3RO3A

Crystal structure of lgn/minscuteable complex
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
159
structure length
159
Chain Sequence
SRAAQGRAFGNLGNTHYLLGNFRDAVIAHEQRLLIAKEFGDKAAERIAYSNLGNAYIFLGEFETASEYYKKTLLLARQLKDRAVEAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIAQELKDRIGEGRACWSLGNAYTALGNHDQAMHFAEKHLEISREV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords G-protein-signaling modulator 2
publication title LGN/mInsc and LGN/NuMA complex structures suggest distinct functions in asymmetric cell division for the Par3/mInsc/LGN and G[alpha]i/LGN/NuMA pathways
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 74
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2011-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13176 TPR_7 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ro3A00
2HR2A 2XPIA 4UI9K 2IF4A 4G1TA 4N2SA 4I2ZA 2PQNA 3ASFA 5EX3A 4G25A 2L6JA 1IYGA 1OUVA 5A7DB 3CEQA 4GA1A 3LKUA 3NF1A 2E2EA 2KATA 1A17A 5EX0A 4N3AA 3SF4A 5BT1A 3ZGQA 4JHRA 4B94A 3O48A 3MA5A 4AIFA 4UQXA 4NRHB 2XCBA 2J9QA 3AS4A 4AM9A 3U4TA 2UWJG 4BT9A 3AS5A 2YHCA 4HOTA 2HO1A 2Y4UA 4U0ZA 4U04A 5KJNA 2ONDA 5LCWJ 2VSYA 2YQ8A 1QZ2A 4KXKB 4KBQA 3LPZA 5ARGA 4HOUA 4GPKA 1KLXA 3CK7A 4I1AA 1ELWA 3CK9A 2FBNA 4YVQC 2UY1B 5KJLA 2XEVA 4ABNA 4BT8A 3EDTB 3K9IA 4Y6WA 2NC9A 4LEUA 1XNFA 2XGMA 2FEZA 1HXIA 2MHKA 3CVLA 2PQRA 4YVOA 3S7BA 3OXFA 5ARFA 3PE4A 4G23A 3LY9A 3OXLA 3ASGA 3TG5A 4GCNA 4F3VA 2AVPA 3GZ1A 4I9EA 3RU0A 1W3BA 3Q5MA 2JLBA 1IHGA 5CCLA 4XI0A 4CGVA 2C0LA 2VGXB 5CCMA 1FCHA 1ELRA 2XGOA 5G04J 4JA7A 5HQ8A 2IFUA 1TJCA 3KS2A 4N2QA 2GW1A 5FT9A 1NA3A 3KD7A 3Q4AB 2FO7A 3QWVA 2PL2A 4AY5A 1Y8MA 4EQFA 4HORA 3UUXA 5EKQD 2Q7FA 3MV2B 2KC7A 3RIBA 4G2VA 2HYZA 4BWRA 4CDRA 3RKVA 3SZ7A 3TGOA 4I17A 3GYZA 4J8DA 1YA0A 4N39A 4WNGA 5D0OD 3LY7A 2BUGA 3AS8A 5LCWC 4H7XA 4AY6A 3VTXA 1KT1A 4W9RA 2WPVA 4WNFA 5FZSA 3S7DA 4NQ0A 4GCOA 4XI9A 3CVPA 2FI7A 4APOA 5KJKA 1QQEA 3CK8A 2VSNA 3PE3A 4H7YA 1WAO1 4J8EA 1HZ4A 5JJTA 3LY8A 3ZN3A 3Q47B 4WNEA 5G05J 2KCKA 4YNDA 5A6CA 1NA0A 4GYYA 3GZ2A 4U0UA 3UQ3A 2P58C 4UQZA 4Y6CA 4XIFA 3ASHA 3Q15A 4I9CA 1ZU2A 2VYIA 4O6FA 5DBKA 3CKCA 4GA2A 2PZIA 3BEEA 4UI9J 4GYOA 3ZHEB 4CGWA 1P5QA 4U07A 3FFLA 5DIZA 5G04C 4GZ5A 5KJMA 5HI7A 3HYMB 2V5FA 4I2WA 4JL0A 3MEKA 3S7JA 1NZNA 3E4BA 3ZPJA 2C0MA 3LYAA 3MV3B 3ULQA 3FP3A 1E96B 4HOQA 2FF4A 3RO3A 2Y4TA 4KYOB 3S7FA 2I6HA 5C1DA 3N71A 4BTAA 3CKBA 2LNIA 2LSUA 2KCVA 1KT0A 3RO2A 3U3WA 2VGYA 4N3CA 3R9AB 4JA9A 3IEGA 2WQHA 3QOUA 3Q49B 3ESKA 4WNDA 3JYSA 3ASDA 2XGSA 4WUYA 3KAEA 3OXGA 5BW8C 3TG4A 1WM5A 4ME2A 5CHEE 2LSVA 3RJVA 3QKYA 5G05C 2C2LA 2UY1A 4A1SA 2OOEA 2R5SA 5D0QD 4G24A 4GYWA 3LCAA 5JJ6A 4U0SA 3UPVA 4BTBA 3WXXA 4GA0A 1B89A 5FZRA 3URZA 1ZBPA 4HOSA 4J0UA 5JJ7A 4UI9C 4RG9A 5AYWD 5M72A 5FJYA 2KCLA 3CV0A 5FZQA 3QDNA 2VQ2A 3ZFWA 4GZ3A 3VTYA 3MKRA 3ZHEA 4G26A 3QWWA 3FWVA 2DBAA 4RG6A 1HH8A 4N3BA 2XCCA 3TAXA 1PC2A 2QFCA 2VGXA 5FTPA 3QWPA 4IN3B 4UQYA 3PDNA 4N5CA 3GW4A 3CVNA 4J8FA 3CVQA 5BNWA 4GZ6A
chains in the Genus database with same CATH superfamily
1OCZE 3HG0D 4J6IA 3V79K 4I2ZA 2I1JA 1TN6A 1FPPA 5AJLA 3Q9NC 2XENA 4JD2G 3PEVB 1OUVA 1UG3A 1X5BA 3EU5A 4KT6B 3UKRG 5ENQD 2P9PG 3ZGQA 1HO8A 4LG6A 4B94A 5G2NA 3LS8A 3AS4A 4GPMA 3U4TA 4RLYA 1Z3XA 4I6GA 3NB2A 3VLDA 2R05A 5ENOD 5LP0A 4DX6D 2RFMA 3CHRA 3FUJA 4G11A 2X6IA 3CIAA 2XS1A 4FJZA 4KBQA 3UINC 2CHWA 5ARGA 2F8XK 2XHEA 4NACA 2XEVA 3TWTA 4HRNA 4ABNA 4BX9A 4DUIA 2IY0C 4X8QA 3V31A 1H19A 4CRWA 2XGMA 4LRZA 3BU8A 4HLEA 3CVLA 1TJFA 5EN5D 2MOWA 3NOGD 3LY9A 3ASGA 3TG5A 2AVPA 2AXUA 3C3QA 3RU0A 2J49A 3UTMA 3RRUA 1W3BA 3AJIA 2MRIA 3HXCA 2YNQA 1IHGA 5IY5E 4IYPA 1S0PA 2WXGA 4CDMA 4ILHB 1Q2ZA 1NFIE 3B7TA 4K5BA 5G04J 2X38A 4DRXE 1A5EA 3JQ0A 4L1BA 3QARA 3L22A 5HQ8A 3KS2A 4N2QA 3EJNA 1MHQA 3QWVA 5FQ8A 4JB8P 4XE0A 1BU9A 2GROB 3UUXA 4V3IA 5EKQD 3PNTB 3JXJA 3I5PA 2ETCA 3FU0A 3RIBA 4G2VA 4BWRA 4CDRA 3C3RA 4J8DA 1JWGA 1YA0A 2V0PA 3UMVA 3LY7A 3DXMG 4HI9A 1KT1A 4W9RA 5FZSA 3NZUA 3I3NA 4FHKA 5T8IA 3S7DA 3V2OA 5CBOA 4ANUA 4TUUA 2AW6A 4WAFA 2FI7A 1BI8B 3D9KA 3FUMA 3E37A 5KJKA 1QQEA 4FJYA 2VSNA 3ENEA 3PE3A 4U7EB 2XEEA 4J8EA 1HZ4A 4UUCA 3ZN3A 5AQ7A 3TWWA 2KBXA 4AOFA 5CEAA 4OAVB 4J8YA 2YINA 3VLFA 5H7PA 5A23A 5BV1A 4K0RA 3ZXPA 3PEUB 3ASHA 1N94A 1SW6A 5ENSD 3RAUA 4GYOA 1P5QA 4A3VA 1RZ4A 3FFLA 2OEWA 4CCAA 3TXMA 1BPOA 5LX8A 5JMND 3MYVA 3FY4A 3LEWA 2WMOA 1N4RA 4F53A 4Q94A 3V30A 1NI1A 1TNUA 4D10C 3E4BA 3QAQA 2R17C 4GMLA 2XS8A 3TWVA 1K3ZD 1SZAA 3JQ1A 3ULQA 4PS7A 3E34A 2Y4TA 1OXJA 1EF1C 1O1TA 2EIJE 3AG2E 1BD8A 3N71A 4BTAA 1HFAA 2LSUA 3HXBA 2H6GA 2GRLA 3U3WA 1H0AA 5EIDA 1OCRE 5LOZA 3D9JA 1N4QA 3BG0B 5CMWA 5AJDA 3LJ3A 2KXPC 3R9AB 4JA9A 3IEGA 1HF8A 2I1KA 3ESKA 5AENA 4TXQA 3ZRHA 1IHBA 2I9CA 3Q9UC 2CG2A 1V55E 4HB5A 5AQ9A 2GRNB 4ME2A 2B6CA 4HLLA 3CHPA 3PVLA 2X6KA 4UWFA 1O5MA 2UY1A 2OOEA 4FHJA 4GTTA 1MX2A 3EU9A 1JCSA 4I1OB 5CMYA 1OWPA 3CHMA 5CEDB 5JJ6A 4BTBA 4A3TA 4WWPA 4L2LA 4GA0A 4EBAG 4CEMA 3MCXA 4O1OA 4HOSA 3BG1B 1D8EA 3P1UA 4F1PA 4RG9A 3ZNGA 4B8CB 3R7QA 3QDNA 3FDHA 3QWWA 1RW2A 2AXVA 5CBNA 1HH8A 4DX5D 3SY2A 5C2YA 3FUFA 4ANVA 3ASOE 5BV0A 3QWPA 3E33A 4IN3B 1OWMA 2XRYA 4ATZD 2A4ZA 2P9NG 3SGHA 3G2SA 4EBAA 2XPIA 3UIOC 3IV0A 3DPDA 1VDYA 4LCTA 3OAWA 4L23A 2OEVA 3MX3A 2BEDA 1A17A 2X6JA 5EX0A 3SF4A 2FULA 4B89A 3MA5A 3BUAA 5B1BE 2ZXWE 4NRHB 1JUQA 3ABKE 3FTXA 5JHAA 4BSZB 4OVVA 4DPRA 1SZ9A 3FU6A 2J07A 2UWJG 3MKQA 3FH5A 4BSXA 2Y69E 5FINA 2L6BA 2HO1A 3AG1E 2VGEA 4I43A 3SD5A 4U04A 3ONKA 5J08A 2VSYA 4DX1A 2V4HC 1MJ0A 4FP7A 2V4LA 2VSOE 1QZ2A 2AJAA 4U8VD 4KXKB 2WXLA 3SFZA 3LPZA 5ENNA 3EIQC 1XGWA 1KLXA 4JXTA 4CYMD 1ELWA 4JZYA 3UIPC 2FBNA 2QC9A 5ANLA 2UY1B 2GGFA 2QZAA 1WG0A 5KJLA 4JEHA 2P9IG 4BT8A 1D9SA 1IQUA 3ZYKA 1HE8A 2WXPA 3DEOA 1UJJA 2FEZA 1HU3A 4C0EA 4UWKA 4DX7D 3FUDA 3PE4A 4G23A 3FUNA 4F3VA 3CHQA 3GZ1A 2WXKA 4G8LA 2KZTB 3Q73A 3Q5MA 2JEKA 2JLBA 1EDUA 3PZ4A 4CGVA 4DI4A 3KSQA 2C0LA 3FH7A 1N4PA 5HKPA 3D9OA 5AQAA 4LERA 1E7VA 3D9HA 4JVSA 3TJPA 5FQ6A 2JABA 4M3OA 3R9MA 3FUHA 2WQ7A 4IRUA 3DXKG 1Y8MA 4BERA 4HORA 4EZKA 3E30A 2AWIA 2GRPB 2Y1LE 3DSWA 4GTVA 2V8SE 5HS0A 2EILE 2I2OA 2WXMA 3ONLA 3AU5A 4NIKA 4I17A 3O4ZA 1KZOA 1DNPA 4NURA 2WXHA 4F7AA 5LCWC 1JWFA 4AY6A 3VTXA 4WNFA 4ZHBA 2EINE 3VLEA 2VJ8A 3PZ3A 4NQ0A 2QYUA 1QBQA 3NAWA 3T9KA 4EPZA 3UM1A 1UOHA 3CVPA 4JHKA 3J5QB 1OCOE 3ZU7B 4XEIG 1AWCB 3TWUA 5AAOA 1HG5A 4TUMA 5KNGA 4H7YA 3FTVA 1WAO1 3LY8A 2P9UG 3FH8A 3FHEA 1S63A 4A55A 3CHSA 5BXUA 3QJZA 3T5XA 5A6CA 3UQ3A 4J8SA 3QNKA 4LSZE 3C72A 3ZYLA 3CR3A 3HXEA 3CKCA 2PZIA 4CGWA 2IEJA 2LAIA 2L0TB 1OWNA 2HM8A 4JEUA 2NYJA 1K8KG 5FWQA 4MLPA 2DYSE 4I2WA 4JL0A 4GMJA 4PUCA 3Q78A 4FA6A 2WXOA 4HVBA 4TXRA 2KM4A 2C0MA 3HVEA 4GTOA 3EHRA 3LYAA 3MV3B 4HBDA 3CVUA 3RO3A 4KYOB 3AG4E 3MJWA 3SBSA 5C1DA 3ZYMA 2WXQA 2LNIA 4HRMB 3PUKA 1KT0A 3ZUVB 3RO2A 2YHEA 4GZCA 5BPPA 1YYHA 1LD7A 4HXIA 1HS6A 4CDNA 4QFVA 4GZDA 3UT4A 3L17A 2Y3AA 4AJWA 2VGYA 2IU1A 2FO1E 2RFAA 4RVBA 3Q49B 2DZOA 1UW4B 2QYJA 2IOSA 1N0QA 2XGSA 4OAUC 3TG4A 4OVUA 3L54A 2MYOA 3JUIA 2F37A 1FVFA 3T5VA 2LSVA 3RJVA 2Y0BG 5G05C 2C2LA 4A1SA 2R5SA 2HE0A 4TV3A 3B95A 1EPUA 4PDXA 4GYWA 5T4YA 1H2UA 3B7UX 5FZRA 1X81A 4K03A 3L16A 3AAAC 4UI9C 2CHXA 5M72A 3DSVA 5BXOA 2WXRA 2KCLA 5FZQA 3TWQA 4UWLA 1N4SA 3ZFWA 1PY1A 2LO6A 4AV7A 3MKRA 3ZHEA 1Z3YA 2X6HA 3HXFA 2GRRB 4G26A 4AP2A 3ZXSA 2IJGX 4RG6A 1S70B 1N9AA 5EILA 4MKTA 3SFXA 2QFCA 2AXZA 5FTPA 3PDNA 1TR4A 4I1MA 4YDEA 3CVNA 4L2YA 5BNWA 5ANRA 5FQ7A 3SI5A 2ZISA 2HR2A 3NOCD 5T3RA 1TNOA 2ILRA 2IF4A 4G1TA 1E7UA 3HVEB 3ASFA 4RSYA 4O1PA 2P9KG 3HHMA 5EX3A 4G25A 4A63B 2L6JA 3SBTB 3APDA 4DI3A 3CEQA 1Y6IA 4C0MA 3D9PA 5AIJA 3EHMA 3DSXA 4JHRA 1U2VG 4AIFA 3CHOA 4UQXA 4ACKA 5CRUA 3X2QE 4PS8A 4WWOA 4URKA 1HX8A 4AM9A 3SNXA 2XEHA 4BT9A 3FEYA 2B0OE 1V54E 1JCQA 3AS5A 2J08A 2LXLA 2ETBA 2Y4UA 4U0ZA 4FLBA 1E8ZA 3ZKJA 2ONDA 2XPZA 5LCWJ 2YQ8A 3UT7A 1N54A 2J4BA 3PUJA 4HOUA 4FU3A 4AEZC 3CK7A 4I1AA 4KZ0A 3ML8A 4GTRA 3UT8A 5LFAA 3ABLE 1TN8A 1FT1A 1OY3D 3K9IA 4JHJA 4LEUA 4E85A 5EIBE 1HXIA 1L5JA 1G3NB 2MHKA 5B1AE 1U3CA 1LTXA 4HNAD 2WXNA 2PQRA 3G2VA 4CZ2D 3SFYA 2BF0X 4L7TA 3TL5A 3CQGB 3IBEA 1ZB1A 3APCA 4FLHA 3KEZA 5CCLA 1MZCA 2WM9A 3OTNA 3FTZA 4XI0A 1WY6A 4ZFHA 1FCHA 3CSTA 4JA7A 4IULA 3ESLA 4MS6A 1TJCA 2DZNA 3FTUA 2ZGGA 2GW1A 2FO7A 3QC1A 3CVXA 4AY5A 3FU5A 4U96D 4LNBA 3ZW3A 1SQMA 1UN9A 4GB9A 3JUEA 2WQ6A 1PAQA 4EZLA 4HRLA 2V5QC 4F1SA 2Q7FA 2WB2A 2KC7A 2P9SG 1TNYA 3RKVA 3TGOA 3Q7AA 5B3SE 4WNGA 5D0OD 2A5EA 3RRNB 2H6HA 2DIWA 3R7RA 4H7XA 2WXJA 2WPVA 2LAHA 3UM3A 3CGHA 5AARA 3EHNA 4ILGA 4APOA 3APFA 2NXPA 3DSUA 3CQCB 3CK8A 5JA4D 4PH4B 3Q47B 4WNEA 5G05J 3L9TA 1KPSB 3SQVA 4YDOA 3GZ2A 4U0UA 5KWDA 3IHYA 2P58C 3Q15A 4U63A 4O6FA 5DBKA 3BEEA 4UI9J 4U07A 3B7BA 2EQXA 1Z6TA 2J09A 4TXPA 2J4DA 2PM7A 1OWLA 1ELKA 4XKBA 3HYMB 3DPYA 4FULA 3DSSA 1U3DA 4HFGA 1NZNA 3L82A 3ZVVA 3PRZA 4C48B 3LDZA 3RK6A 4L9PA 4DK5A 1E96B 2R03A 4DLQA 4K5CA 2I6HA 4E6HA 1JCRA 4EECA 2KCVA 1OT8A 3W9GA 3PS6A 1OWOA 5ENTD 4B8AA 4OYSA 3MGBA 3CVVA 4BY6A 3NZSA 3MKQB 3PH0C 3JCKC 1Z5SC 1HG2A 4DJAA 2WQHA 2L0IA 4UWHA 5E75A 4WNDA 4HQDA 2J8SD 3KAEA 3OXGA 4LUNU 3C98A 5CHEE 1K1AA 2OVFA 3UKUG 5KNHD 2XZTG 3RRMB 1AP7A 3QKYA 1K1BA 2IO3C 3EHQA 4BESA 2IOLA 5FQ4A 4APFA 4U8YD 4GMRA 5FIOA 3FUKA 2ZGDA 4G24A 3S2AA 3IHVA 2XRZA 3UPVA 3WXXA 3ZEFA 3IXEA 3URZA 2GRMA 4J0UA 4GTMA 3L08A 2XZDG 3AU4A 5AYWD 5FJYA 2VQ2A 3V2XA 4CT4A 3VTYA 5ENRD 3PZ2A 3F6QA 4N3BA 5ENPD 2XCCA 3U66A 1PC2A 3PNLB 2VGXA 3Q75A 3D9MA 2DYRE 3UXGA 2ETAA 1JPLA 3KEAA 3L13A 4UWGA 4J8FA 4B93B 1EYHA 2BTDA 4Q69A 3LVQE 4GZ6A 2F0YA 3FUIA 4UI9K 4N2SA 4N5QA 2ZIRA 1TYQG 2PQNA 2R59A 3D9LA 1LF8A 4B0ZA 1IYGA 5A7DB 4GA1A 3LKUA 2WXIA 3NF1A 4KMOA 2E2EA 4F6RD 2KATA 4N3AA 3I4GA 5BT1A 4HI8A 5EYLA 1BLXB 3O48A 1INZA 2P2CP 3Q7FA 2XCBA 4O60A 2J9QA 3P2BA 3TXNA 3WG7E 1BI7B 4AXHA 4BEPA 2EIME 2YHCA 4HOTA 3TWRA 2RKKA 1TNBA 3C5RA 4PS3A 4AVXA 5KJNA 2BKKB 5ITZF 4QQIA 3ASNE 3T8MA 4GPKA 4XX5A 3CK9A 4YVQC 1N11A 2CG3A 3NQPA 3LVRE 5D66A 4LNGA 2H6FA 1H6OA 3EDTB 4YDYA 4GTSA 4Y6WA 2NC9A 1XNFA 4CT0A 3HIZA 5CECB 3ZYQA 3UM0A 4YVOA 3S7BA 3OXFA 5ARFA 4BX8A 1H6PA 2OV8A 2DVWA 3FUEA 3OXLA 4GCNA 4I9EA 4GAAA 1MX4A 4EHMA 4MBGA 1LD8A 5EYPF 3SHFA 4ANXA 2VTBA 3RSEG 2M63A 3L6AA 2VGXB 5CCMA 1ELRA 5EDSA 2XGOA 3J5PA 1H2VC 2CHZA 4GTQA 2IFUA 4C9BB 5FT9A 5KCMA 1NA3A 3KD7A 3Q4AB 3FTWA 3CVYA 3D3MA 2PL2A 2BKGA 4U95D 2PM6A 3G2UA 4EQFA 1UN8A 3CVWA 5J90A 2CFZA 2X6FA 3UX4A 5AN8A 3FULA 4DLOA 3MV2B 2HYZA 3TWXA 3I4RB 3SZ7A 2QY7A 1GW6A 4XZ4A 1TNZA 3GYZA 4N39A 4Q96A 1E8YA 3SO8A 1H6KA 2BUGA 3AS8A 3GZSA 5HRYA 3PREA 3E32A 4GCOA 4XI9A 4Z68A 3MZLB 3QK0A 3FTYA 3B7SA 1OCCE 4KVMA 1WDYA 1O1SA 2IO2C 3JXIA 4JPSA 4BETA 5JJTA 4A1GA 2DCPA 3HDXA 3W9FA 2EIKE 2E0IA 1IQRA 4YDWA 2VSXE 3LJNA 1MYOA 4K5AB 3KSLA 4ACLA 2KCKA 3HRAA 3PZ1A 5G55A 4YNDA 3G2WA 1NA0A 4GYYA 4R7LA 2F8YA 1S64A 5D2MC 2XQ0A 4UQZA 2LUHA 4J7WA 4Y6CA 1D8DA 4XIFA 4I9CA 1FVHA 1ZU2A 3ABME 2VYIA 1UJKA 4GA2A 2KZTA 3ZHEB 4P29A 1O1RA 1IKND 4KZCA 4FC8A 5DIZA 5KBAA 3CLJA 5G04C 4ANWA 1KZPA 4GZ5A 4ATGA 5HI7A 5KJMA 1N95A 2V5FA 3G2TA 4G8KA 3MEKA 3S7JA 2PNNA 2DWZA 4JW1A 2VTBB 1SA4A 4ILIA 3ZPJA 2P9LG 4GU5A 3FU3A 4BFRA 3B7RL 2ZU6B 3EIJA 1E8WA 1SA5A 2OCCE 1TEZA 3FP3A 1DC2A 4HOQA 2FF4A 3Q79A 5AQBA 3S7FA 3CSFA 1YMPA 5CRVA 4LNUD 1DCQA 3CKBA 4TRQA 1YCSB 4JC8A 4XKCA 4FADA 1H2TC 3ISMC 1QNFA 1IXVA 1QYMA 3NBNB 3DEPA 4KVOA 4M7CA 2OVBA 4GTPA 4HS2A 3ULYA 1E90A 1MQSA 2WMNA 4N3CA 1NL4A 3U9WA 3DWLG 3QOUA 5JHBA 3JYSA 4I6EA 3PZDA 3ASDA 2IQCA 4WUYA 2RD0A 5BW8C 1DCEA 3DSTA 3ULEG 1WM5A 3TWSA 1N52A 5BUZA 3IKOB 3UM2A 1FT2A 3D9NA 1SVXA 2RG8A 5CERB 3C3OA 5D0QD 3D9IA 3LCAA 5E76A 4U0SA 3EUVA 3LXUX 3BQOA 3DRAA 1B89A 2LXMA 3T8KA 1ZBPA 5JJ7A 4WWNA 3DBSA 2CFUA 2X3MA 1N0RA 2R02A 3CV0A 2H6IA 2IONA 4DX2A 3UI2A 3FEXA 4GZ3A 2WVIA 2A5UA 1TN7A 1E8XA 1NP7A 3FWVA 4EZJA 2DBAA 4RQIA 2L9BA 3FTSA 3ML9A 2WXFA 2GRQB 3TAXA 4U8HA 3QB2A 2R2LA 3ZIMA 3U64A 3HXDA 4UQYA 4N5CA 1DVPA 2NSZA 3GW4A 1MX6A 3CVQA 3B13A 4MRUA 4I6JA 2XPYA 3AG3E
chains in the Genus database with same CATH topology
2HR2A 4EBAA 2XPIA 3FUIA 4J6IA 5T3RA 2ILRA 4UI9K 2IF4A 4G1TA 4N2SA 4I2ZA 1E7UA 3IV0A 2I1JA 1VDYA 3DPDA 3HVEB 4LCTA 2PQNA 3ASFA 3OAWA 5AJLA 4RSYA 2R59A 4L23A 3HHMA 5EX3A 3D9LA 3MX3A 4G25A 1LF8A 4B0ZA 2L6JA 3PEVB 3APDA 3SBTB 4DI3A 1OUVA 5A7DB 3CEQA 4GA1A 3LKUA 1UG3A 1X5BA 1Y6IA 2WXIA 4C0MA 3D9PA 3NF1A 4KMOA 2E2EA 2KATA 5AIJA 1A17A 2X6JA 3EHMA 5EX0A 4KT6B 4N3AA 3SF4A 2FULA 4B89A 3I4GA 5BT1A 3ZGQA 1HO8A 4JHRA 1INZA 4B94A 3O48A 3MA5A 4AIFA 3CHOA 4UQXA 4ACKA 4NRHB 1JUQA 5G2NA 2XCBA 2J9QA 3FTXA 5JHAA 3LS8A 3AS4A 4PS8A 1HX8A 4OVVA 4WWOA 4AM9A 3U4TA 1SZ9A 3P2BA 3SNXA 3FU6A 2J07A 2UWJG 4BT9A 3MKQA 3FEYA 3TXNA 1Z3XA 3FH5A 4I6GA 3VLDA 4AXHA 4BSXA 3AS5A 2J08A 2YHCA 4HOTA 2HO1A 5LP0A 2Y4UA 4U0ZA 4FLBA 4I43A 3SD5A 4PS3A 4AVXA 3CHRA 4U04A 1E8ZA 5KJNA 3FUJA 3ONKA 2ONDA 4G11A 2XPZA 5LCWJ 5J08A 2VSYA 2X6IA 2YQ8A 3UT7A 3CIAA 4FP7A 2V4LA 2VSOE 1QZ2A 4KXKB 4FJZA 2WXLA 3SFZA 4KBQA 1N54A 2J4BA 3LPZA 3PUJA 2CHWA 5ARGA 4HOUA 3EIQC 5ENNA 4FU3A 3T8MA 4AEZC 4GPKA 1XGWA 4XX5A 1KLXA 4JXTA 3CK7A 4I1AA 1ELWA 3CK9A 4JZYA 2FBNA 4KZ0A 2XHEA 4YVQC 5ANLA 2UY1B 2CG3A 2GGFA 4NACA 5KJLA 3NQPA 3ML8A 3UT8A 2XEVA 3LVRE 5LFAA 4JEHA 4ABNA 4BT8A 4BX9A 1IQUA 3EDTB 3K9IA 3ZYKA 4Y6WA 2NC9A 4JHJA 4LEUA 1H19A 1XNFA 1HE8A 2WXPA 4E85A 1UJJA 4CRWA 2XGMA 4CT0A 2FEZA 3HIZA 4LRZA 1HXIA 1L5JA 1HU3A 4DPRA 3ZYQA 4C0EA 4UWKA 4HLEA 2MHKA 1U3CA 3FUDA 3CVLA 1TJFA 2WXNA 2PQRA 3G2VA 4YVOA 3S7BA 2MOWA 3OXFA 5ARFA 4BX8A 2OV8A 3PE4A 4G23A 3FUEA 3LY9A 3FUNA 3OXLA 2BF0X 3ASGA 3TG5A 4GCNA 4F3VA 3CHQA 2AVPA 3GZ1A 4I9EA 2AXUA 2WXKA 4L7TA 2J49A 2KZTB 3RU0A 3RRUA 3TL5A 1W3BA 3CQGB 4GAAA 3Q5MA 3IBEA 2MRIA 2JEKA 3APCA 2YNQA 2JLBA 4FLHA 1IHGA 3KEZA 5CCLA 1EDUA 2WM9A 3OTNA 3FTZA 4IYPA 4XI0A 1WY6A 4DI4A 4CGVA 4ANXA 3SHFA 2VTBA 1S0PA 2C0LA 3FH7A 2WXGA 4CDMA 4ILHB 2M63A 3L6AA 2VGXB 5CCMA 3D9OA 1FCHA 1ELRA 5EDSA 4LERA 2XGOA 3B7TA 5G04J 2X38A 1H2VC 1E7VA 3CSTA 3JQ0A 4L1BA 2CHZA 3QARA 4JVSA 3TJPA 4JA7A 3L22A 4IULA 3ESLA 5HQ8A 2IFUA 4MS6A 4C9BB 5FQ6A 1TJCA 3KS2A 3FTUA 4N2QA 2GW1A 5FT9A 5KCMA 1NA3A 3EJNA 3KD7A 3Q4AB 4M3OA 1MHQA 2FO7A 3FTWA 3QC1A 3FUHA 3CVXA 2WQ7A 3CVYA 3D3MA 3QWVA 2PL2A 5FQ8A 4AY5A 4IRUA 3FU5A 4XE0A 1Y8MA 2PM6A 3G2UA 4EQFA 1UN8A 3ZW3A 1SQMA 1UN9A 4GB9A 4EZKA 3CVWA 3UUXA 4HORA 2WQ6A 5J90A 1PAQA 2CFZA 4V3IA 3PNTB 5EKQD 4EZLA 2X6FA 3UX4A 2AWIA 3I5PA 3FULA 4DLOA 4F1SA 2Q7FA 3FU0A 3MV2B 2WB2A 2KC7A 3RIBA 4G2VA 2HYZA 2V8SE 4BWRA 4CDRA 3I4RB 2I2OA 2WXMA 3RKVA 3ONLA 3AU5A 3SZ7A 2QY7A 3TGOA 1GW6A 4XZ4A 4I17A 3GYZA 3O4ZA 1JWGA 1YA0A 4J8DA 4N39A 1E8YA 2V0PA 4Q96A 1H6KA 1DNPA 5D0OD 3UMVA 3LY7A 3RRNB 2DIWA 4NURA 2BUGA 3AS8A 2WXHA 3R7RA 4F7AA 5LCWC 3GZSA 4H7XA 1JWFA 2WXJA 4AY6A 3VTXA 1KT1A 4W9RA 2WPVA 4WNFA 5FZSA 3PREA 3NZUA 3I3NA 4FHKA 5T8IA 2LAHA 3S7DA 3CGHA 3VLEA 2VJ8A 4NQ0A 4GCOA 4ANUA 3EHNA 4EPZA 4TUUA 4XI9A 2AW6A 3MZLB 4ILGA 3CVPA 4WAFA 2FI7A 4JHKA 3QK0A 3FTYA 4APOA 3APFA 3D9KA 3FUMA 2NXPA 3B7SA 4KVMA 5KJKA 1QQEA 4URKA 3CQCB 3CK8A 4FJYA 2VSNA 3ENEA 1HG5A 3PE3A 4H7YA 3FTVA 1WAO1 4JPSA 4J8EA 1HZ4A 4A1GA 5JJTA 2DCPA 3HDXA 3LY8A 4PH4B 3ZN3A 1IYGA 2E0IA 3Q47B 4WNEA 3FH8A 1IQRA 3FHEA 2VSXE 4AOFA 5G05J 4ACLA 4A55A 2KCKA 3CHSA 5G55A 2YINA 3QJZA 3VLFA 4YNDA 3T5XA 3G2WA 5A6CA 5A23A 1NA0A 4GYYA 3GZ2A 4U0UA 4R7LA 4K0RA 3UQ3A 4J8SA 3QNKA 5BV1A 3IHYA 2P58C 2XQ0A 4UQZA 3ZYLA 3PEUB 4Y6CA 4XIFA 3ASHA 3Q15A 3CR3A 1FVHA 1ZU2A 4I9CA 2VYIA 4U63A 4O6FA 1UJKA 5DBKA 3CKCA 4GA2A 2PZIA 3BEEA 4UI9J 2KZTA 4GYOA 3ZHEB 4CGWA 1P5QA 4U07A 4A3VA 4P29A 2EQXA 4KZCA 1Z6TA 2LAIA 3FFLA 4FC8A 2L0TB 5DIZA 1OWNA 2J09A 2HM8A 4JEUA 2J4DA 3CLJA 5G04C 4CCAA 4ANWA 4GZ5A 3TXMA 1BPOA 4ATGA 2PM7A 5HI7A 5KJMA 1OWLA 1ELKA 5LX8A 3MYVA 4XKBA 3FY4A 3HYMB 4MLPA 2V5FA 4I2WA 3G2TA 5FWQA 4JL0A 4GMJA 3LEWA 4PUCA 2WMOA 4FULA 3MEKA 3S7JA 4F53A 4FA6A 1U3DA 4Q94A 4HFGA 4JW1A 1NZNA 2VTBB 2WXOA 4D10C 3E4BA 3QAQA 2R17C 4ILIA 4HVBA 3ZPJA 3ZVVA 2KM4A 4GMLA 2C0MA 3HVEA 4GU5A 3FU3A 3PRZA 3LDZA 4BFRA 3B7RL 3LYAA 2ZU6B 3RK6A 3MV3B 3EIJA 3CVUA 1E8WA 1SZAA 3JQ1A 4DK5A 1TEZA 3ULQA 3FP3A 1E96B 4DLQA 4HOQA 4PS7A 2FF4A 3RO3A 2Y4TA 4KYOB 3S7FA 1EF1C 3CSFA 3MJWA 3SBSA 2I6HA 5C1DA 3N71A 4BTAA 4E6HA 3ZYMA 1HFAA 3CKBA 4TRQA 2WXQA 2LNIA 4EECA 2LSUA 4JC8A 2KCVA 3PUKA 1KT0A 3RO2A 2YHEA 4GZCA 5BPPA 3PS6A 4XKCA 2GRLA 4FADA 1OWOA 1H2TC 1QNFA 4B8AA 4HXIA 3U3WA 1H0AA 4OYSA 1HS6A 4KVOA 3MGBA 2OVBA 4CDNA 4HS2A 4QFVA 3D9JA 4GZDA 5LOZA 3UT4A 1E90A 3CVVA 4BY6A 3BG0B 3NZSA 5CMWA 3L17A 1MQSA 2Y3AA 4AJWA 2WMNA 2VGYA 2IU1A 5AJDA 3MKQB 3PH0C 3LJ3A 3JCKC 4N3CA 1HG2A 4DJAA 3R9AB 4JA9A 3IEGA 3U9WA 4RVBA 2WQHA 3QOUA 1HF8A 2L0IA 1UW4B 3Q49B 2I1KA 3ESKA 4UWHA 4WNDA 3JYSA 4I6EA 5E75A 2IOSA 5AENA 3ZRHA 2I9CA 3PZDA 3ASDA 2CG2A 2XGSA 2IQCA 4WUYA 2RD0A 3KAEA 3OXGA 4LUNU 4WNGA 5BW8C 3TG4A 4OVUA 3L54A 1WM5A 3JUIA 3C98A 4ME2A 1N52A 1FVFA 5CHEE 5BUZA 2OVFA 3IKOB 3T5VA 2LSVA 3CHPA 3RJVA 3D9NA 3RRMB 3PVLA 2X6KA 4UWFA 2RG8A 3QKYA 5G05C 2C2LA 2UY1A 4A1SA 2OOEA 2R5SA 4FHJA 2IOLA 5FQ4A 4TV3A 4APFA 1EPUA 4PDXA 5D0QD 3FUKA 3D9IA 4I1OB 5CMYA 1OWPA 3CHMA 4G24A 3S2AA 4GYWA 3LCAA 5E76A 5JJ6A 4U0SA 5T4YA 3IHVA 2XRZA 3UPVA 4BTBA 1H2UA 4A3TA 4WWPA 3LXUX 3WXXA 4L2LA 4GA0A 4EBAG 1B89A 3MCXA 4CEMA 3B7UX 5FZRA 3ZEFA 5JHBA 3URZA 1ZBPA 4K03A 2GRMA 4HOSA 4J0UA 3L16A 3BG1B 5JJ7A 4WWNA 3P1UA 3L08A 4UI9C 3DBSA 2CHXA 2CFUA 2X3MA 3AU4A 4RG9A 5AYWD 5M72A 2WXRA 2KCLA 3CV0A 5FJYA 5FZQA 4B8CB 2IONA 3R7QA 4UWLA 3QDNA 2VQ2A 3ZFWA 3FEXA 1PY1A 4GZ3A 2WVIA 2A5UA 2LO6A 4AV7A 4CT4A 3FDHA 3MKRA 3VTYA 3ZHEA 1E8XA 1Z3YA 2X6HA 4G26A 1NP7A 3FWVA 3QWWA 4EZJA 4AP2A 2DBAA 3ZXSA 2AXVA 2IJGX 4RG6A 2L9BA 1HH8A 3FTSA 3ML9A 4MKTA 4N3BA 2WXFA 2XCCA 3U66A 3TAXA 1PC2A 3PNLB 5C2YA 2QFCA 2VGXA 4U8HA 3FUFA 3D9MA 3QB2A 4ANVA 5BV0A 2AXZA 5FTPA 3ZIMA 3U64A 3QWPA 1JPLA 4IN3B 4UQYA 1OWMA 3PDNA 4N5CA 2XRYA 1DVPA 3L13A 2NSZA 4I1MA 4UWGA 2A4ZA 3CVNA 3GW4A 4J8FA 4L2YA 3CVQA 3B13A 1EYHA 2BTDA 4Q69A 5BNWA 4MRUA 3LVQE 4I6JA 3SGHA 4GZ6A 5ANRA 5FQ7A 3SI5A 2XPYA 3G2SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HR2 A;  2XPI A;  4UI9 K;  2IF4 A;  4G1T A;  4N2S A;  4I2Z A;  2PQN A;  3ASF A;  5EX3 A;  4G25 A;  2L6J A;  1IYG A;  1OUV A;  5A7D B;  3CEQ A;  4GA1 A;  3LKU A;  3NF1 A;  2E2E A;  2KAT A;  1A17 A;  5EX0 A;  4N3A A;  3SF4 A;  5BT1 A;  3ZGQ A;  4JHR A;  4B94 A;  3O48 A;  3MA5 A;  4AIF A;  4UQX A;  4NRH B;  2XCB A;  2J9Q A;  3AS4 A;  4AM9 A;  3U4T A;  2UWJ G;  4BT9 A;  3AS5 A;  2YHC A;  4HOT A;  2HO1 A;  2Y4U A;  4U0Z A;  4U04 A;  5KJN A;  2OND A;  5LCW J;  2VSY A;  2YQ8 A;  1QZ2 A;  4KXK B;  4KBQ A;  3LPZ A;  5ARG A;  4HOU A;  4GPK A;  1KLX A;  3CK7 A;  4I1A A;  1ELW A;  3CK9 A;  2FBN A;  4YVQ C;  2UY1 B;  5KJL A;  2XEV A;  4ABN A;  4BT8 A;  3EDT B;  3K9I A;  4Y6W A;  2NC9 A;  4LEU A;  1XNF A;  2XGM A;  2FEZ A;  1HXI A;  2MHK A;  3CVL A;  2PQR A;  4YVO A;  3S7B A;  3OXF A;  5ARF A;  3PE4 A;  4G23 A;  3LY9 A;  3OXL A;  3ASG A;  3TG5 A;  4GCN A;  4F3V A;  2AVP A;  3GZ1 A;  4I9E A;  3RU0 A;  1W3B A;  3Q5M A;  2JLB A;  1IHG A;  5CCL A;  4XI0 A;  4CGV A;  2C0L A;  2VGX B;  5CCM A;  1FCH A;  1ELR A;  2XGO A;  5G04 J;  4JA7 A;  5HQ8 A;  2IFU A;  1TJC A;  3KS2 A;  4N2Q A;  2GW1 A;  5FT9 A;  1NA3 A;  3KD7 A;  3Q4A B;  2FO7 A;  3QWV A;  2PL2 A;  4AY5 A;  1Y8M A;  4EQF A;  4HOR A;  3UUX A;  5EKQ D;  2Q7F A;  3MV2 B;  2KC7 A;  3RIB A;  4G2V A;  2HYZ A;  4BWR A;  4CDR A;  3RKV A;  3SZ7 A;  3TGO A;  4I17 A;  3GYZ A;  4J8D A;  1YA0 A;  4N39 A;  4WNG A;  5D0O D;  3LY7 A;  2BUG A;  3AS8 A;  5LCW C;  4H7X A;  4AY6 A;  3VTX A;  1KT1 A;  4W9R A;  2WPV A;  4WNF A;  5FZS A;  3S7D A;  4NQ0 A;  4GCO A;  4XI9 A;  3CVP A;  2FI7 A;  4APO A;  5KJK A;  1QQE A;  3CK8 A;  2VSN A;  3PE3 A;  4H7Y A;  1WAO 1;  4J8E A;  1HZ4 A;  5JJT A;  3LY8 A;  3ZN3 A;  3Q47 B;  4WNE A;  5G05 J;  2KCK A;  4YND A;  5A6C A;  1NA0 A;  4GYY A;  3GZ2 A;  4U0U A;  3UQ3 A;  2P58 C;  4UQZ A;  4Y6C A;  4XIF A;  3ASH A;  3Q15 A;  4I9C A;  1ZU2 A;  2VYI A;  4O6F A;  5DBK A;  3CKC A;  4GA2 A;  2PZI A;  3BEE A;  4UI9 J;  4GYO A;  3ZHE B;  4CGW A;  1P5Q A;  4U07 A;  3FFL A;  5DIZ A;  5G04 C;  4GZ5 A;  5KJM A;  5HI7 A;  3HYM B;  2V5F A;  4I2W A;  4JL0 A;  3MEK A;  3S7J A;  1NZN A;  3E4B A;  3ZPJ A;  2C0M A;  3LYA A;  3MV3 B;  3ULQ A;  3FP3 A;  1E96 B;  4HOQ A;  2FF4 A;  3RO3 A;  2Y4T A;  4KYO B;  3S7F A;  2I6H A;  5C1D A;  3N71 A;  4BTA A;  3CKB A;  2LNI A;  2LSU A;  2KCV A;  1KT0 A;  3RO2 A;  3U3W A;  2VGY A;  4N3C A;  3R9A B;  4JA9 A;  3IEG A;  2WQH A;  3QOU A;  3Q49 B;  3ESK A;  4WND A;  3JYS A;  3ASD A;  2XGS A;  4WUY A;  3KAE A;  3OXG A;  5BW8 C;  3TG4 A;  1WM5 A;  4ME2 A;  5CHE E;  2LSV A;  3RJV A;  3QKY A;  5G05 C;  2C2L A;  2UY1 A;  4A1S A;  2OOE A;  2R5S A;  5D0Q D;  4G24 A;  4GYW A;  3LCA A;  5JJ6 A;  4U0S A;  3UPV A;  4BTB A;  3WXX A;  4GA0 A;  1B89 A;  5FZR A;  3URZ A;  1ZBP A;  4HOS A;  4J0U A;  5JJ7 A;  4UI9 C;  4RG9 A;  5AYW D;  5M72 A;  5FJY A;  2KCL A;  3CV0 A;  5FZQ A;  3QDN A;  2VQ2 A;  3ZFW A;  4GZ3 A;  3VTY A;  3MKR A;  3ZHE A;  4G26 A;  3QWW A;  3FWV A;  2DBA A;  4RG6 A;  1HH8 A;  4N3B A;  2XCC A;  3TAX A;  1PC2 A;  2QFC A;  2VGX A;  5FTP A;  3QWP A;  4IN3 B;  4UQY A;  3PDN A;  4N5C A;  3GW4 A;  3CVN A;  4J8F A;  3CVQ A;  5BNW A;  4GZ6 A; 
#chains in the Genus database with same CATH topology
 1OCZ E;  3HG0 D;  4J6I A;  3V79 K;  4I2Z A;  2I1J A;  1TN6 A;  1FPP A;  5AJL A;  3Q9N C;  2XEN A;  4JD2 G;  3PEV B;  1OUV A;  1UG3 A;  1X5B A;  3EU5 A;  4KT6 B;  3UKR G;  5ENQ D;  2P9P G;  3ZGQ A;  1HO8 A;  4LG6 A;  4B94 A;  5G2N A;  3LS8 A;  3AS4 A;  4GPM A;  3U4T A;  4RLY A;  1Z3X A;  4I6G A;  3NB2 A;  3VLD A;  2R05 A;  5ENO D;  5LP0 A;  4DX6 D;  2RFM A;  3CHR A;  3FUJ A;  4G11 A;  2X6I A;  3CIA A;  2XS1 A;  4FJZ A;  4KBQ A;  3UIN C;  2CHW A;  5ARG A;  2F8X K;  2XHE A;  4NAC A;  2XEV A;  3TWT A;  4HRN A;  4ABN A;  4BX9 A;  4DUI A;  2IY0 C;  4X8Q A;  3V31 A;  1H19 A;  4CRW A;  2XGM A;  4LRZ A;  3BU8 A;  4HLE A;  3CVL A;  1TJF A;  5EN5 D;  2MOW A;  3NOG D;  3LY9 A;  3ASG A;  3TG5 A;  2AVP A;  2AXU A;  3C3Q A;  3RU0 A;  2J49 A;  3UTM A;  3RRU A;  1W3B A;  3AJI A;  2MRI A;  3HXC A;  2YNQ A;  1IHG A;  5IY5 E;  4IYP A;  1S0P A;  2WXG A;  4CDM A;  4ILH B;  1Q2Z A;  1NFI E;  3B7T A;  4K5B A;  5G04 J;  2X38 A;  4DRX E;  1A5E A;  3JQ0 A;  4L1B A;  3QAR A;  3L22 A;  5HQ8 A;  3KS2 A;  4N2Q A;  3EJN A;  1MHQ A;  3QWV A;  5FQ8 A;  4JB8 P;  4XE0 A;  1BU9 A;  2GRO B;  3UUX A;  4V3I A;  5EKQ D;  3PNT B;  3JXJ A;  3I5P A;  2ETC A;  3FU0 A;  3RIB A;  4G2V A;  4BWR A;  4CDR A;  3C3R A;  4J8D A;  1JWG A;  1YA0 A;  2V0P A;  3UMV A;  3LY7 A;  3DXM G;  4HI9 A;  1KT1 A;  4W9R A;  5FZS A;  3NZU A;  3I3N A;  4FHK A;  5T8I A;  3S7D A;  3V2O A;  5CBO A;  4ANU A;  4TUU A;  2AW6 A;  4WAF A;  2FI7 A;  1BI8 B;  3D9K A;  3FUM A;  3E37 A;  5KJK A;  1QQE A;  4FJY A;  2VSN A;  3ENE A;  3PE3 A;  4U7E B;  2XEE A;  4J8E A;  1HZ4 A;  4UUC A;  3ZN3 A;  5AQ7 A;  3TWW A;  2KBX A;  4AOF A;  5CEA A;  4OAV B;  4J8Y A;  2YIN A;  3VLF A;  5H7P A;  5A23 A;  5BV1 A;  4K0R A;  3ZXP A;  3PEU B;  3ASH A;  1N94 A;  1SW6 A;  5ENS D;  3RAU A;  4GYO A;  1P5Q A;  4A3V A;  1RZ4 A;  3FFL A;  2OEW A;  4CCA A;  3TXM A;  1BPO A;  5LX8 A;  5JMN D;  3MYV A;  3FY4 A;  3LEW A;  2WMO A;  1N4R A;  4F53 A;  4Q94 A;  3V30 A;  1NI1 A;  1TNU A;  4D10 C;  3E4B A;  3QAQ A;  2R17 C;  4GML A;  2XS8 A;  3TWV A;  1K3Z D;  1SZA A;  3JQ1 A;  3ULQ A;  4PS7 A;  3E34 A;  2Y4T A;  1OXJ A;  1EF1 C;  1O1T A;  2EIJ E;  3AG2 E;  1BD8 A;  3N71 A;  4BTA A;  1HFA A;  2LSU A;  3HXB A;  2H6G A;  2GRL A;  3U3W A;  1H0A A;  5EID A;  1OCR E;  5LOZ A;  3D9J A;  1N4Q A;  3BG0 B;  5CMW A;  5AJD A;  3LJ3 A;  2KXP C;  3R9A B;  4JA9 A;  3IEG A;  1HF8 A;  2I1K A;  3ESK A;  5AEN A;  4TXQ A;  3ZRH A;  1IHB A;  2I9C A;  3Q9U C;  2CG2 A;  1V55 E;  4HB5 A;  5AQ9 A;  2GRN B;  4ME2 A;  2B6C A;  4HLL A;  3CHP A;  3PVL A;  2X6K A;  4UWF A;  1O5M A;  2UY1 A;  2OOE A;  4FHJ A;  4GTT A;  1MX2 A;  3EU9 A;  1JCS A;  4I1O B;  5CMY A;  1OWP A;  3CHM A;  5CED B;  5JJ6 A;  4BTB A;  4A3T A;  4WWP A;  4L2L A;  4GA0 A;  4EBA G;  4CEM A;  3MCX A;  4O1O A;  4HOS A;  3BG1 B;  1D8E A;  3P1U A;  4F1P A;  4RG9 A;  3ZNG A;  4B8C B;  3R7Q A;  3QDN A;  3FDH A;  3QWW A;  1RW2 A;  2AXV A;  5CBN A;  1HH8 A;  4DX5 D;  3SY2 A;  5C2Y A;  3FUF A;  4ANV A;  3ASO E;  5BV0 A;  3QWP A;  3E33 A;  4IN3 B;  1OWM A;  2XRY A;  4ATZ D;  2A4Z A;  2P9N G;  3SGH A;  3G2S A;  4EBA A;  2XPI A;  3UIO C;  3IV0 A;  3DPD A;  1VDY A;  4LCT A;  3OAW A;  4L23 A;  2OEV A;  3MX3 A;  2BED A;  1A17 A;  2X6J A;  5EX0 A;  3SF4 A;  2FUL A;  4B89 A;  3MA5 A;  3BUA A;  5B1B E;  2ZXW E;  4NRH B;  1JUQ A;  3ABK E;  3FTX A;  5JHA A;  4BSZ B;  4OVV A;  4DPR A;  1SZ9 A;  3FU6 A;  2J07 A;  2UWJ G;  3MKQ A;  3FH5 A;  4BSX A;  2Y69 E;  5FIN A;  2L6B A;  2HO1 A;  3AG1 E;  2VGE A;  4I43 A;  3SD5 A;  4U04 A;  3ONK A;  5J08 A;  2VSY A;  4DX1 A;  2V4H C;  1MJ0 A;  4FP7 A;  2V4L A;  2VSO E;  1QZ2 A;  2AJA A;  4U8V D;  4KXK B;  2WXL A;  3SFZ A;  3LPZ A;  5ENN A;  3EIQ C;  1XGW A;  1KLX A;  4JXT A;  4CYM D;  1ELW A;  4JZY A;  3UIP C;  2FBN A;  2QC9 A;  5ANL A;  2UY1 B;  2GGF A;  2QZA A;  1WG0 A;  5KJL A;  4JEH A;  2P9I G;  4BT8 A;  1D9S A;  1IQU A;  3ZYK A;  1HE8 A;  2WXP A;  3DEO A;  1UJJ A;  2FEZ A;  1HU3 A;  4C0E A;  4UWK A;  4DX7 D;  3FUD A;  3PE4 A;  4G23 A;  3FUN A;  4F3V A;  3CHQ A;  3GZ1 A;  2WXK A;  4G8L A;  2KZT B;  3Q73 A;  3Q5M A;  2JEK A;  2JLB A;  1EDU A;  3PZ4 A;  4CGV A;  4DI4 A;  3KSQ A;  2C0L A;  3FH7 A;  1N4P A;  5HKP A;  3D9O A;  5AQA A;  4LER A;  1E7V A;  3D9H A;  4JVS A;  3TJP A;  5FQ6 A;  2JAB A;  4M3O A;  3R9M A;  3FUH A;  2WQ7 A;  4IRU A;  3DXK G;  1Y8M A;  4BER A;  4HOR A;  4EZK A;  3E30 A;  2AWI A;  2GRP B;  2Y1L E;  3DSW A;  4GTV A;  2V8S E;  5HS0 A;  2EIL E;  2I2O A;  2WXM A;  3ONL A;  3AU5 A;  4NIK A;  4I17 A;  3O4Z A;  1KZO A;  1DNP A;  4NUR A;  2WXH A;  4F7A A;  5LCW C;  1JWF A;  4AY6 A;  3VTX A;  4WNF A;  4ZHB A;  2EIN E;  3VLE A;  2VJ8 A;  3PZ3 A;  4NQ0 A;  2QYU A;  1QBQ A;  3NAW A;  3T9K A;  4EPZ A;  3UM1 A;  1UOH A;  3CVP A;  4JHK A;  3J5Q B;  1OCO E;  3ZU7 B;  4XEI G;  1AWC B;  3TWU A;  5AAO A;  1HG5 A;  4TUM A;  5KNG A;  4H7Y A;  3FTV A;  1WAO 1;  3LY8 A;  2P9U G;  3FH8 A;  3FHE A;  1S63 A;  4A55 A;  3CHS A;  5BXU A;  3QJZ A;  3T5X A;  5A6C A;  3UQ3 A;  4J8S A;  3QNK A;  4LSZ E;  3C72 A;  3ZYL A;  3CR3 A;  3HXE A;  3CKC A;  2PZI A;  4CGW A;  2IEJ A;  2LAI A;  2L0T B;  1OWN A;  2HM8 A;  4JEU A;  2NYJ A;  1K8K G;  5FWQ A;  4MLP A;  2DYS E;  4I2W A;  4JL0 A;  4GMJ A;  4PUC A;  3Q78 A;  4FA6 A;  2WXO A;  4HVB A;  4TXR A;  2KM4 A;  2C0M A;  3HVE A;  4GTO A;  3EHR A;  3LYA A;  3MV3 B;  4HBD A;  3CVU A;  3RO3 A;  4KYO B;  3AG4 E;  3MJW A;  3SBS A;  5C1D A;  3ZYM A;  2WXQ A;  2LNI A;  4HRM B;  3PUK A;  1KT0 A;  3ZUV B;  3RO2 A;  2YHE A;  4GZC A;  5BPP A;  1YYH A;  1LD7 A;  4HXI A;  1HS6 A;  4CDN A;  4QFV A;  4GZD A;  3UT4 A;  3L17 A;  2Y3A A;  4AJW A;  2VGY A;  2IU1 A;  2FO1 E;  2RFA A;  4RVB A;  3Q49 B;  2DZO A;  1UW4 B;  2QYJ A;  2IOS A;  1N0Q A;  2XGS A;  4OAU C;  3TG4 A;  4OVU A;  3L54 A;  2MYO A;  3JUI A;  2F37 A;  1FVF A;  3T5V A;  2LSV A;  3RJV A;  2Y0B G;  5G05 C;  2C2L A;  4A1S A;  2R5S A;  2HE0 A;  4TV3 A;  3B95 A;  1EPU A;  4PDX A;  4GYW A;  5T4Y A;  1H2U A;  3B7U X;  5FZR A;  1X81 A;  4K03 A;  3L16 A;  3AAA C;  4UI9 C;  2CHX A;  5M72 A;  3DSV A;  5BXO A;  2WXR A;  2KCL A;  5FZQ A;  3TWQ A;  4UWL A;  1N4S A;  3ZFW A;  1PY1 A;  2LO6 A;  4AV7 A;  3MKR A;  3ZHE A;  1Z3Y A;  2X6H A;  3HXF A;  2GRR B;  4G26 A;  4AP2 A;  3ZXS A;  2IJG X;  4RG6 A;  1S70 B;  1N9A A;  5EIL A;  4MKT A;  3SFX A;  2QFC A;  2AXZ A;  5FTP A;  3PDN A;  1TR4 A;  4I1M A;  4YDE A;  3CVN A;  4L2Y A;  5BNW A;  5ANR A;  5FQ7 A;  3SI5 A;  2ZIS A;  2HR2 A;  3NOC D;  5T3R A;  1TNO A;  2ILR A;  2IF4 A;  4G1T A;  1E7U A;  3HVE B;  3ASF A;  4RSY A;  4O1P A;  2P9K G;  3HHM A;  5EX3 A;  4G25 A;  4A63 B;  2L6J A;  3SBT B;  3APD A;  4DI3 A;  3CEQ A;  1Y6I A;  4C0M A;  3D9P A;  5AIJ A;  3EHM A;  3DSX A;  4JHR A;  1U2V G;  4AIF A;  3CHO A;  4UQX A;  4ACK A;  5CRU A;  3X2Q E;  4PS8 A;  4WWO A;  4URK A;  1HX8 A;  4AM9 A;  3SNX A;  2XEH A;  4BT9 A;  3FEY A;  2B0O E;  1V54 E;  1JCQ A;  3AS5 A;  2J08 A;  2LXL A;  2ETB A;  2Y4U A;  4U0Z A;  4FLB A;  1E8Z A;  3ZKJ A;  2OND A;  2XPZ A;  5LCW J;  2YQ8 A;  3UT7 A;  1N54 A;  2J4B A;  3PUJ A;  4HOU A;  4FU3 A;  4AEZ C;  3CK7 A;  4I1A A;  4KZ0 A;  3ML8 A;  4GTR A;  3UT8 A;  5LFA A;  3ABL E;  1TN8 A;  1FT1 A;  1OY3 D;  3K9I A;  4JHJ A;  4LEU A;  4E85 A;  5EIB E;  1HXI A;  1L5J A;  1G3N B;  2MHK A;  5B1A E;  1U3C A;  1LTX A;  4HNA D;  2WXN A;  2PQR A;  3G2V A;  4CZ2 D;  3SFY A;  2BF0 X;  4L7T A;  3TL5 A;  3CQG B;  3IBE A;  1ZB1 A;  3APC A;  4FLH A;  3KEZ A;  5CCL A;  1MZC A;  2WM9 A;  3OTN A;  3FTZ A;  4XI0 A;  1WY6 A;  4ZFH A;  1FCH A;  3CST A;  4JA7 A;  4IUL A;  3ESL A;  4MS6 A;  1TJC A;  2DZN A;  3FTU A;  2ZGG A;  2GW1 A;  2FO7 A;  3QC1 A;  3CVX A;  4AY5 A;  3FU5 A;  4U96 D;  4LNB A;  3ZW3 A;  1SQM A;  1UN9 A;  4GB9 A;  3JUE A;  2WQ6 A;  1PAQ A;  4EZL A;  4HRL A;  2V5Q C;  4F1S A;  2Q7F A;  2WB2 A;  2KC7 A;  2P9S G;  1TNY A;  3RKV A;  3TGO A;  3Q7A A;  5B3S E;  4WNG A;  5D0O D;  2A5E A;  3RRN B;  2H6H A;  2DIW A;  3R7R A;  4H7X A;  2WXJ A;  2WPV A;  2LAH A;  3UM3 A;  3CGH A;  5AAR A;  3EHN A;  4ILG A;  4APO A;  3APF A;  2NXP A;  3DSU A;  3CQC B;  3CK8 A;  5JA4 D;  4PH4 B;  3Q47 B;  4WNE A;  5G05 J;  3L9T A;  1KPS B;  3SQV A;  4YDO A;  3GZ2 A;  4U0U A;  5KWD A;  3IHY A;  2P58 C;  3Q15 A;  4U63 A;  4O6F A;  5DBK A;  3BEE A;  4UI9 J;  4U07 A;  3B7B A;  2EQX A;  1Z6T A;  2J09 A;  4TXP A;  2J4D A;  2PM7 A;  1OWL A;  1ELK A;  4XKB A;  3HYM B;  3DPY A;  4FUL A;  3DSS A;  1U3D A;  4HFG A;  1NZN A;  3L82 A;  3ZVV A;  3PRZ A;  4C48 B;  3LDZ A;  3RK6 A;  4L9P A;  4DK5 A;  1E96 B;  2R03 A;  4DLQ A;  4K5C A;  2I6H A;  4E6H A;  1JCR A;  4EEC A;  2KCV A;  1OT8 A;  3W9G A;  3PS6 A;  1OWO A;  5ENT D;  4B8A A;  4OYS A;  3MGB A;  3CVV A;  4BY6 A;  3NZS A;  3MKQ B;  3PH0 C;  3JCK C;  1Z5S C;  1HG2 A;  4DJA A;  2WQH A;  2L0I A;  4UWH A;  5E75 A;  4WND A;  4HQD A;  2J8S D;  3KAE A;  3OXG A;  4LUN U;  3C98 A;  5CHE E;  1K1A A;  2OVF A;  3UKU G;  5KNH D;  2XZT G;  3RRM B;  1AP7 A;  3QKY A;  1K1B A;  2IO3 C;  3EHQ A;  4BES A;  2IOL A;  5FQ4 A;  4APF A;  4U8Y D;  4GMR A;  5FIO A;  3FUK A;  2ZGD A;  4G24 A;  3S2A A;  3IHV A;  2XRZ A;  3UPV A;  3WXX A;  3ZEF A;  3IXE A;  3URZ A;  2GRM A;  4J0U A;  4GTM A;  3L08 A;  2XZD G;  3AU4 A;  5AYW D;  5FJY A;  2VQ2 A;  3V2X A;  4CT4 A;  3VTY A;  5ENR D;  3PZ2 A;  3F6Q A;  4N3B A;  5ENP D;  2XCC A;  3U66 A;  1PC2 A;  3PNL B;  2VGX A;  3Q75 A;  3D9M A;  2DYR E;  3UXG A;  2ETA A;  1JPL A;  3KEA A;  3L13 A;  4UWG A;  4J8F A;  4B93 B;  1EYH A;  2BTD A;  4Q69 A;  3LVQ E;  4GZ6 A;  2F0Y A;  3FUI A;  4UI9 K;  4N2S A;  4N5Q A;  2ZIR A;  1TYQ G;  2PQN A;  2R59 A;  3D9L A;  1LF8 A;  4B0Z A;  1IYG A;  5A7D B;  4GA1 A;  3LKU A;  2WXI A;  3NF1 A;  4KMO A;  2E2E A;  4F6R D;  2KAT A;  4N3A A;  3I4G A;  5BT1 A;  4HI8 A;  5EYL A;  1BLX B;  3O48 A;  1INZ A;  2P2C P;  3Q7F A;  2XCB A;  4O60 A;  2J9Q A;  3P2B A;  3TXN A;  3WG7 E;  1BI7 B;  4AXH A;  4BEP A;  2EIM E;  2YHC A;  4HOT A;  3TWR A;  2RKK A;  1TNB A;  3C5R A;  4PS3 A;  4AVX A;  5KJN A;  2BKK B;  5ITZ F;  4QQI A;  3ASN E;  3T8M A;  4GPK A;  4XX5 A;  3CK9 A;  4YVQ C;  1N11 A;  2CG3 A;  3NQP A;  3LVR E;  5D66 A;  4LNG A;  2H6F A;  1H6O A;  3EDT B;  4YDY A;  4GTS A;  4Y6W A;  2NC9 A;  1XNF A;  4CT0 A;  3HIZ A;  5CEC B;  3ZYQ A;  3UM0 A;  4YVO A;  3S7B A;  3OXF A;  5ARF A;  4BX8 A;  1H6P A;  2OV8 A;  2DVW A;  3FUE A;  3OXL A;  4GCN A;  4I9E A;  4GAA A;  1MX4 A;  4EHM A;  4MBG A;  1LD8 A;  5EYP F;  3SHF A;  4ANX A;  2VTB A;  3RSE G;  2M63 A;  3L6A A;  2VGX B;  5CCM A;  1ELR A;  5EDS A;  2XGO A;  3J5P A;  1H2V C;  2CHZ A;  4GTQ A;  2IFU A;  4C9B B;  5FT9 A;  5KCM A;  1NA3 A;  3KD7 A;  3Q4A B;  3FTW A;  3CVY A;  3D3M A;  2PL2 A;  2BKG A;  4U95 D;  2PM6 A;  3G2U A;  4EQF A;  1UN8 A;  3CVW A;  5J90 A;  2CFZ A;  2X6F A;  3UX4 A;  5AN8 A;  3FUL A;  4DLO A;  3MV2 B;  2HYZ A;  3TWX A;  3I4R B;  3SZ7 A;  2QY7 A;  1GW6 A;  4XZ4 A;  1TNZ A;  3GYZ A;  4N39 A;  4Q96 A;  1E8Y A;  3SO8 A;  1H6K A;  2BUG A;  3AS8 A;  3GZS A;  5HRY A;  3PRE A;  3E32 A;  4GCO A;  4XI9 A;  4Z68 A;  3MZL B;  3QK0 A;  3FTY A;  3B7S A;  1OCC E;  4KVM A;  1WDY A;  1O1S A;  2IO2 C;  3JXI A;  4JPS A;  4BET A;  5JJT A;  4A1G A;  2DCP A;  3HDX A;  3W9F A;  2EIK E;  2E0I A;  1IQR A;  4YDW A;  2VSX E;  3LJN A;  1MYO A;  4K5A B;  3KSL A;  4ACL A;  2KCK A;  3HRA A;  3PZ1 A;  5G55 A;  4YND A;  3G2W A;  1NA0 A;  4GYY A;  4R7L A;  2F8Y A;  1S64 A;  5D2M C;  2XQ0 A;  4UQZ A;  2LUH A;  4J7W A;  4Y6C A;  1D8D A;  4XIF A;  4I9C A;  1FVH A;  1ZU2 A;  3ABM E;  2VYI A;  1UJK A;  4GA2 A;  2KZT A;  3ZHE B;  4P29 A;  1O1R A;  1IKN D;  4KZC A;  4FC8 A;  5DIZ A;  5KBA A;  3CLJ A;  5G04 C;  4ANW A;  1KZP A;  4GZ5 A;  4ATG A;  5HI7 A;  5KJM A;  1N95 A;  2V5F A;  3G2T A;  4G8K A;  3MEK A;  3S7J A;  2PNN A;  2DWZ A;  4JW1 A;  2VTB B;  1SA4 A;  4ILI A;  3ZPJ A;  2P9L G;  4GU5 A;  3FU3 A;  4BFR A;  3B7R L;  2ZU6 B;  3EIJ A;  1E8W A;  1SA5 A;  2OCC E;  1TEZ A;  3FP3 A;  1DC2 A;  4HOQ A;  2FF4 A;  3Q79 A;  5AQB A;  3S7F A;  3CSF A;  1YMP A;  5CRV A;  4LNU D;  1DCQ A;  3CKB A;  4TRQ A;  1YCS B;  4JC8 A;  4XKC A;  4FAD A;  1H2T C;  3ISM C;  1QNF A;  1IXV A;  1QYM A;  3NBN B;  3DEP A;  4KVO A;  4M7C A;  2OVB A;  4GTP A;  4HS2 A;  3ULY A;  1E90 A;  1MQS A;  2WMN A;  4N3C A;  1NL4 A;  3U9W A;  3DWL G;  3QOU A;  5JHB A;  3JYS A;  4I6E A;  3PZD A;  3ASD A;  2IQC A;  4WUY A;  2RD0 A;  5BW8 C;  1DCE A;  3DST A;  3ULE G;  1WM5 A;  3TWS A;  1N52 A;  5BUZ A;  3IKO B;  3UM2 A;  1FT2 A;  3D9N A;  1SVX A;  2RG8 A;  5CER B;  3C3O A;  5D0Q D;  3D9I A;  3LCA A;  5E76 A;  4U0S A;  3EUV A;  3LXU X;  3BQO A;  3DRA A;  1B89 A;  2LXM A;  3T8K A;  1ZBP A;  5JJ7 A;  4WWN A;  3DBS A;  2CFU A;  2X3M A;  1N0R A;  2R02 A;  3CV0 A;  2H6I A;  2ION A;  4DX2 A;  3UI2 A;  3FEX A;  4GZ3 A;  2WVI A;  2A5U A;  1TN7 A;  1E8X A;  1NP7 A;  3FWV A;  4EZJ A;  2DBA A;  4RQI A;  2L9B A;  3FTS A;  3ML9 A;  2WXF A;  2GRQ B;  3TAX A;  4U8H A;  3QB2 A;  2R2L A;  3ZIM A;  3U64 A;  3HXD A;  4UQY A;  4N5C A;  1DVP A;  2NSZ A;  3GW4 A;  1MX6 A;  3CVQ A;  3B13 A;  4MRU A;  4I6J A;  2XPY A;  3AG3 E; 
#chains in the Genus database with same CATH homology
 2HR2 A;  4EBA A;  2XPI A;  3FUI A;  4J6I A;  5T3R A;  2ILR A;  4UI9 K;  2IF4 A;  4G1T A;  4N2S A;  4I2Z A;  1E7U A;  3IV0 A;  2I1J A;  1VDY A;  3DPD A;  3HVE B;  4LCT A;  2PQN A;  3ASF A;  3OAW A;  5AJL A;  4RSY A;  2R59 A;  4L23 A;  3HHM A;  5EX3 A;  3D9L A;  3MX3 A;  4G25 A;  1LF8 A;  4B0Z A;  2L6J A;  3PEV B;  3APD A;  3SBT B;  4DI3 A;  1OUV A;  5A7D B;  3CEQ A;  4GA1 A;  3LKU A;  1UG3 A;  1X5B A;  1Y6I A;  2WXI A;  4C0M A;  3D9P A;  3NF1 A;  4KMO A;  2E2E A;  2KAT A;  5AIJ A;  1A17 A;  2X6J A;  3EHM A;  5EX0 A;  4KT6 B;  4N3A A;  3SF4 A;  2FUL A;  4B89 A;  3I4G A;  5BT1 A;  3ZGQ A;  1HO8 A;  4JHR A;  1INZ A;  4B94 A;  3O48 A;  3MA5 A;  4AIF A;  3CHO A;  4UQX A;  4ACK A;  4NRH B;  1JUQ A;  5G2N A;  2XCB A;  2J9Q A;  3FTX A;  5JHA A;  3LS8 A;  3AS4 A;  4PS8 A;  1HX8 A;  4OVV A;  4WWO A;  4AM9 A;  3U4T A;  1SZ9 A;  3P2B A;  3SNX A;  3FU6 A;  2J07 A;  2UWJ G;  4BT9 A;  3MKQ A;  3FEY A;  3TXN A;  1Z3X A;  3FH5 A;  4I6G A;  3VLD A;  4AXH A;  4BSX A;  3AS5 A;  2J08 A;  2YHC A;  4HOT A;  2HO1 A;  5LP0 A;  2Y4U A;  4U0Z A;  4FLB A;  4I43 A;  3SD5 A;  4PS3 A;  4AVX A;  3CHR A;  4U04 A;  1E8Z A;  5KJN A;  3FUJ A;  3ONK A;  2OND A;  4G11 A;  2XPZ A;  5LCW J;  5J08 A;  2VSY A;  2X6I A;  2YQ8 A;  3UT7 A;  3CIA A;  4FP7 A;  2V4L A;  2VSO E;  1QZ2 A;  4KXK B;  4FJZ A;  2WXL A;  3SFZ A;  4KBQ A;  1N54 A;  2J4B A;  3LPZ A;  3PUJ A;  2CHW A;  5ARG A;  4HOU A;  3EIQ C;  5ENN A;  4FU3 A;  3T8M A;  4AEZ C;  4GPK A;  1XGW A;  4XX5 A;  1KLX A;  4JXT A;  3CK7 A;  4I1A A;  1ELW A;  3CK9 A;  4JZY A;  2FBN A;  4KZ0 A;  2XHE A;  4YVQ C;  5ANL A;  2UY1 B;  2CG3 A;  2GGF A;  4NAC A;  5KJL A;  3NQP A;  3ML8 A;  3UT8 A;  2XEV A;  3LVR E;  5LFA A;  4JEH A;  4ABN A;  4BT8 A;  4BX9 A;  1IQU A;  3EDT B;  3K9I A;  3ZYK A;  4Y6W A;  2NC9 A;  4JHJ A;  4LEU A;  1H19 A;  1XNF A;  1HE8 A;  2WXP A;  4E85 A;  1UJJ A;  4CRW A;  2XGM A;  4CT0 A;  2FEZ A;  3HIZ A;  4LRZ A;  1HXI A;  1L5J A;  1HU3 A;  4DPR A;  3ZYQ A;  4C0E A;  4UWK A;  4HLE A;  2MHK A;  1U3C A;  3FUD A;  3CVL A;  1TJF A;  2WXN A;  2PQR A;  3G2V A;  4YVO A;  3S7B A;  2MOW A;  3OXF A;  5ARF A;  4BX8 A;  2OV8 A;  3PE4 A;  4G23 A;  3FUE A;  3LY9 A;  3FUN A;  3OXL A;  2BF0 X;  3ASG A;  3TG5 A;  4GCN A;  4F3V A;  3CHQ A;  2AVP A;  3GZ1 A;  4I9E A;  2AXU A;  2WXK A;  4L7T A;  2J49 A;  2KZT B;  3RU0 A;  3RRU A;  3TL5 A;  1W3B A;  3CQG B;  4GAA A;  3Q5M A;  3IBE A;  2MRI A;  2JEK A;  3APC A;  2YNQ A;  2JLB A;  4FLH A;  1IHG A;  3KEZ A;  5CCL A;  1EDU A;  2WM9 A;  3OTN A;  3FTZ A;  4IYP A;  4XI0 A;  1WY6 A;  4DI4 A;  4CGV A;  4ANX A;  3SHF A;  2VTB A;  1S0P A;  2C0L A;  3FH7 A;  2WXG A;  4CDM A;  4ILH B;  2M63 A;  3L6A A;  2VGX B;  5CCM A;  3D9O A;  1FCH A;  1ELR A;  5EDS A;  4LER A;  2XGO A;  3B7T A;  5G04 J;  2X38 A;  1H2V C;  1E7V A;  3CST A;  3JQ0 A;  4L1B A;  2CHZ A;  3QAR A;  4JVS A;  3TJP A;  4JA7 A;  3L22 A;  4IUL A;  3ESL A;  5HQ8 A;  2IFU A;  4MS6 A;  4C9B B;  5FQ6 A;  1TJC A;  3KS2 A;  3FTU A;  4N2Q A;  2GW1 A;  5FT9 A;  5KCM A;  1NA3 A;  3EJN A;  3KD7 A;  3Q4A B;  4M3O A;  1MHQ A;  2FO7 A;  3FTW A;  3QC1 A;  3FUH A;  3CVX A;  2WQ7 A;  3CVY A;  3D3M A;  3QWV A;  2PL2 A;  5FQ8 A;  4AY5 A;  4IRU A;  3FU5 A;  4XE0 A;  1Y8M A;  2PM6 A;  3G2U A;  4EQF A;  1UN8 A;  3ZW3 A;  1SQM A;  1UN9 A;  4GB9 A;  4EZK A;  3CVW A;  3UUX A;  4HOR A;  2WQ6 A;  5J90 A;  1PAQ A;  2CFZ A;  4V3I A;  3PNT B;  5EKQ D;  4EZL A;  2X6F A;  3UX4 A;  2AWI A;  3I5P A;  3FUL A;  4DLO A;  4F1S A;  2Q7F A;  3FU0 A;  3MV2 B;  2WB2 A;  2KC7 A;  3RIB A;  4G2V A;  2HYZ A;  2V8S E;  4BWR A;  4CDR A;  3I4R B;  2I2O A;  2WXM A;  3RKV A;  3ONL A;  3AU5 A;  3SZ7 A;  2QY7 A;  3TGO A;  1GW6 A;  4XZ4 A;  4I17 A;  3GYZ A;  3O4Z A;  1JWG A;  1YA0 A;  4J8D A;  4N39 A;  1E8Y A;  2V0P A;  4Q96 A;  1H6K A;  1DNP A;  5D0O D;  3UMV A;  3LY7 A;  3RRN B;  2DIW A;  4NUR A;  2BUG A;  3AS8 A;  2WXH A;  3R7R A;  4F7A A;  5LCW C;  3GZS A;  4H7X A;  1JWF A;  2WXJ A;  4AY6 A;  3VTX A;  1KT1 A;  4W9R A;  2WPV A;  4WNF A;  5FZS A;  3PRE A;  3NZU A;  3I3N A;  4FHK A;  5T8I A;  2LAH A;  3S7D A;  3CGH A;  3VLE A;  2VJ8 A;  4NQ0 A;  4GCO A;  4ANU A;  3EHN A;  4EPZ A;  4TUU A;  4XI9 A;  2AW6 A;  3MZL B;  4ILG A;  3CVP A;  4WAF A;  2FI7 A;  4JHK A;  3QK0 A;  3FTY A;  4APO A;  3APF A;  3D9K A;  3FUM A;  2NXP A;  3B7S A;  4KVM A;  5KJK A;  1QQE A;  4URK A;  3CQC B;  3CK8 A;  4FJY A;  2VSN A;  3ENE A;  1HG5 A;  3PE3 A;  4H7Y A;  3FTV A;  1WAO 1;  4JPS A;  4J8E A;  1HZ4 A;  4A1G A;  5JJT A;  2DCP A;  3HDX A;  3LY8 A;  4PH4 B;  3ZN3 A;  1IYG A;  2E0I A;  3Q47 B;  4WNE A;  3FH8 A;  1IQR A;  3FHE A;  2VSX E;  4AOF A;  5G05 J;  4ACL A;  4A55 A;  2KCK A;  3CHS A;  5G55 A;  2YIN A;  3QJZ A;  3VLF A;  4YND A;  3T5X A;  3G2W A;  5A6C A;  5A23 A;  1NA0 A;  4GYY A;  3GZ2 A;  4U0U A;  4R7L A;  4K0R A;  3UQ3 A;  4J8S A;  3QNK A;  5BV1 A;  3IHY A;  2P58 C;  2XQ0 A;  4UQZ A;  3ZYL A;  3PEU B;  4Y6C A;  4XIF A;  3ASH A;  3Q15 A;  3CR3 A;  1FVH A;  1ZU2 A;  4I9C A;  2VYI A;  4U63 A;  4O6F A;  1UJK A;  5DBK A;  3CKC A;  4GA2 A;  2PZI A;  3BEE A;  4UI9 J;  2KZT A;  4GYO A;  3ZHE B;  4CGW A;  1P5Q A;  4U07 A;  4A3V A;  4P29 A;  2EQX A;  4KZC A;  1Z6T A;  2LAI A;  3FFL A;  4FC8 A;  2L0T B;  5DIZ A;  1OWN A;  2J09 A;  2HM8 A;  4JEU A;  2J4D A;  3CLJ A;  5G04 C;  4CCA A;  4ANW A;  4GZ5 A;  3TXM A;  1BPO A;  4ATG A;  2PM7 A;  5HI7 A;  5KJM A;  1OWL A;  1ELK A;  5LX8 A;  3MYV A;  4XKB A;  3FY4 A;  3HYM B;  4MLP A;  2V5F A;  4I2W A;  3G2T A;  5FWQ A;  4JL0 A;  4GMJ A;  3LEW A;  4PUC A;  2WMO A;  4FUL A;  3MEK A;  3S7J A;  4F53 A;  4FA6 A;  1U3D A;  4Q94 A;  4HFG A;  4JW1 A;  1NZN A;  2VTB B;  2WXO A;  4D10 C;  3E4B A;  3QAQ A;  2R17 C;  4ILI A;  4HVB A;  3ZPJ A;  3ZVV A;  2KM4 A;  4GML A;  2C0M A;  3HVE A;  4GU5 A;  3FU3 A;  3PRZ A;  3LDZ A;  4BFR A;  3B7R L;  3LYA A;  2ZU6 B;  3RK6 A;  3MV3 B;  3EIJ A;  3CVU A;  1E8W A;  1SZA A;  3JQ1 A;  4DK5 A;  1TEZ A;  3ULQ A;  3FP3 A;  1E96 B;  4DLQ A;  4HOQ A;  4PS7 A;  2FF4 A;  3RO3 A;  2Y4T A;  4KYO B;  3S7F A;  1EF1 C;  3CSF A;  3MJW A;  3SBS A;  2I6H A;  5C1D A;  3N71 A;  4BTA A;  4E6H A;  3ZYM A;  1HFA A;  3CKB A;  4TRQ A;  2WXQ A;  2LNI A;  4EEC A;  2LSU A;  4JC8 A;  2KCV A;  3PUK A;  1KT0 A;  3RO2 A;  2YHE A;  4GZC A;  5BPP A;  3PS6 A;  4XKC A;  2GRL A;  4FAD A;  1OWO A;  1H2T C;  1QNF A;  4B8A A;  4HXI A;  3U3W A;  1H0A A;  4OYS A;  1HS6 A;  4KVO A;  3MGB A;  2OVB A;  4CDN A;  4HS2 A;  4QFV A;  3D9J A;  4GZD A;  5LOZ A;  3UT4 A;  1E90 A;  3CVV A;  4BY6 A;  3BG0 B;  3NZS A;  5CMW A;  3L17 A;  1MQS A;  2Y3A A;  4AJW A;  2WMN A;  2VGY A;  2IU1 A;  5AJD A;  3MKQ B;  3PH0 C;  3LJ3 A;  3JCK C;  4N3C A;  1HG2 A;  4DJA A;  3R9A B;  4JA9 A;  3IEG A;  3U9W A;  4RVB A;  2WQH A;  3QOU A;  1HF8 A;  2L0I A;  1UW4 B;  3Q49 B;  2I1K A;  3ESK A;  4UWH A;  4WND A;  3JYS A;  4I6E A;  5E75 A;  2IOS A;  5AEN A;  3ZRH A;  2I9C A;  3PZD A;  3ASD A;  2CG2 A;  2XGS A;  2IQC A;  4WUY A;  2RD0 A;  3KAE A;  3OXG A;  4LUN U;  4WNG A;  5BW8 C;  3TG4 A;  4OVU A;  3L54 A;  1WM5 A;  3JUI A;  3C98 A;  4ME2 A;  1N52 A;  1FVF A;  5CHE E;  5BUZ A;  2OVF A;  3IKO B;  3T5V A;  2LSV A;  3CHP A;  3RJV A;  3D9N A;  3RRM B;  3PVL A;  2X6K A;  4UWF A;  2RG8 A;  3QKY A;  5G05 C;  2C2L A;  2UY1 A;  4A1S A;  2OOE A;  2R5S A;  4FHJ A;  2IOL A;  5FQ4 A;  4TV3 A;  4APF A;  1EPU A;  4PDX A;  5D0Q D;  3FUK A;  3D9I A;  4I1O B;  5CMY A;  1OWP A;  3CHM A;  4G24 A;  3S2A A;  4GYW A;  3LCA A;  5E76 A;  5JJ6 A;  4U0S A;  5T4Y A;  3IHV A;  2XRZ A;  3UPV A;  4BTB A;  1H2U A;  4A3T A;  4WWP A;  3LXU X;  3WXX A;  4L2L A;  4GA0 A;  4EBA G;  1B89 A;  3MCX A;  4CEM A;  3B7U X;  5FZR A;  3ZEF A;  5JHB A;  3URZ A;  1ZBP A;  4K03 A;  2GRM A;  4HOS A;  4J0U A;  3L16 A;  3BG1 B;  5JJ7 A;  4WWN A;  3P1U A;  3L08 A;  4UI9 C;  3DBS A;  2CHX A;  2CFU A;  2X3M A;  3AU4 A;  4RG9 A;  5AYW D;  5M72 A;  2WXR A;  2KCL A;  3CV0 A;  5FJY A;  5FZQ A;  4B8C B;  2ION A;  3R7Q A;  4UWL A;  3QDN A;  2VQ2 A;  3ZFW A;  3FEX A;  1PY1 A;  4GZ3 A;  2WVI A;  2A5U A;  2LO6 A;  4AV7 A;  4CT4 A;  3FDH A;  3MKR A;  3VTY A;  3ZHE A;  1E8X A;  1Z3Y A;  2X6H A;  4G26 A;  1NP7 A;  3FWV A;  3QWW A;  4EZJ A;  4AP2 A;  2DBA A;  3ZXS A;  2AXV A;  2IJG X;  4RG6 A;  2L9B A;  1HH8 A;  3FTS A;  3ML9 A;  4MKT A;  4N3B A;  2WXF A;  2XCC A;  3U66 A;  3TAX A;  1PC2 A;  3PNL B;  5C2Y A;  2QFC A;  2VGX A;  4U8H A;  3FUF A;  3D9M A;  3QB2 A;  4ANV A;  5BV0 A;  2AXZ A;  5FTP A;  3ZIM A;  3U64 A;  3QWP A;  1JPL A;  4IN3 B;  4UQY A;  1OWM A;  3PDN A;  4N5C A;  2XRY A;  1DVP A;  3L13 A;  2NSZ A;  4I1M A;  4UWG A;  2A4Z A;  3CVN A;  3GW4 A;  4J8F A;  4L2Y A;  3CVQ A;  3B13 A;  1EYH A;  2BTD A;  4Q69 A;  5BNW A;  4MRU A;  3LVQ E;  4I6J A;  3SGH A;  4GZ6 A;  5ANR A;  5FQ7 A;  3SI5 A;  2XPY A;  3G2S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...