3RO3A

Crystal structure of lgn/minscuteable complex
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
159
structure length
159
Chain Sequence
SRAAQGRAFGNLGNTHYLLGNFRDAVIAHEQRLLIAKEFGDKAAERIAYSNLGNAYIFLGEFETASEYYKKTLLLARQLKDRAVEAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIAQELKDRIGEGRACWSLGNAYTALGNHDQAMHFAEKHLEISREV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title LGN/mInsc and LGN/NuMA complex structures suggest distinct functions in asymmetric cell division for the Par3/mInsc/LGN and G[alpha]i/LGN/NuMA pathways
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords G-protein-signaling modulator 2
total genus 74
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2011-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13176 TPR_7 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ro3A00
3SF4A 5G05J 3ASFA 4GYYA 5CCMA 3AS4A 5G04C 5EKQD 5BT1A 1ELWA 4HOTA 1KT0A 2P58C 4UQYA 2XEVA 4O6FA 4G23A 4H7XA 3OXFA 3GW4A 4WNEA 5CHEE 2YHCA 3S7DA 4CDRA 1KT1A 4G25A 4G2VA 5DIZA 1FCHA 2XGSA 4KBQA 4N3CA 4U07A 3QDNA 4GCNA 2LNIA 4GZ3A 4GZ5A 3QOUA 4XIFA 4W9RA 2Q7FA 3U3WA 1OUVA 2PQNA 3ASHA 3CK9A 3Q4AB 4Y6WA 3CVNA 4XI9A 4N3AA 5C1DA 3MV3B 3Q49B 3S7FA 2WPVA 4CGVA 3GZ1A 2XCBA 1HZ4A 3K9IA 2DBAA 4HOSA 4GYWA 3Q15A 1W3BA 2VSNA 4B94A 2UY1A 5A6CA 3JYSA 3MV2B 3QWPA 4GYOA 4YVOA 4KXKB 4NRHB 3PE3A 1YA0A 3LKUA 4IN3B 4HOQA 3URZA 4G1TA 4ME2A 2OOEA 5HI7A 3WXXA 5JJ7A 2VGXA 3CKCA 4LEUA 5KJMA 1Y8MA 1KLXA 2VGXB 4U0ZA 4I17A 4HORA 2BUGA 2KATA 3CK8A 4RG9A 1WM5A 2I6HA 2ONDA 2VGYA 2HO1A 2XCCA 4JL0A 4RG6A 4U0UA 3E4BA 4UQZA 3RO3A 3ULQA 5M72A 4I2WA 2AVPA 5KJKA 3IEGA 4EQFA 3KD7A 3RIBA 3GYZA 1NA0A 2C2LA 2HR2A 2XGOA 3LPZA 4N5CA 2IF4A 2V5FA 3QKYA 5FT9A 5FZSA 4JA9A 3ZHEB 2PL2A 4J0UA 4WNGA 4BT9A 3RO2A 3S7BA 4WNFA 4YNDA 2HYZA 3ZFWA 3CK7A 3ESKA 4I1AA 3EDTB 5EX0A 3OXGA 1A17A 2GW1A 2UY1B 3AS5A 4J8FA 4Y6CA 4CGWA 4N2QA 5ARGA 3PDNA 2C0MA 3PE4A 5BW8C 3CEQA 3CVLA 4ABNA 1WAO1 5A7DB 3MA5A 1IHGA 2FF4A 4JHRA 4GA0A 2PQRA 5FTPA 3ZGQA 3UPVA 1NA3A 3U4TA 3QWVA 1HXIA 5FZQA 5FZRA 5LCWC 5ARFA 3KS2A 5JJ6A 1XNFA 1ZU2A 2E2EA 3FWVA 4G26A 5D0OD 3S7JA 1HH8A 2FBNA 4N3BA 4BTAA 5D0QD 2Y4TA 3LCAA 3TG5A 4AIFA 4I9CA 3RU0A 3UQ3A 4I9EA 5AYWD 1ELRA 4BTBA 3UUXA 5HQ8A 3KAEA 3VTYA 3TG4A 4GA2A 3QWWA 4GZ6A 2MHKA 4UI9J 4I2ZA 4JA7A 3SZ7A 2C0LA 3VTXA 4UQXA 2VQ2A 1P5QA 3LY7A 1TJCA 4U0SA 2PZIA 5CCLA 4N2SA 2FEZA 2WQHA 3RKVA 2LSVA 3CVPA 3CVQA 3CV0A 3MEKA 3N71A 4G24A 4U04A 4H7YA 4WNDA 2J9QA 2QFCA 4F3VA 2JLBA 3O48A 4UI9K 4AM9A 2Y4UA 3ZN3A 4BT8A 4AY6A 3OXLA 3ZHEA 4BWRA 1NZNA 4APOA 2L6JA 4J8DA 4NQ0A 4A1SA 1B89A 4J8EA 3TGOA 3ASDA 3GZ2A 3Q5MA 2KCLA 5G05C 1PC2A 1ZBPA 1QZ2A 2XGMA 4AY5A 2KC7A 2VYIA 3FFLA 3NF1A 4YVQC 5G04J 3R9AB 3ZPJA 5KJLA 1IYGA 2VSYA 3MKRA 5LCWJ 3TAXA 5EX3A 4HOUA 5BNWA 2LSUA 2YQ8A 1E96B 4WUYA 3AS8A 4KYOB 2R5SA 2XPIA 3LY9A 3BEEA 4GCOA 4N39A 3RJVA 5DBKA 2KCKA 4GPKA 2IFUA 3CKBA 2UWJG 3LYAA 4XI0A 5JJTA 1QQEA 2FI7A 2KCVA 3ASGA 2FO7A 3HYMB 3Q47B 4GA1A 5FJYA 3LY8A 5KJNA 2NC9A 4UI9C 3FP3A
chains in the Genus database with same CATH superfamily
5G05J 2DVWA 5G04C 3UM0A 1X5BA 4O6FA 4AP2A 2VSOE 4JHJA 4JEHA 3LJNA 3FH8A 4KZ0A 3CVNA 3ML9A 2VSNA 3B95A 5CRUA 1SA4A 2WXOA 4KXKB 3FH7A 2LUHA 4HRLA 2IEJA 3E37A 3CKCA 4RSYA 3L08A 4CT0A 2Y3AA 2C2LA 1MQSA 3ML8A 5HQ8A 4L2LA 3ESKA 3ZEFA 3ZRHA 3PREA 1IHGA 2FF4A 3ABKE 4NIKA 5FZRA 5LCWC 4G26A 3J5QB 4HNAD 3AAAC 1HE8A 1NP7A 3DPDA 1Z3XA 2J09A 3FUHA 1K1BA 5ANLA 3TWTA 3LY7A 3MKQB 2PZIA 1OWMA 3L17A 4TUUA 4JEUA 4OYSA 2PNNA 4FU3A 4UWFA 3AJIA 3DSXA 3ULYA 2RD0A 3EIQC 1PC2A 1QZ2A 2PM7A 1LF8A 1H0AA 2AXUA 3RAUA 4MS6A 3TAXA 3C72A 2Y0BG 3FTXA 4HOUA 5ENSD 3RRNB 4KYOB 2XRYA 3LY9A 3UMVA 3BEEA 4N39A 4K5BA 3CKBA 2UWJG 2V8SE 2Y1LE 4OAUC 4GTPA 4GB9A 3HXDA 4DJAA 3Q78A 4G23A 3TL5A 3L82A 4GZ5A 4BY6A 1S70B 2H6HA 2WPVA 1HZ4A 2DBAA 3ULEG 1DCEA 3CHMA 3UI2A 4NURA 4UUCA 4JB8P 3WXXA 2WMNA 2JABA 2XZDG 4PS8A 3B7UX 4BESA 1MX2A 2EQXA 3DXMG 2ZU6B 4L9PA 1N0QA 2XS8A 5FZSA 4LERA 4I1AA 5AAOA 3PE4A 3FUMA 4DI4A 5D0OD 2P9UG 4GZDA 3D9NA 2Y4TA 3JUEA 3RU0A 3SHFA 4BEPA 3SGHA 4UQXA 5ENNA 3APDA 4ACKA 2FEZA 3HXFA 1HG2A 1N4PA 4JW1A 2EIJE 2JLBA 4AOFA 3CHSA 5EILA 3UT4A 1AWCB 1U3CA 1H19A 2LXLA 3V2XA 5FQ4A 4X8QA 2KZTA 2P9KG 4N5QA 1NI1A 2OEVA 3KEAA 3ENEA 2IOSA 3ZXSA 1KT1A 4UWKA 2GRPB 4XIFA 4XKBA 3ASHA 1BD8A 3GZ1A 4JHKA 4GYWA 2WMOA 2MOWA 5A6CA 4YVOA 3PE3A 4YDWA 1WDYA 4Z68A 5FINA 2DIWA 3TWRA 5ENTD 4KVMA 2ONDA 3ABME 3FTSA 3ISMC 1K8KG 3AG3E 2HYZA 1LTXA 1A17A 3G2VA 5LFAA 4TUMA 4JHRA 1XNFA 3FWVA 1HH8A 2IJGX 3SNXA 2OEWA 4I9CA 3UUXA 4IULA 4L23A 4UI9J 2QYJA 3FTWA 4Q96A 4D10C 2RKKA 4N2SA 1YCSB 4K0RA 1D8DA 2LSVA 4U04A 4H7YA 1N52A 2IONA 4APOA 4J8EA 2WVIA 4G8LA 2KCLA 2RG8A 4I6EA 2X6IA 3FFLA 1V54E 3FH5A 2VSYA 1UJJA 2YQ8A 3PZDA 1QBQA 3O4ZA 3L22A 1EDUA 2IFUA 3Q7AA 3HYMB 2V4LA 1MHQA 4HXIA 1TR4A 4ANUA 3S7DA 4CDRA 4DI3A 4HFGA 2Q7FA 4DX6D 3JCKC 2F8YA 3CVYA 3BU8A 4GTTA 2XPYA 1LD7A 3I5PA 4ATZD 3V30A 1DNPA 4EZJA 5T8IA 2OOEA 1MX6A 3ZYLA 2VGXA 3HG0D 4LEUA 3B13A 1DCQA 1VDYA 4AV7A 4CDNA 2R02A 2KATA 4U0UA 5B3SE 2HO1A 5EYLA 3CHOA 3T5VA 3J5PA 3NQPA 4JPSA 3LPZA 2ZISA 4UWHA 4Y6CA 5FQ8A 5D66A 1HXIA 5JJ6A 3NB2A 1ZB1A 4BSXA 4AXHA 5BV1A 3S2AA 3TG4A 5JA4D 3PUJA 2QYUA 1SQMA 3FU5A 1OT8A 3CIAA 3CVPA 4WNDA 3ZW3A 3FU3A 2X6FA 4AY6A 3NOGD 4JZYA 4K5AB 2ETCA 2AXVA 5JHBA 2XGMA 2VYIA 2XZTG 1E96B 4KMOA 4IYPA 3B7SA 3FEXA 1N94A 2VTBA 3LY8A 2NC9A 3FP3A 2XENA 2L6BA 3CQGB 3PVLA 3UM3A 2XRZA 2CHZA 3UIPC 4WAFA 3VLFA 4QQIA 1FCHA 3FU6A 2VTBB 1S0PA 4GTMA 1E7UA 1N54A 3Q4AB 5AJLA 4XZ4A 1NFIE 5EDSA 4F7AA 1SVXA 4G1TA 2WXIA 4HRNA 3ZYQA 3ZVVA 4HQDA 2QC9A 2VGXB 3D9PA 4HORA 3FUNA 4HI8A 4UQZA 3SD5A 3C3OA 3ZXPA 3IEGA 2X6KA 3QKYA 4P29A 4J0UA 2DYRE 5BXOA 3CEQA 3TXNA 2P9LG 4EBAA 2Y69E 3AG2E 3FULA 4TXQA 4N3BA 1JUQA 2NSZA 2WM9A 2WB2A 4ACLA 4FC8A 3KAEA 5HS0A 3VTYA 4I6GA 4GZ6A 3NZUA 3UXGA 4JA7A 1P5QA 4U0SA 2L9BA 4JC8A 2H6IA 2X6HA 3I4GA 4AM9A 1UG3A 3FTVA 3Q79A 2OCCE 3T9KA 3SBTB 5KJLA 3MZLB 5BV0A 3MGBA 4GCOA 3LYAA 3F6QA 4GA1A 4DX7D 3UINC 2CG2A 4GZCA 3LDZA 4HRMB 3NBNB 3FUJA 5CBOA 2A5EA 3PUKA 4OAVB 4Y6WA 4MKTA 4A63B 2YNQA 4FHKA 4K03A 5B1BE 3V79K 2CHXA 2BUGA 1TYQG 4U7EB 1YYHA 5KJKA 2CHWA 4DPRA 3TWXA 3UM1A 4G11A 1N11A 5C2YA 3QJZA 5AQAA 2HM8A 3CK7A 1TNYA 5LOZA 2B6CA 4B89A 1NA3A 3U4TA 3VLDA 3FTYA 5HKPA 3HDXA 5D0QD 2JEKA 4E6HA 5CBNA 3R7RA 5ITZF 1IHBA 1D8EA 3D9HA 3PEVB 5FIOA 2J9QA 3O48A 1X81A 1JPLA 5EIDA 3AG1E 5B1AE 4HLEA 3ZU7B 3EHRA 3Q47B 2WXKA 4CEMA 1H2UA 3U64A 3SBSA 2P2CP 1JWFA 4PDXA 2EILE 4G2VA 4EHMA 4BERA 4N3CA 3BG1B 2PQNA 3FEYA 1E8ZA 1H2TC 3Q49B 4HOSA 4LCTA 5E76A 4B0ZA 3LKUA 4CZ2D 5J90A 2B0OE 4J7WA 3MCXA 4J8YA 3D9JA 3Q9UC 4F1PA 1GW6A 1XGWA 4EQFA 4CCAA 5FQ6A 1UN8A 3L9TA 2HR2A 1UJKA 3HHMA 4N5CA 5BUZA 3TXMA 4YNDA 5EN5D 1FVFA 2UY1B 3PDNA 5AENA 3ZUVB 1IQRA 3MKQA 4GTOA 1FT1A 5AJDA 3QWWA 2MHKA 3SZ7A 1O1SA 1TNZA 1TJFA 3UX4A 2V4HC 4C0MA 4EBAG 1E90A 2P9IG 3CSFA 1TNBA 1OCOE 4K5CA 3UKRG 3RSEG 5G05C 1ZBPA 3CSTA 3E33A 3ZIMA 5KCMA 3P1UA 2R5SA 2XPIA 4GPKA 3FTUA 3V31A 1SA5A 3DXKG 1ELWA 3Q9NC 2LAIA 4H7XA 4DK5A 2XGSA 3CHQA 4GZ3A 3U3WA 5C1DA 4CGVA 1H6OA 4G8KA 3K9IA 5CMWA 3MV2B 2I2OA 3RRUA 3G2WA 4URKA 4ILHB 1KLXA 2R59A 1OWLA 4E85A 1INZA 1UN9A 2VGYA 3I4RB 3DPYA 3APFA 5FT9A 4FA6A 5LP0A 4U8HA 3D9OA 3APCA 4C48B 5FZQA 3LEWA 5ARFA 5AIJA 5CECB 2BF0X 1G3NB 3NZSA 3CQCB 4A3TA 5AYWD 2VJ8A 2WQHA 2J07A 4UWGA 2BTDA 2Y4UA 3ZN3A 4BWRA 2XPZA 3ZHEA 4JD2G 4J8DA 4EZKA 3L54A 2CFZA 3DSWA 3GZ2A 3ONKA 3EU9A 2KC7A 4YVQC 3VLEA 5LCWJ 3HXEA 4DX5D 2J4BA 5BNWA 2LO6A 3CVWA 5CERB 3AS8A 5DBKA 3ZNGA 4XI0A 4L1BA 3CVXA 2J4DA 1H6KA 3OTNA 2RFMA 3U9WA 2WXMA 3B7BA 4ATGA 4B8AA 3HIZA 3D9LA 2GRLA 2YHCA 2XS1A 3PS6A 4ILIA 2IOLA 4RLYA 4BETA 4W9RA 5EYPF 2R03A 2XCBA 2P9PG 3Q15A 3Q73A 4O60A 3JYSA 5AN8A 2FULA 4CT4A 3L16A 4JL0A 4U8VD 4RVBA 3IBEA 3WG7E 2NYJA 4IRUA 2P9NG 4WWOA 2PM6A 2AXZA 3T5XA 1LD8A 4KZCA 3SI5A 2V0PA 1BI8B 1RZ4A 3C3RA 1NL4A 4LNBA 3DRAA 2A5UA 1TJCA 3PZ2A 4LG6A 1IXVA 1N4QA 3FUEA 1IQUA 4O1OA 4NQ0A 1B89A 1IYGA 1RW2A 3C3QA 4DX2A 2KCVA 4CRWA 5AQ7A 4TXPA 5LX8A 3ABLE 5D2MC 4UQYA 3OXFA 5DIZA 1TNUA 3ZPJA 1SW6A 1EPUA 3E32A 2ETBA 1W3BA 3LVRE 1TN7A 1BI7B 2R2LA 3QWPA 2J08A 5FQ7A 3FUDA 3CVUA 1OWOA 3LVQE 5CEDB 3D3MA 5AARA 2DYSE 5EIBE 1Z3YA 1UW4B 2AVPA 3RIBA 1BU9A 4A1GA 3G2TA 3V2OA 3EIJA 3FU0A 2C0MA 4ANWA 1WAO1 2IY0C 3KSLA 5A7DB 4F53A 3S7JA 1MYOA 4HBDA 5JHAA 2AW6A 2WXJA 4FJZA 2ETAA 3B7TA 2WXHA 1N0RA 1O5MA 1UOHA 3RKVA 3SF4A 3CV0A 4L2YA 2QFCA 3OXLA 3CR3A 4LRZA 3Q5MA 3NF1A 5G04J 4A3VA 5T4YA 3C5RA 5CEAA 5J08A 2ZIRA 3CGHA 1OCZE 3KEZA 2LXMA 5CCMA 1O1TA 4JVSA 1S64A 4FADA 1QYMA 2GRMA 5CHEE 2V5QC 3DEOA 1N9AA 4DLOA 4G25A 4U07A 3CK9A 3MV3B 4XE0A 4XX5A 3EJNA 4HB5A 4RQIA 1DVPA 3TWQA 1OWPA 4I43A 4EPZA 4EZLA 3D9IA 4FHJA 3ASNE 3OAWA 2DWZA 4HOTA 2I9CA 4EECA 4WWNA 3CHRA 2OVFA 1NA0A 5FWQA 2IF4A 4I1OB 4WNGA 3TWWA 1EF1C 3EDTB 4OVVA 1HG5A 4TV3A 5BW8C 1WG0A 4GA0A 2I1KA 1TN8A 2H6FA 3PRZA 3QK0A 4BTAA 5ENRD 2ZGDA 3TWVA 3AU5A 3EHQA 2IQCA 1OY3D 2C0LA 3DSUA 3QC1A 4FJYA 4ANVA 2QY7A 5KWDA 1NZNA 3BG0B 4JXTA 4A1SA 3PNLB 4LNUD 2GGFA 4NACA 4DX1A 2EIME 3U66A 3RJVA 1KPSB 1H6PA 5FJYA 4Q94A 4LSZE 4TRQA 4HLLA 4ANXA 4GYYA 5EKQD 2MYOA 2P58C 2QZAA 5BPPA 2VGEA 2WXNA 4KBQA 3T8KA 5IY5E 2LNIA 3PEUB 2GRQB 4XI9A 5H7PA 3C98A 1MZCA 3JXJA 1QNFA 1YA0A 5HI7A 4O1PA 2DZOA 3Q75A 2X38A 1JCRA 4RG9A 4RG6A 2I6HA 2XCCA 3ULQA 4I6JA 3QAQA 4V3IA 5JJTA 4CGWA 3JXIA 2GW1A 4N2QA 4B93B 2F37A 3HVEB 2H6GA 4HI9A 3MA5A 4KVOA 2GRRB 5KNGA 2KZTB 5KNHD 1E7VA 1HX8A 4GMRA 4AIFA 4BTBA 1ELRA 3GZSA 2XHEA 3BQOA 4GA2A 1JCSA 4BFRA 1OCCE 3EHMA 1V55E 4WNEA 2WXQA 1BPOA 3UIOC 3PH0C 1HFAA 2J8SD 4AJWA 5EX3A 2CG3A 3BUAA 4DLQA 3HRAA 4DRXE 1SZAA 2FI7A 1OWNA 3MJWA 5ANRA 3LS8A 1Z5SC 3DSSA 3UT7A 3QDNA 3QOUA 1OUVA 4C0EA 3S7FA 3D9MA 4B94A 2UY1A 2IO3C 4GYOA 4NRHB 1Z6TA 4IN3B 1KZPA 4HS2A 4HOQA 5JJ7A 4GTRA 1Y8MA 4UWLA 4I17A 1HF8A 3CK8A 1BLXB 3R9MA 5M72A 3SFZA 3KSQA 2EINE 3GYZA 2GRNB 3S7BA 1ELKA 1HO8A 4PS7A 2M63A 1H2VC 1Q2ZA 2L0TB 3HVEA 3PZ4A 2OVBA 5T3RA 2E2EA 3TWSA 1KZOA 3UTMA 2NXPA 3ZYKA 2XEHA 3TG5A 5ENQD 2WQ7A 2DZNA 3JQ1A 3HXBA 4ZHBA 1K1AA 4I2ZA 4U95D 1DC2A 4U63A 3LXUX 3AU4A 3CVQA 3W9GA 4G24A 3SFYA 3RK6A 3T8MA 4BT8A 2L6JA 2IU1A 3ASDA 3IXEA 3R9AB 4YDEA 4LNGA 2FO1E 2AWIA 4R7LA 2KCKA 2KBXA 4GMLA 1QQEA 2BKGA 3ASGA 3PNTB 4AY5A 3JUIA 3UT8A 3HXCA 3L6AA 3ASFA 3QNKA 2XEVA 4XEIG 5AQ9A 3ZFWA 4ABNA 4MBGA 1AP7A 2MRIA 4N3AA 2RFAA 4FULA 2L0IA 1MJ0A 4A55A 3URZA 1TEZA 4ME2A 5BXUA 3FHEA 1SZ9A 1OCRE 3IHVA 3RO3A 2KXPC 2HE0A 3KD7A 2XGOA 3I3NA 3SQVA 4M7CA 3TWUA 1FPPA 1YMPA 4J8FA 5G2NA 3ZYMA 1HU3A 3ESLA 3FUKA 4ILGA 3R7QA 2ZXWE 3LCAA 5G55A 1TNOA 2WXFA 3B7RL 3JQ0A 3UQ3A 3SO8A 4I1MA 4BX9A 3VTXA 4GU5A 5CCLA 5JMND 4Q69A 1JWGA 3MX3A 5CMYA 3UKUG 2OV8A 4UI9K 2IO2C 4GTVA 3W9FA 2XQ0A 3MYVA 4HVBA 2F8XK 3FUFA 2LSUA 4CYMD 4WUYA 2GROB 3E30A 3LJ3A 4FLBA 1WY6A 4F1SA 3DWLG 2FO7A 3NOCD 4FLHA 4UI9C 3PZ1A 4GTSA 2WXLA 4GTQA 3E34A 3IKOB 1OXJA 4F6RD 2X6JA 3FDHA 3GW4A 3FY4A 4CDMA 2XEEA 2E0IA 3EU5A 5AQBA 4PS3A 1N4SA 1IKND 2R17C 1K3ZD 4ZFHA 3EUVA 1TN6A 1E8XA 3FTZA 1N4RA 4GAAA 2VSXE 2LAHA 3IV0A 2J49A 5CRVA 3L13A 1U3DA 4I2WA 4MLPA 4U96D 2WXGA 1N95A 3ZHEB 4BT9A 3RO2A 5EX0A 3OXGA 1A5EA 3AS5A 3FUIA 5ARGA 4C9BB 2PQRA 3QWVA 3CHPA 2A4ZA 1ZU2A 2FBNA 3G2UA 2KM4A 4FP7A 4I9EA 2ILRA 2BKKB 3DSVA 2VQ2A 4M3OA 1S63A 4LUNU 3N71A 4U8YD 2YHEA 3TGOA 1U2VG 4L7TA 1EYHA 4YDYA 2P9SG 3MKRA 4AEZC 2I1JA 1JCQA 5KJNA 3G2SA 2WQ6A 2ZGGA 1HS6A 3AS4A 3QARA 4QFVA 5BT1A 4J8SA 1KT0A 1FVHA 5ENOD 3TJPA 4GMJA 1D9SA 3ZGQA 4PUCA 3EHNA 4GCNA 3Q7FA 4APFA 3P2BA 3ASOE 4PH4B 2WXPA 4DUIA 2YINA 2WXRA 3DEPA 2EIKE 5KJMA 2DCPA 4U0ZA 1FT2A 1WM5A 1E8WA 3DSTA 3E4BA 4TXRA 2BEDA 2V5FA 4JA9A 2PL2A 3RRMB 4WNFA 3X2QE 3SY2A 3IHYA 5ENPD 1PY1A 4AVXA 3PZ3A 3CVLA 4OVUA 4MRUA 5FTPA 3UPVA 3UM2A 5E75A 3KS2A 3SFXA 2AJAA 1L5JA 3CLJA 3ZKJA 5A23A 3AG4E 4J6IA 5KBAA 3DBSA 3QB2A 2F0YA 1PAQA 3NAWA 4KT6B 3ONLA 2X3MA 3MEKA 4B8CB 4F3VA 1E8YA 4YDOA 2R05A 4BSZB 4WWPA 4GPMA 3D9KA 3CVVA 1Y6IA 4BX8A 1O1RA 4XKCA 2CFUA 1MX4A 5HRYA
chains in the Genus database with same CATH topology
2WXMA 5G05J 3CQGB 3PVLA 5G04C 4ATGA 4B8AA 3HIZA 3D9LA 1X5BA 2XRZA 2CHZA 4O6FA 2GRLA 2YHCA 3PS6A 4AP2A 2VSOE 4WAFA 4ILIA 3UT7A 3VLFA 2IOLA 4JHJA 1FCHA 3FU6A 2VTBB 1S0PA 3QDNA 3QOUA 4JEHA 3FH8A 4W9RA 4KZ0A 1OUVA 1E7UA 1N54A 3Q4AB 5AJLA 3CVNA 4C0EA 4XZ4A 3S7FA 3ML9A 2XCBA 3D9MA 3Q15A 2VSNA 5EDSA 4B94A 4F7AA 2UY1A 2WXOA 3JYSA 4GYOA 4KXKB 1Z6TA 3FH7A 4NRHB 4IN3B 4HOQA 4HS2A 4G1TA 2FULA 2WXIA 3ZYQA 3ZVVA 4CT4A 5JJ7A 3CKCA 1Y8MA 4UWLA 2VGXB 4RSYA 3D9PA 3L16A 4I17A 1HF8A 4HORA 3L08A 3CK8A 3FUNA 4JL0A 4CT0A 4UQZA 3SD5A 2Y3AA 5M72A 3SFZA 3IEGA 4RVBA 2X6KA 3IBEA 3GYZA 2C2LA 1MQSA 3QKYA 4IRUA 3ML8A 4P29A 5HQ8A 4J0UA 3S7BA 1ELKA 4L2LA 4WWOA 1HO8A 3ESKA 2PM6A 4PS7A 2M63A 1H2VC 2L0TB 2AXZA 3ZEFA 3ZRHA 3CEQA 3T5XA 3PREA 3TXNA 3HVEA 1IHGA 2FF4A 2OVBA 4EBAA 5FZRA 5LCWC 5T3RA 2E2EA 4G26A 4KZCA 2NXPA 3FULA 3ZYKA 4N3BA 1HE8A 1JUQA 1NP7A 3TG5A 2NSZA 2WM9A 2WB2A 2WQ7A 3SI5A 2V0PA 4ACLA 3DPDA 3JQ1A 4FC8A 3KAEA 3VTYA 1Z3XA 4I6GA 2J09A 3FUHA 3NZUA 4GZ6A 4I2ZA 4JA7A 5ANLA 1P5QA 2A5UA 1TJCA 3LY7A 3MKQB 2PZIA 4U0SA 4U63A 2L9BA 3LXUX 1OWMA 4JC8A 3L17A 3AU4A 3CVQA 4G24A 3RK6A 4TUUA 2X6HA 3I4GA 4JEUA 3FUEA 4OYSA 1IQUA 4AM9A 4FU3A 4UWFA 3T8MA 4BT8A 1UG3A 2L6JA 4NQ0A 1B89A 3FTVA 2RD0A 2IU1A 3ASDA 3EIQC 1PC2A 1QZ2A 2PM7A 1LF8A 3R9AB 3SBTB 1H0AA 3MZLB 5BV0A 5KJLA 2AXUA 1IYGA 4MS6A 3TAXA 3FTXA 4HOUA 3MGBA 3RRNB 4KYOB 2XRYA 3LY9A 2AWIA 3BEEA 4GCOA 4N39A 4R7LA 3UMVA 2KCKA 4GMLA 3CKBA 2UWJG 3LYAA 1QQEA 2KCVA 3ASGA 3PNTB 2V8SE 4GA1A 4AY5A 4CRWA 3JUIA 3UT8A 3L6AA 3ASFA 5LX8A 2CG2A 4GZCA 3LDZA 3FUJA 3QNKA 4GB9A 4UQYA 2XEVA 4DJAA 4G23A 3OXFA 3TL5A 3ZFWA 5DIZA 3ZPJA 4ABNA 4GZ5A 3PUKA 4BY6A 1EPUA 2MRIA 4Y6WA 4MKTA 4N3AA 4FULA 2WPVA 1HZ4A 2DBAA 2YNQA 2L0IA 1W3BA 4FHKA 3LVRE 3CHMA 3QWPA 2J08A 4NURA 5FQ7A 4K03A 3FUDA 4A55A 3CVUA 3URZA 1TEZA 4ME2A 1OWOA 3WXXA 3LVQE 2WMNA 4PS8A 3B7UX 1SZ9A 2CHXA 3FHEA 2BUGA 2EQXA 3D3MA 3IHVA 3RO3A 1Z3YA 1UW4B 2AVPA 2ZU6B 5KJKA 2CHWA 3KD7A 3RIBA 4DPRA 4G11A 2XGOA 3I3NA 4A1GA 5FZSA 5C2YA 3QJZA 4LERA 2HM8A 3G2TA 3CK7A 4I1AA 3EIJA 4J8FA 3FU0A 5LOZA 5G2NA 2C0MA 3PE4A 4ANWA 3ZYMA 1WAO1 5A7DB 4F53A 1HU3A 4B89A 1NA3A 3ESLA 3FUMA 3U4TA 4DI4A 3FUKA 5D0OD 3S7JA 4ILGA 3VLDA 3FTYA 4GZDA 3D9NA 3HDXA 3R7QA 5D0QD 2Y4TA 3LCAA 5JHAA 2JEKA 5G55A 2WXFA 3RU0A 3B7RL 3JQ0A 2AW6A 3UQ3A 4E6HA 3R7RA 4I1MA 2WXJA 3SHFA 4FJZA 3B7TA 2WXHA 4BX9A 3SGHA 3VTXA 4GU5A 4UQXA 5ENNA 3APDA 5CCLA 4ACKA 3PEVB 4Q69A 1JWGA 2FEZA 3MX3A 5CMYA 1HG2A 3RKVA 3SF4A 3CV0A 4JW1A 4L2YA 2J9QA 2QFCA 2OV8A 2JLBA 3O48A 4UI9K 4AOFA 3CHSA 3OXLA 3CR3A 4LRZA 3UT4A 1JPLA 2XQ0A 3Q5MA 1U3CA 3MYVA 1H19A 4HVBA 3NF1A 5G04J 5FQ4A 1INZA 3FUFA 2KZTA 4A3VA 5T4YA 2LSUA 4WUYA 4HLEA 3LJ3A 4FLBA 1WY6A 4F1SA 5J08A 3Q47B 2FO7A 2WXKA 3CGHA 4CEMA 4FLHA 1H2UA 4UI9C 3U64A 2WXLA 3KEZA 3SBSA 5CCMA 4JVSA 3IKOB 3ENEA 4FADA 1JWFA 2X6JA 3FDHA 2IOSA 3GW4A 4PDXA 2GRMA 5CHEE 3ZXSA 3FY4A 4DLOA 4CDMA 1KT1A 2E0IA 4G25A 4G2VA 4UWKA 4N3CA 4U07A 4XIFA 3BG1B 4PS3A 4XKBA 2R17C 2PQNA 3CK9A 3ASHA 3FEYA 1E8ZA 1H2TC 3MV3B 3Q49B 4HOSA 4LCTA 3GZ1A 4XE0A 4JHKA 4XX5A 4GYWA 3EJNA 2WMOA 2MOWA 1E8XA 1DVPA 5A6CA 3FTZA 4GAAA 4YVOA 2VSXE 5E76A 1OWPA 4I43A 2LAHA 3LKUA 3PE3A 4B0ZA 5J90A 3IV0A 4EPZA 4EZLA 2DIWA 3D9IA 4FHJA 3OAWA 3MCXA 2J49A 4KVMA 2ONDA 3D9JA 3L13A 4HOTA 1U3DA 1GW6A 1XGWA 2I9CA 4I2WA 4EECA 4EQFA 4MLPA 4WWNA 3CHRA 3FTSA 4CCAA 2OVFA 1UN8A 2WXGA 5FQ6A 1NA0A 2HR2A 1UJKA 3HHMA 4N5CA 5FWQA 2IF4A 3ZHEB 4BT9A 5BUZA 4I1OB 4WNGA 3RO2A 3TXMA 4YNDA 1EF1C 2HYZA 5EX0A 3EDTB 3OXGA 1A17A 4OVVA 1HG5A 1FVFA 2UY1B 3AS5A 3G2VA 3FUIA 4TV3A 5ARGA 3PDNA 5BW8C 4C9BB 5LFAA 4JHRA 4GA0A 2PQRA 2I1KA 3QWVA 3CHPA 2A4ZA 1XNFA 1ZU2A 3FWVA 5AENA 1HH8A 2IJGX 3PRZA 3QK0A 2FBNA 4BTAA 1IQRA 3G2UA 3SNXA 2KM4A 4FP7A 4I9CA 4I9EA 2ILRA 3AU5A 3MKQA 3UUXA 5AJDA 4IULA 4L23A 3QWWA 2MHKA 2IQCA 4UI9J 3SZ7A 2C0LA 3FTWA 3QC1A 2VQ2A 4FJYA 4ANVA 4M3OA 4Q96A 4D10C 4N2SA 1TJFA 4LUNU 3UX4A 4K0RA 4C0MA 4EBAG 1E90A 3CSFA 2LSVA 3N71A 4U04A 4H7YA 2QY7A 1N52A 2YHEA 2IONA 1NZNA 4APOA 3BG0B 4JXTA 4A1SA 3TGOA 4J8EA 2WVIA 3PNLB 4L7TA 1EYHA 2GGFA 2KCLA 2RG8A 4I6EA 1ZBPA 5G05C 4NACA 2X6IA 3FFLA 3FH5A 3CSTA 2VSYA 3MKRA 3ZIMA 1UJJA 5KCMA 3P1UA 4AEZC 2YQ8A 3PZDA 2R5SA 2I1JA 2XPIA 3O4ZA 3L22A 3RJVA 3U66A 4GPKA 1EDUA 2IFUA 3FTUA 5KJNA 3HYMB 5FJYA 4Q94A 4TRQA 3G2SA 2V4LA 2WQ6A 4ANXA 1MHQA 4GYYA 1HS6A 3AS4A 3QARA 4HXIA 4QFVA 4J8SA 5EKQD 1ELWA 5BT1A 1KT0A 2P58C 1FVHA 5BPPA 2LAIA 4H7XA 4ANUA 3TJPA 3S7DA 4DK5A 2WXNA 4CDRA 4GMJA 4DI3A 3ZGQA 4KBQA 2XGSA 4PUCA 3EHNA 4GCNA 2LNIA 3CHQA 3PEUB 4GZ3A 4HFGA 2Q7FA 4APFA 3U3WA 4XI9A 5C1DA 3P2BA 3JCKC 4CGVA 3K9IA 3CVYA 5CMWA 4PH4B 2WXPA 2XPYA 3I5PA 2YINA 1DNPA 2WXRA 3MV2B 3C98A 2I2OA 1QNFA 1YA0A 4EZJA 5KJMA 5HI7A 2OOEA 5T8IA 3RRUA 2X38A 2VGXA 3G2WA 4LEUA 2DCPA 3ZYLA 3B13A 4URKA 1VDYA 1KLXA 2R59A 4ILHB 4U0ZA 4AV7A 4CDNA 2KATA 1OWLA 4RG9A 4E85A 1UN9A 1WM5A 1E8WA 2I6HA 2VGYA 2HO1A 2XCCA 4RG6A 3CHOA 4U0UA 3E4BA 4I6JA 3ULQA 3QAQA 3T5VA 3I4RB 4V3IA 3APFA 3NQPA 4JPSA 5FT9A 3LPZA 2V5FA 5JJTA 4JA9A 4CGWA 2PL2A 3RRMB 4WNFA 4FA6A 5LP0A 4UWHA 2GW1A 3IHYA 4U8HA 4Y6CA 1PY1A 4N2QA 4AVXA 3D9OA 3HVEB 3CVLA 5FQ8A 4OVUA 3MA5A 4MRUA 5FTPA 3UPVA 1HXIA 3APCA 5FZQA 3LEWA 5E75A 3KS2A 5ARFA 4KVOA 5JJ6A 1L5JA 2KZTB 4BSXA 1E7VA 2BF0X 3CLJA 5AIJA 3NZSA 4AXHA 1HX8A 3CQCB 4AIFA 4A3TA 5BV1A 5AYWD 3S2AA 1ELRA 4BTBA 5A23A 3GZSA 3TG4A 2VJ8A 2XHEA 4GA2A 3PUJA 4J6IA 3DBSA 3QB2A 4BFRA 1SQMA 1PAQA 3FU5A 4KT6B 2WQHA 2X3MA 3CIAA 2J07A 3EHMA 3ONLA 4UWGA 2BTDA 3CVPA 4WNEA 3MEKA 4WNDA 3ZW3A 4B8CB 4F3VA 2WXQA 3FU3A 2X6FA 2Y4UA 1E8YA 3ZN3A 4AY6A 2XPZA 3ZHEA 4BWRA 1BPOA 4J8DA 4JZYA 4EZKA 3L54A 4WWPA 2AXVA 2CFZA 3GZ2A 3D9KA 3ONKA 3PH0C 5JHBA 3CVVA 2XGMA 1Y6IA 2KC7A 2VYIA 4YVQC 1HFAA 3VLEA 5LCWJ 4AJWA 2J4BA 5EX3A 2CG3A 2LO6A 5BNWA 3CVWA 1E96B 3AS8A 4BX8A 4KMOA 4DLQA 4IYPA 3B7SA 4XKCA 5DBKA 3FEXA 4XI0A 1SZAA 4L1BA 2FI7A 2CFUA 3CVXA 2VTBA 2J4DA 1H6KA 3OTNA 1OWNA 3LY8A 3MJWA 5ANRA 2NC9A 3LS8A 3U9WA 3FP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SF4 A;  5G05 J;  3ASF A;  4GYY A;  5CCM A;  3AS4 A;  5G04 C;  5EKQ D;  5BT1 A;  1ELW A;  4HOT A;  1KT0 A;  2P58 C;  4UQY A;  2XEV A;  4O6F A;  4G23 A;  4H7X A;  3OXF A;  3GW4 A;  4WNE A;  5CHE E;  2YHC A;  3S7D A;  4CDR A;  1KT1 A;  4G25 A;  4G2V A;  5DIZ A;  1FCH A;  2XGS A;  4KBQ A;  4N3C A;  4U07 A;  3QDN A;  4GCN A;  2LNI A;  4GZ3 A;  4GZ5 A;  3QOU A;  4XIF A;  4W9R A;  2Q7F A;  3U3W A;  1OUV A;  2PQN A;  3ASH A;  3CK9 A;  3Q4A B;  4Y6W A;  3CVN A;  4XI9 A;  4N3A A;  5C1D A;  3MV3 B;  3Q49 B;  3S7F A;  2WPV A;  4CGV A;  3GZ1 A;  2XCB A;  1HZ4 A;  3K9I A;  2DBA A;  4HOS A;  4GYW A;  3Q15 A;  1W3B A;  2VSN A;  4B94 A;  2UY1 A;  5A6C A;  3JYS A;  3MV2 B;  3QWP A;  4GYO A;  4YVO A;  4KXK B;  4NRH B;  3PE3 A;  1YA0 A;  3LKU A;  4IN3 B;  4HOQ A;  3URZ A;  4G1T A;  4ME2 A;  2OOE A;  5HI7 A;  3WXX A;  5JJ7 A;  2VGX A;  3CKC A;  4LEU A;  5KJM A;  1Y8M A;  1KLX A;  2VGX B;  4U0Z A;  4I17 A;  4HOR A;  2BUG A;  2KAT A;  3CK8 A;  4RG9 A;  1WM5 A;  2I6H A;  2OND A;  2VGY A;  2HO1 A;  2XCC A;  4JL0 A;  4RG6 A;  4U0U A;  3E4B A;  4UQZ A;  3RO3 A;  3ULQ A;  5M72 A;  4I2W A;  2AVP A;  5KJK A;  3IEG A;  4EQF A;  3KD7 A;  3RIB A;  3GYZ A;  1NA0 A;  2C2L A;  2HR2 A;  2XGO A;  3LPZ A;  4N5C A;  2IF4 A;  2V5F A;  3QKY A;  5FT9 A;  5FZS A;  4JA9 A;  3ZHE B;  2PL2 A;  4J0U A;  4WNG A;  4BT9 A;  3RO2 A;  3S7B A;  4WNF A;  4YND A;  2HYZ A;  3ZFW A;  3CK7 A;  3ESK A;  4I1A A;  3EDT B;  5EX0 A;  3OXG A;  1A17 A;  2GW1 A;  2UY1 B;  3AS5 A;  4J8F A;  4Y6C A;  4CGW A;  4N2Q A;  5ARG A;  3PDN A;  2C0M A;  3PE4 A;  5BW8 C;  3CEQ A;  3CVL A;  4ABN A;  1WAO 1;  5A7D B;  3MA5 A;  1IHG A;  2FF4 A;  4JHR A;  4GA0 A;  2PQR A;  5FTP A;  3ZGQ A;  3UPV A;  1NA3 A;  3U4T A;  3QWV A;  1HXI A;  5FZQ A;  5FZR A;  5LCW C;  5ARF A;  3KS2 A;  5JJ6 A;  1XNF A;  1ZU2 A;  2E2E A;  3FWV A;  4G26 A;  5D0O D;  3S7J A;  1HH8 A;  2FBN A;  4N3B A;  4BTA A;  5D0Q D;  2Y4T A;  3LCA A;  3TG5 A;  4AIF A;  4I9C A;  3RU0 A;  3UQ3 A;  4I9E A;  5AYW D;  1ELR A;  4BTB A;  3UUX A;  5HQ8 A;  3KAE A;  3VTY A;  3TG4 A;  4GA2 A;  3QWW A;  4GZ6 A;  2MHK A;  4UI9 J;  4I2Z A;  4JA7 A;  3SZ7 A;  2C0L A;  3VTX A;  4UQX A;  2VQ2 A;  1P5Q A;  3LY7 A;  1TJC A;  4U0S A;  2PZI A;  5CCL A;  4N2S A;  2FEZ A;  2WQH A;  3RKV A;  2LSV A;  3CVP A;  3CVQ A;  3CV0 A;  3MEK A;  3N71 A;  4G24 A;  4U04 A;  4H7Y A;  4WND A;  2J9Q A;  2QFC A;  4F3V A;  2JLB A;  3O48 A;  4UI9 K;  4AM9 A;  2Y4U A;  3ZN3 A;  4BT8 A;  4AY6 A;  3OXL A;  3ZHE A;  4BWR A;  1NZN A;  4APO A;  2L6J A;  4J8D A;  4NQ0 A;  4A1S A;  1B89 A;  4J8E A;  3TGO A;  3ASD A;  3GZ2 A;  3Q5M A;  2KCL A;  5G05 C;  1PC2 A;  1ZBP A;  1QZ2 A;  2XGM A;  4AY5 A;  2KC7 A;  2VYI A;  3FFL A;  3NF1 A;  4YVQ C;  5G04 J;  3R9A B;  3ZPJ A;  5KJL A;  1IYG A;  2VSY A;  3MKR A;  5LCW J;  3TAX A;  5EX3 A;  4HOU A;  5BNW A;  2LSU A;  2YQ8 A;  1E96 B;  4WUY A;  3AS8 A;  4KYO B;  2R5S A;  2XPI A;  3LY9 A;  3BEE A;  4GCO A;  4N39 A;  3RJV A;  5DBK A;  2KCK A;  4GPK A;  2IFU A;  3CKB A;  2UWJ G;  3LYA A;  4XI0 A;  5JJT A;  1QQE A;  2FI7 A;  2KCV A;  3ASG A;  2FO7 A;  3HYM B;  3Q47 B;  4GA1 A;  5FJY A;  3LY8 A;  5KJN A;  2NC9 A;  4UI9 C;  3FP3 A; 
#chains in the Genus database with same CATH topology
 5G05 J;  2DVW A;  5G04 C;  3UM0 A;  1X5B A;  4O6F A;  4AP2 A;  2VSO E;  4JHJ A;  4JEH A;  3LJN A;  3FH8 A;  4KZ0 A;  3CVN A;  3ML9 A;  2VSN A;  3B95 A;  5CRU A;  1SA4 A;  2WXO A;  4KXK B;  3FH7 A;  2LUH A;  4HRL A;  2IEJ A;  3E37 A;  3CKC A;  4RSY A;  3L08 A;  4CT0 A;  2Y3A A;  2C2L A;  1MQS A;  3ML8 A;  5HQ8 A;  4L2L A;  3ESK A;  3ZEF A;  3ZRH A;  3PRE A;  1IHG A;  2FF4 A;  3ABK E;  4NIK A;  5FZR A;  5LCW C;  4G26 A;  3J5Q B;  4HNA D;  3AAA C;  1HE8 A;  1NP7 A;  3DPD A;  1Z3X A;  2J09 A;  3FUH A;  1K1B A;  5ANL A;  3TWT A;  3LY7 A;  3MKQ B;  2PZI A;  1OWM A;  3L17 A;  4TUU A;  4JEU A;  4OYS A;  2PNN A;  4FU3 A;  4UWF A;  3AJI A;  3DSX A;  3ULY A;  2RD0 A;  3EIQ C;  1PC2 A;  1QZ2 A;  2PM7 A;  1LF8 A;  1H0A A;  2AXU A;  3RAU A;  4MS6 A;  3TAX A;  3C72 A;  2Y0B G;  3FTX A;  4HOU A;  5ENS D;  3RRN B;  4KYO B;  2XRY A;  3LY9 A;  3UMV A;  3BEE A;  4N39 A;  4K5B A;  3CKB A;  2UWJ G;  2V8S E;  2Y1L E;  4OAU C;  4GTP A;  4GB9 A;  3HXD A;  4DJA A;  3Q78 A;  4G23 A;  3TL5 A;  3L82 A;  4GZ5 A;  4BY6 A;  1S70 B;  2H6H A;  2WPV A;  1HZ4 A;  2DBA A;  3ULE G;  1DCE A;  3CHM A;  3UI2 A;  4NUR A;  4UUC A;  4JB8 P;  3WXX A;  2WMN A;  2JAB A;  2XZD G;  4PS8 A;  3B7U X;  4BES A;  1MX2 A;  2EQX A;  3DXM G;  2ZU6 B;  4L9P A;  1N0Q A;  2XS8 A;  5FZS A;  4LER A;  4I1A A;  5AAO A;  3PE4 A;  3FUM A;  4DI4 A;  5D0O D;  2P9U G;  4GZD A;  3D9N A;  2Y4T A;  3JUE A;  3RU0 A;  3SHF A;  4BEP A;  3SGH A;  4UQX A;  5ENN A;  3APD A;  4ACK A;  2FEZ A;  3HXF A;  1HG2 A;  1N4P A;  4JW1 A;  2EIJ E;  2JLB A;  4AOF A;  3CHS A;  5EIL A;  3UT4 A;  1AWC B;  1U3C A;  1H19 A;  2LXL A;  3V2X A;  5FQ4 A;  4X8Q A;  2KZT A;  2P9K G;  4N5Q A;  1NI1 A;  2OEV A;  3KEA A;  3ENE A;  2IOS A;  3ZXS A;  1KT1 A;  4UWK A;  2GRP B;  4XIF A;  4XKB A;  3ASH A;  1BD8 A;  3GZ1 A;  4JHK A;  4GYW A;  2WMO A;  2MOW A;  5A6C A;  4YVO A;  3PE3 A;  4YDW A;  1WDY A;  4Z68 A;  5FIN A;  2DIW A;  3TWR A;  5ENT D;  4KVM A;  2OND A;  3ABM E;  3FTS A;  3ISM C;  1K8K G;  3AG3 E;  2HYZ A;  1LTX A;  1A17 A;  3G2V A;  5LFA A;  4TUM A;  4JHR A;  1XNF A;  3FWV A;  1HH8 A;  2IJG X;  3SNX A;  2OEW A;  4I9C A;  3UUX A;  4IUL A;  4L23 A;  4UI9 J;  2QYJ A;  3FTW A;  4Q96 A;  4D10 C;  2RKK A;  4N2S A;  1YCS B;  4K0R A;  1D8D A;  2LSV A;  4U04 A;  4H7Y A;  1N52 A;  2ION A;  4APO A;  4J8E A;  2WVI A;  4G8L A;  2KCL A;  2RG8 A;  4I6E A;  2X6I A;  3FFL A;  1V54 E;  3FH5 A;  2VSY A;  1UJJ A;  2YQ8 A;  3PZD A;  1QBQ A;  3O4Z A;  3L22 A;  1EDU A;  2IFU A;  3Q7A A;  3HYM B;  2V4L A;  1MHQ A;  4HXI A;  1TR4 A;  4ANU A;  3S7D A;  4CDR A;  4DI3 A;  4HFG A;  2Q7F A;  4DX6 D;  3JCK C;  2F8Y A;  3CVY A;  3BU8 A;  4GTT A;  2XPY A;  1LD7 A;  3I5P A;  4ATZ D;  3V30 A;  1DNP A;  4EZJ A;  5T8I A;  2OOE A;  1MX6 A;  3ZYL A;  2VGX A;  3HG0 D;  4LEU A;  3B13 A;  1DCQ A;  1VDY A;  4AV7 A;  4CDN A;  2R02 A;  2KAT A;  4U0U A;  5B3S E;  2HO1 A;  5EYL A;  3CHO A;  3T5V A;  3J5P A;  3NQP A;  4JPS A;  3LPZ A;  2ZIS A;  4UWH A;  4Y6C A;  5FQ8 A;  5D66 A;  1HXI A;  5JJ6 A;  3NB2 A;  1ZB1 A;  4BSX A;  4AXH A;  5BV1 A;  3S2A A;  3TG4 A;  5JA4 D;  3PUJ A;  2QYU A;  1SQM A;  3FU5 A;  1OT8 A;  3CIA A;  3CVP A;  4WND A;  3ZW3 A;  3FU3 A;  2X6F A;  4AY6 A;  3NOG D;  4JZY A;  4K5A B;  2ETC A;  2AXV A;  5JHB A;  2XGM A;  2VYI A;  2XZT G;  1E96 B;  4KMO A;  4IYP A;  3B7S A;  3FEX A;  1N94 A;  2VTB A;  3LY8 A;  2NC9 A;  3FP3 A;  2XEN A;  2L6B A;  3CQG B;  3PVL A;  3UM3 A;  2XRZ A;  2CHZ A;  3UIP C;  4WAF A;  3VLF A;  4QQI A;  1FCH A;  3FU6 A;  2VTB B;  1S0P A;  4GTM A;  1E7U A;  1N54 A;  3Q4A B;  5AJL A;  4XZ4 A;  1NFI E;  5EDS A;  4F7A A;  1SVX A;  4G1T A;  2WXI A;  4HRN A;  3ZYQ A;  3ZVV A;  4HQD A;  2QC9 A;  2VGX B;  3D9P A;  4HOR A;  3FUN A;  4HI8 A;  4UQZ A;  3SD5 A;  3C3O A;  3ZXP A;  3IEG A;  2X6K A;  3QKY A;  4P29 A;  4J0U A;  2DYR E;  5BXO A;  3CEQ A;  3TXN A;  2P9L G;  4EBA A;  2Y69 E;  3AG2 E;  3FUL A;  4TXQ A;  4N3B A;  1JUQ A;  2NSZ A;  2WM9 A;  2WB2 A;  4ACL A;  4FC8 A;  3KAE A;  5HS0 A;  3VTY A;  4I6G A;  4GZ6 A;  3NZU A;  3UXG A;  4JA7 A;  1P5Q A;  4U0S A;  2L9B A;  4JC8 A;  2H6I A;  2X6H A;  3I4G A;  4AM9 A;  1UG3 A;  3FTV A;  3Q79 A;  2OCC E;  3T9K A;  3SBT B;  5KJL A;  3MZL B;  5BV0 A;  3MGB A;  4GCO A;  3LYA A;  3F6Q A;  4GA1 A;  4DX7 D;  3UIN C;  2CG2 A;  4GZC A;  3LDZ A;  4HRM B;  3NBN B;  3FUJ A;  5CBO A;  2A5E A;  3PUK A;  4OAV B;  4Y6W A;  4MKT A;  4A63 B;  2YNQ A;  4FHK A;  4K03 A;  5B1B E;  3V79 K;  2CHX A;  2BUG A;  1TYQ G;  4U7E B;  1YYH A;  5KJK A;  2CHW A;  4DPR A;  3TWX A;  3UM1 A;  4G11 A;  1N11 A;  5C2Y A;  3QJZ A;  5AQA A;  2HM8 A;  3CK7 A;  1TNY A;  5LOZ A;  2B6C A;  4B89 A;  1NA3 A;  3U4T A;  3VLD A;  3FTY A;  5HKP A;  3HDX A;  5D0Q D;  2JEK A;  4E6H A;  5CBN A;  3R7R A;  5ITZ F;  1IHB A;  1D8E A;  3D9H A;  3PEV B;  5FIO A;  2J9Q A;  3O48 A;  1X81 A;  1JPL A;  5EID A;  3AG1 E;  5B1A E;  4HLE A;  3ZU7 B;  3EHR A;  3Q47 B;  2WXK A;  4CEM A;  1H2U A;  3U64 A;  3SBS A;  2P2C P;  1JWF A;  4PDX A;  2EIL E;  4G2V A;  4EHM A;  4BER A;  4N3C A;  3BG1 B;  2PQN A;  3FEY A;  1E8Z A;  1H2T C;  3Q49 B;  4HOS A;  4LCT A;  5E76 A;  4B0Z A;  3LKU A;  4CZ2 D;  5J90 A;  2B0O E;  4J7W A;  3MCX A;  4J8Y A;  3D9J A;  3Q9U C;  4F1P A;  1GW6 A;  1XGW A;  4EQF A;  4CCA A;  5FQ6 A;  1UN8 A;  3L9T A;  2HR2 A;  1UJK A;  3HHM A;  4N5C A;  5BUZ A;  3TXM A;  4YND A;  5EN5 D;  1FVF A;  2UY1 B;  3PDN A;  5AEN A;  3ZUV B;  1IQR A;  3MKQ A;  4GTO A;  1FT1 A;  5AJD A;  3QWW A;  2MHK A;  3SZ7 A;  1O1S A;  1TNZ A;  1TJF A;  3UX4 A;  2V4H C;  4C0M A;  4EBA G;  1E90 A;  2P9I G;  3CSF A;  1TNB A;  1OCO E;  4K5C A;  3UKR G;  3RSE G;  5G05 C;  1ZBP A;  3CST A;  3E33 A;  3ZIM A;  5KCM A;  3P1U A;  2R5S A;  2XPI A;  4GPK A;  3FTU A;  3V31 A;  1SA5 A;  3DXK G;  1ELW A;  3Q9N C;  2LAI A;  4H7X A;  4DK5 A;  2XGS A;  3CHQ A;  4GZ3 A;  3U3W A;  5C1D A;  4CGV A;  1H6O A;  4G8K A;  3K9I A;  5CMW A;  3MV2 B;  2I2O A;  3RRU A;  3G2W A;  4URK A;  4ILH B;  1KLX A;  2R59 A;  1OWL A;  4E85 A;  1INZ A;  1UN9 A;  2VGY A;  3I4R B;  3DPY A;  3APF A;  5FT9 A;  4FA6 A;  5LP0 A;  4U8H A;  3D9O A;  3APC A;  4C48 B;  5FZQ A;  3LEW A;  5ARF A;  5AIJ A;  5CEC B;  2BF0 X;  1G3N B;  3NZS A;  3CQC B;  4A3T A;  5AYW D;  2VJ8 A;  2WQH A;  2J07 A;  4UWG A;  2BTD A;  2Y4U A;  3ZN3 A;  4BWR A;  2XPZ A;  3ZHE A;  4JD2 G;  4J8D A;  4EZK A;  3L54 A;  2CFZ A;  3DSW A;  3GZ2 A;  3ONK A;  3EU9 A;  2KC7 A;  4YVQ C;  3VLE A;  5LCW J;  3HXE A;  4DX5 D;  2J4B A;  5BNW A;  2LO6 A;  3CVW A;  5CER B;  3AS8 A;  5DBK A;  3ZNG A;  4XI0 A;  4L1B A;  3CVX A;  2J4D A;  1H6K A;  3OTN A;  2RFM A;  3U9W A;  2WXM A;  3B7B A;  4ATG A;  4B8A A;  3HIZ A;  3D9L A;  2GRL A;  2YHC A;  2XS1 A;  3PS6 A;  4ILI A;  2IOL A;  4RLY A;  4BET A;  4W9R A;  5EYP F;  2R03 A;  2XCB A;  2P9P G;  3Q15 A;  3Q73 A;  4O60 A;  3JYS A;  5AN8 A;  2FUL A;  4CT4 A;  3L16 A;  4JL0 A;  4U8V D;  4RVB A;  3IBE A;  3WG7 E;  2NYJ A;  4IRU A;  2P9N G;  4WWO A;  2PM6 A;  2AXZ A;  3T5X A;  1LD8 A;  4KZC A;  3SI5 A;  2V0P A;  1BI8 B;  1RZ4 A;  3C3R A;  1NL4 A;  4LNB A;  3DRA A;  2A5U A;  1TJC A;  3PZ2 A;  4LG6 A;  1IXV A;  1N4Q A;  3FUE A;  1IQU A;  4O1O A;  4NQ0 A;  1B89 A;  1IYG A;  1RW2 A;  3C3Q A;  4DX2 A;  2KCV A;  4CRW A;  5AQ7 A;  4TXP A;  5LX8 A;  3ABL E;  5D2M C;  4UQY A;  3OXF A;  5DIZ A;  1TNU A;  3ZPJ A;  1SW6 A;  1EPU A;  3E32 A;  2ETB A;  1W3B A;  3LVR E;  1TN7 A;  1BI7 B;  2R2L A;  3QWP A;  2J08 A;  5FQ7 A;  3FUD A;  3CVU A;  1OWO A;  3LVQ E;  5CED B;  3D3M A;  5AAR A;  2DYS E;  5EIB E;  1Z3Y A;  1UW4 B;  2AVP A;  3RIB A;  1BU9 A;  4A1G A;  3G2T A;  3V2O A;  3EIJ A;  3FU0 A;  2C0M A;  4ANW A;  1WAO 1;  2IY0 C;  3KSL A;  5A7D B;  4F53 A;  3S7J A;  1MYO A;  4HBD A;  5JHA A;  2AW6 A;  2WXJ A;  4FJZ A;  2ETA A;  3B7T A;  2WXH A;  1N0R A;  1O5M A;  1UOH A;  3RKV A;  3SF4 A;  3CV0 A;  4L2Y A;  2QFC A;  3OXL A;  3CR3 A;  4LRZ A;  3Q5M A;  3NF1 A;  5G04 J;  4A3V A;  5T4Y A;  3C5R A;  5CEA A;  5J08 A;  2ZIR A;  3CGH A;  1OCZ E;  3KEZ A;  2LXM A;  5CCM A;  1O1T A;  4JVS A;  1S64 A;  4FAD A;  1QYM A;  2GRM A;  5CHE E;  2V5Q C;  3DEO A;  1N9A A;  4DLO A;  4G25 A;  4U07 A;  3CK9 A;  3MV3 B;  4XE0 A;  4XX5 A;  3EJN A;  4HB5 A;  4RQI A;  1DVP A;  3TWQ A;  1OWP A;  4I43 A;  4EPZ A;  4EZL A;  3D9I A;  4FHJ A;  3ASN E;  3OAW A;  2DWZ A;  4HOT A;  2I9C A;  4EEC A;  4WWN A;  3CHR A;  2OVF A;  1NA0 A;  5FWQ A;  2IF4 A;  4I1O B;  4WNG A;  3TWW A;  1EF1 C;  3EDT B;  4OVV A;  1HG5 A;  4TV3 A;  5BW8 C;  1WG0 A;  4GA0 A;  2I1K A;  1TN8 A;  2H6F A;  3PRZ A;  3QK0 A;  4BTA A;  5ENR D;  2ZGD A;  3TWV A;  3AU5 A;  3EHQ A;  2IQC A;  1OY3 D;  2C0L A;  3DSU A;  3QC1 A;  4FJY A;  4ANV A;  2QY7 A;  5KWD A;  1NZN A;  3BG0 B;  4JXT A;  4A1S A;  3PNL B;  4LNU D;  2GGF A;  4NAC A;  4DX1 A;  2EIM E;  3U66 A;  3RJV A;  1KPS B;  1H6P A;  5FJY A;  4Q94 A;  4LSZ E;  4TRQ A;  4HLL A;  4ANX A;  4GYY A;  5EKQ D;  2MYO A;  2P58 C;  2QZA A;  5BPP A;  2VGE A;  2WXN A;  4KBQ A;  3T8K A;  5IY5 E;  2LNI A;  3PEU B;  2GRQ B;  4XI9 A;  5H7P A;  3C98 A;  1MZC A;  3JXJ A;  1QNF A;  1YA0 A;  5HI7 A;  4O1P A;  2DZO A;  3Q75 A;  2X38 A;  1JCR A;  4RG9 A;  4RG6 A;  2I6H A;  2XCC A;  3ULQ A;  4I6J A;  3QAQ A;  4V3I A;  5JJT A;  4CGW A;  3JXI A;  2GW1 A;  4N2Q A;  4B93 B;  2F37 A;  3HVE B;  2H6G A;  4HI9 A;  3MA5 A;  4KVO A;  2GRR B;  5KNG A;  2KZT B;  5KNH D;  1E7V A;  1HX8 A;  4GMR A;  4AIF A;  4BTB A;  1ELR A;  3GZS A;  2XHE A;  3BQO A;  4GA2 A;  1JCS A;  4BFR A;  1OCC E;  3EHM A;  1V55 E;  4WNE A;  2WXQ A;  1BPO A;  3UIO C;  3PH0 C;  1HFA A;  2J8S D;  4AJW A;  5EX3 A;  2CG3 A;  3BUA A;  4DLQ A;  3HRA A;  4DRX E;  1SZA A;  2FI7 A;  1OWN A;  3MJW A;  5ANR A;  3LS8 A;  1Z5S C;  3DSS A;  3UT7 A;  3QDN A;  3QOU A;  1OUV A;  4C0E A;  3S7F A;  3D9M A;  4B94 A;  2UY1 A;  2IO3 C;  4GYO A;  4NRH B;  1Z6T A;  4IN3 B;  1KZP A;  4HS2 A;  4HOQ A;  5JJ7 A;  4GTR A;  1Y8M A;  4UWL A;  4I17 A;  1HF8 A;  3CK8 A;  1BLX B;  3R9M A;  5M72 A;  3SFZ A;  3KSQ A;  2EIN E;  3GYZ A;  2GRN B;  3S7B A;  1ELK A;  1HO8 A;  4PS7 A;  2M63 A;  1H2V C;  1Q2Z A;  2L0T B;  3HVE A;  3PZ4 A;  2OVB A;  5T3R A;  2E2E A;  3TWS A;  1KZO A;  3UTM A;  2NXP A;  3ZYK A;  2XEH A;  3TG5 A;  5ENQ D;  2WQ7 A;  2DZN A;  3JQ1 A;  3HXB A;  4ZHB A;  1K1A A;  4I2Z A;  4U95 D;  1DC2 A;  4U63 A;  3LXU X;  3AU4 A;  3CVQ A;  3W9G A;  4G24 A;  3SFY A;  3RK6 A;  3T8M A;  4BT8 A;  2L6J A;  2IU1 A;  3ASD A;  3IXE A;  3R9A B;  4YDE A;  4LNG A;  2FO1 E;  2AWI A;  4R7L A;  2KCK A;  2KBX A;  4GML A;  1QQE A;  2BKG A;  3ASG A;  3PNT B;  4AY5 A;  3JUI A;  3UT8 A;  3HXC A;  3L6A A;  3ASF A;  3QNK A;  2XEV A;  4XEI G;  5AQ9 A;  3ZFW A;  4ABN A;  4MBG A;  1AP7 A;  2MRI A;  4N3A A;  2RFA A;  4FUL A;  2L0I A;  1MJ0 A;  4A55 A;  3URZ A;  1TEZ A;  4ME2 A;  5BXU A;  3FHE A;  1SZ9 A;  1OCR E;  3IHV A;  3RO3 A;  2KXP C;  2HE0 A;  3KD7 A;  2XGO A;  3I3N A;  3SQV A;  4M7C A;  3TWU A;  1FPP A;  1YMP A;  4J8F A;  5G2N A;  3ZYM A;  1HU3 A;  3ESL A;  3FUK A;  4ILG A;  3R7Q A;  2ZXW E;  3LCA A;  5G55 A;  1TNO A;  2WXF A;  3B7R L;  3JQ0 A;  3UQ3 A;  3SO8 A;  4I1M A;  4BX9 A;  3VTX A;  4GU5 A;  5CCL A;  5JMN D;  4Q69 A;  1JWG A;  3MX3 A;  5CMY A;  3UKU G;  2OV8 A;  4UI9 K;  2IO2 C;  4GTV A;  3W9F A;  2XQ0 A;  3MYV A;  4HVB A;  2F8X K;  3FUF A;  2LSU A;  4CYM D;  4WUY A;  2GRO B;  3E30 A;  3LJ3 A;  4FLB A;  1WY6 A;  4F1S A;  3DWL G;  2FO7 A;  3NOC D;  4FLH A;  4UI9 C;  3PZ1 A;  4GTS A;  2WXL A;  4GTQ A;  3E34 A;  3IKO B;  1OXJ A;  4F6R D;  2X6J A;  3FDH A;  3GW4 A;  3FY4 A;  4CDM A;  2XEE A;  2E0I A;  3EU5 A;  5AQB A;  4PS3 A;  1N4S A;  1IKN D;  2R17 C;  1K3Z D;  4ZFH A;  3EUV A;  1TN6 A;  1E8X A;  3FTZ A;  1N4R A;  4GAA A;  2VSX E;  2LAH A;  3IV0 A;  2J49 A;  5CRV A;  3L13 A;  1U3D A;  4I2W A;  4MLP A;  4U96 D;  2WXG A;  1N95 A;  3ZHE B;  4BT9 A;  3RO2 A;  5EX0 A;  3OXG A;  1A5E A;  3AS5 A;  3FUI A;  5ARG A;  4C9B B;  2PQR A;  3QWV A;  3CHP A;  2A4Z A;  1ZU2 A;  2FBN A;  3G2U A;  2KM4 A;  4FP7 A;  4I9E A;  2ILR A;  2BKK B;  3DSV A;  2VQ2 A;  4M3O A;  1S63 A;  4LUN U;  3N71 A;  4U8Y D;  2YHE A;  3TGO A;  1U2V G;  4L7T A;  1EYH A;  4YDY A;  2P9S G;  3MKR A;  4AEZ C;  2I1J A;  1JCQ A;  5KJN A;  3G2S A;  2WQ6 A;  2ZGG A;  1HS6 A;  3AS4 A;  3QAR A;  4QFV A;  5BT1 A;  4J8S A;  1KT0 A;  1FVH A;  5ENO D;  3TJP A;  4GMJ A;  1D9S A;  3ZGQ A;  4PUC A;  3EHN A;  4GCN A;  3Q7F A;  4APF A;  3P2B A;  3ASO E;  4PH4 B;  2WXP A;  4DUI A;  2YIN A;  2WXR A;  3DEP A;  2EIK E;  5KJM A;  2DCP A;  4U0Z A;  1FT2 A;  1WM5 A;  1E8W A;  3DST A;  3E4B A;  4TXR A;  2BED A;  2V5F A;  4JA9 A;  2PL2 A;  3RRM B;  4WNF A;  3X2Q E;  3SY2 A;  3IHY A;  5ENP D;  1PY1 A;  4AVX A;  3PZ3 A;  3CVL A;  4OVU A;  4MRU A;  5FTP A;  3UPV A;  3UM2 A;  5E75 A;  3KS2 A;  3SFX A;  2AJA A;  1L5J A;  3CLJ A;  3ZKJ A;  5A23 A;  3AG4 E;  4J6I A;  5KBA A;  3DBS A;  3QB2 A;  2F0Y A;  1PAQ A;  3NAW A;  4KT6 B;  3ONL A;  2X3M A;  3MEK A;  4B8C B;  4F3V A;  1E8Y A;  4YDO A;  2R05 A;  4BSZ B;  4WWP A;  4GPM A;  3D9K A;  3CVV A;  1Y6I A;  4BX8 A;  1O1R A;  4XKC A;  2CFU A;  1MX4 A;  5HRY A; 
#chains in the Genus database with same CATH homology
 2WXM A;  5G05 J;  3CQG B;  3PVL A;  5G04 C;  4ATG A;  4B8A A;  3HIZ A;  3D9L A;  1X5B A;  2XRZ A;  2CHZ A;  4O6F A;  2GRL A;  2YHC A;  3PS6 A;  4AP2 A;  2VSO E;  4WAF A;  4ILI A;  3UT7 A;  3VLF A;  2IOL A;  4JHJ A;  1FCH A;  3FU6 A;  2VTB B;  1S0P A;  3QDN A;  3QOU A;  4JEH A;  3FH8 A;  4W9R A;  4KZ0 A;  1OUV A;  1E7U A;  1N54 A;  3Q4A B;  5AJL A;  3CVN A;  4C0E A;  4XZ4 A;  3S7F A;  3ML9 A;  2XCB A;  3D9M A;  3Q15 A;  2VSN A;  5EDS A;  4B94 A;  4F7A A;  2UY1 A;  2WXO A;  3JYS A;  4GYO A;  4KXK B;  1Z6T A;  3FH7 A;  4NRH B;  4IN3 B;  4HOQ A;  4HS2 A;  4G1T A;  2FUL A;  2WXI A;  3ZYQ A;  3ZVV A;  4CT4 A;  5JJ7 A;  3CKC A;  1Y8M A;  4UWL A;  2VGX B;  4RSY A;  3D9P A;  3L16 A;  4I17 A;  1HF8 A;  4HOR A;  3L08 A;  3CK8 A;  3FUN A;  4JL0 A;  4CT0 A;  4UQZ A;  3SD5 A;  2Y3A A;  5M72 A;  3SFZ A;  3IEG A;  4RVB A;  2X6K A;  3IBE A;  3GYZ A;  2C2L A;  1MQS A;  3QKY A;  4IRU A;  3ML8 A;  4P29 A;  5HQ8 A;  4J0U A;  3S7B A;  1ELK A;  4L2L A;  4WWO A;  1HO8 A;  3ESK A;  2PM6 A;  4PS7 A;  2M63 A;  1H2V C;  2L0T B;  2AXZ A;  3ZEF A;  3ZRH A;  3CEQ A;  3T5X A;  3PRE A;  3TXN A;  3HVE A;  1IHG A;  2FF4 A;  2OVB A;  4EBA A;  5FZR A;  5LCW C;  5T3R A;  2E2E A;  4G26 A;  4KZC A;  2NXP A;  3FUL A;  3ZYK A;  4N3B A;  1HE8 A;  1JUQ A;  1NP7 A;  3TG5 A;  2NSZ A;  2WM9 A;  2WB2 A;  2WQ7 A;  3SI5 A;  2V0P A;  4ACL A;  3DPD A;  3JQ1 A;  4FC8 A;  3KAE A;  3VTY A;  1Z3X A;  4I6G A;  2J09 A;  3FUH A;  3NZU A;  4GZ6 A;  4I2Z A;  4JA7 A;  5ANL A;  1P5Q A;  2A5U A;  1TJC A;  3LY7 A;  3MKQ B;  2PZI A;  4U0S A;  4U63 A;  2L9B A;  3LXU X;  1OWM A;  4JC8 A;  3L17 A;  3AU4 A;  3CVQ A;  4G24 A;  3RK6 A;  4TUU A;  2X6H A;  3I4G A;  4JEU A;  3FUE A;  4OYS A;  1IQU A;  4AM9 A;  4FU3 A;  4UWF A;  3T8M A;  4BT8 A;  1UG3 A;  2L6J A;  4NQ0 A;  1B89 A;  3FTV A;  2RD0 A;  2IU1 A;  3ASD A;  3EIQ C;  1PC2 A;  1QZ2 A;  2PM7 A;  1LF8 A;  3R9A B;  3SBT B;  1H0A A;  3MZL B;  5BV0 A;  5KJL A;  2AXU A;  1IYG A;  4MS6 A;  3TAX A;  3FTX A;  4HOU A;  3MGB A;  3RRN B;  4KYO B;  2XRY A;  3LY9 A;  2AWI A;  3BEE A;  4GCO A;  4N39 A;  4R7L A;  3UMV A;  2KCK A;  4GML A;  3CKB A;  2UWJ G;  3LYA A;  1QQE A;  2KCV A;  3ASG A;  3PNT B;  2V8S E;  4GA1 A;  4AY5 A;  4CRW A;  3JUI A;  3UT8 A;  3L6A A;  3ASF A;  5LX8 A;  2CG2 A;  4GZC A;  3LDZ A;  3FUJ A;  3QNK A;  4GB9 A;  4UQY A;  2XEV A;  4DJA A;  4G23 A;  3OXF A;  3TL5 A;  3ZFW A;  5DIZ A;  3ZPJ A;  4ABN A;  4GZ5 A;  3PUK A;  4BY6 A;  1EPU A;  2MRI A;  4Y6W A;  4MKT A;  4N3A A;  4FUL A;  2WPV A;  1HZ4 A;  2DBA A;  2YNQ A;  2L0I A;  1W3B A;  4FHK A;  3LVR E;  3CHM A;  3QWP A;  2J08 A;  4NUR A;  5FQ7 A;  4K03 A;  3FUD A;  4A55 A;  3CVU A;  3URZ A;  1TEZ A;  4ME2 A;  1OWO A;  3WXX A;  3LVQ E;  2WMN A;  4PS8 A;  3B7U X;  1SZ9 A;  2CHX A;  3FHE A;  2BUG A;  2EQX A;  3D3M A;  3IHV A;  3RO3 A;  1Z3Y A;  1UW4 B;  2AVP A;  2ZU6 B;  5KJK A;  2CHW A;  3KD7 A;  3RIB A;  4DPR A;  4G11 A;  2XGO A;  3I3N A;  4A1G A;  5FZS A;  5C2Y A;  3QJZ A;  4LER A;  2HM8 A;  3G2T A;  3CK7 A;  4I1A A;  3EIJ A;  4J8F A;  3FU0 A;  5LOZ A;  5G2N A;  2C0M A;  3PE4 A;  4ANW A;  3ZYM A;  1WAO 1;  5A7D B;  4F53 A;  1HU3 A;  4B89 A;  1NA3 A;  3ESL A;  3FUM A;  3U4T A;  4DI4 A;  3FUK A;  5D0O D;  3S7J A;  4ILG A;  3VLD A;  3FTY A;  4GZD A;  3D9N A;  3HDX A;  3R7Q A;  5D0Q D;  2Y4T A;  3LCA A;  5JHA A;  2JEK A;  5G55 A;  2WXF A;  3RU0 A;  3B7R L;  3JQ0 A;  2AW6 A;  3UQ3 A;  4E6H A;  3R7R A;  4I1M A;  2WXJ A;  3SHF A;  4FJZ A;  3B7T A;  2WXH A;  4BX9 A;  3SGH A;  3VTX A;  4GU5 A;  4UQX A;  5ENN A;  3APD A;  5CCL A;  4ACK A;  3PEV B;  4Q69 A;  1JWG A;  2FEZ A;  3MX3 A;  5CMY A;  1HG2 A;  3RKV A;  3SF4 A;  3CV0 A;  4JW1 A;  4L2Y A;  2J9Q A;  2QFC A;  2OV8 A;  2JLB A;  3O48 A;  4UI9 K;  4AOF A;  3CHS A;  3OXL A;  3CR3 A;  4LRZ A;  3UT4 A;  1JPL A;  2XQ0 A;  3Q5M A;  1U3C A;  3MYV A;  1H19 A;  4HVB A;  3NF1 A;  5G04 J;  5FQ4 A;  1INZ A;  3FUF A;  2KZT A;  4A3V A;  5T4Y A;  2LSU A;  4WUY A;  4HLE A;  3LJ3 A;  4FLB A;  1WY6 A;  4F1S A;  5J08 A;  3Q47 B;  2FO7 A;  2WXK A;  3CGH A;  4CEM A;  4FLH A;  1H2U A;  4UI9 C;  3U64 A;  2WXL A;  3KEZ A;  3SBS A;  5CCM A;  4JVS A;  3IKO B;  3ENE A;  4FAD A;  1JWF A;  2X6J A;  3FDH A;  2IOS A;  3GW4 A;  4PDX A;  2GRM A;  5CHE E;  3ZXS A;  3FY4 A;  4DLO A;  4CDM A;  1KT1 A;  2E0I A;  4G25 A;  4G2V A;  4UWK A;  4N3C A;  4U07 A;  4XIF A;  3BG1 B;  4PS3 A;  4XKB A;  2R17 C;  2PQN A;  3CK9 A;  3ASH A;  3FEY A;  1E8Z A;  1H2T C;  3MV3 B;  3Q49 B;  4HOS A;  4LCT A;  3GZ1 A;  4XE0 A;  4JHK A;  4XX5 A;  4GYW A;  3EJN A;  2WMO A;  2MOW A;  1E8X A;  1DVP A;  5A6C A;  3FTZ A;  4GAA A;  4YVO A;  2VSX E;  5E76 A;  1OWP A;  4I43 A;  2LAH A;  3LKU A;  3PE3 A;  4B0Z A;  5J90 A;  3IV0 A;  4EPZ A;  4EZL A;  2DIW A;  3D9I A;  4FHJ A;  3OAW A;  3MCX A;  2J49 A;  4KVM A;  2OND A;  3D9J A;  3L13 A;  4HOT A;  1U3D A;  1GW6 A;  1XGW A;  2I9C A;  4I2W A;  4EEC A;  4EQF A;  4MLP A;  4WWN A;  3CHR A;  3FTS A;  4CCA A;  2OVF A;  1UN8 A;  2WXG A;  5FQ6 A;  1NA0 A;  2HR2 A;  1UJK A;  3HHM A;  4N5C A;  5FWQ A;  2IF4 A;  3ZHE B;  4BT9 A;  5BUZ A;  4I1O B;  4WNG A;  3RO2 A;  3TXM A;  4YND A;  1EF1 C;  2HYZ A;  5EX0 A;  3EDT B;  3OXG A;  1A17 A;  4OVV A;  1HG5 A;  1FVF A;  2UY1 B;  3AS5 A;  3G2V A;  3FUI A;  4TV3 A;  5ARG A;  3PDN A;  5BW8 C;  4C9B B;  5LFA A;  4JHR A;  4GA0 A;  2PQR A;  2I1K A;  3QWV A;  3CHP A;  2A4Z A;  1XNF A;  1ZU2 A;  3FWV A;  5AEN A;  1HH8 A;  2IJG X;  3PRZ A;  3QK0 A;  2FBN A;  4BTA A;  1IQR A;  3G2U A;  3SNX A;  2KM4 A;  4FP7 A;  4I9C A;  4I9E A;  2ILR A;  3AU5 A;  3MKQ A;  3UUX A;  5AJD A;  4IUL A;  4L23 A;  3QWW A;  2MHK A;  2IQC A;  4UI9 J;  3SZ7 A;  2C0L A;  3FTW A;  3QC1 A;  2VQ2 A;  4FJY A;  4ANV A;  4M3O A;  4Q96 A;  4D10 C;  4N2S A;  1TJF A;  4LUN U;  3UX4 A;  4K0R A;  4C0M A;  4EBA G;  1E90 A;  3CSF A;  2LSV A;  3N71 A;  4U04 A;  4H7Y A;  2QY7 A;  1N52 A;  2YHE A;  2ION A;  1NZN A;  4APO A;  3BG0 B;  4JXT A;  4A1S A;  3TGO A;  4J8E A;  2WVI A;  3PNL B;  4L7T A;  1EYH A;  2GGF A;  2KCL A;  2RG8 A;  4I6E A;  1ZBP A;  5G05 C;  4NAC A;  2X6I A;  3FFL A;  3FH5 A;  3CST A;  2VSY A;  3MKR A;  3ZIM A;  1UJJ A;  5KCM A;  3P1U A;  4AEZ C;  2YQ8 A;  3PZD A;  2R5S A;  2I1J A;  2XPI A;  3O4Z A;  3L22 A;  3RJV A;  3U66 A;  4GPK A;  1EDU A;  2IFU A;  3FTU A;  5KJN A;  3HYM B;  5FJY A;  4Q94 A;  4TRQ A;  3G2S A;  2V4L A;  2WQ6 A;  4ANX A;  1MHQ A;  4GYY A;  1HS6 A;  3AS4 A;  3QAR A;  4HXI A;  4QFV A;  4J8S A;  5EKQ D;  1ELW A;  5BT1 A;  1KT0 A;  2P58 C;  1FVH A;  5BPP A;  2LAI A;  4H7X A;  4ANU A;  3TJP A;  3S7D A;  4DK5 A;  2WXN A;  4CDR A;  4GMJ A;  4DI3 A;  3ZGQ A;  4KBQ A;  2XGS A;  4PUC A;  3EHN A;  4GCN A;  2LNI A;  3CHQ A;  3PEU B;  4GZ3 A;  4HFG A;  2Q7F A;  4APF A;  3U3W A;  4XI9 A;  5C1D A;  3P2B A;  3JCK C;  4CGV A;  3K9I A;  3CVY A;  5CMW A;  4PH4 B;  2WXP A;  2XPY A;  3I5P A;  2YIN A;  1DNP A;  2WXR A;  3MV2 B;  3C98 A;  2I2O A;  1QNF A;  1YA0 A;  4EZJ A;  5KJM A;  5HI7 A;  2OOE A;  5T8I A;  3RRU A;  2X38 A;  2VGX A;  3G2W A;  4LEU A;  2DCP A;  3ZYL A;  3B13 A;  4URK A;  1VDY A;  1KLX A;  2R59 A;  4ILH B;  4U0Z A;  4AV7 A;  4CDN A;  2KAT A;  1OWL A;  4RG9 A;  4E85 A;  1UN9 A;  1WM5 A;  1E8W A;  2I6H A;  2VGY A;  2HO1 A;  2XCC A;  4RG6 A;  3CHO A;  4U0U A;  3E4B A;  4I6J A;  3ULQ A;  3QAQ A;  3T5V A;  3I4R B;  4V3I A;  3APF A;  3NQP A;  4JPS A;  5FT9 A;  3LPZ A;  2V5F A;  5JJT A;  4JA9 A;  4CGW A;  2PL2 A;  3RRM B;  4WNF A;  4FA6 A;  5LP0 A;  4UWH A;  2GW1 A;  3IHY A;  4U8H A;  4Y6C A;  1PY1 A;  4N2Q A;  4AVX A;  3D9O A;  3HVE B;  3CVL A;  5FQ8 A;  4OVU A;  3MA5 A;  4MRU A;  5FTP A;  3UPV A;  1HXI A;  3APC A;  5FZQ A;  3LEW A;  5E75 A;  3KS2 A;  5ARF A;  4KVO A;  5JJ6 A;  1L5J A;  2KZT B;  4BSX A;  1E7V A;  2BF0 X;  3CLJ A;  5AIJ A;  3NZS A;  4AXH A;  1HX8 A;  3CQC B;  4AIF A;  4A3T A;  5BV1 A;  5AYW D;  3S2A A;  1ELR A;  4BTB A;  5A23 A;  3GZS A;  3TG4 A;  2VJ8 A;  2XHE A;  4GA2 A;  3PUJ A;  4J6I A;  3DBS A;  3QB2 A;  4BFR A;  1SQM A;  1PAQ A;  3FU5 A;  4KT6 B;  2WQH A;  2X3M A;  3CIA A;  2J07 A;  3EHM A;  3ONL A;  4UWG A;  2BTD A;  3CVP A;  4WNE A;  3MEK A;  4WND A;  3ZW3 A;  4B8C B;  4F3V A;  2WXQ A;  3FU3 A;  2X6F A;  2Y4U A;  1E8Y A;  3ZN3 A;  4AY6 A;  2XPZ A;  3ZHE A;  4BWR A;  1BPO A;  4J8D A;  4JZY A;  4EZK A;  3L54 A;  4WWP A;  2AXV A;  2CFZ A;  3GZ2 A;  3D9K A;  3ONK A;  3PH0 C;  5JHB A;  3CVV A;  2XGM A;  1Y6I A;  2KC7 A;  2VYI A;  4YVQ C;  1HFA A;  3VLE A;  5LCW J;  4AJW A;  2J4B A;  5EX3 A;  2CG3 A;  2LO6 A;  5BNW A;  3CVW A;  1E96 B;  3AS8 A;  4BX8 A;  4KMO A;  4DLQ A;  4IYP A;  3B7S A;  4XKC A;  5DBK A;  3FEX A;  4XI0 A;  1SZA A;  4L1B A;  2FI7 A;  2CFU A;  3CVX A;  2VTB A;  2J4D A;  1H6K A;  3OTN A;  1OWN A;  3LY8 A;  3MJW A;  5ANR A;  2NC9 A;  3LS8 A;  3U9W A;  3FP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...