2P9IG

Crystal structure of bovine arp2/3 complex co-crystallized with adp and crosslinked with gluteraldehyde
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
143
structure length
137
Chain Sequence
ARFRKVDVDEYDENKFVDEDAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 42
structure length 137
sequence length 143
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 2p9iG00
3UKUG 2P9PG 1U2VG 3ULEG 2P9IG 2P9SG 1K8KG 3RSEG 2P9KG 3DWLG 2P9LG 2P9NG 4XEIG 3DXKG 4JD2G 3UKRG 2P9UG 3DXMG 1TYQG
chains in the Genus database with same CATH superfamily
4O60A 2ONDA 1OCCE 2EIME 2Y3AA 1H6OA 4N2QA 5LCWC 2C0MA 1JCQA 2R02A 3NOCD 5T8IA 2ZIRA 4JVSA 4NURA 2VTBA 3MX3A 2FULA 4WUYA 4UWHA 4MBGA 3JYSA 3UPVA 4R7LA 2ETAA 4W9RA 5AYWD 3PZ2A 3FTWA 3B7BA 3FULA 2J4DA 4MLPA 2GGFA 1NL4A 2Q7FA 3BUAA 2DIWA 3CVQA 3FTYA 3CVVA 3CHSA 3S2AA 3UKRG 1UJJA 4BEPA 3JXJA 2J9QA 2MOWA 5BW8C 5ARGA 2R03A 2WQHA 1PAQA 3NBNB 5KJNA 1N4QA 3FUMA 4ILIA 1OWPA 4RG9A 4L23A 2BEDA 4JC8A 2LSVA 4K0RA 1N4SA 3L82A 1OCZE 4MKTA 2XCCA 4KVOA 3UM3A 4HOUA 2PZIA 4JL0A 2DYRE 2LAIA 2YQ8A 2ZXWE 4WNGA 4A55A 3O4ZA 3SNXA 3HXDA 4I43A 3CK7A 1V55E 2CG3A 2OV8A 5FQ6A 3QDNA 2WXQA 2WVIA 3FTUA 2V0PA 4G24A 3SBSA 3ZFWA 3D3MA 4HNAD 3SF4A 4YVQC 1E8ZA 3IHYA 1YYHA 3WG7E 4GZ6A 3QC1A 4KXKB 5AQ9A 3S7DA 4YDYA 3UM1A 3IV0A 4TUUA 1E7VA 3IEGA 4WNDA 5DBKA 3FFLA 4N39A 5FQ7A 2ZU6B 3MYVA 5BNWA 3HHMA 4KZCA 3PUKA 3JUEA 4GA0A 1U3CA 3LY8A 3FH8A 4FHJA 4GZDA 3UMVA 4BTBA 2GRQB 3OXLA 3HXBA 4WNEA 3TAXA 4RVBA 3AU5A 4J6IA 3PVLA 3DEOA 4DX6D 3C3QA 1UG3A 4JA7A 4CGWA 5LCWJ 3KD7A 2BTDA 3KEAA 4TXPA 3RJVA 2VTBB 4EECA 3QWWA 3SQVA 4G23A 2L0IA 2X6HA 2Y1LE 4L2LA 1DCEA 2XEEA 1H2VC 4NACA 3KSQA 4U0UA 1DNPA 2J08A 3ZHEA 3U64A 2GW1A 3CHQA 2NXPA 1TJFA 1NZNA 3DEPA 5ENTD 3FH7A 3RU0A 3ASOE 4BSXA 4BSZB 2NYJA 4AIFA 3LY7A 1BLXB 4GAAA 2AXUA 4IRUA 4DJAA 4JPSA 4FP7A 2VSOE 3SZ7A 4P29A 3SHFA 5J90A 2XZDG 5A6CA 5EX3A 5M72A 4U7EB 3ONLA 4DPRA 4K5AB 1FCHA 2L0TB 3JCKC 2DVWA 4BY6A 4BERA 4MS6A 3MZLB 1OWNA 3OXFA 1B89A 2X6JA 2KXPC 3AG4E 3ZU7B 4CCAA 4B89A 1PC2A 4N3AA 3Q7AA 1H0AA 3TWXA 1HU3A 2WXOA 5BPPA 5HKPA 4HOSA 3LCAA 2XGMA 2WXPA 3AG2E 4DLOA 4BT9A 3U4TA 3FTSA 1N94A 4GMJA 2WXFA 3TXNA 2IOSA 1EYHA 3CGHA 1NP7A 3PS6A 4XE0A 4J8FA 5FTPA 1Y8MA 1HG2A 3RRUA 2L6BA 4I1OB 3DBSA 2V4HC 3Q78A 3RKVA 2FI7A 1WDYA 3TG5A 3PH0C 5JJTA 5JJ6A 3HDXA 4JHJA 4U96D 4ILGA 3PRZA 3J5QB 4RQIA 3UIPC 3ZKJA 4GTMA 2QYUA 2MRIA 4Q94A 3B7UX 4XZ4A 3E33A 3APCA 2PM6A 1OY3D 5FZQA 4AEZC 1TNYA 3ABME 2XZTG 3EDTB 3DXKG 2V8SE 3I4GA 2WXLA 1S63A 4GTQA 2X38A 3P1UA 4PUCA 4N3BA 1JCSA 3CVNA 3Q4AB 3OTNA 2HM8A 3CKCA 4GPKA 3CHOA 2VGYA 4J8EA 4RG6A 2WQ7A 3V31A 2J8SD 4DX5D 1PY1A 4TXRA 3ZHEB 4HLEA 4A63B 1O1TA 2XQ0A 2XGSA 3KAEA 2OEVA 3FU0A 1OXJA 4G25A 3EHMA 2AXVA 3LVQE 2P58C 3HXFA 3L08A 3HIZA 4EQFA 4G8LA 1OUVA 1UN8A 3BG0B 3E30A 3D9MA 5ENQD 1LTXA 1TYQG 2I1KA 3QOUA 2MYOA 4Q69A 2JABA 1HXIA 1IHGA 2VGEA 4HLLA 1ZBPA 4ATGA 1LF8A 2LUHA 1HH8A 2AXZA 4URKA 2EQXA 4LNGA 4PDXA 5C1DA 2J4BA 3DXMG 1IYGA 4U07A 1SZ9A 2KM4A 1LD7A 4FC8A 3FUDA 1SA5A 1HZ4A 1Z5SC 2CG2A 4HQDA 3FTZA 3K9IA 2OCCE 4DRXE 1EF1C 4LCTA 3T5VA 2EINE 4TRQA 4AY6A 3ZW3A 3FUKA 1HO8A 1TR4A 3Q47B 5B1AE 3S7BA 4HRMB 1OCOE 5BV0A 4WAFA 3W9FA 3RO2A 2DBAA 3IKOB 4FJYA 4FADA 2R17C 3T8KA 3HVEA 3E37A 3BEEA 4HFGA 4B0ZA 3I3NA 4OVVA 3IBEA 4PS7A 3TWVA 4WWOA 2WXIA 2P9UG 1ZU2A 2XS1A 3R7RA 5G04C 3BG1B 3D9JA 4UUCA 3UQ3A 1NA3A 3D9OA 5ITZF 4NIKA 4C48B 1OWOA 3LEWA 3FUEA 4HORA 4O1PA 5EKQD 3IHVA 3ISMC 4U04A 5CRUA 3ESKA 3D9IA 4YVOA 2OOEA 5H7PA 2H6FA 3LJ3A 1OWLA 4G8KA 3T8MA 1WY6A 4BFRA 2GRLA 2X6FA 3UUXA 1A5EA 1N0QA 2ILRA 3G2VA 5KBAA 2CHXA 1NI1A 4U95D 1G3NB 5FIOA 3V30A 3HG0D 3APDA 1HE8A 4I9CA 1QZ2A 3CVLA 3DRAA 3Q7FA 5BXOA 3DSVA 1MHQA 3CQCB 5BV1A 2GRMA 5HQ8A 4HXIA 3LPZA 3QARA 4DI3A 3TXMA 3UT8A 1MX2A 1W3BA 5AN8A 5E75A 2GROB 4UWFA 4GZ3A 3AG3E 2IU1A 2AVPA 3GYZA 3DSTA 4TV3A 2B0OE 2LSUA 4IN3B 3GZ1A 4EZLA 4JHRA 3AU4A 2PNNA 2KBXA 4WWNA 1U3DA 1ZB1A 5LOZA 3PUJA 3CHMA 5FINA 1JUQA 3TWRA 2KZTA 4JHKA 3PDNA 4UWKA 2WXJA 1DVPA 2WXHA 4YDEA 5AIJA 4UWGA 1SA4A 4LERA 2PQNA 5EDSA 5JMND 2A5EA 2WM9A 3SFXA 3CHRA 4U8VD 2DYSE 4UI9C 2C0LA 5AARA 4F53A 4JW1A 4JXTA 4J8DA 1ELKA 4DI4A 3AAAC 1SZAA 2P2CP 5CBNA 2WXMA 2XEHA 4CT0A 3FWVA 3TWUA 1TNOA 4G2VA 2YHCA 4GYWA 3AS5A 3NB2A 4A1SA 5G04J 4CDNA 3MV2B 4JD2G 3QKYA 2IO3C 2X3MA 3EHRA 2ZGDA 3CK8A 2IJGX 4XKBA 3ULYA 1UN9A 4IULA 2FBNA 2AJAA 5KJLA 3URZA 5HRYA 3ZYMA 4KZ0A 3B7SA 5CCMA 3MV3B 4FJZA 2HR2A 5LP0A 1O1SA 1HFAA 2KCVA 2I9CA 1LD8A 3R7QA 4DK5A 2QC9A 2GRRB 3JUIA 4HI8A 2FEZA 4YNDA 4HI9A 4BX9A 2X6KA 2LNIA 3LJNA 1MZCA 4AP2A 2FO7A 3QB2A 2VGXA 3RSEG 4ANVA 3MGBA 1Z6TA 3ASNE 4O1OA 3CVPA 2I1JA 1N4RA 1NFIE 3D9PA 2I2OA 3FDHA 5ANLA 3FUNA 3ZRHA 1N9AA 2WMNA 1UOHA 3SO8A 1MJ0A 2UWJG 4DX1A 3V79K 1DCQA 3ASDA 2VSNA 4GTPA 4DX7D 4XI9A 3PNLB 4APOA 2KZTB 4H7XA 2C2LA 1UW4B 3U66A 2KATA 1OT8A 1HG5A 3T5XA 2VJ8A 3LXUX 4F1PA 4AVXA 4B93B 4GB9A 4AJWA 1MYOA 4UI9J 1S70B 4LEUA 1MX4A 2RFAA 3DPYA 2P9IG 4ANXA 4L9PA 3QNKA 3ZPJA 3EIJA 1RW2A 2L6JA 3QWPA 3SY2A 5CMYA 3ZIMA 4Z68A 2J09A 2R2LA 5EYLA 4I2ZA 3LDZA 3ZN3A 3EU5A 3Q15A 2IY0C 2V5FA 1N4PA 4J8SA 1K8KG 3LVRE 5ARFA 3PNTB 4JB8P 3KSLA 3RRMB 2WB2A 4EBAA 2J49A 4ANUA 4UQYA 1TN6A 4I6JA 3KEZA 5CHEE 4BX8A 1QNFA 4FLHA 1L5JA 4L7TA 4F7AA 4AXHA 3U9WA 4GTVA 5EIDA 4C0MA 3ONKA 2I6HA 3SI5A 5KCMA 4DX2A 3WXXA 3UT7A 4CDMA 2GRPB 2V5QC 2YINA 5CCLA 3L9TA 2GRNB 4O6FA 4CDRA 1IQUA 1E8WA 2IO2C 5BUZA 3ZXSA 4BTAA 4GPMA 1TN7A 5B1BE 4QQIA 3ZVVA 4PS3A 3CIAA 4HRNA 2XPZA 2CFZA 4AY5A 2XPYA 4XIFA 5CEDB 2VGXB 2P9SG 1DC2A 2AWIA 1YMPA 1GW6A 4J7WA 4XEIG 3SGHA 3BQOA 4YDWA 4N2SA 1SVXA 3ZEFA 2WQ6A 2FO1E 2BUGA 3CVWA 4RLYA 3NZUA 1V54E 2WXNA 4F1SA 3SBTB 2VSYA 4JEUA 1HX8A 3D9HA 1FT2A 3JQ1A 5AJLA 3AS8A 3FEYA 3ABKE 2IQCA 3RK6A 2Y69E 2HO1A 3CSFA 3RRNB 4NRHB 3CR3A 4GYYA 1N95A 4NQ0A 4GZCA 4E6HA 3MKRA 2Y4UA 1SW6A 3ZNGA 3Q49B 3FP3A 2RG8A 1TNBA 2DWZA 5FJYA 5ANRA 3FH5A 1H2TC 3UIOC 4B94A 4I1AA 3DSWA 5D0OD 4A3VA 3AG1E 1BI7B 2V4LA 3NAWA 4EHMA 3ZUVB 2BF0X 2IF4A 5ENSD 4MRUA 3L54A 5AQBA 4WWPA 3DSUA 4ZHBA 2YHEA 5FWQA 3AS4A 2CHZA 2QFCA 1EDUA 2VQ2A 4GTRA 5EN5D 3V2OA 2L9BA 5AENA 2OVBA 3ZXPA 4XX5A 5KJKA 4LUNU 5CEAA 1OCRE 4B8CB 4ILHB 2EIJE 3C3RA 2H6IA 2LAHA 5HS0A 2H6HA 2WMOA 2QY7A 2E2EA 4LNBA 3CVYA 4HOQA 2F8YA 3DPDA 2XCBA 3ZGQA 3EHQA 4HBDA 4F3VA 2XGOA 1KLXA 1KT0A 1K1BA 4FU3A 3R9AB 1JPLA 4KT6B 3ZYKA 3TWTA 4GCOA 1X81A 3T9KA 1UJKA 4FHKA 2B6CA 3D9LA 5DIZA 3Q9UC 1Q2ZA 4UQZA 1FT1A 3UX4A 3EJNA 4GA1A 4BETA 3CVXA 4GU5A 1AP7A 1N52A 1E8XA 3Q75A 5ENNA 3KS2A 4UWLA 1TN8A 3V2XA 1N54A 3TJPA 3GZ2A 3MKQA 1FVFA 1QQEA 5JHBA 2XEVA 3PZDA 4N3CA 5AAOA 2DZOA 1X5BA 2Y0BG 3GZSA 4EZJA 4JA9A 4HRLA 3PZ3A 2BKGA 3FU5A 3JXIA 2BKKB 1K3ZD 1BU9A 5LFAA 2ETBA 3MJWA 3MA5A 4CZ2D 4FA6A 3QK0A 3B95A 2R05A 2AW6A 4TXQA 2EIKE 1Y6IA 1BD8A 3UM0A 2RD0A 2E0IA 2VYIA 3TWQA 1ELRA 4AM9A 3C5RA 2ZISA 4C9BB 3ML9A 4HB5A 3S7FA 1TNZA 4G1TA 1YCSB 3PZ4A 4OYSA 5IY5E 3L16A 4APFA 1MX6A 3HYMB 4KMOA 3FU6A 3TG4A 3LKUA 3EUVA 1FVHA 2QYJA 3L22A 2RKKA 2LXLA 2R5SA 4ANWA 3UM2A 1IHBA 3HXCA 3L13A 4ABNA 3I5PA 2XHEA 5T3RA 4HVBA 5BXUA 5ENOD 2DCPA 3UKUG 3PEVB 3FUJA 2NSZA 3S7JA 3J5PA 3PREA 5FQ8A 2NC9A 3FU3A 3UI2A 3TWWA 3HVEB 4L1BA 4FLBA 4JEHA 5LX8A 2CHWA 5G05C 2F0YA 3OXGA 3QWVA 4CT4A 4B8AA 5D66A 1H2UA 4XKCA 4LSZE 2XS8A 3QJZA 3RO3A 3DWLG 3VTXA 1NA0A 1WM5A 1S64A 2IFUA 3PE3A 3NF1A 2XENA 3GW4A 5D0QD 4KBQA 1U2VG 2PQRA 4CEMA 5KWDA 4I1MA 5JHAA 5A7DB 3SD5A 1IKND 1D8EA 3Q73A 4LG6A 4CRWA 4H7YA 2KC7A 4GMLA 4K03A 1KPSB 2A5UA 2H6GA 3AJIA 3ASGA 1KZPA 1N11A 5ENRD 4Q96A 3W9GA 1TNUA 3NZSA 3MKQB 3D9NA 3C98A 1E8YA 3HXEA 3TGOA 3D9KA 2IONA 3CHPA 2F8XK 2R59A 1E7UA 1H6KA 5CERB 1K1AA 3X2QE 5B3SE 4V3IA 1BPOA 3APFA 3FUFA 1D9SA 3L17A 3U3WA 1KZOA 4GCNA 4Y6WA 2RFMA 1JWGA 3IXEA 4M7CA 5A23A 1E90A 1VDYA 3LY9A 3RAUA 3RIBA 3P2BA 5G2NA 4QFVA 3UXGA 3PEUB 1KT1A 1IQRA 1BI8B 4I6GA 4I6EA 4N5CA 3FY4A 1IXVA 3PZ1A 4I9EA 3DSXA 4ZFHA 3SFYA 2UY1A 5JA4D 4U8HA 3Q9NC 4C0EA 2MHKA 5J08A 3F6QA 4ACLA 1TJCA 1QYMA 4HS2A 1E96B 2Y4TA 4GZ5A 3R9MA 3ZYQA 3I4RB 5FT9A 2X6IA 2VSXE 3ABLE 2KCLA 1AWCB 3NOGD 4CGVA 5JJ7A 4GMRA 4EPZA 3CQGB 4GTOA 4A3TA 2IOLA 5G05J 3CKBA 4K5BA 2WPVA 4D10C 1JWFA 3CSTA 3CEQA 1RZ4A 1SQMA 1XGWA 5D2MC 3E32A 4ACKA 1N0RA 3MEKA 4LNUD 3ZYLA 4EBAG 3L6AA 3VLDA 4JZYA 3C3OA 4EZKA 1HF8A 2WXGA 4BWRA 2P9LG 3LYAA 4U0SA 5EILA 3B13A 3VTYA 1O1RA 2F37A 2OVFA 4G11A 4HOTA 1ELWA 1EPUA 2JLBA 4L2YA 4PS8A 1HS6A 1WG0A 3EHNA 2ETCA 2IEJA 3C72A 1OWMA 5KNHD 1O5MA 3QAQA 3E4BA 3ENEA 4PH4B 1Z3YA 1XNFA 1A17A 3FHEA 3FUHA 4UI9K 2HE0A 4ME2A 4AOFA 5AQAA 1D8DA 2XRYA 1QBQA 2PL2A 3TWSA 2P9NG 5EIBE 3CK9A 2FF4A 4DUIA 4GYOA 2XPIA 4I2WA 5C2YA 3ULEG 4M3OA 5KNGA 3JQ0A 2PM7A 4G26A 4KYOB 4FULA 4N5QA 3FTXA 3Q5MA 5E76A 3TL5A 4GA2A 3VLFA 2P9PG 4Y6CA 4BESA 5FZRA 5CBOA 2A4ZA 3HRAA 5EYPF 4UQXA 3NQPA 4RSYA 5AQ7A 3G2WA 3Q79A 3FTVA 3O48A 3CVUA 2UY1B 4GTSA 2LXMA 4IYPA 4K5CA 3VLEA 1P5QA 1WAO1 4DLQA 1INZA 4I17A 4CYMD 3B7TA 5KJMA 4LRZA 3UT4A 4OAVB 5ENPD 1S0PA 4A1GA 4E85A 1FPPA 2J07A 4AV7A 1MQSA 4U63A 5FQ4A 4YDOA 4U8YD 5CECB 4J0UA 3EIQC 3ASHA 2WXRA 3LS8A 2DZNA 1H6PA 2LO6A 2QZAA 4OAUC 3EU9A 3E34A 3MCXA 4BT8A 1TEZA 2CFUA 3SFZA 5FZSA 3FEXA 5CMWA 4KVMA 2M63A 1H19A 4ATZD 5AJDA 3FUIA 4GTTA 4F6RD 2EILE 2XRZA 5CRVA 3OAWA 2JEKA 3G2UA 5EX0A 5BT1A 5G55A 3DSSA 3CV0A 2ZGGA 4X8QA 4WNFA 4TUMA 2WXKA 3CLJA 5HI7A 2KCKA 3ML8A 2HYZA 3BU8A 3ULQA 3UTMA 3B7RL 4J8YA 3PE4A 5T4YA 2P9KG 2OEWA 1Z3XA 3ASFA 1YA0A 4U0ZA 3N71A 4OVUA 3G2TA 2YNQA 3G2SA 3UINC 4XI0A 3ESLA 1JCRA
chains in the Genus database with same CATH topology
3UKUG 2P9PG 1U2VG 3ULEG 2P9IG 2P9SG 1K8KG 3RSEG 2P9KG 3DWLG 2P9LG 2P9NG 4XEIG 3DXKG 4JD2G 3UKRG 2P9UG 3DXMG 1TYQG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UKU G;  2P9P G;  1U2V G;  3ULE G;  2P9I G;  2P9S G;  1K8K G;  3RSE G;  2P9K G;  3DWL G;  2P9L G;  2P9N G;  4XEI G;  3DXK G;  4JD2 G;  3UKR G;  2P9U G;  3DXM G;  1TYQ G; 
#chains in the Genus database with same CATH topology
 4O60 A;  2OND A;  1OCC E;  2EIM E;  2Y3A A;  1H6O A;  4N2Q A;  5LCW C;  2C0M A;  1JCQ A;  2R02 A;  3NOC D;  5T8I A;  2ZIR A;  4JVS A;  4NUR A;  2VTB A;  3MX3 A;  2FUL A;  4WUY A;  4UWH A;  4MBG A;  3JYS A;  3UPV A;  4R7L A;  2ETA A;  4W9R A;  5AYW D;  3PZ2 A;  3FTW A;  3B7B A;  3FUL A;  2J4D A;  4MLP A;  2GGF A;  1NL4 A;  2Q7F A;  3BUA A;  2DIW A;  3CVQ A;  3FTY A;  3CVV A;  3CHS A;  3S2A A;  3UKR G;  1UJJ A;  4BEP A;  3JXJ A;  2J9Q A;  2MOW A;  5BW8 C;  5ARG A;  2R03 A;  2WQH A;  1PAQ A;  3NBN B;  5KJN A;  1N4Q A;  3FUM A;  4ILI A;  1OWP A;  4RG9 A;  4L23 A;  2BED A;  4JC8 A;  2LSV A;  4K0R A;  1N4S A;  3L82 A;  1OCZ E;  4MKT A;  2XCC A;  4KVO A;  3UM3 A;  4HOU A;  2PZI A;  4JL0 A;  2DYR E;  2LAI A;  2YQ8 A;  2ZXW E;  4WNG A;  4A55 A;  3O4Z A;  3SNX A;  3HXD A;  4I43 A;  3CK7 A;  1V55 E;  2CG3 A;  2OV8 A;  5FQ6 A;  3QDN A;  2WXQ A;  2WVI A;  3FTU A;  2V0P A;  4G24 A;  3SBS A;  3ZFW A;  3D3M A;  4HNA D;  3SF4 A;  4YVQ C;  1E8Z A;  3IHY A;  1YYH A;  3WG7 E;  4GZ6 A;  3QC1 A;  4KXK B;  5AQ9 A;  3S7D A;  4YDY A;  3UM1 A;  3IV0 A;  4TUU A;  1E7V A;  3IEG A;  4WND A;  5DBK A;  3FFL A;  4N39 A;  5FQ7 A;  2ZU6 B;  3MYV A;  5BNW A;  3HHM A;  4KZC A;  3PUK A;  3JUE A;  4GA0 A;  1U3C A;  3LY8 A;  3FH8 A;  4FHJ A;  4GZD A;  3UMV A;  4BTB A;  2GRQ B;  3OXL A;  3HXB A;  4WNE A;  3TAX A;  4RVB A;  3AU5 A;  4J6I A;  3PVL A;  3DEO A;  4DX6 D;  3C3Q A;  1UG3 A;  4JA7 A;  4CGW A;  5LCW J;  3KD7 A;  2BTD A;  3KEA A;  4TXP A;  3RJV A;  2VTB B;  4EEC A;  3QWW A;  3SQV A;  4G23 A;  2L0I A;  2X6H A;  2Y1L E;  4L2L A;  1DCE A;  2XEE A;  1H2V C;  4NAC A;  3KSQ A;  4U0U A;  1DNP A;  2J08 A;  3ZHE A;  3U64 A;  2GW1 A;  3CHQ A;  2NXP A;  1TJF A;  1NZN A;  3DEP A;  5ENT D;  3FH7 A;  3RU0 A;  3ASO E;  4BSX A;  4BSZ B;  2NYJ A;  4AIF A;  3LY7 A;  1BLX B;  4GAA A;  2AXU A;  4IRU A;  4DJA A;  4JPS A;  4FP7 A;  2VSO E;  3SZ7 A;  4P29 A;  3SHF A;  5J90 A;  2XZD G;  5A6C A;  5EX3 A;  5M72 A;  4U7E B;  3ONL A;  4DPR A;  4K5A B;  1FCH A;  2L0T B;  3JCK C;  2DVW A;  4BY6 A;  4BER A;  4MS6 A;  3MZL B;  1OWN A;  3OXF A;  1B89 A;  2X6J A;  2KXP C;  3AG4 E;  3ZU7 B;  4CCA A;  4B89 A;  1PC2 A;  4N3A A;  3Q7A A;  1H0A A;  3TWX A;  1HU3 A;  2WXO A;  5BPP A;  5HKP A;  4HOS A;  3LCA A;  2XGM A;  2WXP A;  3AG2 E;  4DLO A;  4BT9 A;  3U4T A;  3FTS A;  1N94 A;  4GMJ A;  2WXF A;  3TXN A;  2IOS A;  1EYH A;  3CGH A;  1NP7 A;  3PS6 A;  4XE0 A;  4J8F A;  5FTP A;  1Y8M A;  1HG2 A;  3RRU A;  2L6B A;  4I1O B;  3DBS A;  2V4H C;  3Q78 A;  3RKV A;  2FI7 A;  1WDY A;  3TG5 A;  3PH0 C;  5JJT A;  5JJ6 A;  3HDX A;  4JHJ A;  4U96 D;  4ILG A;  3PRZ A;  3J5Q B;  4RQI A;  3UIP C;  3ZKJ A;  4GTM A;  2QYU A;  2MRI A;  4Q94 A;  3B7U X;  4XZ4 A;  3E33 A;  3APC A;  2PM6 A;  1OY3 D;  5FZQ A;  4AEZ C;  1TNY A;  3ABM E;  2XZT G;  3EDT B;  3DXK G;  2V8S E;  3I4G A;  2WXL A;  1S63 A;  4GTQ A;  2X38 A;  3P1U A;  4PUC A;  4N3B A;  1JCS A;  3CVN A;  3Q4A B;  3OTN A;  2HM8 A;  3CKC A;  4GPK A;  3CHO A;  2VGY A;  4J8E A;  4RG6 A;  2WQ7 A;  3V31 A;  2J8S D;  4DX5 D;  1PY1 A;  4TXR A;  3ZHE B;  4HLE A;  4A63 B;  1O1T A;  2XQ0 A;  2XGS A;  3KAE A;  2OEV A;  3FU0 A;  1OXJ A;  4G25 A;  3EHM A;  2AXV A;  3LVQ E;  2P58 C;  3HXF A;  3L08 A;  3HIZ A;  4EQF A;  4G8L A;  1OUV A;  1UN8 A;  3BG0 B;  3E30 A;  3D9M A;  5ENQ D;  1LTX A;  1TYQ G;  2I1K A;  3QOU A;  2MYO A;  4Q69 A;  2JAB A;  1HXI A;  1IHG A;  2VGE A;  4HLL A;  1ZBP A;  4ATG A;  1LF8 A;  2LUH A;  1HH8 A;  2AXZ A;  4URK A;  2EQX A;  4LNG A;  4PDX A;  5C1D A;  2J4B A;  3DXM G;  1IYG A;  4U07 A;  1SZ9 A;  2KM4 A;  1LD7 A;  4FC8 A;  3FUD A;  1SA5 A;  1HZ4 A;  1Z5S C;  2CG2 A;  4HQD A;  3FTZ A;  3K9I A;  2OCC E;  4DRX E;  1EF1 C;  4LCT A;  3T5V A;  2EIN E;  4TRQ A;  4AY6 A;  3ZW3 A;  3FUK A;  1HO8 A;  1TR4 A;  3Q47 B;  5B1A E;  3S7B A;  4HRM B;  1OCO E;  5BV0 A;  4WAF A;  3W9F A;  3RO2 A;  2DBA A;  3IKO B;  4FJY A;  4FAD A;  2R17 C;  3T8K A;  3HVE A;  3E37 A;  3BEE A;  4HFG A;  4B0Z A;  3I3N A;  4OVV A;  3IBE A;  4PS7 A;  3TWV A;  4WWO A;  2WXI A;  2P9U G;  1ZU2 A;  2XS1 A;  3R7R A;  5G04 C;  3BG1 B;  3D9J A;  4UUC A;  3UQ3 A;  1NA3 A;  3D9O A;  5ITZ F;  4NIK A;  4C48 B;  1OWO A;  3LEW A;  3FUE A;  4HOR A;  4O1P A;  5EKQ D;  3IHV A;  3ISM C;  4U04 A;  5CRU A;  3ESK A;  3D9I A;  4YVO A;  2OOE A;  5H7P A;  2H6F A;  3LJ3 A;  1OWL A;  4G8K A;  3T8M A;  1WY6 A;  4BFR A;  2GRL A;  2X6F A;  3UUX A;  1A5E A;  1N0Q A;  2ILR A;  3G2V A;  5KBA A;  2CHX A;  1NI1 A;  4U95 D;  1G3N B;  5FIO A;  3V30 A;  3HG0 D;  3APD A;  1HE8 A;  4I9C A;  1QZ2 A;  3CVL A;  3DRA A;  3Q7F A;  5BXO A;  3DSV A;  1MHQ A;  3CQC B;  5BV1 A;  2GRM A;  5HQ8 A;  4HXI A;  3LPZ A;  3QAR A;  4DI3 A;  3TXM A;  3UT8 A;  1MX2 A;  1W3B A;  5AN8 A;  5E75 A;  2GRO B;  4UWF A;  4GZ3 A;  3AG3 E;  2IU1 A;  2AVP A;  3GYZ A;  3DST A;  4TV3 A;  2B0O E;  2LSU A;  4IN3 B;  3GZ1 A;  4EZL A;  4JHR A;  3AU4 A;  2PNN A;  2KBX A;  4WWN A;  1U3D A;  1ZB1 A;  5LOZ A;  3PUJ A;  3CHM A;  5FIN A;  1JUQ A;  3TWR A;  2KZT A;  4JHK A;  3PDN A;  4UWK A;  2WXJ A;  1DVP A;  2WXH A;  4YDE A;  5AIJ A;  4UWG A;  1SA4 A;  4LER A;  2PQN A;  5EDS A;  5JMN D;  2A5E A;  2WM9 A;  3SFX A;  3CHR A;  4U8V D;  2DYS E;  4UI9 C;  2C0L A;  5AAR A;  4F53 A;  4JW1 A;  4JXT A;  4J8D A;  1ELK A;  4DI4 A;  3AAA C;  1SZA A;  2P2C P;  5CBN A;  2WXM A;  2XEH A;  4CT0 A;  3FWV A;  3TWU A;  1TNO A;  4G2V A;  2YHC A;  4GYW A;  3AS5 A;  3NB2 A;  4A1S A;  5G04 J;  4CDN A;  3MV2 B;  4JD2 G;  3QKY A;  2IO3 C;  2X3M A;  3EHR A;  2ZGD A;  3CK8 A;  2IJG X;  4XKB A;  3ULY A;  1UN9 A;  4IUL A;  2FBN A;  2AJA A;  5KJL A;  3URZ A;  5HRY A;  3ZYM A;  4KZ0 A;  3B7S A;  5CCM A;  3MV3 B;  4FJZ A;  2HR2 A;  5LP0 A;  1O1S A;  1HFA A;  2KCV A;  2I9C A;  1LD8 A;  3R7Q A;  4DK5 A;  2QC9 A;  2GRR B;  3JUI A;  4HI8 A;  2FEZ A;  4YND A;  4HI9 A;  4BX9 A;  2X6K A;  2LNI A;  3LJN A;  1MZC A;  4AP2 A;  2FO7 A;  3QB2 A;  2VGX A;  3RSE G;  4ANV A;  3MGB A;  1Z6T A;  3ASN E;  4O1O A;  3CVP A;  2I1J A;  1N4R A;  1NFI E;  3D9P A;  2I2O A;  3FDH A;  5ANL A;  3FUN A;  3ZRH A;  1N9A A;  2WMN A;  1UOH A;  3SO8 A;  1MJ0 A;  2UWJ G;  4DX1 A;  3V79 K;  1DCQ A;  3ASD A;  2VSN A;  4GTP A;  4DX7 D;  4XI9 A;  3PNL B;  4APO A;  2KZT B;  4H7X A;  2C2L A;  1UW4 B;  3U66 A;  2KAT A;  1OT8 A;  1HG5 A;  3T5X A;  2VJ8 A;  3LXU X;  4F1P A;  4AVX A;  4B93 B;  4GB9 A;  4AJW A;  1MYO A;  4UI9 J;  1S70 B;  4LEU A;  1MX4 A;  2RFA A;  3DPY A;  2P9I G;  4ANX A;  4L9P A;  3QNK A;  3ZPJ A;  3EIJ A;  1RW2 A;  2L6J A;  3QWP A;  3SY2 A;  5CMY A;  3ZIM A;  4Z68 A;  2J09 A;  2R2L A;  5EYL A;  4I2Z A;  3LDZ A;  3ZN3 A;  3EU5 A;  3Q15 A;  2IY0 C;  2V5F A;  1N4P A;  4J8S A;  1K8K G;  3LVR E;  5ARF A;  3PNT B;  4JB8 P;  3KSL A;  3RRM B;  2WB2 A;  4EBA A;  2J49 A;  4ANU A;  4UQY A;  1TN6 A;  4I6J A;  3KEZ A;  5CHE E;  4BX8 A;  1QNF A;  4FLH A;  1L5J A;  4L7T A;  4F7A A;  4AXH A;  3U9W A;  4GTV A;  5EID A;  4C0M A;  3ONK A;  2I6H A;  3SI5 A;  5KCM A;  4DX2 A;  3WXX A;  3UT7 A;  4CDM A;  2GRP B;  2V5Q C;  2YIN A;  5CCL A;  3L9T A;  2GRN B;  4O6F A;  4CDR A;  1IQU A;  1E8W A;  2IO2 C;  5BUZ A;  3ZXS A;  4BTA A;  4GPM A;  1TN7 A;  5B1B E;  4QQI A;  3ZVV A;  4PS3 A;  3CIA A;  4HRN A;  2XPZ A;  2CFZ A;  4AY5 A;  2XPY A;  4XIF A;  5CED B;  2VGX B;  2P9S G;  1DC2 A;  2AWI A;  1YMP A;  1GW6 A;  4J7W A;  4XEI G;  3SGH A;  3BQO A;  4YDW A;  4N2S A;  1SVX A;  3ZEF A;  2WQ6 A;  2FO1 E;  2BUG A;  3CVW A;  4RLY A;  3NZU A;  1V54 E;  2WXN A;  4F1S A;  3SBT B;  2VSY A;  4JEU A;  1HX8 A;  3D9H A;  1FT2 A;  3JQ1 A;  5AJL A;  3AS8 A;  3FEY A;  3ABK E;  2IQC A;  3RK6 A;  2Y69 E;  2HO1 A;  3CSF A;  3RRN B;  4NRH B;  3CR3 A;  4GYY A;  1N95 A;  4NQ0 A;  4GZC A;  4E6H A;  3MKR A;  2Y4U A;  1SW6 A;  3ZNG A;  3Q49 B;  3FP3 A;  2RG8 A;  1TNB A;  2DWZ A;  5FJY A;  5ANR A;  3FH5 A;  1H2T C;  3UIO C;  4B94 A;  4I1A A;  3DSW A;  5D0O D;  4A3V A;  3AG1 E;  1BI7 B;  2V4L A;  3NAW A;  4EHM A;  3ZUV B;  2BF0 X;  2IF4 A;  5ENS D;  4MRU A;  3L54 A;  5AQB A;  4WWP A;  3DSU A;  4ZHB A;  2YHE A;  5FWQ A;  3AS4 A;  2CHZ A;  2QFC A;  1EDU A;  2VQ2 A;  4GTR A;  5EN5 D;  3V2O A;  2L9B A;  5AEN A;  2OVB A;  3ZXP A;  4XX5 A;  5KJK A;  4LUN U;  5CEA A;  1OCR E;  4B8C B;  4ILH B;  2EIJ E;  3C3R A;  2H6I A;  2LAH A;  5HS0 A;  2H6H A;  2WMO A;  2QY7 A;  2E2E A;  4LNB A;  3CVY A;  4HOQ A;  2F8Y A;  3DPD A;  2XCB A;  3ZGQ A;  3EHQ A;  4HBD A;  4F3V A;  2XGO A;  1KLX A;  1KT0 A;  1K1B A;  4FU3 A;  3R9A B;  1JPL A;  4KT6 B;  3ZYK A;  3TWT A;  4GCO A;  1X81 A;  3T9K A;  1UJK A;  4FHK A;  2B6C A;  3D9L A;  5DIZ A;  3Q9U C;  1Q2Z A;  4UQZ A;  1FT1 A;  3UX4 A;  3EJN A;  4GA1 A;  4BET A;  3CVX A;  4GU5 A;  1AP7 A;  1N52 A;  1E8X A;  3Q75 A;  5ENN A;  3KS2 A;  4UWL A;  1TN8 A;  3V2X A;  1N54 A;  3TJP A;  3GZ2 A;  3MKQ A;  1FVF A;  1QQE A;  5JHB A;  2XEV A;  3PZD A;  4N3C A;  5AAO A;  2DZO A;  1X5B A;  2Y0B G;  3GZS A;  4EZJ A;  4JA9 A;  4HRL A;  3PZ3 A;  2BKG A;  3FU5 A;  3JXI A;  2BKK B;  1K3Z D;  1BU9 A;  5LFA A;  2ETB A;  3MJW A;  3MA5 A;  4CZ2 D;  4FA6 A;  3QK0 A;  3B95 A;  2R05 A;  2AW6 A;  4TXQ A;  2EIK E;  1Y6I A;  1BD8 A;  3UM0 A;  2RD0 A;  2E0I A;  2VYI A;  3TWQ A;  1ELR A;  4AM9 A;  3C5R A;  2ZIS A;  4C9B B;  3ML9 A;  4HB5 A;  3S7F A;  1TNZ A;  4G1T A;  1YCS B;  3PZ4 A;  4OYS A;  5IY5 E;  3L16 A;  4APF A;  1MX6 A;  3HYM B;  4KMO A;  3FU6 A;  3TG4 A;  3LKU A;  3EUV A;  1FVH A;  2QYJ A;  3L22 A;  2RKK A;  2LXL A;  2R5S A;  4ANW A;  3UM2 A;  1IHB A;  3HXC A;  3L13 A;  4ABN A;  3I5P A;  2XHE A;  5T3R A;  4HVB A;  5BXU A;  5ENO D;  2DCP A;  3UKU G;  3PEV B;  3FUJ A;  2NSZ A;  3S7J A;  3J5P A;  3PRE A;  5FQ8 A;  2NC9 A;  3FU3 A;  3UI2 A;  3TWW A;  3HVE B;  4L1B A;  4FLB A;  4JEH A;  5LX8 A;  2CHW A;  5G05 C;  2F0Y A;  3OXG A;  3QWV A;  4CT4 A;  4B8A A;  5D66 A;  1H2U A;  4XKC A;  4LSZ E;  2XS8 A;  3QJZ A;  3RO3 A;  3DWL G;  3VTX A;  1NA0 A;  1WM5 A;  1S64 A;  2IFU A;  3PE3 A;  3NF1 A;  2XEN A;  3GW4 A;  5D0Q D;  4KBQ A;  1U2V G;  2PQR A;  4CEM A;  5KWD A;  4I1M A;  5JHA A;  5A7D B;  3SD5 A;  1IKN D;  1D8E A;  3Q73 A;  4LG6 A;  4CRW A;  4H7Y A;  2KC7 A;  4GML A;  4K03 A;  1KPS B;  2A5U A;  2H6G A;  3AJI A;  3ASG A;  1KZP A;  1N11 A;  5ENR D;  4Q96 A;  3W9G A;  1TNU A;  3NZS A;  3MKQ B;  3D9N A;  3C98 A;  1E8Y A;  3HXE A;  3TGO A;  3D9K A;  2ION A;  3CHP A;  2F8X K;  2R59 A;  1E7U A;  1H6K A;  5CER B;  1K1A A;  3X2Q E;  5B3S E;  4V3I A;  1BPO A;  3APF A;  3FUF A;  1D9S A;  3L17 A;  3U3W A;  1KZO A;  4GCN A;  4Y6W A;  2RFM A;  1JWG A;  3IXE A;  4M7C A;  5A23 A;  1E90 A;  1VDY A;  3LY9 A;  3RAU A;  3RIB A;  3P2B A;  5G2N A;  4QFV A;  3UXG A;  3PEU B;  1KT1 A;  1IQR A;  1BI8 B;  4I6G A;  4I6E A;  4N5C A;  3FY4 A;  1IXV A;  3PZ1 A;  4I9E A;  3DSX A;  4ZFH A;  3SFY A;  2UY1 A;  5JA4 D;  4U8H A;  3Q9N C;  4C0E A;  2MHK A;  5J08 A;  3F6Q A;  4ACL A;  1TJC A;  1QYM A;  4HS2 A;  1E96 B;  2Y4T A;  4GZ5 A;  3R9M A;  3ZYQ A;  3I4R B;  5FT9 A;  2X6I A;  2VSX E;  3ABL E;  2KCL A;  1AWC B;  3NOG D;  4CGV A;  5JJ7 A;  4GMR A;  4EPZ A;  3CQG B;  4GTO A;  4A3T A;  2IOL A;  5G05 J;  3CKB A;  4K5B A;  2WPV A;  4D10 C;  1JWF A;  3CST A;  3CEQ A;  1RZ4 A;  1SQM A;  1XGW A;  5D2M C;  3E32 A;  4ACK A;  1N0R A;  3MEK A;  4LNU D;  3ZYL A;  4EBA G;  3L6A A;  3VLD A;  4JZY A;  3C3O A;  4EZK A;  1HF8 A;  2WXG A;  4BWR A;  2P9L G;  3LYA A;  4U0S A;  5EIL A;  3B13 A;  3VTY A;  1O1R A;  2F37 A;  2OVF A;  4G11 A;  4HOT A;  1ELW A;  1EPU A;  2JLB A;  4L2Y A;  4PS8 A;  1HS6 A;  1WG0 A;  3EHN A;  2ETC A;  2IEJ A;  3C72 A;  1OWM A;  5KNH D;  1O5M A;  3QAQ A;  3E4B A;  3ENE A;  4PH4 B;  1Z3Y A;  1XNF A;  1A17 A;  3FHE A;  3FUH A;  4UI9 K;  2HE0 A;  4ME2 A;  4AOF A;  5AQA A;  1D8D A;  2XRY A;  1QBQ A;  2PL2 A;  3TWS A;  2P9N G;  5EIB E;  3CK9 A;  2FF4 A;  4DUI A;  4GYO A;  2XPI A;  4I2W A;  5C2Y A;  3ULE G;  4M3O A;  5KNG A;  3JQ0 A;  2PM7 A;  4G26 A;  4KYO B;  4FUL A;  4N5Q A;  3FTX A;  3Q5M A;  5E76 A;  3TL5 A;  4GA2 A;  3VLF A;  2P9P G;  4Y6C A;  4BES A;  5FZR A;  5CBO A;  2A4Z A;  3HRA A;  5EYP F;  4UQX A;  3NQP A;  4RSY A;  5AQ7 A;  3G2W A;  3Q79 A;  3FTV A;  3O48 A;  3CVU A;  2UY1 B;  4GTS A;  2LXM A;  4IYP A;  4K5C A;  3VLE A;  1P5Q A;  1WAO 1;  4DLQ A;  1INZ A;  4I17 A;  4CYM D;  3B7T A;  5KJM A;  4LRZ A;  3UT4 A;  4OAV B;  5ENP D;  1S0P A;  4A1G A;  4E85 A;  1FPP A;  2J07 A;  4AV7 A;  1MQS A;  4U63 A;  5FQ4 A;  4YDO A;  4U8Y D;  5CEC B;  4J0U A;  3EIQ C;  3ASH A;  2WXR A;  3LS8 A;  2DZN A;  1H6P A;  2LO6 A;  2QZA A;  4OAU C;  3EU9 A;  3E34 A;  3MCX A;  4BT8 A;  1TEZ A;  2CFU A;  3SFZ A;  5FZS A;  3FEX A;  5CMW A;  4KVM A;  2M63 A;  1H19 A;  4ATZ D;  5AJD A;  3FUI A;  4GTT A;  4F6R D;  2EIL E;  2XRZ A;  5CRV A;  3OAW A;  2JEK A;  3G2U A;  5EX0 A;  5BT1 A;  5G55 A;  3DSS A;  3CV0 A;  2ZGG A;  4X8Q A;  4WNF A;  4TUM A;  2WXK A;  3CLJ A;  5HI7 A;  2KCK A;  3ML8 A;  2HYZ A;  3BU8 A;  3ULQ A;  3UTM A;  3B7R L;  4J8Y A;  3PE4 A;  5T4Y A;  2P9K G;  2OEW A;  1Z3X A;  3ASF A;  1YA0 A;  4U0Z A;  3N71 A;  4OVU A;  3G2T A;  2YNQ A;  3G2S A;  3UIN C;  4XI0 A;  3ESL A;  1JCR A; 
#chains in the Genus database with same CATH homology
 3UKU G;  2P9P G;  1U2V G;  3ULE G;  2P9I G;  2P9S G;  1K8K G;  3RSE G;  2P9K G;  3DWL G;  2P9L G;  2P9N G;  4XEI G;  3DXK G;  4JD2 G;  3UKR G;  2P9U G;  3DXM G;  1TYQ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...