5H7PA 4N5QA 1H6OA 3L13A 4CDMA 4HOUA 3WG7E 4JPSA 2L6BA 2P58C 4NURA 4EQFA 4GCNA 3HXEA 4GTQA 4WNEA 4QFVA 1E8YA 3HRAA 5T3RA 4EZKA 2R02A 2DBAA 3SFZA 3HVEB 4HOQA 2RKKA 3ZGQA 1OY3D 2AJAA 3TWUA 5A7DB 4JA9A 4LUNU 3ABME 4I1AA 2Y3AA 4I1OB 4GPMA 3LY7A 3JUEA 5BXUA 3V30A 3S2AA 3QWWA 1Y6IA 2L6JA 3CK8A 5KJLA 5AQ7A 2KZTB 4GU5A 2E0IA 1HH8A 1NP7A 2QYUA 2EQXA 4OVUA 3PZ4A 1FVFA 2VGYA 2LXLA 4GA2A 4AM9A 4F1SA 2WPVA 5CEAA 5EYLA 1INZA 3LVQE 2OVFA 4U04A 3RSEG 3ONKA 5ANRA 4D10C 5CRUA 4CDRA 4KYOB 3JXIA 3NZUA 5D66A 5KNHD 2C0LA 3FEXA 2DWZA 1MX6A 4XKBA 3CEQA 2KATA 3CV0A 2BUGA 2DIWA 3RRUA 2I1JA 4CCAA 2EIME 2WMNA 4FU3A 5CRVA 1OCRE 1YCSB 5G04C 2M63A 3S7FA 5A23A 3OXLA 2XCBA 4U8YD 4P29A 5FWQA 2MYOA 3PRZA 1Q2ZA 2BF0X 5AENA 3AG2E 3IXEA 4WWOA 4J6IA 3AG4E 3Q9NC 5FZRA 2CFUA 2R17C 5BUZA 5ARGA 3JUIA 2ZIRA 5ENTD 1UW4B 4JB8P 3L16A 3EJNA 3FUKA 2PL2A 4U7EB 2AXVA 3PZ1A 3C3RA 2VSOE 3DEOA 1TJFA 2QY7A 2HE0A 3ZYMA 3JQ0A 3QC1A 5CECB 1TN6A 3FU3A 3DSSA 2WXIA 4DPRA 3EHRA 2WXRA 3HDXA 4GMLA 5D0QD 1O1SA 4U96D 3TWRA 3UT4A 4BTAA 3HHMA 5KJKA 5EYPF 3ZKJA 2V4HC 3SNXA 5AYWD 3FUHA 1DNPA 3UUXA 3ML9A 5FTPA 2VYIA 3PEUB 5HQ8A 1UN8A 4U8VD 5HKPA 3ASGA 2WXFA 3SF4A 3Q73A 2GW1A 1TN8A 2DZNA 3KEAA 4J8FA 4BESA 2FBNA 2GRRB 3O4ZA 1BU9A 1LD8A 4LNGA 3UINC 2H6GA 2X38A 4MLPA 5LFAA 1S63A 1N9AA 3Q79A 3FU5A 3NB2A 2GRPB 3MV3B 1IQUA 3U66A 5CMYA 3PS6A 3MKQA 5E75A 4L7TA 2V8SE 4ZHBA 4GTVA 1N94A 3RO2A 3Q15A 4XZ4A 5ENSD 3GZ1A 2WQ6A 4A63B 3HXDA 4I6EA 5HRYA 3DWLG 3CSFA 3V2XA 4N3CA 2F8XK 4AY5A 4CT4A 3DSWA 2P9KG 2XENA 4ANWA 2VSXE 3MV2B 2IY0C 2I6HA 2EINE 4L1BA 1TYQG 3UMVA 3APCA 1E96B 3ULYA 5DBKA 4GMRA 4KZ0A 2XS1A 5AN8A 4LNBA 4HLLA 4UWFA 1X81A 4UQZA 4LCTA 4K0RA 3TG5A 5BPPA 4C9BB 5LX8A 4KT6B 3VTYA 3DEPA 3EHNA 5G2NA 3MCXA 3UIOC 2C2LA 2IU1A 4FA6A 1XGWA 4YDYA 3HIZA 4O1PA 2MRIA 4LG6A 3X2QE 1E8WA 1SW6A 3DSVA 2PZIA 3UX4A 4UWGA 2KCLA 4Q69A 2F37A 2KM4A 3QWVA 4UUCA 1RZ4A 5FQ8A 3L22A 4JEHA 2A5EA 4GTRA 2E2EA 3AJIA 4XE0A 3PUJA 3ZYLA 4UWKA 4JW1A 3CHRA 1K1BA 4I2ZA 5BV1A 2XPIA 5G04J 3NAWA 3FU6A 1EPUA 1HG5A 4JD2G 5BV0A 5KCMA 3D9OA 3W9FA 2DCPA 2AW6A 3UKRG 2ZU6B 5FZQA 1AP7A 1N95A 2OV8A 4YVQC 3ONLA 4BEPA 2MOWA 3HG0D 3VLEA 1L5JA 2XZDG 3TL5A 3BUAA 2ZGDA 3MEKA 5DIZA 1V55E 2DZOA 3MGBA 3QKYA 3ZPJA 3FH8A 2HYZA 2IOLA 2EIJE 4GPKA 2WXLA 4HI9A 1U2VG 1BI8B 1JUQA 1QBQA 5B1AE 1QNFA 4U0UA 4TV3A 2IQCA 3OXFA 3QOUA 4UI9J 2XZTG 2ONDA 4HOSA 4A3VA 2WXJA 4CGVA 3SGHA 2CG2A 1A17A 1IYGA 1LTXA 4RQIA 1D8DA 4FLHA 5BXOA 1MZCA 2X6HA 4N2SA 3FTXA 5C2YA 1HX8A 4JXTA 3TWVA 1U3CA 2ZISA 1IQRA 4YDOA 3KSQA 1S0PA 2AWIA 5CBNA 3I3NA 4DX5D 5FJYA 2WXKA 3ISMC 1E90A 3FY4A 4A1SA 3APDA 3HXCA 1K8KG 4FC8A 5B1BE 5CMWA 4ANVA 3TWSA 2OEWA 2DYSE 4XX5A 5CCLA 4U0ZA 3DXKG 3CGHA 2CHWA 3CVPA 3PUKA 4Y6CA 5ENRD 4I17A 2VGXA 3CIAA 4CYMD 2WXQA 3QDNA 5G05J 4F1PA 1IHGA 2KCVA 1D8EA 2XGMA 2IJGX 1FT2A 1TNYA 3D9LA 5ENNA 3DBSA 2V0PA 4BERA 4MBGA 5T8IA 2Q7FA 2Y4UA 3AAAC 2XHEA 3Q47B 4B0ZA 2GRQB 1O1TA 4UWHA 3TWQA 2RG8A 4I1MA 5D2MC 3RKVA 4AOFA 3PH0C 1TNZA 2B6CA 3EUVA 3ZNGA 3UTMA 3FFLA 3SY2A 3FTVA 3V79K 2R59A 3E34A 1OCZE 3CVVA 4HI8A 4E85A 3G2VA 2WXHA 3J5PA 1AWCB 4AVXA 3ML8A 4AJWA 3RIBA 4HB5A 1DC2A 3D9NA 4QQIA 4WWNA 4GYWA 5LCWJ 3UPVA 2P9UG 4J0UA 2L0TB 3FDHA 3ZN3A 1QYMA 2EILE 2QC9A 2X6IA 5JMND 3CK7A 2R05A 4KXKB 3JCKC 3CVLA 5BW8C 5AJLA 1IXVA 3Q7AA 2LNIA 3TGOA 2RFMA 3IHVA 1H6KA
chains in the Genus database with same CATH topology
2ZGDA 2XEHA 3V31A 2XEEA 3ZUVB 3UI2A 2DVWA 4CYMD 2Y0BG 4Z68A 5AQBA 2DZNA 2VGEA 5KNGA 4ZFHA 1S70B 1BLXB 4DUIA 3KEAA 3D9HA 3DEPA 5ENOD 3NOGD 1YCSB 2L6BA 2Y1LE 3Q9UC 4F1PA 4BESA 4HRLA 2DZOA 4DX2A 1BU9A 4K5AB 1MX2A 3B95A 4U95D 3SO8A 1UOHA 2P2CP 3TWWA 4HRNA 3TWXA 5JA4D 3C5RA 1MYOA 4YDYA 3UXGA 4O1PA 4QFVA 4C48B 4LG6A 3HRAA 4BERA 2JABA 4HI9A 1SW6A 4U8YD 1BI8B 4NIKA 2MYOA 4J8YA 5FIOA 4CZ2D 3AAAC 3W9GA 5CBOA 4K5CA 4LSZE 3IXEA 2F37A 1OY3D 5ENPD 1A5EA 1BI7B 2AJAA 5KWDA 4UUCA 3TWUA 1MX4A 3B7BA 3Q9NC 1OT8A 2XZTG 4ZHBA 3LJNA 2A5EA 3JXJA 5FINA 4GPMA 3TWQA 5EILA 3JUEA 5ENSD 3V30A 5BXUA 4DX1A 5ENTD 3AJIA 3T8KA 4JB8P 3EU9A 3TWTA 5EIDA 3J5QB 2KXPC 3ZU7B 4A63B 3ZNGA 4G8KA 4O1OA 5CERB 5AQ7A 1D9SA 2NYJA 3UTMA 5AAOA 1DCQA 5HRYA 3NBNB 4G8LA 2KBXA 1WG0A 5BXOA 3V79K 2F8YA 1BD8A 5AQAA 4HI8A 3V2XA 1K3ZD 4HRMB 2J8SD 2F8XK 3J5PA 1N0RA 3DEOA 1AWCB 2B0OE 3T9KA 1WDYA 2HE0A 5AQ9A 4LNUD 3TWVA 1K1BA 1N0QA 2ETBA 4DX6D 2XENA 5CECB 4HB5A 2ETAA 3NOCD 5CEDB 1G3NB 1IHBA 1YYHA 3F6QA 5EN5D 5CBNA 3EHRA 4DRXE 4OAVB 4DX5D 4DX7D 1YMPA 2V5QC 1DC2A 2ETCA 4QQIA 4ATZD 4U96D 3V2OA 2BKGA 3W9FA 3TWRA 4O60A 5AARA 5EYLA 5CEAA 1NFIE 1AP7A 1SVXA 4YDWA 5EYPF 4B93B 4BETA 5ITZF 4TUMA 2V4HC 3ZKJA 1QYMA 2QC9A 4HQDA 1IKND 4HNAD 4GMRA 5JMND 3TWSA 2RFAA 1N11A 3JXIA 4K5BA 2ZGGA 4BEPA 4J7WA 2PNNA 3HG0D 5D66A 5AN8A 4HBDA 5HS0A 5KNHD 5EIBE 1K1AA 4BSZB 1MJ0A 4OAUC 5KBAA 4N5QA 4RLYA 4HLLA 4U8VD 5HKPA 1IXVA 1TR4A 2BKKB 5ENQD 2FO1E 2DWZA 1MX6A 2RFMA 2XZDG 3EHQA 5ENRD 2QYJA 4F6RD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZGD A;  2XEH A;  3V31 A;  2XEE A;  3ZUV B;  3UI2 A;  2DVW A;  4CYM D;  2Y0B G;  4Z68 A;  5AQB A;  2DZN A;  2VGE A;  5KNG A;  4ZFH A;  1S70 B;  1BLX B;  4DUI A;  3KEA A;  3D9H A;  3DEP A;  5ENO D;  3NOG D;  1YCS B;  2L6B A;  2Y1L E;  3Q9U C;  4F1P A;  4BES A;  4HRL A;  2DZO A;  4DX2 A;  1BU9 A;  4K5A B;  1MX2 A;  3B95 A;  4U95 D;  3SO8 A;  1UOH A;  2P2C P;  3TWW A;  4HRN A;  3TWX A;  5JA4 D;  3C5R A;  1MYO A;  4YDY A;  3UXG A;  4O1P A;  4QFV A;  4C48 B;  4LG6 A;  3HRA A;  4BER A;  2JAB A;  4HI9 A;  1SW6 A;  4U8Y D;  1BI8 B;  4NIK A;  2MYO A;  4J8Y A;  5FIO A;  4CZ2 D;  3AAA C;  3W9G A;  5CBO A;  4K5C A;  4LSZ E;  3IXE A;  2F37 A;  1OY3 D;  5ENP D;  1A5E A;  1BI7 B;  2AJA A;  5KWD A;  4UUC A;  3TWU A;  1MX4 A;  3B7B A;  3Q9N C;  1OT8 A;  2XZT G;  4ZHB A;  3LJN A;  2A5E A;  3JXJ A;  5FIN A;  4GPM A;  3TWQ A;  5EIL A;  3JUE A;  5ENS D;  3V30 A;  5BXU A;  4DX1 A;  5ENT D;  3AJI A;  3T8K A;  4JB8 P;  3EU9 A;  3TWT A;  5EID A;  3J5Q B;  2KXP C;  3ZU7 B;  4A63 B;  3ZNG A;  4G8K A;  4O1O A;  5CER B;  5AQ7 A;  1D9S A;  2NYJ A;  3UTM A;  5AAO A;  1DCQ A;  5HRY A;  3NBN B;  4G8L A;  2KBX A;  1WG0 A;  5BXO A;  3V79 K;  2F8Y A;  1BD8 A;  5AQA A;  4HI8 A;  3V2X A;  1K3Z D;  4HRM B;  2J8S D;  2F8X K;  3J5P A;  1N0R A;  3DEO A;  1AWC B;  2B0O E;  3T9K A;  1WDY A;  2HE0 A;  5AQ9 A;  4LNU D;  3TWV A;  1K1B A;  1N0Q A;  2ETB A;  4DX6 D;  2XEN A;  5CEC B;  4HB5 A;  2ETA A;  3NOC D;  5CED B;  1G3N B;  1IHB A;  1YYH A;  3F6Q A;  5EN5 D;  5CBN A;  3EHR A;  4DRX E;  4OAV B;  4DX5 D;  4DX7 D;  1YMP A;  2V5Q C;  1DC2 A;  2ETC A;  4QQI A;  4ATZ D;  4U96 D;  3V2O A;  2BKG A;  3W9F A;  3TWR A;  4O60 A;  5AAR A;  5EYL A;  5CEA A;  1NFI E;  1AP7 A;  1SVX A;  4YDW A;  5EYP F;  4B93 B;  4BET A;  5ITZ F;  4TUM A;  2V4H C;  3ZKJ A;  1QYM A;  2QC9 A;  4HQD A;  1IKN D;  4HNA D;  4GMR A;  5JMN D;  3TWS A;  2RFA A;  1N11 A;  3JXI A;  4K5B A;  2ZGG A;  4BEP A;  4J7W A;  2PNN A;  3HG0 D;  5D66 A;  5AN8 A;  4HBD A;  5HS0 A;  5KNH D;  5EIB E;  1K1A A;  4BSZ B;  1MJ0 A;  4OAU C;  5KBA A;  4N5Q A;  4RLY A;  4HLL A;  4U8V D;  5HKP A;  1IXV A;  1TR4 A;  2BKK B;  5ENQ D;  2FO1 E;  2DWZ A;  1MX6 A;  2RFM A;  2XZD G;  3EHQ A;  5ENR D;  2QYJ A;  4F6R D; 
#chains in the Genus database with same CATH topology
 3LJ3 A;  4XEI G;  5FQ7 A;  3CR3 A;  5EKQ D;  2BTD A;  3B7S A;  4ZFH A;  3D9H A;  5ENO D;  2Y1L E;  1NA3 A;  2I9C A;  3CHS A;  1MYO A;  4W9R A;  3CVX A;  5E76 A;  2ZXW E;  5M72 A;  1HFA A;  2ILR A;  4JEU A;  3BU8 A;  3K9I A;  3B7B A;  4FLB A;  4TRQ A;  5FIN A;  1UJK A;  4G23 A;  4JHR A;  3EU9 A;  3IHY A;  1HO8 A;  1LF8 A;  3PE3 A;  4Q94 A;  5CER B;  1H2T C;  3S7B A;  4CEM A;  2NYJ A;  5CCM A;  3ASN E;  5AQA A;  1K3Z D;  3AS8 A;  4WAF A;  5FT9 A;  1N0R A;  3P1U A;  4YDE A;  4RVB A;  1HZ4 A;  3G2U A;  4EEC A;  4G2V A;  2ETA A;  3F6Q A;  2XQ0 A;  4OAV B;  3SHF A;  4NRH B;  2J4B A;  1H2U A;  3ESL A;  3E4B A;  3KD7 A;  4J8E A;  4I6J A;  5G55 A;  4TUM A;  1LD7 A;  2J4D A;  1SA4 A;  4GZ3 A;  4M3O A;  4N3B A;  2CHX A;  2CG3 A;  5HS0 A;  4APF A;  2J08 A;  1KT0 A;  4RLY A;  2FO1 E;  4FJY A;  4WNF A;  4F6R D;  3V31 A;  2J49 A;  4AV7 A;  1HS6 A;  3UI2 A;  3ZVV A;  3D9I A;  1N4Q A;  1S70 B;  1BLX B;  3TXM A;  2FI7 A;  3JYS A;  2IF4 A;  3ULE G;  4HXI A;  3MX3 A;  1Y8M A;  2KCK A;  4U63 A;  2BED A;  4DX2 A;  3PZ3 A;  4PS8 A;  4K5A B;  4UQX A;  2I1K A;  3SO8 A;  4C48 B;  3LXU X;  4FUL A;  2ION A;  4CGW A;  4FAD A;  3QAQ A;  4R7L A;  4LEU A;  3S7J A;  1BI7 B;  3FTZ A;  2NSZ A;  4U8H A;  3LJN A;  5EIL A;  4ILG A;  5IY5 E;  2LO6 A;  4RSY A;  2VQ2 A;  2V4L A;  5EID A;  4BX8 A;  1DCQ A;  4GTT A;  2UY1 A;  3Q75 A;  4DLO A;  2AXU A;  5EX0 A;  4J8S A;  2J8S D;  3SBT B;  4JL0 A;  3T9K A;  5J90 A;  4UQY A;  4L9P A;  2A4Z A;  4WND A;  3LY9 A;  1G3N B;  3FEY A;  2MHK A;  2V5Q C;  2ETC A;  2BKG A;  4DLQ A;  4FHK A;  1NFI E;  1H19 A;  3L9T A;  3OXG A;  4HNA D;  4GZD A;  3P2B A;  2RFA A;  1H6P A;  2AVP A;  4PS3 A;  3LY8 A;  2FEZ A;  4PH4 B;  1TR4 A;  1ZB1 A;  3ZUV B;  3LPZ A;  3GYZ A;  4DUI A;  1SA5 A;  4BT9 A;  1NI1 A;  1Z3X A;  3R9M A;  4TUU A;  4AP2 A;  4C0E A;  2QFC A;  1PC2 A;  4DI3 A;  5T4Y A;  1N54 A;  3L54 A;  1NZN A;  2JAB A;  4N2Q A;  2CFZ A;  4J8Y A;  3KEZ A;  5KJN A;  3BQO A;  3C72 A;  3ZHE A;  4NQ0 A;  3CVN A;  2XGO A;  4ACK A;  3CQC B;  4HFG A;  1MX4 A;  3JQ1 A;  4U07 A;  4XI0 A;  3FTS A;  1TNU A;  2PM7 A;  4G25 A;  2H6I A;  4KZC A;  2J09 A;  3S7D A;  3OAW A;  3J5Q B;  4JA7 A;  1OCC E;  5AAO A;  3LS8 A;  2XCC A;  4B8A A;  3EHM A;  3FTY A;  2WB2 A;  5FZS A;  3KS2 A;  4U0S A;  1YMP A;  2X6K A;  1EDU A;  3ZIM A;  3V2O A;  1UJJ A;  4AIF A;  4YVO A;  4YDW A;  4BET A;  2GRL A;  5ITZ F;  1ELK A;  4DK5 A;  3HXB A;  3KAE A;  2X6F A;  4DJA A;  2BKK B;  1KZO A;  2YNQ A;  1SZ9 A;  3Q78 A;  3EHQ A;  3ZFW A;  2OCC E;  1ELR A;  2Y0B G;  3DSX A;  4GTM A;  3LCA A;  2VSY A;  2WXG A;  3NOG D;  4KVO A;  3B95 A;  3UM0 A;  4A55 A;  1UOH A;  3TWW A;  3ASD A;  3CQG B;  1JPL A;  3UXG A;  4GYY A;  2R2L A;  3D9J A;  1E8X A;  3G2W A;  2AXZ A;  5FIO A;  2GGF A;  1WY6 A;  2IEJ A;  5FQ6 A;  3I5P A;  4KMO A;  4HLE A;  1W3B A;  1X5B A;  4Q96 A;  3CHQ A;  4GMJ A;  5HI7 A;  1TJC A;  2XPY A;  2PQR A;  4UWL A;  4J8D A;  3C3Q A;  3TWT A;  4G8K A;  2H6F A;  2KBX A;  3SBS A;  2F8Y A;  4CRW A;  3MJW A;  2RD0 A;  3HXF A;  4TXP A;  1TN7 A;  3UM2 A;  3BEE A;  2YHC A;  3B13 A;  4LNU D;  1B89 A;  4GYO A;  3MYV A;  4F7A A;  1YYH A;  3FWV A;  5EN5 D;  3RJV A;  3MKR A;  1BPO A;  3RK6 A;  3ULQ A;  2X6J A;  4RG6 A;  4B8C B;  5LP0 A;  3GZ2 A;  1UG3 A;  4HQD A;  3PNT B;  3ASO E;  3G2S A;  4Y6W A;  4J7W A;  1N4S A;  3MZL B;  2QZA A;  1MJ0 A;  4JHK A;  5KBA A;  4YND A;  2HO1 A;  4GCO A;  4AEZ C;  2GRM A;  3I4R B;  1UN9 A;  4HVB A;  3DSU A;  5KNG A;  4IYP A;  2XEH A;  3C98 A;  1TNO A;  2DVW A;  4Z68 A;  4AY6 A;  3PZD A;  3LYA A;  2GRN B;  4HOR A;  2WM9 A;  3FUD A;  3NF1 A;  2P9S G;  4H7Y A;  5LOZ A;  2FUL A;  2WXM A;  3EIJ A;  3CHM A;  1MX2 A;  2I2O A;  3DST A;  4B89 A;  1Z3Y A;  3C5R A;  1SQM A;  1KPS B;  2VSN A;  1O1R A;  1V54 E;  3DRA A;  4I43 A;  3VLD A;  4GZ6 A;  4MRU A;  3FUM A;  3IV0 A;  1OT8 A;  1Z6T A;  2R03 A;  3JXJ A;  3RO3 A;  1XNF A;  2XRZ A;  4NAC A;  1ZBP A;  1EF1 C;  2R5S A;  4XI9 A;  2C0M A;  1BD8 A;  1OWM A;  3G2T A;  1OWN A;  4O6F A;  2Y4T A;  2IOS A;  1JCR A;  3PZ2 A;  3UT7 A;  2LSV A;  4L23 A;  1JCQ A;  4CT0 A;  2XGS A;  3ABL E;  1FPP A;  3PE4 A;  3ASH A;  1HF8 A;  5CED B;  3NOC D;  1IHB A;  3CHP A;  1TNB A;  2WVI A;  3E30 A;  1KZP A;  1PY1 A;  2J9Q A;  4G26 A;  4RG9 A;  1E7V A;  3L17 A;  2VTB A;  2P9P G;  1SVX A;  3VLF A;  1TEZ A;  2P9N G;  2OEV A;  5ANL A;  1VDY A;  3CVW A;  2IO3 C;  4HBD A;  4APO A;  3FTU A;  3FH7 A;  3QK0 A;  1MQS A;  3CVU A;  3PNL B;  1OWP A;  2OVB A;  3GZS A;  1FVH A;  4EBA G;  2XS8 A;  3SI5 A;  5EX3 A;  1GW6 A;  3FH5 A;  3UIP C;  3Q5M A;  1N52 A;  2LAI A;  3PRE A;  1S64 A;  3QJZ A;  3AS4 A;  2WQ7 A;  4ILI A;  3B7R L;  2EIK E;  2F0Y A;  3ZRH A;  3R9A B;  4IRU A;  3LVR E;  5ENP D;  4ANX A;  3NQP A;  1OWO A;  3AS5 A;  3FUE A;  1HXI A;  3RAU A;  5D0O D;  4DX1 A;  1ZU2 A;  3VTX A;  1E8Z A;  3QWP A;  4BT8 A;  3L6A A;  4HOT A;  2B0O E;  2YHE A;  1WDY A;  4I6G A;  2WXN A;  4ACL A;  3UM1 A;  4GA1 A;  3FU0 A;  4PDX A;  2UY1 B;  2WMO A;  3FTW A;  4ATZ D;  2LSU A;  1HG2 A;  3PEV B;  3DPD A;  4A1G A;  3MKQ B;  1OXJ A;  4OYS A;  2ZGG A;  2PNN A;  3ENE A;  1K1A A;  3KSL A;  3CLJ A;  3FP3 A;  3IEG A;  2XEE A;  5BNW A;  2CHZ A;  2JLB A;  4G11 A;  3U3W A;  1JWF A;  4E6H A;  4EBA A;  3Q9U C;  3HVE A;  4HRL A;  2P2C P;  4L2L A;  4GB9 A;  5JA4 D;  3O48 A;  1ELW A;  1EYH A;  3ZYQ A;  4FJZ A;  5EDS A;  1QZ2 A;  4BY6 A;  2WXO A;  3BG0 B;  4JVS A;  1MHQ A;  4H7X A;  3W9G A;  1SZA A;  2KZT A;  5KWD A;  2LAH A;  1E7U A;  1DCE A;  4N5C A;  2GRO B;  3PDN A;  3DPY A;  4GA0 A;  3T8K A;  3PVL A;  3ZHE B;  3ABK E;  4EHM A;  1HE8 A;  1KT1 A;  4HRM B;  4FHJ A;  3I4G A;  3R7Q A;  4UI9 C;  1QQE A;  5AQ9 A;  3UKU G;  3TJP A;  1JCS A;  3EDT B;  3CVY A;  3EU5 A;  4DRX E;  5JJ7 A;  4DX7 D;  2HM8 A;  4LER A;  3Q4A B;  1DVP A;  3FUJ A;  3UT8 A;  4G24 A;  4GTS A;  4ANU A;  3CHO A;  3IKO B;  5AAR A;  2WQH A;  3Q49 B;  3FUN A;  3UM3 A;  1O5M A;  1IKN D;  4ILH B;  5AJD A;  3D9K A;  2XEV A;  4X8Q A;  4N39 A;  2X3M A;  2FF4 A;  3B7T A;  5ENQ D;  3E32 A;  2QYJ A;  5ARF A;  3RRM B;  3HYM B;  4XIF A;  2VGE A;  2YQ8 A;  4LRZ A;  4KVM A;  4EPZ A;  3RRN B;  3AU4 A;  1HU3 A;  2Y69 E;  3TWX A;  4BWR A;  4GTP A;  4MS6 A;  4L2Y A;  4XKC A;  4NIK A;  2FO7 A;  1Z5S C;  4CZ2 D;  5G05 C;  3SFX A;  3ZXS A;  4K5C A;  4MKT A;  3CK9 A;  3ZW3 A;  3QB2 A;  2DYR E;  3QAR A;  4I9E A;  4OVV A;  3ZU7 B;  4G1T A;  3IBE A;  3NBN B;  2WXP A;  4G8L A;  2VJ8 A;  4GZC A;  2PQN A;  4IN3 B;  3OTN A;  3TXN A;  4IUL A;  4DX6 D;  4ATG A;  4WUY A;  3FUL A;  3D9M A;  1NL4 A;  4TXR A;  2J07 A;  3B7U X;  4O60 A;  3AG1 E;  1OUV A;  4KBQ A;  3T5X A;  1H2V C;  1N11 A;  3FUF A;  2IFU A;  5EIB E;  2P9I G;  3U9W A;  2NC9 A;  1YA0 A;  5JJT A;  4C0M A;  2A5U A;  5LCW C;  4UI9 K;  2OOE A;  5JJ6 A;  4DI4 A;  2L0I A;  4ME2 A;  2H6H A;  1U3D A;  4BX9 A;  5JHB A;  3N71 A;  3UQ3 A;  4U95 D;  4F3V A;  3CKB A;  4HS2 A;  5KJM A;  4HRN A;  1PAQ A;  4JHJ A;  4CDN A;  4N3A A;  3CVQ A;  3ASF A;  1H0A A;  5CBO A;  3CST A;  1A5E A;  4PUC A;  5B3S E;  1N4P A;  1FCH A;  2VGX B;  4A3T A;  3FHE A;  4FP7 A;  4URK A;  3SQV A;  3SD5 A;  3WXX A;  1WG0 A;  2XPZ A;  2LUH A;  5JHA A;  3E37 A;  1FT1 A;  3DXM G;  1RW2 A;  2V5F A;  3R7R A;  4WNG A;  2NXP A;  3T8M A;  2XRY A;  1WAO 1;  4JZY A;  3D9P A;  2LXM A;  3Q7F A;  3LKU A;  3L82 A;  4JC8 A;  5AIJ A;  2UWJ G;  1JWG A;  3NZS A;  3GW4 A;  3ZEF A;  3ESK A;  5BT1 A;  4PS7 A;  4OAU C;  2JEK A;  3LDZ A;  4I9C A;  3U4T A;  5J08 A;  3QNK A;  2VTB B;  4GTO A;  1KLX A;  5AQB A;  3L08 A;  5CHE E;  5C1D A;  3FUI A;  4K03 A;  1WM5 A;  3CKC A;  3AG3 E;  3LEW A;  4M7C A;  3APF A;  4F53 A;  2KC7 A;  2P9L G;  4GZ5 A;  4LSZ E;  3AU5 A;  2YIN A;  5FQ4 A;  3TG4 A;  4B94 A;  3C3O A;  3T5V A;  2KXP C;  3URZ A;  4O1O A;  2HR2 A;  1D9S A;  3MA5 A;  4GAA A;  1OCO E;  3ZXP A;  4WWP A;  4BTB A;  3U64 A;  3TAX A;  4BSX A;  3BG1 B;  4BFR A;  4EZJ A;  3E33 A;  1N0Q A;  2ETB A;  1P5Q A;  3SFY A;  4TXQ A;  1NA0 A;  3EIQ C;  4EZL A;  1OWL A;  4V3I A;  4ABN A;  1N4R A;  2L9B A;  4B93 B;  4AXH A;  3D3M A;  3ZYK A;  2IO2 C;  4K5B A;  2PM6 A;  4I2W A;  3RU0 A;  3SZ7 A;  5A6C A;  4BSZ B;  5H7P A;  4N5Q A;  1H6O A;  3L13 A;  4CDM A;  4HOU A;  3WG7 E;  4JPS A;  2L6B A;  2P58 C;  4NUR A;  4EQF A;  4GCN A;  3HXE A;  4GTQ A;  4WNE A;  4QFV A;  1E8Y A;  3HRA A;  5T3R A;  4EZK A;  2R02 A;  2DBA A;  3SFZ A;  3HVE B;  4HOQ A;  2RKK A;  3ZGQ A;  1OY3 D;  2AJA A;  3TWU A;  5A7D B;  4JA9 A;  4LUN U;  3ABM E;  4I1A A;  2Y3A A;  4I1O B;  4GPM A;  3LY7 A;  3JUE A;  5BXU A;  3V30 A;  3S2A A;  3QWW A;  1Y6I A;  2L6J A;  3CK8 A;  5KJL A;  5AQ7 A;  2KZT B;  4GU5 A;  2E0I A;  1HH8 A;  1NP7 A;  2QYU A;  2EQX A;  4OVU A;  3PZ4 A;  1FVF A;  2VGY A;  2LXL A;  4GA2 A;  4AM9 A;  4F1S A;  2WPV A;  5CEA A;  5EYL A;  1INZ A;  3LVQ E;  2OVF A;  4U04 A;  3RSE G;  3ONK A;  5ANR A;  4D10 C;  5CRU A;  4CDR A;  4KYO B;  3JXI A;  3NZU A;  5D66 A;  5KNH D;  2C0L A;  3FEX A;  2DWZ A;  1MX6 A;  4XKB A;  3CEQ A;  2KAT A;  3CV0 A;  2BUG A;  2DIW A;  3RRU A;  2I1J A;  4CCA A;  2EIM E;  2WMN A;  4FU3 A;  5CRV A;  1OCR E;  1YCS B;  5G04 C;  2M63 A;  3S7F A;  5A23 A;  3OXL A;  2XCB A;  4U8Y D;  4P29 A;  5FWQ A;  2MYO A;  3PRZ A;  1Q2Z A;  2BF0 X;  5AEN A;  3AG2 E;  3IXE A;  4WWO A;  4J6I A;  3AG4 E;  3Q9N C;  5FZR A;  2CFU A;  2R17 C;  5BUZ A;  5ARG A;  3JUI A;  2ZIR A;  5ENT D;  1UW4 B;  4JB8 P;  3L16 A;  3EJN A;  3FUK A;  2PL2 A;  4U7E B;  2AXV A;  3PZ1 A;  3C3R A;  2VSO E;  3DEO A;  1TJF A;  2QY7 A;  2HE0 A;  3ZYM A;  3JQ0 A;  3QC1 A;  5CEC B;  1TN6 A;  3FU3 A;  3DSS A;  2WXI A;  4DPR A;  3EHR A;  2WXR A;  3HDX A;  4GML A;  5D0Q D;  1O1S A;  4U96 D;  3TWR A;  3UT4 A;  4BTA A;  3HHM A;  5KJK A;  5EYP F;  3ZKJ A;  2V4H C;  3SNX A;  5AYW D;  3FUH A;  1DNP A;  3UUX A;  3ML9 A;  5FTP A;  2VYI A;  3PEU B;  5HQ8 A;  1UN8 A;  4U8V D;  5HKP A;  3ASG A;  2WXF A;  3SF4 A;  3Q73 A;  2GW1 A;  1TN8 A;  2DZN A;  3KEA A;  4J8F A;  4BES A;  2FBN A;  2GRR B;  3O4Z A;  1BU9 A;  1LD8 A;  4LNG A;  3UIN C;  2H6G A;  2X38 A;  4MLP A;  5LFA A;  1S63 A;  1N9A A;  3Q79 A;  3FU5 A;  3NB2 A;  2GRP B;  3MV3 B;  1IQU A;  3U66 A;  5CMY A;  3PS6 A;  3MKQ A;  5E75 A;  4L7T A;  2V8S E;  4ZHB A;  4GTV A;  1N94 A;  3RO2 A;  3Q15 A;  4XZ4 A;  5ENS D;  3GZ1 A;  2WQ6 A;  4A63 B;  3HXD A;  4I6E A;  5HRY A;  3DWL G;  3CSF A;  3V2X A;  4N3C A;  2F8X K;  4AY5 A;  4CT4 A;  3DSW A;  2P9K G;  2XEN A;  4ANW A;  2VSX E;  3MV2 B;  2IY0 C;  2I6H A;  2EIN E;  4L1B A;  1TYQ G;  3UMV A;  3APC A;  1E96 B;  3ULY A;  5DBK A;  4GMR A;  4KZ0 A;  2XS1 A;  5AN8 A;  4LNB A;  4HLL A;  4UWF A;  1X81 A;  4UQZ A;  4LCT A;  4K0R A;  3TG5 A;  5BPP A;  4C9B B;  5LX8 A;  4KT6 B;  3VTY A;  3DEP A;  3EHN A;  5G2N A;  3MCX A;  3UIO C;  2C2L A;  2IU1 A;  4FA6 A;  1XGW A;  4YDY A;  3HIZ A;  4O1P A;  2MRI A;  4LG6 A;  3X2Q E;  1E8W A;  1SW6 A;  3DSV A;  2PZI A;  3UX4 A;  4UWG A;  2KCL A;  4Q69 A;  2F37 A;  2KM4 A;  3QWV A;  4UUC A;  1RZ4 A;  5FQ8 A;  3L22 A;  4JEH A;  2A5E A;  4GTR A;  2E2E A;  3AJI A;  4XE0 A;  3PUJ A;  3ZYL A;  4UWK A;  4JW1 A;  3CHR A;  1K1B A;  4I2Z A;  5BV1 A;  2XPI A;  5G04 J;  3NAW A;  3FU6 A;  1EPU A;  1HG5 A;  4JD2 G;  5BV0 A;  5KCM A;  3D9O A;  3W9F A;  2DCP A;  2AW6 A;  3UKR G;  2ZU6 B;  5FZQ A;  1AP7 A;  1N95 A;  2OV8 A;  4YVQ C;  3ONL A;  4BEP A;  2MOW A;  3HG0 D;  3VLE A;  1L5J A;  2XZD G;  3TL5 A;  3BUA A;  2ZGD A;  3MEK A;  5DIZ A;  1V55 E;  2DZO A;  3MGB A;  3QKY A;  3ZPJ A;  3FH8 A;  2HYZ A;  2IOL A;  2EIJ E;  4GPK A;  2WXL A;  4HI9 A;  1U2V G;  1BI8 B;  1JUQ A;  1QBQ A;  5B1A E;  1QNF A;  4U0U A;  4TV3 A;  2IQC A;  3OXF A;  3QOU A;  4UI9 J;  2XZT G;  2OND A;  4HOS A;  4A3V A;  2WXJ A;  4CGV A;  3SGH A;  2CG2 A;  1A17 A;  1IYG A;  1LTX A;  4RQI A;  1D8D A;  4FLH A;  5BXO A;  1MZC A;  2X6H A;  4N2S A;  3FTX A;  5C2Y A;  1HX8 A;  4JXT A;  3TWV A;  1U3C A;  2ZIS A;  1IQR A;  4YDO A;  3KSQ A;  1S0P A;  2AWI A;  5CBN A;  3I3N A;  4DX5 D;  5FJY A;  2WXK A;  3ISM C;  1E90 A;  3FY4 A;  4A1S A;  3APD A;  3HXC A;  1K8K G;  4FC8 A;  5B1B E;  5CMW A;  4ANV A;  3TWS A;  2OEW A;  2DYS E;  4XX5 A;  5CCL A;  4U0Z A;  3DXK G;  3CGH A;  2CHW A;  3CVP A;  3PUK A;  4Y6C A;  5ENR D;  4I17 A;  2VGX A;  3CIA A;  4CYM D;  2WXQ A;  3QDN A;  5G05 J;  4F1P A;  1IHG A;  2KCV A;  1D8E A;  2XGM A;  2IJG X;  1FT2 A;  1TNY A;  3D9L A;  5ENN A;  3DBS A;  2V0P A;  4BER A;  4MBG A;  5T8I A;  2Q7F A;  2Y4U A;  3AAA C;  2XHE A;  3Q47 B;  4B0Z A;  2GRQ B;  1O1T A;  4UWH A;  3TWQ A;  2RG8 A;  4I1M A;  5D2M C;  3RKV A;  4AOF A;  3PH0 C;  1TNZ A;  2B6C A;  3EUV A;  3ZNG A;  3UTM A;  3FFL A;  3SY2 A;  3FTV A;  3V79 K;  2R59 A;  3E34 A;  1OCZ E;  3CVV A;  4HI8 A;  4E85 A;  3G2V A;  2WXH A;  3J5P A;  1AWC B;  4AVX A;  3ML8 A;  4AJW A;  3RIB A;  4HB5 A;  1DC2 A;  3D9N A;  4QQI A;  4WWN A;  4GYW A;  5LCW J;  3UPV A;  2P9U G;  4J0U A;  2L0T B;  3FDH A;  3ZN3 A;  1QYM A;  2EIL E;  2QC9 A;  2X6I A;  5JMN D;  3CK7 A;  2R05 A;  4KXK B;  3JCK C;  3CVL A;  5BW8 C;  5AJL A;  1IXV A;  3Q7A A;  2LNI A;  3TGO A;  2RFM A;  3IHV A;  1H6K A; 
#chains in the Genus database with same CATH homology
 2ZGD A;  2XEH A;  3V31 A;  2XEE A;  3ZUV B;  3UI2 A;  2DVW A;  4CYM D;  2Y0B G;  4Z68 A;  5AQB A;  2DZN A;  2VGE A;  5KNG A;  4ZFH A;  1S70 B;  1BLX B;  4DUI A;  3KEA A;  3D9H A;  3DEP A;  5ENO D;  3NOG D;  1YCS B;  2L6B A;  2Y1L E;  3Q9U C;  4F1P A;  4BES A;  4HRL A;  2DZO A;  4DX2 A;  1BU9 A;  4K5A B;  1MX2 A;  3B95 A;  4U95 D;  3SO8 A;  1UOH A;  2P2C P;  3TWW A;  4HRN A;  3TWX A;  5JA4 D;  3C5R A;  1MYO A;  4YDY A;  3UXG A;  4O1P A;  4QFV A;  4C48 B;  4LG6 A;  3HRA A;  4BER A;  2JAB A;  4HI9 A;  1SW6 A;  4U8Y D;  1BI8 B;  4NIK A;  2MYO A;  4J8Y A;  5FIO A;  4CZ2 D;  3AAA C;  3W9G A;  5CBO A;  4K5C A;  4LSZ E;  3IXE A;  2F37 A;  1OY3 D;  5ENP D;  1A5E A;  1BI7 B;  2AJA A;  5KWD A;  4UUC A;  3TWU A;  1MX4 A;  3B7B A;  3Q9N C;  1OT8 A;  2XZT G;  4ZHB A;  3LJN A;  2A5E A;  3JXJ A;  5FIN A;  4GPM A;  3TWQ A;  5EIL A;  3JUE A;  5ENS D;  3V30 A;  5BXU A;  4DX1 A;  5ENT D;  3AJI A;  3T8K A;  4JB8 P;  3EU9 A;  3TWT A;  5EID A;  3J5Q B;  2KXP C;  3ZU7 B;  4A63 B;  3ZNG A;  4G8K A;  4O1O A;  5CER B;  5AQ7 A;  1D9S A;  2NYJ A;  3UTM A;  5AAO A;  1DCQ A;  5HRY A;  3NBN B;  4G8L A;  2KBX A;  1WG0 A;  5BXO A;  3V79 K;  2F8Y A;  1BD8 A;  5AQA A;  4HI8 A;  3V2X A;  1K3Z D;  4HRM B;  2J8S D;  2F8X K;  3J5P A;  1N0R A;  3DEO A;  1AWC B;  2B0O E;  3T9K A;  1WDY A;  2HE0 A;  5AQ9 A;  4LNU D;  3TWV A;  1K1B A;  1N0Q A;  2ETB A;  4DX6 D;  2XEN A;  5CEC B;  4HB5 A;  2ETA A;  3NOC D;  5CED B;  1G3N B;  1IHB A;  1YYH A;  3F6Q A;  5EN5 D;  5CBN A;  3EHR A;  4DRX E;  4OAV B;  4DX5 D;  4DX7 D;  1YMP A;  2V5Q C;  1DC2 A;  2ETC A;  4QQI A;  4ATZ D;  4U96 D;  3V2O A;  2BKG A;  3W9F A;  3TWR A;  4O60 A;  5AAR A;  5EYL A;  5CEA A;  1NFI E;  1AP7 A;  1SVX A;  4YDW A;  5EYP F;  4B93 B;  4BET A;  5ITZ F;  4TUM A;  2V4H C;  3ZKJ A;  1QYM A;  2QC9 A;  4HQD A;  1IKN D;  4HNA D;  4GMR A;  5JMN D;  3TWS A;  2RFA A;  1N11 A;  3JXI A;  4K5B A;  2ZGG A;  4BEP A;  4J7W A;  2PNN A;  3HG0 D;  5D66 A;  5AN8 A;  4HBD A;  5HS0 A;  5KNH D;  5EIB E;  1K1A A;  4BSZ B;  1MJ0 A;  4OAU C;  5KBA A;  4N5Q A;  4RLY A;  4HLL A;  4U8V D;  5HKP A;  1IXV A;  1TR4 A;  2BKK B;  5ENQ D;  2FO1 E;  2DWZ A;  1MX6 A;  2RFM A;  2XZD G;  3EHQ A;  5ENR D;  2QYJ A;  4F6R D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...