2P9IG

Crystal structure of bovine arp2/3 complex co-crystallized with adp and crosslinked with gluteraldehyde
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
143
structure length
137
Chain Sequence
b'ARFRKVDVDEYDENKFVDEDAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 42
structure length 137
sequence length 143
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 2p9iG00
1U2VG 4JD2G 1TYQG 2P9LG 3DXKG 3DXMG 3UKUG 3DWLG 2P9PG 2P9KG 2P9SG 2P9NG 4XEIG 3RSEG 2P9IG 3ULEG 3UKRG 2P9UG 1K8KG
chains in the Genus database with same CATH superfamily
2IU1A 4GTQA 4FJZA 4A1GA 3HDXA 5KBAA 2ETAA 4F3VA 4HB5A 3UM0A 3ZYLA 1UG3A 2Y1LE 3D9NA 2L0IA 3LS8A 5H7PA 3SD5A 3HIZA 2XS1A 4J0UA 4TUUA 4TXPA 4LERA 4GMJA 3LCAA 3R7QA 4ACKA 3EJNA 5LFAA 2XGSA 4RQIA 3VTXA 1ZBPA 1WDYA 4ANUA 2XEVA 2BKGA 3FTWA 3ZVVA 3UT4A 4N3BA 5KJKA 2OV8A 2H6HA 4CEMA 3NB2A 5CRUA 4I2WA 4AY5A 3FUJA 3LXUX 4H7XA 4ME2A 2HR2A 3TWQA 1TNZA 1HH8A 1Z5SC 4LUNU 5KJNA 1TJFA 2E0IA 3FUKA 4M3OA 4B0ZA 4GCNA 3ZW3A 3LKUA 5JA4D 3D9JA 2RFAA 4GA1A 2XPIA 4YDEA 4FLBA 5JJ7A 5BXUA 2R03A 1QZ2A 3PDNA 2OOEA 2BEDA 1KT1A 4B93B 5FWQA 2MRIA 1HG2A 3DSXA 4KVOA 3MCXA 4FC8A 2FEZA 2QY7A 3PUJA 4LCTA 3DPYA 2Y4UA 3CVUA 3B13A 3QK0A 1EYHA 2QZAA 3W9GA 3I5PA 3TL5A 1TR4A 4NURA 3AG3E 1K1BA 3JXJA 1YYHA 3C5RA 5KCMA 3Q4AB 3RU0A 3UKUG 4HBDA 3DWLG 4ANVA 1OXJA 3ZFWA 4GTPA 5FZQA 3LY9A 4IN3B 5FQ8A 1FVHA 1OWMA 3QJZA 1N11A 3IXEA 2IO3C 4BTAA 3HXCA 5G04J 3TWUA 3MKQB 5ARFA 4WNGA 2UY1B 4DX5D 2HM8A 2WQ6A 2LAIA 4YVQC 3HXFA 2IONA 3L13A 2R5SA 4GB9A 1N95A 4KZ0A 3ZXPA 5ENOD 3ZN3A 3HVEA 1N4SA 4AV7A 2FI7A 2ONDA 3ZGQA 2FO1E 4GTRA 3CSTA 1FVFA 1NZNA 2VGXA 3AJIA 4Q96A 2Y3AA 4KVMA 2JEKA 3CVYA 3EIJA 3SGHA 2YNQA 5D0OD 3TAXA 4DI3A 4I17A 4BSZB 4A3VA 2GRRB 1D8EA 3CR3A 4IYPA 1OCZE 4JEUA 2OVBA 4GAAA 3AS8A 2EQXA 3MEKA 1HZ4A 4BWRA 3SHFA 3SI5A 3TGOA 3EDTB 1MHQA 5A23A 4Q69A 4CT4A 4W9RA 2AWIA 5AQAA 4PH4B 3D9OA 2QFCA 3Q47B 4KZCA 1MQSA 4I9EA 4WNEA 4U63A 1LD8A 3C3OA 2OEWA 2NYJA 3OAWA 1H6PA 4JB8P 4GTSA 4JA9A 3ZHEA 2R2LA 4PS8A 2LSUA 1DVPA 4EPZA 4DX1A 3DSVA 4GZDA 3I3NA 2IQCA 3FEYA 2LXMA 2CG2A 3K9IA 2XRYA 2WXIA 1W3BA 1Z3XA 4HLLA 2YHCA 3TWSA 3U3WA 2WXFA 2XPZA 3RJVA 5EX0A 1GW6A 4GYOA 3LY8A 5C1DA 2A5UA 1E8ZA 1N9AA 3APFA 3I4RB 1DC2A 4LRZA 1BPOA 3CK8A 1V55E 1OCRE 4I6EA 4DX6D 3CVQA 2KATA 4AEZC 2LAHA 2VGEA 2V0PA 2Y0BG 5CHEE 2DYSE 3LY7A 5IY5E 3QB2A 2XPYA 4BEPA 4JD2G 4N2SA 4G1TA 3ZXSA 4JXTA 5ENTD 5AQ9A 3HVEB 2DZOA 3R9MA 2XEHA 3CLJA 3ASGA 5CCMA 3LVQE 4BX9A 4H7YA 4JEHA 2VGXB 4GMLA 3VTYA 2KCLA 1UJKA 2ZGGA 4GMRA 3IHYA 3HYMB 1SVXA 4ATGA 1L5JA 3NAWA 3FUIA 1H6KA 4ANWA 2XQ0A 3PREA 4BFRA 4XKBA 4HOSA 1O1SA 1E8XA 5HKPA 5BV0A 3L54A 1BI7B 4GZ3A 4LG6A 2J9QA 4C0EA 4N5QA 3UI2A 4G11A 4K03A 4OVVA 3FH5A 4F1SA 3ESLA 4EECA 1AWCB 4DLQA 3JUEA 3B95A 3CVLA 3C3RA 1X81A 4K0RA 3JQ1A 4BESA 3FH7A 3MJWA 2WXPA 3NZUA 2PM6A 3D9MA 4UWLA 4YVOA 4ILIA 4UI9J 1DCQA 2DBAA 3CIAA 1WAO1 1B89A 1HS6A 4CGWA 1JPLA 2X6IA 1N4PA 2AXVA 1S63A 4RG6A 3Q7AA 3ZHEB 1FT1A 4TXQA 3FUNA 3B7UX 5JHBA 4ATZD 2KBXA 2IJGX 5FQ4A 1ELKA 2GRPB 3L08A 4HOUA 3R7RA 4FHKA 4BERA 2EILE 2L6BA 4UQZA 3UM3A 3FUDA 1TEZA 1E96B 3Q9UC 2NSZA 4ACLA 2BTDA 3ZKJA 2WXJA 3FU6A 2XCCA 1MX6A 2AJAA 1IYGA 3T5VA 1ELWA 1A5EA 4B94A 3QAQA 2V5FA 2GRNB 4BSXA 3APCA 3EUVA 5ENQD 5CBNA 4YDOA 3ZIMA 1U3DA 3TWWA 1H2VC 3MYVA 3Q15A 3V31A 3RSEG 3QNKA 3UT7A 3S7BA 4I1MA 2GRMA 5DBKA 4HRMB 4HRNA 2X38A 5FINA 3TJPA 3CHOA 3OTNA 3UX4A 3SFXA 5AYWD 2H6IA 2J4BA 4WNDA 2WXMA 3SFZA 4F53A 3EHNA 3T5XA 4FLHA 3IBEA 1S0PA 2X6FA 3ABME 2ILRA 3NOGD 3LJNA 2E2EA 1Z6TA 5AAOA 3C72A 5AIJA 4Y6CA 1IXVA 3D9HA 3TWTA 1IKND 1QYMA 3CHSA 1YMPA 4HI8A 2KZTA 4N39A 4F1PA 3BG1B 3Q9NC 3EIQC 4HFGA 3ASNE 3QDNA 2JABA 4DLOA 4BT9A 1TYQG 2WVIA 1MJ0A 4GA2A 4J8YA 5BXOA 4RLYA 5FT9A 3ONLA 3FU5A 1O1RA 1KZOA 3Q5MA 3DBSA 2CG3A 4HS2A 1YCSB 4JA7A 2YHEA 2VYIA 1H19A 4GTVA 4C0MA 3AU4A 5JJ6A 3J5PA 3URZA 2NXPA 4LNGA 4J6IA 5G2NA 3ASFA 3AG2E 1D8DA 3T8MA 5LCWC 3ZYQA 3JXIA 2R17C 4ANXA 5HI7A 5AQBA 3PS6A 3QARA 2A4ZA 4BT8A 4JW1A 2WXHA 2KC7A 3IV0A 3CVXA 4GYYA 3ZNGA 3O4ZA 4GCOA 3B7BA 3KS2A 4OAVB 1XNFA 3DSUA 5LX8A 3Q7FA 4JZYA 2AXUA 4RSYA 1OWOA 4GTOA 5CERB 1D9SA 5EN5D 5AN8A 1FT2A 3QWPA 4JPSA 4UUCA 4D10C 4G8KA 1N0QA 3PNTB 2V8SE 4G24A 2LNIA 4HORA 4I2ZA 3DSWA 4GA0A 3WXXA 4HOTA 5A6CA 2FF4A 5ARGA 4AJWA 4IULA 2WXQA 4HOQA 4FADA 3LDZA 2C2LA 2EIJE 2HE0A 2PNNA 5EIDA 5FQ6A 3L82A 3ULYA 2XHEA 4HVBA 1MYOA 3ONKA 4CYMD 4YDWA 2KZTB 4C48B 2GRQB 3FUHA 5D2MC 2IFUA 4BY6A 2DCPA 3TWXA 2C0MA 2R05A 5FTPA 2XS8A 3AAAC 2V4LA 2XZTG 3ZEFA 1O5MA 4NRHB 5EDSA 2AXZA 3EHMA 3KAEA 3LEWA 3L16A 4PS3A 5CCLA 5HRYA 4APOA 3ESKA 5ENPD 5CMWA 4RVBA 3S7FA 2WQHA 4ILGA 3SQVA 2YQ8A 3HG0D 3JUIA 5LP0A 3JYSA 4N3CA 4ZFHA 3AG4E 4LNBA 3FTVA 3PE4A 5D0QD 1E7UA 1OUVA 4APFA 1OY3D 3CVWA 5EYPF 1SZ9A 3PH0C 1LD7A 3ENEA 3FHEA 2J4DA 3PVLA 4MLPA 4UWGA 3PNLB 2IOLA 4KT6B 3E33A 3CGHA 3ULEG 3KSQA 3RKVA 4CDNA 5G05C 4I6GA 1KPSB 2KCVA 1A17A 4JL0A 2GW1A 4G25A 5KNGA 2XZDG 2CFUA 1SZAA 4CGVA 3Q79A 4JHKA 4MRUA 2P9UG 2P58C 3FWVA 4FJYA 3QOUA 2WXKA 1BI8B 4HQDA 2J07A 2LXLA 2ZISA 1H2TC 3FTZA 5G04C 3L17A 2WM9A 4DJAA 2I9CA 3DPDA 3NOCD 2X6KA 3FTUA 5B1BE 4B8CB 2WMOA 4U0ZA 4Q94A 3PUKA 2ZU6B 3G2WA 3FP3A 4U7EB 2PM7A 2I6HA 3T8KA 3DEOA 5BT1A 4IRUA 3UMVA 4A1SA 4O60A 4X8QA 5G55A 1HX8A 4M7CA 2KXPC 1OWLA 4RG9A 5EIBE 3VLEA 3LPZA 4QFVA 3ZYKA 4ILHB 4PDXA 1H2UA 5T8IA 4WAFA 1UJJA 4HLEA 4J7WA 1K1AA 5C2YA 3D9KA 2J08A 3ASOE 4U8YD 1WM5A 1N4QA 4HI9A 2WMNA 4N3AA 3SBTB 2MOWA 3V30A 1S64A 2GGFA 5KJMA 1E90A 1Y6IA 1O1TA 2OVFA 2IOSA 4AM9A 4NQ0A 1JCSA 1HO8A 4CZ2D 4GU5A 2P9PG 3UT8A 3QKYA 4A3TA 3TWRA 4JVSA 4EZJA 4JHRA 3O48A 5CEAA 1SW6A 3X2QE 3U9WA 2FULA 3V2XA 4MKTA 4KXKB 4O1OA 4U04A 1N54A 5KJLA 3FEXA 1N0RA 5KNHD 3MZLB 4OVUA 4KBQA 1N94A 4XX5A 4EZKA 3BU8A 4E6HA 3DXKG 1HFAA 3C98A 3IEGA 4DX2A 2WXRA 3ASDA 4JC8A 5E75A 2I1KA 2C0LA 5AARA 4LNUD 4WNFA 2WXOA 1OWPA 3FUEA 2VQ2A 1NFIE 3UM1A 2DZNA 3CVVA 1MX4A 4UWFA 4ZHBA 5AENA 3PEUB 2YINA 3D3MA 2RD0A 1EDUA 5E76A 2IF4A 4PUCA 3RIBA 1KZPA 4G26A 2V5QC 2PQRA 1G3NB 1Y8MA 1V54E 2HO1A 5BV1A 4GTTA 2KM4A 5B3SE 3PZ2A 4BETA 4A63B 4N5CA 3CKBA 3B7TA 3SO8A 3FUFA 4AVXA 4XZ4A 1Z3YA 3CK9A 3EHQA 1UN8A 4HNAD 3UKRG 1EF1C 1H0AA 4EZLA 3FULA 3N71A 3JQ0A 4YDYA 3SNXA 3HXDA 4AOFA 1HF8A 3DRAA 4Z68A 2GRLA 1INZA 5ITZF 3D9PA 3L6AA 3AU5A 5BUZA 3PE3A 2P2CP 3ISMC 4L7TA 2F37A 1XGWA 3UIOC 3D9LA 3HRAA 4XKCA 3EU5A 4K5BA 2PQNA 4OYSA 4XEIG 2XEEA 2PZIA 1UW4B 2UY1A 3OXLA 1IHBA 4OAUC 4UI9C 2EIKE 3DXMG 5BW8C 3FU0A 2XGMA 2CHZA 4TUMA 3P2BA 3AG1E 4QQIA 2UWJG 5CRVA 4U95D 2X6HA 3UPVA 3Q75A 3ZRHA 3GZ2A 2M63A 4EQFA 2ZIRA 3CQCB 3OXGA 3T9KA 1JWGA 1TNUA 3IHVA 3UQ3A 5ENRD 3KEAA 2B6CA 3VLDA 4DI4A 3Q78A 2P9NG 5J90A 4R7LA 4BX8A 4HXIA 4DX7D 3BUAA 4O1PA 3E37A 3J5QB 5EKQD 4U07A 2DWZA 3B7SA 1H6OA 2RG8A 2Q7FA 3VLFA 2L9BA 4K5AB 3TG5A 4XI0A 2WB2A 3HXBA 1SA4A 3E34A 3G2TA 1KLXA 1P5QA 5FQ7A 3GZ1A 3S7JA 2EINE 3MGBA 2VSNA 3E30A 4DK5A 4FULA 2X6JA 2DIWA 5JJTA 3DSSA 3FTYA 5FZRA 1UN9A 3OXFA 2LSVA 4PS7A 3G2UA 3RRNB 1DNPA 4FHJA 1QQEA 2MHKA 1NA0A 4UWKA 4NACA 5KWDA 3KD7A 4WWNA 4CDMA 3UUXA 2F0YA 3DSTA 3BG0B 4GZCA 1TNOA 3U66A 5G05J 1HE8A 1E7VA 2P9SG 2R02A 5FIOA 4DRXE 1JCRA 1K3ZD 1SQMA 2WPVA 4F6RD 3D9IA 2WQ7A 3CV0A 3NZSA 1JUQA 3KSLA 3RK6A 4YNDA 1IQRA 1WY6A 1MZCA 2AVPA 2J8SD 2P9KG 2WXLA 4TRQA 2ETCA 4J8SA 5CEDB 2VSOE 4JHJA 1HU3A 1JWFA 1FPPA 1MX2A 2HYZA 2QYUA 1AP7A 3MV3B 3Q49B 4XE0A 4DPRA 3V79K 1QBQA 1NA3A 3ZUVB 4G2VA 5LOZA 2KCKA 3E32A 2OCCE 1EPUA 3SZ7A 1VDYA 5HQ8A 4L23A 4GYWA 2RKKA 1OCCE 4LSZE 2F8YA 2H6GA 4TV3A 4U0UA 4FU3A 3MKRA 2EIME 5AQ7A 2J49A 3BQOA 3EHRA 4AXHA 1ZB1A 3ABLE 1U2VG 3S2AA 2FBNA 4XIFA 3L22A 2H6FA 3ZU7B 4B8AA 2VTBA 1TN8A 2VSXE 5EILA 4CCAA 3PZDA 5DIZA 2JLBA 1Q2ZA 2IY0C 4KMOA 5CECB 2VJ8A 5HS0A 4EBAA 3CSFA 1IQUA 2Y4TA 1ELRA 4G23A 4A55A 1JCQA 3V2OA 5CBOA 4I9CA 4N2QA 2A5EA 2OEVA 2VGYA 2X3MA 1TNBA 3JCKC 4MS6A 4CDRA 5B1AE 3SBSA 3MV2B 4Y6WA 3Q73A 3CHQA 3AS4A 4GZ5A 1N4RA 3UM2A 3UIPC 4GTMA 4GZ6A 4UQYA 3ML8A 4F7AA 2P9LG 4WUYA 4UI9K 4U8HA 5BPPA 1X5BA 4K5CA 1PC2A 1OWNA 4L9PA 2QC9A 1LTXA 1DCEA 5EYLA 3RRMB 4EHMA 2ETBA 2L6JA 2RFMA 2CHWA 3CK7A 2WXNA 2BUGA 3L9TA 4FP7A 3SY2A 2R59A 3APDA 3ULQA 4V3IA 5AJDA 5FZSA 2V4HC 4C9BB 2ZXWE 3C3QA 1KT0A 1IHGA 4G8LA 3AS5A 4GPMA 3HHMA 3CHMA 3DEPA 3ZPJA 1PY1A 1K8KG 3TXNA 3NQPA 2VSYA 4TXRA 5M72A 2MYOA 3RO3A 1BLXB 4HRLA 5T3RA 1E8WA 3UINC 5ANLA 5ENSD 5ENNA 1U3CA 4L2LA 5FJYA 2BF0X 3FDHA 3SFYA 2XCBA 3PRZA 5ANRA 3CKCA 3E4BA 1OT8A 4AY6A 3TG4A 1OCOE 2GROB 3RRUA 2CFZA 1WG0A 3PZ1A 4LEUA 3BEEA 3LYAA 1NL4A 2VTBB 4ABNA 3CQGB 2B0OE 3ASHA 3RAUA 2AW6A 3WG7E 3TXMA 3I4GA 4U96D 4E85A 4L1BA 2XGOA 4P29A 4BTBA 2PL2A 3ML9A 2ZGDA 4I1OB 4UQXA 1SA5A 1RZ4A 2P9IG 4I1AA 3R9AB 5A7DB 3KEZA 3CHRA 3QWVA 3FH8A 1RW2A 3G2VA 4CRWA 3CEQA 4NIKA 5CMYA 1NI1A 3PZ4A 5EX3A 4WWPA 1ZU2A 4GPKA 1TN6A 3MA5A 3TWVA 4L2YA 1PAQA 2LUHA 1LF8A 3FY4A 2L0TB 2DYRE 2I2OA 3RO2A 2CHXA 3LVRE 4CT0A 1YA0A 2FO7A 3F6QA 3GYZA 3B7RL 1TJCA 3HXEA 1TNYA 3ABKE 2QYJA 4U0SA 4J8FA 4WWOA 3NF1A 1HG5A 1N52A 5D66A 1QNFA 2J09A 3CVNA 2IEJA 3IKOB 3FTSA 4UWHA 4KYOB 4EBAG 3QWWA 1S70B 3ZYMA 3NBNB 4J8DA 3FUMA 3FTXA 3S7DA 5LCWJ 2WXGA 4O6FA 3FFLA 3G2SA 2Y69E 3P1UA 1UOHA 3GW4A 2BKKB 2I1JA 2LO6A 1NP7A 4URKA 3EU9A 3MX3A 3UTMA 4DUIA 5JMND 3U64A 3CVPA 4XI9A 1BU9A 4U8VD 2F8XK 2DVWA 3W9FA 3PEVB 2IO2C 1E8YA 3GZSA 5BNWA 4FA6A 4B89A 2XRZA 3LJ3A 1FCHA 3PZ3A 1TN7A 4I43A 3FU3A 3UXGA 3CHPA 4J8EA 1HXIA 4AIFA 4I6JA 1BD8A 4MBGA 5JHAA 5J08A 3QC1A 5AJLA 3U4TA 4AP2A 2NC9A 2XENA 3SF4A 3MKQA 5T4YA
chains in the Genus database with same CATH topology
1U2VG 4JD2G 1TYQG 2P9LG 3DXKG 3DXMG 3UKUG 3DWLG 2P9PG 2P9KG 2P9SG 2P9NG 4XEIG 3RSEG 2P9IG 3ULEG 3UKRG 2P9UG 1K8KG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U2V G;  4JD2 G;  1TYQ G;  2P9L G;  3DXK G;  3DXM G;  3UKU G;  3DWL G;  2P9P G;  2P9K G;  2P9S G;  2P9N G;  4XEI G;  3RSE G;  2P9I G;  3ULE G;  3UKR G;  2P9U G;  1K8K G; 
#chains in the Genus database with same CATH topology
 2IU1 A;  4GTQ A;  4FJZ A;  4A1G A;  3HDX A;  5KBA A;  2ETA A;  4F3V A;  4HB5 A;  3UM0 A;  3ZYL A;  1UG3 A;  2Y1L E;  3D9N A;  2L0I A;  3LS8 A;  5H7P A;  3SD5 A;  3HIZ A;  2XS1 A;  4J0U A;  4TUU A;  4TXP A;  4LER A;  4GMJ A;  3LCA A;  3R7Q A;  4ACK A;  3EJN A;  5LFA A;  2XGS A;  4RQI A;  3VTX A;  1ZBP A;  1WDY A;  4ANU A;  2XEV A;  2BKG A;  3FTW A;  3ZVV A;  3UT4 A;  4N3B A;  5KJK A;  2OV8 A;  2H6H A;  4CEM A;  3NB2 A;  5CRU A;  4I2W A;  4AY5 A;  3FUJ A;  3LXU X;  4H7X A;  4ME2 A;  2HR2 A;  3TWQ A;  1TNZ A;  1HH8 A;  1Z5S C;  4LUN U;  5KJN A;  1TJF A;  2E0I A;  3FUK A;  4M3O A;  4B0Z A;  4GCN A;  3ZW3 A;  3LKU A;  5JA4 D;  3D9J A;  2RFA A;  4GA1 A;  2XPI A;  4YDE A;  4FLB A;  5JJ7 A;  5BXU A;  2R03 A;  1QZ2 A;  3PDN A;  2OOE A;  2BED A;  1KT1 A;  4B93 B;  5FWQ A;  2MRI A;  1HG2 A;  3DSX A;  4KVO A;  3MCX A;  4FC8 A;  2FEZ A;  2QY7 A;  3PUJ A;  4LCT A;  3DPY A;  2Y4U A;  3CVU A;  3B13 A;  3QK0 A;  1EYH A;  2QZA A;  3W9G A;  3I5P A;  3TL5 A;  1TR4 A;  4NUR A;  3AG3 E;  1K1B A;  3JXJ A;  1YYH A;  3C5R A;  5KCM A;  3Q4A B;  3RU0 A;  3UKU G;  4HBD A;  3DWL G;  4ANV A;  1OXJ A;  3ZFW A;  4GTP A;  5FZQ A;  3LY9 A;  4IN3 B;  5FQ8 A;  1FVH A;  1OWM A;  3QJZ A;  1N11 A;  3IXE A;  2IO3 C;  4BTA A;  3HXC A;  5G04 J;  3TWU A;  3MKQ B;  5ARF A;  4WNG A;  2UY1 B;  4DX5 D;  2HM8 A;  2WQ6 A;  2LAI A;  4YVQ C;  3HXF A;  2ION A;  3L13 A;  2R5S A;  4GB9 A;  1N95 A;  4KZ0 A;  3ZXP A;  5ENO D;  3ZN3 A;  3HVE A;  1N4S A;  4AV7 A;  2FI7 A;  2OND A;  3ZGQ A;  2FO1 E;  4GTR A;  3CST A;  1FVF A;  1NZN A;  2VGX A;  3AJI A;  4Q96 A;  2Y3A A;  4KVM A;  2JEK A;  3CVY A;  3EIJ A;  3SGH A;  2YNQ A;  5D0O D;  3TAX A;  4DI3 A;  4I17 A;  4BSZ B;  4A3V A;  2GRR B;  1D8E A;  3CR3 A;  4IYP A;  1OCZ E;  4JEU A;  2OVB A;  4GAA A;  3AS8 A;  2EQX A;  3MEK A;  1HZ4 A;  4BWR A;  3SHF A;  3SI5 A;  3TGO A;  3EDT B;  1MHQ A;  5A23 A;  4Q69 A;  4CT4 A;  4W9R A;  2AWI A;  5AQA A;  4PH4 B;  3D9O A;  2QFC A;  3Q47 B;  4KZC A;  1MQS A;  4I9E A;  4WNE A;  4U63 A;  1LD8 A;  3C3O A;  2OEW A;  2NYJ A;  3OAW A;  1H6P A;  4JB8 P;  4GTS A;  4JA9 A;  3ZHE A;  2R2L A;  4PS8 A;  2LSU A;  1DVP A;  4EPZ A;  4DX1 A;  3DSV A;  4GZD A;  3I3N A;  2IQC A;  3FEY A;  2LXM A;  2CG2 A;  3K9I A;  2XRY A;  2WXI A;  1W3B A;  1Z3X A;  4HLL A;  2YHC A;  3TWS A;  3U3W A;  2WXF A;  2XPZ A;  3RJV A;  5EX0 A;  1GW6 A;  4GYO A;  3LY8 A;  5C1D A;  2A5U A;  1E8Z A;  1N9A A;  3APF A;  3I4R B;  1DC2 A;  4LRZ A;  1BPO A;  3CK8 A;  1V55 E;  1OCR E;  4I6E A;  4DX6 D;  3CVQ A;  2KAT A;  4AEZ C;  2LAH A;  2VGE A;  2V0P A;  2Y0B G;  5CHE E;  2DYS E;  3LY7 A;  5IY5 E;  3QB2 A;  2XPY A;  4BEP A;  4JD2 G;  4N2S A;  4G1T A;  3ZXS A;  4JXT A;  5ENT D;  5AQ9 A;  3HVE B;  2DZO A;  3R9M A;  2XEH A;  3CLJ A;  3ASG A;  5CCM A;  3LVQ E;  4BX9 A;  4H7Y A;  4JEH A;  2VGX B;  4GML A;  3VTY A;  2KCL A;  1UJK A;  2ZGG A;  4GMR A;  3IHY A;  3HYM B;  1SVX A;  4ATG A;  1L5J A;  3NAW A;  3FUI A;  1H6K A;  4ANW A;  2XQ0 A;  3PRE A;  4BFR A;  4XKB A;  4HOS A;  1O1S A;  1E8X A;  5HKP A;  5BV0 A;  3L54 A;  1BI7 B;  4GZ3 A;  4LG6 A;  2J9Q A;  4C0E A;  4N5Q A;  3UI2 A;  4G11 A;  4K03 A;  4OVV A;  3FH5 A;  4F1S A;  3ESL A;  4EEC A;  1AWC B;  4DLQ A;  3JUE A;  3B95 A;  3CVL A;  3C3R A;  1X81 A;  4K0R A;  3JQ1 A;  4BES A;  3FH7 A;  3MJW A;  2WXP A;  3NZU A;  2PM6 A;  3D9M A;  4UWL A;  4YVO A;  4ILI A;  4UI9 J;  1DCQ A;  2DBA A;  3CIA A;  1WAO 1;  1B89 A;  1HS6 A;  4CGW A;  1JPL A;  2X6I A;  1N4P A;  2AXV A;  1S63 A;  4RG6 A;  3Q7A A;  3ZHE B;  1FT1 A;  4TXQ A;  3FUN A;  3B7U X;  5JHB A;  4ATZ D;  2KBX A;  2IJG X;  5FQ4 A;  1ELK A;  2GRP B;  3L08 A;  4HOU A;  3R7R A;  4FHK A;  4BER A;  2EIL E;  2L6B A;  4UQZ A;  3UM3 A;  3FUD A;  1TEZ A;  1E96 B;  3Q9U C;  2NSZ A;  4ACL A;  2BTD A;  3ZKJ A;  2WXJ A;  3FU6 A;  2XCC A;  1MX6 A;  2AJA A;  1IYG A;  3T5V A;  1ELW A;  1A5E A;  4B94 A;  3QAQ A;  2V5F A;  2GRN B;  4BSX A;  3APC A;  3EUV A;  5ENQ D;  5CBN A;  4YDO A;  3ZIM A;  1U3D A;  3TWW A;  1H2V C;  3MYV A;  3Q15 A;  3V31 A;  3RSE G;  3QNK A;  3UT7 A;  3S7B A;  4I1M A;  2GRM A;  5DBK A;  4HRM B;  4HRN A;  2X38 A;  5FIN A;  3TJP A;  3CHO A;  3OTN A;  3UX4 A;  3SFX A;  5AYW D;  2H6I A;  2J4B A;  4WND A;  2WXM A;  3SFZ A;  4F53 A;  3EHN A;  3T5X A;  4FLH A;  3IBE A;  1S0P A;  2X6F A;  3ABM E;  2ILR A;  3NOG D;  3LJN A;  2E2E A;  1Z6T A;  5AAO A;  3C72 A;  5AIJ A;  4Y6C A;  1IXV A;  3D9H A;  3TWT A;  1IKN D;  1QYM A;  3CHS A;  1YMP A;  4HI8 A;  2KZT A;  4N39 A;  4F1P A;  3BG1 B;  3Q9N C;  3EIQ C;  4HFG A;  3ASN E;  3QDN A;  2JAB A;  4DLO A;  4BT9 A;  1TYQ G;  2WVI A;  1MJ0 A;  4GA2 A;  4J8Y A;  5BXO A;  4RLY A;  5FT9 A;  3ONL A;  3FU5 A;  1O1R A;  1KZO A;  3Q5M A;  3DBS A;  2CG3 A;  4HS2 A;  1YCS B;  4JA7 A;  2YHE A;  2VYI A;  1H19 A;  4GTV A;  4C0M A;  3AU4 A;  5JJ6 A;  3J5P A;  3URZ A;  2NXP A;  4LNG A;  4J6I A;  5G2N A;  3ASF A;  3AG2 E;  1D8D A;  3T8M A;  5LCW C;  3ZYQ A;  3JXI A;  2R17 C;  4ANX A;  5HI7 A;  5AQB A;  3PS6 A;  3QAR A;  2A4Z A;  4BT8 A;  4JW1 A;  2WXH A;  2KC7 A;  3IV0 A;  3CVX A;  4GYY A;  3ZNG A;  3O4Z A;  4GCO A;  3B7B A;  3KS2 A;  4OAV B;  1XNF A;  3DSU A;  5LX8 A;  3Q7F A;  4JZY A;  2AXU A;  4RSY A;  1OWO A;  4GTO A;  5CER B;  1D9S A;  5EN5 D;  5AN8 A;  1FT2 A;  3QWP A;  4JPS A;  4UUC A;  4D10 C;  4G8K A;  1N0Q A;  3PNT B;  2V8S E;  4G24 A;  2LNI A;  4HOR A;  4I2Z A;  3DSW A;  4GA0 A;  3WXX A;  4HOT A;  5A6C A;  2FF4 A;  5ARG A;  4AJW A;  4IUL A;  2WXQ A;  4HOQ A;  4FAD A;  3LDZ A;  2C2L A;  2EIJ E;  2HE0 A;  2PNN A;  5EID A;  5FQ6 A;  3L82 A;  3ULY A;  2XHE A;  4HVB A;  1MYO A;  3ONK A;  4CYM D;  4YDW A;  2KZT B;  4C48 B;  2GRQ B;  3FUH A;  5D2M C;  2IFU A;  4BY6 A;  2DCP A;  3TWX A;  2C0M A;  2R05 A;  5FTP A;  2XS8 A;  3AAA C;  2V4L A;  2XZT G;  3ZEF A;  1O5M A;  4NRH B;  5EDS A;  2AXZ A;  3EHM A;  3KAE A;  3LEW A;  3L16 A;  4PS3 A;  5CCL A;  5HRY A;  4APO A;  3ESK A;  5ENP D;  5CMW A;  4RVB A;  3S7F A;  2WQH A;  4ILG A;  3SQV A;  2YQ8 A;  3HG0 D;  3JUI A;  5LP0 A;  3JYS A;  4N3C A;  4ZFH A;  3AG4 E;  4LNB A;  3FTV A;  3PE4 A;  5D0Q D;  1E7U A;  1OUV A;  4APF A;  1OY3 D;  3CVW A;  5EYP F;  1SZ9 A;  3PH0 C;  1LD7 A;  3ENE A;  3FHE A;  2J4D A;  3PVL A;  4MLP A;  4UWG A;  3PNL B;  2IOL A;  4KT6 B;  3E33 A;  3CGH A;  3ULE G;  3KSQ A;  3RKV A;  4CDN A;  5G05 C;  4I6G A;  1KPS B;  2KCV A;  1A17 A;  4JL0 A;  2GW1 A;  4G25 A;  5KNG A;  2XZD G;  2CFU A;  1SZA A;  4CGV A;  3Q79 A;  4JHK A;  4MRU A;  2P9U G;  2P58 C;  3FWV A;  4FJY A;  3QOU A;  2WXK A;  1BI8 B;  4HQD A;  2J07 A;  2LXL A;  2ZIS A;  1H2T C;  3FTZ A;  5G04 C;  3L17 A;  2WM9 A;  4DJA A;  2I9C A;  3DPD A;  3NOC D;  2X6K A;  3FTU A;  5B1B E;  4B8C B;  2WMO A;  4U0Z A;  4Q94 A;  3PUK A;  2ZU6 B;  3G2W A;  3FP3 A;  4U7E B;  2PM7 A;  2I6H A;  3T8K A;  3DEO A;  5BT1 A;  4IRU A;  3UMV A;  4A1S A;  4O60 A;  4X8Q A;  5G55 A;  1HX8 A;  4M7C A;  2KXP C;  1OWL A;  4RG9 A;  5EIB E;  3VLE A;  3LPZ A;  4QFV A;  3ZYK A;  4ILH B;  4PDX A;  1H2U A;  5T8I A;  4WAF A;  1UJJ A;  4HLE A;  4J7W A;  1K1A A;  5C2Y A;  3D9K A;  2J08 A;  3ASO E;  4U8Y D;  1WM5 A;  1N4Q A;  4HI9 A;  2WMN A;  4N3A A;  3SBT B;  2MOW A;  3V30 A;  1S64 A;  2GGF A;  5KJM A;  1E90 A;  1Y6I A;  1O1T A;  2OVF A;  2IOS A;  4AM9 A;  4NQ0 A;  1JCS A;  1HO8 A;  4CZ2 D;  4GU5 A;  2P9P G;  3UT8 A;  3QKY A;  4A3T A;  3TWR A;  4JVS A;  4EZJ A;  4JHR A;  3O48 A;  5CEA A;  1SW6 A;  3X2Q E;  3U9W A;  2FUL A;  3V2X A;  4MKT A;  4KXK B;  4O1O A;  4U04 A;  1N54 A;  5KJL A;  3FEX A;  1N0R A;  5KNH D;  3MZL B;  4OVU A;  4KBQ A;  1N94 A;  4XX5 A;  4EZK A;  3BU8 A;  4E6H A;  3DXK G;  1HFA A;  3C98 A;  3IEG A;  4DX2 A;  2WXR A;  3ASD A;  4JC8 A;  5E75 A;  2I1K A;  2C0L A;  5AAR A;  4LNU D;  4WNF A;  2WXO A;  1OWP A;  3FUE A;  2VQ2 A;  1NFI E;  3UM1 A;  2DZN A;  3CVV A;  1MX4 A;  4UWF A;  4ZHB A;  5AEN A;  3PEU B;  2YIN A;  3D3M A;  2RD0 A;  1EDU A;  5E76 A;  2IF4 A;  4PUC A;  3RIB A;  1KZP A;  4G26 A;  2V5Q C;  2PQR A;  1G3N B;  1Y8M A;  1V54 E;  2HO1 A;  5BV1 A;  4GTT A;  2KM4 A;  5B3S E;  3PZ2 A;  4BET A;  4A63 B;  4N5C A;  3CKB A;  3B7T A;  3SO8 A;  3FUF A;  4AVX A;  4XZ4 A;  1Z3Y A;  3CK9 A;  3EHQ A;  1UN8 A;  4HNA D;  3UKR G;  1EF1 C;  1H0A A;  4EZL A;  3FUL A;  3N71 A;  3JQ0 A;  4YDY A;  3SNX A;  3HXD A;  4AOF A;  1HF8 A;  3DRA A;  4Z68 A;  2GRL A;  1INZ A;  5ITZ F;  3D9P A;  3L6A A;  3AU5 A;  5BUZ A;  3PE3 A;  2P2C P;  3ISM C;  4L7T A;  2F37 A;  1XGW A;  3UIO C;  3D9L A;  3HRA A;  4XKC A;  3EU5 A;  4K5B A;  2PQN A;  4OYS A;  4XEI G;  2XEE A;  2PZI A;  1UW4 B;  2UY1 A;  3OXL A;  1IHB A;  4OAU C;  4UI9 C;  2EIK E;  3DXM G;  5BW8 C;  3FU0 A;  2XGM A;  2CHZ A;  4TUM A;  3P2B A;  3AG1 E;  4QQI A;  2UWJ G;  5CRV A;  4U95 D;  2X6H A;  3UPV A;  3Q75 A;  3ZRH A;  3GZ2 A;  2M63 A;  4EQF A;  2ZIR A;  3CQC B;  3OXG A;  3T9K A;  1JWG A;  1TNU A;  3IHV A;  3UQ3 A;  5ENR D;  3KEA A;  2B6C A;  3VLD A;  4DI4 A;  3Q78 A;  2P9N G;  5J90 A;  4R7L A;  4BX8 A;  4HXI A;  4DX7 D;  3BUA A;  4O1P A;  3E37 A;  3J5Q B;  5EKQ D;  4U07 A;  2DWZ A;  3B7S A;  1H6O A;  2RG8 A;  2Q7F A;  3VLF A;  2L9B A;  4K5A B;  3TG5 A;  4XI0 A;  2WB2 A;  3HXB A;  1SA4 A;  3E34 A;  3G2T A;  1KLX A;  1P5Q A;  5FQ7 A;  3GZ1 A;  3S7J A;  2EIN E;  3MGB A;  2VSN A;  3E30 A;  4DK5 A;  4FUL A;  2X6J A;  2DIW A;  5JJT A;  3DSS A;  3FTY A;  5FZR A;  1UN9 A;  3OXF A;  2LSV A;  4PS7 A;  3G2U A;  3RRN B;  1DNP A;  4FHJ A;  1QQE A;  2MHK A;  1NA0 A;  4UWK A;  4NAC A;  5KWD A;  3KD7 A;  4WWN A;  4CDM A;  3UUX A;  2F0Y A;  3DST A;  3BG0 B;  4GZC A;  1TNO A;  3U66 A;  5G05 J;  1HE8 A;  1E7V A;  2P9S G;  2R02 A;  5FIO A;  4DRX E;  1JCR A;  1K3Z D;  1SQM A;  2WPV A;  4F6R D;  3D9I A;  2WQ7 A;  3CV0 A;  3NZS A;  1JUQ A;  3KSL A;  3RK6 A;  4YND A;  1IQR A;  1WY6 A;  1MZC A;  2AVP A;  2J8S D;  2P9K G;  2WXL A;  4TRQ A;  2ETC A;  4J8S A;  5CED B;  2VSO E;  4JHJ A;  1HU3 A;  1JWF A;  1FPP A;  1MX2 A;  2HYZ A;  2QYU A;  1AP7 A;  3MV3 B;  3Q49 B;  4XE0 A;  4DPR A;  3V79 K;  1QBQ A;  1NA3 A;  3ZUV B;  4G2V A;  5LOZ A;  2KCK A;  3E32 A;  2OCC E;  1EPU A;  3SZ7 A;  1VDY A;  5HQ8 A;  4L23 A;  4GYW A;  2RKK A;  1OCC E;  4LSZ E;  2F8Y A;  2H6G A;  4TV3 A;  4U0U A;  4FU3 A;  3MKR A;  2EIM E;  5AQ7 A;  2J49 A;  3BQO A;  3EHR A;  4AXH A;  1ZB1 A;  3ABL E;  1U2V G;  3S2A A;  2FBN A;  4XIF A;  3L22 A;  2H6F A;  3ZU7 B;  4B8A A;  2VTB A;  1TN8 A;  2VSX E;  5EIL A;  4CCA A;  3PZD A;  5DIZ A;  2JLB A;  1Q2Z A;  2IY0 C;  4KMO A;  5CEC B;  2VJ8 A;  5HS0 A;  4EBA A;  3CSF A;  1IQU A;  2Y4T A;  1ELR A;  4G23 A;  4A55 A;  1JCQ A;  3V2O A;  5CBO A;  4I9C A;  4N2Q A;  2A5E A;  2OEV A;  2VGY A;  2X3M A;  1TNB A;  3JCK C;  4MS6 A;  4CDR A;  5B1A E;  3SBS A;  3MV2 B;  4Y6W A;  3Q73 A;  3CHQ A;  3AS4 A;  4GZ5 A;  1N4R A;  3UM2 A;  3UIP C;  4GTM A;  4GZ6 A;  4UQY A;  3ML8 A;  4F7A A;  2P9L G;  4WUY A;  4UI9 K;  4U8H A;  5BPP A;  1X5B A;  4K5C A;  1PC2 A;  1OWN A;  4L9P A;  2QC9 A;  1LTX A;  1DCE A;  5EYL A;  3RRM B;  4EHM A;  2ETB A;  2L6J A;  2RFM A;  2CHW A;  3CK7 A;  2WXN A;  2BUG A;  3L9T A;  4FP7 A;  3SY2 A;  2R59 A;  3APD A;  3ULQ A;  4V3I A;  5AJD A;  5FZS A;  2V4H C;  4C9B B;  2ZXW E;  3C3Q A;  1KT0 A;  1IHG A;  4G8L A;  3AS5 A;  4GPM A;  3HHM A;  3CHM A;  3DEP A;  3ZPJ A;  1PY1 A;  1K8K G;  3TXN A;  3NQP A;  2VSY A;  4TXR A;  5M72 A;  2MYO A;  3RO3 A;  1BLX B;  4HRL A;  5T3R A;  1E8W A;  3UIN C;  5ANL A;  5ENS D;  5ENN A;  1U3C A;  4L2L A;  5FJY A;  2BF0 X;  3FDH A;  3SFY A;  2XCB A;  3PRZ A;  5ANR A;  3CKC A;  3E4B A;  1OT8 A;  4AY6 A;  3TG4 A;  1OCO E;  2GRO B;  3RRU A;  2CFZ A;  1WG0 A;  3PZ1 A;  4LEU A;  3BEE A;  3LYA A;  1NL4 A;  2VTB B;  4ABN A;  3CQG B;  2B0O E;  3ASH A;  3RAU A;  2AW6 A;  3WG7 E;  3TXM A;  3I4G A;  4U96 D;  4E85 A;  4L1B A;  2XGO A;  4P29 A;  4BTB A;  2PL2 A;  3ML9 A;  2ZGD A;  4I1O B;  4UQX A;  1SA5 A;  1RZ4 A;  2P9I G;  4I1A A;  3R9A B;  5A7D B;  3KEZ A;  3CHR A;  3QWV A;  3FH8 A;  1RW2 A;  3G2V A;  4CRW A;  3CEQ A;  4NIK A;  5CMY A;  1NI1 A;  3PZ4 A;  5EX3 A;  4WWP A;  1ZU2 A;  4GPK A;  1TN6 A;  3MA5 A;  3TWV A;  4L2Y A;  1PAQ A;  2LUH A;  1LF8 A;  3FY4 A;  2L0T B;  2DYR E;  2I2O A;  3RO2 A;  2CHX A;  3LVR E;  4CT0 A;  1YA0 A;  2FO7 A;  3F6Q A;  3GYZ A;  3B7R L;  1TJC A;  3HXE A;  1TNY A;  3ABK E;  2QYJ A;  4U0S A;  4J8F A;  4WWO A;  3NF1 A;  1HG5 A;  1N52 A;  5D66 A;  1QNF A;  2J09 A;  3CVN A;  2IEJ A;  3IKO B;  3FTS A;  4UWH A;  4KYO B;  4EBA G;  3QWW A;  1S70 B;  3ZYM A;  3NBN B;  4J8D A;  3FUM A;  3FTX A;  3S7D A;  5LCW J;  2WXG A;  4O6F A;  3FFL A;  3G2S A;  2Y69 E;  3P1U A;  1UOH A;  3GW4 A;  2BKK B;  2I1J A;  2LO6 A;  1NP7 A;  4URK A;  3EU9 A;  3MX3 A;  3UTM A;  4DUI A;  5JMN D;  3U64 A;  3CVP A;  4XI9 A;  1BU9 A;  4U8V D;  2F8X K;  2DVW A;  3W9F A;  3PEV B;  2IO2 C;  1E8Y A;  3GZS A;  5BNW A;  4FA6 A;  4B89 A;  2XRZ A;  3LJ3 A;  1FCH A;  3PZ3 A;  1TN7 A;  4I43 A;  3FU3 A;  3UXG A;  3CHP A;  4J8E A;  1HXI A;  4AIF A;  4I6J A;  1BD8 A;  4MBG A;  5JHA A;  5J08 A;  3QC1 A;  5AJL A;  3U4T A;  4AP2 A;  2NC9 A;  2XEN A;  3SF4 A;  3MKQ A;  5T4Y A; 
#chains in the Genus database with same CATH homology
 1U2V G;  4JD2 G;  1TYQ G;  2P9L G;  3DXK G;  3DXM G;  3UKU G;  3DWL G;  2P9P G;  2P9K G;  2P9S G;  2P9N G;  4XEI G;  3RSE G;  2P9I G;  3ULE G;  3UKR G;  2P9U G;  1K8K G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...