4U95D

Coupling of remote alternating-access transport mechanisms for protons and substrates in the multidrug efflux pump acrb
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
156
structure length
156
Chain Sequence
GSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Multidrug efflux pump subunit AcrB
publication title Coupling of remote alternating-access transport mechanisms for protons and substrates in the multidrug efflux pump AcrB
pubmed doi rcsb
source organism Escherichia coli
total genus 53
structure length 156
sequence length 156
chains with identical sequence E
ec nomenclature
pdb deposition date 2014-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4u95D00
4B93B 4JB8P 1MX6A 3UXGA 1TR4A 5EIDA 3IXEA 3TWWA 3V2XA 4F6RD 1YMPA 5KBAA 2FO1E 5EN5D 5HKPA 3UTMA 5KWDA 2Y0BG 4HQDA 4A63B 4BETA 2V4HC 4F1PA 4K5BA 5KNHD 1BU9A 1K1BA 2DVWA 5CEDB 5HRYA 1IHBA 3V30A 5ITZF 1SVXA 1DC2A 5CBNA 3TWSA 3V31A 4DX5D 2VGEA 4O60A 3NOGD 4HRMB 4Z68A 4OAVB 1SW6A 4G8LA 1BLXB 2ETAA 4HLLA 3C5RA 4CYMD 4O1PA 5EYPF 4HB5A 2DZNA 4YDYA 3ZNGA 5EYLA 5FIOA 3DEOA 4OAUC 5CECB 3TWQA 2XENA 4G8KA 4U8YD 1D9SA 1N0QA 1QYMA 3DEPA 4N5QA 3TWVA 3W9FA 1DCQA 2B0OE 2XZTG 4TUMA 3UI2A 4BEPA 5ENPD 5ENTD 3F6QA 5AAOA 4ZHBA 3J5QB 4DX7D 2QC9A 1A5EA 4J7WA 4U8VD 3T8KA 3T9KA 3TWXA 4HBDA 3NOCD 4BSZB 2MYOA 1WDYA 1S70B 3V2OA 5BXUA 2L6BA 5AARA 2JABA 1K1AA 3Q9UC 5AN8A 4LG6A 5EILA 3J5PA 3LJNA 3ZU7B 2QYJA 4DX1A 2DZOA 4HRLA 1BI8B 3W9GA 2AJAA 3Q9NC 5ENOD 3TWRA 4BERA 2RFMA 3B95A 2XEEA 3EHQA 4CZ2D 1MJ0A 2V5QC 3JUEA 1IKND 2F37A 5ENSD 1UOHA 2J8SD 5CERB 3B7BA 4DX2A 1MYOA 5CEAA 4HRNA 5FINA 4QFVA 5AQ7A 3EU9A 1K3ZD 1MX4A 4YDWA 3HRAA 5AQAA 2HE0A 3AJIA 3EHRA 5AQBA 4DRXE 1BI7B 1AWCB 4J8YA 1BD8A 4C48B 2F8XK 2KBXA 3KEAA 2KXPC 2BKGA 2ZGGA 5CBOA 4QQIA 2A5EA 1WG0A 4HI9A 2BKKB 3JXIA 4LNUD 5ENRD 2NYJA 3SO8A 4DUIA 4HI8A 5JA4D 4NIKA 3ZUVB 1IXVA 2XZDG 5JMND 2Y1LE 1N0RA 5ENQD 3TWUA 4BESA 4GMRA 5KNGA 4LSZE 5HS0A 1OY3D 3TWTA 2PNNA 4U95D 4DX6D 1MX2A 3HG0D 4O1OA 2RFAA 4UUCA 3NBNB 4ATZD 4HNAD 1G3NB 4GPMA 2P2CP 1YCSB 3JXJA 2ETCA 4RLYA 2XEHA 1NFIE 4U96D 2ZGDA 2F8YA 5D66A 3ZKJA 5EIBE 3V79K 1OT8A 4K5CA 4K5AB 2ETBA 1AP7A 5AQ9A 3AAAC 2DWZA 1N11A 1YYHA 3D9HA 4ZFHA 5BXOA
chains in the Genus database with same CATH superfamily
3EU5A 3PZ2A 4JHKA 3B7TA 1BPOA 2IONA 2DYSE 5KBAA 1NI1A 4B8AA 2NSZA 3GYZA 5CEDB 5HRYA 3SD5A 5B1AE 1Y6IA 2A5UA 3R9MA 4K03A 3QKYA 5EYPF 2WXNA 1UG3A 4TXRA 4XE0A 4HBDA 2XRYA 5B3SE 4C0EA 2JEKA 2XEVA 3UM2A 4UI9C 5FZSA 3Q9NC 1OCRE 4J8DA 5EX0A 2VTBB 5ENSD 4KYOB 4JPSA 3RJVA 4HRNA 3CVPA 4BX8A 1HXIA 2EIKE 5CCLA 3FH5A 4FP7A 1BI7B 1PC2A 1O1RA 3RO3A 3OXFA 3ABKE 4HOUA 3G2UA 3SO8A 2IFUA 4V3IA 3RRMB 3TWUA 4W9RA 3SY2A 2EIJE 3IBEA 4WNFA 1H2VC 4ATGA 1G3NB 2DBAA 4Q96A 3SZ7A 2GRLA 5LCWC 1OT8A 2WPVA 2XCCA 4XX5A 4CGWA 4UWLA 4N3BA 4NACA 5BW8C 5BXOA 3G2VA 5A7DB 2CG3A 3UXGA 1GW6A 2BTDA 2QYUA 5KWDA 3FTYA 2GRRB 5CHEE 2DVWA 4G25A 1WY6A 1BLXB 2BEDA 1QZ2A 2P9PG 3CV0A 4HB5A 1JWFA 3LY8A 1HG2A 2CFZA 3PREA 4JA7A 4N5QA 4XI9A 4APFA 3AU5A 1A5EA 2H6HA 3DSTA 4EPZA 1E7UA 3AG4E 4J8SA 3QOUA 2WVIA 2MHKA 3DXKG 4PS7A 4A55A 5ENOD 2WQHA 2RD0A 3TG4A 3SF4A 3MGBA 4QFVA 5LFAA 5AENA 4U04A 5LX8A 1KT1A 3HRAA 3L82A 3FUIA 1V54E 3DXMG 3RKVA 3KEAA 4UWGA 1ELWA 2Y4UA 3U64A 5JA4D 5JMND 2Y1LE 4GYOA 3TWTA 3QB2A 4WWOA 3BG0B 1TN7A 3LKUA 2ZU6B 1FVHA 3E32A 4K5AB 2WXLA 3SNXA 3Q75A 1BI8B 5CRUA 3CVUA 5EIDA 3VLEA 2YNQA 2V4HC 4JL0A 1O1TA 1QBQA 3KSQA 1IHBA 4DX5D 2C2LA 2KCKA 4G11A 2VGXA 3ZHEA 3ZIMA 4LERA 4C0MA 3BUAA 4AJWA 5CMYA 2DZNA 1E7VA 2HO1A 3OTNA 4RSYA 3D9LA 3QWWA 4EZKA 1E8XA 3MZLB 4BEPA 3ULQA 3AS5A 2J08A 1JPLA 3AG3E 3EIJA 1D8DA 1XNFA 5AARA 4CGVA 2J09A 1SZAA 3FUDA 2WXGA 2EIME 3AG1E 2KM4A 1Z3XA 4GAAA 3B7BA 5CEAA 3EU9A 3CSFA 5AQBA 3APFA 3ZVVA 3FTSA 4ANUA 2KXPC 2BKGA 2XGOA 3VLDA 1IYGA 4ILGA 4OVUA 3MV2B 3ABME 2IOSA 1HG5A 4ATZD 5FJYA 2IJGX 2ETCA 2VYIA 5D66A 3TXNA 4E6HA 4OVVA 3HVEB 2J4DA 4JHJA 4K5CA 1KZPA 3FTUA 5AQ9A 3PZDA 5D0QD 4JD2G 4F6RD 2I2OA 3SBSA 2HR2A 1YMPA 3ULEG 1O5MA 2M63A 3N71A 5KNHD 5T8IA 3NAWA 1TJCA 3CVLA 3QC1A 4JA9A 5AYWD 4KT6B 4J6IA 3CHSA 5FTPA 4H7YA 4HOSA 2YINA 2IQCA 1N0QA 1QYMA 4FLBA 4N3CA 2WXRA 3URZA 2KZTA 3W9FA 4YDOA 1XGWA 2I1KA 2R5SA 4ZHBA 5AAOA 5J08A 4U8VD 3T8KA 1Z6TA 3PUKA 3QAQA 2L6BA 5AN8A 4I6EA 1H0AA 3LJNA 2QY7A 3UT7A 1TN6A 5KJMA 3TWRA 3PNLB 4FLHA 4XI0A 4TUUA 5FQ8A 1BD8A 4D10C 1WG0A 2BKKB 4HFGA 3UM1A 2WMOA 3LPZA 3ZUVB 1U3DA 3CVNA 1NL4A 1N0RA 4X8QA 5CRVA 1N4PA 2WXJA 3ULYA 2ETBA 2X3MA 1OXJA 1N11A 4YDEA 4NURA 3TWWA 4I6JA 5EN5D 5HKPA 3ZYKA 5A6CA 4N2SA 2Y0BG 3ZHEB 5BV0A 4EZJA 3RIBA 3D9NA 4GMJA 3UQ3A 3L17A 4HRMB 3C3OA 1DVPA 4I2WA 3MEKA 4DPRA 2WQ6A 4CYMD 3ZNGA 3GZ2A 5FIOA 2XRZA 4BTBA 2OOEA 2XENA 4BY6A 3QWPA 1N52A 2VSYA 3UI2A 1TNYA 4MBGA 4R7LA 3KS2A 1OWPA 4BSZB 4UQZA 4YVQC 4E85A 3LVRE 4N3AA 1Y8MA 2WXFA 2WXHA 1HS6A 3ZU7B 3C3QA 3HXBA 5JJ6A 3UM0A 2OEVA 3LEWA 5CERB 4LNBA 2WQ7A 3Q7AA 3PE4A 4GZ5A 2F8XK 3ASHA 4AXHA 4I6GA 4QQIA 4RQIA 1S0PA 1QNFA 1SA4A 4LNUD 3TJPA 1HH8A 4G2VA 4UWKA 2BUGA 4FA6A 3Q73A 5HS0A 3CR3A 2AWIA 3DPYA 3G2WA 2J4BA 3ZYLA 3T8MA 1MZCA 2F8YA 3FTWA 1TN8A 5G05C 2P9UG 4F1SA 2LO6A 4JB8P 2YHCA 1MX6A 5JJTA 3V2XA 2FO1E 2GRNB 3FU5A 4CDRA 3LXUX 3FUFA 4B89A 3TGOA 3D3MA 2V4LA 4CRWA 2GRQB 5ARFA 1SVXA 2ONDA 2XS8A 2IO2C 3ASDA 3NOGD 3UT8A 2KCLA 3X2QE 4Z68A 2IY0C 2CFUA 3U9WA 4HLLA 4C9BB 1FPPA 4L23A 2XQ0A 5EYLA 4U0UA 4MRUA 3T5VA 3S7FA 3TWQA 3E37A 5ENPD 3UKUG 3L9TA 4TRQA 2DIWA 4F3VA 1KT0A 2UY1A 4DX1A 3LY7A 3EHQA 3NQPA 2V5QC 3APDA 3FDHA 3HXCA 4DLQA 3D9KA 1OWOA 2E2EA 4I1AA 4U0ZA 4G26A 3CVYA 3R7RA 2ZXWE 3EDTB 2PL2A 3AG2E 3QARA 4J8YA 4BWRA 4F7AA 2Q7FA 4KVMA 3PH0C 5AIJA 2ZISA 2X6FA 4Y6CA 4LCTA 4FADA 1RW2A 3OXGA 2JLBA 1PAQA 1H19A 3CVQA 3GW4A 5D2MC 4J8EA 4Y6WA 2FULA 3UM3A 2LUHA 3JCKC 4AIFA 1TR4A 2B6CA 4ANWA 4BT8A 3S7BA 4F1PA 1YA0A 5E75A 2Y3AA 5EX3A 4ACLA 1SW6A 4G1TA 2HM8A 4O1PA 4B0ZA 4YDYA 2WXPA 1K8KG 2YQ8A 1OCOE 5ENTD 4U63A 4A3TA 3MJWA 3ZYQA 4J7WA 1E8YA 3KD7A 1H6KA 3NOCD 5LOZA 1S70B 2OEWA 5G04C 5HQ8A 2JABA 3IEGA 4LG6A 2MRIA 2PM6A 3ZPJA 2XS1A 4JC8A 3ZYMA 4CEMA 4DX2A 2XGSA 5AQ7A 4KXKB 2X6JA 4DI4A 1MX4A 3B7SA 1FT2A 2HE0A 4C48B 1TYQG 2A5EA 3UUXA 4OAUC 2KATA 2OVBA 4IRUA 4GZCA 4GYYA 3IHVA 1NP7A 1MX2A 4F53A 1JWGA 2YHEA 4O1OA 3PS6A 4L2LA 2RFAA 1TNOA 3JQ0A 3CVVA 3Q47B 2XEHA 4U96D 5EIBE 4UI9K 2XGMA 2IO3C 1TNUA 2RKKA 4HORA 4L7TA 4FJZA 1OWLA 2XPZA 4U07A 2IF4A 5G2NA 5B1BE 3ZXPA 4JXTA 4ACKA 4GU5A 2H6GA 4A63B 4ABNA 4BETA 5CMWA 3FTZA 4ANXA 1HE8A 3EUVA 4LEUA 4OAVB 3PDNA 5FQ4A 1WM5A 5ENNA 1SZ9A 5C1DA 1VDYA 2B0OE 4TUMA 3IV0A 3ENEA 2WXKA 3C3RA 4KMOA 2MYOA 4PDXA 1UJKA 2Y69E 3QK0A 4GTVA 3CHQA 1H2TC 4IN3B 4JVSA 3PEVB 4CDNA 5A23A 3CQGB 3HXEA 5AQAA 3GZ1A 3AJIA 4FHJA 2CHXA 2NYJA 4HOQA 3FULA 4U8HA 5ANRA 4CT0A 3ESKA 5ENQD 3OAWA 4GPMA 1YCSB 3JXJA 4KBQA 4YVOA 3CIAA 5EDSA 3FY4A 1MQSA 3ZGQA 3O48A 3MYVA 2VQ2A 5BPPA 3E34A 4HQDA 3KEZA 2E0IA 3CHOA 3SGHA 2FF4A 4N2QA 3MV3B 4URKA 5EKQD 3CQCB 3L22A 1EYHA 2ETAA 5FZRA 4UQYA 3G2TA 1HX8A 3B7UX 5BT1A 3FEYA 3HDXA 4I2ZA 2P9LG 3ABLE 4CT4A 3LJ3A 3Q7FA 3U66A 4UWFA 1UJJA 2PM7A 4FJYA 3G2SA 3V2OA 2MOWA 4A1SA 3FU6A 5LP0A 4AVXA 2QYJA 3LYAA 4AOFA 5J90A 3FUMA 1UOHA 5HI7A 1IHGA 3DSXA 3BG1B 4DRXE 4GZDA 3HIZA 3AS8A 3SI5A 2PQRA 3ONKA 4J8FA 4EZLA 4LSZE 2PNNA 2LAHA 1HF8A 1A17A 3JQ1A 2AXUA 3JUIA 3S7JA 4B94A 2XPYA 3V79K 3DSSA 2J07A 1SQMA 2DWZA 4FULA 4B93B 1N9AA 3ONLA 4DJAA 3QWVA 1Z3YA 2EILE 2X6HA 4L2YA 3PRZA 3UIPC 1HO8A 3LS8A 3FP3A 2VGEA 3SFXA 2FO7A 2KCVA 3PVLA 3S7DA 3SHFA 3IKOB 1D9SA 4MLPA 2VGXB 1DCQA 3FH8A 2IU1A 3F6QA 2NC9A 2VTBA 5BXUA 2BF0X 3J5PA 1TNBA 2XEEA 2GRPB 2X6IA 1TEZA 3D9PA 2J8SD 2R59A 3ASNE 3AS4A 5D0OD 3UPVA 4AM9A 2OCCE 2FI7A 3BU8A 4XKBA 4N39A 2KBXA 4I17A 2IEJA 4GTMA 3UT4A 4FHKA 3MKQA 1N4RA 4UI9J 2AXZA 5KNGA 2WB2A 4ILIA 4WAFA 4P29A 3C72A 3ZKJA 5BV1A 3PUJA 3D9HA 3CVXA 3AAAC 3L54A 5T4YA 3TL5A 3DSWA 1N4SA 4B8CB 3FU0A 3CK7A 4BTAA 4GPKA 2CHWA 3HXDA 3IXEA 1FT1A 3CK9A 4HVBA 1BU9A 3RSEG 4TV3A 4GA0A 5BUZA 4J0UA 2R05A 1Z5SC 3V31A 4BX9A 4O60A 5LCWJ 2KC7A 4DLOA 2QFCA 3Q79A 2VSXE 4GA2A 5CECB 2OVFA 1OCCE 3DEPA 3MCXA 4AY5A 3FU3A 4DK5A 1OCZE 1JCQA 3T9KA 1MHQA 1LD8A 2L0TB 2KZTB 5G04J 2XPIA 1K1AA 1TJFA 3BEEA 3LCAA 2EINE 2C0MA 3K9IA 4HOTA 4BERA 2AXVA 3B95A 1N94A 3AU4A 3CHMA 1RZ4A 5FQ6A 3FTVA 4NQ0A 1JCRA 1EF1C 1H2UA 3EHRA 3VLFA 4GTOA 5KJLA 4GTQA 1JCSA 1DNPA 2LXMA 4DUIA 3FFLA 2XZDG 4EBAG 3HHMA 2RG8A 5T3RA 5FT9A 3E4BA 4BESA 4DX6D 3L6AA 4WWPA 3UINC 4UUCA 3CLJA 2ZIRA 3L13A 3FWVA 1QQEA 2UWJG 1NZNA 3ML8A 4GZ6A 4TXQA 1X5BA 4WWNA 4JW1A 1ELRA 5JJ7A 3CSTA 3I3NA 3SQVA 3P2BA 4N5CA 3IHYA 2GW1A 4GYWA 1S64A 4GTPA 2WMNA 2Y4TA 3KSLA 4EECA 2AW6A 3LDZA 3TWVA 3D9MA 1W3BA 3EHNA 3J5QB 1N4QA 4ILHB 3FHEA 4WNGA 3UX4A 3FUKA 5M72A 3RU0A 1WDYA 4GCOA 3U3WA 5JHAA 2DZOA 3LY9A 4HRLA 1HU3A 2P9SG 4CZ2D 2L0IA 1MYOA 4PH4B 2LXLA 3MKQB 1K3ZD 2WXOA 3PE3A 1E8ZA 4HI8A 3WXXA 2L6JA 4JZYA 4GMRA 3HVEA 3DPDA 4U95D 3HG0D 5FZQA 3FUNA 4I1MA 4HNAD 2P2CP 3DSVA 1ZBPA 4XIFA 4MS6A 1IQRA 3ZXSA 1PY1A 3U4TA 2WXQA 4BSXA 4ZFHA 3CGHA 4Q94A 3KAEA 2DCPA 2NXPA 3NF1A 4PS8A 2P58C 1ZB1A 4WNEA 1OUVA 2EQXA 5ANLA 3FUHA 4G8LA 1D8EA 1OWMA 4A3VA 2LNIA 3CHRA 3QJZA 1TNZA 2I9CA 4M7CA 3E33A 4G8KA 2XZTG 2QZAA 3VTYA 2GROB 2WM9A 1E96B 4DI3A 2QC9A 2V0PA 4LRZA 1V55E 2LSUA 3D9IA 3I4GA 1OWNA 3NZUA 3UMVA 3DWLG 2V5FA 2HYZA 2RFMA 5ARGA 4CDMA 3Q4AB 4APOA 4EBAA 3LVQE 4I1OB 3Q5MA 2UY1B 4RG9A 5KJNA 3PZ1A 4G24A 4WUYA 4FC8A 3EJNA 4U0SA 4L9PA 3SBTB 5KJKA 3D9OA 5CBOA 4HI9A 2C0LA 4AV7A 3CKBA 2GRMA 4GTSA 4U7EB 2X6KA 4RG6A 4AP2A 4HS2A 3Q49B 2LAIA 3E30A 3UIOC 2WXMA 2ILRA 5DBKA 4PUCA 2VSNA 4YNDA 4LUNU 2PZIA 4FU3A 3FTXA 2DYRE 3EIQC 2FEZA 1UW4B 2J9QA 1X81A 3TAXA 3QNKA 1IQUA 5ITZF 3R9AB 1DC2A 3MA5A 3RAUA 4BT9A 2VSOE 1HZ4A 1H6OA 4GB9A 1UN9A 3HXFA 1N95A 4JEHA 2VGYA 2XCBA 4GMLA 2PQNA 3Q78A 3NZSA 2F0YA 1UN8A 1E90A 4WNDA 3TWXA 3VTXA 3B7RL 3I5PA 3FH7A 3ZW3A 4LNGA 3PEUB 4UQXA 5EILA 4KZ0A 2H6IA 3W9GA 2AJAA 3CK8A 1NA0A 3ZEFA 1IKND 5FQ7A 4I9CA 2I6HA 1JUQA 1LF8A 2V8SE 3BQOA 3O4ZA 2R03A 5ENRD 2IOLA 1E8WA 4I43A 4NIKA 3P1UA 1IXVA 4GTRA 1HFAA 1FVFA 2LSVA 3ISMC 1SA5A 1NFIE 5BNWA 4KZCA 3DRAA 4CCAA 5FWQA 3FUJA 4L1BA 3L16A 3CHPA 2FBNA 1LTXA 1U3CA 5C2YA 4MKTA 3PNTB 3UTMA 3R7QA 2X38A 1K1BA 3V30A 5CBNA 4GA1A 3FUEA 3S2AA 3RRUA 4IYPA 2P9NG 3Q15A 5G05J 4IULA 1U2VG 3DEOA 5KCMA 3ESLA 5CCMA 4HLEA 1KZOA 1P5QA 4GCNA 3ASFA 3ZN3A 2P9IG 4PS3A 3DBSA 4JEUA 2I1JA 4NRHB 4K0RA 3Q9UC 3WG7E 1WAO1 3HYMB 1L5JA 2GGFA 1NA3A 1EDUA 4I9EA 1MJ0A 3UKRG 3JUEA 1N54A 2F37A 5FINA 4H7XA 3QDNA 4O6FA 1B89A 4GZ3A 1ZU2A 4YDWA 3ML9A 1AWCB 3RO2A 2ZGGA 3JXIA 3CVWA 1DCEA 4JHRA 3C98A 3DSUA 4BFRA 3NBNB 1ELKA 4ME2A 1LD7A 2L9BA 2R17C 3CKCA 1Q2ZA 3APCA 4GTTA 3D9JA 3MX3A 1AP7A 4ANVA 2OV8A 3MKRA 4TXPA 3ASGA 3PZ3A 2CHZA 3NB2A 5AJDA 4K5BA 2WXIA 4UWHA 2CG2A 5JHBA 3TWSA 4A1GA 1KPSB 5G55A 3C5RA 2XHEA 3ZRHA 3CEQA 3SFYA 2AVPA 4U8YD 3RK6A 4EQFA 1H6PA 3OXLA 4DX7D 3L08A 4AEZC 5IY5E 3SFZA 4AY6A 1KLXA 3FEXA 4Q69A 5E76A 4OYSA 4EHMA 4HXIA 4XEIG 2VJ8A 2A4ZA 3EHMA 1FCHA 4XKCA 3B13A 3GZSA 3ASOE 4KVOA 1EPUA 5DIZA 3JYSA 4M3OA 3ZFWA 1OY3D 1INZA 3I4RB 3PZ4A 1O1SA 3TG5A 2H6FA 2J49A 2P9KG 3TXMA 3T5XA 4RLYA 5H7PA 2ZGDA 1S63A 5AJLA 2R2LA 2R02A 4RVBA 3RRNB 4G23A 1YYHA 4XZ4A
chains in the Genus database with same CATH topology
4B93B 4JB8P 1MX6A 3UXGA 1TR4A 5EIDA 3IXEA 3TWWA 3V2XA 4F6RD 1YMPA 5KBAA 2FO1E 5EN5D 5HKPA 3UTMA 5KWDA 2Y0BG 4HQDA 4A63B 4BETA 2V4HC 4F1PA 4K5BA 5KNHD 1BU9A 1K1BA 2DVWA 5CEDB 5HRYA 1IHBA 3V30A 5ITZF 1SVXA 1DC2A 5CBNA 3TWSA 3V31A 4DX5D 2VGEA 4O60A 3NOGD 4HRMB 4Z68A 4OAVB 1SW6A 4G8LA 1BLXB 2ETAA 4HLLA 3C5RA 4CYMD 4O1PA 5EYPF 4HB5A 2DZNA 4YDYA 3ZNGA 5EYLA 5FIOA 3DEOA 4OAUC 5CECB 3TWQA 2XENA 4G8KA 4U8YD 1D9SA 1N0QA 1QYMA 3DEPA 4N5QA 3TWVA 3W9FA 1DCQA 2B0OE 2XZTG 4TUMA 3UI2A 4BEPA 5ENPD 5ENTD 3F6QA 5AAOA 4ZHBA 3J5QB 4DX7D 2QC9A 1A5EA 4J7WA 4U8VD 3T8KA 3T9KA 3TWXA 4HBDA 3NOCD 4BSZB 2MYOA 1WDYA 1S70B 3V2OA 5BXUA 2L6BA 5AARA 2JABA 1K1AA 3Q9UC 5AN8A 4LG6A 5EILA 3J5PA 3LJNA 3ZU7B 2QYJA 4DX1A 2DZOA 4HRLA 1BI8B 3W9GA 2AJAA 3Q9NC 5ENOD 3TWRA 4BERA 2RFMA 3B95A 2XEEA 3EHQA 4CZ2D 1MJ0A 2V5QC 3JUEA 1IKND 2F37A 5ENSD 1UOHA 2J8SD 5CERB 3B7BA 4DX2A 1MYOA 5CEAA 4HRNA 5FINA 4QFVA 5AQ7A 3EU9A 1K3ZD 1MX4A 4YDWA 3HRAA 5AQAA 2HE0A 3AJIA 3EHRA 5AQBA 4DRXE 1BI7B 1AWCB 4J8YA 1BD8A 4C48B 2F8XK 2KBXA 3KEAA 2KXPC 2BKGA 2ZGGA 5CBOA 4QQIA 2A5EA 1WG0A 4HI9A 2BKKB 3JXIA 4LNUD 5ENRD 2NYJA 3SO8A 4DUIA 4HI8A 5JA4D 4NIKA 3ZUVB 1IXVA 2XZDG 5JMND 2Y1LE 1N0RA 5ENQD 3TWUA 4BESA 4GMRA 5KNGA 4LSZE 5HS0A 1OY3D 3TWTA 2PNNA 4U95D 4DX6D 1MX2A 3HG0D 4O1OA 2RFAA 4UUCA 3NBNB 4ATZD 4HNAD 1G3NB 4GPMA 2P2CP 1YCSB 3JXJA 2ETCA 4RLYA 2XEHA 1NFIE 4U96D 2ZGDA 2F8YA 5D66A 3ZKJA 5EIBE 3V79K 1OT8A 4K5CA 4K5AB 2ETBA 1AP7A 5AQ9A 3AAAC 2DWZA 1N11A 1YYHA 3D9HA 4ZFHA 5BXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B93 B;  4JB8 P;  1MX6 A;  3UXG A;  1TR4 A;  5EID A;  3IXE A;  3TWW A;  3V2X A;  4F6R D;  1YMP A;  5KBA A;  2FO1 E;  5EN5 D;  5HKP A;  3UTM A;  5KWD A;  2Y0B G;  4HQD A;  4A63 B;  4BET A;  2V4H C;  4F1P A;  4K5B A;  5KNH D;  1BU9 A;  1K1B A;  2DVW A;  5CED B;  5HRY A;  1IHB A;  3V30 A;  5ITZ F;  1SVX A;  1DC2 A;  5CBN A;  3TWS A;  3V31 A;  4DX5 D;  2VGE A;  4O60 A;  3NOG D;  4HRM B;  4Z68 A;  4OAV B;  1SW6 A;  4G8L A;  1BLX B;  2ETA A;  4HLL A;  3C5R A;  4CYM D;  4O1P A;  5EYP F;  4HB5 A;  2DZN A;  4YDY A;  3ZNG A;  5EYL A;  5FIO A;  3DEO A;  4OAU C;  5CEC B;  3TWQ A;  2XEN A;  4G8K A;  4U8Y D;  1D9S A;  1N0Q A;  1QYM A;  3DEP A;  4N5Q A;  3TWV A;  3W9F A;  1DCQ A;  2B0O E;  2XZT G;  4TUM A;  3UI2 A;  4BEP A;  5ENP D;  5ENT D;  3F6Q A;  5AAO A;  4ZHB A;  3J5Q B;  4DX7 D;  2QC9 A;  1A5E A;  4J7W A;  4U8V D;  3T8K A;  3T9K A;  3TWX A;  4HBD A;  3NOC D;  4BSZ B;  2MYO A;  1WDY A;  1S70 B;  3V2O A;  5BXU A;  2L6B A;  5AAR A;  2JAB A;  1K1A A;  3Q9U C;  5AN8 A;  4LG6 A;  5EIL A;  3J5P A;  3LJN A;  3ZU7 B;  2QYJ A;  4DX1 A;  2DZO A;  4HRL A;  1BI8 B;  3W9G A;  2AJA A;  3Q9N C;  5ENO D;  3TWR A;  4BER A;  2RFM A;  3B95 A;  2XEE A;  3EHQ A;  4CZ2 D;  1MJ0 A;  2V5Q C;  3JUE A;  1IKN D;  2F37 A;  5ENS D;  1UOH A;  2J8S D;  5CER B;  3B7B A;  4DX2 A;  1MYO A;  5CEA A;  4HRN A;  5FIN A;  4QFV A;  5AQ7 A;  3EU9 A;  1K3Z D;  1MX4 A;  4YDW A;  3HRA A;  5AQA A;  2HE0 A;  3AJI A;  3EHR A;  5AQB A;  4DRX E;  1BI7 B;  1AWC B;  4J8Y A;  1BD8 A;  4C48 B;  2F8X K;  2KBX A;  3KEA A;  2KXP C;  2BKG A;  2ZGG A;  5CBO A;  4QQI A;  2A5E A;  1WG0 A;  4HI9 A;  2BKK B;  3JXI A;  4LNU D;  5ENR D;  2NYJ A;  3SO8 A;  4DUI A;  4HI8 A;  5JA4 D;  4NIK A;  3ZUV B;  1IXV A;  2XZD G;  5JMN D;  2Y1L E;  1N0R A;  5ENQ D;  3TWU A;  4BES A;  4GMR A;  5KNG A;  4LSZ E;  5HS0 A;  1OY3 D;  3TWT A;  2PNN A;  4U95 D;  4DX6 D;  1MX2 A;  3HG0 D;  4O1O A;  2RFA A;  4UUC A;  3NBN B;  4ATZ D;  4HNA D;  1G3N B;  4GPM A;  2P2C P;  1YCS B;  3JXJ A;  2ETC A;  4RLY A;  2XEH A;  1NFI E;  4U96 D;  2ZGD A;  2F8Y A;  5D66 A;  3ZKJ A;  5EIB E;  3V79 K;  1OT8 A;  4K5C A;  4K5A B;  2ETB A;  1AP7 A;  5AQ9 A;  3AAA C;  2DWZ A;  1N11 A;  1YYH A;  3D9H A;  4ZFH A;  5BXO A; 
#chains in the Genus database with same CATH topology
 3EU5 A;  3PZ2 A;  4JHK A;  3B7T A;  1BPO A;  2ION A;  2DYS E;  5KBA A;  1NI1 A;  4B8A A;  2NSZ A;  3GYZ A;  5CED B;  5HRY A;  3SD5 A;  5B1A E;  1Y6I A;  2A5U A;  3R9M A;  4K03 A;  3QKY A;  5EYP F;  2WXN A;  1UG3 A;  4TXR A;  4XE0 A;  4HBD A;  2XRY A;  5B3S E;  4C0E A;  2JEK A;  2XEV A;  3UM2 A;  4UI9 C;  5FZS A;  3Q9N C;  1OCR E;  4J8D A;  5EX0 A;  2VTB B;  5ENS D;  4KYO B;  4JPS A;  3RJV A;  4HRN A;  3CVP A;  4BX8 A;  1HXI A;  2EIK E;  5CCL A;  3FH5 A;  4FP7 A;  1BI7 B;  1PC2 A;  1O1R A;  3RO3 A;  3OXF A;  3ABK E;  4HOU A;  3G2U A;  3SO8 A;  2IFU A;  4V3I A;  3RRM B;  3TWU A;  4W9R A;  3SY2 A;  2EIJ E;  3IBE A;  4WNF A;  1H2V C;  4ATG A;  1G3N B;  2DBA A;  4Q96 A;  3SZ7 A;  2GRL A;  5LCW C;  1OT8 A;  2WPV A;  2XCC A;  4XX5 A;  4CGW A;  4UWL A;  4N3B A;  4NAC A;  5BW8 C;  5BXO A;  3G2V A;  5A7D B;  2CG3 A;  3UXG A;  1GW6 A;  2BTD A;  2QYU A;  5KWD A;  3FTY A;  2GRR B;  5CHE E;  2DVW A;  4G25 A;  1WY6 A;  1BLX B;  2BED A;  1QZ2 A;  2P9P G;  3CV0 A;  4HB5 A;  1JWF A;  3LY8 A;  1HG2 A;  2CFZ A;  3PRE A;  4JA7 A;  4N5Q A;  4XI9 A;  4APF A;  3AU5 A;  1A5E A;  2H6H A;  3DST A;  4EPZ A;  1E7U A;  3AG4 E;  4J8S A;  3QOU A;  2WVI A;  2MHK A;  3DXK G;  4PS7 A;  4A55 A;  5ENO D;  2WQH A;  2RD0 A;  3TG4 A;  3SF4 A;  3MGB A;  4QFV A;  5LFA A;  5AEN A;  4U04 A;  5LX8 A;  1KT1 A;  3HRA A;  3L82 A;  3FUI A;  1V54 E;  3DXM G;  3RKV A;  3KEA A;  4UWG A;  1ELW A;  2Y4U A;  3U64 A;  5JA4 D;  5JMN D;  2Y1L E;  4GYO A;  3TWT A;  3QB2 A;  4WWO A;  3BG0 B;  1TN7 A;  3LKU A;  2ZU6 B;  1FVH A;  3E32 A;  4K5A B;  2WXL A;  3SNX A;  3Q75 A;  1BI8 B;  5CRU A;  3CVU A;  5EID A;  3VLE A;  2YNQ A;  2V4H C;  4JL0 A;  1O1T A;  1QBQ A;  3KSQ A;  1IHB A;  4DX5 D;  2C2L A;  2KCK A;  4G11 A;  2VGX A;  3ZHE A;  3ZIM A;  4LER A;  4C0M A;  3BUA A;  4AJW A;  5CMY A;  2DZN A;  1E7V A;  2HO1 A;  3OTN A;  4RSY A;  3D9L A;  3QWW A;  4EZK A;  1E8X A;  3MZL B;  4BEP A;  3ULQ A;  3AS5 A;  2J08 A;  1JPL A;  3AG3 E;  3EIJ A;  1D8D A;  1XNF A;  5AAR A;  4CGV A;  2J09 A;  1SZA A;  3FUD A;  2WXG A;  2EIM E;  3AG1 E;  2KM4 A;  1Z3X A;  4GAA A;  3B7B A;  5CEA A;  3EU9 A;  3CSF A;  5AQB A;  3APF A;  3ZVV A;  3FTS A;  4ANU A;  2KXP C;  2BKG A;  2XGO A;  3VLD A;  1IYG A;  4ILG A;  4OVU A;  3MV2 B;  3ABM E;  2IOS A;  1HG5 A;  4ATZ D;  5FJY A;  2IJG X;  2ETC A;  2VYI A;  5D66 A;  3TXN A;  4E6H A;  4OVV A;  3HVE B;  2J4D A;  4JHJ A;  4K5C A;  1KZP A;  3FTU A;  5AQ9 A;  3PZD A;  5D0Q D;  4JD2 G;  4F6R D;  2I2O A;  3SBS A;  2HR2 A;  1YMP A;  3ULE G;  1O5M A;  2M63 A;  3N71 A;  5KNH D;  5T8I A;  3NAW A;  1TJC A;  3CVL A;  3QC1 A;  4JA9 A;  5AYW D;  4KT6 B;  4J6I A;  3CHS A;  5FTP A;  4H7Y A;  4HOS A;  2YIN A;  2IQC A;  1N0Q A;  1QYM A;  4FLB A;  4N3C A;  2WXR A;  3URZ A;  2KZT A;  3W9F A;  4YDO A;  1XGW A;  2I1K A;  2R5S A;  4ZHB A;  5AAO A;  5J08 A;  4U8V D;  3T8K A;  1Z6T A;  3PUK A;  3QAQ A;  2L6B A;  5AN8 A;  4I6E A;  1H0A A;  3LJN A;  2QY7 A;  3UT7 A;  1TN6 A;  5KJM A;  3TWR A;  3PNL B;  4FLH A;  4XI0 A;  4TUU A;  5FQ8 A;  1BD8 A;  4D10 C;  1WG0 A;  2BKK B;  4HFG A;  3UM1 A;  2WMO A;  3LPZ A;  3ZUV B;  1U3D A;  3CVN A;  1NL4 A;  1N0R A;  4X8Q A;  5CRV A;  1N4P A;  2WXJ A;  3ULY A;  2ETB A;  2X3M A;  1OXJ A;  1N11 A;  4YDE A;  4NUR A;  3TWW A;  4I6J A;  5EN5 D;  5HKP A;  3ZYK A;  5A6C A;  4N2S A;  2Y0B G;  3ZHE B;  5BV0 A;  4EZJ A;  3RIB A;  3D9N A;  4GMJ A;  3UQ3 A;  3L17 A;  4HRM B;  3C3O A;  1DVP A;  4I2W A;  3MEK A;  4DPR A;  2WQ6 A;  4CYM D;  3ZNG A;  3GZ2 A;  5FIO A;  2XRZ A;  4BTB A;  2OOE A;  2XEN A;  4BY6 A;  3QWP A;  1N52 A;  2VSY A;  3UI2 A;  1TNY A;  4MBG A;  4R7L A;  3KS2 A;  1OWP A;  4BSZ B;  4UQZ A;  4YVQ C;  4E85 A;  3LVR E;  4N3A A;  1Y8M A;  2WXF A;  2WXH A;  1HS6 A;  3ZU7 B;  3C3Q A;  3HXB A;  5JJ6 A;  3UM0 A;  2OEV A;  3LEW A;  5CER B;  4LNB A;  2WQ7 A;  3Q7A A;  3PE4 A;  4GZ5 A;  2F8X K;  3ASH A;  4AXH A;  4I6G A;  4QQI A;  4RQI A;  1S0P A;  1QNF A;  1SA4 A;  4LNU D;  3TJP A;  1HH8 A;  4G2V A;  4UWK A;  2BUG A;  4FA6 A;  3Q73 A;  5HS0 A;  3CR3 A;  2AWI A;  3DPY A;  3G2W A;  2J4B A;  3ZYL A;  3T8M A;  1MZC A;  2F8Y A;  3FTW A;  1TN8 A;  5G05 C;  2P9U G;  4F1S A;  2LO6 A;  4JB8 P;  2YHC A;  1MX6 A;  5JJT A;  3V2X A;  2FO1 E;  2GRN B;  3FU5 A;  4CDR A;  3LXU X;  3FUF A;  4B89 A;  3TGO A;  3D3M A;  2V4L A;  4CRW A;  2GRQ B;  5ARF A;  1SVX A;  2OND A;  2XS8 A;  2IO2 C;  3ASD A;  3NOG D;  3UT8 A;  2KCL A;  3X2Q E;  4Z68 A;  2IY0 C;  2CFU A;  3U9W A;  4HLL A;  4C9B B;  1FPP A;  4L23 A;  2XQ0 A;  5EYL A;  4U0U A;  4MRU A;  3T5V A;  3S7F A;  3TWQ A;  3E37 A;  5ENP D;  3UKU G;  3L9T A;  4TRQ A;  2DIW A;  4F3V A;  1KT0 A;  2UY1 A;  4DX1 A;  3LY7 A;  3EHQ A;  3NQP A;  2V5Q C;  3APD A;  3FDH A;  3HXC A;  4DLQ A;  3D9K A;  1OWO A;  2E2E A;  4I1A A;  4U0Z A;  4G26 A;  3CVY A;  3R7R A;  2ZXW E;  3EDT B;  2PL2 A;  3AG2 E;  3QAR A;  4J8Y A;  4BWR A;  4F7A A;  2Q7F A;  4KVM A;  3PH0 C;  5AIJ A;  2ZIS A;  2X6F A;  4Y6C A;  4LCT A;  4FAD A;  1RW2 A;  3OXG A;  2JLB A;  1PAQ A;  1H19 A;  3CVQ A;  3GW4 A;  5D2M C;  4J8E A;  4Y6W A;  2FUL A;  3UM3 A;  2LUH A;  3JCK C;  4AIF A;  1TR4 A;  2B6C A;  4ANW A;  4BT8 A;  3S7B A;  4F1P A;  1YA0 A;  5E75 A;  2Y3A A;  5EX3 A;  4ACL A;  1SW6 A;  4G1T A;  2HM8 A;  4O1P A;  4B0Z A;  4YDY A;  2WXP A;  1K8K G;  2YQ8 A;  1OCO E;  5ENT D;  4U63 A;  4A3T A;  3MJW A;  3ZYQ A;  4J7W A;  1E8Y A;  3KD7 A;  1H6K A;  3NOC D;  5LOZ A;  1S70 B;  2OEW A;  5G04 C;  5HQ8 A;  2JAB A;  3IEG A;  4LG6 A;  2MRI A;  2PM6 A;  3ZPJ A;  2XS1 A;  4JC8 A;  3ZYM A;  4CEM A;  4DX2 A;  2XGS A;  5AQ7 A;  4KXK B;  2X6J A;  4DI4 A;  1MX4 A;  3B7S A;  1FT2 A;  2HE0 A;  4C48 B;  1TYQ G;  2A5E A;  3UUX A;  4OAU C;  2KAT A;  2OVB A;  4IRU A;  4GZC A;  4GYY A;  3IHV A;  1NP7 A;  1MX2 A;  4F53 A;  1JWG A;  2YHE A;  4O1O A;  3PS6 A;  4L2L A;  2RFA A;  1TNO A;  3JQ0 A;  3CVV A;  3Q47 B;  2XEH A;  4U96 D;  5EIB E;  4UI9 K;  2XGM A;  2IO3 C;  1TNU A;  2RKK A;  4HOR A;  4L7T A;  4FJZ A;  1OWL A;  2XPZ A;  4U07 A;  2IF4 A;  5G2N A;  5B1B E;  3ZXP A;  4JXT A;  4ACK A;  4GU5 A;  2H6G A;  4A63 B;  4ABN A;  4BET A;  5CMW A;  3FTZ A;  4ANX A;  1HE8 A;  3EUV A;  4LEU A;  4OAV B;  3PDN A;  5FQ4 A;  1WM5 A;  5ENN A;  1SZ9 A;  5C1D A;  1VDY A;  2B0O E;  4TUM A;  3IV0 A;  3ENE A;  2WXK A;  3C3R A;  4KMO A;  2MYO A;  4PDX A;  1UJK A;  2Y69 E;  3QK0 A;  4GTV A;  3CHQ A;  1H2T C;  4IN3 B;  4JVS A;  3PEV B;  4CDN A;  5A23 A;  3CQG B;  3HXE A;  5AQA A;  3GZ1 A;  3AJI A;  4FHJ A;  2CHX A;  2NYJ A;  4HOQ A;  3FUL A;  4U8H A;  5ANR A;  4CT0 A;  3ESK A;  5ENQ D;  3OAW A;  4GPM A;  1YCS B;  3JXJ A;  4KBQ A;  4YVO A;  3CIA A;  5EDS A;  3FY4 A;  1MQS A;  3ZGQ A;  3O48 A;  3MYV A;  2VQ2 A;  5BPP A;  3E34 A;  4HQD A;  3KEZ A;  2E0I A;  3CHO A;  3SGH A;  2FF4 A;  4N2Q A;  3MV3 B;  4URK A;  5EKQ D;  3CQC B;  3L22 A;  1EYH A;  2ETA A;  5FZR A;  4UQY A;  3G2T A;  1HX8 A;  3B7U X;  5BT1 A;  3FEY A;  3HDX A;  4I2Z A;  2P9L G;  3ABL E;  4CT4 A;  3LJ3 A;  3Q7F A;  3U66 A;  4UWF A;  1UJJ A;  2PM7 A;  4FJY A;  3G2S A;  3V2O A;  2MOW A;  4A1S A;  3FU6 A;  5LP0 A;  4AVX A;  2QYJ A;  3LYA A;  4AOF A;  5J90 A;  3FUM A;  1UOH A;  5HI7 A;  1IHG A;  3DSX A;  3BG1 B;  4DRX E;  4GZD A;  3HIZ A;  3AS8 A;  3SI5 A;  2PQR A;  3ONK A;  4J8F A;  4EZL A;  4LSZ E;  2PNN A;  2LAH A;  1HF8 A;  1A17 A;  3JQ1 A;  2AXU A;  3JUI A;  3S7J A;  4B94 A;  2XPY A;  3V79 K;  3DSS A;  2J07 A;  1SQM A;  2DWZ A;  4FUL A;  4B93 B;  1N9A A;  3ONL A;  4DJA A;  3QWV A;  1Z3Y A;  2EIL E;  2X6H A;  4L2Y A;  3PRZ A;  3UIP C;  1HO8 A;  3LS8 A;  3FP3 A;  2VGE A;  3SFX A;  2FO7 A;  2KCV A;  3PVL A;  3S7D A;  3SHF A;  3IKO B;  1D9S A;  4MLP A;  2VGX B;  1DCQ A;  3FH8 A;  2IU1 A;  3F6Q A;  2NC9 A;  2VTB A;  5BXU A;  2BF0 X;  3J5P A;  1TNB A;  2XEE A;  2GRP B;  2X6I A;  1TEZ A;  3D9P A;  2J8S D;  2R59 A;  3ASN E;  3AS4 A;  5D0O D;  3UPV A;  4AM9 A;  2OCC E;  2FI7 A;  3BU8 A;  4XKB A;  4N39 A;  2KBX A;  4I17 A;  2IEJ A;  4GTM A;  3UT4 A;  4FHK A;  3MKQ A;  1N4R A;  4UI9 J;  2AXZ A;  5KNG A;  2WB2 A;  4ILI A;  4WAF A;  4P29 A;  3C72 A;  3ZKJ A;  5BV1 A;  3PUJ A;  3D9H A;  3CVX A;  3AAA C;  3L54 A;  5T4Y A;  3TL5 A;  3DSW A;  1N4S A;  4B8C B;  3FU0 A;  3CK7 A;  4BTA A;  4GPK A;  2CHW A;  3HXD A;  3IXE A;  1FT1 A;  3CK9 A;  4HVB A;  1BU9 A;  3RSE G;  4TV3 A;  4GA0 A;  5BUZ A;  4J0U A;  2R05 A;  1Z5S C;  3V31 A;  4BX9 A;  4O60 A;  5LCW J;  2KC7 A;  4DLO A;  2QFC A;  3Q79 A;  2VSX E;  4GA2 A;  5CEC B;  2OVF A;  1OCC E;  3DEP A;  3MCX A;  4AY5 A;  3FU3 A;  4DK5 A;  1OCZ E;  1JCQ A;  3T9K A;  1MHQ A;  1LD8 A;  2L0T B;  2KZT B;  5G04 J;  2XPI A;  1K1A A;  1TJF A;  3BEE A;  3LCA A;  2EIN E;  2C0M A;  3K9I A;  4HOT A;  4BER A;  2AXV A;  3B95 A;  1N94 A;  3AU4 A;  3CHM A;  1RZ4 A;  5FQ6 A;  3FTV A;  4NQ0 A;  1JCR A;  1EF1 C;  1H2U A;  3EHR A;  3VLF A;  4GTO A;  5KJL A;  4GTQ A;  1JCS A;  1DNP A;  2LXM A;  4DUI A;  3FFL A;  2XZD G;  4EBA G;  3HHM A;  2RG8 A;  5T3R A;  5FT9 A;  3E4B A;  4BES A;  4DX6 D;  3L6A A;  4WWP A;  3UIN C;  4UUC A;  3CLJ A;  2ZIR A;  3L13 A;  3FWV A;  1QQE A;  2UWJ G;  1NZN A;  3ML8 A;  4GZ6 A;  4TXQ A;  1X5B A;  4WWN A;  4JW1 A;  1ELR A;  5JJ7 A;  3CST A;  3I3N A;  3SQV A;  3P2B A;  4N5C A;  3IHY A;  2GW1 A;  4GYW A;  1S64 A;  4GTP A;  2WMN A;  2Y4T A;  3KSL A;  4EEC A;  2AW6 A;  3LDZ A;  3TWV A;  3D9M A;  1W3B A;  3EHN A;  3J5Q B;  1N4Q A;  4ILH B;  3FHE A;  4WNG A;  3UX4 A;  3FUK A;  5M72 A;  3RU0 A;  1WDY A;  4GCO A;  3U3W A;  5JHA A;  2DZO A;  3LY9 A;  4HRL A;  1HU3 A;  2P9S G;  4CZ2 D;  2L0I A;  1MYO A;  4PH4 B;  2LXL A;  3MKQ B;  1K3Z D;  2WXO A;  3PE3 A;  1E8Z A;  4HI8 A;  3WXX A;  2L6J A;  4JZY A;  4GMR A;  3HVE A;  3DPD A;  4U95 D;  3HG0 D;  5FZQ A;  3FUN A;  4I1M A;  4HNA D;  2P2C P;  3DSV A;  1ZBP A;  4XIF A;  4MS6 A;  1IQR A;  3ZXS A;  1PY1 A;  3U4T A;  2WXQ A;  4BSX A;  4ZFH A;  3CGH A;  4Q94 A;  3KAE A;  2DCP A;  2NXP A;  3NF1 A;  4PS8 A;  2P58 C;  1ZB1 A;  4WNE A;  1OUV A;  2EQX A;  5ANL A;  3FUH A;  4G8L A;  1D8E A;  1OWM A;  4A3V A;  2LNI A;  3CHR A;  3QJZ A;  1TNZ A;  2I9C A;  4M7C A;  3E33 A;  4G8K A;  2XZT G;  2QZA A;  3VTY A;  2GRO B;  2WM9 A;  1E96 B;  4DI3 A;  2QC9 A;  2V0P A;  4LRZ A;  1V55 E;  2LSU A;  3D9I A;  3I4G A;  1OWN A;  3NZU A;  3UMV A;  3DWL G;  2V5F A;  2HYZ A;  2RFM A;  5ARG A;  4CDM A;  3Q4A B;  4APO A;  4EBA A;  3LVQ E;  4I1O B;  3Q5M A;  2UY1 B;  4RG9 A;  5KJN A;  3PZ1 A;  4G24 A;  4WUY A;  4FC8 A;  3EJN A;  4U0S A;  4L9P A;  3SBT B;  5KJK A;  3D9O A;  5CBO A;  4HI9 A;  2C0L A;  4AV7 A;  3CKB A;  2GRM A;  4GTS A;  4U7E B;  2X6K A;  4RG6 A;  4AP2 A;  4HS2 A;  3Q49 B;  2LAI A;  3E30 A;  3UIO C;  2WXM A;  2ILR A;  5DBK A;  4PUC A;  2VSN A;  4YND A;  4LUN U;  2PZI A;  4FU3 A;  3FTX A;  2DYR E;  3EIQ C;  2FEZ A;  1UW4 B;  2J9Q A;  1X81 A;  3TAX A;  3QNK A;  1IQU A;  5ITZ F;  3R9A B;  1DC2 A;  3MA5 A;  3RAU A;  4BT9 A;  2VSO E;  1HZ4 A;  1H6O A;  4GB9 A;  1UN9 A;  3HXF A;  1N95 A;  4JEH A;  2VGY A;  2XCB A;  4GML A;  2PQN A;  3Q78 A;  3NZS A;  2F0Y A;  1UN8 A;  1E90 A;  4WND A;  3TWX A;  3VTX A;  3B7R L;  3I5P A;  3FH7 A;  3ZW3 A;  4LNG A;  3PEU B;  4UQX A;  5EIL A;  4KZ0 A;  2H6I A;  3W9G A;  2AJA A;  3CK8 A;  1NA0 A;  3ZEF A;  1IKN D;  5FQ7 A;  4I9C A;  2I6H A;  1JUQ A;  1LF8 A;  2V8S E;  3BQO A;  3O4Z A;  2R03 A;  5ENR D;  2IOL A;  1E8W A;  4I43 A;  4NIK A;  3P1U A;  1IXV A;  4GTR A;  1HFA A;  1FVF A;  2LSV A;  3ISM C;  1SA5 A;  1NFI E;  5BNW A;  4KZC A;  3DRA A;  4CCA A;  5FWQ A;  3FUJ A;  4L1B A;  3L16 A;  3CHP A;  2FBN A;  1LTX A;  1U3C A;  5C2Y A;  4MKT A;  3PNT B;  3UTM A;  3R7Q A;  2X38 A;  1K1B A;  3V30 A;  5CBN A;  4GA1 A;  3FUE A;  3S2A A;  3RRU A;  4IYP A;  2P9N G;  3Q15 A;  5G05 J;  4IUL A;  1U2V G;  3DEO A;  5KCM A;  3ESL A;  5CCM A;  4HLE A;  1KZO A;  1P5Q A;  4GCN A;  3ASF A;  3ZN3 A;  2P9I G;  4PS3 A;  3DBS A;  4JEU A;  2I1J A;  4NRH B;  4K0R A;  3Q9U C;  3WG7 E;  1WAO 1;  3HYM B;  1L5J A;  2GGF A;  1NA3 A;  1EDU A;  4I9E A;  1MJ0 A;  3UKR G;  3JUE A;  1N54 A;  2F37 A;  5FIN A;  4H7X A;  3QDN A;  4O6F A;  1B89 A;  4GZ3 A;  1ZU2 A;  4YDW A;  3ML9 A;  1AWC B;  3RO2 A;  2ZGG A;  3JXI A;  3CVW A;  1DCE A;  4JHR A;  3C98 A;  3DSU A;  4BFR A;  3NBN B;  1ELK A;  4ME2 A;  1LD7 A;  2L9B A;  2R17 C;  3CKC A;  1Q2Z A;  3APC A;  4GTT A;  3D9J A;  3MX3 A;  1AP7 A;  4ANV A;  2OV8 A;  3MKR A;  4TXP A;  3ASG A;  3PZ3 A;  2CHZ A;  3NB2 A;  5AJD A;  4K5B A;  2WXI A;  4UWH A;  2CG2 A;  5JHB A;  3TWS A;  4A1G A;  1KPS B;  5G55 A;  3C5R A;  2XHE A;  3ZRH A;  3CEQ A;  3SFY A;  2AVP A;  4U8Y D;  3RK6 A;  4EQF A;  1H6P A;  3OXL A;  4DX7 D;  3L08 A;  4AEZ C;  5IY5 E;  3SFZ A;  4AY6 A;  1KLX A;  3FEX A;  4Q69 A;  5E76 A;  4OYS A;  4EHM A;  4HXI A;  4XEI G;  2VJ8 A;  2A4Z A;  3EHM A;  1FCH A;  4XKC A;  3B13 A;  3GZS A;  3ASO E;  4KVO A;  1EPU A;  5DIZ A;  3JYS A;  4M3O A;  3ZFW A;  1OY3 D;  1INZ A;  3I4R B;  3PZ4 A;  1O1S A;  3TG5 A;  2H6F A;  2J49 A;  2P9K G;  3TXM A;  3T5X A;  4RLY A;  5H7P A;  2ZGD A;  1S63 A;  5AJL A;  2R2L A;  2R02 A;  4RVB A;  3RRN B;  4G23 A;  1YYH A;  4XZ4 A; 
#chains in the Genus database with same CATH homology
 4B93 B;  4JB8 P;  1MX6 A;  3UXG A;  1TR4 A;  5EID A;  3IXE A;  3TWW A;  3V2X A;  4F6R D;  1YMP A;  5KBA A;  2FO1 E;  5EN5 D;  5HKP A;  3UTM A;  5KWD A;  2Y0B G;  4HQD A;  4A63 B;  4BET A;  2V4H C;  4F1P A;  4K5B A;  5KNH D;  1BU9 A;  1K1B A;  2DVW A;  5CED B;  5HRY A;  1IHB A;  3V30 A;  5ITZ F;  1SVX A;  1DC2 A;  5CBN A;  3TWS A;  3V31 A;  4DX5 D;  2VGE A;  4O60 A;  3NOG D;  4HRM B;  4Z68 A;  4OAV B;  1SW6 A;  4G8L A;  1BLX B;  2ETA A;  4HLL A;  3C5R A;  4CYM D;  4O1P A;  5EYP F;  4HB5 A;  2DZN A;  4YDY A;  3ZNG A;  5EYL A;  5FIO A;  3DEO A;  4OAU C;  5CEC B;  3TWQ A;  2XEN A;  4G8K A;  4U8Y D;  1D9S A;  1N0Q A;  1QYM A;  3DEP A;  4N5Q A;  3TWV A;  3W9F A;  1DCQ A;  2B0O E;  2XZT G;  4TUM A;  3UI2 A;  4BEP A;  5ENP D;  5ENT D;  3F6Q A;  5AAO A;  4ZHB A;  3J5Q B;  4DX7 D;  2QC9 A;  1A5E A;  4J7W A;  4U8V D;  3T8K A;  3T9K A;  3TWX A;  4HBD A;  3NOC D;  4BSZ B;  2MYO A;  1WDY A;  1S70 B;  3V2O A;  5BXU A;  2L6B A;  5AAR A;  2JAB A;  1K1A A;  3Q9U C;  5AN8 A;  4LG6 A;  5EIL A;  3J5P A;  3LJN A;  3ZU7 B;  2QYJ A;  4DX1 A;  2DZO A;  4HRL A;  1BI8 B;  3W9G A;  2AJA A;  3Q9N C;  5ENO D;  3TWR A;  4BER A;  2RFM A;  3B95 A;  2XEE A;  3EHQ A;  4CZ2 D;  1MJ0 A;  2V5Q C;  3JUE A;  1IKN D;  2F37 A;  5ENS D;  1UOH A;  2J8S D;  5CER B;  3B7B A;  4DX2 A;  1MYO A;  5CEA A;  4HRN A;  5FIN A;  4QFV A;  5AQ7 A;  3EU9 A;  1K3Z D;  1MX4 A;  4YDW A;  3HRA A;  5AQA A;  2HE0 A;  3AJI A;  3EHR A;  5AQB A;  4DRX E;  1BI7 B;  1AWC B;  4J8Y A;  1BD8 A;  4C48 B;  2F8X K;  2KBX A;  3KEA A;  2KXP C;  2BKG A;  2ZGG A;  5CBO A;  4QQI A;  2A5E A;  1WG0 A;  4HI9 A;  2BKK B;  3JXI A;  4LNU D;  5ENR D;  2NYJ A;  3SO8 A;  4DUI A;  4HI8 A;  5JA4 D;  4NIK A;  3ZUV B;  1IXV A;  2XZD G;  5JMN D;  2Y1L E;  1N0R A;  5ENQ D;  3TWU A;  4BES A;  4GMR A;  5KNG A;  4LSZ E;  5HS0 A;  1OY3 D;  3TWT A;  2PNN A;  4U95 D;  4DX6 D;  1MX2 A;  3HG0 D;  4O1O A;  2RFA A;  4UUC A;  3NBN B;  4ATZ D;  4HNA D;  1G3N B;  4GPM A;  2P2C P;  1YCS B;  3JXJ A;  2ETC A;  4RLY A;  2XEH A;  1NFI E;  4U96 D;  2ZGD A;  2F8Y A;  5D66 A;  3ZKJ A;  5EIB E;  3V79 K;  1OT8 A;  4K5C A;  4K5A B;  2ETB A;  1AP7 A;  5AQ9 A;  3AAA C;  2DWZ A;  1N11 A;  1YYH A;  3D9H A;  4ZFH A;  5BXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...