3RO3A

Crystal structure of lgn/minscuteable complex
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
159
structure length
159
Chain Sequence
b'SRAAQGRAFGNLGNTHYLLGNFRDAVIAHEQRLLIAKEFGDKAAERIAYSNLGNAYIFLGEFETASEYYKKTLLLARQLKDRAVEAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIAQELKDRIGEGRACWSLGNAYTALGNHDQAMHFAEKHLEISREV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords G-protein-signaling modulator 2
publication title LGN/mInsc and LGN/NuMA complex structures suggest distinct functions in asymmetric cell division for the Par3/mInsc/LGN and G[alpha]i/LGN/NuMA pathways
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 74
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2011-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13176 TPR_7 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ro3A00
2AVPA 3IEGA 4WNDA 5A7DB 4CDRA 3S7FA 1KLXA 3LCAA 4GA2A 4WUYA 5G04J 3S7BA 3Q15A 4YVOA 1OUVA 2QFCA 5A6CA 3O48A 2UY1B 4GA0A 3QKYA 3FFLA 4NQ0A 3SZ7A 3ASGA 4AY6A 4YVQC 3KAEA 5FT9A 2VSNA 2GW1A 2PQRA 1W3BA 4AM9A 2FI7A 2VSYA 2KATA 4UI9K 3MV3B 3AS4A 4I2WA 4GYYA 3FP3A 4JA7A 3URZA 3SF4A 4G23A 4ME2A 3R9AB 3ASHA 4XI9A 1HZ4A 2VGYA 4G26A 1WM5A 1QQEA 5G05J 3GYZA 5EX0A 4U04A 3RO2A 5BNWA 3AS8A 5LCWJ 1WAO1 1KT1A 4BT9A 2J9QA 5CCLA 3RKVA 2FBNA 3OXGA 2KCKA 3LYAA 4AIFA 2XPIA 4LEUA 3CVQA 2KCVA 4G24A 1XNFA 2KC7A 4WNFA 1NZNA 1PC2A 2FF4A 4U07A 5KJKA 1YA0A 2IFUA 4APOA 3RIBA 2C2LA 4GYWA 2XCCA 4G25A 1HXIA 3UQ3A 4HOSA 2VYIA 5ARFA 5CCMA 1ELWA 2XGSA 2HR2A 3CK9A 2NC9A 1HH8A 2VGXA 3PE3A 4Y6WA 4H7XA 5DBKA 4YNDA 4RG9A 3MKRA 4JL0A 3GW4A 3OXFA 1P5QA 3NF1A 2L6JA 4J8DA 3UUXA 4UQYA 5FZSA 4HOUA 5M72A 3MA5A 3ZN3A 3FWVA 5CHEE 4GPKA 2HO1A 4N3CA 3OXLA 4N2SA 5FJYA 5JJ6A 2DBAA 2R5SA 3KS2A 2I6HA 2PZIA 4U0UA 3UPVA 4GCOA 4N5CA 4J0UA 2XGMA 4B94A 4HORA 4G1TA 2ONDA 2E2EA 1KT0A 2UWJG 5HI7A 5KJMA 3N71A 3VTYA 1ZU2A 5FTPA 5JJ7A 4CGWA 3Q5MA 4W9RA 4N2QA 1NA3A 5BW8C 4XI0A 5AYWD 1Y8MA 3MV2B 4GZ5A 5ARGA 5JJTA 5D0QD 1A17A 3QDNA 4JHRA 4N3AA 2FEZA 3QWVA 2LNIA 4F3VA 3CEQA 2YQ8A 3LY8A 4I9EA 3TGOA 4HOTA 4KYOB 5DIZA 2XEVA 4Y6CA 2P58C 2KCLA 2MHKA 2HYZA 2LSVA 3PE4A 3CKCA 3CVPA 4RG6A 2Y4UA 3WXXA 4H7YA 4NRHB 2C0MA 4I17A 3RJVA 4GA1A 3U4TA 2PL2A 2VQ2A 1E96B 4N39A 1B89A 4HOQA 4BTAA 2VGXB 4GZ3A 4GCNA 3GZ2A 2XCBA 1IYGA 5KJLA 3ZFWA 3S7JA 4U0SA 4O6FA 1IHGA 3S7DA 3RO3A 5HQ8A 3QWPA 2LSUA 2PQNA 4UQXA 2XGOA 3TG4A 4AY5A 3VTXA 4KXKB 3ZHEA 4J8FA 2Y4TA 4UI9C 5EX3A 3TG5A 3LPZA 4I9CA 2V5FA 3RU0A 3BEEA 3QOUA 4CGVA 3QWWA 3E4BA 4N3BA 3PDNA 4IN3B 3ZHEB 4BT8A 5G04C 4A1SA 3Q49B 1ZBPA 3LY9A 2BUGA 4U0ZA 4JA9A 3CKBA 4ABNA 3ASDA 3TAXA 5D0OD 4GYOA 3ULQA 3CK8A 1ELRA 3ZPJA 2OOEA 1TJCA 3HYMB 4BWRA 4I1AA 2IF4A 3CVLA 4KBQA 3EDTB 3Q47B 2YHCA 3LY7A 1FCHA 5FZQA 1QZ2A 2C0LA 3ASFA 3CK7A 2Q7FA 3JYSA 3MEKA 2WPVA 4I2ZA 4BTBA 4UQZA 3AS5A 4GZ6A 5EKQD 3Q4AB 5KJNA 2WQHA 2FO7A 1NA0A 5G05C 5LCWC 4WNGA 3K9IA 4XIFA 4EQFA 3ESKA 5FZRA 3LKUA 4G2VA 4WNEA 3U3WA 3GZ1A 3KD7A 3CVNA 3CV0A 5C1DA 4J8EA 3ZGQA 4UI9J 5BT1A 2UY1A 2JLBA
chains in the Genus database with same CATH superfamily
1Z3YA 4WWOA 3PEUB 3RSEG 5A7DB 3ZIMA 4CDRA 4J7WA 1XGWA 5D2MC 5B1AE 3EU5A 5G04J 3OAWA 1OUVA 2QFCA 5A6CA 4GA0A 3FU0A 3QKYA 4C9BB 1HX8A 3ASGA 3AU5A 2LO6A 3HVEA 2F8YA 3JXIA 1TNZA 5FT9A 2GW1A 3SGHA 4MRUA 4ILGA 1W3BA 3PUKA 4K03A 4AM9A 1KZOA 4JZYA 5HRYA 2KATA 3UIPC 4Q96A 4GAAA 3MV3B 1RZ4A 4K5AB 3QAQA 4GYYA 3ULYA 3FP3A 3ZYQA 4JA7A 2EIJE 3ASOE 1HG5A 3SF4A 1E8YA 3ASHA 3RK6A 1JWFA 5JHAA 1LD7A 1HZ4A 1OCRE 2VGYA 4PDXA 3GYZA 4U04A 5KWDA 3RRNB 3JCKC 2ZISA 2FBNA 3LYAA 4EBAG 3CVQA 2KC7A 3CSTA 1UJKA 4JW1A 1PC2A 4L1BA 1IKND 5KJKA 2IFUA 3RIBA 5ENQD 3LEWA 1INZA 4TXRA 4G25A 2EIME 2VYIA 3AG2E 2H6HA 1ELWA 3CK9A 3HRAA 4FHJA 4IRUA 4H7XA 3E32A 3MKRA 3TJPA 3HDXA 3GW4A 2R2LA 2ZIRA 3UM2A 1P5QA 3NF1A 1H6KA 1NL4A 2MOWA 2JEKA 4UQYA 5FZSA 2KZTB 4BX9A 2LAIA 5CBOA 5FQ8A 4GPKA 2HO1A 3V2OA 1FPPA 3OXLA 4N2SA 1OWOA 3W9FA 3HHMA 2DBAA 3D9PA 4HFGA 4U0UA 4ATZD 2XGMA 1JCQA 5FIOA 4CRWA 4HB5A 3Q9NC 2QY7A 3CVXA 4HBDA 5KNHD 1SW6A 2WXOA 2RD0A 2AXZA 5BV0A 4FA6A 3NOGD 3VTYA 1MX2A 1ZU2A 1PY1A 5JJ7A 4CGWA 4W9RA 4HVBA 1NA3A 3B7UX 5BW8C 3D9OA 3AG3E 3PEVB 5AYWD 4DI4A 3MKQB 5FINA 4GZ5A 5KNGA 1K8KG 4BETA 4EECA 3CLJA 2F8XK 3CHMA 1OY3D 1OCCE 2DYRE 2XHEA 4BERA 4ANUA 5CERB 3VLEA 4FULA 1A17A 5JMND 2A4ZA 3FTUA 2LNIA 2EQXA 4LRZA 3CEQA 4F53A 4EHMA 1BD8A 3G2TA 1S0PA 4F7AA 2XEVA 4DX7D 3UT4A 3DSTA 1TNOA 2MHKA 2JABA 5AJDA 3CHPA 3D9IA 4G8LA 5B3SE 1E8ZA 4LG6A 1NFIE 2QYJA 3QC1A 1IYGA 2J08A 1SA5A 2KXPC 4U0SA 5AJLA 3ZYLA 2WXLA 4ZHBA 4EZLA 3U9WA 1NI1A 3TG4A 3PZ4A 4GPMA 4PS3A 1IQRA 3KEAA 4RQIA 3LPZA 4TUUA 4GTMA 3QWWA 3E4BA 4YDWA 4AJWA 1TN8A 4N3BA 2NXPA 4LNGA 3V2XA 4CCAA 1UW4B 2OVFA 1ZBPA 2L0TB 3LY9A 3U66A 3LJNA 3G2UA 2P9PG 2Y1LE 3CK8A 4YDOA 4DJAA 5ENNA 4UUCA 3GZSA 3FUIA 4UWGA 3UIOC 3Q47B 2B6CA 3LY7A 1FCHA 2EIKE 1QZ2A 3FUEA 4JPSA 5J08A 3ASFA 3UKRG 3CK7A 3FUMA 3S2AA 3UT8A 4BTBA 3Q4AB 4FLBA 2VGEA 4CT4A 3PREA 1NA0A 5G05C 4HRNA 5ENOD 2WM9A 4X8QA 2AWIA 4ATGA 2XENA 3QARA 4MBGA 3K9IA 1DCQA 3FHEA 5CEDB 3ESKA 5ITZF 3LKUA 2P9NG 3U3WA 3HXEA 3KD7A 4MLPA 4CDNA 1TNUA 5C1DA 3I5PA 1E7VA 3G2WA 3IBEA 1QNFA 1EF1C 4LUNU 2J09A 1OXJA 3S7FA 1KLXA 4GA2A 4WUYA 3S7BA 1D9SA 4N5QA 3Q15A 2IO2C 3FH7A 3FUKA 4A3TA 1JCSA 3O48A 4BY6A 1MHQA 3JQ0A 1X5BA 2CG3A 4CDMA 2WXNA 4O1OA 4NQ0A 3PRZA 3HXBA 4AY6A 2VJ8A 1TNBA 1TR4A 5IY5E 1JWGA 1BU9A 1TEZA 2ZU6B 3I4RB 2WMOA 2X6FA 2FI7A 5LFAA 2DCPA 2L6BA 3MZLB 4UI9K 1TN6A 4P29A 3AS4A 4D10C 5G2NA 2ETCA 4G23A 4Q69A 2R05A 5G05J 1QQEA 5EX0A 3PVLA 3RO2A 5BNWA 4BSXA 3UM1A 1D8DA 3R7RA 2XPZA 1U2VG 3OXGA 2KCKA 4AIFA 1BPOA 1S64A 1A5EA 4E85A 3EIQC 2KCVA 4WWPA 2PM6A 5BV1A 2IQCA 1HF8A 1TNYA 3E34A 2P9UG 3ABME 2C2LA 2NSZA 4GYWA 2V4LA 4OVVA 2XCCA 5AN8A 3CHQA 1N4SA 5H7PA 3BG1B 5CCMA 3QB2A 2QYUA 1OWLA 2XGSA 2HR2A 2NC9A 3FH8A 4OAUC 4LCTA 2KZTA 2LAHA 3DSUA 5KCMA 5DBKA 2IY0C 2DZNA 1HE8A 3Q9UC 4JC8A 4PH4B 3D9JA 3UM3A 3ZXPA 5M72A 5AAOA 1MZCA 3DPYA 3LXUX 1SQMA 5BXOA 4AXHA 3ZN3A 4URKA 4GMRA 4HLLA 5CHEE 1H6PA 2X6KA 3KEZA 3UKUG 3ASNE 2J8SD 3PZ2A 2LXLA 3MYVA 3ZYMA 3KS2A 2PZIA 2L9BA 3FU6A 4GMJA 3B95A 3AJIA 3FUJA 4N5CA 3EHMA 4J0UA 4M3OA 1E8WA 4JD2G 4WWNA 1KT0A 3C5RA 3ZVVA 2V8SE 2ETAA 4B8AA 5KJMA 1Y6IA 2E0IA 1UN9A 2WVIA 3LS8A 3MKQA 5CRUA 1MX4A 4I6JA 1DCEA 3PZ3A 2DIWA 4XI0A 5ARGA 4ACLA 3C98A 4GTOA 3QDNA 5D66A 3SFXA 3T5XA 4F3VA 3LY8A 4FU3A 3MGBA 4HOTA 2LXMA 4XE0A 2KCLA 2P9LG 1O1TA 3PE4A 1HS6A 2CHWA 3O4ZA 3MJWA 4NRHB 1O5MA 3CHSA 1JCRA 3FEYA 4GA1A 3U4TA 3ENEA 4HOQA 3Q79A 3BUAA 4BTAA 4C0MA 3EHNA 4EBAA 4GCNA 5FQ6A 2XZDG 2AJAA 3KSLA 3HXCA 3FTYA 3QNKA 2X38A 5EYLA 3RO3A 3QWPA 4RSYA 3TWUA 4OVUA 2PQNA 2CG2A 4UQXA 1N95A 3DBSA 4UI9C 5EYPF 4KT6B 3TG5A 3EU9A 4ANVA 2GROB 4LNBA 4NURA 4DLOA 4BFRA 3ISMC 4GB9A 4K5CA 3NAWA 5FWQA 3PDNA 1BLXB 3B7TA 3J5PA 3FH5A 2ZXWE 4A1SA 4GTVA 3B7SA 2BUGA 4JA9A 4J8YA 2RG8A 2MYOA 3C3QA 5CECB 4U96D 1OT8A 2CFUA 1K1BA 1LF8A 3QJZA 3ZPJA 1X81A 1TJCA 1YMPA 3HYMB 4BWRA 5FQ7A 4I1AA 1N11A 4KBQA 1SA4A 1H2UA 2YHCA 2A5UA 4KMOA 2ZGGA 4GTTA 4A55A 2WPVA 3AS5A 4F6RD 4DRXE 4U7EB 3FULA 1UN8A 3VLFA 4GTQA 5LCWC 4JHKA 3DPDA 4XIFA 1IHBA 2WXMA 4FHKA 1WG0A 4WNEA 3TWXA 5AQAA 3CVNA 4J8EA 3L82A 4JVSA 4L7TA 4M7CA 4UI9J 2BF0X 3FUNA 3L54A 3NBNB 2JLBA 3IEGA 3D9KA 3TL5A 4WNDA 1UG3A 3CVYA 4U8YD 4B89A 1O1SA 2WXPA 3G2VA 2P9KG 4YVOA 4APFA 4UWLA 1DNPA 1SZ9A 3E33A 3LVQE 3JXJA 2UY1B 4GTPA 3AG4E 4MS6A 4CEMA 2IJGX 2J4DA 1MQSA 2I1JA 4PS8A 5EN5D 5AQ9A 4RLYA 1YYHA 3TWQA 4HXIA 2R59A 4YVQC 2BKGA 2MRIA 3KAEA 4K0RA 2DZOA 3FTSA 5BXUA 4PS7A 2J49A 2GRQB 2PQRA 3P1UA 3Q78A 4FC8A 1D8EA 3EHRA 4FLHA 2VSYA 2V4HC 1IQUA 4I2WA 3TXMA 4UWHA 2XS1A 3URZA 4J6IA 4UWKA 2LUHA 2X3MA 4ME2A 3UTMA 3JUIA 3ZYKA 1H2TC 3C3OA 5ANRA 4G26A 3SNXA 1WM5A 4B8CB 3VLDA 4R7LA 3FU3A 4U95D 4XKBA 5LCWJ 2NYJA 1WAO1 1KT1A 4KZCA 2J9QA 1G3NB 5CCLA 3L16A 3Q7AA 2J4BA 2XPIA 3HXFA 3KSQA 4DUIA 4G24A 4LNUD 3Q73A 5AARA 1FVFA 1NZNA 2XRYA 1GW6A 4U07A 1TYQG 1UJJA 4TXPA 5AENA 2YINA 1EDUA 2OV8A 4J8SA 4HOSA 5ENTD 1S63A 5ARFA 1EYHA 1N54A 1HH8A 4DX5D 4Y6WA 2EILE 3V30A 4RG9A 3G2SA 2BKKB 3HG0D 3CHOA 2P9SG 4XZ4A 3PH0C 3CVWA 4BX8A 3FDHA 2QC9A 2WXFA 3UUXA 4HOUA 4A63B 4ACKA 1U3DA 1LTXA 3MA5A 3NQPA 3FTWA 3ULEG 4TXQA 4JXTA 3D9HA 5BUZA 3U64A 5EILA 4EZJA 1SZAA 1N0RA 3FUHA 1E90A 5FJYA 5JJ6A 5LOZA 5AQ7A 4TRQA 4U8HA 5CEAA 3FTXA 3ML9A 3R9MA 3ABKE 3RAUA 2I6HA 4ILIA 2V5QC 3BG0B 4XEIG 4E6HA 4GCOA 3W9GA 2WXIA 2DWZA 4HORA 4G1TA 3DEPA 4GTSA 2E2EA 4L2YA 3L13A 4TUMA 5EIDA 3ONLA 2PM7A 3MX3A 4ANWA 4A1GA 1OCOE 4FADA 3C72A 4K5BA 2RFMA 5ANLA 2B0OE 3UXGA 4N2QA 3UI2A 2XRZA 2I1KA 4F1PA 4GZDA 4KZ0A 4TV3A 2ETBA 2OEWA 1Y8MA 3B13A 3MV2B 2PNNA 3RRMB 5KBAA 4GMLA 5JJTA 3SI5A 2CFZA 4CYMD 2P2CP 5ENPD 3TXNA 2BEDA 2VTBB 1JPLA 3DSVA 3FU5A 3DEOA 4XX5A 2J07A 5E75A 3D3MA 4JHRA 1OWMA 2GRPB 1ZB1A 2EINE 3TGOA 2F0YA 2WXQA 5DIZA 2WXRA 1OWPA 3C3RA 5ENSD 2P58C 2BTDA 4NIKA 2Y4UA 3WXXA 4H7YA 3HIZA 2C0MA 1N9AA 2WQ7A 2VQ2A 1WY6A 2FO1E 1E96B 3FUFA 3WG7E 1B89A 3MCXA 4GZ3A 3JQ1A 4GU5A 4JEHA 2GGFA 3DXKG 4DPRA 3S7DA 3E37A 1EPUA 1HG2A 5HQ8A 4KVOA 3PZ1A 4YDYA 2OVBA 2CHXA 3J5QB 1KPSB 4AY5A 1SVXA 4KXKB 1V55E 4IULA 3T9KA 2H6FA 4J8FA 5EX3A 1DC2A 4I9CA 2V5FA 3APDA 3RU0A 5LP0A 3UX4A 3QOUA 5C2YA 3B7BA 4IN3B 3ZHEB 2H6IA 4BESA 5BPPA 4KVMA 2HM8A 3NOCD 3CKBA 4ABNA 4HS2A 3SQVA 4GYOA 1HU3A 2HE0A 3TWVA 3APFA 2RKKA 2CHZA 1ELRA 4G11A 2OOEA 2Y69E 2R02A 3AAAC 4AOFA 2IOLA 2R03A 3IXEA 4C0EA 3EDTB 3TWWA 5FZQA 4I1OB 2C0LA 2P9IG 3CQCB 3ESLA 2VSOE 2Q7FA 4MKTA 4B0ZA 4UQZA 3JUEA 4GZ6A 2A5EA 3SFYA 4HRLA 1KZPA 2ZGDA 5KJNA 5JA4D 3IHYA 2FO7A 1JUQA 4WNGA 4LSZE 4HRMB 4GTRA 2IO3C 5FZRA 4DK5A 4JEUA 3GZ1A 2L0IA 3ZGQA 4HI9A 2RFAA 3NB2A 3QK0A 3ONKA 2UY1A 2AVPA 5CMYA 4PUCA 2XQ0A 3OTNA 3SBTB 1Z6TA 3LCAA 3UM0A 4DI3A 4NACA 2AXUA 1Q2ZA 1U3CA 4AP2A 3FFLA 1MYOA 1HFAA 4O60A 3SZ7A 2QZAA 1AP7A 5HKPA 1H0AA 2GRLA 4L2LA 5HS0A 1RW2A 4B93B 2VSNA 5LX8A 3CR3A 5J90A 3DSXA 3F6QA 3FTVA 1N4PA 3APCA 3HVEB 5CMWA 3B7RL 1K3ZD 3R9AB 3V31A 4XI9A 1DVPA 4ILHB 3BQOA 4FP7A 3ML8A 3PNLB 1E8XA 3AS8A 3ZEFA 4AVXA 3X2QE 3ZKJA 4BT9A 3ZRHA 3RKVA 4YDEA 3SD5A 1OWNA 3EIJA 4LEUA 4V3IA 1XNFA 4WNFA 1Z5SC 1AWCB 2FF4A 3AU4A 3CHRA 1YA0A 4APOA 4HLEA 3FTZA 3IHVA 3FUDA 4JHJA 2XEHA 3T8KA 2X6IA 2X6JA 3DRAA 3CSFA 2V0PA 1K1AA 1HXIA 3UQ3A 1H2VC 4BSZB 4HI8A 4I6EA 1E7UA 2IONA 2WB2A 1L5JA 5FQ4A 4EPZA 3PUJA 2F37A 2VGXA 3E30A 3PE3A 1TJFA 3ZU7B 4YNDA 5G55A 4JL0A 1BI8B 4BEPA 3OXFA 2L6JA 4J8DA 1FT1A 3L9TA 4I43A 1Z3XA 3EHQA 2WXKA 1NP7A 4EZKA 4FJZA 3T8MA 2IU1A 4HQDA 3FWVA 3CVUA 3ZW3A 1MX6A 4N3CA 4ZFHA 2ILRA 3D9LA 1OCZE 3UINC 2GRMA 2M63A 1MJ0A 2R5SA 4CT0A 3AG1E 5JHBA 3UPVA 3LVRE 3NZSA 4B94A 2VSXE 1TN7A 3DWLG 2XS8A 2ONDA 3L17A 2UWJG 5EDSA 5HI7A 5A23A 1BI7B 3RRUA 4ANXA 3SY2A 5CRVA 4DX2A 3V79K 1VDYA 4FJYA 5E76A 4L23A 3N71A 1FVHA 4F1SA 1HO8A 5B1BE 3D9MA 5FTPA 3L6AA 3EJNA 3Q5MA 2VTBA 1IXVA 2AXVA 1ELKA 4QQIA 1QBQA 3I3NA 3IV0A 2OCCE 4XKCA 3D9NA 3R7QA 4UWFA 4I6GA 2R17C 2Y3AA 5D0QD 5T8IA 4AEZC 1YCSB 4AV7A 4HNAD 4N3AA 2FEZA 3QWVA 3DXMG 3LDZA 5AIJA 4C48B 3ZUVB 2IOSA 2YQ8A 4I9EA 2IEJA 1UOHA 4KYOB 4Y6CA 3ABLE 2I9CA 3PNTB 2XZTG 2HYZA 2LSVA 3CKCA 3CVPA 3FY4A 4RG6A 4I17A 2H6GA 3RJVA 4RVBA 2DVWA 2PL2A 1N52A 2YNQA 3L22A 4N39A 5ENRD 4DX6D 2VGXB 2WXJA 2Y0BG 2GRNB 3GZ2A 2WXHA 2XCBA 5KJLA 1PAQA 1QYMA 3ZFWA 2X6HA 4O1PA 3S7JA 3T5VA 4O6FA 2WMNA 1IHGA 1LD8A 5T4YA 3CGHA 2LSUA 3L08A 2FULA 2XGOA 4A3VA 3VTXA 4OAVB 1H6OA 3SO8A 3ZHEA 2Y4TA 3SHFA 1FT2A 3BEEA 3P2BA 4CGVA 2YHEA 1N4QA 3TWRA 3CIAA 5EIBE 1S70B 3SBSA 4CZ2D 3ZNGA 4BT8A 5G04C 3Q49B 4LERA 4Z68A 4U0ZA 3BU8A 2I2OA 3TWTA 3ASDA 4I1MA 3TAXA 2XEEA 5D0OD 3ULQA 2GRRB 4QFVA 3LJ3A 3HXDA 3FEXA 1N4RA 3Q7FA 2WQ6A 3CVVA 2DYSE 4GZCA 3CQGB 1V54E 2IF4A 3CVLA 2KM4A 4L9PA 1H19A 2WXGA 3UMVA 1N0QA 4WAFA 4JB8P 5AQBA 3DSWA 3EUVA 4U8VD 3JYSA 3MEKA 3ZXSA 4I2ZA 2KBXA 4DLQA 5EKQD 2XPYA 4IYPA 2OEVA 2WQHA 3DSSA 1O1RA 3PS6A 4Q94A 4OYSA 1N94A 3TWSA 5T3RA 3IKOB 4EQFA 4G2VA 2AW6A 3PZDA 3CV0A 4U63A 4DX1A 1WDYA 3I4GA 3SFZA 3Q75A 4G8KA 3NZUA 3UT7A 5CBNA 5BT1A
chains in the Genus database with same CATH topology
2AVPA 1Z3YA 3IEGA 3D9KA 4WWOA 3TL5A 4WNDA 2J09A 3PEUB 5A7DB 3ZIMA 4CDRA 1UG3A 4PUCA 5CMYA 3CVYA 1XGWA 2XQ0A 3S7FA 4B89A 2WXPA 3OTNA 3SBTB 1Z6TA 1KLXA 3LCAA 4GA2A 3G2VA 4WUYA 4DI3A 5G04J 3S7BA 4NACA 3Q15A 3OAWA 4YVOA 1OUVA 4APFA 2AXUA 4UWLA 2QFCA 1DNPA 1SZ9A 1U3CA 3FH7A 5A6CA 3FUKA 3LVQE 4A3TA 3O48A 4BY6A 2UY1B 4MS6A 4GA0A 4AP2A 1MHQA 2IJGX 3FU0A 2J4DA 1MQSA 1X5BA 2I1JA 3JQ0A 2CG3A 3FFLA 3QKYA 4PS8A 4C9BB 1HFAA 4CDMA 2WXNA 1HX8A 4NQ0A 3SZ7A 3PRZA 4HXIA 2R59A 3ASGA 3AU5A 4AY6A 4YVQC 2LO6A 3HVEA 2VJ8A 2MRIA 3KAEA 1H0AA 4K0RA 2GRLA 4L2LA 5FT9A 5LX8A 2VSNA 2GW1A 3SGHA 4MRUA 3FTSA 1JWGA 4PS7A 2J49A 3CR3A 4ILGA 5J90A 1TEZA 2ZU6B 2PQRA 1W3BA 3PUKA 3P1UA 4K03A 3I4RB 3FTVA 4AM9A 2WMOA 4FC8A 2X6FA 4JZYA 4FLHA 2FI7A 2VSYA 5LFAA 2DCPA 2KATA 3APCA 3HVEB 3MZLB 5CMWA 4UI9K 4P29A 4GAAA 3MV3B 4Q96A 1IQUA 3AS4A 4I2WA 3TXMA 3B7RL 4D10C 3QAQA 4GYYA 4UWHA 3FP3A 3ZYQA 4JA7A 5G2NA 3URZA 4J6IA 1HG5A 4UWKA 2X3MA 3SF4A 4G23A 4ME2A 3R9AB 3JUIA 3ZYKA 1E8YA 3ASHA 4Q69A 3RK6A 1H2TC 1JWFA 5JHAA 4XI9A 1HZ4A 2VGYA 5ANRA 1DVPA 4G26A 4PDXA 3SNXA 1WM5A 1QQEA 4ILHB 4FP7A 4R7LA 5G05J 3GYZA 5EX0A 3FU3A 3VLDA 3PVLA 4U04A 3ML8A 3PNLB 4XKBA 3RO2A 5BNWA 1E8XA 4BSXA 3AS8A 5LCWJ 3ZEFA 4AVXA 1WAO1 3R7RA 1KT1A 3RRNB 2XPZA 3JCKC 4KZCA 4BT9A 2J9QA 5CCLA 3ZRHA 3L16A 3RKVA 3SD5A 2FBNA 3OXGA 2KCKA 3LYAA 1BPOA 4AIFA 1OWNA 2J4BA 2XPIA 3EIJA 4LEUA 4V3IA 4EBAG 3CVQA 3EIQC 2KCVA 4E85A 4G24A 1XNFA 2KC7A 4WNFA 4WWPA 3CSTA 1FVFA 1NZNA 1UJKA 2PM6A 4JW1A 1PC2A 2XRYA 5BV1A 2IQCA 1HF8A 2FF4A 1GW6A 4L1BA 4U07A 3AU4A 3CHRA 5KJKA 1YA0A 2IFUA 1UJJA 5AENA 4APOA 4HLEA 2YINA 3RIBA 3FTZA 3IHVA 3FUDA 4JHJA 2C2LA 3LEWA 2NSZA 1INZA 4GYWA 2V4LA 1EDUA 2X6IA 2X6JA 2OV8A 2XCCA 4OVVA 3CSFA 2V0PA 4G25A 1HXIA 3UQ3A 4J8SA 3CHQA 4HOSA 1H2VC 2VYIA 3BG1B 4I6EA 1E7UA 2IONA 5ARFA 5CCMA 1L5JA 5FQ4A 3QB2A 2WB2A 4EPZA 1EYHA 1N54A 1OWLA 3PUJA 1ELWA 2XGSA 2HR2A 3CK9A 2NC9A 4FHJA 1HH8A 3FH8A 2VGXA 3PE3A 4Y6WA 4LCTA 1TJFA 2KZTA 4IRUA 2LAHA 4H7XA 5KCMA 5DBKA 4YNDA 4RG9A 5G55A 3G2SA 3CHOA 3MKRA 4JL0A 3TJPA 3HDXA 3GW4A 4XZ4A 3PH0C 3CVWA 4BX8A 1HE8A 3OXFA 4JC8A 3FDHA 4PH4B 1P5QA 3D9JA 3NF1A 2L6JA 4J8DA 2WXFA 1H6KA 3UUXA 4I43A 2MOWA 1Z3XA 2JEKA 4UQYA 5FZSA 4HOUA 5M72A 4ACKA 2WXKA 1NP7A 1U3DA 2KZTB 4EZKA 4FJZA 3MA5A 3T8MA 4BX9A 3LXUX 3NQPA 1SQMA 4AXHA 2LAIA 2IU1A 3ZN3A 3FTWA 3FWVA 4JXTA 5BUZA 3U64A 4URKA 3CVUA 5CHEE 5FQ8A 4EZJA 4GPKA 2HO1A 1SZAA 2X6KA 3ZW3A 4N3CA 3FUHA 1E90A 2ILRA 3D9LA 3KEZA 3OXLA 5FJYA 4N2SA 1OWOA 5JJ6A 5LOZA 4TRQA 2GRMA 4U8HA 4B8CB 2M63A 3HHMA 3FTXA 2DBAA 3ML9A 3MYVA 2R5SA 3D9PA 3ZYMA 4CT0A 3KS2A 2I6HA 4ILIA 2PZIA 3BG0B 2L9BA 3FU6A 4HFGA 5JHBA 4U0UA 3UPVA 4GMJA 4E6HA 4GCOA 3LVRE 3NZSA 3FUJA 4N5CA 3EHMA 4J0UA 2WXIA 2XGMA 4B94A 2VSXE 4M3OA 4HORA 1E8WA 4G1TA 4WWNA 2ONDA 2E2EA 4L2YA 3L13A 1KT0A 3L17A 4CRWA 2UWJG 5EDSA 5HI7A 5A23A 3ZVVA 2V8SE 3RRUA 3ONLA 4ANXA 2PM7A 4B8AA 5KJMA 3MX3A 2QY7A 4ANWA 4A1GA 3CVXA 1VDYA 1Y6IA 4FADA 4FJYA 5E76A 2E0IA 4L23A 1UN9A 1FVHA 2WXOA 2WVIA 3N71A 4F1SA 2RD0A 3LS8A 3MKQA 2AXZA 5BV0A 4FA6A 1HO8A 3VTYA 4I6JA 5ANLA 1ZU2A 3D9MA 5FTPA 1PY1A 3L6AA 5JJ7A 3EJNA 4CGWA 3Q5MA 2VTBA 4W9RA 4HVBA 2AXVA 4N2QA 1NA3A 1ELKA 2DIWA 3B7UX 3D9OA 2I1KA 3I3NA 5BW8C 3PEVB 2XRZA 4GZDA 4KZ0A 4TV3A 3IV0A 4XI0A 5AYWD 4DI4A 1Y8MA 3B13A 3MKQB 3MV2B 4XKCA 4GZ5A 5ARGA 3RRMB 4EECA 3CLJA 3CHMA 4GMLA 5JJTA 3SI5A 2CFZA 2XHEA 3D9NA 3R7QA 4UWFA 3TXNA 4I6GA 4ACLA 4ANUA 2R17C 2Y3AA 2VTBB 1JPLA 3C98A 3VLEA 5D0QD 5T8IA 4AEZC 3FU5A 4FULA 1A17A 3QDNA 2A4ZA 4XX5A 2J07A 4AV7A 5E75A 3D3MA 3FTUA 4JHRA 1OWMA 4N3AA 2FEZA 3QWVA 3T5XA 2LNIA 2EQXA 4LRZA 4F3VA 3CEQA 4F53A 3LDZA 5AIJA 2IOSA 2YQ8A 3LY8A 4I9EA 4FU3A 2WXQA 3G2TA 1S0PA 3MGBA 4KYOB 5DIZA 2WXRA 2XEVA 4Y6CA 4F7AA 4HOTA 3UT4A 1OWPA 2I9CA 2P58C 3PNTB 4XE0A 2BTDA 2KCLA 2MHKA 5AJDA 2HYZA 2LSVA 3PE4A 3CHPA 1HS6A 2CHWA 3CKCA 3CVPA 3D9IA 3FY4A 3O4ZA 4RG6A 2Y4UA 3WXXA 3MJWA 4H7YA 3HIZA 4NRHB 3CHSA 3FEYA 2C0MA 1E8ZA 2WQ7A 4I17A 3RJVA 4GA1A 4RVBA 3U4TA 2PL2A 1N52A 2VQ2A 1WY6A 2YNQA 3L22A 1E96B 4N39A 3FUFA 3ENEA 1B89A 4HOQA 3MCXA 4BTAA 4C0MA 2VGXB 2WXJA 3QC1A 3EHNA 4GZ3A 4EBAA 4GCNA 3GZ2A 5FQ6A 2WXHA 2XCBA 1IYGA 3JQ1A 2J08A 5KJLA 1PAQA 3ZFWA 2X6HA 3T5VA 3S7JA 4GU5A 4JEHA 4U0SA 2GGFA 4O6FA 2WMNA 1IHGA 3FTYA 4DPRA 3QNKA 2X38A 5T4YA 3S7DA 3CGHA 5AJLA 1EPUA 1HG2A 3RO3A 5HQ8A 3QWPA 4KVOA 2LSUA 4RSYA 3L08A 3ZYLA 2WXLA 2FULA 4EZLA 3U9WA 2OVBA 2PQNA 2CG2A 2CHXA 4OVUA 4UQXA 2XGOA 3TG4A 4A3VA 4AY5A 3VTXA 4KXKB 1IQRA 4PS3A 4IULA 3ZHEA 4J8FA 2Y4TA 3DBSA 4UI9C 5EX3A 4KT6B 3TG5A 3SHFA 3LPZA 4TUUA 3TGOA 4ANVA 4I9CA 2V5FA 3APDA 4NURA 4DLOA 3RU0A 4BFRA 5LP0A 3BEEA 3UX4A 3P2BA 3QOUA 4CGVA 2YHEA 3QWWA 3E4BA 5C2YA 4AJWA 4GB9A 3CIAA 4N3BA 5FWQA 3SBSA 2NXPA 3PDNA 3B7TA 3FH5A 4IN3B 3ZHEB 4BT8A 5G04C 4A1SA 3Q49B 4CCAA 1UW4B 2OVFA 4KVMA 5BPPA 1ZBPA 2HM8A 2L0TB 3B7SA 4LERA 3LY9A 2BUGA 4U0ZA 4CEMA 4JA9A 3CKBA 2I2OA 3U66A 4ABNA 4HS2A 3G2UA 3ASDA 4I1MA 3TAXA 2RG8A 5D0OD 4GYOA 3ULQA 1HU3A 4QFVA 2CFUA 3APFA 3LJ3A 3CK8A 4DJAA 5ENNA 2CHZA 1ELRA 1LF8A 3FEXA 3QJZA 3ZPJA 3GZSA 2OOEA 4G11A 2WQ6A 3CVVA 1TJCA 3HYMB 3FUIA 4GZCA 4UWGA 3CQGB 4BWRA 4AOFA 2IOLA 5FQ7A 4I1AA 2IF4A 3CVLA 4C0EA 4KBQA 2KM4A 3EDTB 1H2UA 2YHCA 3Q47B 3LY7A 1FCHA 5FZQA 1H19A 2A5UA 4KMOA 2WXGA 4I1OB 1QZ2A 3FUEA 3UMVA 2C0LA 3CQCB 3ESLA 4WAFA 4JPSA 5J08A 2VSOE 3ASFA 4A55A 3CK7A 2Q7FA 3JYSA 3MEKA 3FUMA 4MKTA 3S2AA 2WPVA 3ZXSA 4B0ZA 4I2ZA 3UT8A 4BTBA 4UQZA 3AS5A 4DLQA 4GZ6A 5EKQD 3Q4AB 4FLBA 5KJNA 2XPYA 4CT4A 3FULA 3IHYA 3PREA 2WQHA 4IYPA 2FO7A 1NA0A 5G05C 1UN8A 2WM9A 3PS6A 1JUQA 2AWIA 3VLFA 4ATGA 4Q94A 4OYSA 5LCWC 3QARA 4WNGA 4JHKA 5T3RA 3K9IA 3IKOB 3DPDA 3FHEA 4XIFA 4EQFA 3ESKA 2WXMA 5FZRA 4DK5A 4FHKA 3LKUA 4G2VA 4WNEA 3U3WA 4JEUA 3GZ1A 3KD7A 2AW6A 4MLPA 3CVNA 3CV0A 3PZDA 4CDNA 3I5PA 4J8EA 4U63A 1E7VA 5C1DA 4JVSA 2L0IA 3I4GA 3ZGQA 3G2WA 3IBEA 1QNFA 1EF1C 4L7TA 4UI9J 2BF0X 3QK0A 3FUNA 3SFZA 3NZUA 4LUNU 3L54A 3ONKA 3UT7A 5BT1A 2UY1A 2JLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AVP A;  3IEG A;  4WND A;  5A7D B;  4CDR A;  3S7F A;  1KLX A;  3LCA A;  4GA2 A;  4WUY A;  5G04 J;  3S7B A;  3Q15 A;  4YVO A;  1OUV A;  2QFC A;  5A6C A;  3O48 A;  2UY1 B;  4GA0 A;  3QKY A;  3FFL A;  4NQ0 A;  3SZ7 A;  3ASG A;  4AY6 A;  4YVQ C;  3KAE A;  5FT9 A;  2VSN A;  2GW1 A;  2PQR A;  1W3B A;  4AM9 A;  2FI7 A;  2VSY A;  2KAT A;  4UI9 K;  3MV3 B;  3AS4 A;  4I2W A;  4GYY A;  3FP3 A;  4JA7 A;  3URZ A;  3SF4 A;  4G23 A;  4ME2 A;  3R9A B;  3ASH A;  4XI9 A;  1HZ4 A;  2VGY A;  4G26 A;  1WM5 A;  1QQE A;  5G05 J;  3GYZ A;  5EX0 A;  4U04 A;  3RO2 A;  5BNW A;  3AS8 A;  5LCW J;  1WAO 1;  1KT1 A;  4BT9 A;  2J9Q A;  5CCL A;  3RKV A;  2FBN A;  3OXG A;  2KCK A;  3LYA A;  4AIF A;  2XPI A;  4LEU A;  3CVQ A;  2KCV A;  4G24 A;  1XNF A;  2KC7 A;  4WNF A;  1NZN A;  1PC2 A;  2FF4 A;  4U07 A;  5KJK A;  1YA0 A;  2IFU A;  4APO A;  3RIB A;  2C2L A;  4GYW A;  2XCC A;  4G25 A;  1HXI A;  3UQ3 A;  4HOS A;  2VYI A;  5ARF A;  5CCM A;  1ELW A;  2XGS A;  2HR2 A;  3CK9 A;  2NC9 A;  1HH8 A;  2VGX A;  3PE3 A;  4Y6W A;  4H7X A;  5DBK A;  4YND A;  4RG9 A;  3MKR A;  4JL0 A;  3GW4 A;  3OXF A;  1P5Q A;  3NF1 A;  2L6J A;  4J8D A;  3UUX A;  4UQY A;  5FZS A;  4HOU A;  5M72 A;  3MA5 A;  3ZN3 A;  3FWV A;  5CHE E;  4GPK A;  2HO1 A;  4N3C A;  3OXL A;  4N2S A;  5FJY A;  5JJ6 A;  2DBA A;  2R5S A;  3KS2 A;  2I6H A;  2PZI A;  4U0U A;  3UPV A;  4GCO A;  4N5C A;  4J0U A;  2XGM A;  4B94 A;  4HOR A;  4G1T A;  2OND A;  2E2E A;  1KT0 A;  2UWJ G;  5HI7 A;  5KJM A;  3N71 A;  3VTY A;  1ZU2 A;  5FTP A;  5JJ7 A;  4CGW A;  3Q5M A;  4W9R A;  4N2Q A;  1NA3 A;  5BW8 C;  4XI0 A;  5AYW D;  1Y8M A;  3MV2 B;  4GZ5 A;  5ARG A;  5JJT A;  5D0Q D;  1A17 A;  3QDN A;  4JHR A;  4N3A A;  2FEZ A;  3QWV A;  2LNI A;  4F3V A;  3CEQ A;  2YQ8 A;  3LY8 A;  4I9E A;  3TGO A;  4HOT A;  4KYO B;  5DIZ A;  2XEV A;  4Y6C A;  2P58 C;  2KCL A;  2MHK A;  2HYZ A;  2LSV A;  3PE4 A;  3CKC A;  3CVP A;  4RG6 A;  2Y4U A;  3WXX A;  4H7Y A;  4NRH B;  2C0M A;  4I17 A;  3RJV A;  4GA1 A;  3U4T A;  2PL2 A;  2VQ2 A;  1E96 B;  4N39 A;  1B89 A;  4HOQ A;  4BTA A;  2VGX B;  4GZ3 A;  4GCN A;  3GZ2 A;  2XCB A;  1IYG A;  5KJL A;  3ZFW A;  3S7J A;  4U0S A;  4O6F A;  1IHG A;  3S7D A;  3RO3 A;  5HQ8 A;  3QWP A;  2LSU A;  2PQN A;  4UQX A;  2XGO A;  3TG4 A;  4AY5 A;  3VTX A;  4KXK B;  3ZHE A;  4J8F A;  2Y4T A;  4UI9 C;  5EX3 A;  3TG5 A;  3LPZ A;  4I9C A;  2V5F A;  3RU0 A;  3BEE A;  3QOU A;  4CGV A;  3QWW A;  3E4B A;  4N3B A;  3PDN A;  4IN3 B;  3ZHE B;  4BT8 A;  5G04 C;  4A1S A;  3Q49 B;  1ZBP A;  3LY9 A;  2BUG A;  4U0Z A;  4JA9 A;  3CKB A;  4ABN A;  3ASD A;  3TAX A;  5D0O D;  4GYO A;  3ULQ A;  3CK8 A;  1ELR A;  3ZPJ A;  2OOE A;  1TJC A;  3HYM B;  4BWR A;  4I1A A;  2IF4 A;  3CVL A;  4KBQ A;  3EDT B;  3Q47 B;  2YHC A;  3LY7 A;  1FCH A;  5FZQ A;  1QZ2 A;  2C0L A;  3ASF A;  3CK7 A;  2Q7F A;  3JYS A;  3MEK A;  2WPV A;  4I2Z A;  4BTB A;  4UQZ A;  3AS5 A;  4GZ6 A;  5EKQ D;  3Q4A B;  5KJN A;  2WQH A;  2FO7 A;  1NA0 A;  5G05 C;  5LCW C;  4WNG A;  3K9I A;  4XIF A;  4EQF A;  3ESK A;  5FZR A;  3LKU A;  4G2V A;  4WNE A;  3U3W A;  3GZ1 A;  3KD7 A;  3CVN A;  3CV0 A;  5C1D A;  4J8E A;  3ZGQ A;  4UI9 J;  5BT1 A;  2UY1 A;  2JLB A; 
#chains in the Genus database with same CATH topology
 1Z3Y A;  4WWO A;  3PEU B;  3RSE G;  5A7D B;  3ZIM A;  4CDR A;  4J7W A;  1XGW A;  5D2M C;  5B1A E;  3EU5 A;  5G04 J;  3OAW A;  1OUV A;  2QFC A;  5A6C A;  4GA0 A;  3FU0 A;  3QKY A;  4C9B B;  1HX8 A;  3ASG A;  3AU5 A;  2LO6 A;  3HVE A;  2F8Y A;  3JXI A;  1TNZ A;  5FT9 A;  2GW1 A;  3SGH A;  4MRU A;  4ILG A;  1W3B A;  3PUK A;  4K03 A;  4AM9 A;  1KZO A;  4JZY A;  5HRY A;  2KAT A;  3UIP C;  4Q96 A;  4GAA A;  3MV3 B;  1RZ4 A;  4K5A B;  3QAQ A;  4GYY A;  3ULY A;  3FP3 A;  3ZYQ A;  4JA7 A;  2EIJ E;  3ASO E;  1HG5 A;  3SF4 A;  1E8Y A;  3ASH A;  3RK6 A;  1JWF A;  5JHA A;  1LD7 A;  1HZ4 A;  1OCR E;  2VGY A;  4PDX A;  3GYZ A;  4U04 A;  5KWD A;  3RRN B;  3JCK C;  2ZIS A;  2FBN A;  3LYA A;  4EBA G;  3CVQ A;  2KC7 A;  3CST A;  1UJK A;  4JW1 A;  1PC2 A;  4L1B A;  1IKN D;  5KJK A;  2IFU A;  3RIB A;  5ENQ D;  3LEW A;  1INZ A;  4TXR A;  4G25 A;  2EIM E;  2VYI A;  3AG2 E;  2H6H A;  1ELW A;  3CK9 A;  3HRA A;  4FHJ A;  4IRU A;  4H7X A;  3E32 A;  3MKR A;  3TJP A;  3HDX A;  3GW4 A;  2R2L A;  2ZIR A;  3UM2 A;  1P5Q A;  3NF1 A;  1H6K A;  1NL4 A;  2MOW A;  2JEK A;  4UQY A;  5FZS A;  2KZT B;  4BX9 A;  2LAI A;  5CBO A;  5FQ8 A;  4GPK A;  2HO1 A;  3V2O A;  1FPP A;  3OXL A;  4N2S A;  1OWO A;  3W9F A;  3HHM A;  2DBA A;  3D9P A;  4HFG A;  4U0U A;  4ATZ D;  2XGM A;  1JCQ A;  5FIO A;  4CRW A;  4HB5 A;  3Q9N C;  2QY7 A;  3CVX A;  4HBD A;  5KNH D;  1SW6 A;  2WXO A;  2RD0 A;  2AXZ A;  5BV0 A;  4FA6 A;  3NOG D;  3VTY A;  1MX2 A;  1ZU2 A;  1PY1 A;  5JJ7 A;  4CGW A;  4W9R A;  4HVB A;  1NA3 A;  3B7U X;  5BW8 C;  3D9O A;  3AG3 E;  3PEV B;  5AYW D;  4DI4 A;  3MKQ B;  5FIN A;  4GZ5 A;  5KNG A;  1K8K G;  4BET A;  4EEC A;  3CLJ A;  2F8X K;  3CHM A;  1OY3 D;  1OCC E;  2DYR E;  2XHE A;  4BER A;  4ANU A;  5CER B;  3VLE A;  4FUL A;  1A17 A;  5JMN D;  2A4Z A;  3FTU A;  2LNI A;  2EQX A;  4LRZ A;  3CEQ A;  4F53 A;  4EHM A;  1BD8 A;  3G2T A;  1S0P A;  4F7A A;  2XEV A;  4DX7 D;  3UT4 A;  3DST A;  1TNO A;  2MHK A;  2JAB A;  5AJD A;  3CHP A;  3D9I A;  4G8L A;  5B3S E;  1E8Z A;  4LG6 A;  1NFI E;  2QYJ A;  3QC1 A;  1IYG A;  2J08 A;  1SA5 A;  2KXP C;  4U0S A;  5AJL A;  3ZYL A;  2WXL A;  4ZHB A;  4EZL A;  3U9W A;  1NI1 A;  3TG4 A;  3PZ4 A;  4GPM A;  4PS3 A;  1IQR A;  3KEA A;  4RQI A;  3LPZ A;  4TUU A;  4GTM A;  3QWW A;  3E4B A;  4YDW A;  4AJW A;  1TN8 A;  4N3B A;  2NXP A;  4LNG A;  3V2X A;  4CCA A;  1UW4 B;  2OVF A;  1ZBP A;  2L0T B;  3LY9 A;  3U66 A;  3LJN A;  3G2U A;  2P9P G;  2Y1L E;  3CK8 A;  4YDO A;  4DJA A;  5ENN A;  4UUC A;  3GZS A;  3FUI A;  4UWG A;  3UIO C;  3Q47 B;  2B6C A;  3LY7 A;  1FCH A;  2EIK E;  1QZ2 A;  3FUE A;  4JPS A;  5J08 A;  3ASF A;  3UKR G;  3CK7 A;  3FUM A;  3S2A A;  3UT8 A;  4BTB A;  3Q4A B;  4FLB A;  2VGE A;  4CT4 A;  3PRE A;  1NA0 A;  5G05 C;  4HRN A;  5ENO D;  2WM9 A;  4X8Q A;  2AWI A;  4ATG A;  2XEN A;  3QAR A;  4MBG A;  3K9I A;  1DCQ A;  3FHE A;  5CED B;  3ESK A;  5ITZ F;  3LKU A;  2P9N G;  3U3W A;  3HXE A;  3KD7 A;  4MLP A;  4CDN A;  1TNU A;  5C1D A;  3I5P A;  1E7V A;  3G2W A;  3IBE A;  1QNF A;  1EF1 C;  4LUN U;  2J09 A;  1OXJ A;  3S7F A;  1KLX A;  4GA2 A;  4WUY A;  3S7B A;  1D9S A;  4N5Q A;  3Q15 A;  2IO2 C;  3FH7 A;  3FUK A;  4A3T A;  1JCS A;  3O48 A;  4BY6 A;  1MHQ A;  3JQ0 A;  1X5B A;  2CG3 A;  4CDM A;  2WXN A;  4O1O A;  4NQ0 A;  3PRZ A;  3HXB A;  4AY6 A;  2VJ8 A;  1TNB A;  1TR4 A;  5IY5 E;  1JWG A;  1BU9 A;  1TEZ A;  2ZU6 B;  3I4R B;  2WMO A;  2X6F A;  2FI7 A;  5LFA A;  2DCP A;  2L6B A;  3MZL B;  4UI9 K;  1TN6 A;  4P29 A;  3AS4 A;  4D10 C;  5G2N A;  2ETC A;  4G23 A;  4Q69 A;  2R05 A;  5G05 J;  1QQE A;  5EX0 A;  3PVL A;  3RO2 A;  5BNW A;  4BSX A;  3UM1 A;  1D8D A;  3R7R A;  2XPZ A;  1U2V G;  3OXG A;  2KCK A;  4AIF A;  1BPO A;  1S64 A;  1A5E A;  4E85 A;  3EIQ C;  2KCV A;  4WWP A;  2PM6 A;  5BV1 A;  2IQC A;  1HF8 A;  1TNY A;  3E34 A;  2P9U G;  3ABM E;  2C2L A;  2NSZ A;  4GYW A;  2V4L A;  4OVV A;  2XCC A;  5AN8 A;  3CHQ A;  1N4S A;  5H7P A;  3BG1 B;  5CCM A;  3QB2 A;  2QYU A;  1OWL A;  2XGS A;  2HR2 A;  2NC9 A;  3FH8 A;  4OAU C;  4LCT A;  2KZT A;  2LAH A;  3DSU A;  5KCM A;  5DBK A;  2IY0 C;  2DZN A;  1HE8 A;  3Q9U C;  4JC8 A;  4PH4 B;  3D9J A;  3UM3 A;  3ZXP A;  5M72 A;  5AAO A;  1MZC A;  3DPY A;  3LXU X;  1SQM A;  5BXO A;  4AXH A;  3ZN3 A;  4URK A;  4GMR A;  4HLL A;  5CHE E;  1H6P A;  2X6K A;  3KEZ A;  3UKU G;  3ASN E;  2J8S D;  3PZ2 A;  2LXL A;  3MYV A;  3ZYM A;  3KS2 A;  2PZI A;  2L9B A;  3FU6 A;  4GMJ A;  3B95 A;  3AJI A;  3FUJ A;  4N5C A;  3EHM A;  4J0U A;  4M3O A;  1E8W A;  4JD2 G;  4WWN A;  1KT0 A;  3C5R A;  3ZVV A;  2V8S E;  2ETA A;  4B8A A;  5KJM A;  1Y6I A;  2E0I A;  1UN9 A;  2WVI A;  3LS8 A;  3MKQ A;  5CRU A;  1MX4 A;  4I6J A;  1DCE A;  3PZ3 A;  2DIW A;  4XI0 A;  5ARG A;  4ACL A;  3C98 A;  4GTO A;  3QDN A;  5D66 A;  3SFX A;  3T5X A;  4F3V A;  3LY8 A;  4FU3 A;  3MGB A;  4HOT A;  2LXM A;  4XE0 A;  2KCL A;  2P9L G;  1O1T A;  3PE4 A;  1HS6 A;  2CHW A;  3O4Z A;  3MJW A;  4NRH B;  1O5M A;  3CHS A;  1JCR A;  3FEY A;  4GA1 A;  3U4T A;  3ENE A;  4HOQ A;  3Q79 A;  3BUA A;  4BTA A;  4C0M A;  3EHN A;  4EBA A;  4GCN A;  5FQ6 A;  2XZD G;  2AJA A;  3KSL A;  3HXC A;  3FTY A;  3QNK A;  2X38 A;  5EYL A;  3RO3 A;  3QWP A;  4RSY A;  3TWU A;  4OVU A;  2PQN A;  2CG2 A;  4UQX A;  1N95 A;  3DBS A;  4UI9 C;  5EYP F;  4KT6 B;  3TG5 A;  3EU9 A;  4ANV A;  2GRO B;  4LNB A;  4NUR A;  4DLO A;  4BFR A;  3ISM C;  4GB9 A;  4K5C A;  3NAW A;  5FWQ A;  3PDN A;  1BLX B;  3B7T A;  3J5P A;  3FH5 A;  2ZXW E;  4A1S A;  4GTV A;  3B7S A;  2BUG A;  4JA9 A;  4J8Y A;  2RG8 A;  2MYO A;  3C3Q A;  5CEC B;  4U96 D;  1OT8 A;  2CFU A;  1K1B A;  1LF8 A;  3QJZ A;  3ZPJ A;  1X81 A;  1TJC A;  1YMP A;  3HYM B;  4BWR A;  5FQ7 A;  4I1A A;  1N11 A;  4KBQ A;  1SA4 A;  1H2U A;  2YHC A;  2A5U A;  4KMO A;  2ZGG A;  4GTT A;  4A55 A;  2WPV A;  3AS5 A;  4F6R D;  4DRX E;  4U7E B;  3FUL A;  1UN8 A;  3VLF A;  4GTQ A;  5LCW C;  4JHK A;  3DPD A;  4XIF A;  1IHB A;  2WXM A;  4FHK A;  1WG0 A;  4WNE A;  3TWX A;  5AQA A;  3CVN A;  4J8E A;  3L82 A;  4JVS A;  4L7T A;  4M7C A;  4UI9 J;  2BF0 X;  3FUN A;  3L54 A;  3NBN B;  2JLB A;  3IEG A;  3D9K A;  3TL5 A;  4WND A;  1UG3 A;  3CVY A;  4U8Y D;  4B89 A;  1O1S A;  2WXP A;  3G2V A;  2P9K G;  4YVO A;  4APF A;  4UWL A;  1DNP A;  1SZ9 A;  3E33 A;  3LVQ E;  3JXJ A;  2UY1 B;  4GTP A;  3AG4 E;  4MS6 A;  4CEM A;  2IJG X;  2J4D A;  1MQS A;  2I1J A;  4PS8 A;  5EN5 D;  5AQ9 A;  4RLY A;  1YYH A;  3TWQ A;  4HXI A;  2R59 A;  4YVQ C;  2BKG A;  2MRI A;  3KAE A;  4K0R A;  2DZO A;  3FTS A;  5BXU A;  4PS7 A;  2J49 A;  2GRQ B;  2PQR A;  3P1U A;  3Q78 A;  4FC8 A;  1D8E A;  3EHR A;  4FLH A;  2VSY A;  2V4H C;  1IQU A;  4I2W A;  3TXM A;  4UWH A;  2XS1 A;  3URZ A;  4J6I A;  4UWK A;  2LUH A;  2X3M A;  4ME2 A;  3UTM A;  3JUI A;  3ZYK A;  1H2T C;  3C3O A;  5ANR A;  4G26 A;  3SNX A;  1WM5 A;  4B8C B;  3VLD A;  4R7L A;  3FU3 A;  4U95 D;  4XKB A;  5LCW J;  2NYJ A;  1WAO 1;  1KT1 A;  4KZC A;  2J9Q A;  1G3N B;  5CCL A;  3L16 A;  3Q7A A;  2J4B A;  2XPI A;  3HXF A;  3KSQ A;  4DUI A;  4G24 A;  4LNU D;  3Q73 A;  5AAR A;  1FVF A;  1NZN A;  2XRY A;  1GW6 A;  4U07 A;  1TYQ G;  1UJJ A;  4TXP A;  5AEN A;  2YIN A;  1EDU A;  2OV8 A;  4J8S A;  4HOS A;  5ENT D;  1S63 A;  5ARF A;  1EYH A;  1N54 A;  1HH8 A;  4DX5 D;  4Y6W A;  2EIL E;  3V30 A;  4RG9 A;  3G2S A;  2BKK B;  3HG0 D;  3CHO A;  2P9S G;  4XZ4 A;  3PH0 C;  3CVW A;  4BX8 A;  3FDH A;  2QC9 A;  2WXF A;  3UUX A;  4HOU A;  4A63 B;  4ACK A;  1U3D A;  1LTX A;  3MA5 A;  3NQP A;  3FTW A;  3ULE G;  4TXQ A;  4JXT A;  3D9H A;  5BUZ A;  3U64 A;  5EIL A;  4EZJ A;  1SZA A;  1N0R A;  3FUH A;  1E90 A;  5FJY A;  5JJ6 A;  5LOZ A;  5AQ7 A;  4TRQ A;  4U8H A;  5CEA A;  3FTX A;  3ML9 A;  3R9M A;  3ABK E;  3RAU A;  2I6H A;  4ILI A;  2V5Q C;  3BG0 B;  4XEI G;  4E6H A;  4GCO A;  3W9G A;  2WXI A;  2DWZ A;  4HOR A;  4G1T A;  3DEP A;  4GTS A;  2E2E A;  4L2Y A;  3L13 A;  4TUM A;  5EID A;  3ONL A;  2PM7 A;  3MX3 A;  4ANW A;  4A1G A;  1OCO E;  4FAD A;  3C72 A;  4K5B A;  2RFM A;  5ANL A;  2B0O E;  3UXG A;  4N2Q A;  3UI2 A;  2XRZ A;  2I1K A;  4F1P A;  4GZD A;  4KZ0 A;  4TV3 A;  2ETB A;  2OEW A;  1Y8M A;  3B13 A;  3MV2 B;  2PNN A;  3RRM B;  5KBA A;  4GML A;  5JJT A;  3SI5 A;  2CFZ A;  4CYM D;  2P2C P;  5ENP D;  3TXN A;  2BED A;  2VTB B;  1JPL A;  3DSV A;  3FU5 A;  3DEO A;  4XX5 A;  2J07 A;  5E75 A;  3D3M A;  4JHR A;  1OWM A;  2GRP B;  1ZB1 A;  2EIN E;  3TGO A;  2F0Y A;  2WXQ A;  5DIZ A;  2WXR A;  1OWP A;  3C3R A;  5ENS D;  2P58 C;  2BTD A;  4NIK A;  2Y4U A;  3WXX A;  4H7Y A;  3HIZ A;  2C0M A;  1N9A A;  2WQ7 A;  2VQ2 A;  1WY6 A;  2FO1 E;  1E96 B;  3FUF A;  3WG7 E;  1B89 A;  3MCX A;  4GZ3 A;  3JQ1 A;  4GU5 A;  4JEH A;  2GGF A;  3DXK G;  4DPR A;  3S7D A;  3E37 A;  1EPU A;  1HG2 A;  5HQ8 A;  4KVO A;  3PZ1 A;  4YDY A;  2OVB A;  2CHX A;  3J5Q B;  1KPS B;  4AY5 A;  1SVX A;  4KXK B;  1V55 E;  4IUL A;  3T9K A;  2H6F A;  4J8F A;  5EX3 A;  1DC2 A;  4I9C A;  2V5F A;  3APD A;  3RU0 A;  5LP0 A;  3UX4 A;  3QOU A;  5C2Y A;  3B7B A;  4IN3 B;  3ZHE B;  2H6I A;  4BES A;  5BPP A;  4KVM A;  2HM8 A;  3NOC D;  3CKB A;  4ABN A;  4HS2 A;  3SQV A;  4GYO A;  1HU3 A;  2HE0 A;  3TWV A;  3APF A;  2RKK A;  2CHZ A;  1ELR A;  4G11 A;  2OOE A;  2Y69 E;  2R02 A;  3AAA C;  4AOF A;  2IOL A;  2R03 A;  3IXE A;  4C0E A;  3EDT B;  3TWW A;  5FZQ A;  4I1O B;  2C0L A;  2P9I G;  3CQC B;  3ESL A;  2VSO E;  2Q7F A;  4MKT A;  4B0Z A;  4UQZ A;  3JUE A;  4GZ6 A;  2A5E A;  3SFY A;  4HRL A;  1KZP A;  2ZGD A;  5KJN A;  5JA4 D;  3IHY A;  2FO7 A;  1JUQ A;  4WNG A;  4LSZ E;  4HRM B;  4GTR A;  2IO3 C;  5FZR A;  4DK5 A;  4JEU A;  3GZ1 A;  2L0I A;  3ZGQ A;  4HI9 A;  2RFA A;  3NB2 A;  3QK0 A;  3ONK A;  2UY1 A;  2AVP A;  5CMY A;  4PUC A;  2XQ0 A;  3OTN A;  3SBT B;  1Z6T A;  3LCA A;  3UM0 A;  4DI3 A;  4NAC A;  2AXU A;  1Q2Z A;  1U3C A;  4AP2 A;  3FFL A;  1MYO A;  1HFA A;  4O60 A;  3SZ7 A;  2QZA A;  1AP7 A;  5HKP A;  1H0A A;  2GRL A;  4L2L A;  5HS0 A;  1RW2 A;  4B93 B;  2VSN A;  5LX8 A;  3CR3 A;  5J90 A;  3DSX A;  3F6Q A;  3FTV A;  1N4P A;  3APC A;  3HVE B;  5CMW A;  3B7R L;  1K3Z D;  3R9A B;  3V31 A;  4XI9 A;  1DVP A;  4ILH B;  3BQO A;  4FP7 A;  3ML8 A;  3PNL B;  1E8X A;  3AS8 A;  3ZEF A;  4AVX A;  3X2Q E;  3ZKJ A;  4BT9 A;  3ZRH A;  3RKV A;  4YDE A;  3SD5 A;  1OWN A;  3EIJ A;  4LEU A;  4V3I A;  1XNF A;  4WNF A;  1Z5S C;  1AWC B;  2FF4 A;  3AU4 A;  3CHR A;  1YA0 A;  4APO A;  4HLE A;  3FTZ A;  3IHV A;  3FUD A;  4JHJ A;  2XEH A;  3T8K A;  2X6I A;  2X6J A;  3DRA A;  3CSF A;  2V0P A;  1K1A A;  1HXI A;  3UQ3 A;  1H2V C;  4BSZ B;  4HI8 A;  4I6E A;  1E7U A;  2ION A;  2WB2 A;  1L5J A;  5FQ4 A;  4EPZ A;  3PUJ A;  2F37 A;  2VGX A;  3E30 A;  3PE3 A;  1TJF A;  3ZU7 B;  4YND A;  5G55 A;  4JL0 A;  1BI8 B;  4BEP A;  3OXF A;  2L6J A;  4J8D A;  1FT1 A;  3L9T A;  4I43 A;  1Z3X A;  3EHQ A;  2WXK A;  1NP7 A;  4EZK A;  4FJZ A;  3T8M A;  2IU1 A;  4HQD A;  3FWV A;  3CVU A;  3ZW3 A;  1MX6 A;  4N3C A;  4ZFH A;  2ILR A;  3D9L A;  1OCZ E;  3UIN C;  2GRM A;  2M63 A;  1MJ0 A;  2R5S A;  4CT0 A;  3AG1 E;  5JHB A;  3UPV A;  3LVR E;  3NZS A;  4B94 A;  2VSX E;  1TN7 A;  3DWL G;  2XS8 A;  2OND A;  3L17 A;  2UWJ G;  5EDS A;  5HI7 A;  5A23 A;  1BI7 B;  3RRU A;  4ANX A;  3SY2 A;  5CRV A;  4DX2 A;  3V79 K;  1VDY A;  4FJY A;  5E76 A;  4L23 A;  3N71 A;  1FVH A;  4F1S A;  1HO8 A;  5B1B E;  3D9M A;  5FTP A;  3L6A A;  3EJN A;  3Q5M A;  2VTB A;  1IXV A;  2AXV A;  1ELK A;  4QQI A;  1QBQ A;  3I3N A;  3IV0 A;  2OCC E;  4XKC A;  3D9N A;  3R7Q A;  4UWF A;  4I6G A;  2R17 C;  2Y3A A;  5D0Q D;  5T8I A;  4AEZ C;  1YCS B;  4AV7 A;  4HNA D;  4N3A A;  2FEZ A;  3QWV A;  3DXM G;  3LDZ A;  5AIJ A;  4C48 B;  3ZUV B;  2IOS A;  2YQ8 A;  4I9E A;  2IEJ A;  1UOH A;  4KYO B;  4Y6C A;  3ABL E;  2I9C A;  3PNT B;  2XZT G;  2HYZ A;  2LSV A;  3CKC A;  3CVP A;  3FY4 A;  4RG6 A;  4I17 A;  2H6G A;  3RJV A;  4RVB A;  2DVW A;  2PL2 A;  1N52 A;  2YNQ A;  3L22 A;  4N39 A;  5ENR D;  4DX6 D;  2VGX B;  2WXJ A;  2Y0B G;  2GRN B;  3GZ2 A;  2WXH A;  2XCB A;  5KJL A;  1PAQ A;  1QYM A;  3ZFW A;  2X6H A;  4O1P A;  3S7J A;  3T5V A;  4O6F A;  2WMN A;  1IHG A;  1LD8 A;  5T4Y A;  3CGH A;  2LSU A;  3L08 A;  2FUL A;  2XGO A;  4A3V A;  3VTX A;  4OAV B;  1H6O A;  3SO8 A;  3ZHE A;  2Y4T A;  3SHF A;  1FT2 A;  3BEE A;  3P2B A;  4CGV A;  2YHE A;  1N4Q A;  3TWR A;  3CIA A;  5EIB E;  1S70 B;  3SBS A;  4CZ2 D;  3ZNG A;  4BT8 A;  5G04 C;  3Q49 B;  4LER A;  4Z68 A;  4U0Z A;  3BU8 A;  2I2O A;  3TWT A;  3ASD A;  4I1M A;  3TAX A;  2XEE A;  5D0O D;  3ULQ A;  2GRR B;  4QFV A;  3LJ3 A;  3HXD A;  3FEX A;  1N4R A;  3Q7F A;  2WQ6 A;  3CVV A;  2DYS E;  4GZC A;  3CQG B;  1V54 E;  2IF4 A;  3CVL A;  2KM4 A;  4L9P A;  1H19 A;  2WXG A;  3UMV A;  1N0Q A;  4WAF A;  4JB8 P;  5AQB A;  3DSW A;  3EUV A;  4U8V D;  3JYS A;  3MEK A;  3ZXS A;  4I2Z A;  2KBX A;  4DLQ A;  5EKQ D;  2XPY A;  4IYP A;  2OEV A;  2WQH A;  3DSS A;  1O1R A;  3PS6 A;  4Q94 A;  4OYS A;  1N94 A;  3TWS A;  5T3R A;  3IKO B;  4EQF A;  4G2V A;  2AW6 A;  3PZD A;  3CV0 A;  4U63 A;  4DX1 A;  1WDY A;  3I4G A;  3SFZ A;  3Q75 A;  4G8K A;  3NZU A;  3UT7 A;  5CBN A;  5BT1 A; 
#chains in the Genus database with same CATH homology
 2AVP A;  1Z3Y A;  3IEG A;  3D9K A;  4WWO A;  3TL5 A;  4WND A;  2J09 A;  3PEU B;  5A7D B;  3ZIM A;  4CDR A;  1UG3 A;  4PUC A;  5CMY A;  3CVY A;  1XGW A;  2XQ0 A;  3S7F A;  4B89 A;  2WXP A;  3OTN A;  3SBT B;  1Z6T A;  1KLX A;  3LCA A;  4GA2 A;  3G2V A;  4WUY A;  4DI3 A;  5G04 J;  3S7B A;  4NAC A;  3Q15 A;  3OAW A;  4YVO A;  1OUV A;  4APF A;  2AXU A;  4UWL A;  2QFC A;  1DNP A;  1SZ9 A;  1U3C A;  3FH7 A;  5A6C A;  3FUK A;  3LVQ E;  4A3T A;  3O48 A;  4BY6 A;  2UY1 B;  4MS6 A;  4GA0 A;  4AP2 A;  1MHQ A;  2IJG X;  3FU0 A;  2J4D A;  1MQS A;  1X5B A;  2I1J A;  3JQ0 A;  2CG3 A;  3FFL A;  3QKY A;  4PS8 A;  4C9B B;  1HFA A;  4CDM A;  2WXN A;  1HX8 A;  4NQ0 A;  3SZ7 A;  3PRZ A;  4HXI A;  2R59 A;  3ASG A;  3AU5 A;  4AY6 A;  4YVQ C;  2LO6 A;  3HVE A;  2VJ8 A;  2MRI A;  3KAE A;  1H0A A;  4K0R A;  2GRL A;  4L2L A;  5FT9 A;  5LX8 A;  2VSN A;  2GW1 A;  3SGH A;  4MRU A;  3FTS A;  1JWG A;  4PS7 A;  2J49 A;  3CR3 A;  4ILG A;  5J90 A;  1TEZ A;  2ZU6 B;  2PQR A;  1W3B A;  3PUK A;  3P1U A;  4K03 A;  3I4R B;  3FTV A;  4AM9 A;  2WMO A;  4FC8 A;  2X6F A;  4JZY A;  4FLH A;  2FI7 A;  2VSY A;  5LFA A;  2DCP A;  2KAT A;  3APC A;  3HVE B;  3MZL B;  5CMW A;  4UI9 K;  4P29 A;  4GAA A;  3MV3 B;  4Q96 A;  1IQU A;  3AS4 A;  4I2W A;  3TXM A;  3B7R L;  4D10 C;  3QAQ A;  4GYY A;  4UWH A;  3FP3 A;  3ZYQ A;  4JA7 A;  5G2N A;  3URZ A;  4J6I A;  1HG5 A;  4UWK A;  2X3M A;  3SF4 A;  4G23 A;  4ME2 A;  3R9A B;  3JUI A;  3ZYK A;  1E8Y A;  3ASH A;  4Q69 A;  3RK6 A;  1H2T C;  1JWF A;  5JHA A;  4XI9 A;  1HZ4 A;  2VGY A;  5ANR A;  1DVP A;  4G26 A;  4PDX A;  3SNX A;  1WM5 A;  1QQE A;  4ILH B;  4FP7 A;  4R7L A;  5G05 J;  3GYZ A;  5EX0 A;  3FU3 A;  3VLD A;  3PVL A;  4U04 A;  3ML8 A;  3PNL B;  4XKB A;  3RO2 A;  5BNW A;  1E8X A;  4BSX A;  3AS8 A;  5LCW J;  3ZEF A;  4AVX A;  1WAO 1;  3R7R A;  1KT1 A;  3RRN B;  2XPZ A;  3JCK C;  4KZC A;  4BT9 A;  2J9Q A;  5CCL A;  3ZRH A;  3L16 A;  3RKV A;  3SD5 A;  2FBN A;  3OXG A;  2KCK A;  3LYA A;  1BPO A;  4AIF A;  1OWN A;  2J4B A;  2XPI A;  3EIJ A;  4LEU A;  4V3I A;  4EBA G;  3CVQ A;  3EIQ C;  2KCV A;  4E85 A;  4G24 A;  1XNF A;  2KC7 A;  4WNF A;  4WWP A;  3CST A;  1FVF A;  1NZN A;  1UJK A;  2PM6 A;  4JW1 A;  1PC2 A;  2XRY A;  5BV1 A;  2IQC A;  1HF8 A;  2FF4 A;  1GW6 A;  4L1B A;  4U07 A;  3AU4 A;  3CHR A;  5KJK A;  1YA0 A;  2IFU A;  1UJJ A;  5AEN A;  4APO A;  4HLE A;  2YIN A;  3RIB A;  3FTZ A;  3IHV A;  3FUD A;  4JHJ A;  2C2L A;  3LEW A;  2NSZ A;  1INZ A;  4GYW A;  2V4L A;  1EDU A;  2X6I A;  2X6J A;  2OV8 A;  2XCC A;  4OVV A;  3CSF A;  2V0P A;  4G25 A;  1HXI A;  3UQ3 A;  4J8S A;  3CHQ A;  4HOS A;  1H2V C;  2VYI A;  3BG1 B;  4I6E A;  1E7U A;  2ION A;  5ARF A;  5CCM A;  1L5J A;  5FQ4 A;  3QB2 A;  2WB2 A;  4EPZ A;  1EYH A;  1N54 A;  1OWL A;  3PUJ A;  1ELW A;  2XGS A;  2HR2 A;  3CK9 A;  2NC9 A;  4FHJ A;  1HH8 A;  3FH8 A;  2VGX A;  3PE3 A;  4Y6W A;  4LCT A;  1TJF A;  2KZT A;  4IRU A;  2LAH A;  4H7X A;  5KCM A;  5DBK A;  4YND A;  4RG9 A;  5G55 A;  3G2S A;  3CHO A;  3MKR A;  4JL0 A;  3TJP A;  3HDX A;  3GW4 A;  4XZ4 A;  3PH0 C;  3CVW A;  4BX8 A;  1HE8 A;  3OXF A;  4JC8 A;  3FDH A;  4PH4 B;  1P5Q A;  3D9J A;  3NF1 A;  2L6J A;  4J8D A;  2WXF A;  1H6K A;  3UUX A;  4I43 A;  2MOW A;  1Z3X A;  2JEK A;  4UQY A;  5FZS A;  4HOU A;  5M72 A;  4ACK A;  2WXK A;  1NP7 A;  1U3D A;  2KZT B;  4EZK A;  4FJZ A;  3MA5 A;  3T8M A;  4BX9 A;  3LXU X;  3NQP A;  1SQM A;  4AXH A;  2LAI A;  2IU1 A;  3ZN3 A;  3FTW A;  3FWV A;  4JXT A;  5BUZ A;  3U64 A;  4URK A;  3CVU A;  5CHE E;  5FQ8 A;  4EZJ A;  4GPK A;  2HO1 A;  1SZA A;  2X6K A;  3ZW3 A;  4N3C A;  3FUH A;  1E90 A;  2ILR A;  3D9L A;  3KEZ A;  3OXL A;  5FJY A;  4N2S A;  1OWO A;  5JJ6 A;  5LOZ A;  4TRQ A;  2GRM A;  4U8H A;  4B8C B;  2M63 A;  3HHM A;  3FTX A;  2DBA A;  3ML9 A;  3MYV A;  2R5S A;  3D9P A;  3ZYM A;  4CT0 A;  3KS2 A;  2I6H A;  4ILI A;  2PZI A;  3BG0 B;  2L9B A;  3FU6 A;  4HFG A;  5JHB A;  4U0U A;  3UPV A;  4GMJ A;  4E6H A;  4GCO A;  3LVR E;  3NZS A;  3FUJ A;  4N5C A;  3EHM A;  4J0U A;  2WXI A;  2XGM A;  4B94 A;  2VSX E;  4M3O A;  4HOR A;  1E8W A;  4G1T A;  4WWN A;  2OND A;  2E2E A;  4L2Y A;  3L13 A;  1KT0 A;  3L17 A;  4CRW A;  2UWJ G;  5EDS A;  5HI7 A;  5A23 A;  3ZVV A;  2V8S E;  3RRU A;  3ONL A;  4ANX A;  2PM7 A;  4B8A A;  5KJM A;  3MX3 A;  2QY7 A;  4ANW A;  4A1G A;  3CVX A;  1VDY A;  1Y6I A;  4FAD A;  4FJY A;  5E76 A;  2E0I A;  4L23 A;  1UN9 A;  1FVH A;  2WXO A;  2WVI A;  3N71 A;  4F1S A;  2RD0 A;  3LS8 A;  3MKQ A;  2AXZ A;  5BV0 A;  4FA6 A;  1HO8 A;  3VTY A;  4I6J A;  5ANL A;  1ZU2 A;  3D9M A;  5FTP A;  1PY1 A;  3L6A A;  5JJ7 A;  3EJN A;  4CGW A;  3Q5M A;  2VTB A;  4W9R A;  4HVB A;  2AXV A;  4N2Q A;  1NA3 A;  1ELK A;  2DIW A;  3B7U X;  3D9O A;  2I1K A;  3I3N A;  5BW8 C;  3PEV B;  2XRZ A;  4GZD A;  4KZ0 A;  4TV3 A;  3IV0 A;  4XI0 A;  5AYW D;  4DI4 A;  1Y8M A;  3B13 A;  3MKQ B;  3MV2 B;  4XKC A;  4GZ5 A;  5ARG A;  3RRM B;  4EEC A;  3CLJ A;  3CHM A;  4GML A;  5JJT A;  3SI5 A;  2CFZ A;  2XHE A;  3D9N A;  3R7Q A;  4UWF A;  3TXN A;  4I6G A;  4ACL A;  4ANU A;  2R17 C;  2Y3A A;  2VTB B;  1JPL A;  3C98 A;  3VLE A;  5D0Q D;  5T8I A;  4AEZ C;  3FU5 A;  4FUL A;  1A17 A;  3QDN A;  2A4Z A;  4XX5 A;  2J07 A;  4AV7 A;  5E75 A;  3D3M A;  3FTU A;  4JHR A;  1OWM A;  4N3A A;  2FEZ A;  3QWV A;  3T5X A;  2LNI A;  2EQX A;  4LRZ A;  4F3V A;  3CEQ A;  4F53 A;  3LDZ A;  5AIJ A;  2IOS A;  2YQ8 A;  3LY8 A;  4I9E A;  4FU3 A;  2WXQ A;  3G2T A;  1S0P A;  3MGB A;  4KYO B;  5DIZ A;  2WXR A;  2XEV A;  4Y6C A;  4F7A A;  4HOT A;  3UT4 A;  1OWP A;  2I9C A;  2P58 C;  3PNT B;  4XE0 A;  2BTD A;  2KCL A;  2MHK A;  5AJD A;  2HYZ A;  2LSV A;  3PE4 A;  3CHP A;  1HS6 A;  2CHW A;  3CKC A;  3CVP A;  3D9I A;  3FY4 A;  3O4Z A;  4RG6 A;  2Y4U A;  3WXX A;  3MJW A;  4H7Y A;  3HIZ A;  4NRH B;  3CHS A;  3FEY A;  2C0M A;  1E8Z A;  2WQ7 A;  4I17 A;  3RJV A;  4GA1 A;  4RVB A;  3U4T A;  2PL2 A;  1N52 A;  2VQ2 A;  1WY6 A;  2YNQ A;  3L22 A;  1E96 B;  4N39 A;  3FUF A;  3ENE A;  1B89 A;  4HOQ A;  3MCX A;  4BTA A;  4C0M A;  2VGX B;  2WXJ A;  3QC1 A;  3EHN A;  4GZ3 A;  4EBA A;  4GCN A;  3GZ2 A;  5FQ6 A;  2WXH A;  2XCB A;  1IYG A;  3JQ1 A;  2J08 A;  5KJL A;  1PAQ A;  3ZFW A;  2X6H A;  3T5V A;  3S7J A;  4GU5 A;  4JEH A;  4U0S A;  2GGF A;  4O6F A;  2WMN A;  1IHG A;  3FTY A;  4DPR A;  3QNK A;  2X38 A;  5T4Y A;  3S7D A;  3CGH A;  5AJL A;  1EPU A;  1HG2 A;  3RO3 A;  5HQ8 A;  3QWP A;  4KVO A;  2LSU A;  4RSY A;  3L08 A;  3ZYL A;  2WXL A;  2FUL A;  4EZL A;  3U9W A;  2OVB A;  2PQN A;  2CG2 A;  2CHX A;  4OVU A;  4UQX A;  2XGO A;  3TG4 A;  4A3V A;  4AY5 A;  3VTX A;  4KXK B;  1IQR A;  4PS3 A;  4IUL A;  3ZHE A;  4J8F A;  2Y4T A;  3DBS A;  4UI9 C;  5EX3 A;  4KT6 B;  3TG5 A;  3SHF A;  3LPZ A;  4TUU A;  3TGO A;  4ANV A;  4I9C A;  2V5F A;  3APD A;  4NUR A;  4DLO A;  3RU0 A;  4BFR A;  5LP0 A;  3BEE A;  3UX4 A;  3P2B A;  3QOU A;  4CGV A;  2YHE A;  3QWW A;  3E4B A;  5C2Y A;  4AJW A;  4GB9 A;  3CIA A;  4N3B A;  5FWQ A;  3SBS A;  2NXP A;  3PDN A;  3B7T A;  3FH5 A;  4IN3 B;  3ZHE B;  4BT8 A;  5G04 C;  4A1S A;  3Q49 B;  4CCA A;  1UW4 B;  2OVF A;  4KVM A;  5BPP A;  1ZBP A;  2HM8 A;  2L0T B;  3B7S A;  4LER A;  3LY9 A;  2BUG A;  4U0Z A;  4CEM A;  4JA9 A;  3CKB A;  2I2O A;  3U66 A;  4ABN A;  4HS2 A;  3G2U A;  3ASD A;  4I1M A;  3TAX A;  2RG8 A;  5D0O D;  4GYO A;  3ULQ A;  1HU3 A;  4QFV A;  2CFU A;  3APF A;  3LJ3 A;  3CK8 A;  4DJA A;  5ENN A;  2CHZ A;  1ELR A;  1LF8 A;  3FEX A;  3QJZ A;  3ZPJ A;  3GZS A;  2OOE A;  4G11 A;  2WQ6 A;  3CVV A;  1TJC A;  3HYM B;  3FUI A;  4GZC A;  4UWG A;  3CQG B;  4BWR A;  4AOF A;  2IOL A;  5FQ7 A;  4I1A A;  2IF4 A;  3CVL A;  4C0E A;  4KBQ A;  2KM4 A;  3EDT B;  1H2U A;  2YHC A;  3Q47 B;  3LY7 A;  1FCH A;  5FZQ A;  1H19 A;  2A5U A;  4KMO A;  2WXG A;  4I1O B;  1QZ2 A;  3FUE A;  3UMV A;  2C0L A;  3CQC B;  3ESL A;  4WAF A;  4JPS A;  5J08 A;  2VSO E;  3ASF A;  4A55 A;  3CK7 A;  2Q7F A;  3JYS A;  3MEK A;  3FUM A;  4MKT A;  3S2A A;  2WPV A;  3ZXS A;  4B0Z A;  4I2Z A;  3UT8 A;  4BTB A;  4UQZ A;  3AS5 A;  4DLQ A;  4GZ6 A;  5EKQ D;  3Q4A B;  4FLB A;  5KJN A;  2XPY A;  4CT4 A;  3FUL A;  3IHY A;  3PRE A;  2WQH A;  4IYP A;  2FO7 A;  1NA0 A;  5G05 C;  1UN8 A;  2WM9 A;  3PS6 A;  1JUQ A;  2AWI A;  3VLF A;  4ATG A;  4Q94 A;  4OYS A;  5LCW C;  3QAR A;  4WNG A;  4JHK A;  5T3R A;  3K9I A;  3IKO B;  3DPD A;  3FHE A;  4XIF A;  4EQF A;  3ESK A;  2WXM A;  5FZR A;  4DK5 A;  4FHK A;  3LKU A;  4G2V A;  4WNE A;  3U3W A;  4JEU A;  3GZ1 A;  3KD7 A;  2AW6 A;  4MLP A;  3CVN A;  3CV0 A;  3PZD A;  4CDN A;  3I5P A;  4J8E A;  4U63 A;  1E7V A;  5C1D A;  4JVS A;  2L0I A;  3I4G A;  3ZGQ A;  3G2W A;  3IBE A;  1QNF A;  1EF1 C;  4L7T A;  4UI9 J;  2BF0 X;  3QK0 A;  3FUN A;  3SFZ A;  3NZU A;  4LUN U;  3L54 A;  3ONK A;  3UT7 A;  5BT1 A;  2UY1 A;  2JLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...