2P9IG

Crystal structure of bovine arp2/3 complex co-crystallized with adp and crosslinked with gluteraldehyde
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
143
structure length
137
Chain Sequence
ARFRKVDVDEYDENKFVDEDAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
total genus 42
structure length 137
sequence length 143
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 2p9iG00
3DWLG 2P9NG 2P9PG 4XEIG 2P9IG 3DXMG 1K8KG 1U2VG 3ULEG 2P9KG 3DXKG 3RSEG 3UKUG 3UKRG 4JD2G 2P9UG 2P9LG 2P9SG 1TYQG
chains in the Genus database with same CATH superfamily
2GROB 3MA5A 2Y1LE 5CMYA 5ENTD 4YNDA 4H7XA 1UJKA 5KJLA 1S70B 2X6HA 2XCCA 3AG2E 3ABKE 2ZGDA 5DBKA 1OT8A 1KZOA 4RQIA 3DXMG 4XX5A 3RK6A 2J09A 2OEVA 2WXQA 4JVSA 4U95D 4U8HA 5ENNA 2X3MA 4DK5A 4L23A 3LY7A 2VSNA 3R9MA 1YA0A 2X38A 4JZYA 3FTYA 5HKPA 1HS6A 2MYOA 2GRLA 5AJLA 4LEUA 3KD7A 3HG0D 4XI9A 5FT9A 4GZDA 2XHEA 1MX6A 2WXLA 4FU3A 5AENA 2FI7A 1IHBA 3MZLB 3SO8A 4LSZE 2AXUA 3GZ1A 1O1SA 2RG8A 3S7FA 4K03A 4UI9C 1BI8B 3TG4A 3I5PA 5EIDA 4YDOA 3PUJA 2KATA 5CEDB 3FHEA 2LSVA 3U4TA 3KEZA 2HYZA 4I9EA 2L0IA 3PNLB 3ML8A 2YQ8A 3PS6A 5AQ7A 4H7YA 3G2UA 2V8SE 3URZA 1UW4B 2V0PA 4XI0A 5FQ4A 3FU6A 4U0UA 4K5CA 3DSUA 3MKQA 5KWDA 4I6JA 3Q73A 3RKVA 3TWXA 4YVOA 3AG4E 2GRNB 2VJ8A 1BD8A 4RLYA 3QAQA 1L5JA 3SF4A 3TWTA 2LXMA 4TV3A 5IY5E 2WQ6A 5BV1A 3PDNA 2DYRE 2HM8A 3R7RA 4GCOA 2L6JA 4IN3B 4L2YA 3CQCB 1D8EA 4CEMA 5CERB 1FVFA 2GGFA 5BT1A 3BEEA 3DRAA 2NXPA 2J49A 1GW6A 2XENA 2I9CA 5CMWA 4GTMA 3PE4A 1QQEA 4LNUD 2R5SA 3AU4A 3Q7AA 4J8FA 5LCWJ 3QB2A 1K8KG 3HDXA 3HXBA 3L17A 2YHEA 4E85A 4BFRA 3CVXA 2H6GA 3ASNE 3CVNA 3ZUVB 4U7EB 5LX8A 1K1AA 4DRXE 1U3CA 3FEXA 4J8DA 3PREA 4ACKA 1OCRE 3ABME 3SZ7A 5KCMA 5T4YA 3TG5A 3T5VA 4U8YD 2R03A 1AP7A 5FZSA 2KCKA 3V2OA 4JD2G 3RRUA 4DPRA 1YMPA 4JW1A 4URKA 4FJZA 1TNZA 5ITZF 5EYLA 5KBAA 2KCVA 3BU8A 2X6FA 1RW2A 2WXOA 2VGYA 4LG6A 1Q2ZA 3CSFA 3LPZA 3L16A 3UTMA 2YHCA 3L08A 2OOEA 5AAOA 3C3QA 1HE8A 1O1RA 3VLDA 4I1MA 3D9KA 2XEHA 3MCXA 3DXKG 1X5BA 1ZB1A 1E8XA 4HXIA 1TYQG 1D8DA 3CK9A 3CHPA 3MJWA 3EIQC 3FUJA 3FH5A 3P1UA 4I9CA 3ZRHA 1NFIE 2J07A 4BEPA 2JEKA 2NC9A 1HF8A 1HX8A 4QQIA 3RJVA 4AEZC 3UKRG 3UXGA 5FIOA 4A3TA 5AIJA 3VTXA 2VSOE 3D9IA 3LJ3A 5G05J 1O1TA 4KXKB 2QYJA 4FA6A 4Y6CA 1H0AA 1O5MA 4BX9A 4U0ZA 5JHAA 4RSYA 2J4BA 4G2VA 3EHMA 1H6PA 2BUGA 2V4HC 1Z3XA 3CKBA 3FFLA 3Q5MA 4MS6A 1LF8A 3CLJA 5ANRA 1N4PA 3HXDA 3RRMB 2B0OE 1OXJA 4GTOA 4XIFA 2DCPA 2WQ7A 5AYWD 3D9JA 3CHQA 1TN8A 3QC1A 5JJ6A 4N2QA 2ZU6B 3G2VA 1FPPA 2VYIA 1XNFA 3RAUA 4N3AA 4KZ0A 1DNPA 4D10C 4AV7A 5ANLA 5CCMA 4MBGA 1QYMA 3K9IA 4DI4A 5CCLA 4J8SA 4ANWA 3I4RB 5KJNA 3MV3B 1N94A 4GCNA 4XZ4A 2QY7A 3QDNA 3Q7FA 3R9AB 4J0UA 1ZBPA 1E7UA 1OWOA 3FU0A 2V5QC 3FTVA 3FUFA 4JL0A 2LNIA 4Q69A 5CRUA 3DEPA 2RFMA 3ONKA 4LRZA 2L0TB 4C9BB 1UOHA 3QWVA 3D9PA 4A55A 4I2WA 4CYMD 3GZSA 4ILHB 3KS2A 4L1BA 1DC2A 2ZGGA 3QARA 3QKYA 3JUEA 4WNFA 4JXTA 4F7AA 3CVWA 3W9FA 3NZUA 1BU9A 3Q49B 2DWZA 3EHRA 1N4RA 1HG2A 5G04C 2KZTB 3FTSA 2UY1A 2A4ZA 2GRPB 4B0ZA 1IHGA 4PH4B 3NBNB 3WXXA 3HVEA 2J08A 4F6RD 1FCHA 5FWQA 3SHFA 3LXUX 2EIJE 2WXRA 1U3DA 2WXNA 3ULYA 5J90A 2FO1E 1H19A 1IXVA 4GMJA 5ENPD 4CT0A 3CHOA 2IF4A 4EZLA 2GW1A 3UQ3A 5D66A 5ARGA 4MRUA 3ULQA 2MOWA 1MX2A 3NZSA 3WG7E 2FULA 2NSZA 3CVLA 3FU5A 4NACA 1V54E 5E75A 3L54A 2PNNA 3RRNB 3ZVVA 4AY6A 4AY5A 2XEEA 3L9TA 3LDZA 2QFCA 4O1OA 3SBTB 1Z3YA 3MX3A 4RVBA 2WXMA 1K1BA 2F0YA 2BF0X 3O4ZA 4L2LA 2AJAA 4NQ0A 4PS8A 3AAAC 3FUHA 2B6CA 4N3BA 1V55E 3PZ1A 4TXQA 5ENOD 5C1DA 2A5UA 3JUIA 1MHQA 5E76A 3MEKA 4GMRA 3SBSA 3CVUA 4U0SA 3ZXSA 3ZFWA 2P58C 2CG3A 2Y3AA 3CR3A 3S7JA 4DUIA 2C0MA 4BT8A 4WWNA 4WWPA 4U07A 4B89A 4XEIG 2P9IG 4DI3A 1TNYA 1UJJA 3N71A 4JB8P 3MKQB 1FT2A 3TXMA 4DX5D 3UT7A 3LJNA 4F1SA 3C98A 1OWMA 4C0MA 2C2LA 3ZEFA 3OXGA 2IO3C 1PAQA 2WXGA 1BPOA 3QWWA 3Q79A 3ZYMA 1EYHA 4I2ZA 5FINA 5EN5D 4Q94A 4KT6B 1RZ4A 5A7DB 3ASFA 2EIME 1B89A 5AN8A 5B3SE 4YDWA 3SD5A 4AXHA 3B7BA 2XPIA 3FUEA 1BLXB 5T8IA 2KC7A 4K0RA 5HRYA 2VGXB 2KM4A 2PZIA 2WXKA 4KZCA 3EHNA 1JUQA 3FDHA 3SFXA 4CGWA 3ENEA 3PEUB 4F3VA 4BWRA 2OV8A 2IO2C 4B8AA 1K3ZD 4PS7A 1TR4A 4M7CA 3CK7A 3Q9UC 4L7TA 3ZN3A 4JA7A 1TJFA 4G11A 2IONA 4XKCA 2KCLA 1SVXA 3FUNA 4UUCA 4GMLA 5ENSD 2RKKA 5DIZA 2Q7FA 1KLXA 4HVBA 5KJMA 4FJYA 1UN9A 3ASOE 4EZKA 4BY6A 2AW6A 1DCEA 3ZHEA 2LSUA 4WNEA 1SA5A 3CK8A 2WXIA 4N3CA 3LY9A 1JCRA 4GA0A 1SW6A 4HLLA 4YDEA 1E90A 5B1AE 4C0EA 3FUDA 2P9NG 3B7UX 4O60A 4LERA 1MX4A 4FHKA 3ZPJA 3DSTA 4Q96A 4CRWA 4UI9J 4WAFA 4HOTA 3DBSA 4GZ6A 3NQPA 4I6GA 3LEWA 4CGVA 2XS8A 2PM6A 4I43A 1HH8A 3DWLG 4KBQA 2WXHA 1JCSA 2E0IA 5C2YA 2J4DA 3RIBA 1QZ2A 3LYAA 2R02A 3CKCA 3RO3A 3NOCD 3LS8A 3HYMB 3JXIA 4UWFA 5AJDA 3HXCA 4OYSA 3MKRA 3B7RL 1SZAA 2YNQA 1FT1A 1HZ4A 5EIBE 5CHEE 3ONLA 4PUCA 2ZIRA 4K5AB 4FADA 4PDXA 2NYJA 4UWHA 1YCSB 3ZGQA 3FP3A 3B7TA 1AWCB 1EPUA 3APCA 4JEUA 3KSQA 2ETCA 3IXEA 2HE0A 2ILRA 3UIOC 2P9KG 2WPVA 3ZKJA 3NF1A 1NP7A 4J8YA 3ASHA 4CT4A 3FH7A 3CV0A 3B7SA 3JXJA 2GRMA 3L6AA 3DEOA 4G8KA 4GZCA 3S7BA 4APFA 4O1PA 1FVHA 4EPZA 5AQ9A 1TNBA 1HXIA 2ETBA 1XGWA 1WAO1 3D9HA 3UINC 5ARFA 4ACLA 1N9AA 3GYZA 3S7DA 4U96D 4TUMA 5CRVA 3FTWA 2IEJA 1WDYA 2E2EA 3ZNGA 3D9OA 4BX8A 3PZ2A 2J9QA 4HBDA 1G3NB 4AJWA 4GPKA 4HQDA 2XS1A 3SNXA 3W9GA 3L13A 4X8QA 2BTDA 4BSZB 4CDNA 1D9SA 3DPYA 1SQMA 3VLEA 3C5RA 5CEAA 2R2LA 4UI9K 3APDA 2Y69E 3T9KA 2WXJA 3VLFA 1UG3A 3TWQA 3E33A 4BETA 3CQGB 4BT9A 4WWOA 4FLHA 1WM5A 2XCBA 3UM0A 3D9MA 2R05A 3SI5A 4N5CA 4BSXA 3UM2A 5T3RA 4AIFA 3ASGA 5ENRD 2PM7A 3MGBA 4N39A 3ZU7B 4L9PA 4B8CB 1DCQA 3NOGD 2VSXE 3AS5A 3E30A 1WY6A 4DX2A 4I1OB 3E4BA 5FQ6A 3ZYKA 3O48A 4ME2A 4J8EA 3UKUG 1TN7A 2F8YA 2IY0C 5AQAA 4GAAA 5AQBA 1JWGA 4EZJA 2FEZA 3ESLA 2AXVA 3B13A 4GA2A 1MZCA 2V4LA 1OWPA 2XGSA 5D2MC 3PRZA 4EHMA 4JPSA 2VSYA 3D3MA 2VQ2A 3CVPA 2F8XK 2MHKA 3TGOA 4BTAA 4LNGA 3ABLE 3CHSA 2HO1A 3OXLA 3U64A 1S63A 3EIJA 2WMNA 3OTNA 3HXEA 1VDYA 4I1AA 1JPLA 4EQFA 2PQNA 3V30A 4Y6WA 2LUHA 4GTVA 5JMND 4ANVA 1N4QA 2XEVA 3L22A 2ETAA 3D9LA 2P9UG 3F6QA 5EKQD 4RG9A 1EF1C 3C72A 4HB5A 3GZ2A 1MQSA 4GZ5A 3IEGA 4ZHBA 1P5QA 4A3VA 3UM1A 2CFZA 3KAEA 2QZAA 4ILIA 1S64A 3T8KA 2JABA 4GB9A 1Y8MA 3LKUA 4CCAA 2C0LA 3Q15A 3ESKA 4TRQA 1N0QA 2RD0A 3SFZA 2VTBA 5KJKA 4DLQA 2WMOA 3P2BA 1PY1A 2A5EA 2Y4UA 5A6CA 3SQVA 4FLBA 1SA4A 5JJTA 4O6FA 3E37A 4HRNA 5FJYA 3CHMA 3IBEA 4HNAD 1E8WA 4ABNA 2HR2A 1JWFA 5EX3A 3ZIMA 4EBAG 2L9BA 4G8LA 3J5PA 3S2AA 4PS3A 4FP7A 3QNKA 4UQZA 4GYWA 4HORA 3X2QE 4DX1A 2R59A 1A5EA 1E8ZA 3UT8A 4GYYA 2KZTA 2RFAA 3DSXA 3T5XA 4FHJA 4JEHA 3BUAA 1TNOA 2LXLA 3UMVA 2P9LG 4BESA 4GTPA 3QWPA 1Z5SC 2BEDA 1ELWA 1LD7A 5G04J 1H6KA 2BKKB 3HIZA 4C48B 4FULA 4MLPA 4GTQA 3G2WA 2XRYA 1KT0A 2WVIA 3G2SA 3I3NA 4GZ3A 3U3WA 1IYGA 3Q47B 2FO7A 3R7QA 3HRAA 5BPPA 3JQ0A 3PVLA 5BXUA 2IOLA 2OVBA 5B1BE 4XKBA 3UX4A 2MRIA 4RG6A 2X6IA 3TWRA 5CBOA 3NAWA 2I1JA 2DZOA 1WG0A 3C3RA 3FTUA 1IQUA 3CVVA 4KVMA 1ELRA 4JHKA 3TWSA 2PQRA 3V2XA 2FF4A 3J5QB 2AXZA 3AS8A 2I6HA 3ZHEB 4HLEA 3FH8A 5BV0A 1NA3A 2OEWA 2WQHA 4W9RA 3SFYA 4UWKA 1S0PA 4Z68A 2R17C 3FUIA 5LCWC 3MV2B 4NURA 1KT1A 2GRRB 3TAXA 3NB2A 4TXPA 2JLBA 4HFGA 3CEQA 4DX7D 3LY8A 4EECA 3ASDA 5BUZA 5JA4D 3UIPC 5FQ8A 2F37A 3IHYA 2IJGX 5H7PA 3KSLA 5FQ7A 3V79K 4BTBA 1E7VA 3C3OA 3OXFA 3AU5A 1ELKA 2DVWA 1Y6IA 3SY2A 4E6HA 2QYUA 3U66A 4G23A 3PH0C 4GPMA 4AOFA 1A17A 3FEYA 3UPVA 5J08A 1TNUA 2IFUA 4GTSA 3RU0A 5JJ7A 3PNTB 3FTZA 3RO2A 4YVQC 2ZISA 3Q9NC 1SZ9A 5BNWA 4HRMB 4J6IA 1PC2A 4EBAA 3VTYA 3ISMC 4G26A 4J7WA 4GYOA 4R7LA 2X6JA 4CDMA 3CSTA 2X6KA 5EX0A 1NZNA 4AP2A 3V31A 2VGXA 2P9SG 2EIKE 4IRUA 5FTPA 1OWLA 3CVQA 3QOUA 2M63A 1N54A 2DZNA 5FZQA 4G25A 1HO8A 3JQ1A 3LVQE 3B95A 3JCKC 3ZXPA 4YDYA 3DSSA 2L6BA 2EQXA 4UQXA 1OCOE 4HOQA 1INZA 3TL5A 3AG1E 2CHWA 4IULA 4V3IA 5CECB 2WB2A 2ZXWE 5G05C 1OCCE 1YYHA 2CG2A 3IV0A 1MYOA 3E34A 4JC8A 4HOUA 3L82A 2XPYA 5D0OD 1DVPA 4KMOA 4A1GA 2KBXA 3FTXA 4B94A 3FY4A 3Q75A 4G1TA 2QC9A 5G55A 2ONDA 3PZ3A 4LNBA 3FU3A 2DBAA 4N2SA 4F53A 2Y4TA 1NA0A 3AG3E 4A1SA 1IKND 3BG0B 4UQYA 4LCTA 4OAVB 3EU5A 4HI8A 1KPSB 4ILGA 3ZYQA 1H6OA 3EDTB 1KZPA 2GRQB 3FULA 1MJ0A 1N95A 4CZ2D 1E8YA 5G2NA 4HI9A 1NL4A 3CGHA 4AVXA 3GW4A 3RSEG 2LAHA 4LUNU 1HG5A 1W3BA 4WNDA 4G24A 5AARA 5BXOA 4UWGA 5KNGA 4OAUC 3AJIA 3D9NA 1NI1A 2KXPC 2P9PG 4U8VD 2XRZA 2WXFA 3E32A 1LTXA 1JCQA 5LFAA 1E96B 3ZYLA 4ZFHA 4B93B 4OVUA 3ULEG 1TN6A 4A63B 3FUKA 2YINA 4AM9A 4KYOB 2OCCE 2V5FA 5LP0A 5HS0A 5BW8C 3PZDA 4I6EA 5A23A 3DSVA 3BG1B 3TJPA 1Z6TA 3PE3A 4WUYA 4P29A 2I2OA 2XGOA 1QNFA 4KVOA 3Q4AB 4K5BA 2P2CP 4CDRA 4ANXA 3HHMA 3U9WA 2XGMA 4U04A 2I1KA 3QJZA 3CVYA 3TXNA 2BKGA 2VGEA 3UI2A 4M3OA 4QFVA 1IQRA 4FC8A 2AWIA 3UM3A 4HRLA 4ATZD 2LAIA 2H6IA 4TXRA 2DIWA 4MKTA 3QK0A 2CHZA 5EILA 3PEVB 3LCAA 2UY1B 5CBNA 2CFUA 4NRHB 3Q78A 1QBQA 3IKOB 2XZDG 3PZ4A 3DSWA 3TWVA 3TWUA 4JA9A 1H2VC 1N11A 3HVEB 4GA1A 1HFAA 4I17A 1H2UA 3HXFA 4IYPA 1OWNA 3ML9A 5D0QD 4F1PA 1OUVA 1LD8A 2IQCA 2XQ0A 5JHBA 2J8SD 4GTRA 3LVRE 2LO6A 3EJNA 2UWJG 3APFA 1ZU2A 2H6FA 3T8MA 5KNHD 5EDSA 1N0RA 2VTBB 4HOSA 1H2TC 3I4GA 5EYPF 2EINE 4DLOA 1OCZE 1N4SA 2PL2A 3CHRA 3MYVA 4JHRA 4U63A 4GTTA 1OY3D 3IHVA 4HS2A 3CIAA 1U2VG 2IOSA 3JYSA 2DYSE 2XZTG 2IU1A 1UN8A 3UUXA 4APOA 4ATGA 3FWVA 3UT4A 4TUUA 4WNGA 5LOZA 1BI7B 2H6HA 3PUKA 3ZW3A 3EHQA 5HI7A 1X81A 5ENQD 3BQOA 4DJAA 4DX6D 1EDUA 1N52A 3SGHA 1TEZA 2Y0BG 2FBNA 2WM9A 3DPDA 1HU3A 2AVPA 5M72A 3EUVA 3KEAA 4NIKA 3EU9A 3OAWA 4JHJA 5HQ8A 3AS4A 2EILE 5FZRA 4UWLA 1TJCA 2WXPA 4N5QA 2CHXA 4ANUA 3TWWA 3G2TA 4OVVA 3FUMA 4XE0A 2OVFA 4BERA 2XPZA 4GU5A
chains in the Genus database with same CATH topology
3DWLG 2P9NG 2P9PG 4XEIG 2P9IG 3DXMG 1K8KG 1U2VG 3ULEG 2P9KG 3DXKG 3RSEG 3UKUG 3UKRG 4JD2G 2P9UG 2P9LG 2P9SG 1TYQG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DWL G;  2P9N G;  2P9P G;  4XEI G;  2P9I G;  3DXM G;  1K8K G;  1U2V G;  3ULE G;  2P9K G;  3DXK G;  3RSE G;  3UKU G;  3UKR G;  4JD2 G;  2P9U G;  2P9L G;  2P9S G;  1TYQ G; 
#chains in the Genus database with same CATH topology
 2GRO B;  3MA5 A;  2Y1L E;  5CMY A;  5ENT D;  4YND A;  4H7X A;  1UJK A;  5KJL A;  1S70 B;  2X6H A;  2XCC A;  3AG2 E;  3ABK E;  2ZGD A;  5DBK A;  1OT8 A;  1KZO A;  4RQI A;  3DXM G;  4XX5 A;  3RK6 A;  2J09 A;  2OEV A;  2WXQ A;  4JVS A;  4U95 D;  4U8H A;  5ENN A;  2X3M A;  4DK5 A;  4L23 A;  3LY7 A;  2VSN A;  3R9M A;  1YA0 A;  2X38 A;  4JZY A;  3FTY A;  5HKP A;  1HS6 A;  2MYO A;  2GRL A;  5AJL A;  4LEU A;  3KD7 A;  3HG0 D;  4XI9 A;  5FT9 A;  4GZD A;  2XHE A;  1MX6 A;  2WXL A;  4FU3 A;  5AEN A;  2FI7 A;  1IHB A;  3MZL B;  3SO8 A;  4LSZ E;  2AXU A;  3GZ1 A;  1O1S A;  2RG8 A;  3S7F A;  4K03 A;  4UI9 C;  1BI8 B;  3TG4 A;  3I5P A;  5EID A;  4YDO A;  3PUJ A;  2KAT A;  5CED B;  3FHE A;  2LSV A;  3U4T A;  3KEZ A;  2HYZ A;  4I9E A;  2L0I A;  3PNL B;  3ML8 A;  2YQ8 A;  3PS6 A;  5AQ7 A;  4H7Y A;  3G2U A;  2V8S E;  3URZ A;  1UW4 B;  2V0P A;  4XI0 A;  5FQ4 A;  3FU6 A;  4U0U A;  4K5C A;  3DSU A;  3MKQ A;  5KWD A;  4I6J A;  3Q73 A;  3RKV A;  3TWX A;  4YVO A;  3AG4 E;  2GRN B;  2VJ8 A;  1BD8 A;  4RLY A;  3QAQ A;  1L5J A;  3SF4 A;  3TWT A;  2LXM A;  4TV3 A;  5IY5 E;  2WQ6 A;  5BV1 A;  3PDN A;  2DYR E;  2HM8 A;  3R7R A;  4GCO A;  2L6J A;  4IN3 B;  4L2Y A;  3CQC B;  1D8E A;  4CEM A;  5CER B;  1FVF A;  2GGF A;  5BT1 A;  3BEE A;  3DRA A;  2NXP A;  2J49 A;  1GW6 A;  2XEN A;  2I9C A;  5CMW A;  4GTM A;  3PE4 A;  1QQE A;  4LNU D;  2R5S A;  3AU4 A;  3Q7A A;  4J8F A;  5LCW J;  3QB2 A;  1K8K G;  3HDX A;  3HXB A;  3L17 A;  2YHE A;  4E85 A;  4BFR A;  3CVX A;  2H6G A;  3ASN E;  3CVN A;  3ZUV B;  4U7E B;  5LX8 A;  1K1A A;  4DRX E;  1U3C A;  3FEX A;  4J8D A;  3PRE A;  4ACK A;  1OCR E;  3ABM E;  3SZ7 A;  5KCM A;  5T4Y A;  3TG5 A;  3T5V A;  4U8Y D;  2R03 A;  1AP7 A;  5FZS A;  2KCK A;  3V2O A;  4JD2 G;  3RRU A;  4DPR A;  1YMP A;  4JW1 A;  4URK A;  4FJZ A;  1TNZ A;  5ITZ F;  5EYL A;  5KBA A;  2KCV A;  3BU8 A;  2X6F A;  1RW2 A;  2WXO A;  2VGY A;  4LG6 A;  1Q2Z A;  3CSF A;  3LPZ A;  3L16 A;  3UTM A;  2YHC A;  3L08 A;  2OOE A;  5AAO A;  3C3Q A;  1HE8 A;  1O1R A;  3VLD A;  4I1M A;  3D9K A;  2XEH A;  3MCX A;  3DXK G;  1X5B A;  1ZB1 A;  1E8X A;  4HXI A;  1TYQ G;  1D8D A;  3CK9 A;  3CHP A;  3MJW A;  3EIQ C;  3FUJ A;  3FH5 A;  3P1U A;  4I9C A;  3ZRH A;  1NFI E;  2J07 A;  4BEP A;  2JEK A;  2NC9 A;  1HF8 A;  1HX8 A;  4QQI A;  3RJV A;  4AEZ C;  3UKR G;  3UXG A;  5FIO A;  4A3T A;  5AIJ A;  3VTX A;  2VSO E;  3D9I A;  3LJ3 A;  5G05 J;  1O1T A;  4KXK B;  2QYJ A;  4FA6 A;  4Y6C A;  1H0A A;  1O5M A;  4BX9 A;  4U0Z A;  5JHA A;  4RSY A;  2J4B A;  4G2V A;  3EHM A;  1H6P A;  2BUG A;  2V4H C;  1Z3X A;  3CKB A;  3FFL A;  3Q5M A;  4MS6 A;  1LF8 A;  3CLJ A;  5ANR A;  1N4P A;  3HXD A;  3RRM B;  2B0O E;  1OXJ A;  4GTO A;  4XIF A;  2DCP A;  2WQ7 A;  5AYW D;  3D9J A;  3CHQ A;  1TN8 A;  3QC1 A;  5JJ6 A;  4N2Q A;  2ZU6 B;  3G2V A;  1FPP A;  2VYI A;  1XNF A;  3RAU A;  4N3A A;  4KZ0 A;  1DNP A;  4D10 C;  4AV7 A;  5ANL A;  5CCM A;  4MBG A;  1QYM A;  3K9I A;  4DI4 A;  5CCL A;  4J8S A;  4ANW A;  3I4R B;  5KJN A;  3MV3 B;  1N94 A;  4GCN A;  4XZ4 A;  2QY7 A;  3QDN A;  3Q7F A;  3R9A B;  4J0U A;  1ZBP A;  1E7U A;  1OWO A;  3FU0 A;  2V5Q C;  3FTV A;  3FUF A;  4JL0 A;  2LNI A;  4Q69 A;  5CRU A;  3DEP A;  2RFM A;  3ONK A;  4LRZ A;  2L0T B;  4C9B B;  1UOH A;  3QWV A;  3D9P A;  4A55 A;  4I2W A;  4CYM D;  3GZS A;  4ILH B;  3KS2 A;  4L1B A;  1DC2 A;  2ZGG A;  3QAR A;  3QKY A;  3JUE A;  4WNF A;  4JXT A;  4F7A A;  3CVW A;  3W9F A;  3NZU A;  1BU9 A;  3Q49 B;  2DWZ A;  3EHR A;  1N4R A;  1HG2 A;  5G04 C;  2KZT B;  3FTS A;  2UY1 A;  2A4Z A;  2GRP B;  4B0Z A;  1IHG A;  4PH4 B;  3NBN B;  3WXX A;  3HVE A;  2J08 A;  4F6R D;  1FCH A;  5FWQ A;  3SHF A;  3LXU X;  2EIJ E;  2WXR A;  1U3D A;  2WXN A;  3ULY A;  5J90 A;  2FO1 E;  1H19 A;  1IXV A;  4GMJ A;  5ENP D;  4CT0 A;  3CHO A;  2IF4 A;  4EZL A;  2GW1 A;  3UQ3 A;  5D66 A;  5ARG A;  4MRU A;  3ULQ A;  2MOW A;  1MX2 A;  3NZS A;  3WG7 E;  2FUL A;  2NSZ A;  3CVL A;  3FU5 A;  4NAC A;  1V54 E;  5E75 A;  3L54 A;  2PNN A;  3RRN B;  3ZVV A;  4AY6 A;  4AY5 A;  2XEE A;  3L9T A;  3LDZ A;  2QFC A;  4O1O A;  3SBT B;  1Z3Y A;  3MX3 A;  4RVB A;  2WXM A;  1K1B A;  2F0Y A;  2BF0 X;  3O4Z A;  4L2L A;  2AJA A;  4NQ0 A;  4PS8 A;  3AAA C;  3FUH A;  2B6C A;  4N3B A;  1V55 E;  3PZ1 A;  4TXQ A;  5ENO D;  5C1D A;  2A5U A;  3JUI A;  1MHQ A;  5E76 A;  3MEK A;  4GMR A;  3SBS A;  3CVU A;  4U0S A;  3ZXS A;  3ZFW A;  2P58 C;  2CG3 A;  2Y3A A;  3CR3 A;  3S7J A;  4DUI A;  2C0M A;  4BT8 A;  4WWN A;  4WWP A;  4U07 A;  4B89 A;  4XEI G;  2P9I G;  4DI3 A;  1TNY A;  1UJJ A;  3N71 A;  4JB8 P;  3MKQ B;  1FT2 A;  3TXM A;  4DX5 D;  3UT7 A;  3LJN A;  4F1S A;  3C98 A;  1OWM A;  4C0M A;  2C2L A;  3ZEF A;  3OXG A;  2IO3 C;  1PAQ A;  2WXG A;  1BPO A;  3QWW A;  3Q79 A;  3ZYM A;  1EYH A;  4I2Z A;  5FIN A;  5EN5 D;  4Q94 A;  4KT6 B;  1RZ4 A;  5A7D B;  3ASF A;  2EIM E;  1B89 A;  5AN8 A;  5B3S E;  4YDW A;  3SD5 A;  4AXH A;  3B7B A;  2XPI A;  3FUE A;  1BLX B;  5T8I A;  2KC7 A;  4K0R A;  5HRY A;  2VGX B;  2KM4 A;  2PZI A;  2WXK A;  4KZC A;  3EHN A;  1JUQ A;  3FDH A;  3SFX A;  4CGW A;  3ENE A;  3PEU B;  4F3V A;  4BWR A;  2OV8 A;  2IO2 C;  4B8A A;  1K3Z D;  4PS7 A;  1TR4 A;  4M7C A;  3CK7 A;  3Q9U C;  4L7T A;  3ZN3 A;  4JA7 A;  1TJF A;  4G11 A;  2ION A;  4XKC A;  2KCL A;  1SVX A;  3FUN A;  4UUC A;  4GML A;  5ENS D;  2RKK A;  5DIZ A;  2Q7F A;  1KLX A;  4HVB A;  5KJM A;  4FJY A;  1UN9 A;  3ASO E;  4EZK A;  4BY6 A;  2AW6 A;  1DCE A;  3ZHE A;  2LSU A;  4WNE A;  1SA5 A;  3CK8 A;  2WXI A;  4N3C A;  3LY9 A;  1JCR A;  4GA0 A;  1SW6 A;  4HLL A;  4YDE A;  1E90 A;  5B1A E;  4C0E A;  3FUD A;  2P9N G;  3B7U X;  4O60 A;  4LER A;  1MX4 A;  4FHK A;  3ZPJ A;  3DST A;  4Q96 A;  4CRW A;  4UI9 J;  4WAF A;  4HOT A;  3DBS A;  4GZ6 A;  3NQP A;  4I6G A;  3LEW A;  4CGV A;  2XS8 A;  2PM6 A;  4I43 A;  1HH8 A;  3DWL G;  4KBQ A;  2WXH A;  1JCS A;  2E0I A;  5C2Y A;  2J4D A;  3RIB A;  1QZ2 A;  3LYA A;  2R02 A;  3CKC A;  3RO3 A;  3NOC D;  3LS8 A;  3HYM B;  3JXI A;  4UWF A;  5AJD A;  3HXC A;  4OYS A;  3MKR A;  3B7R L;  1SZA A;  2YNQ A;  1FT1 A;  1HZ4 A;  5EIB E;  5CHE E;  3ONL A;  4PUC A;  2ZIR A;  4K5A B;  4FAD A;  4PDX A;  2NYJ A;  4UWH A;  1YCS B;  3ZGQ A;  3FP3 A;  3B7T A;  1AWC B;  1EPU A;  3APC A;  4JEU A;  3KSQ A;  2ETC A;  3IXE A;  2HE0 A;  2ILR A;  3UIO C;  2P9K G;  2WPV A;  3ZKJ A;  3NF1 A;  1NP7 A;  4J8Y A;  3ASH A;  4CT4 A;  3FH7 A;  3CV0 A;  3B7S A;  3JXJ A;  2GRM A;  3L6A A;  3DEO A;  4G8K A;  4GZC A;  3S7B A;  4APF A;  4O1P A;  1FVH A;  4EPZ A;  5AQ9 A;  1TNB A;  1HXI A;  2ETB A;  1XGW A;  1WAO 1;  3D9H A;  3UIN C;  5ARF A;  4ACL A;  1N9A A;  3GYZ A;  3S7D A;  4U96 D;  4TUM A;  5CRV A;  3FTW A;  2IEJ A;  1WDY A;  2E2E A;  3ZNG A;  3D9O A;  4BX8 A;  3PZ2 A;  2J9Q A;  4HBD A;  1G3N B;  4AJW A;  4GPK A;  4HQD A;  2XS1 A;  3SNX A;  3W9G A;  3L13 A;  4X8Q A;  2BTD A;  4BSZ B;  4CDN A;  1D9S A;  3DPY A;  1SQM A;  3VLE A;  3C5R A;  5CEA A;  2R2L A;  4UI9 K;  3APD A;  2Y69 E;  3T9K A;  2WXJ A;  3VLF A;  1UG3 A;  3TWQ A;  3E33 A;  4BET A;  3CQG B;  4BT9 A;  4WWO A;  4FLH A;  1WM5 A;  2XCB A;  3UM0 A;  3D9M A;  2R05 A;  3SI5 A;  4N5C A;  4BSX A;  3UM2 A;  5T3R A;  4AIF A;  3ASG A;  5ENR D;  2PM7 A;  3MGB A;  4N39 A;  3ZU7 B;  4L9P A;  4B8C B;  1DCQ A;  3NOG D;  2VSX E;  3AS5 A;  3E30 A;  1WY6 A;  4DX2 A;  4I1O B;  3E4B A;  5FQ6 A;  3ZYK A;  3O48 A;  4ME2 A;  4J8E A;  3UKU G;  1TN7 A;  2F8Y A;  2IY0 C;  5AQA A;  4GAA A;  5AQB A;  1JWG A;  4EZJ A;  2FEZ A;  3ESL A;  2AXV A;  3B13 A;  4GA2 A;  1MZC A;  2V4L A;  1OWP A;  2XGS A;  5D2M C;  3PRZ A;  4EHM A;  4JPS A;  2VSY A;  3D3M A;  2VQ2 A;  3CVP A;  2F8X K;  2MHK A;  3TGO A;  4BTA A;  4LNG A;  3ABL E;  3CHS A;  2HO1 A;  3OXL A;  3U64 A;  1S63 A;  3EIJ A;  2WMN A;  3OTN A;  3HXE A;  1VDY A;  4I1A A;  1JPL A;  4EQF A;  2PQN A;  3V30 A;  4Y6W A;  2LUH A;  4GTV A;  5JMN D;  4ANV A;  1N4Q A;  2XEV A;  3L22 A;  2ETA A;  3D9L A;  2P9U G;  3F6Q A;  5EKQ D;  4RG9 A;  1EF1 C;  3C72 A;  4HB5 A;  3GZ2 A;  1MQS A;  4GZ5 A;  3IEG A;  4ZHB A;  1P5Q A;  4A3V A;  3UM1 A;  2CFZ A;  3KAE A;  2QZA A;  4ILI A;  1S64 A;  3T8K A;  2JAB A;  4GB9 A;  1Y8M A;  3LKU A;  4CCA A;  2C0L A;  3Q15 A;  3ESK A;  4TRQ A;  1N0Q A;  2RD0 A;  3SFZ A;  2VTB A;  5KJK A;  4DLQ A;  2WMO A;  3P2B A;  1PY1 A;  2A5E A;  2Y4U A;  5A6C A;  3SQV A;  4FLB A;  1SA4 A;  5JJT A;  4O6F A;  3E37 A;  4HRN A;  5FJY A;  3CHM A;  3IBE A;  4HNA D;  1E8W A;  4ABN A;  2HR2 A;  1JWF A;  5EX3 A;  3ZIM A;  4EBA G;  2L9B A;  4G8L A;  3J5P A;  3S2A A;  4PS3 A;  4FP7 A;  3QNK A;  4UQZ A;  4GYW A;  4HOR A;  3X2Q E;  4DX1 A;  2R59 A;  1A5E A;  1E8Z A;  3UT8 A;  4GYY A;  2KZT A;  2RFA A;  3DSX A;  3T5X A;  4FHJ A;  4JEH A;  3BUA A;  1TNO A;  2LXL A;  3UMV A;  2P9L G;  4BES A;  4GTP A;  3QWP A;  1Z5S C;  2BED A;  1ELW A;  1LD7 A;  5G04 J;  1H6K A;  2BKK B;  3HIZ A;  4C48 B;  4FUL A;  4MLP A;  4GTQ A;  3G2W A;  2XRY A;  1KT0 A;  2WVI A;  3G2S A;  3I3N A;  4GZ3 A;  3U3W A;  1IYG A;  3Q47 B;  2FO7 A;  3R7Q A;  3HRA A;  5BPP A;  3JQ0 A;  3PVL A;  5BXU A;  2IOL A;  2OVB A;  5B1B E;  4XKB A;  3UX4 A;  2MRI A;  4RG6 A;  2X6I A;  3TWR A;  5CBO A;  3NAW A;  2I1J A;  2DZO A;  1WG0 A;  3C3R A;  3FTU A;  1IQU A;  3CVV A;  4KVM A;  1ELR A;  4JHK A;  3TWS A;  2PQR A;  3V2X A;  2FF4 A;  3J5Q B;  2AXZ A;  3AS8 A;  2I6H A;  3ZHE B;  4HLE A;  3FH8 A;  5BV0 A;  1NA3 A;  2OEW A;  2WQH A;  4W9R A;  3SFY A;  4UWK A;  1S0P A;  4Z68 A;  2R17 C;  3FUI A;  5LCW C;  3MV2 B;  4NUR A;  1KT1 A;  2GRR B;  3TAX A;  3NB2 A;  4TXP A;  2JLB A;  4HFG A;  3CEQ A;  4DX7 D;  3LY8 A;  4EEC A;  3ASD A;  5BUZ A;  5JA4 D;  3UIP C;  5FQ8 A;  2F37 A;  3IHY A;  2IJG X;  5H7P A;  3KSL A;  5FQ7 A;  3V79 K;  4BTB A;  1E7V A;  3C3O A;  3OXF A;  3AU5 A;  1ELK A;  2DVW A;  1Y6I A;  3SY2 A;  4E6H A;  2QYU A;  3U66 A;  4G23 A;  3PH0 C;  4GPM A;  4AOF A;  1A17 A;  3FEY A;  3UPV A;  5J08 A;  1TNU A;  2IFU A;  4GTS A;  3RU0 A;  5JJ7 A;  3PNT B;  3FTZ A;  3RO2 A;  4YVQ C;  2ZIS A;  3Q9N C;  1SZ9 A;  5BNW A;  4HRM B;  4J6I A;  1PC2 A;  4EBA A;  3VTY A;  3ISM C;  4G26 A;  4J7W A;  4GYO A;  4R7L A;  2X6J A;  4CDM A;  3CST A;  2X6K A;  5EX0 A;  1NZN A;  4AP2 A;  3V31 A;  2VGX A;  2P9S G;  2EIK E;  4IRU A;  5FTP A;  1OWL A;  3CVQ A;  3QOU A;  2M63 A;  1N54 A;  2DZN A;  5FZQ A;  4G25 A;  1HO8 A;  3JQ1 A;  3LVQ E;  3B95 A;  3JCK C;  3ZXP A;  4YDY A;  3DSS A;  2L6B A;  2EQX A;  4UQX A;  1OCO E;  4HOQ A;  1INZ A;  3TL5 A;  3AG1 E;  2CHW A;  4IUL A;  4V3I A;  5CEC B;  2WB2 A;  2ZXW E;  5G05 C;  1OCC E;  1YYH A;  2CG2 A;  3IV0 A;  1MYO A;  3E34 A;  4JC8 A;  4HOU A;  3L82 A;  2XPY A;  5D0O D;  1DVP A;  4KMO A;  4A1G A;  2KBX A;  3FTX A;  4B94 A;  3FY4 A;  3Q75 A;  4G1T A;  2QC9 A;  5G55 A;  2OND A;  3PZ3 A;  4LNB A;  3FU3 A;  2DBA A;  4N2S A;  4F53 A;  2Y4T A;  1NA0 A;  3AG3 E;  4A1S A;  1IKN D;  3BG0 B;  4UQY A;  4LCT A;  4OAV B;  3EU5 A;  4HI8 A;  1KPS B;  4ILG A;  3ZYQ A;  1H6O A;  3EDT B;  1KZP A;  2GRQ B;  3FUL A;  1MJ0 A;  1N95 A;  4CZ2 D;  1E8Y A;  5G2N A;  4HI9 A;  1NL4 A;  3CGH A;  4AVX A;  3GW4 A;  3RSE G;  2LAH A;  4LUN U;  1HG5 A;  1W3B A;  4WND A;  4G24 A;  5AAR A;  5BXO A;  4UWG A;  5KNG A;  4OAU C;  3AJI A;  3D9N A;  1NI1 A;  2KXP C;  2P9P G;  4U8V D;  2XRZ A;  2WXF A;  3E32 A;  1LTX A;  1JCQ A;  5LFA A;  1E96 B;  3ZYL A;  4ZFH A;  4B93 B;  4OVU A;  3ULE G;  1TN6 A;  4A63 B;  3FUK A;  2YIN A;  4AM9 A;  4KYO B;  2OCC E;  2V5F A;  5LP0 A;  5HS0 A;  5BW8 C;  3PZD A;  4I6E A;  5A23 A;  3DSV A;  3BG1 B;  3TJP A;  1Z6T A;  3PE3 A;  4WUY A;  4P29 A;  2I2O A;  2XGO A;  1QNF A;  4KVO A;  3Q4A B;  4K5B A;  2P2C P;  4CDR A;  4ANX A;  3HHM A;  3U9W A;  2XGM A;  4U04 A;  2I1K A;  3QJZ A;  3CVY A;  3TXN A;  2BKG A;  2VGE A;  3UI2 A;  4M3O A;  4QFV A;  1IQR A;  4FC8 A;  2AWI A;  3UM3 A;  4HRL A;  4ATZ D;  2LAI A;  2H6I A;  4TXR A;  2DIW A;  4MKT A;  3QK0 A;  2CHZ A;  5EIL A;  3PEV B;  3LCA A;  2UY1 B;  5CBN A;  2CFU A;  4NRH B;  3Q78 A;  1QBQ A;  3IKO B;  2XZD G;  3PZ4 A;  3DSW A;  3TWV A;  3TWU A;  4JA9 A;  1H2V C;  1N11 A;  3HVE B;  4GA1 A;  1HFA A;  4I17 A;  1H2U A;  3HXF A;  4IYP A;  1OWN A;  3ML9 A;  5D0Q D;  4F1P A;  1OUV A;  1LD8 A;  2IQC A;  2XQ0 A;  5JHB A;  2J8S D;  4GTR A;  3LVR E;  2LO6 A;  3EJN A;  2UWJ G;  3APF A;  1ZU2 A;  2H6F A;  3T8M A;  5KNH D;  5EDS A;  1N0R A;  2VTB B;  4HOS A;  1H2T C;  3I4G A;  5EYP F;  2EIN E;  4DLO A;  1OCZ E;  1N4S A;  2PL2 A;  3CHR A;  3MYV A;  4JHR A;  4U63 A;  4GTT A;  1OY3 D;  3IHV A;  4HS2 A;  3CIA A;  1U2V G;  2IOS A;  3JYS A;  2DYS E;  2XZT G;  2IU1 A;  1UN8 A;  3UUX A;  4APO A;  4ATG A;  3FWV A;  3UT4 A;  4TUU A;  4WNG A;  5LOZ A;  1BI7 B;  2H6H A;  3PUK A;  3ZW3 A;  3EHQ A;  5HI7 A;  1X81 A;  5ENQ D;  3BQO A;  4DJA A;  4DX6 D;  1EDU A;  1N52 A;  3SGH A;  1TEZ A;  2Y0B G;  2FBN A;  2WM9 A;  3DPD A;  1HU3 A;  2AVP A;  5M72 A;  3EUV A;  3KEA A;  4NIK A;  3EU9 A;  3OAW A;  4JHJ A;  5HQ8 A;  3AS4 A;  2EIL E;  5FZR A;  4UWL A;  1TJC A;  2WXP A;  4N5Q A;  2CHX A;  4ANU A;  3TWW A;  3G2T A;  4OVV A;  3FUM A;  4XE0 A;  2OVF A;  4BER A;  2XPZ A;  4GU5 A; 
#chains in the Genus database with same CATH homology
 3DWL G;  2P9N G;  2P9P G;  4XEI G;  2P9I G;  3DXM G;  1K8K G;  1U2V G;  3ULE G;  2P9K G;  3DXK G;  3RSE G;  3UKU G;  3UKR G;  4JD2 G;  2P9U G;  2P9L G;  2P9S G;  1TYQ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...