3RO3A

Crystal structure of lgn/minscuteable complex
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
159
structure length
159
Chain Sequence
SRAAQGRAFGNLGNTHYLLGNFRDAVIAHEQRLLIAKEFGDKAAERIAYSNLGNAYIFLGEFETASEYYKKTLLLARQLKDRAVEAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIAQELKDRIGEGRACWSLGNAYTALGNHDQAMHFAEKHLEISREV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title LGN/mInsc and LGN/NuMA complex structures suggest distinct functions in asymmetric cell division for the Par3/mInsc/LGN and G[alpha]i/LGN/NuMA pathways
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords G-protein-signaling modulator 2
total genus 74
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2011-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13176 TPR_7 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ro3A00
2DBAA 4U0ZA 1A17A 4XI0A 4ABNA 1ZBPA 3MEKA 1PC2A 1KT0A 1NZNA 1QZ2A 2UY1A 3BEEA 3QWPA 4H7XA 1WAO1 2PQNA 4YVOA 5KJLA 4J8EA 2KCVA 4JA7A 2VGXB 4U07A 3MKRA 5FZRA 4JA9A 3RU0A 2PQRA 3GYZA 4G24A 3TGOA 1W3BA 2LSVA 1OUVA 3FFLA 3GZ2A 4I1AA 4KBQA 4U0UA 4WNGA 1KLXA 5KJKA 4WUYA 3VTYA 2FI7A 4APOA 4J8FA 5A7DB 2C0LA 2J9QA 2VSYA 4N2SA 2XPIA 3N71A 2KCKA 2GW1A 5EX0A 3LY8A 1ELRA 3ULQA 3UPVA 3CVNA 5KJNA 3HYMB 4BT9A 4G2VA 4UQXA 1E96B 3CK9A 3FP3A 5FT9A 3PE4A 3CVPA 2OOEA 1IYGA 3CKCA 3IEGA 3UQ3A 3LY7A 2KC7A 3JYSA 4N3BA 5C1DA 2VYIA 4G26A 4RG9A 3TG4A 2KCLA 2XEVA 5FZSA 4UI9K 3UUXA 5HI7A 1YA0A 2WQHA 3SF4A 3QOUA 4BT8A 2XGSA 3LCAA 4UI9J 5D0QD 2XCBA 4GCNA 1ELWA 3ASDA 5ARFA 3CKBA 3O48A 3QWWA 4I9EA 3RO3A 5M72A 2ONDA 1WM5A 4JHRA 4GPKA 5BW8C 4CDRA 3ESKA 4CGWA 2C0MA 2XGOA 3S7BA 2FO7A 3ASHA 3NF1A 3Q15A 4AY6A 2Y4UA 3MV3B 4GYYA 4N3CA 5FZQA 4GA2A 4RG6A 5BT1A 4HOTA 2R5SA 4WNEA 4WNDA 3ZPJA 2YHCA 4N39A 5JJ6A 5JJTA 2KATA 4HOSA 3MA5A 1NA3A 4I2WA 3ZGQA 2FF4A 2QFCA 2VQ2A 3LKUA 3Q5MA 3OXGA 4GYWA 1XNFA 3WXXA 4U0SA 4Y6WA 5CHEE 4HOQA 2I6HA 4G1TA 5AYWD 3OXLA 4I2ZA 3S7DA 2AVPA 3GW4A 3S7FA 4J0UA 3RIBA 3ZHEA 4EQFA 4AM9A 3KS2A 4H7YA 3LY9A 5FTPA 5G05C 3SZ7A 4A1SA 3EDTB 1NA0A 4N3AA 3CK7A 4HORA 2LNIA 4GZ6A 4O6FA 4F3VA 3OXFA 5LCWC 3KD7A 4CGVA 2NC9A 1IHGA 5A6CA 3CVLA 3MV2B 3PDNA 4BWRA 2BUGA 2IFUA 3TG5A 2VGXA 1P5QA 3CVQA 3E4BA 3RO2A 2PL2A 1FCHA 3AS4A 3ZN3A 2VSNA 2E2EA 1B89A 4UQYA 5JJ7A 2L6JA 4YVQC 3CEQA 5KJMA 5ARGA 5HQ8A 4GCOA 3U3WA 2FEZA 2XCCA 4GZ5A 2HR2A 2VGYA 5EKQD 2V5FA 5CCLA 3ASGA 2IF4A 2WPVA 4AY5A 5DIZA 2C2LA 2UWJG 4KYOB 4W9RA 2Q7FA 3RJVA 2JLBA 3AS8A 5EX3A 4GA0A 4GYOA 4U04A 3R9AB 3TAXA 3URZA 3AS5A 5FJYA 3VTXA 4HOUA 3CV0A 4N5CA 3RKVA 3KAEA 4IN3B 4B94A 3CK8A 5G04J 3S7JA 4LEUA 1HZ4A 4AIFA 4BTAA 3LPZA 5BNWA 4BTBA 4N2QA 2MHKA 4UQZA 3QKYA 4XIFA 3QWVA 1QQEA 4GA1A 5D0OD 5G05J 3K9IA 4I9CA 4NRHB 4GZ3A 4XI9A 4J8DA 5DBKA 1HH8A 2FBNA 3Q4AB 2LSUA 2HO1A 4KXKB 4WNFA 4I17A 4NQ0A 4UI9C 4G25A 2HYZA 3LYAA 3QDNA 4ME2A 2XGMA 3U4TA 5G04C 1HXIA 1TJCA 2P58C 3PE3A 3ZFWA 3ZHEB 2Y4TA 2YQ8A 3ASFA 5CCMA 5LCWJ 4YNDA 3GZ1A 1ZU2A 4JL0A 2UY1B 1Y8MA 1KT1A 2PZIA 3FWVA 3Q49B 4G23A 4Y6CA 3Q47B
chains in the Genus database with same CATH superfamily
5EIBE 3VTYA 3PS6A 3QWPA 2KCVA 4E85A 4WNGA 4B8CB 2VSYA 5AENA 3FULA 5B1AE 1U3DA 4U7EB 2J49A 4G26A 3Q9UC 4UI9K 4UUCA 3UUXA 3E30A 2OCCE 2XRZA 4TXRA 4HB5A 1E90A 5AN8A 3QWWA 4I43A 5D66A 1PAQA 3UT4A 4GPKA 5BT1A 3ZGQA 2IOLA 3IV0A 3APFA 1TEZA 2KZTA 4Y6WA 2I6HA 4BX8A 1S70B 5FTPA 3I3NA 3NBNB 4MLPA 1HO8A 3RRUA 2R59A 3L17A 4EZJA 3UM1A 2PM6A 1FCHA 2EIKE 4UQYA 3SGHA 1E8YA 2P9PG 2XCCA 2B6CA 3LVRE 3U9WA 1HU3A 2C2LA 3IHYA 3NZUA 4LCTA 2FO1E 2MYOA 2JLBA 2BTDA 3SD5A 4U8VD 1JWFA 3PUJA 5KWDA 4BTBA 2M63A 3FTSA 3T8KA 4PDXA 3E37A 3D9HA 3SO8A 3U64A 3SBSA 3SI5A 2P9SG 4ATGA 4N2SA 4JZYA 5AARA 4F53A 3E34A 4UWHA 3C98A 4D10C 3Q49B 3AG4E 4M3OA 5C2YA 1NZNA 3BEEA 4YVOA 1RZ4A 2IY0C 5G2NA 2J9QA 4KT6B 3TXNA 1H2TC 5EX0A 3JXJA 1OWPA 3CK9A 3UQ3A 3RRMB 4C0MA 3J5QB 4PS8A 3HXFA 4J8YA 2P2CP 2V4LA 5BW8C 4J8SA 2XPZA 3ASOE 3BG0B 5LP0A 2R03A 3SBTB 4WNEA 3RAUA 1U3CA 3FHEA 3LKUA 4U8YD 4WWPA 4I6JA 2J4DA 4HI8A 3GW4A 3EDTB 2X6IA 3SQVA 3FTZA 5LOZA 3UI2A 3NQPA 3TWQA 3CEQA 2VGYA 3TWUA 2F8YA 3EHRA 4PS7A 3X2QE 5AQBA 3VTXA 2FULA 2IONA 1O1SA 5AQAA 2WXPA 1QQEA 2BKKB 4ACKA 3K9IA 4IULA 4EPZA 2VJ8A 1IKND 2IO3C 5T4YA 2AXUA 3VLEA 4B0ZA 2CFUA 1SVXA 3ASFA 4Y6CA 5CRUA 1N95A 2X6FA 5KJLA 4JA7A 3RU0A 2J08A 3GZ2A 3UTMA 2XEEA 3Q73A 3N71A 4TUUA 1JCRA 3BQOA 3TXMA 2OOEA 1PY1A 3LY7A 4P29A 3PZ1A 3V79K 3LCAA 5D0QD 4I6EA 3L16A 5ARFA 3O48A 4ANVA 3FUIA 3UM0A 1S0PA 3KSLA 2A5EA 2GRRB 2KATA 3Q5MA 3CLJA 3QB2A 4HI9A 2KM4A 3ZXSA 5HRYA 2RFAA 3DSUA 5G05C 1GW6A 2VGEA 4HFGA 1O5MA 4HBDA 1LD7A 3PREA 4ILHB 4FADA 3DXMG 4KZCA 1DNPA 1V54E 3AG3E 5FINA 4LNGA 3ML9A 3JQ1A 1UOHA 4TUMA 4AEZC 2GROB 2H6FA 3TAXA 5ITZF 2P9NG 3QAQA 4AJWA 2XS8A 4XI9A 4U63A 2EINE 2KBXA 4F1PA 3IKOB 4PUCA 4YNDA 3ZYLA 3FY4A 4U0ZA 2VTBA 1A17A 4M7CA 1N54A 4J8EA 3B7RL 3FFLA 2DZNA 3G2VA 4I1AA 5KNHD 5KJKA 4BERA 4UWGA 4G2VA 4UQXA 3MCXA 4L23A 5CERB 3FTXA 3EHQA 3JYSA 2WXQA 2WXKA 4JEUA 1N4PA 5M72A 5ENQD 2NSZA 4HVBA 2C0MA 4ATZD 4B89A 2H6HA 4WWNA 4WNDA 4N39A 3B7TA 3OXGA 4GYWA 3ZUVB 4FULA 4U0SA 4G1TA 3S7FA 4E6HA 5CBNA 1ELKA 3KS2A 5EILA 3L9TA 3PUKA 3SFYA 3ZYMA 4ANWA 5CMWA 4ANXA 5HKPA 5JJ7A 1B89A 4KVOA 3DSSA 3TWWA 5FIOA 1MJ0A 2GRNB 3FU0A 1N0RA 4U8HA 2DYSE 3CV0A 5JMND 4CEMA 1E7VA 3ONKA 2EQXA 3NOCD 2DVWA 2BF0X 1UJJA 3UM2A 4GTQA 1HH8A 2R2LA 2FBNA 3D3MA 3AAAC 3JUIA 5BV1A 4UI9C 4TXPA 4BX9A 1FPPA 1MYOA 1LF8A 4G23A 2RFMA 3B7BA 3MEKA 2UY1A 1Q2ZA 3CHMA 1OUVA 2I2OA 3L22A 4ANUA 1D9SA 3EU9A 1BU9A 3FP3A 3AU4A 2VYIA 3SY2A 1YA0A 3ASNE 3SFXA 3FU3A 2R17C 3CKBA 5ENTD 3PVLA 1TNUA 2HE0A 4JW1A 2L6BA 3ZIMA 3MV3B 3RK6A 2ZISA 3AG1E 4GU5A 1BPOA 2F37A 4AVXA 5CHEE 2OVFA 3T9KA 4AM9A 4EBAA 4GZ6A 1HE8A 2AXZA 2RKKA 1OWLA 1Z3XA 4DX5D 3C3OA 2GRMA 3PEUB 5JHAA 4GTOA 5ENRD 3C5RA 1JCQA 2AWIA 4GZ5A 1SW6A 2V5FA 5BUZA 2UWJG 5BXOA 3JCKC 4A63B 2AW6A 1Y6IA 3AS5A 3S2AA 2DZOA 1HF8A 1HZ4A 3EHNA 4LEUA 3LPZA 4MBGA 2MOWA 3ZW3A 4EBAG 2WQ7A 1OCCE 4JB8P 2P58C 1ZU2A 1N11A 2DBAA 2WMOA 1N9AA 1H2VC 1PC2A 1KT0A 1DCQA 2PQNA 3ZKJA 4LRZA 3ZYKA 2PQRA 2PNNA 4K0RA 5A7DB 2LAHA 4UWFA 3FU6A 3HYMB 3LEWA 1TYQG 4HLEA 3DSXA 1N52A 2IJGX 3FUKA 4TRQA 4RG9A 2XEVA 4JVSA 2WQHA 3EHMA 5J08A 1WM5A 1EF1C 1AP7A 2XPYA 4AY6A 3ZRHA 1SQMA 4HS2A 3D9JA 3CVUA 2WQ6A 3WXXA 2BEDA 5AYWD 2AVPA 2RG8A 4OYSA 3APCA 2WVIA 2E2EA 3DEOA 3L82A 5H7PA 2Q7FA 4BSXA 3HG0D 4IN3B 3FUMA 3FDHA 5G05J 3UX4A 5DBKA 3UXGA 2GRLA 5ANRA 2LXMA 1K8KG 2LO6A 4GMJA 3SHFA 2KXPC 3ZHEB 3L13A 3G2TA 3GZ1A 4JL0A 2DIWA 1TNOA 4ABNA 4EECA 4JA9A 1YMPA 2XHEA 4DLOA 4CDNA 1IQUA 1TN7A 2XPIA 3EUVA 5HS0A 3UT7A 3ZXPA 3CVPA 1ZB1A 4RLYA 4LNBA 4RQIA 5HI7A 1AWCB 2ETAA 4XEIG 4N3CA 4HOTA 2YHCA 4Z68A 4FJZA 1DVPA 4K5CA 4BSZB 4NACA 3FTYA 3DSVA 3ZU7B 3RSEG 5A6CA 2BUGA 1FT1A 1OWNA 3U3WA 5AJLA 2P9UG 3EIQC 1N0QA 5DIZA 3JUEA 3W9FA 3RJVA 4YDOA 2ZIRA 3R9AB 2IOSA 3ISMC 1FVHA 3CHPA 4N5CA 5CMYA 4CT0A 2WXOA 5JHBA 4F1SA 3LVQE 3QKYA 4XIFA 2IU1A 2H6GA 2NYJA 2X6HA 3I4RB 2ZU6B 2ZGDA 4G25A 2HYZA 1N4RA 4Q94A 3VLFA 5EKQD 1UG3A 3I4GA 2ILRA 4QFVA 4Q69A 2WMNA 1NP7A 3AG2E 2VGXB 3GYZA 4KVMA 4U0UA 1N94A 2C0LA 4JC8A 4FU3A 3FUDA 2IEJA 3MYVA 4GTMA 4UI9J 4U96D 3UT8A 3C3RA 3RO3A 2ONDA 4JHKA 5LFAA 3TWXA 5JA4D 3HVEA 5JJTA 4CCAA 3MKQA 1BI8B 5FQ7A 2GRQB 3C72A 3ZHEA 2I1KA 4HNAD 2Y0BG 3CHOA 3UKUG 2YNQA 3IBEA 4LUNU 3CVLA 3D9NA 1BI7B 3TG5A 1JCSA 3TWTA 5KJMA 4HRLA 1MZCA 2QYUA 4JHJA 4KMOA 4C9BB 3ENEA 2WM9A 4ACLA 4XX5A 3AS8A 3URZA 1UW4B 4PH4B 4OVUA 2NXPA 3CVXA 4GPMA 1OWMA 4NRHB 3PZDA 3IHVA 3HXCA 3UIOC 1TNBA 4GMRA 4MKTA 1QBQA 4O1OA 4B93B 3KEAA 4OAUC 1O1TA 1OY3D 3PNLB 1KT1A 3FU5A 2RD0A 4JD2G 4ZHBA 1MQSA 2WXRA 3HDXA 5CRVA 3UPVA 2GW1A 5KJNA 2X6KA 5BXUA 3CKCA 2XQ0A 3Q7FA 4FLHA 2KC7A 4A55A 2KCLA 2VSOE 2Y69E 3QOUA 1TJFA 3LJ3A 3PZ2A 2XZDG 3DEPA 3FEXA 3NF1A 3Q7AA 4GYYA 4F6RD 1H0AA 3QNKA 1TR4A 4V3IA 4O1PA 4TXQA 1U2VG 3CHQA 3S7DA 3OXLA 3LY9A 4DJAA 4GZDA 1IXVA 3OXFA 1S63A 2IFUA 3FUFA 1OCZE 3BUAA 2VSNA 3TJPA 1JPLA 1MX6A 4GTTA 5B1BE 3MZLB 3T5XA 2IF4A 5B3SE 4FJYA 1HG5A 4OVVA 4GTPA 4AIFA 4BTAA 5D0OD 4IYPA 4J6IA 4A1GA 3OTNA 2P9LG 1EDUA 2P9KG 2HO1A 4UWKA 4DX1A 4EZKA 2XGMA 4DLQA 3UIPC 5CCMA 3ZEFA 3FWVA 4LNUD 3FTVA 2WXHA 2X38A 3OAWA 4BEPA 3TL5A 1L5JA 2WXMA 5ENPD 3V2XA 3DWLG 4K03A 4CYMD 4BT9A 3D9MA 3D9OA 4G8LA 4I1OB 3ZYQA 2A5UA 4L9PA 2OV8A 4XKCA 2XGSA 5EIDA 4BT8A 4DI4A 1UN9A 1SA5A 4K5BA 4CGWA 2QC9A 5ENNA 3S7BA 4AV7A 4RG6A 1SZ9A 3BG1B 1X5BA 4HOQA 1MHQA 1NA0A 4O6FA 5LCWC 4HQDA 3TWRA 3MV2B 1JWGA 4EZLA 3ULYA 1K3ZD 1LD8A 1UJKA 3RO2A 1KPSB 3ZN3A 2L6JA 1OCOE 2HR2A 4YDWA 1FVFA 1N4SA 2J8SD 2WXNA 4XE0A 1JUQA 4JEHA 2X6JA 3DPDA 3CK8A 5EN5D 3JQ0A 4DI3A 4I1MA 5BNWA 3G2UA 3L08A 3HIZA 1HX8A 3QWVA 3Q79A 3IXEA 3B7SA 2Y3AA 4J8DA 1QNFA 1D8DA 2CG2A 3BU8A 1OT8A 3MX3A 1HXIA 3PEVB 2B0OE 3LJNA 1Y8MA 1ZBPA 3R7QA 2P9IG 3MKRA 2L0IA 4G24A 4Q96A 4BY6A 5T3RA 2EIJE 4FA6A 4I6GA 2OVBA 1TNZA 4WWOA 1E96B 3IEGA 5FQ6A 4HRNA 4N3BA 2BKGA 3FUNA 3V30A 1ELWA 1K1AA 3B7UX 4IRUA 1KZPA 1O1RA 4C48B 4XZ4A 3MKQB 5BV0A 3HXEA 2R5SA 3ZPJA 3DPYA 5JJ6A 1NL4A 2VQ2A 3ZVVA 4CRWA 4PS3A 2X3MA 4EQFA 4H7YA 4AXHA 4N3AA 3CK7A 4FP7A 4CGVA 4BWRA 4FLBA 4URKA 1YYHA 2A4ZA 5ENOD 2EILE 5EYPF 4YVQC 3PNTB 5HQ8A 4AP2A 4GCOA 1Z5SC 4G8KA 2I9CA 3CQGB 4KYOB 2E0IA 2I1JA 5FJYA 1X81A 1EYHA 2J4BA 4B94A 3DSWA 1G3NB 3UMVA 1D8EA 4I9CA 1BLXB 4TV3A 4KXKB 1H6OA 3QARA 3DBSA 4ME2A 3U4TA 3PE3A 2DYRE 2GRPB 3QJZA 2UY1B 2AXVA 2GGFA 2XEHA 5FQ8A 3J5PA 3C3QA 3CGHA 4WAFA 2ZGGA 3ABKE 3NAWA 5C1DA 4N5QA 5FZSA 3SF4A 4GAAA 4GCNA 2WXIA 3FH8A 4I9EA 3G2SA 3Q15A 1N4QA 2YHEA 2VSXE 4DK5A 3PH0C 3ABLE 3KSQA 1E8WA 3PZ3A 2XS1A 3L6AA 1XNFA 3CR3A 3GZSA 4AOFA 3RIBA 2WXLA 4HXIA 3E32A 1P5QA 5AJDA 3HHMA 3HXBA 3QC1A 4O60A 4GA0A 4GZCA 5AQ7A 3KAEA 3PRZA 3CIAA 2LUHA 3WG7E 4UQZA 1DC2A 3SFZA 1DCEA 1IHBA 2QYJA 1MX2A 4WNFA 2Y1LE 3FH5A 2AJAA 3QDNA 4MRUA 1HFAA 4CZ2D 3W9GA 4N2QA 4JPSA 5KBAA 1MX4A 1QZ2A 5FZRA 4U07A 3TGOA 4KBQA 4EHMA 1WG0A 2HM8A 3HVEB 3ULQA 4LSZE 3PE4A 4A3VA 5EDSA 5CEDB 3ONLA 3ASDA 4L2YA 2XGOA 4ILGA 2V5QC 4K5AB 1WDYA 1S64A 1Z6TA 1H6PA 3MA5A 4G11A 5LX8A 1INZA 2R02A 3AJIA 3L54A 4L1BA 3SZ7A 2QZAA 3UKRG 2LNIA 3ESLA 3KD7A 4L7TA 3DSTA 1NFIE 5ANLA 2J09A 2VGXA 4NIKA 1OCRE 2QY7A 1VDYA 4R7LA 5ARGA 3T8MA 5CCLA 2ETCA 2IO2C 4W9RA 4GYOA 3TWVA 3RKVA 1A5EA 5KCMA 3S7JA 3O4ZA 2MHKA 3F6QA 1BD8A 4I17A 1WY6A 2Y4TA 3MGBA 2PZIA 3Q47B 2MRIA 4XI0A 3U66A 4H7XA 3TWSA 1WAO1 4J7WA 5FWQA 4CT4A 4QQIA 4NURA 1W3BA 2LSVA 1KLXA 4J8FA 2H6IA 4XKBA 3VLDA 1ELRA 3CVNA 3CHSA 4C0EA 1TNYA 4ILIA 5FQ4A 2IQCA 4JXTA 4GMLA 1H6KA 4JHRA 3CQCB 3ESKA 3ABME 1SA4A 2LAIA 2FO7A 3ASHA 2Y4UA 3CSTA 2QFCA 2WXJA 4HRMB 4DUIA 3KEZA 1K1BA 5KNGA 3E33A 3R7RA 4HORA 2V4HC 2NC9A 1IHGA 3PDNA 3FUHA 3FEYA 4A3TA 4CDMA 3E4BA 3CVYA 3CVQA 1H19A 3PZ4A 3AS4A 3NZSA 4YDYA 3JXIA 4MS6A 4B8AA 2WPVA 1KZOA 3SNXA 5IY5E 4L2LA 2PM7A 1Z3YA 3FTUA 2EIME 1FT2A 5E76A 3CVVA 3D9LA 1SZAA 2ZXWE 3Q4AB 1XGWA 3R9MA 2CHZA 1H2UA 4NQ0A 5BPPA 5G04C 1TJCA 3CSFA 4RVBA 3FUJA 1E8ZA 4BFRA 2DWZA 1IQRA 1E8XA 4LERA 3Q78A 2XENA 3NOGD 2ETBA 4DPRA 5E75A 4HOSA 4ZFHA 4WUYA 2FI7A 4APOA 2L0TB 4LG6A 3CHRA 3UM3A 4FC8A 3D9PA 1LTXA 4GB9A 3LDZA 3TG4A 1HG2A 3UINC 3D9IA 4BETA 3D9KA 4YDEA 3ZNGA 2XRYA 2V8SE 3B95A 2R05A 3P2BA 2CFZA 4GA2A 1NA3A 3NB2A 1YCSB 4I2ZA 4J0UA 3ULEG 3Q9NC 4DRXE 4F3VA 2CHWA 2JABA 3LXUX 5T8IA 3V31A 4DX7D 3APDA 4F7AA 1TN6A 1OXJA 1TN8A 2V0PA 4GTVA 2OEVA 3T5VA 3Q75A 2F8XK 1V55E 5CEAA 5D2MC 2VTBB 3RRNB 4U04A 2WXFA 4HOUA 3DXKG 4BESA 4HLLA 1RW2A 3EIJA 3HRAA 3DRAA 3ZFWA 4GTRA 2YQ8A 4OAVB 4FHJA 4I2WA 5AIJA 5CBOA 3LS8A 3G2WA 4RSYA 3HXDA 3B13A 3FUEA 2KCKA 3LY8A 2LXLA 4FHKA 2WXGA 3MJWA 5FT9A 4U95D 1IYGA 5ENSD 2YINA 2JEKA 3QK0A 2XCBA 2L9BA 4CDRA 2F0YA 1E7UA 5FZQA 3EU5A 1QYMA 4APFA 5AQ9A 2FF4A 3FTWA 2CG3A 2KZTB 1HS6A 4KZ0A 1NI1A 1OWOA 2DCPA 2J07A 4X8QA 3EJNA 2XZTG 4DX2A 2CHXA 2PL2A 5AAOA 4UWLA 3P1UA 2FEZA 2WB2A 3V2OA 3ASGA 4AY5A 3CVWA 3I5PA 5CECB 5EX3A 4DX6D 5G55A 5G04J 5J90A 2OEWA 4GA1A 1EPUA 4GZ3A 4GTSA 2LSUA 5A23A 3ML8A 3LYAA 3FH7A 5EYLA 5LCWJ 1UN8A 4A1SA 3AU5A
chains in the Genus database with same CATH topology
3MEKA 3VTYA 1QZ2A 2UY1A 3PS6A 3QWPA 2KCVA 4U07A 5FZRA 3CHMA 2RD0A 3TGOA 4E85A 4KBQA 4WNGA 1OUVA 2I2OA 1MQSA 4B8CB 2WXRA 3HDXA 2VSYA 3L22A 5AENA 4ANUA 2HM8A 3HVEB 2GW1A 3ULQA 3FULA 3UPVA 5KJNA 2X6KA 3FP3A 1U3DA 3PE4A 3CKCA 2J49A 2XQ0A 4FLHA 3AU4A 2KC7A 4A55A 2VYIA 4G26A 2KCLA 2VSOE 4UI9K 3UUXA 1YA0A 4A3VA 3QOUA 5EDSA 2XRZA 3ONLA 3FU3A 1TJFA 3ASDA 1E90A 2R17C 3CKBA 3LJ3A 3QWWA 4I43A 3PVLA 4L2YA 1PAQA 3FEXA 3UT4A 4GPKA 2XGOA 4ILGA 4JW1A 3NF1A 3ZIMA 3MV3B 4GYYA 5BT1A 3RK6A 4GU5A 1H0AA 3QNKA 1Z6TA 3MA5A 1BPOA 4V3IA 3ZGQA 4G11A 2IOLA 3IV0A 4AVXA 3APFA 1TEZA 2KZTA 5LX8A 1INZA 4Y6WA 3CHQA 5CHEE 2I6HA 2OVFA 3S7DA 3OXLA 4BX8A 4EBAA 4AM9A 3LY9A 4DJAA 3L54A 5FTPA 4GZDA 4L1BA 3SZ7A 3I3NA 4MLPA 2LNIA 1HE8A 1HO8A 4GZ6A 3OXFA 3RRUA 3ESLA 2R59A 3KD7A 2AXZA 3L17A 4L7TA 1OWLA 5ANLA 2IFUA 3FUFA 4EZJA 2J09A 1Z3XA 2VGXA 5JHAA 2PM6A 2GRMA 3PEUB 1FCHA 2QY7A 1VDYA 2VSNA 3TJPA 4UQYA 1JPLA 3SGHA 1E8YA 4R7LA 5ARGA 3T8MA 3MZLB 2XCCA 2AWIA 4GZ5A 3LVRE 3U9WA 5CCLA 2V5FA 5BUZA 3T5XA 2IF4A 4FJYA 1HU3A 1HG5A 2C2LA 2UWJG 3JCKC 3IHYA 3NZUA 4LCTA 4OVVA 4W9RA 2JLBA 2BTDA 4GYOA 2AW6A 3SD5A 1Y6IA 3AS5A 3S2AA 3RKVA 1JWFA 3PUJA 5KCMA 3S7JA 1HF8A 1HZ4A 3EHNA 4LEUA 4AIFA 3LPZA 4BTAA 4AY6A 4BTBA 3O4ZA 2MHKA 4N2QA 2M63A 2MOWA 3FTSA 5D0OD 4IYPA 3ZW3A 4PDXA 4J6IA 4A1GA 3OTNA 3U64A 3SBSA 1EDUA 2HO1A 4EBAG 3SI5A 4I17A 2WQ7A 4UWKA 4ATGA 4EZKA 2XGMA 4DLQA 4N2SA 4JZYA 2P58C 1WY6A 4F53A 2Y4TA 5CCMA 4UWHA 3C98A 1ZU2A 3ZEFA 3MGBA 2PZIA 3FWVA 4D10C 3Q49B 3FTVA 2WXHA 3Q47B 2DBAA 2MRIA 2X38A 4XI0A 2WMOA 4M3OA 3OAWA 1H2VC 1PC2A 1KT0A 1NZNA 5C2YA 3BEEA 4H7XA 3U66A 4YVOA 1WAO1 2PQNA 4LRZA 3TL5A 5FWQA 3ZYKA 2PQRA 4CT4A 4NURA 1W3BA 2LSVA 1L5JA 2WXMA 4K0RA 1KLXA 5G2NA 4J8FA 4K03A 2J9QA 2LAHA 5A7DB 4KT6B 4UWFA 1H2TC 4XKBA 5EX0A 3TXNA 3VLDA 1ELRA 1OWPA 3FU6A 3CVNA 3CHSA 3HYMB 3D9MA 3LEWA 4BT9A 3CK9A 3D9OA 4HLEA 1N52A 2IJGX 3UQ3A 3FUKA 4TRQA 4I1OB 4RG9A 3RRMB 2XEVA 4C0EA 4JVSA 4ILIA 2WQHA 4C0MA 3ZYQA 4PS8A 2A5UA 2IQCA 2OV8A 3EHMA 2XGSA 4GMLA 4JXTA 4XKCA 5FQ4A 4BT8A 4DI4A 1H6KA 1UN9A 5J08A 2V4LA 1WM5A 4JHRA 1EF1C 5BW8C 3CQCB 3ESKA 4CGWA 2LAIA 2XPYA 2XPZA 4J8SA 2FO7A 3ASHA 3BG0B 5ENNA 3S7BA 2Y4UA 5LP0A 3ZRHA 4AV7A 1SQMA 3SBTB 3CSTA 4RG6A 4WNEA 4HS2A 1SZ9A 3D9JA 3CVUA 2WQ6A 3BG1B 1U3CA 2QFCA 3FHEA 2WXJA 3LKUA 3WXXA 1X5BA 4WWPA 4I6JA 2J4DA 4HOQA 3KEZA 5AYWD 2AVPA 3GW4A 1MHQA 3EDTB 1NA0A 3R7RA 4HORA 4O6FA 5LCWC 2NC9A 1IHGA 2RG8A 2X6IA 3MV2B 1JWGA 3FUHA 3PDNA 4OYSA 3FEYA 4A3TA 4CDMA 4EZLA 3E4BA 3APCA 3CVQA 1H19A 1UJKA 2WVIA 3FTZA 5LOZA 3RO2A 3CVYA 3AS4A 3ZN3A 3NZSA 2E2EA 3NQPA 2L6JA 3CEQA 2HR2A 2VGYA 1FVFA 4MS6A 4B8AA 4PS7A 2WPVA 2WXNA 4XE0A 2Q7FA 3SNXA 1JUQA 4BSXA 4JEHA 3VTXA 2FULA 2IONA 4L2LA 2X6JA 4IN3B 3DPDA 3CK8A 2PM7A 3FUMA 1Z3YA 2WXPA 3JQ0A 4I1MA 4DI3A 3FDHA 5BNWA 3G2UA 3FTUA 3L08A 3HIZA 1HX8A 5E76A 3QWVA 1QQEA 5G05J 3CVVA 4ACKA 3K9IA 4IULA 4EPZA 3B7SA 2Y3AA 3UX4A 4J8DA 1QNFA 5DBKA 3D9LA 2GRLA 1SZAA 5ANRA 2VJ8A 3Q4AB 1XGWA 2CG2A 2CHZA 1H2UA 4NQ0A 5T4YA 2AXUA 2LO6A 3MX3A 5BPPA 4GMJA 5G04C 1HXIA 1TJCA 3CSFA 2CFUA 4RVBA 3SHFA 3VLEA 3ZHEB 3PEVB 4B0ZA 3FUJA 3ASFA 1E8ZA 3L13A 3G2TA 3GZ1A 4BFRA 4JL0A 1Y8MA 2DIWA 4Y6CA 1E8XA 1IQRA 4LERA 2X6FA 4ABNA 1ZBPA 3R7QA 4EECA 5KJLA 4JA7A 3RU0A 3MKRA 4JA9A 2L0IA 2J08A 4G24A 4Q96A 2XHEA 4DLOA 4DPRA 3GZ2A 5E75A 4BY6A 5T3RA 4CDNA 4HOSA 4WUYA 2FI7A 4APOA 1IQUA 2L0TB 2XPIA 3N71A 4I6GA 4FA6A 2OVBA 3CHRA 3UT7A 4TUUA 4WWOA 1E96B 4FC8A 3TXMA 3CVPA 2OOEA 3D9PA 3IEGA 5FQ6A 4GB9A 1PY1A 3LY7A 4P29A 4N3BA 3LDZA 3TG4A 3FUNA 1HG2A 3D9IA 5HI7A 3LCAA 5D0QD 4I6EA 1ELWA 3D9KA 3L16A 5ARFA 3B7UX 3O48A 2XRYA 2V8SE 4IRUA 4ANVA 4XZ4A 3FUIA 3MKQB 3P2BA 2CFZA 4N3CA 1S0PA 4GA2A 5BV0A 4HOTA 2R5SA 3ZPJA 2YHCA 5JJ6A 4FJZA 2KATA 1DVPA 1NA3A 2VQ2A 3Q5MA 4NACA 3FTYA 3CLJA 3ZVVA 4CRWA 4PS3A 4I2ZA 3QB2A 2X3MA 2KM4A 3ZXSA 4J0UA 4EQFA 4H7YA 5G05C 1GW6A 4HFGA 4N3AA 3CK7A 4AXHA 4FP7A 4F3VA 2CHWA 3LXUX 4CGVA 5A6CA 5T8IA 4BWRA 2BUGA 4FLBA 3PREA 4ILHB 4URKA 4FADA 2A4ZA 3APDA 4F7AA 4KZCA 4YVQC 3PNTB 1DNPA 1OWNA 2V0PA 4AP2A 4GCOA 5HQ8A 3U3WA 3ML9A 5AJLA 3JQ1A 2I9CA 3EIQC 3T5VA 4AEZC 5DIZA 3CQGB 4KYOB 2VTBB 3RJVA 2E0IA 3RRNB 4U04A 2I1JA 3R9AB 2IOSA 2WXFA 3TAXA 5FJYA 1FVHA 3CHPA 4HOUA 4N5CA 5CMYA 1EYHA 2J4BA 4B94A 4CT0A 2WXOA 5JHBA 4F1SA 3LVQE 3UMVA 3QKYA 3QAQA 4XIFA 4AJWA 2IU1A 4I9CA 4XI9A 3EIJA 2X6HA 4U63A 4TV3A 3I4RB 2ZU6B 4KXKB 3QARA 4G25A 2HYZA 3DBSA 4ME2A 3U4TA 3PE3A 3ZFWA 2YQ8A 3IKOB 4PUCA 4FHJA 4Q94A 4YNDA 3QJZA 3ZYLA 2UY1B 3FY4A 2AXVA 2GGFA 4I2WA 3VLFA 5EKQD 1UG3A 3I4GA 4U0ZA 2VTBA 1A17A 5FQ8A 2ILRA 4QFVA 1N54A 4Q69A 2WMNA 3CGHA 5AIJA 1NP7A 4J8EA 2VGXB 3GYZA 3G2WA 3B7RL 3LS8A 4RSYA 3FFLA 4KVMA 3G2VA 4I1AA 4WAFA 4U0UA 5KJKA 2C0LA 3B13A 4JC8A 3FUEA 2KCKA 4UWGA 3LY8A 4FU3A 4FHKA 2WXGA 3MJWA 4G2VA 3FUDA 3MYVA 4UQXA 5FT9A 1IYGA 3MCXA 4L23A 3FTXA 3JYSA 2YINA 5C1DA 2JEKA 2WXQA 5FZSA 2WXKA 4JEUA 3SF4A 3QK0A 4GAAA 4UI9J 2XCBA 4GCNA 3UT8A 2WXIA 3FH8A 2L9BA 4I9EA 3RO3A 3G2SA 5M72A 2NSZA 2ONDA 4JHKA 4HVBA 4CDRA 2C0MA 5LFAA 4B89A 3Q15A 5FZQA 1E7UA 2YHEA 2VSXE 4WWNA 4WNDA 3PH0C 4N39A 4DK5A 3HVEA 5JJTA 4CCAA 3MKQA 4APFA 1E8WA 2FF4A 3B7TA 3L6AA 3OXGA 4GYWA 1XNFA 3CR3A 4FULA 5FQ7A 4U0SA 3GZSA 4G1TA 3S7FA 4E6HA 4AOFA 3RIBA 3ZHEA 3FTWA 1ELKA 2CG3A 3KS2A 2KZTB 1HS6A 2I1KA 4KZ0A 1OWOA 2DCPA 2J07A 3CHOA 2WXLA 2YNQA 3IBEA 4LUNU 3CVLA 3PUKA 3D9NA 3EJNA 4HXIA 3TG5A 1P5QA 3ZYMA 4ANWA 5AJDA 2CHXA 2PL2A 5CMWA 3HHMA 4ANXA 5JJ7A 1B89A 4KVOA 4UWLA 5KJMA 3P1UA 4JHJA 4KMOA 2FEZA 4C9BB 2WB2A 3ENEA 2WM9A 3ASGA 4ACLA 4AY5A 3CVWA 3FU0A 3QC1A 4XX5A 3I5PA 3AS8A 4U8HA 5EX3A 4GA0A 4GZCA 3URZA 1UW4B 3CV0A 5G55A 3KAEA 4PH4B 4OVUA 3PRZA 4CEMA 1E7VA 5G04J 3ONKA 5J90A 2EQXA 3CIAA 2NXPA 3CVXA 2BF0X 1UJJA 4UQZA 4GA1A 1OWMA 1EPUA 4NRHB 4GZ3A 3PZDA 1HH8A 3IHVA 2FBNA 3D3MA 3SFZA 2LSUA 3JUIA 4MKTA 5A23A 4WNFA 5BV1A 4UI9C 3FH5A 3ML8A 3LYAA 3QDNA 4MRUA 3FH7A 1HFAA 4BX9A 5LCWJ 3PNLB 1LF8A 1KT1A 1UN8A 4G23A 4A1SA 3AU5A 3FU5A 4JPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DBA A;  4U0Z A;  1A17 A;  4XI0 A;  4ABN A;  1ZBP A;  3MEK A;  1PC2 A;  1KT0 A;  1NZN A;  1QZ2 A;  2UY1 A;  3BEE A;  3QWP A;  4H7X A;  1WAO 1;  2PQN A;  4YVO A;  5KJL A;  4J8E A;  2KCV A;  4JA7 A;  2VGX B;  4U07 A;  3MKR A;  5FZR A;  4JA9 A;  3RU0 A;  2PQR A;  3GYZ A;  4G24 A;  3TGO A;  1W3B A;  2LSV A;  1OUV A;  3FFL A;  3GZ2 A;  4I1A A;  4KBQ A;  4U0U A;  4WNG A;  1KLX A;  5KJK A;  4WUY A;  3VTY A;  2FI7 A;  4APO A;  4J8F A;  5A7D B;  2C0L A;  2J9Q A;  2VSY A;  4N2S A;  2XPI A;  3N71 A;  2KCK A;  2GW1 A;  5EX0 A;  3LY8 A;  1ELR A;  3ULQ A;  3UPV A;  3CVN A;  5KJN A;  3HYM B;  4BT9 A;  4G2V A;  4UQX A;  1E96 B;  3CK9 A;  3FP3 A;  5FT9 A;  3PE4 A;  3CVP A;  2OOE A;  1IYG A;  3CKC A;  3IEG A;  3UQ3 A;  3LY7 A;  2KC7 A;  3JYS A;  4N3B A;  5C1D A;  2VYI A;  4G26 A;  4RG9 A;  3TG4 A;  2KCL A;  2XEV A;  5FZS A;  4UI9 K;  3UUX A;  5HI7 A;  1YA0 A;  2WQH A;  3SF4 A;  3QOU A;  4BT8 A;  2XGS A;  3LCA A;  4UI9 J;  5D0Q D;  2XCB A;  4GCN A;  1ELW A;  3ASD A;  5ARF A;  3CKB A;  3O48 A;  3QWW A;  4I9E A;  3RO3 A;  5M72 A;  2OND A;  1WM5 A;  4JHR A;  4GPK A;  5BW8 C;  4CDR A;  3ESK A;  4CGW A;  2C0M A;  2XGO A;  3S7B A;  2FO7 A;  3ASH A;  3NF1 A;  3Q15 A;  4AY6 A;  2Y4U A;  3MV3 B;  4GYY A;  4N3C A;  5FZQ A;  4GA2 A;  4RG6 A;  5BT1 A;  4HOT A;  2R5S A;  4WNE A;  4WND A;  3ZPJ A;  2YHC A;  4N39 A;  5JJ6 A;  5JJT A;  2KAT A;  4HOS A;  3MA5 A;  1NA3 A;  4I2W A;  3ZGQ A;  2FF4 A;  2QFC A;  2VQ2 A;  3LKU A;  3Q5M A;  3OXG A;  4GYW A;  1XNF A;  3WXX A;  4U0S A;  4Y6W A;  5CHE E;  4HOQ A;  2I6H A;  4G1T A;  5AYW D;  3OXL A;  4I2Z A;  3S7D A;  2AVP A;  3GW4 A;  3S7F A;  4J0U A;  3RIB A;  3ZHE A;  4EQF A;  4AM9 A;  3KS2 A;  4H7Y A;  3LY9 A;  5FTP A;  5G05 C;  3SZ7 A;  4A1S A;  3EDT B;  1NA0 A;  4N3A A;  3CK7 A;  4HOR A;  2LNI A;  4GZ6 A;  4O6F A;  4F3V A;  3OXF A;  5LCW C;  3KD7 A;  4CGV A;  2NC9 A;  1IHG A;  5A6C A;  3CVL A;  3MV2 B;  3PDN A;  4BWR A;  2BUG A;  2IFU A;  3TG5 A;  2VGX A;  1P5Q A;  3CVQ A;  3E4B A;  3RO2 A;  2PL2 A;  1FCH A;  3AS4 A;  3ZN3 A;  2VSN A;  2E2E A;  1B89 A;  4UQY A;  5JJ7 A;  2L6J A;  4YVQ C;  3CEQ A;  5KJM A;  5ARG A;  5HQ8 A;  4GCO A;  3U3W A;  2FEZ A;  2XCC A;  4GZ5 A;  2HR2 A;  2VGY A;  5EKQ D;  2V5F A;  5CCL A;  3ASG A;  2IF4 A;  2WPV A;  4AY5 A;  5DIZ A;  2C2L A;  2UWJ G;  4KYO B;  4W9R A;  2Q7F A;  3RJV A;  2JLB A;  3AS8 A;  5EX3 A;  4GA0 A;  4GYO A;  4U04 A;  3R9A B;  3TAX A;  3URZ A;  3AS5 A;  5FJY A;  3VTX A;  4HOU A;  3CV0 A;  4N5C A;  3RKV A;  3KAE A;  4IN3 B;  4B94 A;  3CK8 A;  5G04 J;  3S7J A;  4LEU A;  1HZ4 A;  4AIF A;  4BTA A;  3LPZ A;  5BNW A;  4BTB A;  4N2Q A;  2MHK A;  4UQZ A;  3QKY A;  4XIF A;  3QWV A;  1QQE A;  4GA1 A;  5D0O D;  5G05 J;  3K9I A;  4I9C A;  4NRH B;  4GZ3 A;  4XI9 A;  4J8D A;  5DBK A;  1HH8 A;  2FBN A;  3Q4A B;  2LSU A;  2HO1 A;  4KXK B;  4WNF A;  4I17 A;  4NQ0 A;  4UI9 C;  4G25 A;  2HYZ A;  3LYA A;  3QDN A;  4ME2 A;  2XGM A;  3U4T A;  5G04 C;  1HXI A;  1TJC A;  2P58 C;  3PE3 A;  3ZFW A;  3ZHE B;  2Y4T A;  2YQ8 A;  3ASF A;  5CCM A;  5LCW J;  4YND A;  3GZ1 A;  1ZU2 A;  4JL0 A;  2UY1 B;  1Y8M A;  1KT1 A;  2PZI A;  3FWV A;  3Q49 B;  4G23 A;  4Y6C A;  3Q47 B; 
#chains in the Genus database with same CATH topology
 5EIB E;  3VTY A;  3PS6 A;  3QWP A;  2KCV A;  4E85 A;  4WNG A;  4B8C B;  2VSY A;  5AEN A;  3FUL A;  5B1A E;  1U3D A;  4U7E B;  2J49 A;  4G26 A;  3Q9U C;  4UI9 K;  4UUC A;  3UUX A;  3E30 A;  2OCC E;  2XRZ A;  4TXR A;  4HB5 A;  1E90 A;  5AN8 A;  3QWW A;  4I43 A;  5D66 A;  1PAQ A;  3UT4 A;  4GPK A;  5BT1 A;  3ZGQ A;  2IOL A;  3IV0 A;  3APF A;  1TEZ A;  2KZT A;  4Y6W A;  2I6H A;  4BX8 A;  1S70 B;  5FTP A;  3I3N A;  3NBN B;  4MLP A;  1HO8 A;  3RRU A;  2R59 A;  3L17 A;  4EZJ A;  3UM1 A;  2PM6 A;  1FCH A;  2EIK E;  4UQY A;  3SGH A;  1E8Y A;  2P9P G;  2XCC A;  2B6C A;  3LVR E;  3U9W A;  1HU3 A;  2C2L A;  3IHY A;  3NZU A;  4LCT A;  2FO1 E;  2MYO A;  2JLB A;  2BTD A;  3SD5 A;  4U8V D;  1JWF A;  3PUJ A;  5KWD A;  4BTB A;  2M63 A;  3FTS A;  3T8K A;  4PDX A;  3E37 A;  3D9H A;  3SO8 A;  3U64 A;  3SBS A;  3SI5 A;  2P9S G;  4ATG A;  4N2S A;  4JZY A;  5AAR A;  4F53 A;  3E34 A;  4UWH A;  3C98 A;  4D10 C;  3Q49 B;  3AG4 E;  4M3O A;  5C2Y A;  1NZN A;  3BEE A;  4YVO A;  1RZ4 A;  2IY0 C;  5G2N A;  2J9Q A;  4KT6 B;  3TXN A;  1H2T C;  5EX0 A;  3JXJ A;  1OWP A;  3CK9 A;  3UQ3 A;  3RRM B;  4C0M A;  3J5Q B;  4PS8 A;  3HXF A;  4J8Y A;  2P2C P;  2V4L A;  5BW8 C;  4J8S A;  2XPZ A;  3ASO E;  3BG0 B;  5LP0 A;  2R03 A;  3SBT B;  4WNE A;  3RAU A;  1U3C A;  3FHE A;  3LKU A;  4U8Y D;  4WWP A;  4I6J A;  2J4D A;  4HI8 A;  3GW4 A;  3EDT B;  2X6I A;  3SQV A;  3FTZ A;  5LOZ A;  3UI2 A;  3NQP A;  3TWQ A;  3CEQ A;  2VGY A;  3TWU A;  2F8Y A;  3EHR A;  4PS7 A;  3X2Q E;  5AQB A;  3VTX A;  2FUL A;  2ION A;  1O1S A;  5AQA A;  2WXP A;  1QQE A;  2BKK B;  4ACK A;  3K9I A;  4IUL A;  4EPZ A;  2VJ8 A;  1IKN D;  2IO3 C;  5T4Y A;  2AXU A;  3VLE A;  4B0Z A;  2CFU A;  1SVX A;  3ASF A;  4Y6C A;  5CRU A;  1N95 A;  2X6F A;  5KJL A;  4JA7 A;  3RU0 A;  2J08 A;  3GZ2 A;  3UTM A;  2XEE A;  3Q73 A;  3N71 A;  4TUU A;  1JCR A;  3BQO A;  3TXM A;  2OOE A;  1PY1 A;  3LY7 A;  4P29 A;  3PZ1 A;  3V79 K;  3LCA A;  5D0Q D;  4I6E A;  3L16 A;  5ARF A;  3O48 A;  4ANV A;  3FUI A;  3UM0 A;  1S0P A;  3KSL A;  2A5E A;  2GRR B;  2KAT A;  3Q5M A;  3CLJ A;  3QB2 A;  4HI9 A;  2KM4 A;  3ZXS A;  5HRY A;  2RFA A;  3DSU A;  5G05 C;  1GW6 A;  2VGE A;  4HFG A;  1O5M A;  4HBD A;  1LD7 A;  3PRE A;  4ILH B;  4FAD A;  3DXM G;  4KZC A;  1DNP A;  1V54 E;  3AG3 E;  5FIN A;  4LNG A;  3ML9 A;  3JQ1 A;  1UOH A;  4TUM A;  4AEZ C;  2GRO B;  2H6F A;  3TAX A;  5ITZ F;  2P9N G;  3QAQ A;  4AJW A;  2XS8 A;  4XI9 A;  4U63 A;  2EIN E;  2KBX A;  4F1P A;  3IKO B;  4PUC A;  4YND A;  3ZYL A;  3FY4 A;  4U0Z A;  2VTB A;  1A17 A;  4M7C A;  1N54 A;  4J8E A;  3B7R L;  3FFL A;  2DZN A;  3G2V A;  4I1A A;  5KNH D;  5KJK A;  4BER A;  4UWG A;  4G2V A;  4UQX A;  3MCX A;  4L23 A;  5CER B;  3FTX A;  3EHQ A;  3JYS A;  2WXQ A;  2WXK A;  4JEU A;  1N4P A;  5M72 A;  5ENQ D;  2NSZ A;  4HVB A;  2C0M A;  4ATZ D;  4B89 A;  2H6H A;  4WWN A;  4WND A;  4N39 A;  3B7T A;  3OXG A;  4GYW A;  3ZUV B;  4FUL A;  4U0S A;  4G1T A;  3S7F A;  4E6H A;  5CBN A;  1ELK A;  3KS2 A;  5EIL A;  3L9T A;  3PUK A;  3SFY A;  3ZYM A;  4ANW A;  5CMW A;  4ANX A;  5HKP A;  5JJ7 A;  1B89 A;  4KVO A;  3DSS A;  3TWW A;  5FIO A;  1MJ0 A;  2GRN B;  3FU0 A;  1N0R A;  4U8H A;  2DYS E;  3CV0 A;  5JMN D;  4CEM A;  1E7V A;  3ONK A;  2EQX A;  3NOC D;  2DVW A;  2BF0 X;  1UJJ A;  3UM2 A;  4GTQ A;  1HH8 A;  2R2L A;  2FBN A;  3D3M A;  3AAA C;  3JUI A;  5BV1 A;  4UI9 C;  4TXP A;  4BX9 A;  1FPP A;  1MYO A;  1LF8 A;  4G23 A;  2RFM A;  3B7B A;  3MEK A;  2UY1 A;  1Q2Z A;  3CHM A;  1OUV A;  2I2O A;  3L22 A;  4ANU A;  1D9S A;  3EU9 A;  1BU9 A;  3FP3 A;  3AU4 A;  2VYI A;  3SY2 A;  1YA0 A;  3ASN E;  3SFX A;  3FU3 A;  2R17 C;  3CKB A;  5ENT D;  3PVL A;  1TNU A;  2HE0 A;  4JW1 A;  2L6B A;  3ZIM A;  3MV3 B;  3RK6 A;  2ZIS A;  3AG1 E;  4GU5 A;  1BPO A;  2F37 A;  4AVX A;  5CHE E;  2OVF A;  3T9K A;  4AM9 A;  4EBA A;  4GZ6 A;  1HE8 A;  2AXZ A;  2RKK A;  1OWL A;  1Z3X A;  4DX5 D;  3C3O A;  2GRM A;  3PEU B;  5JHA A;  4GTO A;  5ENR D;  3C5R A;  1JCQ A;  2AWI A;  4GZ5 A;  1SW6 A;  2V5F A;  5BUZ A;  2UWJ G;  5BXO A;  3JCK C;  4A63 B;  2AW6 A;  1Y6I A;  3AS5 A;  3S2A A;  2DZO A;  1HF8 A;  1HZ4 A;  3EHN A;  4LEU A;  3LPZ A;  4MBG A;  2MOW A;  3ZW3 A;  4EBA G;  2WQ7 A;  1OCC E;  4JB8 P;  2P58 C;  1ZU2 A;  1N11 A;  2DBA A;  2WMO A;  1N9A A;  1H2V C;  1PC2 A;  1KT0 A;  1DCQ A;  2PQN A;  3ZKJ A;  4LRZ A;  3ZYK A;  2PQR A;  2PNN A;  4K0R A;  5A7D B;  2LAH A;  4UWF A;  3FU6 A;  3HYM B;  3LEW A;  1TYQ G;  4HLE A;  3DSX A;  1N52 A;  2IJG X;  3FUK A;  4TRQ A;  4RG9 A;  2XEV A;  4JVS A;  2WQH A;  3EHM A;  5J08 A;  1WM5 A;  1EF1 C;  1AP7 A;  2XPY A;  4AY6 A;  3ZRH A;  1SQM A;  4HS2 A;  3D9J A;  3CVU A;  2WQ6 A;  3WXX A;  2BED A;  5AYW D;  2AVP A;  2RG8 A;  4OYS A;  3APC A;  2WVI A;  2E2E A;  3DEO A;  3L82 A;  5H7P A;  2Q7F A;  4BSX A;  3HG0 D;  4IN3 B;  3FUM A;  3FDH A;  5G05 J;  3UX4 A;  5DBK A;  3UXG A;  2GRL A;  5ANR A;  2LXM A;  1K8K G;  2LO6 A;  4GMJ A;  3SHF A;  2KXP C;  3ZHE B;  3L13 A;  3G2T A;  3GZ1 A;  4JL0 A;  2DIW A;  1TNO A;  4ABN A;  4EEC A;  4JA9 A;  1YMP A;  2XHE A;  4DLO A;  4CDN A;  1IQU A;  1TN7 A;  2XPI A;  3EUV A;  5HS0 A;  3UT7 A;  3ZXP A;  3CVP A;  1ZB1 A;  4RLY A;  4LNB A;  4RQI A;  5HI7 A;  1AWC B;  2ETA A;  4XEI G;  4N3C A;  4HOT A;  2YHC A;  4Z68 A;  4FJZ A;  1DVP A;  4K5C A;  4BSZ B;  4NAC A;  3FTY A;  3DSV A;  3ZU7 B;  3RSE G;  5A6C A;  2BUG A;  1FT1 A;  1OWN A;  3U3W A;  5AJL A;  2P9U G;  3EIQ C;  1N0Q A;  5DIZ A;  3JUE A;  3W9F A;  3RJV A;  4YDO A;  2ZIR A;  3R9A B;  2IOS A;  3ISM C;  1FVH A;  3CHP A;  4N5C A;  5CMY A;  4CT0 A;  2WXO A;  5JHB A;  4F1S A;  3LVQ E;  3QKY A;  4XIF A;  2IU1 A;  2H6G A;  2NYJ A;  2X6H A;  3I4R B;  2ZU6 B;  2ZGD A;  4G25 A;  2HYZ A;  1N4R A;  4Q94 A;  3VLF A;  5EKQ D;  1UG3 A;  3I4G A;  2ILR A;  4QFV A;  4Q69 A;  2WMN A;  1NP7 A;  3AG2 E;  2VGX B;  3GYZ A;  4KVM A;  4U0U A;  1N94 A;  2C0L A;  4JC8 A;  4FU3 A;  3FUD A;  2IEJ A;  3MYV A;  4GTM A;  4UI9 J;  4U96 D;  3UT8 A;  3C3R A;  3RO3 A;  2OND A;  4JHK A;  5LFA A;  3TWX A;  5JA4 D;  3HVE A;  5JJT A;  4CCA A;  3MKQ A;  1BI8 B;  5FQ7 A;  2GRQ B;  3C72 A;  3ZHE A;  2I1K A;  4HNA D;  2Y0B G;  3CHO A;  3UKU G;  2YNQ A;  3IBE A;  4LUN U;  3CVL A;  3D9N A;  1BI7 B;  3TG5 A;  1JCS A;  3TWT A;  5KJM A;  4HRL A;  1MZC A;  2QYU A;  4JHJ A;  4KMO A;  4C9B B;  3ENE A;  2WM9 A;  4ACL A;  4XX5 A;  3AS8 A;  3URZ A;  1UW4 B;  4PH4 B;  4OVU A;  2NXP A;  3CVX A;  4GPM A;  1OWM A;  4NRH B;  3PZD A;  3IHV A;  3HXC A;  3UIO C;  1TNB A;  4GMR A;  4MKT A;  1QBQ A;  4O1O A;  4B93 B;  3KEA A;  4OAU C;  1O1T A;  1OY3 D;  3PNL B;  1KT1 A;  3FU5 A;  2RD0 A;  4JD2 G;  4ZHB A;  1MQS A;  2WXR A;  3HDX A;  5CRV A;  3UPV A;  2GW1 A;  5KJN A;  2X6K A;  5BXU A;  3CKC A;  2XQ0 A;  3Q7F A;  4FLH A;  2KC7 A;  4A55 A;  2KCL A;  2VSO E;  2Y69 E;  3QOU A;  1TJF A;  3LJ3 A;  3PZ2 A;  2XZD G;  3DEP A;  3FEX A;  3NF1 A;  3Q7A A;  4GYY A;  4F6R D;  1H0A A;  3QNK A;  1TR4 A;  4V3I A;  4O1P A;  4TXQ A;  1U2V G;  3CHQ A;  3S7D A;  3OXL A;  3LY9 A;  4DJA A;  4GZD A;  1IXV A;  3OXF A;  1S63 A;  2IFU A;  3FUF A;  1OCZ E;  3BUA A;  2VSN A;  3TJP A;  1JPL A;  1MX6 A;  4GTT A;  5B1B E;  3MZL B;  3T5X A;  2IF4 A;  5B3S E;  4FJY A;  1HG5 A;  4OVV A;  4GTP A;  4AIF A;  4BTA A;  5D0O D;  4IYP A;  4J6I A;  4A1G A;  3OTN A;  2P9L G;  1EDU A;  2P9K G;  2HO1 A;  4UWK A;  4DX1 A;  4EZK A;  2XGM A;  4DLQ A;  3UIP C;  5CCM A;  3ZEF A;  3FWV A;  4LNU D;  3FTV A;  2WXH A;  2X38 A;  3OAW A;  4BEP A;  3TL5 A;  1L5J A;  2WXM A;  5ENP D;  3V2X A;  3DWL G;  4K03 A;  4CYM D;  4BT9 A;  3D9M A;  3D9O A;  4G8L A;  4I1O B;  3ZYQ A;  2A5U A;  4L9P A;  2OV8 A;  4XKC A;  2XGS A;  5EID A;  4BT8 A;  4DI4 A;  1UN9 A;  1SA5 A;  4K5B A;  4CGW A;  2QC9 A;  5ENN A;  3S7B A;  4AV7 A;  4RG6 A;  1SZ9 A;  3BG1 B;  1X5B A;  4HOQ A;  1MHQ A;  1NA0 A;  4O6F A;  5LCW C;  4HQD A;  3TWR A;  3MV2 B;  1JWG A;  4EZL A;  3ULY A;  1K3Z D;  1LD8 A;  1UJK A;  3RO2 A;  1KPS B;  3ZN3 A;  2L6J A;  1OCO E;  2HR2 A;  4YDW A;  1FVF A;  1N4S A;  2J8S D;  2WXN A;  4XE0 A;  1JUQ A;  4JEH A;  2X6J A;  3DPD A;  3CK8 A;  5EN5 D;  3JQ0 A;  4DI3 A;  4I1M A;  5BNW A;  3G2U A;  3L08 A;  3HIZ A;  1HX8 A;  3QWV A;  3Q79 A;  3IXE A;  3B7S A;  2Y3A A;  4J8D A;  1QNF A;  1D8D A;  2CG2 A;  3BU8 A;  1OT8 A;  3MX3 A;  1HXI A;  3PEV B;  2B0O E;  3LJN A;  1Y8M A;  1ZBP A;  3R7Q A;  2P9I G;  3MKR A;  2L0I A;  4G24 A;  4Q96 A;  4BY6 A;  5T3R A;  2EIJ E;  4FA6 A;  4I6G A;  2OVB A;  1TNZ A;  4WWO A;  1E96 B;  3IEG A;  5FQ6 A;  4HRN A;  4N3B A;  2BKG A;  3FUN A;  3V30 A;  1ELW A;  1K1A A;  3B7U X;  4IRU A;  1KZP A;  1O1R A;  4C48 B;  4XZ4 A;  3MKQ B;  5BV0 A;  3HXE A;  2R5S A;  3ZPJ A;  3DPY A;  5JJ6 A;  1NL4 A;  2VQ2 A;  3ZVV A;  4CRW A;  4PS3 A;  2X3M A;  4EQF A;  4H7Y A;  4AXH A;  4N3A A;  3CK7 A;  4FP7 A;  4CGV A;  4BWR A;  4FLB A;  4URK A;  1YYH A;  2A4Z A;  5ENO D;  2EIL E;  5EYP F;  4YVQ C;  3PNT B;  5HQ8 A;  4AP2 A;  4GCO A;  1Z5S C;  4G8K A;  2I9C A;  3CQG B;  4KYO B;  2E0I A;  2I1J A;  5FJY A;  1X81 A;  1EYH A;  2J4B A;  4B94 A;  3DSW A;  1G3N B;  3UMV A;  1D8E A;  4I9C A;  1BLX B;  4TV3 A;  4KXK B;  1H6O A;  3QAR A;  3DBS A;  4ME2 A;  3U4T A;  3PE3 A;  2DYR E;  2GRP B;  3QJZ A;  2UY1 B;  2AXV A;  2GGF A;  2XEH A;  5FQ8 A;  3J5P A;  3C3Q A;  3CGH A;  4WAF A;  2ZGG A;  3ABK E;  3NAW A;  5C1D A;  4N5Q A;  5FZS A;  3SF4 A;  4GAA A;  4GCN A;  2WXI A;  3FH8 A;  4I9E A;  3G2S A;  3Q15 A;  1N4Q A;  2YHE A;  2VSX E;  4DK5 A;  3PH0 C;  3ABL E;  3KSQ A;  1E8W A;  3PZ3 A;  2XS1 A;  3L6A A;  1XNF A;  3CR3 A;  3GZS A;  4AOF A;  3RIB A;  2WXL A;  4HXI A;  3E32 A;  1P5Q A;  5AJD A;  3HHM A;  3HXB A;  3QC1 A;  4O60 A;  4GA0 A;  4GZC A;  5AQ7 A;  3KAE A;  3PRZ A;  3CIA A;  2LUH A;  3WG7 E;  4UQZ A;  1DC2 A;  3SFZ A;  1DCE A;  1IHB A;  2QYJ A;  1MX2 A;  4WNF A;  2Y1L E;  3FH5 A;  2AJA A;  3QDN A;  4MRU A;  1HFA A;  4CZ2 D;  3W9G A;  4N2Q A;  4JPS A;  5KBA A;  1MX4 A;  1QZ2 A;  5FZR A;  4U07 A;  3TGO A;  4KBQ A;  4EHM A;  1WG0 A;  2HM8 A;  3HVE B;  3ULQ A;  4LSZ E;  3PE4 A;  4A3V A;  5EDS A;  5CED B;  3ONL A;  3ASD A;  4L2Y A;  2XGO A;  4ILG A;  2V5Q C;  4K5A B;  1WDY A;  1S64 A;  1Z6T A;  1H6P A;  3MA5 A;  4G11 A;  5LX8 A;  1INZ A;  2R02 A;  3AJI A;  3L54 A;  4L1B A;  3SZ7 A;  2QZA A;  3UKR G;  2LNI A;  3ESL A;  3KD7 A;  4L7T A;  3DST A;  1NFI E;  5ANL A;  2J09 A;  2VGX A;  4NIK A;  1OCR E;  2QY7 A;  1VDY A;  4R7L A;  5ARG A;  3T8M A;  5CCL A;  2ETC A;  2IO2 C;  4W9R A;  4GYO A;  3TWV A;  3RKV A;  1A5E A;  5KCM A;  3S7J A;  3O4Z A;  2MHK A;  3F6Q A;  1BD8 A;  4I17 A;  1WY6 A;  2Y4T A;  3MGB A;  2PZI A;  3Q47 B;  2MRI A;  4XI0 A;  3U66 A;  4H7X A;  3TWS A;  1WAO 1;  4J7W A;  5FWQ A;  4CT4 A;  4QQI A;  4NUR A;  1W3B A;  2LSV A;  1KLX A;  4J8F A;  2H6I A;  4XKB A;  3VLD A;  1ELR A;  3CVN A;  3CHS A;  4C0E A;  1TNY A;  4ILI A;  5FQ4 A;  2IQC A;  4JXT A;  4GML A;  1H6K A;  4JHR A;  3CQC B;  3ESK A;  3ABM E;  1SA4 A;  2LAI A;  2FO7 A;  3ASH A;  2Y4U A;  3CST A;  2QFC A;  2WXJ A;  4HRM B;  4DUI A;  3KEZ A;  1K1B A;  5KNG A;  3E33 A;  3R7R A;  4HOR A;  2V4H C;  2NC9 A;  1IHG A;  3PDN A;  3FUH A;  3FEY A;  4A3T A;  4CDM A;  3E4B A;  3CVY A;  3CVQ A;  1H19 A;  3PZ4 A;  3AS4 A;  3NZS A;  4YDY A;  3JXI A;  4MS6 A;  4B8A A;  2WPV A;  1KZO A;  3SNX A;  5IY5 E;  4L2L A;  2PM7 A;  1Z3Y A;  3FTU A;  2EIM E;  1FT2 A;  5E76 A;  3CVV A;  3D9L A;  1SZA A;  2ZXW E;  3Q4A B;  1XGW A;  3R9M A;  2CHZ A;  1H2U A;  4NQ0 A;  5BPP A;  5G04 C;  1TJC A;  3CSF A;  4RVB A;  3FUJ A;  1E8Z A;  4BFR A;  2DWZ A;  1IQR A;  1E8X A;  4LER A;  3Q78 A;  2XEN A;  3NOG D;  2ETB A;  4DPR A;  5E75 A;  4HOS A;  4ZFH A;  4WUY A;  2FI7 A;  4APO A;  2L0T B;  4LG6 A;  3CHR A;  3UM3 A;  4FC8 A;  3D9P A;  1LTX A;  4GB9 A;  3LDZ A;  3TG4 A;  1HG2 A;  3UIN C;  3D9I A;  4BET A;  3D9K A;  4YDE A;  3ZNG A;  2XRY A;  2V8S E;  3B95 A;  2R05 A;  3P2B A;  2CFZ A;  4GA2 A;  1NA3 A;  3NB2 A;  1YCS B;  4I2Z A;  4J0U A;  3ULE G;  3Q9N C;  4DRX E;  4F3V A;  2CHW A;  2JAB A;  3LXU X;  5T8I A;  3V31 A;  4DX7 D;  3APD A;  4F7A A;  1TN6 A;  1OXJ A;  1TN8 A;  2V0P A;  4GTV A;  2OEV A;  3T5V A;  3Q75 A;  2F8X K;  1V55 E;  5CEA A;  5D2M C;  2VTB B;  3RRN B;  4U04 A;  2WXF A;  4HOU A;  3DXK G;  4BES A;  4HLL A;  1RW2 A;  3EIJ A;  3HRA A;  3DRA A;  3ZFW A;  4GTR A;  2YQ8 A;  4OAV B;  4FHJ A;  4I2W A;  5AIJ A;  5CBO A;  3LS8 A;  3G2W A;  4RSY A;  3HXD A;  3B13 A;  3FUE A;  2KCK A;  3LY8 A;  2LXL A;  4FHK A;  2WXG A;  3MJW A;  5FT9 A;  4U95 D;  1IYG A;  5ENS D;  2YIN A;  2JEK A;  3QK0 A;  2XCB A;  2L9B A;  4CDR A;  2F0Y A;  1E7U A;  5FZQ A;  3EU5 A;  1QYM A;  4APF A;  5AQ9 A;  2FF4 A;  3FTW A;  2CG3 A;  2KZT B;  1HS6 A;  4KZ0 A;  1NI1 A;  1OWO A;  2DCP A;  2J07 A;  4X8Q A;  3EJN A;  2XZT G;  4DX2 A;  2CHX A;  2PL2 A;  5AAO A;  4UWL A;  3P1U A;  2FEZ A;  2WB2 A;  3V2O A;  3ASG A;  4AY5 A;  3CVW A;  3I5P A;  5CEC B;  5EX3 A;  4DX6 D;  5G55 A;  5G04 J;  5J90 A;  2OEW A;  4GA1 A;  1EPU A;  4GZ3 A;  4GTS A;  2LSU A;  5A23 A;  3ML8 A;  3LYA A;  3FH7 A;  5EYL A;  5LCW J;  1UN8 A;  4A1S A;  3AU5 A; 
#chains in the Genus database with same CATH homology
 3MEK A;  3VTY A;  1QZ2 A;  2UY1 A;  3PS6 A;  3QWP A;  2KCV A;  4U07 A;  5FZR A;  3CHM A;  2RD0 A;  3TGO A;  4E85 A;  4KBQ A;  4WNG A;  1OUV A;  2I2O A;  1MQS A;  4B8C B;  2WXR A;  3HDX A;  2VSY A;  3L22 A;  5AEN A;  4ANU A;  2HM8 A;  3HVE B;  2GW1 A;  3ULQ A;  3FUL A;  3UPV A;  5KJN A;  2X6K A;  3FP3 A;  1U3D A;  3PE4 A;  3CKC A;  2J49 A;  2XQ0 A;  4FLH A;  3AU4 A;  2KC7 A;  4A55 A;  2VYI A;  4G26 A;  2KCL A;  2VSO E;  4UI9 K;  3UUX A;  1YA0 A;  4A3V A;  3QOU A;  5EDS A;  2XRZ A;  3ONL A;  3FU3 A;  1TJF A;  3ASD A;  1E90 A;  2R17 C;  3CKB A;  3LJ3 A;  3QWW A;  4I43 A;  3PVL A;  4L2Y A;  1PAQ A;  3FEX A;  3UT4 A;  4GPK A;  2XGO A;  4ILG A;  4JW1 A;  3NF1 A;  3ZIM A;  3MV3 B;  4GYY A;  5BT1 A;  3RK6 A;  4GU5 A;  1H0A A;  3QNK A;  1Z6T A;  3MA5 A;  1BPO A;  4V3I A;  3ZGQ A;  4G11 A;  2IOL A;  3IV0 A;  4AVX A;  3APF A;  1TEZ A;  2KZT A;  5LX8 A;  1INZ A;  4Y6W A;  3CHQ A;  5CHE E;  2I6H A;  2OVF A;  3S7D A;  3OXL A;  4BX8 A;  4EBA A;  4AM9 A;  3LY9 A;  4DJA A;  3L54 A;  5FTP A;  4GZD A;  4L1B A;  3SZ7 A;  3I3N A;  4MLP A;  2LNI A;  1HE8 A;  1HO8 A;  4GZ6 A;  3OXF A;  3RRU A;  3ESL A;  2R59 A;  3KD7 A;  2AXZ A;  3L17 A;  4L7T A;  1OWL A;  5ANL A;  2IFU A;  3FUF A;  4EZJ A;  2J09 A;  1Z3X A;  2VGX A;  5JHA A;  2PM6 A;  2GRM A;  3PEU B;  1FCH A;  2QY7 A;  1VDY A;  2VSN A;  3TJP A;  4UQY A;  1JPL A;  3SGH A;  1E8Y A;  4R7L A;  5ARG A;  3T8M A;  3MZL B;  2XCC A;  2AWI A;  4GZ5 A;  3LVR E;  3U9W A;  5CCL A;  2V5F A;  5BUZ A;  3T5X A;  2IF4 A;  4FJY A;  1HU3 A;  1HG5 A;  2C2L A;  2UWJ G;  3JCK C;  3IHY A;  3NZU A;  4LCT A;  4OVV A;  4W9R A;  2JLB A;  2BTD A;  4GYO A;  2AW6 A;  3SD5 A;  1Y6I A;  3AS5 A;  3S2A A;  3RKV A;  1JWF A;  3PUJ A;  5KCM A;  3S7J A;  1HF8 A;  1HZ4 A;  3EHN A;  4LEU A;  4AIF A;  3LPZ A;  4BTA A;  4AY6 A;  4BTB A;  3O4Z A;  2MHK A;  4N2Q A;  2M63 A;  2MOW A;  3FTS A;  5D0O D;  4IYP A;  3ZW3 A;  4PDX A;  4J6I A;  4A1G A;  3OTN A;  3U64 A;  3SBS A;  1EDU A;  2HO1 A;  4EBA G;  3SI5 A;  4I17 A;  2WQ7 A;  4UWK A;  4ATG A;  4EZK A;  2XGM A;  4DLQ A;  4N2S A;  4JZY A;  2P58 C;  1WY6 A;  4F53 A;  2Y4T A;  5CCM A;  4UWH A;  3C98 A;  1ZU2 A;  3ZEF A;  3MGB A;  2PZI A;  3FWV A;  4D10 C;  3Q49 B;  3FTV A;  2WXH A;  3Q47 B;  2DBA A;  2MRI A;  2X38 A;  4XI0 A;  2WMO A;  4M3O A;  3OAW A;  1H2V C;  1PC2 A;  1KT0 A;  1NZN A;  5C2Y A;  3BEE A;  4H7X A;  3U66 A;  4YVO A;  1WAO 1;  2PQN A;  4LRZ A;  3TL5 A;  5FWQ A;  3ZYK A;  2PQR A;  4CT4 A;  4NUR A;  1W3B A;  2LSV A;  1L5J A;  2WXM A;  4K0R A;  1KLX A;  5G2N A;  4J8F A;  4K03 A;  2J9Q A;  2LAH A;  5A7D B;  4KT6 B;  4UWF A;  1H2T C;  4XKB A;  5EX0 A;  3TXN A;  3VLD A;  1ELR A;  1OWP A;  3FU6 A;  3CVN A;  3CHS A;  3HYM B;  3D9M A;  3LEW A;  4BT9 A;  3CK9 A;  3D9O A;  4HLE A;  1N52 A;  2IJG X;  3UQ3 A;  3FUK A;  4TRQ A;  4I1O B;  4RG9 A;  3RRM B;  2XEV A;  4C0E A;  4JVS A;  4ILI A;  2WQH A;  4C0M A;  3ZYQ A;  4PS8 A;  2A5U A;  2IQC A;  2OV8 A;  3EHM A;  2XGS A;  4GML A;  4JXT A;  4XKC A;  5FQ4 A;  4BT8 A;  4DI4 A;  1H6K A;  1UN9 A;  5J08 A;  2V4L A;  1WM5 A;  4JHR A;  1EF1 C;  5BW8 C;  3CQC B;  3ESK A;  4CGW A;  2LAI A;  2XPY A;  2XPZ A;  4J8S A;  2FO7 A;  3ASH A;  3BG0 B;  5ENN A;  3S7B A;  2Y4U A;  5LP0 A;  3ZRH A;  4AV7 A;  1SQM A;  3SBT B;  3CST A;  4RG6 A;  4WNE A;  4HS2 A;  1SZ9 A;  3D9J A;  3CVU A;  2WQ6 A;  3BG1 B;  1U3C A;  2QFC A;  3FHE A;  2WXJ A;  3LKU A;  3WXX A;  1X5B A;  4WWP A;  4I6J A;  2J4D A;  4HOQ A;  3KEZ A;  5AYW D;  2AVP A;  3GW4 A;  1MHQ A;  3EDT B;  1NA0 A;  3R7R A;  4HOR A;  4O6F A;  5LCW C;  2NC9 A;  1IHG A;  2RG8 A;  2X6I A;  3MV2 B;  1JWG A;  3FUH A;  3PDN A;  4OYS A;  3FEY A;  4A3T A;  4CDM A;  4EZL A;  3E4B A;  3APC A;  3CVQ A;  1H19 A;  1UJK A;  2WVI A;  3FTZ A;  5LOZ A;  3RO2 A;  3CVY A;  3AS4 A;  3ZN3 A;  3NZS A;  2E2E A;  3NQP A;  2L6J A;  3CEQ A;  2HR2 A;  2VGY A;  1FVF A;  4MS6 A;  4B8A A;  4PS7 A;  2WPV A;  2WXN A;  4XE0 A;  2Q7F A;  3SNX A;  1JUQ A;  4BSX A;  4JEH A;  3VTX A;  2FUL A;  2ION A;  4L2L A;  2X6J A;  4IN3 B;  3DPD A;  3CK8 A;  2PM7 A;  3FUM A;  1Z3Y A;  2WXP A;  3JQ0 A;  4I1M A;  4DI3 A;  3FDH A;  5BNW A;  3G2U A;  3FTU A;  3L08 A;  3HIZ A;  1HX8 A;  5E76 A;  3QWV A;  1QQE A;  5G05 J;  3CVV A;  4ACK A;  3K9I A;  4IUL A;  4EPZ A;  3B7S A;  2Y3A A;  3UX4 A;  4J8D A;  1QNF A;  5DBK A;  3D9L A;  2GRL A;  1SZA A;  5ANR A;  2VJ8 A;  3Q4A B;  1XGW A;  2CG2 A;  2CHZ A;  1H2U A;  4NQ0 A;  5T4Y A;  2AXU A;  2LO6 A;  3MX3 A;  5BPP A;  4GMJ A;  5G04 C;  1HXI A;  1TJC A;  3CSF A;  2CFU A;  4RVB A;  3SHF A;  3VLE A;  3ZHE B;  3PEV B;  4B0Z A;  3FUJ A;  3ASF A;  1E8Z A;  3L13 A;  3G2T A;  3GZ1 A;  4BFR A;  4JL0 A;  1Y8M A;  2DIW A;  4Y6C A;  1E8X A;  1IQR A;  4LER A;  2X6F A;  4ABN A;  1ZBP A;  3R7Q A;  4EEC A;  5KJL A;  4JA7 A;  3RU0 A;  3MKR A;  4JA9 A;  2L0I A;  2J08 A;  4G24 A;  4Q96 A;  2XHE A;  4DLO A;  4DPR A;  3GZ2 A;  5E75 A;  4BY6 A;  5T3R A;  4CDN A;  4HOS A;  4WUY A;  2FI7 A;  4APO A;  1IQU A;  2L0T B;  2XPI A;  3N71 A;  4I6G A;  4FA6 A;  2OVB A;  3CHR A;  3UT7 A;  4TUU A;  4WWO A;  1E96 B;  4FC8 A;  3TXM A;  3CVP A;  2OOE A;  3D9P A;  3IEG A;  5FQ6 A;  4GB9 A;  1PY1 A;  3LY7 A;  4P29 A;  4N3B A;  3LDZ A;  3TG4 A;  3FUN A;  1HG2 A;  3D9I A;  5HI7 A;  3LCA A;  5D0Q D;  4I6E A;  1ELW A;  3D9K A;  3L16 A;  5ARF A;  3B7U X;  3O48 A;  2XRY A;  2V8S E;  4IRU A;  4ANV A;  4XZ4 A;  3FUI A;  3MKQ B;  3P2B A;  2CFZ A;  4N3C A;  1S0P A;  4GA2 A;  5BV0 A;  4HOT A;  2R5S A;  3ZPJ A;  2YHC A;  5JJ6 A;  4FJZ A;  2KAT A;  1DVP A;  1NA3 A;  2VQ2 A;  3Q5M A;  4NAC A;  3FTY A;  3CLJ A;  3ZVV A;  4CRW A;  4PS3 A;  4I2Z A;  3QB2 A;  2X3M A;  2KM4 A;  3ZXS A;  4J0U A;  4EQF A;  4H7Y A;  5G05 C;  1GW6 A;  4HFG A;  4N3A A;  3CK7 A;  4AXH A;  4FP7 A;  4F3V A;  2CHW A;  3LXU X;  4CGV A;  5A6C A;  5T8I A;  4BWR A;  2BUG A;  4FLB A;  3PRE A;  4ILH B;  4URK A;  4FAD A;  2A4Z A;  3APD A;  4F7A A;  4KZC A;  4YVQ C;  3PNT B;  1DNP A;  1OWN A;  2V0P A;  4AP2 A;  4GCO A;  5HQ8 A;  3U3W A;  3ML9 A;  5AJL A;  3JQ1 A;  2I9C A;  3EIQ C;  3T5V A;  4AEZ C;  5DIZ A;  3CQG B;  4KYO B;  2VTB B;  3RJV A;  2E0I A;  3RRN B;  4U04 A;  2I1J A;  3R9A B;  2IOS A;  2WXF A;  3TAX A;  5FJY A;  1FVH A;  3CHP A;  4HOU A;  4N5C A;  5CMY A;  1EYH A;  2J4B A;  4B94 A;  4CT0 A;  2WXO A;  5JHB A;  4F1S A;  3LVQ E;  3UMV A;  3QKY A;  3QAQ A;  4XIF A;  4AJW A;  2IU1 A;  4I9C A;  4XI9 A;  3EIJ A;  2X6H A;  4U63 A;  4TV3 A;  3I4R B;  2ZU6 B;  4KXK B;  3QAR A;  4G25 A;  2HYZ A;  3DBS A;  4ME2 A;  3U4T A;  3PE3 A;  3ZFW A;  2YQ8 A;  3IKO B;  4PUC A;  4FHJ A;  4Q94 A;  4YND A;  3QJZ A;  3ZYL A;  2UY1 B;  3FY4 A;  2AXV A;  2GGF A;  4I2W A;  3VLF A;  5EKQ D;  1UG3 A;  3I4G A;  4U0Z A;  2VTB A;  1A17 A;  5FQ8 A;  2ILR A;  4QFV A;  1N54 A;  4Q69 A;  2WMN A;  3CGH A;  5AIJ A;  1NP7 A;  4J8E A;  2VGX B;  3GYZ A;  3G2W A;  3B7R L;  3LS8 A;  4RSY A;  3FFL A;  4KVM A;  3G2V A;  4I1A A;  4WAF A;  4U0U A;  5KJK A;  2C0L A;  3B13 A;  4JC8 A;  3FUE A;  2KCK A;  4UWG A;  3LY8 A;  4FU3 A;  4FHK A;  2WXG A;  3MJW A;  4G2V A;  3FUD A;  3MYV A;  4UQX A;  5FT9 A;  1IYG A;  3MCX A;  4L23 A;  3FTX A;  3JYS A;  2YIN A;  5C1D A;  2JEK A;  2WXQ A;  5FZS A;  2WXK A;  4JEU A;  3SF4 A;  3QK0 A;  4GAA A;  4UI9 J;  2XCB A;  4GCN A;  3UT8 A;  2WXI A;  3FH8 A;  2L9B A;  4I9E A;  3RO3 A;  3G2S A;  5M72 A;  2NSZ A;  2OND A;  4JHK A;  4HVB A;  4CDR A;  2C0M A;  5LFA A;  4B89 A;  3Q15 A;  5FZQ A;  1E7U A;  2YHE A;  2VSX E;  4WWN A;  4WND A;  3PH0 C;  4N39 A;  4DK5 A;  3HVE A;  5JJT A;  4CCA A;  3MKQ A;  4APF A;  1E8W A;  2FF4 A;  3B7T A;  3L6A A;  3OXG A;  4GYW A;  1XNF A;  3CR3 A;  4FUL A;  5FQ7 A;  4U0S A;  3GZS A;  4G1T A;  3S7F A;  4E6H A;  4AOF A;  3RIB A;  3ZHE A;  3FTW A;  1ELK A;  2CG3 A;  3KS2 A;  2KZT B;  1HS6 A;  2I1K A;  4KZ0 A;  1OWO A;  2DCP A;  2J07 A;  3CHO A;  2WXL A;  2YNQ A;  3IBE A;  4LUN U;  3CVL A;  3PUK A;  3D9N A;  3EJN A;  4HXI A;  3TG5 A;  1P5Q A;  3ZYM A;  4ANW A;  5AJD A;  2CHX A;  2PL2 A;  5CMW A;  3HHM A;  4ANX A;  5JJ7 A;  1B89 A;  4KVO A;  4UWL A;  5KJM A;  3P1U A;  4JHJ A;  4KMO A;  2FEZ A;  4C9B B;  2WB2 A;  3ENE A;  2WM9 A;  3ASG A;  4ACL A;  4AY5 A;  3CVW A;  3FU0 A;  3QC1 A;  4XX5 A;  3I5P A;  3AS8 A;  4U8H A;  5EX3 A;  4GA0 A;  4GZC A;  3URZ A;  1UW4 B;  3CV0 A;  5G55 A;  3KAE A;  4PH4 B;  4OVU A;  3PRZ A;  4CEM A;  1E7V A;  5G04 J;  3ONK A;  5J90 A;  2EQX A;  3CIA A;  2NXP A;  3CVX A;  2BF0 X;  1UJJ A;  4UQZ A;  4GA1 A;  1OWM A;  1EPU A;  4NRH B;  4GZ3 A;  3PZD A;  1HH8 A;  3IHV A;  2FBN A;  3D3M A;  3SFZ A;  2LSU A;  3JUI A;  4MKT A;  5A23 A;  4WNF A;  5BV1 A;  4UI9 C;  3FH5 A;  3ML8 A;  3LYA A;  3QDN A;  4MRU A;  3FH7 A;  1HFA A;  4BX9 A;  5LCW J;  3PNL B;  1LF8 A;  1KT1 A;  1UN8 A;  4G23 A;  4A1S A;  3AU5 A;  3FU5 A;  4JPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...