4U95D

Coupling of remote alternating-access transport mechanisms for protons and substrates in the multidrug efflux pump acrb
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
156
structure length
156
Chain Sequence
GSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug efflux pump subunit AcrB
publication title Coupling of remote alternating-access transport mechanisms for protons and substrates in the multidrug efflux pump AcrB
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 53
structure length 156
sequence length 156
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4u95D00
4DX2A 2VGEA 4G8LA 2B0OE 1IHBA 5EIBE 4GPMA 2XENA 1N0RA 1IXVA 4J8YA 5AQ7A 2BKGA 1MX2A 2PNNA 3KEAA 3EU9A 4N5QA 4HLLA 4U96D 3DEOA 4U95D 1OY3D 2J8SD 4NIKA 3B95A 4HRMB 4YDWA 5HS0A 3T8KA 1N0QA 1SW6A 3V79K 5JMND 2V4HC 2KBXA 1AWCB 2ETCA 1AP7A 3NOCD 5CECB 1K1BA 2A5EA 3IXEA 3TWUA 5KWDA 5AQBA 4HRNA 4O1PA 3TWRA 3W9FA 5KNGA 5EYPF 3B7BA 4HBDA 4HI8A 2ZGDA 1WDYA 5EIDA 3V2OA 3J5PA 2DZOA 3TWXA 1TR4A 4DX6D 4HNAD 4J7WA 3UXGA 1K1AA 3HRAA 3ZKJA 5CBNA 2BKKB 2QC9A 2DZNA 3T9KA 5CEAA 5BXUA 3DEPA 4ZFHA 5FIOA 4LG6A 5ENOD 3JXIA 4CYMD 1UOHA 3W9GA 4B93B 3V31A 4HB5A 3JXJA 4QFVA 2XEHA 2XZDG 5EYLA 5ENRD 3ZU7B 4K5CA 4BESA 2ETBA 4LNUD 1MX6A 3AJIA 4F6RD 2DWZA 2KXPC 5JA4D 1OT8A 2NYJA 5ITZF 5EILA 1IKND 2L6BA 1N11A 2HE0A 2ZGGA 1D9SA 4YDYA 3Q9UC 3NOGD 4BETA 2MYOA 3D9HA 4K5AB 1YMPA 5AN8A 3ZNGA 4DX7D 3C5RA 2P2CP 3NBNB 2FO1E 2QYJA 4K5BA 1G3NB 3TWTA 5HKPA 4O1OA 1DCQA 4F1PA 1BU9A 3TWSA 5ENPD 2JABA 2Y1LE 3LJNA 2RFAA 3ZUVB 3UTMA 1DC2A 2RFMA 4JB8P 4O60A 4ATZD 1NFIE 4U8VD 2XEEA 1K3ZD 1BI8B 4U8YD 1S70B 3Q9NC 4RLYA 5ENSD 4OAVB 5FINA 1MX4A 4A63B 2F8YA 4BERA 3J5QB 1MJ0A 4Z68A 5CERB 4BSZB 5CEDB 5BXOA 2ETAA 2DVWA 4BEPA 3AAAC 5ENQD 5AQAA 3EHQA 2Y0BG 2XZTG 3JUEA 2F37A 4HI9A 4DUIA 5AQ9A 4OAUC 1BLXB 4TUMA 5D66A 3F6QA 4GMRA 1YYHA 4LSZE 4UUCA 5EN5D 1MYOA 3UI2A 5KBAA 5CBOA 1WG0A 2V5QC 4CZ2D 4QQIA 3V30A 3TWVA 4G8KA 1BD8A 5HRYA 1BI7B 4DX1A 5ENTD 1YCSB 4DX5D 5AARA 4HQDA 4HRLA 1SVXA 4DRXE 3SO8A 1QYMA 5AAOA 4ZHBA 3HG0D 3TWQA 1A5EA 3EHRA 3TWWA 2F8XK 4C48B 5KNHD 3V2XA 2AJAA
chains in the Genus database with same CATH superfamily
3LEWA 2AXVA 3D9KA 4KVMA 1N4QA 3SF4A 4KVOA 2J8SD 4HRMB 1TJCA 3MEKA 2GRLA 2EQXA 2I1JA 3DSVA 4HRNA 3TWRA 3W9FA 4NACA 4ABNA 2YINA 2F0YA 1TNUA 3PE4A 2OOEA 3T9KA 4BSXA 4P29A 4UI9K 3JXIA 1XGWA 3SBTB 5A6CA 1KT0A 2WXQA 4G24A 3KAEA 5KCMA 4K5CA 4FHJA 3WXXA 2LXMA 2XHEA 2P9NG 1V54E 4AV7A 2WXJA 2WXPA 5LFAA 3PE3A 3QJZA 3Q78A 1LD8A 2LSUA 1MHQA 1ELWA 3TWTA 4APFA 3ESLA 4W9RA 1HE8A 2JABA 3FU0A 1N95A 5IY5E 4YNDA 3S7JA 3FUIA 2ETAA 5FT9A 1S63A 3ZXPA 3B7UX 4RSYA 2RG8A 4OYSA 4U0ZA 5D66A 3F6QA 4G25A 3ZIMA 3E30A 4LSZE 1HZ4A 4LCTA 4JHKA 3ESKA 5LOZA 3KSQA 3IBEA 4ZHBA 3D9MA 1JCQA 1RW2A 3HDXA 1E8XA 2VGEA 1B89A 5AIJA 4U95D 3DEOA 3NZSA 4J6IA 2WXLA 2CHZA 5FZSA 4B8AA 3P2BA 1GW6A 2XS8A 1AWCB 3LYAA 3MKQA 5CCMA 3FEYA 4EZJA 4BTAA 3KSLA 3PEUB 2FF4A 3AS5A 1OXJA 3ZKJA 2UY1A 3JQ0A 3SBSA 3E4BA 2IFUA 4CDNA 4ZFHA 5ENOD 3FULA 3ABKE 4J0UA 3OAWA 4TUUA 3MCXA 5JA4D 3RK6A 3UT8A 3QARA 3CGHA 2BTDA 3Q9UC 3CEQA 3Q7FA 2AWIA 4G23A 2XCCA 3CQCB 3BUAA 5G05J 1S64A 4BY6A 2VTBB 1DC2A 5AJLA 1WAO1 3G2TA 4PS3A 3FDHA 3PZ4A 3Q4AB 1S70B 3R9MA 3AG2E 1MJ0A 3SY2A 4U0SA 1ZBPA 4WUYA 3FY4A 5BNWA 4KZCA 1YYHA 5J08A 3ASNE 3OXFA 3ZRHA 4M3OA 4G8KA 5T8IA 2R05A 2QY7A 3GW4A 4D10C 4GCOA 4UQYA 2H6IA 4XEIG 3HHMA 2AVPA 3FTSA 4JC8A 3MX3A 4GAAA 4I2ZA 4YDWA 4I9EA 4BT9A 4Q96A 4N2SA 4JHRA 4LNGA 4XIFA 2UWJG 4KMOA 1K1BA 2WQHA 3TWUA 5LCWC 5EYPF 3B7BA 2JEKA 5FIOA 1H6PA 2A5UA 3I4RB 3L16A 2ILRA 4N3AA 3LY8A 4LNBA 4BESA 2OCCE 4IN3B 2Q7FA 2VSYA 2HR2A 4J8SA 5CRUA 1EYHA 5T3RA 4GCNA 1HFAA 3CIAA 3PREA 2KC7A 3UINC 3ULEG 1H2UA 3TWSA 2X3MA 4LRZA 3CKCA 3FUHA 4O60A 1BI8B 4L7TA 2L0IA 3AG4E 4BERA 4FA6A 2X38A 4TXRA 3TAXA 4AY6A 3FU5A 3CHOA 3Q5MA 1TNYA 1JCRA 2L0TB 4PH4B 4OAUC 2CHWA 3MZLB 5ANRA 2L9BA 3IHYA 5AARA 3MV3B 4AXHA 3RAUA 4HRLA 5EKQD 1A5EA 3TWQA 4Q94A 1PY1A 1OCOE 2P9PG 4DX2A 4TXPA 3CK9A 2J07A 3DSSA 5EIBE 4GPMA 1N0RA 5AQ7A 5G04C 2PNNA 3DRAA 1OY3D 4ACLA 1H2VC 1WM5A 3ZYLA 5HI7A 3SFYA 2OVBA 1KZOA 2WXNA 2L6JA 1E7UA 1KT1A 4FLBA 4N39A 4GYOA 3HRAA 1V55E 3L22A 2HM8A 2QC9A 4GZDA 4U7EB 2R5SA 4LG6A 3UM0A 1H6KA 4HB5A 3UKUG 5LX8A 2VTBA 3LKUA 1FCHA 1QBQA 2NYJA 3RRMB 5ITZF 1ELRA 5EILA 4IRUA 4KZ0A 4ACKA 2M63A 4FU3A 3CVLA 4NRHB 4HOTA 5G04J 4UWHA 3NBNB 2WXKA 2P58C 3CHMA 4DPRA 5A7DB 4TV3A 1NP7A 1NA3A 3FTYA 4XZ4A 4K03A 1Y6IA 2R2LA 4RVBA 2H6HA 2JLBA 5H7PA 3FU6A 4U8HA 4X8QA 4DLQA 1MZCA 2WXGA 3EDTB 1O5MA 3JUEA 1E8WA 3PEVB 1U3DA 2KM4A 2R03A 3NB2A 4AVXA 3CK7A 3ZVVA 4DRXE 1TN7A 4MS6A 5EX0A 5C2YA 4GMJA 1LTXA 3D9OA 2C0LA 2VGYA 2VYIA 4WWOA 4A1GA 4GB9A 1IXVA 2BKGA 4ANVA 3ASHA 4J8EA 1FVFA 3DSTA 3T8KA 3ULQA 5E76A 1SW6A 3C3QA 3CVWA 5E75A 5KWDA 4HOUA 2IF4A 3ZEFA 4NURA 4GZCA 4YDOA 3B7TA 2PQRA 4I43A 3FUEA 4I6EA 3FUFA 4E6HA 2I2OA 4ANWA 3DBSA 2ETBA 2ZU6B 4EBAA 5D2MC 4BFRA 3UT4A 3FTVA 1NZNA 3T8MA 1H6OA 1YMPA 1OCZE 2VQ2A 4DX7D 2XGSA 2XEVA 3CVYA 5ENPD 3SI5A 4A3VA 3UTMA 1LD7A 3D9NA 5CERB 2WXFA 4UQZA 4NQ0A 4MBGA 2XGMA 4WNDA 5KBAA 2VGXB 2OVFA 1TNZA 3DPYA 2J49A 4C0MA 1Z3XA 2Y4UA 4CGWA 4MLPA 4YDEA 3BEEA 4EZLA 3TGOA 1MX2A 3KEAA 2X6JA 4GZ6A 1IQUA 3ZYKA 5LP0A 1HS6A 3DPDA 4GTQA 4JZYA 4EQFA 2IONA 3HXDA 5JHAA 3ONLA 1XNFA 4DK5A 1WDYA 3AU5A 4XE0A 3V2OA 4L1BA 4U0UA 3FP3A 4GYWA 4ANXA 1N9AA 4JA9A 4CYMD 4TRQA 4F7AA 4C0EA 3PZ3A 2WPVA 3FUKA 2DIWA 3Q15A 3CHQA 5JJTA 1O1SA 3APFA 4JD2G 4BX8A 2V4LA 4JPSA 1OWNA 1OWLA 2MRIA 3ZN3A 3PDNA 4XX5A 3S7FA 5JJ7A 2LAHA 4GTRA 1S0PA 2GRPB 1TEZA 3LY9A 1H19A 4HI9A 1L5JA 3UUXA 3C3RA 3C72A 1N4RA 2LUHA 4I17A 3LY7A 1IQRA 4QQIA 4YVQC 5C1DA 5ENTD 2Y4TA 3DSUA 3HVEA 1N52A 1N54A 4XI0A 3ISMC 2DYSE 1KPSB 1UG3A 4JVSA 4GTVA 4HOQA 4FJZA 3ABME 2NC9A 3ZYMA 2V4HC 3FTZA 3FUDA 1OUVA 3D9JA 2R17C 3UM3A 1UW4B 2QYUA 3CHPA 3UXGA 2R02A 3U66A 2ZIRA 2E0IA 3OTNA 4O6FA 2HYZA 2YNQA 2P9KG 2ZXWE 3G2VA 2WM9A 5G05C 5HQ8A 4JEUA 1N11A 2HE0A 4U63A 1X81A 3CVQA 3NF1A 4UWKA 2FO1E 3C5RA 4K5BA 3ZPJA 2CFZA 2QZAA 1HU3A 2VGXA 3FH7A 4YVOA 5AJDA 3LJNA 4CT4A 2RFMA 4L2LA 3VLEA 1NFIE 4JXTA 4B94A 4Y6CA 3O48A 2FULA 4BSZB 5FZQA 1IYGA 3EHQA 2FBNA 3QWPA 4N3BA 3TXNA 1MYOA 3LS8A 3RRUA 3UKRG 2E2EA 3V30A 3K9IA 1HG2A 4DX5D 4I1AA 4GA2A 3BG1B 4CCAA 1SVXA 1Q2ZA 2IEJA 3ASFA 4U04A 3ZFWA 3V2XA 4G8LA 3UPVA 3ZXSA 4N3CA 2Y3AA 2GRQB 5HS0A 4L23A 4PUCA 4EPZA 2EIKE 3ML8A 2YHCA 3KS2A 5AQBA 3X2QE 3HIZA 5FQ4A 1YA0A 2C2LA 3QDNA 2PM6A 3ENEA 3MYVA 3OXLA 3V31A 3CQGB 3ZU7B 1MX6A 1E8YA 3HXBA 3E34A 4DJAA 2WQ6A 2C0MA 3WG7E 2ZGGA 3VTXA 3D9HA 1HH8A 4AM9A 1N94A 4FC8A 2Y1LE 3TG5A 2PL2A 3CVXA 2VSXE 2XEEA 4U8YD 4RLYA 1DVPA 4ATGA 2XS1A 1MX4A 4A63B 3R7RA 4WNEA 3U64A 1BPOA 4BEPA 3FTUA 2AW6A 4DI3A 4PDXA 4UI9J 3APDA 5DBKA 3RKVA 4DX1A 3U9WA 3D9LA 3B7SA 2F8XK 4GU5A 3PNLB 5KJNA 4G2VA 5JMND 2GW1A 1DCEA 2WXIA 3ASOE 2AXZA 4GMLA 2DYRE 3DXMG 3APCA 1TNBA 1A17A 4HNAD 4LERA 2GGFA 5FZRA 3SHFA 2MHKA 1IHGA 5EX3A 4QFVA 2XZDG 1U2VG 4K0RA 2YQ8A 4UQXA 4B89A 3ZW3A 4BTBA 4R7LA 3QK0A 4OVVA 2KXPC 2GRNB 1OT8A 3GZSA 3CVUA 4I2WA 4F3VA 2MYOA 4K5AB 3JYSA 4O1OA 5B1BE 2QFCA 1E7VA 2BUGA 4FADA 3E32A 4RG6A 3T5XA 3UIPC 5ARGA 3L17A 3E33A 3LCAA 3Q9NC 3FUJA 2F8YA 2KCLA 2RKKA 5BXOA 2EILE 3I3NA 2J08A 3SNXA 4GMRA 4UUCA 2OEWA 5CBOA 1JCSA 2LNIA 3TWVA 5HRYA 1X5BA 4I9CA 2GRRB 5ANLA 3L9TA 2PQNA 4AEZC 2P9IG 3TXMA 3FFLA 2XENA 3CLJA 4FJYA 4HLLA 1UJKA 3S2AA 4NIKA 2R59A 5AYWD 2KBXA 3RRNB 1HG5A 3RJVA 1OWPA 3TWXA 4HORA 4TXQA 4AJWA 3GZ2A 5BXUA 3TJPA 1ZB1A 3EJNA 3W9GA 4CT0A 4J8DA 4JHJA 3BQOA 1SA4A 5FQ6A 3HXCA 3CVNA 1D8EA 5BUZA 1D9SA 3Q75A 5G55A 5CMYA 4B8CB 5CRVA 5HKPA 1OWOA 1DCQA 3CK8A 1UN8A 4H7YA 3OXGA 1HXIA 4V3IA 2X6KA 2DCPA 2PM7A 2CG3A 4FP7A 4AY5A 4RQIA 4TUMA 3LPZA 5EN5D 1WG0A 3R7QA 3EIQC 4CZ2D 1HO8A 1BD8A 3UT7A 1BI7B 4EBAG 1E96B 4GYYA 1P5QA 3ZHEB 1Y8MA 3EHRA 4ANUA 2AJAA 1EF1C 2IQCA 4M7CA 2EIME 2XPIA 5AENA 3CSTA 4CEMA 1QZ2A 4Y6WA 1NL4A 3C3OA 3QAQA 3NOCD 1TNOA 1EPUA 4LEUA 4XKBA 4J7WA 1O1RA 3AS8A 2I6HA 2X6HA 3DEPA 2LO6A 4A1SA 1NI1A 2WMNA 3CHRA 5ENRD 4AIFA 5DIZA 1TYQG 4BT8A 3ZGQA 2B6CA 3NOGD 4BETA 3QNKA 5AN8A 3MJWA 3NZUA 4WAFA 4GZ5A 5BV1A 4F1PA 4HLEA 4GTMA 5CHEE 4GZ3A 4JB8P 3KD7A 2WXHA 1K3ZD 3HXFA 2XCBA 3PZ1A 2J4BA 4KT6B 5T4YA 3GZ1A 4KYOB 2CHXA 3U3WA 2XZTG 3IHVA 4WWPA 1BLXB 2WXMA 3UI2A 3KEZA 3VTYA 4DLOA 2GRMA 4FLHA 1JWGA 3ONKA 3BG0B 1KZPA 4N5CA 4A3TA 5KNHD 4GPKA 5EDSA 2XRZA 2LXLA 4J8YA 4APOA 1SA5A 3CHSA 3C98A 2AXUA 5KJKA 2IY0C 3B7RL 3RU0A 5CECB 2P9LG 5FQ8A 3FTWA 5B3SE 4GA1A 1TR4A 4EZKA 1K1AA 5CBNA 2KCVA 2DZNA 5CEAA 4N2QA 1UOHA 4B93B 2XEHA 3QWVA 4J8FA 4HXIA 2EINE 4LNUD 5B1AE 3O4ZA 1QQEA 4JW1A 4F6RD 3FH5A 1FVHA 2DWZA 2KCKA 4U07A 4A55A 1E90A 3AU4A 4C9BB 4H7XA 4L9PA 1FT1A 3ZNGA 2QYJA 5BPPA 3EHMA 4GTSA 2RFAA 3DSXA 4ATZD 2WMOA 5FQ7A 3DSWA 5FINA 5JJ6A 3ZHEA 4G26A 4F1SA 1K8KG 1FPPA 4G11A 2DVWA 4UWLA 2Y0BG 4G1TA 4DUIA 5JHBA 1TN8A 3PUKA 1Z6TA 1VDYA 3IKOB 4KBQA 3MV2B 3IV0A 4HQDA 3Q73A 3E37A 3RO3A 2IO2C 5BV0A 2GROB 3TWWA 4C48B 1HF8A 2V8SE 4HS2A 4U96D 5D0OD 2P9SG 3N71A 3LVRE 2ETCA 2FO7A 3LJ3A 1SQMA 3EUVA 4HBDA 4HI8A 3RSEG 5EIDA 2DZOA 3PNTB 4URKA 3G2WA 2HO1A 3EU5A 4FULA 2H6GA 3JXJA 4RG9A 4PS8A 2MOWA 4IYPA 2XGOA 3RIBA 3AG1E 2IJGX 3G2SA 2IOLA 3G2UA 3DXKG 1SZ9A 2L6BA 2WVIA 4BWRA 4I6GA 3S7BA 1Z3YA 3Q79A 1G3NB 2XPZA 3FWVA 4IULA 3ZUVB 3EHNA 4UI9C 4CDRA 2KZTB 3FHEA 3NQPA 5A23A 3I4GA 3J5QB 4WWNA 4XI9A 4FHKA 2F37A 5CCLA 3FUNA 2WXOA 3ZYQA 2YHEA 4DI4A 1W3BA 3I5PA 3NAWA 4F53A 2NXPA 3SO8A 4AP2A 5FJYA 2EIJE 4HVBA 2VSNA 3VLDA 1WY6A 3EU9A 3P1UA 3L54A 3AG3E 1TJFA 3FU3A 3L82A 4Q69A 1N0QA 5KJLA 4JEHA 4E85A 5G2NA 3HYMB 1UN9A 3QKYA 4ILHB 3GYZA 3L6AA 1SZAA 4JL0A 3CKBA 1FT2A 3DWLG 3T5VA 4CGVA 3D9PA 5FWQA 5BW8C 3CR3A 4CRWA 4ME2A 3AJIA 5LCWJ 3PZDA 3CV0A 1JUQA 1IKND 4LUNU 3LDZA 3Q7AA 3FH8A 4JA7A 2P2CP 2V5FA 3SZ7A 3JUIA 2OV8A 3PS6A 2XPYA 3EIJA 4U8VD 2V0PA 5J90A 1EDUA 2P9UG 3PH0C 5ENSD 2VSOE 3QWWA 2XRYA 4OVUA 2XQ0A 1OCRE 5AQ9A 3L13A 3L08A 2FEZA 3ML9A 3VLFA 3JQ1A 2FI7A 3CVPA 3UIOC 4XKCA 1KLXA 1MQSA 2J09A 5BT1A 5AAOA 1ZU2A 3ASDA 1IHBA 3TL5A 5ARFA 3Q49B 1Z5SC 3PUJA 1QNFA 3V79K 4L2YA 1AP7A 2VJ8A 2A5EA 4O1PA 4UWFA 3UM1A 2WQ7A 1D8DA 3UMVA 5M72A 4PS7A 4BX9A 4HOSA 3URZA 1INZA 2BF0X 2J9QA 2KATA 5EYLA 1OWMA 4MKTA 2X6FA 2KZTA 4I1MA 2IOSA 5ENNA 4WNFA 4UWGA 4YDYA 1JWFA 4ILGA 3RO2A 1BU9A 3SQVA 2IU1A 2DBAA 1PAQA 2X6IA 4GA0A 3ABLE 4OAVB 3UQ3A 3MKRA 3PZ2A 5CEDB 3UX4A 1N4SA 4GTOA 3AAAC 3LXUX 5AQAA 1OCCE 2ONDA 1N4PA 3S7DA 1UJJA 3D9IA 2BEDA 1H0AA 4EECA 3HVEB 3AS4A 4KXKB 2H6FA 1NA0A 1QYMA 2CG2A 4WNGA 2CFUA 5CMWA 1RZ4A 2B0OE 3PRZA 4N5QA 4GTTA 3B95A 3D3MA 3BU8A 3MGBA 3B13A 3IXEA 2WB2A 5KNGA 2ZGDA 3ULYA 3J5PA 4DX6D 3QC1A 2RD0A 3SGHA 5D0QD 3JCKC 2BKKB 1E8ZA 4AOFA 1PC2A 2J4DA 3R9AB 4I1OB 1JPLA 4ILIA 3CVVA 5FTPA 3CSFA 1O1TA 3FTXA 3MKQB 5KJMA 4I6JA 4HFGA 1DNPA 3QB2A 4B0ZA 1U3CA 3LVQE 2PZIA 2UY1B 2I1KA 3ASGA 2LSVA 2A4ZA 3SD5A 3SFXA 3UM2A 4GTPA 1ELKA 2WXRA 1LF8A 2I9CA 3TG4A 3SFZA 2ZISA 4Z68A 2Y69E 3FEXA 3IEGA 5ENQD 3U4TA 3MA5A 2OEVA 4CDMA 4EHMA 3QOUA 3FUMA 1TN6A 3PVLA 2NSZA 2V5QC 3Q47B 2IO3C 1YCSB 3HXEA 1H2TC 2LAIA 3HG0D 4MRUA 1HX8A
chains in the Genus database with same CATH topology
4DX2A 2VGEA 4G8LA 2B0OE 1IHBA 5EIBE 4GPMA 2XENA 1N0RA 1IXVA 4J8YA 5AQ7A 2BKGA 1MX2A 2PNNA 3KEAA 3EU9A 4N5QA 4HLLA 4U96D 3DEOA 4U95D 1OY3D 2J8SD 4NIKA 3B95A 4HRMB 4YDWA 5HS0A 3T8KA 1N0QA 1SW6A 3V79K 5JMND 2V4HC 2KBXA 1AWCB 2ETCA 1AP7A 3NOCD 5CECB 1K1BA 2A5EA 3IXEA 3TWUA 5KWDA 5AQBA 4HRNA 4O1PA 3TWRA 3W9FA 5KNGA 5EYPF 3B7BA 4HBDA 4HI8A 2ZGDA 1WDYA 5EIDA 3V2OA 3J5PA 2DZOA 3TWXA 1TR4A 4DX6D 4HNAD 4J7WA 3UXGA 1K1AA 3HRAA 3ZKJA 5CBNA 2BKKB 2QC9A 2DZNA 3T9KA 5CEAA 5BXUA 3DEPA 4ZFHA 5FIOA 4LG6A 5ENOD 3JXIA 4CYMD 1UOHA 3W9GA 4B93B 3V31A 4HB5A 3JXJA 4QFVA 2XEHA 2XZDG 5EYLA 5ENRD 3ZU7B 4K5CA 4BESA 2ETBA 4LNUD 1MX6A 3AJIA 4F6RD 2DWZA 2KXPC 5JA4D 1OT8A 2NYJA 5ITZF 5EILA 1IKND 2L6BA 1N11A 2HE0A 2ZGGA 1D9SA 4YDYA 3Q9UC 3NOGD 4BETA 2MYOA 3D9HA 4K5AB 1YMPA 5AN8A 3ZNGA 4DX7D 3C5RA 2P2CP 3NBNB 2FO1E 2QYJA 4K5BA 1G3NB 3TWTA 5HKPA 4O1OA 1DCQA 4F1PA 1BU9A 3TWSA 5ENPD 2JABA 2Y1LE 3LJNA 2RFAA 3ZUVB 3UTMA 1DC2A 2RFMA 4JB8P 4O60A 4ATZD 1NFIE 4U8VD 2XEEA 1K3ZD 1BI8B 4U8YD 1S70B 3Q9NC 4RLYA 5ENSD 4OAVB 5FINA 1MX4A 4A63B 2F8YA 4BERA 3J5QB 1MJ0A 4Z68A 5CERB 4BSZB 5CEDB 5BXOA 2ETAA 2DVWA 4BEPA 3AAAC 5ENQD 5AQAA 3EHQA 2Y0BG 2XZTG 3JUEA 2F37A 4HI9A 4DUIA 5AQ9A 4OAUC 1BLXB 4TUMA 5D66A 3F6QA 4GMRA 1YYHA 4LSZE 4UUCA 5EN5D 1MYOA 3UI2A 5KBAA 5CBOA 1WG0A 2V5QC 4CZ2D 4QQIA 3V30A 3TWVA 4G8KA 1BD8A 5HRYA 1BI7B 4DX1A 5ENTD 1YCSB 4DX5D 5AARA 4HQDA 4HRLA 1SVXA 4DRXE 3SO8A 1QYMA 5AAOA 4ZHBA 3HG0D 3TWQA 1A5EA 3EHRA 3TWWA 2F8XK 4C48B 5KNHD 3V2XA 2AJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DX2 A;  2VGE A;  4G8L A;  2B0O E;  1IHB A;  5EIB E;  4GPM A;  2XEN A;  1N0R A;  1IXV A;  4J8Y A;  5AQ7 A;  2BKG A;  1MX2 A;  2PNN A;  3KEA A;  3EU9 A;  4N5Q A;  4HLL A;  4U96 D;  3DEO A;  4U95 D;  1OY3 D;  2J8S D;  4NIK A;  3B95 A;  4HRM B;  4YDW A;  5HS0 A;  3T8K A;  1N0Q A;  1SW6 A;  3V79 K;  5JMN D;  2V4H C;  2KBX A;  1AWC B;  2ETC A;  1AP7 A;  3NOC D;  5CEC B;  1K1B A;  2A5E A;  3IXE A;  3TWU A;  5KWD A;  5AQB A;  4HRN A;  4O1P A;  3TWR A;  3W9F A;  5KNG A;  5EYP F;  3B7B A;  4HBD A;  4HI8 A;  2ZGD A;  1WDY A;  5EID A;  3V2O A;  3J5P A;  2DZO A;  3TWX A;  1TR4 A;  4DX6 D;  4HNA D;  4J7W A;  3UXG A;  1K1A A;  3HRA A;  3ZKJ A;  5CBN A;  2BKK B;  2QC9 A;  2DZN A;  3T9K A;  5CEA A;  5BXU A;  3DEP A;  4ZFH A;  5FIO A;  4LG6 A;  5ENO D;  3JXI A;  4CYM D;  1UOH A;  3W9G A;  4B93 B;  3V31 A;  4HB5 A;  3JXJ A;  4QFV A;  2XEH A;  2XZD G;  5EYL A;  5ENR D;  3ZU7 B;  4K5C A;  4BES A;  2ETB A;  4LNU D;  1MX6 A;  3AJI A;  4F6R D;  2DWZ A;  2KXP C;  5JA4 D;  1OT8 A;  2NYJ A;  5ITZ F;  5EIL A;  1IKN D;  2L6B A;  1N11 A;  2HE0 A;  2ZGG A;  1D9S A;  4YDY A;  3Q9U C;  3NOG D;  4BET A;  2MYO A;  3D9H A;  4K5A B;  1YMP A;  5AN8 A;  3ZNG A;  4DX7 D;  3C5R A;  2P2C P;  3NBN B;  2FO1 E;  2QYJ A;  4K5B A;  1G3N B;  3TWT A;  5HKP A;  4O1O A;  1DCQ A;  4F1P A;  1BU9 A;  3TWS A;  5ENP D;  2JAB A;  2Y1L E;  3LJN A;  2RFA A;  3ZUV B;  3UTM A;  1DC2 A;  2RFM A;  4JB8 P;  4O60 A;  4ATZ D;  1NFI E;  4U8V D;  2XEE A;  1K3Z D;  1BI8 B;  4U8Y D;  1S70 B;  3Q9N C;  4RLY A;  5ENS D;  4OAV B;  5FIN A;  1MX4 A;  4A63 B;  2F8Y A;  4BER A;  3J5Q B;  1MJ0 A;  4Z68 A;  5CER B;  4BSZ B;  5CED B;  5BXO A;  2ETA A;  2DVW A;  4BEP A;  3AAA C;  5ENQ D;  5AQA A;  3EHQ A;  2Y0B G;  2XZT G;  3JUE A;  2F37 A;  4HI9 A;  4DUI A;  5AQ9 A;  4OAU C;  1BLX B;  4TUM A;  5D66 A;  3F6Q A;  4GMR A;  1YYH A;  4LSZ E;  4UUC A;  5EN5 D;  1MYO A;  3UI2 A;  5KBA A;  5CBO A;  1WG0 A;  2V5Q C;  4CZ2 D;  4QQI A;  3V30 A;  3TWV A;  4G8K A;  1BD8 A;  5HRY A;  1BI7 B;  4DX1 A;  5ENT D;  1YCS B;  4DX5 D;  5AAR A;  4HQD A;  4HRL A;  1SVX A;  4DRX E;  3SO8 A;  1QYM A;  5AAO A;  4ZHB A;  3HG0 D;  3TWQ A;  1A5E A;  3EHR A;  3TWW A;  2F8X K;  4C48 B;  5KNH D;  3V2X A;  2AJA A; 
#chains in the Genus database with same CATH topology
 3LEW A;  2AXV A;  3D9K A;  4KVM A;  1N4Q A;  3SF4 A;  4KVO A;  2J8S D;  4HRM B;  1TJC A;  3MEK A;  2GRL A;  2EQX A;  2I1J A;  3DSV A;  4HRN A;  3TWR A;  3W9F A;  4NAC A;  4ABN A;  2YIN A;  2F0Y A;  1TNU A;  3PE4 A;  2OOE A;  3T9K A;  4BSX A;  4P29 A;  4UI9 K;  3JXI A;  1XGW A;  3SBT B;  5A6C A;  1KT0 A;  2WXQ A;  4G24 A;  3KAE A;  5KCM A;  4K5C A;  4FHJ A;  3WXX A;  2LXM A;  2XHE A;  2P9N G;  1V54 E;  4AV7 A;  2WXJ A;  2WXP A;  5LFA A;  3PE3 A;  3QJZ A;  3Q78 A;  1LD8 A;  2LSU A;  1MHQ A;  1ELW A;  3TWT A;  4APF A;  3ESL A;  4W9R A;  1HE8 A;  2JAB A;  3FU0 A;  1N95 A;  5IY5 E;  4YND A;  3S7J A;  3FUI A;  2ETA A;  5FT9 A;  1S63 A;  3ZXP A;  3B7U X;  4RSY A;  2RG8 A;  4OYS A;  4U0Z A;  5D66 A;  3F6Q A;  4G25 A;  3ZIM A;  3E30 A;  4LSZ E;  1HZ4 A;  4LCT A;  4JHK A;  3ESK A;  5LOZ A;  3KSQ A;  3IBE A;  4ZHB A;  3D9M A;  1JCQ A;  1RW2 A;  3HDX A;  1E8X A;  2VGE A;  1B89 A;  5AIJ A;  4U95 D;  3DEO A;  3NZS A;  4J6I A;  2WXL A;  2CHZ A;  5FZS A;  4B8A A;  3P2B A;  1GW6 A;  2XS8 A;  1AWC B;  3LYA A;  3MKQ A;  5CCM A;  3FEY A;  4EZJ A;  4BTA A;  3KSL A;  3PEU B;  2FF4 A;  3AS5 A;  1OXJ A;  3ZKJ A;  2UY1 A;  3JQ0 A;  3SBS A;  3E4B A;  2IFU A;  4CDN A;  4ZFH A;  5ENO D;  3FUL A;  3ABK E;  4J0U A;  3OAW A;  4TUU A;  3MCX A;  5JA4 D;  3RK6 A;  3UT8 A;  3QAR A;  3CGH A;  2BTD A;  3Q9U C;  3CEQ A;  3Q7F A;  2AWI A;  4G23 A;  2XCC A;  3CQC B;  3BUA A;  5G05 J;  1S64 A;  4BY6 A;  2VTB B;  1DC2 A;  5AJL A;  1WAO 1;  3G2T A;  4PS3 A;  3FDH A;  3PZ4 A;  3Q4A B;  1S70 B;  3R9M A;  3AG2 E;  1MJ0 A;  3SY2 A;  4U0S A;  1ZBP A;  4WUY A;  3FY4 A;  5BNW A;  4KZC A;  1YYH A;  5J08 A;  3ASN E;  3OXF A;  3ZRH A;  4M3O A;  4G8K A;  5T8I A;  2R05 A;  2QY7 A;  3GW4 A;  4D10 C;  4GCO A;  4UQY A;  2H6I A;  4XEI G;  3HHM A;  2AVP A;  3FTS A;  4JC8 A;  3MX3 A;  4GAA A;  4I2Z A;  4YDW A;  4I9E A;  4BT9 A;  4Q96 A;  4N2S A;  4JHR A;  4LNG A;  4XIF A;  2UWJ G;  4KMO A;  1K1B A;  2WQH A;  3TWU A;  5LCW C;  5EYP F;  3B7B A;  2JEK A;  5FIO A;  1H6P A;  2A5U A;  3I4R B;  3L16 A;  2ILR A;  4N3A A;  3LY8 A;  4LNB A;  4BES A;  2OCC E;  4IN3 B;  2Q7F A;  2VSY A;  2HR2 A;  4J8S A;  5CRU A;  1EYH A;  5T3R A;  4GCN A;  1HFA A;  3CIA A;  3PRE A;  2KC7 A;  3UIN C;  3ULE G;  1H2U A;  3TWS A;  2X3M A;  4LRZ A;  3CKC A;  3FUH A;  4O60 A;  1BI8 B;  4L7T A;  2L0I A;  3AG4 E;  4BER A;  4FA6 A;  2X38 A;  4TXR A;  3TAX A;  4AY6 A;  3FU5 A;  3CHO A;  3Q5M A;  1TNY A;  1JCR A;  2L0T B;  4PH4 B;  4OAU C;  2CHW A;  3MZL B;  5ANR A;  2L9B A;  3IHY A;  5AAR A;  3MV3 B;  4AXH A;  3RAU A;  4HRL A;  5EKQ D;  1A5E A;  3TWQ A;  4Q94 A;  1PY1 A;  1OCO E;  2P9P G;  4DX2 A;  4TXP A;  3CK9 A;  2J07 A;  3DSS A;  5EIB E;  4GPM A;  1N0R A;  5AQ7 A;  5G04 C;  2PNN A;  3DRA A;  1OY3 D;  4ACL A;  1H2V C;  1WM5 A;  3ZYL A;  5HI7 A;  3SFY A;  2OVB A;  1KZO A;  2WXN A;  2L6J A;  1E7U A;  1KT1 A;  4FLB A;  4N39 A;  4GYO A;  3HRA A;  1V55 E;  3L22 A;  2HM8 A;  2QC9 A;  4GZD A;  4U7E B;  2R5S A;  4LG6 A;  3UM0 A;  1H6K A;  4HB5 A;  3UKU G;  5LX8 A;  2VTB A;  3LKU A;  1FCH A;  1QBQ A;  2NYJ A;  3RRM B;  5ITZ F;  1ELR A;  5EIL A;  4IRU A;  4KZ0 A;  4ACK A;  2M63 A;  4FU3 A;  3CVL A;  4NRH B;  4HOT A;  5G04 J;  4UWH A;  3NBN B;  2WXK A;  2P58 C;  3CHM A;  4DPR A;  5A7D B;  4TV3 A;  1NP7 A;  1NA3 A;  3FTY A;  4XZ4 A;  4K03 A;  1Y6I A;  2R2L A;  4RVB A;  2H6H A;  2JLB A;  5H7P A;  3FU6 A;  4U8H A;  4X8Q A;  4DLQ A;  1MZC A;  2WXG A;  3EDT B;  1O5M A;  3JUE A;  1E8W A;  3PEV B;  1U3D A;  2KM4 A;  2R03 A;  3NB2 A;  4AVX A;  3CK7 A;  3ZVV A;  4DRX E;  1TN7 A;  4MS6 A;  5EX0 A;  5C2Y A;  4GMJ A;  1LTX A;  3D9O A;  2C0L A;  2VGY A;  2VYI A;  4WWO A;  4A1G A;  4GB9 A;  1IXV A;  2BKG A;  4ANV A;  3ASH A;  4J8E A;  1FVF A;  3DST A;  3T8K A;  3ULQ A;  5E76 A;  1SW6 A;  3C3Q A;  3CVW A;  5E75 A;  5KWD A;  4HOU A;  2IF4 A;  3ZEF A;  4NUR A;  4GZC A;  4YDO A;  3B7T A;  2PQR A;  4I43 A;  3FUE A;  4I6E A;  3FUF A;  4E6H A;  2I2O A;  4ANW A;  3DBS A;  2ETB A;  2ZU6 B;  4EBA A;  5D2M C;  4BFR A;  3UT4 A;  3FTV A;  1NZN A;  3T8M A;  1H6O A;  1YMP A;  1OCZ E;  2VQ2 A;  4DX7 D;  2XGS A;  2XEV A;  3CVY A;  5ENP D;  3SI5 A;  4A3V A;  3UTM A;  1LD7 A;  3D9N A;  5CER B;  2WXF A;  4UQZ A;  4NQ0 A;  4MBG A;  2XGM A;  4WND A;  5KBA A;  2VGX B;  2OVF A;  1TNZ A;  3DPY A;  2J49 A;  4C0M A;  1Z3X A;  2Y4U A;  4CGW A;  4MLP A;  4YDE A;  3BEE A;  4EZL A;  3TGO A;  1MX2 A;  3KEA A;  2X6J A;  4GZ6 A;  1IQU A;  3ZYK A;  5LP0 A;  1HS6 A;  3DPD A;  4GTQ A;  4JZY A;  4EQF A;  2ION A;  3HXD A;  5JHA A;  3ONL A;  1XNF A;  4DK5 A;  1WDY A;  3AU5 A;  4XE0 A;  3V2O A;  4L1B A;  4U0U A;  3FP3 A;  4GYW A;  4ANX A;  1N9A A;  4JA9 A;  4CYM D;  4TRQ A;  4F7A A;  4C0E A;  3PZ3 A;  2WPV A;  3FUK A;  2DIW A;  3Q15 A;  3CHQ A;  5JJT A;  1O1S A;  3APF A;  4JD2 G;  4BX8 A;  2V4L A;  4JPS A;  1OWN A;  1OWL A;  2MRI A;  3ZN3 A;  3PDN A;  4XX5 A;  3S7F A;  5JJ7 A;  2LAH A;  4GTR A;  1S0P A;  2GRP B;  1TEZ A;  3LY9 A;  1H19 A;  4HI9 A;  1L5J A;  3UUX A;  3C3R A;  3C72 A;  1N4R A;  2LUH A;  4I17 A;  3LY7 A;  1IQR A;  4QQI A;  4YVQ C;  5C1D A;  5ENT D;  2Y4T A;  3DSU A;  3HVE A;  1N52 A;  1N54 A;  4XI0 A;  3ISM C;  2DYS E;  1KPS B;  1UG3 A;  4JVS A;  4GTV A;  4HOQ A;  4FJZ A;  3ABM E;  2NC9 A;  3ZYM A;  2V4H C;  3FTZ A;  3FUD A;  1OUV A;  3D9J A;  2R17 C;  3UM3 A;  1UW4 B;  2QYU A;  3CHP A;  3UXG A;  2R02 A;  3U66 A;  2ZIR A;  2E0I A;  3OTN A;  4O6F A;  2HYZ A;  2YNQ A;  2P9K G;  2ZXW E;  3G2V A;  2WM9 A;  5G05 C;  5HQ8 A;  4JEU A;  1N11 A;  2HE0 A;  4U63 A;  1X81 A;  3CVQ A;  3NF1 A;  4UWK A;  2FO1 E;  3C5R A;  4K5B A;  3ZPJ A;  2CFZ A;  2QZA A;  1HU3 A;  2VGX A;  3FH7 A;  4YVO A;  5AJD A;  3LJN A;  4CT4 A;  2RFM A;  4L2L A;  3VLE A;  1NFI E;  4JXT A;  4B94 A;  4Y6C A;  3O48 A;  2FUL A;  4BSZ B;  5FZQ A;  1IYG A;  3EHQ A;  2FBN A;  3QWP A;  4N3B A;  3TXN A;  1MYO A;  3LS8 A;  3RRU A;  3UKR G;  2E2E A;  3V30 A;  3K9I A;  1HG2 A;  4DX5 D;  4I1A A;  4GA2 A;  3BG1 B;  4CCA A;  1SVX A;  1Q2Z A;  2IEJ A;  3ASF A;  4U04 A;  3ZFW A;  3V2X A;  4G8L A;  3UPV A;  3ZXS A;  4N3C A;  2Y3A A;  2GRQ B;  5HS0 A;  4L23 A;  4PUC A;  4EPZ A;  2EIK E;  3ML8 A;  2YHC A;  3KS2 A;  5AQB A;  3X2Q E;  3HIZ A;  5FQ4 A;  1YA0 A;  2C2L A;  3QDN A;  2PM6 A;  3ENE A;  3MYV A;  3OXL A;  3V31 A;  3CQG B;  3ZU7 B;  1MX6 A;  1E8Y A;  3HXB A;  3E34 A;  4DJA A;  2WQ6 A;  2C0M A;  3WG7 E;  2ZGG A;  3VTX A;  3D9H A;  1HH8 A;  4AM9 A;  1N94 A;  4FC8 A;  2Y1L E;  3TG5 A;  2PL2 A;  3CVX A;  2VSX E;  2XEE A;  4U8Y D;  4RLY A;  1DVP A;  4ATG A;  2XS1 A;  1MX4 A;  4A63 B;  3R7R A;  4WNE A;  3U64 A;  1BPO A;  4BEP A;  3FTU A;  2AW6 A;  4DI3 A;  4PDX A;  4UI9 J;  3APD A;  5DBK A;  3RKV A;  4DX1 A;  3U9W A;  3D9L A;  3B7S A;  2F8X K;  4GU5 A;  3PNL B;  5KJN A;  4G2V A;  5JMN D;  2GW1 A;  1DCE A;  2WXI A;  3ASO E;  2AXZ A;  4GML A;  2DYR E;  3DXM G;  3APC A;  1TNB A;  1A17 A;  4HNA D;  4LER A;  2GGF A;  5FZR A;  3SHF A;  2MHK A;  1IHG A;  5EX3 A;  4QFV A;  2XZD G;  1U2V G;  4K0R A;  2YQ8 A;  4UQX A;  4B89 A;  3ZW3 A;  4BTB A;  4R7L A;  3QK0 A;  4OVV A;  2KXP C;  2GRN B;  1OT8 A;  3GZS A;  3CVU A;  4I2W A;  4F3V A;  2MYO A;  4K5A B;  3JYS A;  4O1O A;  5B1B E;  2QFC A;  1E7V A;  2BUG A;  4FAD A;  3E32 A;  4RG6 A;  3T5X A;  3UIP C;  5ARG A;  3L17 A;  3E33 A;  3LCA A;  3Q9N C;  3FUJ A;  2F8Y A;  2KCL A;  2RKK A;  5BXO A;  2EIL E;  3I3N A;  2J08 A;  3SNX A;  4GMR A;  4UUC A;  2OEW A;  5CBO A;  1JCS A;  2LNI A;  3TWV A;  5HRY A;  1X5B A;  4I9C A;  2GRR B;  5ANL A;  3L9T A;  2PQN A;  4AEZ C;  2P9I G;  3TXM A;  3FFL A;  2XEN A;  3CLJ A;  4FJY A;  4HLL A;  1UJK A;  3S2A A;  4NIK A;  2R59 A;  5AYW D;  2KBX A;  3RRN B;  1HG5 A;  3RJV A;  1OWP A;  3TWX A;  4HOR A;  4TXQ A;  4AJW A;  3GZ2 A;  5BXU A;  3TJP A;  1ZB1 A;  3EJN A;  3W9G A;  4CT0 A;  4J8D A;  4JHJ A;  3BQO A;  1SA4 A;  5FQ6 A;  3HXC A;  3CVN A;  1D8E A;  5BUZ A;  1D9S A;  3Q75 A;  5G55 A;  5CMY A;  4B8C B;  5CRV A;  5HKP A;  1OWO A;  1DCQ A;  3CK8 A;  1UN8 A;  4H7Y A;  3OXG A;  1HXI A;  4V3I A;  2X6K A;  2DCP A;  2PM7 A;  2CG3 A;  4FP7 A;  4AY5 A;  4RQI A;  4TUM A;  3LPZ A;  5EN5 D;  1WG0 A;  3R7Q A;  3EIQ C;  4CZ2 D;  1HO8 A;  1BD8 A;  3UT7 A;  1BI7 B;  4EBA G;  1E96 B;  4GYY A;  1P5Q A;  3ZHE B;  1Y8M A;  3EHR A;  4ANU A;  2AJA A;  1EF1 C;  2IQC A;  4M7C A;  2EIM E;  2XPI A;  5AEN A;  3CST A;  4CEM A;  1QZ2 A;  4Y6W A;  1NL4 A;  3C3O A;  3QAQ A;  3NOC D;  1TNO A;  1EPU A;  4LEU A;  4XKB A;  4J7W A;  1O1R A;  3AS8 A;  2I6H A;  2X6H A;  3DEP A;  2LO6 A;  4A1S A;  1NI1 A;  2WMN A;  3CHR A;  5ENR D;  4AIF A;  5DIZ A;  1TYQ G;  4BT8 A;  3ZGQ A;  2B6C A;  3NOG D;  4BET A;  3QNK A;  5AN8 A;  3MJW A;  3NZU A;  4WAF A;  4GZ5 A;  5BV1 A;  4F1P A;  4HLE A;  4GTM A;  5CHE E;  4GZ3 A;  4JB8 P;  3KD7 A;  2WXH A;  1K3Z D;  3HXF A;  2XCB A;  3PZ1 A;  2J4B A;  4KT6 B;  5T4Y A;  3GZ1 A;  4KYO B;  2CHX A;  3U3W A;  2XZT G;  3IHV A;  4WWP A;  1BLX B;  2WXM A;  3UI2 A;  3KEZ A;  3VTY A;  4DLO A;  2GRM A;  4FLH A;  1JWG A;  3ONK A;  3BG0 B;  1KZP A;  4N5C A;  4A3T A;  5KNH D;  4GPK A;  5EDS A;  2XRZ A;  2LXL A;  4J8Y A;  4APO A;  1SA5 A;  3CHS A;  3C98 A;  2AXU A;  5KJK A;  2IY0 C;  3B7R L;  3RU0 A;  5CEC B;  2P9L G;  5FQ8 A;  3FTW A;  5B3S E;  4GA1 A;  1TR4 A;  4EZK A;  1K1A A;  5CBN A;  2KCV A;  2DZN A;  5CEA A;  4N2Q A;  1UOH A;  4B93 B;  2XEH A;  3QWV A;  4J8F A;  4HXI A;  2EIN E;  4LNU D;  5B1A E;  3O4Z A;  1QQE A;  4JW1 A;  4F6R D;  3FH5 A;  1FVH A;  2DWZ A;  2KCK A;  4U07 A;  4A55 A;  1E90 A;  3AU4 A;  4C9B B;  4H7X A;  4L9P A;  1FT1 A;  3ZNG A;  2QYJ A;  5BPP A;  3EHM A;  4GTS A;  2RFA A;  3DSX A;  4ATZ D;  2WMO A;  5FQ7 A;  3DSW A;  5FIN A;  5JJ6 A;  3ZHE A;  4G26 A;  4F1S A;  1K8K G;  1FPP A;  4G11 A;  2DVW A;  4UWL A;  2Y0B G;  4G1T A;  4DUI A;  5JHB A;  1TN8 A;  3PUK A;  1Z6T A;  1VDY A;  3IKO B;  4KBQ A;  3MV2 B;  3IV0 A;  4HQD A;  3Q73 A;  3E37 A;  3RO3 A;  2IO2 C;  5BV0 A;  2GRO B;  3TWW A;  4C48 B;  1HF8 A;  2V8S E;  4HS2 A;  4U96 D;  5D0O D;  2P9S G;  3N71 A;  3LVR E;  2ETC A;  2FO7 A;  3LJ3 A;  1SQM A;  3EUV A;  4HBD A;  4HI8 A;  3RSE G;  5EID A;  2DZO A;  3PNT B;  4URK A;  3G2W A;  2HO1 A;  3EU5 A;  4FUL A;  2H6G A;  3JXJ A;  4RG9 A;  4PS8 A;  2MOW A;  4IYP A;  2XGO A;  3RIB A;  3AG1 E;  2IJG X;  3G2S A;  2IOL A;  3G2U A;  3DXK G;  1SZ9 A;  2L6B A;  2WVI A;  4BWR A;  4I6G A;  3S7B A;  1Z3Y A;  3Q79 A;  1G3N B;  2XPZ A;  3FWV A;  4IUL A;  3ZUV B;  3EHN A;  4UI9 C;  4CDR A;  2KZT B;  3FHE A;  3NQP A;  5A23 A;  3I4G A;  3J5Q B;  4WWN A;  4XI9 A;  4FHK A;  2F37 A;  5CCL A;  3FUN A;  2WXO A;  3ZYQ A;  2YHE A;  4DI4 A;  1W3B A;  3I5P A;  3NAW A;  4F53 A;  2NXP A;  3SO8 A;  4AP2 A;  5FJY A;  2EIJ E;  4HVB A;  2VSN A;  3VLD A;  1WY6 A;  3EU9 A;  3P1U A;  3L54 A;  3AG3 E;  1TJF A;  3FU3 A;  3L82 A;  4Q69 A;  1N0Q A;  5KJL A;  4JEH A;  4E85 A;  5G2N A;  3HYM B;  1UN9 A;  3QKY A;  4ILH B;  3GYZ A;  3L6A A;  1SZA A;  4JL0 A;  3CKB A;  1FT2 A;  3DWL G;  3T5V A;  4CGV A;  3D9P A;  5FWQ A;  5BW8 C;  3CR3 A;  4CRW A;  4ME2 A;  3AJI A;  5LCW J;  3PZD A;  3CV0 A;  1JUQ A;  1IKN D;  4LUN U;  3LDZ A;  3Q7A A;  3FH8 A;  4JA7 A;  2P2C P;  2V5F A;  3SZ7 A;  3JUI A;  2OV8 A;  3PS6 A;  2XPY A;  3EIJ A;  4U8V D;  2V0P A;  5J90 A;  1EDU A;  2P9U G;  3PH0 C;  5ENS D;  2VSO E;  3QWW A;  2XRY A;  4OVU A;  2XQ0 A;  1OCR E;  5AQ9 A;  3L13 A;  3L08 A;  2FEZ A;  3ML9 A;  3VLF A;  3JQ1 A;  2FI7 A;  3CVP A;  3UIO C;  4XKC A;  1KLX A;  1MQS A;  2J09 A;  5BT1 A;  5AAO A;  1ZU2 A;  3ASD A;  1IHB A;  3TL5 A;  5ARF A;  3Q49 B;  1Z5S C;  3PUJ A;  1QNF A;  3V79 K;  4L2Y A;  1AP7 A;  2VJ8 A;  2A5E A;  4O1P A;  4UWF A;  3UM1 A;  2WQ7 A;  1D8D A;  3UMV A;  5M72 A;  4PS7 A;  4BX9 A;  4HOS A;  3URZ A;  1INZ A;  2BF0 X;  2J9Q A;  2KAT A;  5EYL A;  1OWM A;  4MKT A;  2X6F A;  2KZT A;  4I1M A;  2IOS A;  5ENN A;  4WNF A;  4UWG A;  4YDY A;  1JWF A;  4ILG A;  3RO2 A;  1BU9 A;  3SQV A;  2IU1 A;  2DBA A;  1PAQ A;  2X6I A;  4GA0 A;  3ABL E;  4OAV B;  3UQ3 A;  3MKR A;  3PZ2 A;  5CED B;  3UX4 A;  1N4S A;  4GTO A;  3AAA C;  3LXU X;  5AQA A;  1OCC E;  2OND A;  1N4P A;  3S7D A;  1UJJ A;  3D9I A;  2BED A;  1H0A A;  4EEC A;  3HVE B;  3AS4 A;  4KXK B;  2H6F A;  1NA0 A;  1QYM A;  2CG2 A;  4WNG A;  2CFU A;  5CMW A;  1RZ4 A;  2B0O E;  3PRZ A;  4N5Q A;  4GTT A;  3B95 A;  3D3M A;  3BU8 A;  3MGB A;  3B13 A;  3IXE A;  2WB2 A;  5KNG A;  2ZGD A;  3ULY A;  3J5P A;  4DX6 D;  3QC1 A;  2RD0 A;  3SGH A;  5D0Q D;  3JCK C;  2BKK B;  1E8Z A;  4AOF A;  1PC2 A;  2J4D A;  3R9A B;  4I1O B;  1JPL A;  4ILI A;  3CVV A;  5FTP A;  3CSF A;  1O1T A;  3FTX A;  3MKQ B;  5KJM A;  4I6J A;  4HFG A;  1DNP A;  3QB2 A;  4B0Z A;  1U3C A;  3LVQ E;  2PZI A;  2UY1 B;  2I1K A;  3ASG A;  2LSV A;  2A4Z A;  3SD5 A;  3SFX A;  3UM2 A;  4GTP A;  1ELK A;  2WXR A;  1LF8 A;  2I9C A;  3TG4 A;  3SFZ A;  2ZIS A;  4Z68 A;  2Y69 E;  3FEX A;  3IEG A;  5ENQ D;  3U4T A;  3MA5 A;  2OEV A;  4CDM A;  4EHM A;  3QOU A;  3FUM A;  1TN6 A;  3PVL A;  2NSZ A;  2V5Q C;  3Q47 B;  2IO3 C;  1YCS B;  3HXE A;  1H2T C;  2LAI A;  3HG0 D;  4MRU A;  1HX8 A; 
#chains in the Genus database with same CATH homology
 4DX2 A;  2VGE A;  4G8L A;  2B0O E;  1IHB A;  5EIB E;  4GPM A;  2XEN A;  1N0R A;  1IXV A;  4J8Y A;  5AQ7 A;  2BKG A;  1MX2 A;  2PNN A;  3KEA A;  3EU9 A;  4N5Q A;  4HLL A;  4U96 D;  3DEO A;  4U95 D;  1OY3 D;  2J8S D;  4NIK A;  3B95 A;  4HRM B;  4YDW A;  5HS0 A;  3T8K A;  1N0Q A;  1SW6 A;  3V79 K;  5JMN D;  2V4H C;  2KBX A;  1AWC B;  2ETC A;  1AP7 A;  3NOC D;  5CEC B;  1K1B A;  2A5E A;  3IXE A;  3TWU A;  5KWD A;  5AQB A;  4HRN A;  4O1P A;  3TWR A;  3W9F A;  5KNG A;  5EYP F;  3B7B A;  4HBD A;  4HI8 A;  2ZGD A;  1WDY A;  5EID A;  3V2O A;  3J5P A;  2DZO A;  3TWX A;  1TR4 A;  4DX6 D;  4HNA D;  4J7W A;  3UXG A;  1K1A A;  3HRA A;  3ZKJ A;  5CBN A;  2BKK B;  2QC9 A;  2DZN A;  3T9K A;  5CEA A;  5BXU A;  3DEP A;  4ZFH A;  5FIO A;  4LG6 A;  5ENO D;  3JXI A;  4CYM D;  1UOH A;  3W9G A;  4B93 B;  3V31 A;  4HB5 A;  3JXJ A;  4QFV A;  2XEH A;  2XZD G;  5EYL A;  5ENR D;  3ZU7 B;  4K5C A;  4BES A;  2ETB A;  4LNU D;  1MX6 A;  3AJI A;  4F6R D;  2DWZ A;  2KXP C;  5JA4 D;  1OT8 A;  2NYJ A;  5ITZ F;  5EIL A;  1IKN D;  2L6B A;  1N11 A;  2HE0 A;  2ZGG A;  1D9S A;  4YDY A;  3Q9U C;  3NOG D;  4BET A;  2MYO A;  3D9H A;  4K5A B;  1YMP A;  5AN8 A;  3ZNG A;  4DX7 D;  3C5R A;  2P2C P;  3NBN B;  2FO1 E;  2QYJ A;  4K5B A;  1G3N B;  3TWT A;  5HKP A;  4O1O A;  1DCQ A;  4F1P A;  1BU9 A;  3TWS A;  5ENP D;  2JAB A;  2Y1L E;  3LJN A;  2RFA A;  3ZUV B;  3UTM A;  1DC2 A;  2RFM A;  4JB8 P;  4O60 A;  4ATZ D;  1NFI E;  4U8V D;  2XEE A;  1K3Z D;  1BI8 B;  4U8Y D;  1S70 B;  3Q9N C;  4RLY A;  5ENS D;  4OAV B;  5FIN A;  1MX4 A;  4A63 B;  2F8Y A;  4BER A;  3J5Q B;  1MJ0 A;  4Z68 A;  5CER B;  4BSZ B;  5CED B;  5BXO A;  2ETA A;  2DVW A;  4BEP A;  3AAA C;  5ENQ D;  5AQA A;  3EHQ A;  2Y0B G;  2XZT G;  3JUE A;  2F37 A;  4HI9 A;  4DUI A;  5AQ9 A;  4OAU C;  1BLX B;  4TUM A;  5D66 A;  3F6Q A;  4GMR A;  1YYH A;  4LSZ E;  4UUC A;  5EN5 D;  1MYO A;  3UI2 A;  5KBA A;  5CBO A;  1WG0 A;  2V5Q C;  4CZ2 D;  4QQI A;  3V30 A;  3TWV A;  4G8K A;  1BD8 A;  5HRY A;  1BI7 B;  4DX1 A;  5ENT D;  1YCS B;  4DX5 D;  5AAR A;  4HQD A;  4HRL A;  1SVX A;  4DRX E;  3SO8 A;  1QYM A;  5AAO A;  4ZHB A;  3HG0 D;  3TWQ A;  1A5E A;  3EHR A;  3TWW A;  2F8X K;  4C48 B;  5KNH D;  3V2X A;  2AJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...