2P9IG

Crystal structure of bovine arp2/3 complex co-crystallized with adp and crosslinked with gluteraldehyde
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
143
structure length
137
Chain Sequence
ARFRKVDVDEYDENKFVDEDAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
molecule keywords Actin-like protein 3
total genus 42
structure length 137
sequence length 143
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 2p9iG00
3RSEG 3DWLG 2P9LG 2P9UG 4JD2G 3DXKG 3UKRG 2P9IG 2P9KG 4XEIG 1K8KG 2P9PG 3ULEG 3DXMG 1U2VG 2P9NG 1TYQG 3UKUG 2P9SG
chains in the Genus database with same CATH superfamily
4FLHA 4G8LA 1OWPA 3HXDA 2R5SA 3Q75A 4OVVA 4WUYA 4BT9A 1TNYA 2QYUA 3JUEA 2BF0X 3JQ1A 4GMJA 4EZJA 4GTSA 3TWTA 4GPMA 1KZOA 2F8XK 4WWPA 2DWZA 3ESKA 3UXGA 5BXUA 4H7XA 4A3TA 4PUCA 2ONDA 3J5PA 3U4TA 1RW2A 1QQEA 4JA7A 2FI7A 3NF1A 2XEEA 3Q49B 2UY1B 4B89A 3FH5A 3RSEG 3UIOC 5EX0A 4Z68A 2NSZA 3EUVA 4DLQA 1WG0A 2I6HA 4DJAA 2X6HA 3AG1E 2KCLA 4K5AB 1HE8A 2WXIA 2NXPA 2PQRA 5ITZF 1TNUA 4LERA 3DWLG 4I9EA 2LO6A 4GB9A 4UWLA 3CVLA 4ACKA 4LNBA 4O1OA 2WXMA 3FUNA 3C98A 5DBKA 2OCCE 4UWHA 2IFUA 4J8EA 3TAXA 1LD7A 3HHMA 2QC9A 3SNXA 5JA4D 2VQ2A 2XCCA 2DYRE 3LY8A 4A3VA 4GA1A 3ZHEB 1MQSA 4I9CA 1YMPA 3OAWA 1NP7A 3FU0A 1FVHA 2PM7A 4RLYA 4YVOA 1BI7B 3KSQA 2XEHA 3D9HA 3QKYA 5LCWJ 3CLJA 3E4BA 1UG3A 3ZEFA 3P1UA 5A6CA 2FO1E 3ZYKA 3L6AA 3L13A 4GTTA 4UUCA 5FZSA 4QFVA 3LVRE 3UI2A 4RQIA 3UINC 5CRVA 4YDWA 1Z6TA 1HXIA 4ME2A 4CEMA 1S64A 1N9AA 3HXEA 3LKUA 3ZNGA 2QY7A 3T5XA 2P2CP 1IQUA 2J9QA 2X6KA 2XGSA 3ISMC 2WXRA 3U9WA 4OYSA 5KJLA 3B7RL 2V4HC 1U2VG 1S70B 4F1PA 4RSYA 3MEKA 3KD7A 4ZFHA 3TWUA 4KT6B 1AWCB 5J90A 1LF8A 4C0MA 3ZYMA 4U0ZA 2RFMA 5BXOA 1E7VA 1H2VC 2XPIA 3FU5A 2WM9A 3W9GA 3TWRA 3U66A 1AP7A 1JPLA 5BV0A 5FJYA 1EDUA 3ZRHA 5B3SE 4G2VA 5EILA 2WPVA 2XEVA 1PY1A 3BG0B 4JVSA 3L08A 4GPKA 1H0AA 2JEKA 3E32A 3JXIA 5KJNA 1U3DA 2F8YA 1TYQG 3HIZA 1JUQA 2Y4TA 4I43A 3C3OA 4PDXA 4JHKA 3ZXSA 4G26A 2VSXE 3MZLB 4RG6A 3TJPA 2CFZA 4GTMA 5C1DA 2IOSA 4ATZD 2VTBA 1DNPA 2VSNA 3PH0C 5G05J 1WY6A 1HG2A 2J4DA 4FULA 3LJNA 4AP2A 3ZPJA 5A7DB 1EPUA 3FTVA 5M72A 3SI5A 4HOUA 5FQ6A 4KVMA 2L6BA 1PAQA 4BTAA 2OOEA 4AV7A 3PS6A 3QDNA 3ENEA 3I4GA 1JWFA 4U7EB 4AM9A 1IHBA 2XRYA 5G55A 2VJ8A 4P29A 3CHPA 2DCPA 5KNHD 5LP0A 1HG5A 3T8MA 4EBAG 5BT1A 4FC8A 3TG5A 4GTVA 5CBNA 3NZUA 2GRQB 1MX4A 4UI9C 3URZA 3Q9NC 3FU6A 4G11A 4YVQC 3NZSA 3PRZA 3FEXA 4U04A 4N2QA 1Z3YA 1A5EA 4DX1A 5JJ7A 3DEOA 3Q7AA 1N4RA 4I2ZA 4KMOA 5T3RA 4GU5A 2YHEA 4X8QA 1H2TC 4U8HA 4BFRA 3PREA 3RK6A 3IBEA 4J7WA 3EU5A 4ANWA 3S7DA 5KNGA 4PS8A 5ENOD 3PE3A 2V5QC 4IULA 4YDYA 4ANXA 1HX8A 2ETCA 3UT7A 3FTYA 1O1RA 4HOQA 3PNLB 2MHKA 4CDMA 3PVLA 2BTDA 2L6JA 2P9LG 2YINA 4EHMA 2MOWA 2P9NG 2NYJA 2CG2A 1MZCA 2LXMA 2WQHA 3CEQA 5E75A 2HR2A 3FEYA 4FHKA 2BKKB 4JEUA 3FFLA 2F37A 3LJ3A 3UKUG 2LUHA 4B8CB 4MLPA 2A5UA 4GTOA 3FY4A 1WDYA 2IY0C 4FHJA 3RO3A 4ATGA 1O1TA 3UPVA 5HS0A 2E2EA 3DSVA 4LUNU 2XZDG 3SZ7A 3LXUX 3ZVVA 2ZGDA 4JL0A 2JABA 4KZ0A 4IYPA 1E90A 5FZRA 2FF4A 3MV3B 3Q5MA 4HOTA 4FP7A 4U63A 4CCAA 4U07A 3UIPC 2A4ZA 2Y69E 3D9IA 3C72A 4DK5A 2H6FA 4N3AA 3UKRG 4J6IA 4J8YA 3CVPA 2IQCA 2XS1A 4LNUD 3LY9A 3L22A 3IHYA 4UWFA 3UMVA 1W3BA 4HNAD 4DX7D 5D2MC 3FUHA 2B0OE 3CSTA 3Q73A 2CG3A 3UM0A 3SBSA 2OV8A 2CHZA 1E8WA 2R05A 5EDSA 5ENRD 1JWGA 5FTPA 3NOCD 4HRMB 4JC8A 3RU0A 4N5QA 1HU3A 4ANVA 5EKQD 2X6JA 2PZIA 1X81A 1OUVA 3O48A 2R17C 5BPPA 1BD8A 3U3WA 1TN6A 2AXZA 2CHWA 2ZISA 3D9OA 3QJZA 3PZDA 4XEIG 2XGMA 4AXHA 5CEAA 1IHGA 1EYHA 2P9SG 2WB2A 5BNWA 5KJMA 4G24A 3ZYQA 4BEPA 4B8AA 3AS8A 4APFA 1E8YA 4F6RD 2RG8A 3MGBA 1MHQA 3MKQB 2Y3AA 2ZXWE 4BY6A 2RFAA 2GRLA 3FTZA 4CGWA 2J4BA 4GTRA 3DSWA 2LSVA 2M63A 5CEDB 3TL5A 1OCRE 1BLXB 3R9AB 1KZPA 2VGXA 4PH4B 3PEVB 3FUFA 5LOZA 3CVQA 3CHQA 2I1JA 4KYOB 4UQYA 1OWMA 4GA0A 4R7LA 5B1BE 4BT8A 1MYOA 2GRPB 3CKBA 3SD5A 4F1SA 3FH7A 1ELWA 1TJCA 1KT0A 2IU1A 2C0LA 5KBAA 1Y6IA 4U8YD 1ELRA 3EU9A 4MKTA 1WAO1 2DYSE 1OWLA 1SW6A 4WAFA 5D0QD 3LYAA 3CHSA 3RKVA 5ENTD 5JJTA 5JHBA 4DX6D 4YNDA 1K8KG 3G2SA 4CYMD 2AJAA 2WXLA 2I9CA 4GTQA 2GRMA 3L82A 3S7FA 2C0MA 3ZW3A 3GZSA 4JPSA 2EQXA 2KZTB 1SA5A 3AU5A 3HVEB 2P9KG 4BETA 1TR4A 3SO8A 3LS8A 4NIKA 4O1PA 3N71A 4DRXE 3VTXA 3VTYA 4HB5A 4XKCA 1H2UA 1OY3D 1D9SA 4AY5A 1N0RA 4LEUA 2DVWA 2WXQA 5LFAA 4WNGA 3DXMG 4GTPA 4GYWA 2C2LA 4WNFA 3APCA 2XGOA 3UM3A 5CECB 2DZOA 1YYHA 3NQPA 4RG9A 4GZDA 5HKPA 1Z5SC 1N4QA 1JCRA 3APDA 5FINA 3GZ1A 4XIFA 1UN9A 2EINE 1INZA 3BUAA 4MRUA 2GROB 5CMWA 3ZKJA 4ACLA 1QZ2A 4JZYA 4XX5A 3G2WA 1HFAA 1S0PA 4A55A 2X6FA 4GYOA 5AQ9A 3OXLA 3DPYA 4DUIA 2WQ7A 4L2YA 4CGVA 3MJWA 1FT2A 5ARGA 3FH8A 3D9KA 1H6PA 3C3QA 3JXJA 3C5RA 4NQ0A 1NA3A 4HOSA 3QWVA 4TRQA 2XPYA 5EN5D 5CMYA 3JUIA 4UI9J 3QC1A 2R03A 2Q7FA 4D10C 3FUIA 3FUMA 5AAOA 2P9IG 1OCOE 4CT4A 3MYVA 4J8DA 4JA9A 4JW1A 2XZTG 3KEAA 3RRNB 4MBGA 2ZU6B 2HM8A 2Y1LE 5AYWD 1FT1A 3RO2A 5AIJA 4GMLA 3L54A 2VTBB 2ZGGA 1ZB1A 1ZU2A 3EJNA 1YCSB 4NURA 2GRNB 5ARFA 3KEZA 3FHEA 3AG2E 3C3RA 3I4RB 4EECA 3NOGD 3PEUB 4E85A 3EHNA 4GCNA 4K0RA 5B1AE 2KBXA 3CQCB 3LY7A 3DSTA 4TV3A 3QNKA 4CZ2D 5AARA 4G23A 2JLBA 4DX5D 3LEWA 4GA2A 3D9NA 3B7BA 1HF8A 4ILHB 3QWWA 2DBAA 1HO8A 1V54E 3BG1B 3CHRA 1G3NB 4PS7A 2P9UG 3FTSA 5FIOA 4L23A 2L9BA 2WVIA 4BX9A 2LAHA 2IONA 3IHVA 1SA4A 2XHEA 4U8VD 1E96B 4WNDA 3TGOA 1NL4A 3PZ3A 3KAEA 4KZCA 4CDNA 3V31A 5EIBE 3CK8A 2ETBA 4A1SA 2PL2A 5ENQD 4ABNA 4E6HA 4HXIA 3UM2A 5AQ7A 3QAQA 4Y6CA 3UM1A 4N2SA 3JQ0A 2LXLA 4BERA 3ZHEA 3D9MA 2UWJG 3ASFA 3ZGQA 1UJKA 2GRRB 2KCKA 3UX4A 3QOUA 4EZLA 3PDNA 5AN8A 1VDYA 4EBAA 2CHXA 4GZ3A 3FWVA 3SQVA 3AJIA 2MRIA 4HLLA 4C48B 2KXPC 3IXEA 2H6HA 2PNNA 5ENSD 2B6CA 2VSYA 4U96D 3SGHA 1OCZE 3PE4A 4BSXA 3D9PA 3FP3A 4FADA 1O1SA 3PZ2A 3CK7A 2J49A 2XQ0A 3ONLA 5DIZA 3X2QE 4HBDA 1QNFA 4HRNA 3HXBA 3I3NA 4HRLA 3UT8A 3FTUA 2AWIA 3J5QB 3OXFA 1SZAA 3EHRA 2LSUA 2XS8A 3ML8A 4I1MA 3B7UX 1SQMA 3VLEA 1BU9A 3B13A 4I2WA 2UY1A 3S7BA 4NACA 2XCBA 3UQ3A 3HRAA 2P58C 1GW6A 2L0IA 3CGHA 3G2TA 3E33A 3QK0A 4LCTA 1JCQA 3AG3E 1N0QA 4B94A 3FDHA 4G1TA 4U0SA 4HI9A 1TNOA 1E7UA 4NRHB 4FJZA 4AJWA 3FUDA 1E8ZA 3KS2A 4K03A 3SBTB 4G25A 4OAUC 5AJLA 2KZTA 3UUXA 1HS6A 4HORA 1NZNA 3ULYA 4Q96A 3IEGA 4QQIA 4FLBA 4RVBA 2WMNA 3PZ4A 2RKKA 3K9IA 3FULA 2I2OA 3CKCA 3D9LA 3PNTB 4UWKA 1N95A 2DIWA 3HG0D 1HZ4A 3ASGA 4MS6A 2WXNA 3EIQC 4FA6A 2IEJA 1UJJA 4PS3A 3CVUA 2V0PA 5ENPD 5CBOA 2WXOA 4W9RA 1D8EA 1NA0A 2IO3C 2OVFA 1N54A 4FJYA 2IOLA 3ESLA 3TWVA 4HQDA 3WG7E 5AENA 5E76A 2VGXB 3OXGA 1Q2ZA 2GGFA 3LPZA 3Q78A 2J08A 4N39A 1MX6A 1QYMA 2PQNA 5G2NA 4ZHBA 4XE0A 3FTWA 5BV1A 4GZ6A 2FBNA 3P2BA 4A63B 3AG4E 1IXVA 3EDTB 4UQZA 3MKQA 3SFZA 2AXVA 1TNZA 3ZUVB 4G8KA 4HVBA 3Q47B 1N4SA 4LNGA 1XNFA 3ABKE 4CDRA 2RD0A 2FO7A 4M3OA 4WNEA 3CIAA 2PM6A 1UOHA 3B7SA 3CHMA 4GCOA 2YHCA 3CVYA 1K1AA 1MX2A 2LNIA 5A23A 3E30A 2GW1A 1RZ4A 5FT9A 3BU8A 1OWOA 2ILRA 3Q4AB 4F53A 4DLOA 2WXGA 1UW4B 2WXJA 1N52A 4JXTA 3S7JA 3Q79A 2WXPA 3SF4A 5JHAA 3GYZA 1TN7A 4JHRA 2IJGX 2WXKA 2LAIA 3ZU7B 2FULA 4C9BB 2BKGA 3DPDA 3CK9A 3NAWA 5D66A 5CHEE 1E8XA 1IKND 2L0TB 1BPOA 5CCMA 3TG4A 3MCXA 3ASDA 2AW6A 2QZAA 3JYSA 2XPZA 2V5FA 3HVEA 3RJVA 3QB2A 4A1GA 2R59A 4TXRA 4F3VA 4L1BA 5KJKA 4UI9K 1FVFA 3TWWA 3AAAC 2VGEA 1N4PA 3ASNE 4XKBA 3ASOE 1IYGA 2X3MA 4GZ5A 4APOA 4B93B 1O5MA 4HS2A 1QBQA 4FU3A 4N3CA 5JMND 1OXJA 5T8IA 4URKA 2X38A 1OCCE 4M7CA 4XI0A 3ZIMA 5G05C 2AXUA 2WXFA 3RAUA 4I1AA 3R7QA 2FEZA 1H6OA 4L2LA 3FUJA 1DCQA 4U95D 2EILE 3NB2A 4DI4A 1K1BA 3RRUA 5G04J 2F0YA 5KWDA 2EIJE 4O60A 1XGWA 3SY2A 4JB8P 2H6IA 3F6QA 3LVQE 4LG6A 5AJDA 1PC2A 2R2LA 3ASHA 1UN8A 3B95A 3PUJA 4AY6A 2VGYA 2KC7A 1N11A 4HI8A 4JHJA 3G2VA 3CVWA 5CERB 4U0UA 4GAAA 3IV0A 4I6EA 3VLFA 3ULEG 5H7PA 4AEZC 2A5EA 3DSUA 4I1OB 3RIBA 4OAVB 4YDEA 4I6JA 4C0EA 3QARA 3V30A 2EIKE 4KVOA 5AQAA 3BEEA 2NC9A 2CFUA 2BUGA 2H6GA 5LCWC 3PUKA 3D3MA 3TWQA 4O6FA 4BWRA 3NBNB 1V55E 4N5CA 3L17A 4Q94A 3HYMB 3CVVA 4JD2G 3JCKC 3T9KA 1ZBPA 5FZQA 4EZKA 2OVBA 5IY5E 1KT1A 1LTXA 1TJFA 3GZ2A 4IN3B 2KM4A 3LCAA 3MKRA 3L16A 5FQ4A 2EIME 3UT4A 4Y6WA 5FQ8A 3TXMA 3KSLA 3DSXA 3ZYLA 1NI1A 4F7AA 3EHQA 2R02A 4ANUA 1D8DA 3TWSA 1DVPA 4BTBA 1X5BA 1B89A 4LRZA 5KCMA 1JCSA 1TNBA 3DXKG 2WQ6A 4TXQA 1DC2A 4XZ4A 3DRAA 3MX3A 4CT0A 2J07A 3HXFA 3FUKA 3ULQA 1FPPA 2VSOE 2VYIA 3I5PA 4BX8A 4BSZB 3MV2B 3RRMB 1EF1C 2E0IA 3AS4A 3Q7FA 3R7RA 2IF4A 1SVXA 1LD8A 1OWNA 4YDOA 4L7TA 3BQOA 2V8SE 3DSSA 3ABME 2QFCA 4L9PA 3Q9UC 4DX2A 1SZ9A 5BW8C 3QWPA 3FU3A 5ANRA 3T5VA 5BUZA 4GZCA 2X6IA 2OEVA 3CV0A 3MA5A 1DCEA 2HE0A 2Y0BG 3SFYA 5ANLA 1NFIE 3TWXA 2P9PG 3FTXA 5ENNA 3EIJA 5G04C 4XI9A 4I17A 5EX3A 1KLXA 5FQ7A 1K3ZD 4B0ZA 2XENA 5HQ8A 3CVXA 4EPZA 4Q69A 3S2AA 3SFXA 3W9FA 1TN8A 4KXKB 3U64A 3IKOB 1MJ0A 5AQBA 2XRZA 1Y8MA 1H19A 5LX8A 1TEZA 4UQXA 2KCVA 4BESA 1OT8A 3E37A 4WWOA 1L5JA 2ZIRA 2DZNA 3UTMA 3GW4A 3CVNA 3D9JA 4GYYA 4KBQA 1KPSB 5HI7A 3ZXPA 5EIDA 3G2UA 2MYOA 5JJ6A 4HFGA 3VLDA 4N3BA 2Y4UA 2QYJA 5T4YA 1A17A 1BI8B 2IO2C 4AIFA 1S63A 3WXXA 2WXHA 4K5CA 4HLEA 2ETAA 3LDZA 3DBSA 4J8FA 3CR3A 1IQRA 3SHFA 3V79K 3PZ1A 5EYLA 4K5BA 4TXPA 2J09A 3ABLE 4CRWA 2HO1A 4IRUA 5C2YA 4V3IA 2I1KA 3B7TA 3AU4A 2OEWA 2V4LA 1WM5A 3CSFA 3AS5A 5D0OD 4WWNA 2KATA 4GMRA 3DEPA 1FCHA 2BEDA 1ELKA 1U3CA 3ZFWA 3R9MA 3ML9A 3Q15A 4J0UA 4TUMA 4H7YA 2YQ8A 3L9TA 4OVUA 4J8SA 3TXNA 3ONKA 3EHMA 2J8SD 3V2OA 4AOFA 2WMOA 1YA0A 4LSZE 3CHOA 3T8KA 4I6GA 3CQGB 1N94A 4AVXA 4ILIA 5FWQA 3O4ZA 1Z3XA 1P5QA 2AVPA 4ILGA 5HRYA 5CCLA 3E34A 2HYZA 1H6KA 4JEHA 3HDXA 4DI3A 5EYPF 5J08A 3HXCA 4EQFA 5CRUA 2YNQA 4DPRA 3OTNA 1HH8A 3ZN3A 4TUUA 4UWGA 3APFA 3FUEA 3V2XA
chains in the Genus database with same CATH topology
3RSEG 3DWLG 2P9LG 2P9UG 4JD2G 3DXKG 3UKRG 2P9IG 2P9KG 4XEIG 1K8KG 2P9PG 3ULEG 3DXMG 1U2VG 2P9NG 1TYQG 3UKUG 2P9SG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RSE G;  3DWL G;  2P9L G;  2P9U G;  4JD2 G;  3DXK G;  3UKR G;  2P9I G;  2P9K G;  4XEI G;  1K8K G;  2P9P G;  3ULE G;  3DXM G;  1U2V G;  2P9N G;  1TYQ G;  3UKU G;  2P9S G; 
#chains in the Genus database with same CATH topology
 4FLH A;  4G8L A;  1OWP A;  3HXD A;  2R5S A;  3Q75 A;  4OVV A;  4WUY A;  4BT9 A;  1TNY A;  2QYU A;  3JUE A;  2BF0 X;  3JQ1 A;  4GMJ A;  4EZJ A;  4GTS A;  3TWT A;  4GPM A;  1KZO A;  2F8X K;  4WWP A;  2DWZ A;  3ESK A;  3UXG A;  5BXU A;  4H7X A;  4A3T A;  4PUC A;  2OND A;  3J5P A;  3U4T A;  1RW2 A;  1QQE A;  4JA7 A;  2FI7 A;  3NF1 A;  2XEE A;  3Q49 B;  2UY1 B;  4B89 A;  3FH5 A;  3RSE G;  3UIO C;  5EX0 A;  4Z68 A;  2NSZ A;  3EUV A;  4DLQ A;  1WG0 A;  2I6H A;  4DJA A;  2X6H A;  3AG1 E;  2KCL A;  4K5A B;  1HE8 A;  2WXI A;  2NXP A;  2PQR A;  5ITZ F;  1TNU A;  4LER A;  3DWL G;  4I9E A;  2LO6 A;  4GB9 A;  4UWL A;  3CVL A;  4ACK A;  4LNB A;  4O1O A;  2WXM A;  3FUN A;  3C98 A;  5DBK A;  2OCC E;  4UWH A;  2IFU A;  4J8E A;  3TAX A;  1LD7 A;  3HHM A;  2QC9 A;  3SNX A;  5JA4 D;  2VQ2 A;  2XCC A;  2DYR E;  3LY8 A;  4A3V A;  4GA1 A;  3ZHE B;  1MQS A;  4I9C A;  1YMP A;  3OAW A;  1NP7 A;  3FU0 A;  1FVH A;  2PM7 A;  4RLY A;  4YVO A;  1BI7 B;  3KSQ A;  2XEH A;  3D9H A;  3QKY A;  5LCW J;  3CLJ A;  3E4B A;  1UG3 A;  3ZEF A;  3P1U A;  5A6C A;  2FO1 E;  3ZYK A;  3L6A A;  3L13 A;  4GTT A;  4UUC A;  5FZS A;  4QFV A;  3LVR E;  3UI2 A;  4RQI A;  3UIN C;  5CRV A;  4YDW A;  1Z6T A;  1HXI A;  4ME2 A;  4CEM A;  1S64 A;  1N9A A;  3HXE A;  3LKU A;  3ZNG A;  2QY7 A;  3T5X A;  2P2C P;  1IQU A;  2J9Q A;  2X6K A;  2XGS A;  3ISM C;  2WXR A;  3U9W A;  4OYS A;  5KJL A;  3B7R L;  2V4H C;  1U2V G;  1S70 B;  4F1P A;  4RSY A;  3MEK A;  3KD7 A;  4ZFH A;  3TWU A;  4KT6 B;  1AWC B;  5J90 A;  1LF8 A;  4C0M A;  3ZYM A;  4U0Z A;  2RFM A;  5BXO A;  1E7V A;  1H2V C;  2XPI A;  3FU5 A;  2WM9 A;  3W9G A;  3TWR A;  3U66 A;  1AP7 A;  1JPL A;  5BV0 A;  5FJY A;  1EDU A;  3ZRH A;  5B3S E;  4G2V A;  5EIL A;  2WPV A;  2XEV A;  1PY1 A;  3BG0 B;  4JVS A;  3L08 A;  4GPK A;  1H0A A;  2JEK A;  3E32 A;  3JXI A;  5KJN A;  1U3D A;  2F8Y A;  1TYQ G;  3HIZ A;  1JUQ A;  2Y4T A;  4I43 A;  3C3O A;  4PDX A;  4JHK A;  3ZXS A;  4G26 A;  2VSX E;  3MZL B;  4RG6 A;  3TJP A;  2CFZ A;  4GTM A;  5C1D A;  2IOS A;  4ATZ D;  2VTB A;  1DNP A;  2VSN A;  3PH0 C;  5G05 J;  1WY6 A;  1HG2 A;  2J4D A;  4FUL A;  3LJN A;  4AP2 A;  3ZPJ A;  5A7D B;  1EPU A;  3FTV A;  5M72 A;  3SI5 A;  4HOU A;  5FQ6 A;  4KVM A;  2L6B A;  1PAQ A;  4BTA A;  2OOE A;  4AV7 A;  3PS6 A;  3QDN A;  3ENE A;  3I4G A;  1JWF A;  4U7E B;  4AM9 A;  1IHB A;  2XRY A;  5G55 A;  2VJ8 A;  4P29 A;  3CHP A;  2DCP A;  5KNH D;  5LP0 A;  1HG5 A;  3T8M A;  4EBA G;  5BT1 A;  4FC8 A;  3TG5 A;  4GTV A;  5CBN A;  3NZU A;  2GRQ B;  1MX4 A;  4UI9 C;  3URZ A;  3Q9N C;  3FU6 A;  4G11 A;  4YVQ C;  3NZS A;  3PRZ A;  3FEX A;  4U04 A;  4N2Q A;  1Z3Y A;  1A5E A;  4DX1 A;  5JJ7 A;  3DEO A;  3Q7A A;  1N4R A;  4I2Z A;  4KMO A;  5T3R A;  4GU5 A;  2YHE A;  4X8Q A;  1H2T C;  4U8H A;  4BFR A;  3PRE A;  3RK6 A;  3IBE A;  4J7W A;  3EU5 A;  4ANW A;  3S7D A;  5KNG A;  4PS8 A;  5ENO D;  3PE3 A;  2V5Q C;  4IUL A;  4YDY A;  4ANX A;  1HX8 A;  2ETC A;  3UT7 A;  3FTY A;  1O1R A;  4HOQ A;  3PNL B;  2MHK A;  4CDM A;  3PVL A;  2BTD A;  2L6J A;  2P9L G;  2YIN A;  4EHM A;  2MOW A;  2P9N G;  2NYJ A;  2CG2 A;  1MZC A;  2LXM A;  2WQH A;  3CEQ A;  5E75 A;  2HR2 A;  3FEY A;  4FHK A;  2BKK B;  4JEU A;  3FFL A;  2F37 A;  3LJ3 A;  3UKU G;  2LUH A;  4B8C B;  4MLP A;  2A5U A;  4GTO A;  3FY4 A;  1WDY A;  2IY0 C;  4FHJ A;  3RO3 A;  4ATG A;  1O1T A;  3UPV A;  5HS0 A;  2E2E A;  3DSV A;  4LUN U;  2XZD G;  3SZ7 A;  3LXU X;  3ZVV A;  2ZGD A;  4JL0 A;  2JAB A;  4KZ0 A;  4IYP A;  1E90 A;  5FZR A;  2FF4 A;  3MV3 B;  3Q5M A;  4HOT A;  4FP7 A;  4U63 A;  4CCA A;  4U07 A;  3UIP C;  2A4Z A;  2Y69 E;  3D9I A;  3C72 A;  4DK5 A;  2H6F A;  4N3A A;  3UKR G;  4J6I A;  4J8Y A;  3CVP A;  2IQC A;  2XS1 A;  4LNU D;  3LY9 A;  3L22 A;  3IHY A;  4UWF A;  3UMV A;  1W3B A;  4HNA D;  4DX7 D;  5D2M C;  3FUH A;  2B0O E;  3CST A;  3Q73 A;  2CG3 A;  3UM0 A;  3SBS A;  2OV8 A;  2CHZ A;  1E8W A;  2R05 A;  5EDS A;  5ENR D;  1JWG A;  5FTP A;  3NOC D;  4HRM B;  4JC8 A;  3RU0 A;  4N5Q A;  1HU3 A;  4ANV A;  5EKQ D;  2X6J A;  2PZI A;  1X81 A;  1OUV A;  3O48 A;  2R17 C;  5BPP A;  1BD8 A;  3U3W A;  1TN6 A;  2AXZ A;  2CHW A;  2ZIS A;  3D9O A;  3QJZ A;  3PZD A;  4XEI G;  2XGM A;  4AXH A;  5CEA A;  1IHG A;  1EYH A;  2P9S G;  2WB2 A;  5BNW A;  5KJM A;  4G24 A;  3ZYQ A;  4BEP A;  4B8A A;  3AS8 A;  4APF A;  1E8Y A;  4F6R D;  2RG8 A;  3MGB A;  1MHQ A;  3MKQ B;  2Y3A A;  2ZXW E;  4BY6 A;  2RFA A;  2GRL A;  3FTZ A;  4CGW A;  2J4B A;  4GTR A;  3DSW A;  2LSV A;  2M63 A;  5CED B;  3TL5 A;  1OCR E;  1BLX B;  3R9A B;  1KZP A;  2VGX A;  4PH4 B;  3PEV B;  3FUF A;  5LOZ A;  3CVQ A;  3CHQ A;  2I1J A;  4KYO B;  4UQY A;  1OWM A;  4GA0 A;  4R7L A;  5B1B E;  4BT8 A;  1MYO A;  2GRP B;  3CKB A;  3SD5 A;  4F1S A;  3FH7 A;  1ELW A;  1TJC A;  1KT0 A;  2IU1 A;  2C0L A;  5KBA A;  1Y6I A;  4U8Y D;  1ELR A;  3EU9 A;  4MKT A;  1WAO 1;  2DYS E;  1OWL A;  1SW6 A;  4WAF A;  5D0Q D;  3LYA A;  3CHS A;  3RKV A;  5ENT D;  5JJT A;  5JHB A;  4DX6 D;  4YND A;  1K8K G;  3G2S A;  4CYM D;  2AJA A;  2WXL A;  2I9C A;  4GTQ A;  2GRM A;  3L82 A;  3S7F A;  2C0M A;  3ZW3 A;  3GZS A;  4JPS A;  2EQX A;  2KZT B;  1SA5 A;  3AU5 A;  3HVE B;  2P9K G;  4BET A;  1TR4 A;  3SO8 A;  3LS8 A;  4NIK A;  4O1P A;  3N71 A;  4DRX E;  3VTX A;  3VTY A;  4HB5 A;  4XKC A;  1H2U A;  1OY3 D;  1D9S A;  4AY5 A;  1N0R A;  4LEU A;  2DVW A;  2WXQ A;  5LFA A;  4WNG A;  3DXM G;  4GTP A;  4GYW A;  2C2L A;  4WNF A;  3APC A;  2XGO A;  3UM3 A;  5CEC B;  2DZO A;  1YYH A;  3NQP A;  4RG9 A;  4GZD A;  5HKP A;  1Z5S C;  1N4Q A;  1JCR A;  3APD A;  5FIN A;  3GZ1 A;  4XIF A;  1UN9 A;  2EIN E;  1INZ A;  3BUA A;  4MRU A;  2GRO B;  5CMW A;  3ZKJ A;  4ACL A;  1QZ2 A;  4JZY A;  4XX5 A;  3G2W A;  1HFA A;  1S0P A;  4A55 A;  2X6F A;  4GYO A;  5AQ9 A;  3OXL A;  3DPY A;  4DUI A;  2WQ7 A;  4L2Y A;  4CGV A;  3MJW A;  1FT2 A;  5ARG A;  3FH8 A;  3D9K A;  1H6P A;  3C3Q A;  3JXJ A;  3C5R A;  4NQ0 A;  1NA3 A;  4HOS A;  3QWV A;  4TRQ A;  2XPY A;  5EN5 D;  5CMY A;  3JUI A;  4UI9 J;  3QC1 A;  2R03 A;  2Q7F A;  4D10 C;  3FUI A;  3FUM A;  5AAO A;  2P9I G;  1OCO E;  4CT4 A;  3MYV A;  4J8D A;  4JA9 A;  4JW1 A;  2XZT G;  3KEA A;  3RRN B;  4MBG A;  2ZU6 B;  2HM8 A;  2Y1L E;  5AYW D;  1FT1 A;  3RO2 A;  5AIJ A;  4GML A;  3L54 A;  2VTB B;  2ZGG A;  1ZB1 A;  1ZU2 A;  3EJN A;  1YCS B;  4NUR A;  2GRN B;  5ARF A;  3KEZ A;  3FHE A;  3AG2 E;  3C3R A;  3I4R B;  4EEC A;  3NOG D;  3PEU B;  4E85 A;  3EHN A;  4GCN A;  4K0R A;  5B1A E;  2KBX A;  3CQC B;  3LY7 A;  3DST A;  4TV3 A;  3QNK A;  4CZ2 D;  5AAR A;  4G23 A;  2JLB A;  4DX5 D;  3LEW A;  4GA2 A;  3D9N A;  3B7B A;  1HF8 A;  4ILH B;  3QWW A;  2DBA A;  1HO8 A;  1V54 E;  3BG1 B;  3CHR A;  1G3N B;  4PS7 A;  2P9U G;  3FTS A;  5FIO A;  4L23 A;  2L9B A;  2WVI A;  4BX9 A;  2LAH A;  2ION A;  3IHV A;  1SA4 A;  2XHE A;  4U8V D;  1E96 B;  4WND A;  3TGO A;  1NL4 A;  3PZ3 A;  3KAE A;  4KZC A;  4CDN A;  3V31 A;  5EIB E;  3CK8 A;  2ETB A;  4A1S A;  2PL2 A;  5ENQ D;  4ABN A;  4E6H A;  4HXI A;  3UM2 A;  5AQ7 A;  3QAQ A;  4Y6C A;  3UM1 A;  4N2S A;  3JQ0 A;  2LXL A;  4BER A;  3ZHE A;  3D9M A;  2UWJ G;  3ASF A;  3ZGQ A;  1UJK A;  2GRR B;  2KCK A;  3UX4 A;  3QOU A;  4EZL A;  3PDN A;  5AN8 A;  1VDY A;  4EBA A;  2CHX A;  4GZ3 A;  3FWV A;  3SQV A;  3AJI A;  2MRI A;  4HLL A;  4C48 B;  2KXP C;  3IXE A;  2H6H A;  2PNN A;  5ENS D;  2B6C A;  2VSY A;  4U96 D;  3SGH A;  1OCZ E;  3PE4 A;  4BSX A;  3D9P A;  3FP3 A;  4FAD A;  1O1S A;  3PZ2 A;  3CK7 A;  2J49 A;  2XQ0 A;  3ONL A;  5DIZ A;  3X2Q E;  4HBD A;  1QNF A;  4HRN A;  3HXB A;  3I3N A;  4HRL A;  3UT8 A;  3FTU A;  2AWI A;  3J5Q B;  3OXF A;  1SZA A;  3EHR A;  2LSU A;  2XS8 A;  3ML8 A;  4I1M A;  3B7U X;  1SQM A;  3VLE A;  1BU9 A;  3B13 A;  4I2W A;  2UY1 A;  3S7B A;  4NAC A;  2XCB A;  3UQ3 A;  3HRA A;  2P58 C;  1GW6 A;  2L0I A;  3CGH A;  3G2T A;  3E33 A;  3QK0 A;  4LCT A;  1JCQ A;  3AG3 E;  1N0Q A;  4B94 A;  3FDH A;  4G1T A;  4U0S A;  4HI9 A;  1TNO A;  1E7U A;  4NRH B;  4FJZ A;  4AJW A;  3FUD A;  1E8Z A;  3KS2 A;  4K03 A;  3SBT B;  4G25 A;  4OAU C;  5AJL A;  2KZT A;  3UUX A;  1HS6 A;  4HOR A;  1NZN A;  3ULY A;  4Q96 A;  3IEG A;  4QQI A;  4FLB A;  4RVB A;  2WMN A;  3PZ4 A;  2RKK A;  3K9I A;  3FUL A;  2I2O A;  3CKC A;  3D9L A;  3PNT B;  4UWK A;  1N95 A;  2DIW A;  3HG0 D;  1HZ4 A;  3ASG A;  4MS6 A;  2WXN A;  3EIQ C;  4FA6 A;  2IEJ A;  1UJJ A;  4PS3 A;  3CVU A;  2V0P A;  5ENP D;  5CBO A;  2WXO A;  4W9R A;  1D8E A;  1NA0 A;  2IO3 C;  2OVF A;  1N54 A;  4FJY A;  2IOL A;  3ESL A;  3TWV A;  4HQD A;  3WG7 E;  5AEN A;  5E76 A;  2VGX B;  3OXG A;  1Q2Z A;  2GGF A;  3LPZ A;  3Q78 A;  2J08 A;  4N39 A;  1MX6 A;  1QYM A;  2PQN A;  5G2N A;  4ZHB A;  4XE0 A;  3FTW A;  5BV1 A;  4GZ6 A;  2FBN A;  3P2B A;  4A63 B;  3AG4 E;  1IXV A;  3EDT B;  4UQZ A;  3MKQ A;  3SFZ A;  2AXV A;  1TNZ A;  3ZUV B;  4G8K A;  4HVB A;  3Q47 B;  1N4S A;  4LNG A;  1XNF A;  3ABK E;  4CDR A;  2RD0 A;  2FO7 A;  4M3O A;  4WNE A;  3CIA A;  2PM6 A;  1UOH A;  3B7S A;  3CHM A;  4GCO A;  2YHC A;  3CVY A;  1K1A A;  1MX2 A;  2LNI A;  5A23 A;  3E30 A;  2GW1 A;  1RZ4 A;  5FT9 A;  3BU8 A;  1OWO A;  2ILR A;  3Q4A B;  4F53 A;  4DLO A;  2WXG A;  1UW4 B;  2WXJ A;  1N52 A;  4JXT A;  3S7J A;  3Q79 A;  2WXP A;  3SF4 A;  5JHA A;  3GYZ A;  1TN7 A;  4JHR A;  2IJG X;  2WXK A;  2LAI A;  3ZU7 B;  2FUL A;  4C9B B;  2BKG A;  3DPD A;  3CK9 A;  3NAW A;  5D66 A;  5CHE E;  1E8X A;  1IKN D;  2L0T B;  1BPO A;  5CCM A;  3TG4 A;  3MCX A;  3ASD A;  2AW6 A;  2QZA A;  3JYS A;  2XPZ A;  2V5F A;  3HVE A;  3RJV A;  3QB2 A;  4A1G A;  2R59 A;  4TXR A;  4F3V A;  4L1B A;  5KJK A;  4UI9 K;  1FVF A;  3TWW A;  3AAA C;  2VGE A;  1N4P A;  3ASN E;  4XKB A;  3ASO E;  1IYG A;  2X3M A;  4GZ5 A;  4APO A;  4B93 B;  1O5M A;  4HS2 A;  1QBQ A;  4FU3 A;  4N3C A;  5JMN D;  1OXJ A;  5T8I A;  4URK A;  2X38 A;  1OCC E;  4M7C A;  4XI0 A;  3ZIM A;  5G05 C;  2AXU A;  2WXF A;  3RAU A;  4I1A A;  3R7Q A;  2FEZ A;  1H6O A;  4L2L A;  3FUJ A;  1DCQ A;  4U95 D;  2EIL E;  3NB2 A;  4DI4 A;  1K1B A;  3RRU A;  5G04 J;  2F0Y A;  5KWD A;  2EIJ E;  4O60 A;  1XGW A;  3SY2 A;  4JB8 P;  2H6I A;  3F6Q A;  3LVQ E;  4LG6 A;  5AJD A;  1PC2 A;  2R2L A;  3ASH A;  1UN8 A;  3B95 A;  3PUJ A;  4AY6 A;  2VGY A;  2KC7 A;  1N11 A;  4HI8 A;  4JHJ A;  3G2V A;  3CVW A;  5CER B;  4U0U A;  4GAA A;  3IV0 A;  4I6E A;  3VLF A;  3ULE G;  5H7P A;  4AEZ C;  2A5E A;  3DSU A;  4I1O B;  3RIB A;  4OAV B;  4YDE A;  4I6J A;  4C0E A;  3QAR A;  3V30 A;  2EIK E;  4KVO A;  5AQA A;  3BEE A;  2NC9 A;  2CFU A;  2BUG A;  2H6G A;  5LCW C;  3PUK A;  3D3M A;  3TWQ A;  4O6F A;  4BWR A;  3NBN B;  1V55 E;  4N5C A;  3L17 A;  4Q94 A;  3HYM B;  3CVV A;  4JD2 G;  3JCK C;  3T9K A;  1ZBP A;  5FZQ A;  4EZK A;  2OVB A;  5IY5 E;  1KT1 A;  1LTX A;  1TJF A;  3GZ2 A;  4IN3 B;  2KM4 A;  3LCA A;  3MKR A;  3L16 A;  5FQ4 A;  2EIM E;  3UT4 A;  4Y6W A;  5FQ8 A;  3TXM A;  3KSL A;  3DSX A;  3ZYL A;  1NI1 A;  4F7A A;  3EHQ A;  2R02 A;  4ANU A;  1D8D A;  3TWS A;  1DVP A;  4BTB A;  1X5B A;  1B89 A;  4LRZ A;  5KCM A;  1JCS A;  1TNB A;  3DXK G;  2WQ6 A;  4TXQ A;  1DC2 A;  4XZ4 A;  3DRA A;  3MX3 A;  4CT0 A;  2J07 A;  3HXF A;  3FUK A;  3ULQ A;  1FPP A;  2VSO E;  2VYI A;  3I5P A;  4BX8 A;  4BSZ B;  3MV2 B;  3RRM B;  1EF1 C;  2E0I A;  3AS4 A;  3Q7F A;  3R7R A;  2IF4 A;  1SVX A;  1LD8 A;  1OWN A;  4YDO A;  4L7T A;  3BQO A;  2V8S E;  3DSS A;  3ABM E;  2QFC A;  4L9P A;  3Q9U C;  4DX2 A;  1SZ9 A;  5BW8 C;  3QWP A;  3FU3 A;  5ANR A;  3T5V A;  5BUZ A;  4GZC A;  2X6I A;  2OEV A;  3CV0 A;  3MA5 A;  1DCE A;  2HE0 A;  2Y0B G;  3SFY A;  5ANL A;  1NFI E;  3TWX A;  2P9P G;  3FTX A;  5ENN A;  3EIJ A;  5G04 C;  4XI9 A;  4I17 A;  5EX3 A;  1KLX A;  5FQ7 A;  1K3Z D;  4B0Z A;  2XEN A;  5HQ8 A;  3CVX A;  4EPZ A;  4Q69 A;  3S2A A;  3SFX A;  3W9F A;  1TN8 A;  4KXK B;  3U64 A;  3IKO B;  1MJ0 A;  5AQB A;  2XRZ A;  1Y8M A;  1H19 A;  5LX8 A;  1TEZ A;  4UQX A;  2KCV A;  4BES A;  1OT8 A;  3E37 A;  4WWO A;  1L5J A;  2ZIR A;  2DZN A;  3UTM A;  3GW4 A;  3CVN A;  3D9J A;  4GYY A;  4KBQ A;  1KPS B;  5HI7 A;  3ZXP A;  5EID A;  3G2U A;  2MYO A;  5JJ6 A;  4HFG A;  3VLD A;  4N3B A;  2Y4U A;  2QYJ A;  5T4Y A;  1A17 A;  1BI8 B;  2IO2 C;  4AIF A;  1S63 A;  3WXX A;  2WXH A;  4K5C A;  4HLE A;  2ETA A;  3LDZ A;  3DBS A;  4J8F A;  3CR3 A;  1IQR A;  3SHF A;  3V79 K;  3PZ1 A;  5EYL A;  4K5B A;  4TXP A;  2J09 A;  3ABL E;  4CRW A;  2HO1 A;  4IRU A;  5C2Y A;  4V3I A;  2I1K A;  3B7T A;  3AU4 A;  2OEW A;  2V4L A;  1WM5 A;  3CSF A;  3AS5 A;  5D0O D;  4WWN A;  2KAT A;  4GMR A;  3DEP A;  1FCH A;  2BED A;  1ELK A;  1U3C A;  3ZFW A;  3R9M A;  3ML9 A;  3Q15 A;  4J0U A;  4TUM A;  4H7Y A;  2YQ8 A;  3L9T A;  4OVU A;  4J8S A;  3TXN A;  3ONK A;  3EHM A;  2J8S D;  3V2O A;  4AOF A;  2WMO A;  1YA0 A;  4LSZ E;  3CHO A;  3T8K A;  4I6G A;  3CQG B;  1N94 A;  4AVX A;  4ILI A;  5FWQ A;  3O4Z A;  1Z3X A;  1P5Q A;  2AVP A;  4ILG A;  5HRY A;  5CCL A;  3E34 A;  2HYZ A;  1H6K A;  4JEH A;  3HDX A;  4DI3 A;  5EYP F;  5J08 A;  3HXC A;  4EQF A;  5CRU A;  2YNQ A;  4DPR A;  3OTN A;  1HH8 A;  3ZN3 A;  4TUU A;  4UWG A;  3APF A;  3FUE A;  3V2X A; 
#chains in the Genus database with same CATH homology
 3RSE G;  3DWL G;  2P9L G;  2P9U G;  4JD2 G;  3DXK G;  3UKR G;  2P9I G;  2P9K G;  4XEI G;  1K8K G;  2P9P G;  3ULE G;  3DXM G;  1U2V G;  2P9N G;  1TYQ G;  3UKU G;  2P9S G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...