3RO3A

Crystal structure of lgn/minscuteable complex
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
159
structure length
159
Chain Sequence
SRAAQGRAFGNLGNTHYLLGNFRDAVIAHEQRLLIAKEFGDKAAERIAYSNLGNAYIFLGEFETASEYYKKTLLLARQLKDRAVEAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIAQELKDRIGEGRACWSLGNAYTALGNHDQAMHFAEKHLEISREV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords G-protein-signaling modulator 2
publication title LGN/mInsc and LGN/NuMA complex structures suggest distinct functions in asymmetric cell division for the Par3/mInsc/LGN and G[alpha]i/LGN/NuMA pathways
pubmed doi rcsb
source organism Mus musculus
total genus 74
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2011-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13176 TPR_7 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ro3A00
3TG4A 2J9QA 2FEZA 3RU0A 2UWJG 3CV0A 4N39A 3BEEA 3R9AB 3S7JA 2WQHA 4YVQC 3QWPA 3GZ2A 4UQZA 2VSYA 1WAO1 4GZ3A 5G05J 3VTXA 4GA1A 5FZSA 2NC9A 4JHRA 1WM5A 2R5SA 3UQ3A 4HOSA 1FCHA 2XPIA 2XGSA 4RG6A 2JLBA 2VSNA 5DBKA 2L6JA 5DIZA 2HO1A 3O48A 3Q5MA 3AS4A 3ASFA 3TG5A 4AY6A 3GW4A 3EDTB 3ESKA 5D0QD 2VYIA 3LKUA 5FZQA 1IHGA 3MEKA 1XNFA 1ZU2A 2FF4A 2Q7FA 3CK7A 4G26A 4I9CA 4GA0A 5AYWD 5KJKA 1E96B 2XGMA 2MHKA 2PL2A 3Q4AB 3ASDA 1YA0A 2C0LA 3LY7A 4GA2A 3RJVA 1OUVA 3KAEA 5FT9A 4IN3B 3CKCA 3HYMB 4GCOA 2PQNA 4N3CA 4J8EA 2FI7A 4N3AA 5BT1A 2OOEA 3RIBA 4Y6CA 2ONDA 2YHCA 3ZFWA 4U07A 4G2VA 2XGOA 4KXKB 4U04A 4UQYA 4BTBA 3ASHA 4U0ZA 2HR2A 4G1TA 4LEUA 4N3BA 2XCCA 5FTPA 3U3WA 4J8FA 4BT8A 4WNFA 3N71A 2PQRA 4JL0A 3RKVA 3QOUA 2V5FA 4YNDA 2QFCA 2VGYA 3E4BA 1KT0A 3JYSA 4I1AA 1ZBPA 3TGOA 4H7YA 1B89A 2VGXA 3CK8A 3PE3A 2VGXB 5BW8C 5HQ8A 4GPKA 3CVLA 3ZHEA 4BT9A 3ZHEB 2FO7A 3UPVA 5LCWJ 2P58C 4U0UA 4UI9K 4HOTA 5JJTA 1P5QA 4KYOB 4ME2A 4NRHB 4WNDA 4H7XA 5M72A 3ASGA 3OXLA 5EKQD 2IFUA 3CEQA 2VQ2A 4U0SA 4CGWA 4GCNA 2UY1A 5EX0A 2UY1B 3QKYA 5CCLA 3KD7A 5KJNA 1NZNA 3S7DA 3CVQA 3SF4A 2KCLA 4BWRA 2Y4UA 5JJ6A 4XI9A 5CHEE 4I2WA 3LY8A 1HZ4A 4G25A 3MKRA 3Q47B 5FZRA 3ZPJA 4N2QA 4I2ZA 2LSUA 3QWVA 2WPVA 3Q15A 4O6FA 1NA0A 1HH8A 4WUYA 4UI9J 4ABNA 5G05C 3FWVA 3WXXA 3MA5A 2XEVA 3TAXA 1PC2A 1ELRA 5G04J 4JA7A 3S7BA 5LCWC 5JJ7A 3LCAA 2IF4A 1TJCA 3S7FA 4J0UA 4HOUA 3Q49B 3AS5A 3IEGA 2XCBA 1IYGA 3GZ1A 3URZA 4GYOA 1KT1A 5BNWA 2GW1A 2FBNA 4HOQA 3GYZA 3OXFA 4AIFA 4W9RA 1KLXA 5KJLA 3FFLA 4BTAA 4RG9A 3PDNA 4B94A 3KS2A 3RO3A 2KCVA 5A6CA 4A1SA 2AVPA 4N2SA 2LNIA 1HXIA 2KCKA 2PZIA 5EX3A 2E2EA 4GYYA 3LYAA 5C1DA 3AS8A 4XIFA 4AY5A 4NQ0A 2YQ8A 3QWWA 3MV3B 3PE4A 3SZ7A 3LY9A 2I6HA 2C0MA 2DBAA 4GZ5A 4UI9C 3ZGQA 4I17A 3OXGA 4JA9A 5HI7A 2C2LA 4AM9A 1NA3A 5G04C 1Y8MA 2HYZA 3UUXA 5ARFA 3CVNA 3VTYA 4UQXA 3FP3A 3QDNA 3MV2B 3NF1A 5FJYA 1QZ2A 4I9EA 5CCMA 4HORA 3RO2A 3LPZA 4CDRA 4APOA 1W3BA 3U4TA 4KBQA 4GZ6A 4WNEA 1A17A 2KC7A 1QQEA 5ARGA 2Y4TA 3CKBA 3ZN3A 4F3VA 4YVOA 4N5CA 3K9IA 2KATA 5D0OD 2LSVA 1ELWA 4Y6WA 4G23A 4J8DA 3CVPA 5KJMA 4WNGA 3ULQA 3CK9A 2BUGA 4GYWA 5A7DB 4G24A 4CGVA 4EQFA 4XI0A
chains in the Genus database with same CATH superfamily
2OCCE 3EHQA 4ZHBA 4TXPA 2J9QA 4M3OA 2FEZA 2B6CA 3V79K 5D2MC 2UWJG 4N39A 3PREA 3CLJA 3UM1A 2WXMA 3R9AB 1K1BA 2J07A 2VSYA 4GZ3A 2A5EA 4RLYA 2XS1A 3SGHA 2IO2C 2NC9A 4JHRA 4AVXA 3ZYKA 3L82A 5KWDA 2R5SA 2ZIRA 3UQ3A 3DXKG 2PM6A 5AJDA 4O1OA 4NACA 2XPIA 3UKUG 2DZOA 4P29A 3FTYA 3L22A 3TWRA 2QY7A 2L6JA 3ZKJA 2HO1A 3Q5MA 3AS4A 3ULYA 4HRNA 4I6JA 4AY6A 1N94A 1WY6A 2VYIA 4NIKA 1ZU2A 4ANWA 4RSYA 1QYMA 3HRAA 1EPUA 4HLLA 1S64A 3D9NA 3CK7A 4G26A 3I5PA 4BERA 5CMYA 2XGMA 1S70B 3AAAC 4GA2A 3FTZA 3CQGB 5CEAA 5BXUA 4OAUC 4LNUD 2X6HA 1E8ZA 2B0OE 3KEZA 4GCOA 3L08A 1E7UA 4HI8A 4N3CA 4KZ0A 3SI5A 4GTTA 3Q7AA 3Q78A 1ZB1A 3TWQA 4B8CB 3JXIA 2ONDA 4HXIA 3SNXA 3R9MA 1E8YA 2LO6A 1OWLA 1KPSB 5HKPA 3IHVA 3FUNA 2WMOA 3I3NA 2V5QC 3IXEA 1N52A 2Y69E 2KZTA 4BTBA 2KZTB 5BV0A 4OAVB 4U0ZA 4G11A 3EHRA 3D9MA 2WXOA 3DSSA 4PS8A 5CBOA 3RRMB 1KZOA 2OVFA 4BT8A 3N71A 3SBTB 4CT0A 2EIME 3NOCD 2PQRA 3DPYA 1HU3A 2OEWA 3QOUA 4AV7A 3FUIA 1S63A 5ANRA 4E6HA 3BU8A 3E4BA 4KMOA 4DX6D 3CHQA 3JYSA 2XRYA 3TGOA 4H7YA 2VGXA 2VGXB 4B0ZA 5HQ8A 4L2YA 4JD2G 4L2LA 3ZHEA 3ZVVA 2CG3A 3ZHEB 2FO7A 1JCQA 4IULA 5LFAA 2NYJA 2EILE 5A23A 4BEPA 1P5QA 5ITZF 2WM9A 3L17A 4KYOB 3DSVA 2R59A 4GU5A 1KZPA 2QC9A 2A5UA 3L54A 3CEQA 3HXEA 2WXKA 5BV1A 3ASNE 2V4HC 4I6GA 3ML9A 4CGWA 3ZRHA 3C72A 5KJNA 4FLHA 3S7DA 1TNYA 1NP7A 4XKBA 4ACLA 2KCLA 4BWRA 4F6RD 4LRZA 3T8MA 1YYHA 3PVLA 3D9LA 4JB8P 1UOHA 3TWSA 1HZ4A 3FEYA 5T4YA 1LTXA 2H6IA 4BFRA 3MKRA 3Q47B 1U3CA 1TR4A 5ENQD 1BPOA 4HS2A 4XX5A 3HHMA 1FVHA 3C3OA 2VJ8A 3G2TA 4DLOA 3BUAA 3EIQC 4LCTA 2IY0C 3TAXA 3EJNA 1H6OA 2WXHA 1DC2A 3L6AA 1SQMA 2R05A 2LUHA 4LNGA 1OWNA 2J49A 2P9KG 4WWNA 1Z3YA 2ETAA 2LAIA 2WXLA 5JJ7A 4J0UA 2WXJA 3PEUB 2EINE 3J5QB 3DXMG 4OYSA 3AG1E 3IEGA 2X3MA 5LOZA 1IYGA 4RVBA 3URZA 2P9PG 2V4LA 4G8KA 4R7LA 2DVWA 3TJPA 3T8KA 4LNBA 4HOQA 5ENPD 3GYZA 4W9RA 5KJLA 3PDNA 4JEHA 2Y0BG 3UT4A 4ILHB 2WXNA 2LNIA 4E85A 3FTVA 2PZIA 2IJGX 5D66A 4AY5A 3UT7A 3NBNB 4KT6B 3HIZA 3MV3B 1JWGA 4JHJA 2P9IG 2I6HA 2C0MA 4UUCA 4IRUA 4FLBA 4DX1A 5ANLA 3B7TA 3CIAA 3OXGA 3IBEA 5HI7A 3D9OA 1Y8MA 2HYZA 3VTYA 3QDNA 1X5BA 5ENNA 5E75A 4AXHA 4DUIA 4NURA 5FJYA 3NOGD 4JEUA 1QNFA 3FTXA 4AP2A 2X6JA 2L6BA 3RO2A 1O5MA 3LPZA 3R7RA 4APOA 4L9PA 1W3BA 5BXOA 1MX2A 2ZU6B 3MZLB 3TL5A 4MKTA 1O1RA 1QQEA 5ARGA 4ILGA 4F3VA 4MLPA 3VLFA 3X2QE 2P9SG 4N5CA 1IKND 4UWHA 5EILA 3JQ1A 2LSVA 4G8LA 3RK6A 3AU5A 4GAAA 5AN8A 3BQOA 3DWLG 3JCKC 2R03A 5EYLA 2QYJA 5A7DB 5T3RA 4CGVA 1SZAA 4C9BB 2ZXWE 2GROB 2LXMA 3BEEA 3Q9UC 5ENOD 4UWLA 3JXJA 3TWUA 3GZ2A 5C2YA 3SBSA 1WM5A 3D3MA 3PNTB 3U66A 4LSZE 4L23A 4XEIG 2XGSA 4RG6A 4ANXA 3PZDA 2XPZA 4FHKA 2XEHA 5DIZA 3ASFA 1D8DA 5J08A 3TG5A 3GW4A 3QC1A 3SHFA 1BI7B 5HRYA 4CT4A 2Q7FA 2IONA 3IKOB 2L0TB 2H6HA 4GA0A 5KJKA 4I43A 3CHPA 2MHKA 4JC8A 3Q4AB 4U8YD 2C0LA 3LY7A 4YDWA 5FT9A 4IN3B 3HYMB 3DSXA 3QK0A 1SVXA 3PZ1A 3AG4E 4HB5A 2XENA 3AJIA 4AEZC 2OOEA 3SD5A 5AARA 1UN8A 3DSTA 1UW4B 2YHCA 3ZFWA 3ZUVB 4U07A 3FUKA 1PY1A 1U3DA 5ENRD 3ASHA 3UINC 4CDMA 4LEUA 3QB2A 4ATGA 3FH5A 3FTWA 2I1JA 2XHEA 3V2OA 3W9GA 3U3WA 5AJLA 4B93B 5LX8A 2KBXA 3SO8A 4YNDA 1GW6A 3ONLA 3MJWA 3CHMA 3I4RB 1EDUA 2P9UG 5B3SE 4GTMA 5BPPA 1TEZA 4FJYA 2XZTG 4EBAG 3SFZA 3NZUA 4XKCA 3UPVA 5FQ8A 4U0UA 4HOTA 4U8VD 4WWOA 1HX8A 3PUJA 3FH8A 4ME2A 4PDXA 1TNZA 4WNDA 2QZAA 5M72A 3OXLA 1RW2A 4HQDA 5EKQD 1BD8A 3B95A 2VQ2A 4EECA 4ANUA 1YCSB 4PUCA 1G3NB 3CVYA 5CCLA 3FUHA 1MHQA 2LAHA 1TNOA 3CVQA 3FY4A 5AAOA 2HE0A 4OVUA 4C0MA 3ZU7B 4XI9A 5CHEE 4I2WA 2XEEA 3FH7A 3CSTA 3T5XA 3C3QA 4G25A 2R02A 4Q96A 3CHSA 4CZ2D 5G2NA 4N2QA 4I2ZA 5CRVA 3Q15A 2XZDG 4O6FA 2P9NG 1IHBA 4WUYA 2F0YA 1JPLA 4UI9J 2WQ6A 3FU3A 3MA5A 4BY6A 2NXPA 4D10C 1HG5A 3TXNA 1PC2A 1ELRA 1FVFA 4HRLA 3CVWA 2WVIA 3S7BA 1H19A 1H2VC 1TJCA 3Q49B 4LERA 1TJFA 1TN6A 1Q2ZA 3B7SA 1MX6A 4URKA 4DX2A 1MZCA 3IV0A 3VLEA 4TUUA 3ZXPA 4CEMA 1WG0A 3TWXA 2ETCA 4TV3A 3ZYLA 2WQ7A 2R17C 4DK5A 3ZYMA 2FBNA 3E33A 1KLXA 2I9CA 3P1UA 4B94A 5KCMA 3KS2A 3UTMA 2MYOA 5E76A 3RO3A 1NI1A 3UX4A 4CRWA 1H0AA 2BEDA 3CHRA 2RFAA 5A6CA 4A1SA 4GMLA 1HXIA 1NFIE 1LF8A 3UM2A 4Q69A 4ILIA 3FEXA 5EX3A 2E2EA 4GYYA 3LYAA 2CHXA 3AS8A 3NQPA 2BTDA 4NQ0A 5IY5E 1U2VG 1OCZE 3QWWA 4A55A 1NL4A 3EU9A 4KZCA 3VLDA 1OT8A 3HDXA 1K3ZD 2WMNA 4J8SA 3GZSA 3DRAA 2ILRA 4GZ5A 4UI9C 4FP7A 3ZGQA 1IXVA 4I17A 3AG3E 4JA9A 5EIDA 2X38A 5ARFA 3D9IA 2V8SE 4YDOA 1HS6A 4JHKA 2VSXE 2BKGA 3NF1A 4A1GA 3ZIMA 1N11A 2J8SD 3U4TA 2ZGDA 3FU5A 3AU4A 4LG6A 4WNEA 3HVEA 1A5EA 3HVEB 3C98A 2CG2A 4CCAA 3EIJA 2ZGGA 2J09A 2X6KA 3LXUX 1BU9A 3CVUA 1N4SA 2VTBA 4Y6WA 2VTBB 4KVOA 4GYWA 4G24A 3UM0A 3APFA 3ABLE 4XI0A 3TG4A 1N0QA 1FPPA 1JCSA 1OCOE 3FULA 4MBGA 3C5RA 3RU0A 2NSZA 1YMPA 4TXRA 1IQRA 3S7JA 2WQHA 2F8XK 2GRMA 4YVQC 4B89A 3QWPA 4X8QA 2XPYA 2Y3AA 4DPRA 5G05J 1HO8A 1FT1A 3B13A 3W9FA 2XS8A 1OXJA 4HOSA 2IOLA 2WXGA 3TWWA 2JLBA 2VSNA 3NAWA 2CHWA 4A3VA 1L5JA 1H6KA 1X81A 2AWIA 3EDTB 5D0QD 4BSXA 4J6IA 1INZA 3LKUA 5FZQA 4GTPA 1XNFA 3JUIA 4HVBA 5EN5D 4BX8A 4ANVA 4I9CA 1E96B 1OWOA 3J5PA 2PL2A 3MYVA 3LVRE 3Q79A 3UM3A 1OUVA 3CKCA 2YHEA 2FO1E 1JUQA 3PNLB 3MGBA 2L9BA 4DI3A 3ABKE 3APDA 4J8EA 2EIJE 3ZXSA 1V55E 2CFZA 4FU3A 2GRLA 2XRZA 3RIBA 4Y6CA 3UI2A 3ZNGA 3FU0A 3EUVA 4G2VA 4KXKB 3OAWA 3DEOA 2I1KA 3UKRG 2IOSA 4TXQA 2XCCA 5FTPA 5EIBE 3Q75A 5KNHD 3MX3A 3CSFA 3I4GA 3FUEA 3RKVA 3MKQA 1AWCB 4MRUA 2V5FA 3MKQB 3V31A 5CMWA 3UMVA 1H2UA 2VGYA 3PH0C 4HLEA 1KT0A 1LD7A 1ZBPA 3U9WA 2WXQA 2DYSE 4UWGA 3CK8A 3PE3A 4GPKA 3CVLA 1DNPA 1D8EA 3RAUA 4BT9A 4FADA 1Z3XA 3TWTA 3BG1B 3DSWA 4GZDA 1MX4A 3MCXA 1UN9A 2GRPB 1N54A 1AP7A 3ZEFA 4H7XA 4U7EB 2IFUA 4BSZB 3ULEG 3FUJA 3HXFA 4WAFA 4HFGA 4GCNA 2FULA 2DYRE 4I6EA 5AQAA 5EX0A 3QKYA 1OCCE 3PZ3A 3CVVA 4U95D 3RRUA 2IU1A 3SF4A 4C48B 5CERB 1H2TC 1XGWA 4EBAA 3PZ4A 5LP0A 3JQ0A 3ZPJA 5AENA 1E7VA 4TUMA 3U64A 2LSUA 4U8HA 1BLXB 4GTRA 4U63A 2PM7A 2WPVA 2RFMA 1HH8A 3BG0B 4ABNA 5J90A 5FWQA 4M7CA 3ISMC 4UWFA 1TN7A 2BKKB 2HM8A 3IHYA 4JA7A 4LUNU 2RD0A 3PUKA 1UJJA 4PH4B 2LXLA 1Z6TA 4GTSA 1H6PA 2V0PA 3SY2A 2OV8A 4DI4A 2XCBA 5HS0A 3GZ1A 3EHMA 2XQ0A 4K0RA 3FFLA 3FTUA 4BTAA 3G2WA 1TNUA 3HXCA 1UJKA 2CHZA 3QJZA 1HF8A 5FINA 2WXPA 1PAQA 3KEAA 2KCVA 3E37A 2AVPA 4N2SA 2YNQA 1JWFA 2KCKA 4DX5D 2Y1LE 3EHNA 2EQXA 4XIFA 2CFUA 1HFAA 4FA6A 5H7PA 4BETA 2AXVA 4CYMD 3HG0D 1RZ4A 1Y6IA 3D9KA 5JA4D 3V2XA 2DBAA 3G2SA 4MS6A 1LD8A 1N4PA 4BESA 3HXBA 4GTVA 3PRZA 2J4BA 4DLQA 2QYUA 2C2LA 4AM9A 4L7TA 2DZNA 5FIOA 4BX9A 1O1TA 3CVNA 4TRQA 1N4RA 4JXTA 3MV2B 4N5QA 4I9EA 4K5CA 4CDRA 1TN8A 3ML8A 1HG2A 1SA4A 5BUZA 2GRRB 5ENSD 2KC7A 3DSUA 1DVPA 2Y4TA 3ENEA 1N4QA 3CKBA 4GMRA 1S0PA 1IQUA 1WDYA 1E8WA 3V30A 3G2UA 1D9SA 2KATA 2BF0X 1ELWA 2J08A 3ASOE 3LEWA 4J8DA 4HBDA 4WNGA 4PS7A 4J7WA 4RQIA 3UT8A 3R7QA 1DCQA 2KXPC 4K5BA 5AIJA 1V54E 3PEVB 4GZCA 3CV0A 2ZISA 1EF1C 4UQZA 4GB9A 1WAO1 3VTXA 3E34A 3ABME 4GA1A 5FZSA 4J8YA 3B7BA 4EZJA 5AQ7A 1FCHA 3LJNA 3LVQE 5CBNA 5B1AE 5KBAA 5DBKA 3O48A 2IQCA 4CDNA 3KSLA 2I2OA 3ESKA 1OY3D 4O60A 1IHGA 3MEKA 3NB2A 5KNGA 2FF4A 3PS6A 3EU5A 3E32A 2OEVA 3L13A 5AYWD 2GRQB 5JMND 4HNAD 1K8KG 3OTNA 5ENTD 3S2AA 3Q7FA 4I1OB 2L0IA 4C0EA 1SW6A 3ASDA 1YA0A 3LS8A 3RJVA 4ATZD 3KAEA 3CQCB 3CVXA 4OVVA 5FQ7A 2PQNA 2JABA 3APCA 2WB2A 4QFVA 4AJWA 2FI7A 4N3AA 5BT1A 3CHOA 2ETBA 1N95A 2F37A 4EZKA 4O1PA 3LDZA 2H6GA 2X6IA 4FULA 4YDEA 1DCEA 1TNBA 2XGOA 4U04A 2P2CP 2IO3C 4UQYA 1N0RA 2RG8A 2HR2A 4G1TA 4Q94A 4N3BA 2PNNA 2F8YA 4J8FA 3ZYQA 1FT2A 4WNFA 5B1BE 5JHAA 4JL0A 3FUDA 2AW6A 4HRMB 2QFCA 4HI9A 5FQ4A 4I1AA 4APFA 1B89A 5BW8C 3B7UX 4F1SA 2AXUA 3D9PA 4V3IA 3O4ZA 4GTOA 4KVMA 3NZSA 4XZ4A 5LCWJ 4XE0A 2P58C 4UI9K 5JJTA 3FUMA 1E90A 3L16A 3TWVA 2AJAA 4NRHB 3ZW3A 5CECB 3ASGA 2MRIA 4ZFHA 4U0SA 2X6FA 4F1PA 1VDYA 2OVBA 3QNKA 4IYPA 4DX7D 3AG2E 2UY1A 3UXGA 2UY1B 3KD7A 4FHJA 1NZNA 3G2VA 2IEJA 1E8XA 1O1SA 2WXIA 2Y4UA 4PS3A 4DRXE 5JJ6A 2R2LA 5CRUA 3LY8A 1TYQG 4F53A 2GGFA 3FDHA 5FZRA 3QAQA 2WXFA 1JCRA 1Z5SC 4ACKA 5AQ9A 2JEKA 3QWVA 4EPZA 4GMJA 1OWMA 1NA0A 3UIOC 3Q9NC 3PZ2A 5G05C 3FWVA 3WXXA 2XEVA 1K1AA 4GTQA 1SA5A 2VSOE 4UWKA 4WWPA 3ONKA 2H6FA 4L1BA 3JUEA 3E30A 5G04J 2AXZA 2GRNB 3L9TA 3TXMA 5LCWC 2P9LG 3LCAA 2IF4A 3S7FA 4HOUA 3SQVA 4I1MA 3CR3A 1MJ0A 3P2BA 5FQ6A 3AS5A 3KSQA 1UG3A 3SFXA 3CGHA 2A4ZA 4A63B 4QQIA 2KM4A 2WXRA 4GYOA 1KT1A 5BNWA 1ELKA 2DWZA 3LJ3A 2GW1A 4K5AB 1QBQA 3SFYA 3D9HA 3OXFA 4AIFA 3FTSA 4FJZA 3DBSA 4A3TA 4RG9A 2EIKE 4FC8A 1EYHA 4B8AA 1BI8B 2DIWA 2M63A 5C1DA 4JPSA 5G55A 2YQ8A 1N9AA 1MYOA 3PE4A 3SZ7A 3LY9A 4JW1A 3F6QA 4YDYA 5EDSA 2E0IA 3FU6A 4DJAA 5T8IA 4Z68A 3QARA 4JVSA 1NA3A 5G04C 3RRNB 3UUXA 4UQXA 1SZ9A 3FP3A 4F7AA 1QZ2A 1OCRE 5CCMA 2RKKA 1OWPA 3FHEA 4HORA 4K03A 1HE8A 4KBQA 4GZ6A 4GPMA 1A17A 2DCPA 4JZYA 2YINA 2VGEA 3Q73A 3ZN3A 2J4DA 3T9KA 4YVOA 3FUFA 3K9IA 5EYPF 3DEPA 4EHMA 3HXDA 5D0OD 5AQBA 1MQSA 3B7RL 4G23A 2MOWA 3CVPA 3T5VA 5KJMA 3ESLA 3WG7E 3D9JA 3DPDA 3ULQA 3RSEG 5JHBA 3CK9A 2BUGA 5CEDB 4EZLA 3UIPC 4U96D 3C3RA 4EQFA 4AOFA
chains in the Genus database with same CATH topology
3TG4A 2J9QA 4M3OA 2FEZA 3FULA 5AIJA 3RU0A 2NSZA 3PEVB 4GZCA 2UWJG 3CV0A 4N39A 3BEEA 3PREA 3CLJA 1IQRA 2WXMA 3R9AB 3S7JA 4UWLA 2WQHA 2GRMA 4YVQC 1EF1C 4B89A 3QWPA 2J07A 3GZ2A 4UQZA 2VSYA 1WAO1 2XPYA 2Y3AA 4GB9A 4GZ3A 5G05J 5C2YA 1HO8A 4DPRA 3SGHA 4GA1A 5FZSA 3VTXA 2NC9A 4JHRA 1WM5A 4AVXA 3ZYKA 3B13A 3D3MA 3PNTB 4EZJA 2R5SA 3UQ3A 2PM6A 5AJDA 4HOSA 3U66A 4NACA 1FCHA 2XPIA 2IOLA 4L23A 2WXGA 3LVQE 4P29A 2XGSA 4RG6A 2JLBA 3FTYA 2VSNA 3L22A 4ANXA 3PZDA 2WQ6A 2QY7A 2XPZA 5DBKA 2CHWA 2L6JA 1L5JA 4FHKA 5DIZA 2HO1A 3O48A 4A3VA 1H6KA 3Q5MA 3AS4A 3ASFA 2AWIA 2IQCA 4I6JA 3TG5A 4CDNA 3GW4A 5J08A 2I2OA 3EDTB 1WY6A 3ESKA 3QC1A 5D0QD 4BSXA 2VYIA 4J6IA 1INZA 3SHFA 3LKUA 5FZQA 1IHGA 3MEKA 1XNFA 1ZU2A 4CT4A 3JUIA 4ANWA 2FF4A 4RSYA 4HVBA 2Q7FA 2IONA 1EPUA 3PS6A 4BX8A 3D9NA 3IKOB 2L0TB 3CK7A 3L13A 4G26A 3I5PA 4ANVA 4I9CA 4GA0A 5AYWD 5KJKA 1E96B 5CMYA 4I43A 3CHPA 3OTNA 3S2AA 2XGMA 4I1OB 2MHKA 1OWOA 2L0IA 4JC8A 4C0EA 2PL2A 3MYVA 3LVRE 3Q4AB 3ASDA 1YA0A 2C0LA 3LY7A 3LS8A 4GA2A 3RJVA 3FTZA 3CQGB 1OUVA 3KAEA 3CQCB 2X6HA 1E8ZA 4IN3B 5FT9A 3CKCA 3KEZA 3HYMB 3QK0A 2YHEA 3CVXA 4GCOA 3L08A 1JUQA 3PNLB 3MGBA 1E7UA 4OVVA 2L9BA 2PQNA 5FQ7A 4DI3A 4N3CA 3APDA 4J8EA 3APCA 4KZ0A 3ZXSA 4AEZC 2WB2A 4QFVA 2CFZA 4AJWA 3SI5A 4FU3A 2FI7A 2GRLA 4N3AA 5BT1A 2OOEA 3SD5A 4B8CB 2XRZA 3RIBA 4Y6CA 2ONDA 4HXIA 3SNXA 3CHOA 1E8YA 2LO6A 1UN8A 1OWLA 5J90A 1UW4B 4EZKA 3FU0A 3IHVA 3FUNA 2YHCA 2WMOA 3LDZA 3I3NA 2X6IA 3ZFWA 4FULA 4U07A 1N52A 4G2VA 2XGOA 4KXKB 4U04A 2KZTA 3OAWA 3FUKA 1PY1A 4UQYA 4BTBA 2KZTB 2I1KA 1U3DA 5BV0A 2RG8A 3ASHA 4U0ZA 2HR2A 4G1TA 2IOSA 4CDMA 4LEUA 4Q94A 3QB2A 4N3BA 4ATGA 2XCCA 5FTPA 4G11A 3FH5A 3D9MA 2WXOA 3FTWA 2I1JA 2XHEA 4PS8A 3U3WA 5AJLA 3MX3A 4J8FA 3RRMB 3ZYQA 2OVFA 4WNFA 3N71A 3SBTB 4BT8A 4CT0A 3CSFA 3I4GA 5JHAA 2PQRA 3FUEA 3FUDA 4JL0A 3RKVA 5LX8A 1HU3A 3MKQA 3QOUA 4MRUA 4AV7A 2V5FA 3MKQB 4YNDA 2AW6A 1GW6A 2QFCA 3FUIA 3UMVA 5CMWA 5ANRA 3ONLA 1H2UA 2VGYA 4E6HA 3MJWA 5FQ4A 3CHMA 3I4RB 3E4BA 3PH0C 4KMOA 4HLEA 1KT0A 1EDUA 3CHQA 3JYSA 4I1AA 4APFA 1ZBPA 2XRYA 3TGOA 3U9WA 2WXQA 5BPPA 1TEZA 4FJYA 4H7YA 4UWGA 1B89A 2VGXA 3CK8A 3PE3A 2VGXB 5BW8C 4B0ZA 5HQ8A 4L2YA 4EBAG 3SFZA 3NZUA 3CVLA 4GPKA 4L2LA 4XKCA 3B7UX 3ZHEA 1DNPA 3ZVVA 2CG3A 4BT9A 3ZHEB 4F1SA 4FADA 2FO7A 2AXUA 1Z3XA 3D9PA 3SBSA 3UPVA 4V3IA 3O4ZA 4IULA 4KVMA 5FQ8A 3NZSA 4XZ4A 5A23A 5LFAA 5LCWJ 4XE0A 2P58C 4U0UA 3BG1B 4UI9K 4HOTA 4GZDA 5JJTA 4WWOA 3MCXA 1P5QA 1HX8A 3FUMA 3PUJA 1UN9A 2WM9A 3L17A 3FH8A 4KYOB 4ME2A 2R59A 1E90A 1N54A 4PDXA 3L16A 4NRHB 4WNDA 4GU5A 3ZEFA 4H7XA 3ZW3A 2A5UA 3ASGA 3OXLA 5M72A 3L54A 2MRIA 5EKQD 2IFUA 3CEQA 2VQ2A 2WXKA 3FUJA 5BV1A 4EECA 4U0SA 4WAFA 2X6FA 1VDYA 3ML9A 4I6GA 4ANUA 2OVBA 3QNKA 4HFGA 4GCNA 4IYPA 4CGWA 2FULA 4PUCA 4I6EA 2UY1A 5EX0A 3ZRHA 2UY1B 3CVYA 3QKYA 5CCLA 3KD7A 3FUHA 1MHQA 4FHJA 5KJNA 4FLHA 3CVVA 1NZNA 2LAHA 3S7DA 3CVQA 3G2VA 3FY4A 1NP7A 3RRUA 2IU1A 4XKBA 3SF4A 4ACLA 1E8XA 2KCLA 4BWRA 2WXIA 2Y4UA 4LRZA 4OVUA 3T8MA 4C0MA 4PS3A 5JJ6A 3PVLA 4XI9A 5CHEE 4I2WA 3D9LA 3LY8A 1H2TC 1XGWA 3FH7A 4F53A 2GGFA 3CSTA 4EBAA 3T5XA 5LP0A 1HZ4A 3FEYA 4G25A 3FDHA 5T4YA 4BFRA 3MKRA 3JQ0A 4Q96A 3Q47B 5FZRA 3ZPJA 5AENA 1U3CA 3CHSA 1E7VA 3QAQA 5G2NA 2WXFA 4N2QA 4I2ZA 4ACKA 3U64A 1BPOA 2JEKA 2LSUA 4U8HA 4U63A 4HS2A 2PM7A 3QWVA 2WPVA 4XX5A 3Q15A 4GMJA 4EPZA 3HHMA 4O6FA 1FVHA 1OWMA 2VJ8A 1NA0A 3G2TA 4DLOA 1HH8A 4WUYA 1JPLA 4UI9J 3BG0B 5G05C 4ABNA 3FWVA 3EIQC 3FU3A 3MA5A 2XEVA 4LCTA 5FWQA 3WXXA 3TAXA 4BY6A 2NXPA 3EJNA 4D10C 2VSOE 2WXHA 4UWKA 1HG5A 3L6AA 1SQMA 4WWPA 4UWFA 3ONKA 1OWNA 2J49A 4L1BA 3TXNA 1PC2A 1ELRA 4WWNA 1Z3YA 1FVFA 5G04J 3CVWA 2HM8A 3IHYA 2AXZA 2LAIA 4JA7A 2WVIA 4LUNU 2RD0A 3S7BA 1H19A 2WXLA 3TXMA 1H2VC 5JJ7A 5LCWC 3LCAA 3PUKA 2IF4A 1TJCA 3S7FA 1UJJA 4HOUA 3Q49B 4J0UA 4PH4B 2WXJA 1TJFA 4I1MA 4LERA 3B7SA 3PEUB 1Z6TA 4URKA 3CR3A 3P2BA 5FQ6A 3AS5A 3IV0A 4OYSA 2V0PA 3VLEA 1UG3A 4TUUA 4CEMA 2OV8A 3IEGA 2XCBA 4DI4A 2X3MA 3CGHA 4TV3A 2A4ZA 5LOZA 1IYGA 2KM4A 3GZ1A 4RVBA 2WXRA 3URZA 3EHMA 3ZYLA 2WQ7A 2V4LA 2R17C 4DK5A 4GYOA 1KT1A 2XQ0A 4K0RA 1ELKA 5BNWA 3LJ3A 4R7LA 3ZYMA 2GW1A 3TJPA 2FBNA 4HOQA 3GYZA 3OXFA 4AIFA 3FTSA 4FJZA 4W9RA 1KLXA 5KJLA 2I9CA 3DBSA 3FFLA 3FTUA 4RG9A 3G2WA 3P1UA 3PDNA 4JEHA 4A3TA 5KCMA 4B94A 3KS2A 1UJKA 2CHZA 3QJZA 5E76A 1HF8A 3RO3A 3UT4A 3UX4A 4CRWA 2WXPA 1H0AA 1PAQA 4ILHB 2KCVA 3CHRA 2WXNA 5A6CA 4A1SA 4FC8A 2AVPA 4N2SA 4GMLA 1EYHA 2LNIA 4B8AA 1HXIA 2YNQA 1JWFA 1LF8A 2KCKA 4E85A 3FTVA 4Q69A 2PZIA 4ILIA 3FEXA 2DIWA 2M63A 5EX3A 2E2EA 3EHNA 2IJGX 4GYYA 3LYAA 2CHXA 5C1DA 4JPSA 2EQXA 3AS8A 3NQPA 4XIFA 2BTDA 4NQ0A 3UT7A 4AY5A 2CFUA 5G55A 1HFAA 2YQ8A 4FA6A 3QWWA 4A55A 4KT6B 4KZCA 3HIZA 2AXVA 3MV3B 3PE4A 3VLDA 3SZ7A 1JWGA 3LY9A 1Y6IA 4JW1A 3HDXA 5EDSA 2WMNA 4JHJA 2E0IA 2I6HA 2C0MA 3D9KA 4J8SA 4IRUA 3GZSA 2DBAA 2ILRA 3G2SA 3FU6A 4MS6A 4GZ5A 4UI9C 4FP7A 3ZGQA 4FLBA 4DJAA 3PRZA 5ANLA 5T8IA 2J4BA 4I17A 3B7TA 3CIAA 3OXGA 4JA9A 3IBEA 3QARA 4DLQA 5HI7A 4JVSA 2C2LA 3D9OA 4AM9A 1NA3A 4L7TA 5G04C 1Y8MA 2HYZA 4BTAA 3RRNB 3UUXA 4BX9A 2X38A 5ARFA 3CVNA 3VTYA 3D9IA 4TRQA 4UQXA 2V8SE 1SZ9A 3FP3A 1HS6A 3QDNA 4JXTA 1X5BA 5ENNA 5E75A 3MV2B 2VSXE 4JHKA 4AXHA 4F7AA 3NF1A 4NURA 5FJYA 1QZ2A 4I9EA 4JEUA 5CCMA 1QNFA 3FTXA 4A1GA 4AP2A 1OWPA 3ZIMA 3FHEA 2X6JA 4HORA 4AY6A 3RO2A 4K03A 3LPZA 3R7RA 4CDRA 4APOA 1HE8A 1W3BA 3U4TA 4KBQA 3FU5A 4GZ6A 3ML8A 3AU4A 2ZU6B 4WNEA 1HG2A 3MZLB 3TL5A 4MKTA 1A17A 3HVEA 5BUZA 3HVEB 2KC7A 1QQEA 2DCPA 4JZYA 5ARGA 1DVPA 2YINA 2Y4TA 3C98A 4ILGA 3ENEA 3CKBA 2CG2A 3ZN3A 1S0PA 2J4DA 4F3VA 1IQUA 4MLPA 4CCAA 1E8WA 3VLFA 4YVOA 3FUFA 4N5CA 3G2UA 3K9IA 3EIJA 4UWHA 2J09A 2KATA 2BF0X 5D0OD 2X6KA 3LXUX 3JQ1A 1MQSA 2LSVA 3CVUA 1ELWA 2J08A 2VTBA 4Y6WA 2VTBB 3B7RL 3LEWA 3RK6A 4G23A 3AU5A 2MOWA 4J8DA 3CVPA 4GAAA 3T5VA 5KJMA 3ESLA 4WNGA 3D9JA 4KVOA 3DPDA 4PS7A 3ULQA 3JCKC 5JHBA 3CK9A 2BUGA 4EZLA 4GYWA 3UT8A 5A7DB 3R7QA 4G24A 5T3RA 4CGVA 1SZAA 3APFA 4C9BB 4EQFA 4AOFA 4XI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TG4 A;  2J9Q A;  2FEZ A;  3RU0 A;  2UWJ G;  3CV0 A;  4N39 A;  3BEE A;  3R9A B;  3S7J A;  2WQH A;  4YVQ C;  3QWP A;  3GZ2 A;  4UQZ A;  2VSY A;  1WAO 1;  4GZ3 A;  5G05 J;  3VTX A;  4GA1 A;  5FZS A;  2NC9 A;  4JHR A;  1WM5 A;  2R5S A;  3UQ3 A;  4HOS A;  1FCH A;  2XPI A;  2XGS A;  4RG6 A;  2JLB A;  2VSN A;  5DBK A;  2L6J A;  5DIZ A;  2HO1 A;  3O48 A;  3Q5M A;  3AS4 A;  3ASF A;  3TG5 A;  4AY6 A;  3GW4 A;  3EDT B;  3ESK A;  5D0Q D;  2VYI A;  3LKU A;  5FZQ A;  1IHG A;  3MEK A;  1XNF A;  1ZU2 A;  2FF4 A;  2Q7F A;  3CK7 A;  4G26 A;  4I9C A;  4GA0 A;  5AYW D;  5KJK A;  1E96 B;  2XGM A;  2MHK A;  2PL2 A;  3Q4A B;  3ASD A;  1YA0 A;  2C0L A;  3LY7 A;  4GA2 A;  3RJV A;  1OUV A;  3KAE A;  5FT9 A;  4IN3 B;  3CKC A;  3HYM B;  4GCO A;  2PQN A;  4N3C A;  4J8E A;  2FI7 A;  4N3A A;  5BT1 A;  2OOE A;  3RIB A;  4Y6C A;  2OND A;  2YHC A;  3ZFW A;  4U07 A;  4G2V A;  2XGO A;  4KXK B;  4U04 A;  4UQY A;  4BTB A;  3ASH A;  4U0Z A;  2HR2 A;  4G1T A;  4LEU A;  4N3B A;  2XCC A;  5FTP A;  3U3W A;  4J8F A;  4BT8 A;  4WNF A;  3N71 A;  2PQR A;  4JL0 A;  3RKV A;  3QOU A;  2V5F A;  4YND A;  2QFC A;  2VGY A;  3E4B A;  1KT0 A;  3JYS A;  4I1A A;  1ZBP A;  3TGO A;  4H7Y A;  1B89 A;  2VGX A;  3CK8 A;  3PE3 A;  2VGX B;  5BW8 C;  5HQ8 A;  4GPK A;  3CVL A;  3ZHE A;  4BT9 A;  3ZHE B;  2FO7 A;  3UPV A;  5LCW J;  2P58 C;  4U0U A;  4UI9 K;  4HOT A;  5JJT A;  1P5Q A;  4KYO B;  4ME2 A;  4NRH B;  4WND A;  4H7X A;  5M72 A;  3ASG A;  3OXL A;  5EKQ D;  2IFU A;  3CEQ A;  2VQ2 A;  4U0S A;  4CGW A;  4GCN A;  2UY1 A;  5EX0 A;  2UY1 B;  3QKY A;  5CCL A;  3KD7 A;  5KJN A;  1NZN A;  3S7D A;  3CVQ A;  3SF4 A;  2KCL A;  4BWR A;  2Y4U A;  5JJ6 A;  4XI9 A;  5CHE E;  4I2W A;  3LY8 A;  1HZ4 A;  4G25 A;  3MKR A;  3Q47 B;  5FZR A;  3ZPJ A;  4N2Q A;  4I2Z A;  2LSU A;  3QWV A;  2WPV A;  3Q15 A;  4O6F A;  1NA0 A;  1HH8 A;  4WUY A;  4UI9 J;  4ABN A;  5G05 C;  3FWV A;  3WXX A;  3MA5 A;  2XEV A;  3TAX A;  1PC2 A;  1ELR A;  5G04 J;  4JA7 A;  3S7B A;  5LCW C;  5JJ7 A;  3LCA A;  2IF4 A;  1TJC A;  3S7F A;  4J0U A;  4HOU A;  3Q49 B;  3AS5 A;  3IEG A;  2XCB A;  1IYG A;  3GZ1 A;  3URZ A;  4GYO A;  1KT1 A;  5BNW A;  2GW1 A;  2FBN A;  4HOQ A;  3GYZ A;  3OXF A;  4AIF A;  4W9R A;  1KLX A;  5KJL A;  3FFL A;  4BTA A;  4RG9 A;  3PDN A;  4B94 A;  3KS2 A;  3RO3 A;  2KCV A;  5A6C A;  4A1S A;  2AVP A;  4N2S A;  2LNI A;  1HXI A;  2KCK A;  2PZI A;  5EX3 A;  2E2E A;  4GYY A;  3LYA A;  5C1D A;  3AS8 A;  4XIF A;  4AY5 A;  4NQ0 A;  2YQ8 A;  3QWW A;  3MV3 B;  3PE4 A;  3SZ7 A;  3LY9 A;  2I6H A;  2C0M A;  2DBA A;  4GZ5 A;  4UI9 C;  3ZGQ A;  4I17 A;  3OXG A;  4JA9 A;  5HI7 A;  2C2L A;  4AM9 A;  1NA3 A;  5G04 C;  1Y8M A;  2HYZ A;  3UUX A;  5ARF A;  3CVN A;  3VTY A;  4UQX A;  3FP3 A;  3QDN A;  3MV2 B;  3NF1 A;  5FJY A;  1QZ2 A;  4I9E A;  5CCM A;  4HOR A;  3RO2 A;  3LPZ A;  4CDR A;  4APO A;  1W3B A;  3U4T A;  4KBQ A;  4GZ6 A;  4WNE A;  1A17 A;  2KC7 A;  1QQE A;  5ARG A;  2Y4T A;  3CKB A;  3ZN3 A;  4F3V A;  4YVO A;  4N5C A;  3K9I A;  2KAT A;  5D0O D;  2LSV A;  1ELW A;  4Y6W A;  4G23 A;  4J8D A;  3CVP A;  5KJM A;  4WNG A;  3ULQ A;  3CK9 A;  2BUG A;  4GYW A;  5A7D B;  4G24 A;  4CGV A;  4EQF A;  4XI0 A; 
#chains in the Genus database with same CATH topology
 2OCC E;  3EHQ A;  4ZHB A;  4TXP A;  2J9Q A;  4M3O A;  2FEZ A;  2B6C A;  3V79 K;  5D2M C;  2UWJ G;  4N39 A;  3PRE A;  3CLJ A;  3UM1 A;  2WXM A;  3R9A B;  1K1B A;  2J07 A;  2VSY A;  4GZ3 A;  2A5E A;  4RLY A;  2XS1 A;  3SGH A;  2IO2 C;  2NC9 A;  4JHR A;  4AVX A;  3ZYK A;  3L82 A;  5KWD A;  2R5S A;  2ZIR A;  3UQ3 A;  3DXK G;  2PM6 A;  5AJD A;  4O1O A;  4NAC A;  2XPI A;  3UKU G;  2DZO A;  4P29 A;  3FTY A;  3L22 A;  3TWR A;  2QY7 A;  2L6J A;  3ZKJ A;  2HO1 A;  3Q5M A;  3AS4 A;  3ULY A;  4HRN A;  4I6J A;  4AY6 A;  1N94 A;  1WY6 A;  2VYI A;  4NIK A;  1ZU2 A;  4ANW A;  4RSY A;  1QYM A;  3HRA A;  1EPU A;  4HLL A;  1S64 A;  3D9N A;  3CK7 A;  4G26 A;  3I5P A;  4BER A;  5CMY A;  2XGM A;  1S70 B;  3AAA C;  4GA2 A;  3FTZ A;  3CQG B;  5CEA A;  5BXU A;  4OAU C;  4LNU D;  2X6H A;  1E8Z A;  2B0O E;  3KEZ A;  4GCO A;  3L08 A;  1E7U A;  4HI8 A;  4N3C A;  4KZ0 A;  3SI5 A;  4GTT A;  3Q7A A;  3Q78 A;  1ZB1 A;  3TWQ A;  4B8C B;  3JXI A;  2OND A;  4HXI A;  3SNX A;  3R9M A;  1E8Y A;  2LO6 A;  1OWL A;  1KPS B;  5HKP A;  3IHV A;  3FUN A;  2WMO A;  3I3N A;  2V5Q C;  3IXE A;  1N52 A;  2Y69 E;  2KZT A;  4BTB A;  2KZT B;  5BV0 A;  4OAV B;  4U0Z A;  4G11 A;  3EHR A;  3D9M A;  2WXO A;  3DSS A;  4PS8 A;  5CBO A;  3RRM B;  1KZO A;  2OVF A;  4BT8 A;  3N71 A;  3SBT B;  4CT0 A;  2EIM E;  3NOC D;  2PQR A;  3DPY A;  1HU3 A;  2OEW A;  3QOU A;  4AV7 A;  3FUI A;  1S63 A;  5ANR A;  4E6H A;  3BU8 A;  3E4B A;  4KMO A;  4DX6 D;  3CHQ A;  3JYS A;  2XRY A;  3TGO A;  4H7Y A;  2VGX A;  2VGX B;  4B0Z A;  5HQ8 A;  4L2Y A;  4JD2 G;  4L2L A;  3ZHE A;  3ZVV A;  2CG3 A;  3ZHE B;  2FO7 A;  1JCQ A;  4IUL A;  5LFA A;  2NYJ A;  2EIL E;  5A23 A;  4BEP A;  1P5Q A;  5ITZ F;  2WM9 A;  3L17 A;  4KYO B;  3DSV A;  2R59 A;  4GU5 A;  1KZP A;  2QC9 A;  2A5U A;  3L54 A;  3CEQ A;  3HXE A;  2WXK A;  5BV1 A;  3ASN E;  2V4H C;  4I6G A;  3ML9 A;  4CGW A;  3ZRH A;  3C72 A;  5KJN A;  4FLH A;  3S7D A;  1TNY A;  1NP7 A;  4XKB A;  4ACL A;  2KCL A;  4BWR A;  4F6R D;  4LRZ A;  3T8M A;  1YYH A;  3PVL A;  3D9L A;  4JB8 P;  1UOH A;  3TWS A;  1HZ4 A;  3FEY A;  5T4Y A;  1LTX A;  2H6I A;  4BFR A;  3MKR A;  3Q47 B;  1U3C A;  1TR4 A;  5ENQ D;  1BPO A;  4HS2 A;  4XX5 A;  3HHM A;  1FVH A;  3C3O A;  2VJ8 A;  3G2T A;  4DLO A;  3BUA A;  3EIQ C;  4LCT A;  2IY0 C;  3TAX A;  3EJN A;  1H6O A;  2WXH A;  1DC2 A;  3L6A A;  1SQM A;  2R05 A;  2LUH A;  4LNG A;  1OWN A;  2J49 A;  2P9K G;  4WWN A;  1Z3Y A;  2ETA A;  2LAI A;  2WXL A;  5JJ7 A;  4J0U A;  2WXJ A;  3PEU B;  2EIN E;  3J5Q B;  3DXM G;  4OYS A;  3AG1 E;  3IEG A;  2X3M A;  5LOZ A;  1IYG A;  4RVB A;  3URZ A;  2P9P G;  2V4L A;  4G8K A;  4R7L A;  2DVW A;  3TJP A;  3T8K A;  4LNB A;  4HOQ A;  5ENP D;  3GYZ A;  4W9R A;  5KJL A;  3PDN A;  4JEH A;  2Y0B G;  3UT4 A;  4ILH B;  2WXN A;  2LNI A;  4E85 A;  3FTV A;  2PZI A;  2IJG X;  5D66 A;  4AY5 A;  3UT7 A;  3NBN B;  4KT6 B;  3HIZ A;  3MV3 B;  1JWG A;  4JHJ A;  2P9I G;  2I6H A;  2C0M A;  4UUC A;  4IRU A;  4FLB A;  4DX1 A;  5ANL A;  3B7T A;  3CIA A;  3OXG A;  3IBE A;  5HI7 A;  3D9O A;  1Y8M A;  2HYZ A;  3VTY A;  3QDN A;  1X5B A;  5ENN A;  5E75 A;  4AXH A;  4DUI A;  4NUR A;  5FJY A;  3NOG D;  4JEU A;  1QNF A;  3FTX A;  4AP2 A;  2X6J A;  2L6B A;  3RO2 A;  1O5M A;  3LPZ A;  3R7R A;  4APO A;  4L9P A;  1W3B A;  5BXO A;  1MX2 A;  2ZU6 B;  3MZL B;  3TL5 A;  4MKT A;  1O1R A;  1QQE A;  5ARG A;  4ILG A;  4F3V A;  4MLP A;  3VLF A;  3X2Q E;  2P9S G;  4N5C A;  1IKN D;  4UWH A;  5EIL A;  3JQ1 A;  2LSV A;  4G8L A;  3RK6 A;  3AU5 A;  4GAA A;  5AN8 A;  3BQO A;  3DWL G;  3JCK C;  2R03 A;  5EYL A;  2QYJ A;  5A7D B;  5T3R A;  4CGV A;  1SZA A;  4C9B B;  2ZXW E;  2GRO B;  2LXM A;  3BEE A;  3Q9U C;  5ENO D;  4UWL A;  3JXJ A;  3TWU A;  3GZ2 A;  5C2Y A;  3SBS A;  1WM5 A;  3D3M A;  3PNT B;  3U66 A;  4LSZ E;  4L23 A;  4XEI G;  2XGS A;  4RG6 A;  4ANX A;  3PZD A;  2XPZ A;  4FHK A;  2XEH A;  5DIZ A;  3ASF A;  1D8D A;  5J08 A;  3TG5 A;  3GW4 A;  3QC1 A;  3SHF A;  1BI7 B;  5HRY A;  4CT4 A;  2Q7F A;  2ION A;  3IKO B;  2L0T B;  2H6H A;  4GA0 A;  5KJK A;  4I43 A;  3CHP A;  2MHK A;  4JC8 A;  3Q4A B;  4U8Y D;  2C0L A;  3LY7 A;  4YDW A;  5FT9 A;  4IN3 B;  3HYM B;  3DSX A;  3QK0 A;  1SVX A;  3PZ1 A;  3AG4 E;  4HB5 A;  2XEN A;  3AJI A;  4AEZ C;  2OOE A;  3SD5 A;  5AAR A;  1UN8 A;  3DST A;  1UW4 B;  2YHC A;  3ZFW A;  3ZUV B;  4U07 A;  3FUK A;  1PY1 A;  1U3D A;  5ENR D;  3ASH A;  3UIN C;  4CDM A;  4LEU A;  3QB2 A;  4ATG A;  3FH5 A;  3FTW A;  2I1J A;  2XHE A;  3V2O A;  3W9G A;  3U3W A;  5AJL A;  4B93 B;  5LX8 A;  2KBX A;  3SO8 A;  4YND A;  1GW6 A;  3ONL A;  3MJW A;  3CHM A;  3I4R B;  1EDU A;  2P9U G;  5B3S E;  4GTM A;  5BPP A;  1TEZ A;  4FJY A;  2XZT G;  4EBA G;  3SFZ A;  3NZU A;  4XKC A;  3UPV A;  5FQ8 A;  4U0U A;  4HOT A;  4U8V D;  4WWO A;  1HX8 A;  3PUJ A;  3FH8 A;  4ME2 A;  4PDX A;  1TNZ A;  4WND A;  2QZA A;  5M72 A;  3OXL A;  1RW2 A;  4HQD A;  5EKQ D;  1BD8 A;  3B95 A;  2VQ2 A;  4EEC A;  4ANU A;  1YCS B;  4PUC A;  1G3N B;  3CVY A;  5CCL A;  3FUH A;  1MHQ A;  2LAH A;  1TNO A;  3CVQ A;  3FY4 A;  5AAO A;  2HE0 A;  4OVU A;  4C0M A;  3ZU7 B;  4XI9 A;  5CHE E;  4I2W A;  2XEE A;  3FH7 A;  3CST A;  3T5X A;  3C3Q A;  4G25 A;  2R02 A;  4Q96 A;  3CHS A;  4CZ2 D;  5G2N A;  4N2Q A;  4I2Z A;  5CRV A;  3Q15 A;  2XZD G;  4O6F A;  2P9N G;  1IHB A;  4WUY A;  2F0Y A;  1JPL A;  4UI9 J;  2WQ6 A;  3FU3 A;  3MA5 A;  4BY6 A;  2NXP A;  4D10 C;  1HG5 A;  3TXN A;  1PC2 A;  1ELR A;  1FVF A;  4HRL A;  3CVW A;  2WVI A;  3S7B A;  1H19 A;  1H2V C;  1TJC A;  3Q49 B;  4LER A;  1TJF A;  1TN6 A;  1Q2Z A;  3B7S A;  1MX6 A;  4URK A;  4DX2 A;  1MZC A;  3IV0 A;  3VLE A;  4TUU A;  3ZXP A;  4CEM A;  1WG0 A;  3TWX A;  2ETC A;  4TV3 A;  3ZYL A;  2WQ7 A;  2R17 C;  4DK5 A;  3ZYM A;  2FBN A;  3E33 A;  1KLX A;  2I9C A;  3P1U A;  4B94 A;  5KCM A;  3KS2 A;  3UTM A;  2MYO A;  5E76 A;  3RO3 A;  1NI1 A;  3UX4 A;  4CRW A;  1H0A A;  2BED A;  3CHR A;  2RFA A;  5A6C A;  4A1S A;  4GML A;  1HXI A;  1NFI E;  1LF8 A;  3UM2 A;  4Q69 A;  4ILI A;  3FEX A;  5EX3 A;  2E2E A;  4GYY A;  3LYA A;  2CHX A;  3AS8 A;  3NQP A;  2BTD A;  4NQ0 A;  5IY5 E;  1U2V G;  1OCZ E;  3QWW A;  4A55 A;  1NL4 A;  3EU9 A;  4KZC A;  3VLD A;  1OT8 A;  3HDX A;  1K3Z D;  2WMN A;  4J8S A;  3GZS A;  3DRA A;  2ILR A;  4GZ5 A;  4UI9 C;  4FP7 A;  3ZGQ A;  1IXV A;  4I17 A;  3AG3 E;  4JA9 A;  5EID A;  2X38 A;  5ARF A;  3D9I A;  2V8S E;  4YDO A;  1HS6 A;  4JHK A;  2VSX E;  2BKG A;  3NF1 A;  4A1G A;  3ZIM A;  1N11 A;  2J8S D;  3U4T A;  2ZGD A;  3FU5 A;  3AU4 A;  4LG6 A;  4WNE A;  3HVE A;  1A5E A;  3HVE B;  3C98 A;  2CG2 A;  4CCA A;  3EIJ A;  2ZGG A;  2J09 A;  2X6K A;  3LXU X;  1BU9 A;  3CVU A;  1N4S A;  2VTB A;  4Y6W A;  2VTB B;  4KVO A;  4GYW A;  4G24 A;  3UM0 A;  3APF A;  3ABL E;  4XI0 A;  3TG4 A;  1N0Q A;  1FPP A;  1JCS A;  1OCO E;  3FUL A;  4MBG A;  3C5R A;  3RU0 A;  2NSZ A;  1YMP A;  4TXR A;  1IQR A;  3S7J A;  2WQH A;  2F8X K;  2GRM A;  4YVQ C;  4B89 A;  3QWP A;  4X8Q A;  2XPY A;  2Y3A A;  4DPR A;  5G05 J;  1HO8 A;  1FT1 A;  3B13 A;  3W9F A;  2XS8 A;  1OXJ A;  4HOS A;  2IOL A;  2WXG A;  3TWW A;  2JLB A;  2VSN A;  3NAW A;  2CHW A;  4A3V A;  1L5J A;  1H6K A;  1X81 A;  2AWI A;  3EDT B;  5D0Q D;  4BSX A;  4J6I A;  1INZ A;  3LKU A;  5FZQ A;  4GTP A;  1XNF A;  3JUI A;  4HVB A;  5EN5 D;  4BX8 A;  4ANV A;  4I9C A;  1E96 B;  1OWO A;  3J5P A;  2PL2 A;  3MYV A;  3LVR E;  3Q79 A;  3UM3 A;  1OUV A;  3CKC A;  2YHE A;  2FO1 E;  1JUQ A;  3PNL B;  3MGB A;  2L9B A;  4DI3 A;  3ABK E;  3APD A;  4J8E A;  2EIJ E;  3ZXS A;  1V55 E;  2CFZ A;  4FU3 A;  2GRL A;  2XRZ A;  3RIB A;  4Y6C A;  3UI2 A;  3ZNG A;  3FU0 A;  3EUV A;  4G2V A;  4KXK B;  3OAW A;  3DEO A;  2I1K A;  3UKR G;  2IOS A;  4TXQ A;  2XCC A;  5FTP A;  5EIB E;  3Q75 A;  5KNH D;  3MX3 A;  3CSF A;  3I4G A;  3FUE A;  3RKV A;  3MKQ A;  1AWC B;  4MRU A;  2V5F A;  3MKQ B;  3V31 A;  5CMW A;  3UMV A;  1H2U A;  2VGY A;  3PH0 C;  4HLE A;  1KT0 A;  1LD7 A;  1ZBP A;  3U9W A;  2WXQ A;  2DYS E;  4UWG A;  3CK8 A;  3PE3 A;  4GPK A;  3CVL A;  1DNP A;  1D8E A;  3RAU A;  4BT9 A;  4FAD A;  1Z3X A;  3TWT A;  3BG1 B;  3DSW A;  4GZD A;  1MX4 A;  3MCX A;  1UN9 A;  2GRP B;  1N54 A;  1AP7 A;  3ZEF A;  4H7X A;  4U7E B;  2IFU A;  4BSZ B;  3ULE G;  3FUJ A;  3HXF A;  4WAF A;  4HFG A;  4GCN A;  2FUL A;  2DYR E;  4I6E A;  5AQA A;  5EX0 A;  3QKY A;  1OCC E;  3PZ3 A;  3CVV A;  4U95 D;  3RRU A;  2IU1 A;  3SF4 A;  4C48 B;  5CER B;  1H2T C;  1XGW A;  4EBA A;  3PZ4 A;  5LP0 A;  3JQ0 A;  3ZPJ A;  5AEN A;  1E7V A;  4TUM A;  3U64 A;  2LSU A;  4U8H A;  1BLX B;  4GTR A;  4U63 A;  2PM7 A;  2WPV A;  2RFM A;  1HH8 A;  3BG0 B;  4ABN A;  5J90 A;  5FWQ A;  4M7C A;  3ISM C;  4UWF A;  1TN7 A;  2BKK B;  2HM8 A;  3IHY A;  4JA7 A;  4LUN U;  2RD0 A;  3PUK A;  1UJJ A;  4PH4 B;  2LXL A;  1Z6T A;  4GTS A;  1H6P A;  2V0P A;  3SY2 A;  2OV8 A;  4DI4 A;  2XCB A;  5HS0 A;  3GZ1 A;  3EHM A;  2XQ0 A;  4K0R A;  3FFL A;  3FTU A;  4BTA A;  3G2W A;  1TNU A;  3HXC A;  1UJK A;  2CHZ A;  3QJZ A;  1HF8 A;  5FIN A;  2WXP A;  1PAQ A;  3KEA A;  2KCV A;  3E37 A;  2AVP A;  4N2S A;  2YNQ A;  1JWF A;  2KCK A;  4DX5 D;  2Y1L E;  3EHN A;  2EQX A;  4XIF A;  2CFU A;  1HFA A;  4FA6 A;  5H7P A;  4BET A;  2AXV A;  4CYM D;  3HG0 D;  1RZ4 A;  1Y6I A;  3D9K A;  5JA4 D;  3V2X A;  2DBA A;  3G2S A;  4MS6 A;  1LD8 A;  1N4P A;  4BES A;  3HXB A;  4GTV A;  3PRZ A;  2J4B A;  4DLQ A;  2QYU A;  2C2L A;  4AM9 A;  4L7T A;  2DZN A;  5FIO A;  4BX9 A;  1O1T A;  3CVN A;  4TRQ A;  1N4R A;  4JXT A;  3MV2 B;  4N5Q A;  4I9E A;  4K5C A;  4CDR A;  1TN8 A;  3ML8 A;  1HG2 A;  1SA4 A;  5BUZ A;  2GRR B;  5ENS D;  2KC7 A;  3DSU A;  1DVP A;  2Y4T A;  3ENE A;  1N4Q A;  3CKB A;  4GMR A;  1S0P A;  1IQU A;  1WDY A;  1E8W A;  3V30 A;  3G2U A;  1D9S A;  2KAT A;  2BF0 X;  1ELW A;  2J08 A;  3ASO E;  3LEW A;  4J8D A;  4HBD A;  4WNG A;  4PS7 A;  4J7W A;  4RQI A;  3UT8 A;  3R7Q A;  1DCQ A;  2KXP C;  4K5B A;  5AIJ A;  1V54 E;  3PEV B;  4GZC A;  3CV0 A;  2ZIS A;  1EF1 C;  4UQZ A;  4GB9 A;  1WAO 1;  3VTX A;  3E34 A;  3ABM E;  4GA1 A;  5FZS A;  4J8Y A;  3B7B A;  4EZJ A;  5AQ7 A;  1FCH A;  3LJN A;  3LVQ E;  5CBN A;  5B1A E;  5KBA A;  5DBK A;  3O48 A;  2IQC A;  4CDN A;  3KSL A;  2I2O A;  3ESK A;  1OY3 D;  4O60 A;  1IHG A;  3MEK A;  3NB2 A;  5KNG A;  2FF4 A;  3PS6 A;  3EU5 A;  3E32 A;  2OEV A;  3L13 A;  5AYW D;  2GRQ B;  5JMN D;  4HNA D;  1K8K G;  3OTN A;  5ENT D;  3S2A A;  3Q7F A;  4I1O B;  2L0I A;  4C0E A;  1SW6 A;  3ASD A;  1YA0 A;  3LS8 A;  3RJV A;  4ATZ D;  3KAE A;  3CQC B;  3CVX A;  4OVV A;  5FQ7 A;  2PQN A;  2JAB A;  3APC A;  2WB2 A;  4QFV A;  4AJW A;  2FI7 A;  4N3A A;  5BT1 A;  3CHO A;  2ETB A;  1N95 A;  2F37 A;  4EZK A;  4O1P A;  3LDZ A;  2H6G A;  2X6I A;  4FUL A;  4YDE A;  1DCE A;  1TNB A;  2XGO A;  4U04 A;  2P2C P;  2IO3 C;  4UQY A;  1N0R A;  2RG8 A;  2HR2 A;  4G1T A;  4Q94 A;  4N3B A;  2PNN A;  2F8Y A;  4J8F A;  3ZYQ A;  1FT2 A;  4WNF A;  5B1B E;  5JHA A;  4JL0 A;  3FUD A;  2AW6 A;  4HRM B;  2QFC A;  4HI9 A;  5FQ4 A;  4I1A A;  4APF A;  1B89 A;  5BW8 C;  3B7U X;  4F1S A;  2AXU A;  3D9P A;  4V3I A;  3O4Z A;  4GTO A;  4KVM A;  3NZS A;  4XZ4 A;  5LCW J;  4XE0 A;  2P58 C;  4UI9 K;  5JJT A;  3FUM A;  1E90 A;  3L16 A;  3TWV A;  2AJA A;  4NRH B;  3ZW3 A;  5CEC B;  3ASG A;  2MRI A;  4ZFH A;  4U0S A;  2X6F A;  4F1P A;  1VDY A;  2OVB A;  3QNK A;  4IYP A;  4DX7 D;  3AG2 E;  2UY1 A;  3UXG A;  2UY1 B;  3KD7 A;  4FHJ A;  1NZN A;  3G2V A;  2IEJ A;  1E8X A;  1O1S A;  2WXI A;  2Y4U A;  4PS3 A;  4DRX E;  5JJ6 A;  2R2L A;  5CRU A;  3LY8 A;  1TYQ G;  4F53 A;  2GGF A;  3FDH A;  5FZR A;  3QAQ A;  2WXF A;  1JCR A;  1Z5S C;  4ACK A;  5AQ9 A;  2JEK A;  3QWV A;  4EPZ A;  4GMJ A;  1OWM A;  1NA0 A;  3UIO C;  3Q9N C;  3PZ2 A;  5G05 C;  3FWV A;  3WXX A;  2XEV A;  1K1A A;  4GTQ A;  1SA5 A;  2VSO E;  4UWK A;  4WWP A;  3ONK A;  2H6F A;  4L1B A;  3JUE A;  3E30 A;  5G04 J;  2AXZ A;  2GRN B;  3L9T A;  3TXM A;  5LCW C;  2P9L G;  3LCA A;  2IF4 A;  3S7F A;  4HOU A;  3SQV A;  4I1M A;  3CR3 A;  1MJ0 A;  3P2B A;  5FQ6 A;  3AS5 A;  3KSQ A;  1UG3 A;  3SFX A;  3CGH A;  2A4Z A;  4A63 B;  4QQI A;  2KM4 A;  2WXR A;  4GYO A;  1KT1 A;  5BNW A;  1ELK A;  2DWZ A;  3LJ3 A;  2GW1 A;  4K5A B;  1QBQ A;  3SFY A;  3D9H A;  3OXF A;  4AIF A;  3FTS A;  4FJZ A;  3DBS A;  4A3T A;  4RG9 A;  2EIK E;  4FC8 A;  1EYH A;  4B8A A;  1BI8 B;  2DIW A;  2M63 A;  5C1D A;  4JPS A;  5G55 A;  2YQ8 A;  1N9A A;  1MYO A;  3PE4 A;  3SZ7 A;  3LY9 A;  4JW1 A;  3F6Q A;  4YDY A;  5EDS A;  2E0I A;  3FU6 A;  4DJA A;  5T8I A;  4Z68 A;  3QAR A;  4JVS A;  1NA3 A;  5G04 C;  3RRN B;  3UUX A;  4UQX A;  1SZ9 A;  3FP3 A;  4F7A A;  1QZ2 A;  1OCR E;  5CCM A;  2RKK A;  1OWP A;  3FHE A;  4HOR A;  4K03 A;  1HE8 A;  4KBQ A;  4GZ6 A;  4GPM A;  1A17 A;  2DCP A;  4JZY A;  2YIN A;  2VGE A;  3Q73 A;  3ZN3 A;  2J4D A;  3T9K A;  4YVO A;  3FUF A;  3K9I A;  5EYP F;  3DEP A;  4EHM A;  3HXD A;  5D0O D;  5AQB A;  1MQS A;  3B7R L;  4G23 A;  2MOW A;  3CVP A;  3T5V A;  5KJM A;  3ESL A;  3WG7 E;  3D9J A;  3DPD A;  3ULQ A;  3RSE G;  5JHB A;  3CK9 A;  2BUG A;  5CED B;  4EZL A;  3UIP C;  4U96 D;  3C3R A;  4EQF A;  4AOF A; 
#chains in the Genus database with same CATH homology
 3TG4 A;  2J9Q A;  4M3O A;  2FEZ A;  3FUL A;  5AIJ A;  3RU0 A;  2NSZ A;  3PEV B;  4GZC A;  2UWJ G;  3CV0 A;  4N39 A;  3BEE A;  3PRE A;  3CLJ A;  1IQR A;  2WXM A;  3R9A B;  3S7J A;  4UWL A;  2WQH A;  2GRM A;  4YVQ C;  1EF1 C;  4B89 A;  3QWP A;  2J07 A;  3GZ2 A;  4UQZ A;  2VSY A;  1WAO 1;  2XPY A;  2Y3A A;  4GB9 A;  4GZ3 A;  5G05 J;  5C2Y A;  1HO8 A;  4DPR A;  3SGH A;  4GA1 A;  5FZS A;  3VTX A;  2NC9 A;  4JHR A;  1WM5 A;  4AVX A;  3ZYK A;  3B13 A;  3D3M A;  3PNT B;  4EZJ A;  2R5S A;  3UQ3 A;  2PM6 A;  5AJD A;  4HOS A;  3U66 A;  4NAC A;  1FCH A;  2XPI A;  2IOL A;  4L23 A;  2WXG A;  3LVQ E;  4P29 A;  2XGS A;  4RG6 A;  2JLB A;  3FTY A;  2VSN A;  3L22 A;  4ANX A;  3PZD A;  2WQ6 A;  2QY7 A;  2XPZ A;  5DBK A;  2CHW A;  2L6J A;  1L5J A;  4FHK A;  5DIZ A;  2HO1 A;  3O48 A;  4A3V A;  1H6K A;  3Q5M A;  3AS4 A;  3ASF A;  2AWI A;  2IQC A;  4I6J A;  3TG5 A;  4CDN A;  3GW4 A;  5J08 A;  2I2O A;  3EDT B;  1WY6 A;  3ESK A;  3QC1 A;  5D0Q D;  4BSX A;  2VYI A;  4J6I A;  1INZ A;  3SHF A;  3LKU A;  5FZQ A;  1IHG A;  3MEK A;  1XNF A;  1ZU2 A;  4CT4 A;  3JUI A;  4ANW A;  2FF4 A;  4RSY A;  4HVB A;  2Q7F A;  2ION A;  1EPU A;  3PS6 A;  4BX8 A;  3D9N A;  3IKO B;  2L0T B;  3CK7 A;  3L13 A;  4G26 A;  3I5P A;  4ANV A;  4I9C A;  4GA0 A;  5AYW D;  5KJK A;  1E96 B;  5CMY A;  4I43 A;  3CHP A;  3OTN A;  3S2A A;  2XGM A;  4I1O B;  2MHK A;  1OWO A;  2L0I A;  4JC8 A;  4C0E A;  2PL2 A;  3MYV A;  3LVR E;  3Q4A B;  3ASD A;  1YA0 A;  2C0L A;  3LY7 A;  3LS8 A;  4GA2 A;  3RJV A;  3FTZ A;  3CQG B;  1OUV A;  3KAE A;  3CQC B;  2X6H A;  1E8Z A;  4IN3 B;  5FT9 A;  3CKC A;  3KEZ A;  3HYM B;  3QK0 A;  2YHE A;  3CVX A;  4GCO A;  3L08 A;  1JUQ A;  3PNL B;  3MGB A;  1E7U A;  4OVV A;  2L9B A;  2PQN A;  5FQ7 A;  4DI3 A;  4N3C A;  3APD A;  4J8E A;  3APC A;  4KZ0 A;  3ZXS A;  4AEZ C;  2WB2 A;  4QFV A;  2CFZ A;  4AJW A;  3SI5 A;  4FU3 A;  2FI7 A;  2GRL A;  4N3A A;  5BT1 A;  2OOE A;  3SD5 A;  4B8C B;  2XRZ A;  3RIB A;  4Y6C A;  2OND A;  4HXI A;  3SNX A;  3CHO A;  1E8Y A;  2LO6 A;  1UN8 A;  1OWL A;  5J90 A;  1UW4 B;  4EZK A;  3FU0 A;  3IHV A;  3FUN A;  2YHC A;  2WMO A;  3LDZ A;  3I3N A;  2X6I A;  3ZFW A;  4FUL A;  4U07 A;  1N52 A;  4G2V A;  2XGO A;  4KXK B;  4U04 A;  2KZT A;  3OAW A;  3FUK A;  1PY1 A;  4UQY A;  4BTB A;  2KZT B;  2I1K A;  1U3D A;  5BV0 A;  2RG8 A;  3ASH A;  4U0Z A;  2HR2 A;  4G1T A;  2IOS A;  4CDM A;  4LEU A;  4Q94 A;  3QB2 A;  4N3B A;  4ATG A;  2XCC A;  5FTP A;  4G11 A;  3FH5 A;  3D9M A;  2WXO A;  3FTW A;  2I1J A;  2XHE A;  4PS8 A;  3U3W A;  5AJL A;  3MX3 A;  4J8F A;  3RRM B;  3ZYQ A;  2OVF A;  4WNF A;  3N71 A;  3SBT B;  4BT8 A;  4CT0 A;  3CSF A;  3I4G A;  5JHA A;  2PQR A;  3FUE A;  3FUD A;  4JL0 A;  3RKV A;  5LX8 A;  1HU3 A;  3MKQ A;  3QOU A;  4MRU A;  4AV7 A;  2V5F A;  3MKQ B;  4YND A;  2AW6 A;  1GW6 A;  2QFC A;  3FUI A;  3UMV A;  5CMW A;  5ANR A;  3ONL A;  1H2U A;  2VGY A;  4E6H A;  3MJW A;  5FQ4 A;  3CHM A;  3I4R B;  3E4B A;  3PH0 C;  4KMO A;  4HLE A;  1KT0 A;  1EDU A;  3CHQ A;  3JYS A;  4I1A A;  4APF A;  1ZBP A;  2XRY A;  3TGO A;  3U9W A;  2WXQ A;  5BPP A;  1TEZ A;  4FJY A;  4H7Y A;  4UWG A;  1B89 A;  2VGX A;  3CK8 A;  3PE3 A;  2VGX B;  5BW8 C;  4B0Z A;  5HQ8 A;  4L2Y A;  4EBA G;  3SFZ A;  3NZU A;  3CVL A;  4GPK A;  4L2L A;  4XKC A;  3B7U X;  3ZHE A;  1DNP A;  3ZVV A;  2CG3 A;  4BT9 A;  3ZHE B;  4F1S A;  4FAD A;  2FO7 A;  2AXU A;  1Z3X A;  3D9P A;  3SBS A;  3UPV A;  4V3I A;  3O4Z A;  4IUL A;  4KVM A;  5FQ8 A;  3NZS A;  4XZ4 A;  5A23 A;  5LFA A;  5LCW J;  4XE0 A;  2P58 C;  4U0U A;  3BG1 B;  4UI9 K;  4HOT A;  4GZD A;  5JJT A;  4WWO A;  3MCX A;  1P5Q A;  1HX8 A;  3FUM A;  3PUJ A;  1UN9 A;  2WM9 A;  3L17 A;  3FH8 A;  4KYO B;  4ME2 A;  2R59 A;  1E90 A;  1N54 A;  4PDX A;  3L16 A;  4NRH B;  4WND A;  4GU5 A;  3ZEF A;  4H7X A;  3ZW3 A;  2A5U A;  3ASG A;  3OXL A;  5M72 A;  3L54 A;  2MRI A;  5EKQ D;  2IFU A;  3CEQ A;  2VQ2 A;  2WXK A;  3FUJ A;  5BV1 A;  4EEC A;  4U0S A;  4WAF A;  2X6F A;  1VDY A;  3ML9 A;  4I6G A;  4ANU A;  2OVB A;  3QNK A;  4HFG A;  4GCN A;  4IYP A;  4CGW A;  2FUL A;  4PUC A;  4I6E A;  2UY1 A;  5EX0 A;  3ZRH A;  2UY1 B;  3CVY A;  3QKY A;  5CCL A;  3KD7 A;  3FUH A;  1MHQ A;  4FHJ A;  5KJN A;  4FLH A;  3CVV A;  1NZN A;  2LAH A;  3S7D A;  3CVQ A;  3G2V A;  3FY4 A;  1NP7 A;  3RRU A;  2IU1 A;  4XKB A;  3SF4 A;  4ACL A;  1E8X A;  2KCL A;  4BWR A;  2WXI A;  2Y4U A;  4LRZ A;  4OVU A;  3T8M A;  4C0M A;  4PS3 A;  5JJ6 A;  3PVL A;  4XI9 A;  5CHE E;  4I2W A;  3D9L A;  3LY8 A;  1H2T C;  1XGW A;  3FH7 A;  4F53 A;  2GGF A;  3CST A;  4EBA A;  3T5X A;  5LP0 A;  1HZ4 A;  3FEY A;  4G25 A;  3FDH A;  5T4Y A;  4BFR A;  3MKR A;  3JQ0 A;  4Q96 A;  3Q47 B;  5FZR A;  3ZPJ A;  5AEN A;  1U3C A;  3CHS A;  1E7V A;  3QAQ A;  5G2N A;  2WXF A;  4N2Q A;  4I2Z A;  4ACK A;  3U64 A;  1BPO A;  2JEK A;  2LSU A;  4U8H A;  4U63 A;  4HS2 A;  2PM7 A;  3QWV A;  2WPV A;  4XX5 A;  3Q15 A;  4GMJ A;  4EPZ A;  3HHM A;  4O6F A;  1FVH A;  1OWM A;  2VJ8 A;  1NA0 A;  3G2T A;  4DLO A;  1HH8 A;  4WUY A;  1JPL A;  4UI9 J;  3BG0 B;  5G05 C;  4ABN A;  3FWV A;  3EIQ C;  3FU3 A;  3MA5 A;  2XEV A;  4LCT A;  5FWQ A;  3WXX A;  3TAX A;  4BY6 A;  2NXP A;  3EJN A;  4D10 C;  2VSO E;  2WXH A;  4UWK A;  1HG5 A;  3L6A A;  1SQM A;  4WWP A;  4UWF A;  3ONK A;  1OWN A;  2J49 A;  4L1B A;  3TXN A;  1PC2 A;  1ELR A;  4WWN A;  1Z3Y A;  1FVF A;  5G04 J;  3CVW A;  2HM8 A;  3IHY A;  2AXZ A;  2LAI A;  4JA7 A;  2WVI A;  4LUN U;  2RD0 A;  3S7B A;  1H19 A;  2WXL A;  3TXM A;  1H2V C;  5JJ7 A;  5LCW C;  3LCA A;  3PUK A;  2IF4 A;  1TJC A;  3S7F A;  1UJJ A;  4HOU A;  3Q49 B;  4J0U A;  4PH4 B;  2WXJ A;  1TJF A;  4I1M A;  4LER A;  3B7S A;  3PEU B;  1Z6T A;  4URK A;  3CR3 A;  3P2B A;  5FQ6 A;  3AS5 A;  3IV0 A;  4OYS A;  2V0P A;  3VLE A;  1UG3 A;  4TUU A;  4CEM A;  2OV8 A;  3IEG A;  2XCB A;  4DI4 A;  2X3M A;  3CGH A;  4TV3 A;  2A4Z A;  5LOZ A;  1IYG A;  2KM4 A;  3GZ1 A;  4RVB A;  2WXR A;  3URZ A;  3EHM A;  3ZYL A;  2WQ7 A;  2V4L A;  2R17 C;  4DK5 A;  4GYO A;  1KT1 A;  2XQ0 A;  4K0R A;  1ELK A;  5BNW A;  3LJ3 A;  4R7L A;  3ZYM A;  2GW1 A;  3TJP A;  2FBN A;  4HOQ A;  3GYZ A;  3OXF A;  4AIF A;  3FTS A;  4FJZ A;  4W9R A;  1KLX A;  5KJL A;  2I9C A;  3DBS A;  3FFL A;  3FTU A;  4RG9 A;  3G2W A;  3P1U A;  3PDN A;  4JEH A;  4A3T A;  5KCM A;  4B94 A;  3KS2 A;  1UJK A;  2CHZ A;  3QJZ A;  5E76 A;  1HF8 A;  3RO3 A;  3UT4 A;  3UX4 A;  4CRW A;  2WXP A;  1H0A A;  1PAQ A;  4ILH B;  2KCV A;  3CHR A;  2WXN A;  5A6C A;  4A1S A;  4FC8 A;  2AVP A;  4N2S A;  4GML A;  1EYH A;  2LNI A;  4B8A A;  1HXI A;  2YNQ A;  1JWF A;  1LF8 A;  2KCK A;  4E85 A;  3FTV A;  4Q69 A;  2PZI A;  4ILI A;  3FEX A;  2DIW A;  2M63 A;  5EX3 A;  2E2E A;  3EHN A;  2IJG X;  4GYY A;  3LYA A;  2CHX A;  5C1D A;  4JPS A;  2EQX A;  3AS8 A;  3NQP A;  4XIF A;  2BTD A;  4NQ0 A;  3UT7 A;  4AY5 A;  2CFU A;  5G55 A;  1HFA A;  2YQ8 A;  4FA6 A;  3QWW A;  4A55 A;  4KT6 B;  4KZC A;  3HIZ A;  2AXV A;  3MV3 B;  3PE4 A;  3VLD A;  3SZ7 A;  1JWG A;  3LY9 A;  1Y6I A;  4JW1 A;  3HDX A;  5EDS A;  2WMN A;  4JHJ A;  2E0I A;  2I6H A;  2C0M A;  3D9K A;  4J8S A;  4IRU A;  3GZS A;  2DBA A;  2ILR A;  3G2S A;  3FU6 A;  4MS6 A;  4GZ5 A;  4UI9 C;  4FP7 A;  3ZGQ A;  4FLB A;  4DJA A;  3PRZ A;  5ANL A;  5T8I A;  2J4B A;  4I17 A;  3B7T A;  3CIA A;  3OXG A;  4JA9 A;  3IBE A;  3QAR A;  4DLQ A;  5HI7 A;  4JVS A;  2C2L A;  3D9O A;  4AM9 A;  1NA3 A;  4L7T A;  5G04 C;  1Y8M A;  2HYZ A;  4BTA A;  3RRN B;  3UUX A;  4BX9 A;  2X38 A;  5ARF A;  3CVN A;  3VTY A;  3D9I A;  4TRQ A;  4UQX A;  2V8S E;  1SZ9 A;  3FP3 A;  1HS6 A;  3QDN A;  4JXT A;  1X5B A;  5ENN A;  5E75 A;  3MV2 B;  2VSX E;  4JHK A;  4AXH A;  4F7A A;  3NF1 A;  4NUR A;  5FJY A;  1QZ2 A;  4I9E A;  4JEU A;  5CCM A;  1QNF A;  3FTX A;  4A1G A;  4AP2 A;  1OWP A;  3ZIM A;  3FHE A;  2X6J A;  4HOR A;  4AY6 A;  3RO2 A;  4K03 A;  3LPZ A;  3R7R A;  4CDR A;  4APO A;  1HE8 A;  1W3B A;  3U4T A;  4KBQ A;  3FU5 A;  4GZ6 A;  3ML8 A;  3AU4 A;  2ZU6 B;  4WNE A;  1HG2 A;  3MZL B;  3TL5 A;  4MKT A;  1A17 A;  3HVE A;  5BUZ A;  3HVE B;  2KC7 A;  1QQE A;  2DCP A;  4JZY A;  5ARG A;  1DVP A;  2YIN A;  2Y4T A;  3C98 A;  4ILG A;  3ENE A;  3CKB A;  2CG2 A;  3ZN3 A;  1S0P A;  2J4D A;  4F3V A;  1IQU A;  4MLP A;  4CCA A;  1E8W A;  3VLF A;  4YVO A;  3FUF A;  4N5C A;  3G2U A;  3K9I A;  3EIJ A;  4UWH A;  2J09 A;  2KAT A;  2BF0 X;  5D0O D;  2X6K A;  3LXU X;  3JQ1 A;  1MQS A;  2LSV A;  3CVU A;  1ELW A;  2J08 A;  2VTB A;  4Y6W A;  2VTB B;  3B7R L;  3LEW A;  3RK6 A;  4G23 A;  3AU5 A;  2MOW A;  4J8D A;  3CVP A;  4GAA A;  3T5V A;  5KJM A;  3ESL A;  4WNG A;  3D9J A;  4KVO A;  3DPD A;  4PS7 A;  3ULQ A;  3JCK C;  5JHB A;  3CK9 A;  2BUG A;  4EZL A;  4GYW A;  3UT8 A;  5A7D B;  3R7Q A;  4G24 A;  5T3R A;  4CGV A;  1SZA A;  3APF A;  4C9B B;  4EQF A;  4AOF A;  4XI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...