3RO3A

Crystal structure of lgn/minscuteable complex
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
159
structure length
159
Chain Sequence
SRAAQGRAFGNLGNTHYLLGNFRDAVIAHEQRLLIAKEFGDKAAERIAYSNLGNAYIFLGEFETASEYYKKTLLLARQLKDRAVEAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIAQELKDRIGEGRACWSLGNAYTALGNHDQAMHFAEKHLEISREV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords G-protein-signaling modulator 2
publication title LGN/mInsc and LGN/NuMA complex structures suggest distinct functions in asymmetric cell division for the Par3/mInsc/LGN and G[alpha]i/LGN/NuMA pathways
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 74
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2011-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13176 TPR_7 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ro3A00
3ASGA 5CCMA 2L6JA 2LNIA 3ZHEA 4I2WA 4G25A 3AS8A 3UQ3A 5DIZA 5HI7A 4I2ZA 1ELRA 2WQHA 1KLXA 2C0LA 5JJTA 4G24A 4I1AA 1ZU2A 3CVLA 3MV3B 3ASDA 4WNFA 4Y6CA 3S7JA 4N5CA 4HOSA 1E96B 3LY7A 5JJ7A 3CK8A 3ZHEB 2QFCA 3SZ7A 2JLBA 3QWVA 4XI0A 4Y6WA 3O48A 3RJVA 4WNGA 5ARFA 2OOEA 1YA0A 4G26A 5HQ8A 3QWWA 4J8DA 3HYMB 3QWPA 3R9AB 1QQEA 4A1SA 4GCNA 4JA9A 2XCCA 3LY9A 3CKBA 5FTPA 3ZPJA 4U04A 3OXGA 3K9IA 4N39A 2J9QA 1OUVA 4GA1A 4KYOB 3Q49B 3TG4A 3ZGQA 3BEEA 1QZ2A 3ULQA 2XGSA 3MKRA 4WUYA 3QKYA 2KCVA 3CV0A 4CGVA 4W9RA 3ASFA 3SF4A 2HYZA 3GYZA 3URZA 3TGOA 4RG6A 3LCAA 5A7DB 4O6FA 5EX3A 5D0QD 2FEZA 3Q4AB 3MEKA 3TAXA 5ARGA 4WNDA 5D0OD 2Y4UA 1TJCA 3QOUA 4YVOA 2VGXA 3PE3A 4G23A 3LY8A 3RIBA 4HOUA 4G2VA 3WXXA 4U0SA 3RO3A 5FZSA 5FT9A 3ESKA 4AM9A 3ASHA 3LKUA 3OXLA 4HOQA 2IFUA 4AY6A 3CVPA 4KBQA 3S7DA 4GA2A 1W3BA 1IYGA 1P5QA 4U0UA 2YQ8A 2UY1A 4UI9C 3S7BA 2VSNA 3E4BA 4HOTA 4UI9J 3MA5A 5LCWC 5EX0A 5FZQA 3U4TA 2KATA 3CK9A 2R5SA 4B94A 2C0MA 3ZN3A 5KJKA 2YHCA 4AY5A 4WNEA 3UUXA 3OXFA 1Y8MA 5AYWD 5G05C 3S7FA 2VQ2A 3VTXA 4YNDA 3ZFWA 2DBAA 4EQFA 1ELWA 2UY1B 5G05J 4BWRA 2V5FA 5KJLA 4RG9A 4YVQC 2XCBA 5JJ6A 2ONDA 2P58C 3PDNA 3CEQA 2PZIA 4GPKA 4NQ0A 2PL2A 5EKQD 2AVPA 5BT1A 2FF4A 3KD7A 4G1TA 5M72A 3RKVA 4U07A 4UQZA 2LSVA 4BTBA 5FJYA 4H7XA 1FCHA 4I9EA 3CVQA 2KCKA 1PC2A 1NA0A 3AS5A 2LSUA 4F3VA 4APOA 3KS2A 4BT9A 2WPVA 4UQYA 4CDRA 3MV2B 2FO7A 4GCOA 4UQXA 3KAEA 4HORA 1NA3A 1NZNA 3QDNA 3LYAA 1KT1A 5A6CA 4LEUA 4H7YA 3CKCA 5BNWA 3PE4A 4XI9A 2Q7FA 4CGWA 2PQRA 4I17A 4ME2A 2E2EA 4NRHB 5KJMA 4BT8A 4I9CA 1HH8A 1HZ4A 2IF4A 3CK7A 2VSYA 2UWJG 2NC9A 2FI7A 4ABNA 2FBNA 4JHRA 2C2LA 2MHKA 2VGXB 2KCLA 4JL0A 3N71A 4N2QA 3EDTB 3FFLA 4N3CA 3GW4A 3VTYA 4GYYA 4U0ZA 1HXIA 5KJNA 5LCWJ 2BUGA 3FP3A 5C1DA 4JA7A 2XPIA 3GZ2A 1WAO1 3TG5A 2GW1A 3Q15A 2PQNA 1IHGA 4GZ5A 2Y4TA 1KT0A 5CHEE 4N2SA 2KC7A 4XIFA 4GYWA 4BTAA 4J8FA 5BW8C 3Q47B 4GA0A 3FWVA 2VYIA 2XGMA 4GYOA 4KXKB 2HO1A 3RO2A 4J0UA 3NF1A 2I6HA 4UI9K 1WM5A 2XGOA 3GZ1A 4N3BA 3LPZA 1A17A 2HR2A 1ZBPA 5CCLA 3IEGA 4GZ3A 3CVNA 4GZ6A 5DBKA 3RU0A 3UPVA 3JYSA 1XNFA 5G04C 4J8EA 5G04J 3AS4A 3Q5MA 2XEVA 5FZRA 4IN3B 3U3WA 4AIFA 1B89A 2VGYA 4N3AA
chains in the Genus database with same CATH superfamily
1HO8A 3CVVA 3SBSA 5AQAA 1YMPA 2LNIA 3DPDA 3UQ3A 3O4ZA 2Y1LE 1IHBA 4BX9A 1MYOA 3BQOA 1KLXA 2OCCE 1NP7A 3TWWA 5J90A 3FTZA 1D9SA 4I1AA 4UWGA 1ZU2A 2J49A 2VTBB 4JVSA 1N4RA 5ENQD 2LAIA 4WNFA 4F1PA 1E96B 5JJ7A 3CK8A 3T9KA 5FINA 3SZ7A 2JLBA 4M7CA 3QWVA 3FH8A 4XI0A 1UG3A 1UN8A 2GROB 2OOEA 1O5MA 2GRMA 3CIAA 1EPUA 5HQ8A 1OCCE 4ILIA 2KXPC 4FULA 4KZ0A 1N0RA 3CSTA 5ENOD 3ZYQA 1Q2ZA 5CECB 3PZ1A 3D9PA 3CKBA 3ZPJA 3V30A 1FT2A 2J9QA 4KYOB 1H19A 3BEEA 1QZ2A 2XGSA 3MKRA 2YHEA 1TJFA 2YINA 2WXKA 3CV0A 2QZAA 4W9RA 5JMND 2X3MA 1ZB1A 2WQ7A 3LCAA 4O6FA 4KT6B 5D0QD 1O1TA 2HM8A 3Q4AB 3MEKA 2MOWA 3TAXA 5ARGA 4K03A 3QC1A 3TXMA 3PRZA 4I43A 4L1BA 2XEHA 4L7TA 3UTMA 4JW1A 3SNXA 4HOUA 3WXXA 5AJDA 1FT1A 4U0SA 5FZSA 3FUHA 3MKQA 3ESKA 5EN5D 2WXRA 3PEUB 3LKUA 2WXLA 3RRUA 3S7DA 3DSSA 3P2BA 3L17A 1W3BA 2IOLA 4GTRA 2WXJA 4Z68A 1IQUA 4BERA 2RFAA 2UY1A 2DYRE 3S7BA 3UI2A 3UIPC 1N4PA 3FU0A 5LCWC 2NXPA 3U4TA 2KATA 3CK9A 3L6AA 3ZN3A 3T8MA 4AY5A 2P9LG 2X38A 2WXMA 3SGHA 2VQ2A 3VTXA 2GGFA 3IXEA 4JB8P 4UWKA 4BWRA 4A55A 4AEZC 4DI3A 2XCBA 3Q79A 3IV0A 4GPMA 1OWMA 2Y3AA 3SFYA 3ZRHA 2I1JA 1UOHA 4GPKA 4NQ0A 4A63B 3LVQE 4NACA 4DLQA 5EKQD 3ULEG 4J6IA 2FF4A 2XS8A 4HRLA 3HRAA 3KD7A 4LG6A 4G1TA 1MX2A 2WXNA 3JQ0A 3I4RB 1OXJA 2NSZA 3ZXPA 1FCHA 3CVQA 1UJKA 1HFAA 3E33A 1D8EA 2MYOA 4APOA 4A1GA 4HNAD 4B89A 2FO7A 4GTMA 3Q7FA 1H0AA 1N95A 2JEKA 3E30A 1NA3A 2AXUA 3QDNA 4LEUA 4H7YA 3CKCA 2PQRA 3RK6A 2E2EA 5KJMA 2GRQB 1SQMA 4HFGA 3ZNGA 4HRNA 2VSYA 2UWJG 4EPZA 2P2CP 2DZNA 4DPRA 3FH5A 4JD2G 2RD0A 1QYMA 3N71A 4AJWA 4N2QA 2FO1E 3DXKG 2WVIA 3EHQA 4QFVA 2XRZA 2J09A 3EIQC 5KJNA 1K1BA 5BV1A 1JWGA 2BUGA 2OEVA 5C1DA 2XPIA 3GZ2A 2WMNA 1WAO1 2I9CA 1N94A 4FLBA 5EYLA 2PQNA 1IHGA 2GRRB 1KT0A 2X6KA 3DXMG 2L6BA 2DYSE 2EIME 4LSZE 5CBNA 2LO6A 1UJJA 2OV8A 3RO2A 3HIZA 1VDYA 4Q94A 1IKND 5HKPA 3AAAC 4GTTA 1MHQA 1WM5A 1Z3YA 1O1RA 2XGOA 3HXBA 4PUCA 4N3BA 1A17A 4AXHA 1X5BA 1JCSA 2VSOE 1Z5SC 4K5AB 4XE0A 1OWPA 2L9BA 1LD8A 1XNFA 2P9KG 1RW2A 4BSZB 3IHYA 2XEEA 4AV7A 3FU3A 1PY1A 1RZ4A 4HLLA 3AS4A 3R7RA 4IN3B 3FTVA 4U96D 1OWOA 3E32A 4C0EA 2KM4A 1B89A 4IULA 4I1MA 2VTBA 1EDUA 4FJYA 5CCMA 5FWQA 2XZTG 2L6JA 4G25A 5B1BE 5HI7A 3ESLA 3V31A 4GMLA 4CRWA 3LVRE 4TXPA 4U95D 2WQHA 3BU8A 3D9LA 4ILGA 4HI8A 4GTOA 2LUHA 3EJNA 3NAWA 3MV3B 5ENPD 3MYVA 4U8VD 4Y6CA 4N5CA 4HOSA 3LY7A 5FIOA 3ZHEB 5IY5E 3R9MA 2A5EA 3RRNB 2IJGX 5CRUA 3Q9UC 4Y6WA 3ZUVB 4WNGA 5ARFA 4BESA 1JUQA 2YNQA 1TR4A 3CHRA 4CDNA 4HQDA 3P1UA 3B13A 3LS8A 1WG0A 3CVXA 3NOGD 3QAQA 4LNBA 3FEXA 1QQEA 4A1SA 3U66A 3JXJA 5FQ8A 2VSXE 2XZDG 3ONKA 3V79K 4DX5D 5FTPA 4U04A 2WXIA 3JUIA 4EZLA 4JXTA 3ABME 2P9SG 4GA1A 2GRNB 4JPSA 3ULQA 5EDSA 2IONA 5AN8A 5HRYA 4DX1A 3MCXA 1OCRE 3GYZA 2LXLA 4TV3A 2X6HA 4RG6A 3ZEFA 1MX6A 5A7DB 5EX3A 4HB5A 4LCTA 2FEZA 3ASNE 1SZAA 4G8LA 1HF8A 4LRZA 2Y4UA 3T8KA 3RAUA 3ULYA 4YVOA 3PE3A 3JUEA 4I1OB 3TJPA 2F8XK 5JA4D 4G2VA 4LNGA 3TWQA 5B1AE 3V2OA 3B7BA 3UM3A 1NFIE 2F37A 3ASHA 3UT4A 4U7EB 4AY6A 3CVPA 2IO2C 3G2WA 3E37A 3FUEA 2R05A 4K5BA 1OCZE 2WB2A 4G8KA 4N5QA 3TWVA 2YQ8A 5B3SE 3NZSA 4UI9C 4DRXE 4TXRA 3B95A 1UN9A 3FUDA 2XRYA 3EIJA 2B6CA 4O1PA 5EX0A 3RRMB 5AQ7A 2C0MA 4EBAA 3KSQA 4YDOA 2YHCA 4B93B 1Y8MA 5AYWD 3S7FA 4AOFA 2DBAA 3I5PA 4ANWA 4OVVA 3ZIMA 4JEHA 5G05J 2V5FA 1HS6A 2XS1A 1KPSB 5JJ6A 3FH7A 2ZIRA 3NZUA 1A5EA 5ENRD 3UM2A 3X2QE 5G2NA 2P58C 3CEQA 2J07A 1TNUA 3LJNA 2AVPA 2EIJE 3AG1E 3HXDA 5EIDA 2ZGGA 2LSVA 5FJYA 3SI5A 3PH0C 2P9UG 3D9OA 2KCKA 4NURA 1PC2A 5ANLA 4L23A 1NA0A 5CMYA 3AS5A 4RLYA 3KS2A 3LXUX 2IY0C 4BT9A 2BKKB 4I6GA 3UKUG 1IXVA 2WPVA 4WWPA 3MV2B 1ELKA 5AARA 5KCMA 5KNHD 3BUAA 3FU6A 2BTDA 2DWZA 2WXFA 5A6CA 5BNWA 5E75A 4FHKA 4CGWA 3TWTA 4ME2A 3IKOB 4BT8A 4I9CA 3BG0B 1HZ4A 3PVLA 3ZXSA 3T5VA 4J8SA 4F53A 4HXIA 2V4LA 4MLPA 4PS8A 1D8DA 1S0PA 1S64A 3FEYA 4RQIA 1IQRA 4JHRA 2DCPA 4PH4B 2KCLA 5AQ9A 3MJWA 4FP7A 1MJ0A 5CERB 1TNBA 2ETAA 3L13A 3PZ4A 3GW4A 4GYYA 4MBGA 1HXIA 2Y69E 2PNNA 3DSVA 3DEOA 4P29A 4RSYA 4MRUA 2EQXA 2OEWA 2WXQA 1JCRA 3QARA 3R7QA 2GW1A 3Q15A 2AJAA 4UWFA 1KZPA 2KC7A 4J8FA 3CGHA 3ABLE 4DLOA 3B7TA 2I2OA 3NOCD 2EILE 5HS0A 1NI1A 3PNLB 2ILRA 3KEAA 3LPZA 4R7LA 2HR2A 1ZBPA 4I6JA 3SHFA 3CVNA 4KVMA 3UPVA 1TNYA 5G04C 4IYPA 4KVOA 1E7VA 3ZW3A 1OCOE 2DIWA 5BV0A 2FULA 3UT7A 3LEWA 4K0RA 5A23A 4C9BB 4ANVA 4KZCA 1INZA 2OVFA 4ACKA 3L08A 4E85A 1E7UA 1V55E 3Q73A 3ZHEA 3ZU7B 2GRPB 5DIZA 3SY2A 4I2ZA 1ELRA 3ENEA 3NQPA 3L82A 4GMJA 4G24A 1N52A 5JJTA 2V4HC 2WMOA 3UKRG 3L54A 2V8SE 1QBQA 4ANXA 2XHEA 3CVLA 3SFZA 5EIBE 4DI4A 3ASDA 3MZLB 3IHVA 3S7JA 5KNGA 2CFUA 1EYHA 4MKTA 4F6RD 5ITZF 3GZSA 4G26A 3NBNB 4GTVA 2ZISA 1E8WA 3CHQA 3HG0D 3QWWA 3F6QA 2H6GA 1X81A 3PZ2A 1PAQA 3OTNA 4YDEA 4GCNA 3AJIA 4HRMB 2XCCA 5ENTD 3LY9A 1FPPA 3Q9NC 3CVWA 4PS3A 2H6IA 3G2VA 3K9IA 1E8YA 3DSTA 4N39A 1OUVA 4IRUA 4XKCA 3TG4A 3ZGQA 1TN7A 4QQIA 4WUYA 3QKYA 4OVUA 2PM7A 1K1AA 5D2MC 4CZ2D 2CG2A 3VLFA 5JHBA 3ASFA 3FDHA 2HYZA 4HI9A 3TGOA 3FTXA 1S63A 4ZHBA 3D3MA 4BEPA 4ATGA 1DC2A 4JZYA 1Y6IA 4L2YA 4URKA 3D9KA 1SW6A 4B8CB 3FUNA 1S70B 5D0OD 3I4GA 3MGBA 1TJCA 1AWCB 4O1OA 4PDXA 2L0IA 2VGXA 1BU9A 1WY6A 3LY8A 2EINE 3RIBA 4J8YA 3CLJA 3FTUA 2R59A 1K3ZD 4EBAG 2B0OE 3OXLA 1SA4A 2WXGA 1TYQG 4LUNU 3AG3E 5E76A 1P5QA 4GU5A 3L22A 4BFRA 4FA6A 3ONLA 3E4BA 4AVXA 4HOTA 1MX4A 4CDMA 4MS6A 3MA5A 5FZQA 4B94A 1FVHA 5KJKA 1BI8B 5T8IA 4BSXA 3C3QA 3FUIA 3ZYLA 4WNEA 3PREA 3TWSA 3UUXA 2CFZA 4YNDA 3ZFWA 3HVEA 4L9PA 1ELWA 1AP7A 3HXCA 2RFMA 5KJLA 4RG9A 4OAUC 4YVQC 5BXOA 2ONDA 2J4DA 1E8ZA 2PZIA 3KSLA 1TEZA 1OT8A 2H6HA 2ZGDA 4F1SA 1E90A 2PL2A 2QYUA 3CVYA 5M72A 3D9HA 3CHPA 3RKVA 3CSFA 4EZJA 4UQZA 4BTBA 2QY7A 3BG1B 3SD5A 4E6HA 4U8YD 3OAWA 4LNUD 4I9EA 2EIKE 2R2LA 3ZKJA 3I3NA 2WXOA 3VLDA 4F3VA 3AU4A 3Q78A 4RVBA 1H6OA 2R17C 4UQYA 4CDRA 2E0IA 3FUKA 3UM1A 4HORA 4TUMA 3FUMA 2A4ZA 3EHMA 3HDXA 1KT1A 2AXVA 3D9MA 3RSEG 4ACLA 3PE4A 3LJ3A 3UX4A 2Q7FA 5CBOA 4DX7D 2XQ0A 1H2TC 4HBDA 3FTWA 5JHAA 2IF4A 3CK7A 3DPYA 4EZKA 2CG3A 2FI7A 4YDWA 2J4BA 3DEPA 2C2LA 2VGXB 2WXPA 3TWUA 3EDTB 1QNFA 4NIKA 3PUJA 1KZOA 3C5RA 4N3CA 3VTYA 4U0ZA 4Q96A 3MX3A 5T3RA 4B8AA 4JC8A 4OYSA 2KBXA 3FP3A 2AWIA 3J5PA 2XPYA 4GZCA 3TG5A 2F8YA 5FQ6A 2IQCA 1U3DA 3IBEA 1XGWA 4GZ5A 2Y4TA 3EUVA 3CR3A 4C48B 4JEUA 4GYWA 1DCEA 5BW8C 3NB2A 4GA0A 4KXKB 4FADA 3JQ1A 2QYJA 4WWNA 2CHXA 2NYJA 4V3IA 5LP0A 2HO1A 4HVBA 3DRAA 3UT8A 2X6JA 5AENA 2RG8A 3EHRA 3FHEA 4Q69A 1DCQA 2I6HA 1DNPA 3QNKA 3HVEB 3APDA 3U64A 2VJ8A 5CCLA 3QB2A 1BD8A 2OVBA 4GZ6A 4I6EA 3RU0A 4X8QA 2BKGA 3DSWA 3C72A 2XPZA 4J8EA 3B7UX 3D9JA 1HX8A 2P9NG 3Q5MA 2KZTB 2IU1A 3ISMC 1G3NB 3L16A 3C3OA 3V2XA 4UWHA 3C3RA 3AG4E 4CCAA 3D9IA 5CMWA 5H7PA 1JWFA 4KMOA 1EF1C 2VGYA 3PZDA 4WAFA 2J08A 2LAHA 3ASGA 1BPOA 5CEDB 4I2WA 3AS8A 3AU5A 4CYMD 2L0TB 1N9AA 2C0LA 3FULA 4FLHA 5ANRA 1FVFA 2CHZA 4XZ4A 4F7AA 1N4QA 3KEZA 4XKBA 1Z6TA 1TNOA 3HXFA 2QFCA 3UM0A 2WM9A 1LF8A 5LFAA 2J8SD 3L9TA 5T4YA 4PS7A 4OAVB 4HLEA 3FTSA 3O48A 3Q75A 4XEIG 3RJVA 1YA0A 2DVWA 3JCKC 1UW4B 3PUKA 1N11A 5J08A 3UINC 5AJLA 2P9PG 3PS6A 4J8DA 3HYMB 4AP2A 3QWPA 3EU9A 5C2YA 1L5JA 5FQ4A 3R9AB 4JA9A 4DK5A 1TNZA 4XX5A 1N54A 3SO8A 5KWDA 3OXGA 4GTPA 1O1SA 1DVPA 4CT0A 3Q49B 4DJAA 3AG2E 5EYPF 1SVXA 4TXQA 3ML8A 1K8KG 4FC8A 2KCVA 1N4SA 4HS2A 4CGVA 5BXUA 2RKKA 1U2VG 3SF4A 4B0ZA 3URZA 3UIOC 3S2AA 4UWLA 2H6FA 3DSXA 4EHMA 2IO3C 1BLXB 4LERA 1OWNA 3CQCB 3EU5A 4WNDA 3U9WA 1HG2A 3QOUA 1TN8A 1LTXA 5FQ7A 1HU3A 2R03A 3FUFA 2HE0A 4G23A 1TN6A 2A5UA 3G2TA 3RO3A 4FHJA 4M3OA 5FT9A 3CHOA 2PM6A 4AM9A 1MZCA 2X6IA 3TWRA 4HOQA 2IFUA 4KBQA 2WQ6A 4GA2A 2JABA 3UXGA 5CRVA 3W9GA 1IYGA 2AXZA 3W9FA 2V0PA 1N0QA 4U0UA 1GW6A 5AAOA 3FTYA 4YDYA 4BETA 2P9IG 2VSNA 4C0MA 4UUCA 4UI9J 2MRIA 5ENNA 3MKQB 2LXMA 2R5SA 3HHMA 3D9NA 4DUIA 3CQGB 3APCA 4BY6A 3OXFA 5G05C 5D66A 5LOZA 4EQFA 1JPLA 1U3CA 2UY1B 1YCSB 1OY3D 2BF0X 2WXHA 4GAAA 5CEAA 4FU3A 2BEDA 3SFXA 3ABKE 4ANUA 1BI7B 3PDNA 4O60A 2F0YA 3C98A 4A3TA 1E8XA 2IOSA 3ML9A 3TXNA 3LDZA 4DX2A 2I1KA 1JCQA 3B7SA 1YYHA 5BPPA 5BT1A 2ZXWE 2AW6A 1H2UA 5BUZA 3TL5A 3EHNA 2GRLA 4U07A 4GB9A 4ATZD 3CVUA 4H7XA 3DSUA 2QC9A 3J5QB 3FU5A 3DBSA 5KBAA 3ZYKA 4GTQA 4GTSA 2CHWA 1H6PA 2LSUA 4GMRA 3SQVA 4JHJA 2ETCA 5AQBA 2DZOA 3G2UA 3VLEA 3QK0A 4GCOA 4UQXA 3KAEA 4ILHB 1NZNA 3LYAA 1HG5A 2ETBA 4FJZA 3TWXA 1V54E 4XI9A 4DX6D 4U8HA 4I17A 4NRHB 4L2LA 3CHSA 4CT4A 3QJZA 4JHKA 1HH8A 3PEVB 3FUJA 2NC9A 5LX8A 4ABNA 2FBNA 3ASOE 5G55A 4D10C 2MHKA 2VGEA 4JL0A 3B7RL 3FFLA 4EECA 3ZYMA 3DWLG 4J7WA 1H2VC 3PNTB 5LCWJ 1MQSA 4U63A 1SA5A 2X6FA 4JA7A 3HXEA 3FY4A 2IEJA 2Y0BG 1OWLA 4GZDA 2V5QC 3PZ3A 3E34A 4BX8A 5CHEE 4ZFHA 4N2SA 4XIFA 5AIJA 4BTAA 5EILA 3Q47B 1SZ9A 3FWVA 4WWOA 2VYIA 2XGMA 4GYOA 4A3VA 3G2SA 1WDYA 2M63A 4J0UA 4APFA 4TUUA 4TRQA 3ZVVA 3NF1A 4UI9K 3SBTB 2KZTA 3GZ1A 5ENSD 3IEGA 4GZ3A 3T5XA 4G11A 4K5CA 3JXIA 5DBKA 3JYSA 5G04J 3WG7E 2XEVA 5FZRA 3UMVA 4CEMA 2R02A 3Q7AA 1NL4A 3U3WA 1HE8A 3APFA 2XENA 4AIFA 1Z3XA 4N3AA 1H6KA 3CHMA 1LD7A 2ZU6B
chains in the Genus database with same CATH topology
2OVFA 2LAHA 3ASGA 4FJYA 1HO8A 4ACKA 5CCMA 1BPOA 3SBSA 3CVVA 3L08A 5FWQA 4E85A 1E7UA 2L6JA 2LNIA 3DPDA 3ZHEA 4I2WA 4G25A 3AS8A 3UQ3A 3AU5A 5DIZA 3O4ZA 5HI7A 3ESLA 4BX9A 4GMLA 4I2ZA 4CRWA 3LVRE 2L0TB 1ELRA 2WQHA 1KLXA 1NP7A 3ENEA 2C0LA 3FULA 4FLHA 5J90A 3D9LA 4ILGA 5ANRA 3NQPA 1FVFA 3FTZA 3EJNA 4G24A 1N52A 4GMJA 5JJTA 2CHZA 4I1AA 2WMOA 4XZ4A 4F7AA 3L54A 2V8SE 4UWGA 1ZU2A 4ANXA 2XHEA 2J49A 3CVLA 3KEZA 2VTBB 4JVSA 4XKBA 3MV3B 3SFZA 1Z6TA 4DI4A 3ASDA 3MYVA 2LAIA 3MZLB 4WNFA 4Y6CA 3IHVA 3S7JA 4N5CA 4HOSA 1E96B 3LY7A 5JJ7A 2CFUA 3CK8A 1EYHA 3ZHEB 2QFCA 4MKTA 2WM9A 1LF8A 3RRNB 3SZ7A 5LFAA 2JLBA 3QWVA 5T4YA 2IJGX 4PS7A 3FH8A 4XI0A 4HLEA 1UG3A 1UN8A 3FTSA 4Y6WA 3O48A 3GZSA 3RJVA 4WNGA 5ARFA 1JUQA 2OOEA 1YA0A 4G26A 2GRMA 2YNQA 3JCKC 1UW4B 3CIAA 3CHRA 1EPUA 4CDNA 3PUKA 5HQ8A 3P1UA 4ILIA 3B13A 3LS8A 5J08A 5AJLA 1E8WA 3CHQA 3QWWA 4FULA 3PS6A 4KZ0A 3CVXA 4J8DA 3HYMB 4AP2A 3QAQA 3QWPA 5C2YA 1L5JA 5FQ4A 1PAQA 3FEXA 3OTNA 3R9AB 1QQEA 4A1SA 4GCNA 3CSTA 4JA9A 3ZYQA 3U66A 5FQ8A 4DK5A 4XX5A 2XCCA 2VSXE 3LY9A 1N54A 3D9PA 3CKBA 3ONKA 3CVWA 4PS3A 5FTPA 3ZPJA 4U04A 2WXIA 3JUIA 4EZLA 3OXGA 3G2VA 3K9IA 1E8YA 4JXTA 4N39A 2J9QA 1OUVA 1DVPA 4IRUA 4XKCA 4GA1A 1H19A 3Q49B 4KYOB 3TG4A 3BEEA 3ZGQA 4CT0A 4DJAA 4JPSA 1QZ2A 3ULQA 2XGSA 3MKRA 3ML8A 3QKYA 4WUYA 4OVUA 5EDSA 2YHEA 1TJFA 2IONA 2YINA 4FC8A 2PM7A 2KCVA 4HS2A 2WXKA 3CV0A 4CGVA 4W9RA 2CG2A 3VLFA 5JHBA 3MCXA 3ASFA 2X3MA 3SF4A 3FDHA 4B0ZA 2WQ7A 2HYZA 3GYZA 4TV3A 3URZA 3TGOA 3FTXA 2X6HA 4RG6A 3ZEFA 3LCAA 5A7DB 3D3MA 3S2AA 4O6FA 5EX3A 4UWLA 4KT6B 4ATGA 4LCTA 5D0QD 2FEZA 3Q4AB 2HM8A 4JZYA 1Y6IA 4L2YA 3MEKA 4URKA 3D9KA 4LERA 2MOWA 1SZAA 1OWNA 3CQCB 5ARGA 4K03A 4WNDA 3FUNA 3TAXA 3U9WA 1HF8A 4B8CB 3QC1A 5D0OD 3TXMA 3I4GA 4LRZA 2Y4UA 1HG2A 3PRZA 3MGBA 1TJCA 3QOUA 4I43A 4L1BA 4PDXA 5FQ7A 1HU3A 2L0IA 4YVOA 2VGXA 3PE3A 4L7TA 1WY6A 4I1OB 3TJPA 3FUFA 4G23A 4JW1A 3LY8A 3SNXA 3RIBA 4HOUA 2A5UA 4G2VA 3WXXA 5AJDA 4U0SA 3G2TA 3RO3A 4FHJA 5FZSA 4M3OA 3CLJA 5FT9A 3FUHA 3MKQA 3ESKA 3CHOA 2R59A 3FTUA 4EBAG 2PM6A 2WXRA 3PEUB 4AM9A 2X6IA 3ASHA 3LKUA 3OXLA 3UT4A 4HOQA 2WXLA 2IFUA 3RRUA 4AY6A 3CVPA 4KBQA 3S7DA 2WQ6A 4GA2A 3P2BA 3L17A 2WXGA 4LUNU 1W3BA 3G2WA 1IYGA 2AXZA 3FUEA 2WB2A 2IOLA 2V0PA 5E76A 1P5QA 2WXJA 4GU5A 3L22A 4U0UA 2YQ8A 1IQUA 4BFRA 3NZSA 1GW6A 2UY1A 4UI9C 4FA6A 3FTYA 3ONLA 3S7BA 2VSNA 1UN9A 3E4BA 3FUDA 4C0MA 3FU0A 4AVXA 2XRYA 4UI9J 4HOTA 2MRIA 4CDMA 5ENNA 3EIJA 3MKQB 4MS6A 3MA5A 5LCWC 5EX0A 2NXPA 5FZQA 3U4TA 2KATA 3CK9A 3RRMB 2R5SA 3HHMA 4B94A 3L6AA 3D9NA 1FVHA 4HORA 2C0MA 3ZN3A 3T8MA 5KJKA 4EBAA 5T8IA 4BSXA 2YHCA 3FUIA 3CQGB 4AY5A 3APCA 4BY6A 3ZYLA 2X38A 4WNEA 3PREA 3UUXA 3OXFA 1Y8MA 2WXMA 2CFZA 5G05C 5AYWD 3SGHA 3S7FA 4AOFA 2VQ2A 3VTXA 2GGFA 4YNDA 3ZFWA 2DBAA 5LOZA 3HVEA 4EQFA 1JPLA 1ELWA 3I5PA 4ANWA 1U3CA 2UY1B 4OVVA 3ZIMA 3TL5A 4JEHA 5G05J 4UWKA 2BF0X 4BWRA 2WXHA 2V5FA 4A55A 4AEZC 1HS6A 5KJLA 4GAAA 4RG9A 4YVQC 4UI9K 4DI3A 2XCBA 5JJ6A 3FH7A 4FU3A 3IV0A 3NZUA 2ONDA 4ANUA 5G2NA 1OWMA 2Y3AA 2J4DA 3ZRHA 2P58C 3PDNA 3CEQA 3C98A 4A3TA 1E8XA 2I1JA 1E8ZA 2IOSA 2PZIA 1TEZA 2J07A 4GPKA 4NQ0A 3ML9A 4F1SA 3LVQE 3TXNA 3LDZA 4NACA 1E90A 2I1KA 4DLQA 2PL2A 5EKQD 3B7SA 5BPPA 2AVPA 5BT1A 4J6IA 3CVYA 2AW6A 2FF4A 3KD7A 4G1TA 1H2UA 5BUZA 5M72A 3CHPA 2WXNA 3RKVA 3JQ0A 3CSFA 2GRLA 3EHNA 3I4RB 4U07A 2LSVA 4UQZA 2NSZA 4EZJA 4BTBA 2QY7A 4GB9A 5FJYA 3BG1B 3CVUA 3SD5A 4H7XA 3SI5A 4E6HA 3PH0C 3OAWA 1FCHA 3D9OA 4I9EA 3CVQA 1UJKA 2KCKA 3FU5A 4NURA 1PC2A 2WXOA 3I3NA 5ANLA 4L23A 1HFAA 3DBSA 3ZYKA 3VLDA 1NA0A 2CHWA 5CMYA 3AS5A 2LSUA 4F3VA 4APOA 3KS2A 4JHJA 3LXUX 4BT9A 4A1GA 3AU4A 4I6GA 2WPVA 2R17C 4RVBA 4WWPA 4UQYA 4CDRA 3G2UA 4B89A 2E0IA 3MV2B 3VLEA 1ELKA 2FO7A 3QK0A 3FUKA 1H0AA 5KCMA 4GCOA 2JEKA 4UQXA 3FU6A 2BTDA 2WXFA 3KAEA 1NA3A 2AXUA 3FUMA 4ILHB 2A4ZA 1NZNA 3EHMA 3LYAA 3QDNA 3HDXA 1KT1A 1HG5A 5A6CA 2AXVA 3D9MA 4LEUA 4H7YA 4ACLA 3CKCA 4FJZA 5BNWA 5E75A 3PE4A 3LJ3A 4XI9A 3UX4A 4FHKA 2Q7FA 4U8HA 4CGWA 2PQRA 4I17A 2XQ0A 4ME2A 3RK6A 2E2EA 4NRHB 1H2TC 3IKOB 4L2LA 5KJMA 1SQMA 4BT8A 3CHSA 4CT4A 4I9CA 3FTWA 4HFGA 3QJZA 3BG0B 4JHKA 1HH8A 3PEVB 5JHAA 1HZ4A 3PVLA 3ZXSA 2IF4A 3CK7A 2VSYA 4EZKA 3T5VA 4J8SA 4F53A 2UWJG 3FUJA 4EPZA 4HXIA 2NC9A 2V4LA 2CG3A 4MLPA 5LX8A 4PS8A 2FI7A 4ABNA 4DPRA 1S0PA 2FBNA 3FEYA 2J4BA 1IQRA 5G55A 3FH5A 4JHRA 2C2LA 2DCPA 4D10C 2MHKA 2VGXB 2RD0A 4PH4B 2WXPA 2KCLA 4JL0A 3N71A 3MJWA 4AJWA 4FP7A 4N2QA 3EDTB 1QNFA 3B7RL 3PUJA 3FFLA 4EECA 3L13A 4N3CA 3GW4A 3VTYA 2WVIA 4GYYA 3ZYMA 4QFVA 2XRZA 4U0ZA 1HXIA 4Q96A 3MX3A 5T3RA 4B8AA 4P29A 2J09A 3EIQC 4RSYA 4MRUA 5KJNA 2EQXA 1H2VC 3PNTB 4JC8A 5BV1A 5LCWJ 1MQSA 1JWGA 2BUGA 4OYSA 4U63A 3FP3A 5C1DA 2X6FA 4JA7A 2AWIA 2XPIA 2XPYA 3GZ2A 2WMNA 3FY4A 4GZCA 1WAO1 2I9CA 2WXQA 5FQ6A 3TG5A 3QARA 2IQCA 4FLBA 3R7QA 2GW1A 3Q15A 1U3DA 1OWLA 2PQNA 1IHGA 4GZDA 3IBEA 4UWFA 1XGWA 4BX8A 4GZ5A 2Y4TA 1KT0A 3CR3A 2X6KA 5CHEE 4N2SA 2KC7A 4XIFA 5AIJA 4JEUA 4GYWA 4BTAA 4J8FA 5BW8C 3CGHA 3Q47B 1SZ9A 4GA0A 2LO6A 3FWVA 4WWOA 2VYIA 1UJJA 2XGMA 4GYOA 4A3VA 4KXKB 4FADA 4DLOA 3B7TA 3G2SA 3JQ1A 4WWNA 2CHXA 2I2OA 2OV8A 4V3IA 5LP0A 2HO1A 2M63A 3HIZA 4J0UA 3RO2A 4HVBA 3UT8A 2X6JA 5AENA 4APFA 2RG8A 3FHEA 4TUUA 4TRQA 4Q69A 1VDYA 3ZVVA 4Q94A 3NF1A 2I6HA 3PNLB 1DNPA 3QNKA 1MHQA 1WM5A 2XGOA 1Z3YA 2KZTA 3HVEB 4PUCA 3GZ1A 3SBTB 2ILRA 4N3BA 3APDA 3LPZA 2VJ8A 3U64A 1A17A 2HR2A 4R7LA 1ZBPA 4AXHA 1X5BA 3QB2A 3IEGA 5CCLA 2OVBA 4GZ3A 4I6JA 3SHFA 3T5XA 4G11A 3CVNA 2VSOE 4GZ6A 4KVMA 4I6EA 5DBKA 3RU0A 3UPVA 4XE0A 1OWPA 3JYSA 2L9BA 1XNFA 5G04C 2XPZA 4IYPA 4KVOA 4J8EA 1E7VA 3IHYA 3B7UX 3D9JA 3FU3A 1HX8A 3ZW3A 2DIWA 4AV7A 5BV0A 2FULA 5G04J 1PY1A 3AS4A 3Q5MA 2XEVA 3R7RA 3UT7A 2KZTB 3LEWA 5FZRA 3UMVA 2IU1A 4IN3B 4K0RA 4CEMA 3L16A 5A23A 3FTVA 3U3WA 4UWHA 1OWOA 4CCAA 3D9IA 5CMWA 1HE8A 3APFA 1JWFA 4C9BB 4C0EA 2KM4A 4KMOA 1B89A 1EF1C 1Z3XA 4IULA 4AIFA 2VGYA 4N3AA 1H6KA 3CHMA 4I1MA 2ZU6B 4ANVA 2VTBA 3PZDA 4KZCA 4WAFA 1EDUA 1INZA 2J08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ASG A;  5CCM A;  2L6J A;  2LNI A;  3ZHE A;  4I2W A;  4G25 A;  3AS8 A;  3UQ3 A;  5DIZ A;  5HI7 A;  4I2Z A;  1ELR A;  2WQH A;  1KLX A;  2C0L A;  5JJT A;  4G24 A;  4I1A A;  1ZU2 A;  3CVL A;  3MV3 B;  3ASD A;  4WNF A;  4Y6C A;  3S7J A;  4N5C A;  4HOS A;  1E96 B;  3LY7 A;  5JJ7 A;  3CK8 A;  3ZHE B;  2QFC A;  3SZ7 A;  2JLB A;  3QWV A;  4XI0 A;  4Y6W A;  3O48 A;  3RJV A;  4WNG A;  5ARF A;  2OOE A;  1YA0 A;  4G26 A;  5HQ8 A;  3QWW A;  4J8D A;  3HYM B;  3QWP A;  3R9A B;  1QQE A;  4A1S A;  4GCN A;  4JA9 A;  2XCC A;  3LY9 A;  3CKB A;  5FTP A;  3ZPJ A;  4U04 A;  3OXG A;  3K9I A;  4N39 A;  2J9Q A;  1OUV A;  4GA1 A;  4KYO B;  3Q49 B;  3TG4 A;  3ZGQ A;  3BEE A;  1QZ2 A;  3ULQ A;  2XGS A;  3MKR A;  4WUY A;  3QKY A;  2KCV A;  3CV0 A;  4CGV A;  4W9R A;  3ASF A;  3SF4 A;  2HYZ A;  3GYZ A;  3URZ A;  3TGO A;  4RG6 A;  3LCA A;  5A7D B;  4O6F A;  5EX3 A;  5D0Q D;  2FEZ A;  3Q4A B;  3MEK A;  3TAX A;  5ARG A;  4WND A;  5D0O D;  2Y4U A;  1TJC A;  3QOU A;  4YVO A;  2VGX A;  3PE3 A;  4G23 A;  3LY8 A;  3RIB A;  4HOU A;  4G2V A;  3WXX A;  4U0S A;  3RO3 A;  5FZS A;  5FT9 A;  3ESK A;  4AM9 A;  3ASH A;  3LKU A;  3OXL A;  4HOQ A;  2IFU A;  4AY6 A;  3CVP A;  4KBQ A;  3S7D A;  4GA2 A;  1W3B A;  1IYG A;  1P5Q A;  4U0U A;  2YQ8 A;  2UY1 A;  4UI9 C;  3S7B A;  2VSN A;  3E4B A;  4HOT A;  4UI9 J;  3MA5 A;  5LCW C;  5EX0 A;  5FZQ A;  3U4T A;  2KAT A;  3CK9 A;  2R5S A;  4B94 A;  2C0M A;  3ZN3 A;  5KJK A;  2YHC A;  4AY5 A;  4WNE A;  3UUX A;  3OXF A;  1Y8M A;  5AYW D;  5G05 C;  3S7F A;  2VQ2 A;  3VTX A;  4YND A;  3ZFW A;  2DBA A;  4EQF A;  1ELW A;  2UY1 B;  5G05 J;  4BWR A;  2V5F A;  5KJL A;  4RG9 A;  4YVQ C;  2XCB A;  5JJ6 A;  2OND A;  2P58 C;  3PDN A;  3CEQ A;  2PZI A;  4GPK A;  4NQ0 A;  2PL2 A;  5EKQ D;  2AVP A;  5BT1 A;  2FF4 A;  3KD7 A;  4G1T A;  5M72 A;  3RKV A;  4U07 A;  4UQZ A;  2LSV A;  4BTB A;  5FJY A;  4H7X A;  1FCH A;  4I9E A;  3CVQ A;  2KCK A;  1PC2 A;  1NA0 A;  3AS5 A;  2LSU A;  4F3V A;  4APO A;  3KS2 A;  4BT9 A;  2WPV A;  4UQY A;  4CDR A;  3MV2 B;  2FO7 A;  4GCO A;  4UQX A;  3KAE A;  4HOR A;  1NA3 A;  1NZN A;  3QDN A;  3LYA A;  1KT1 A;  5A6C A;  4LEU A;  4H7Y A;  3CKC A;  5BNW A;  3PE4 A;  4XI9 A;  2Q7F A;  4CGW A;  2PQR A;  4I17 A;  4ME2 A;  2E2E A;  4NRH B;  5KJM A;  4BT8 A;  4I9C A;  1HH8 A;  1HZ4 A;  2IF4 A;  3CK7 A;  2VSY A;  2UWJ G;  2NC9 A;  2FI7 A;  4ABN A;  2FBN A;  4JHR A;  2C2L A;  2MHK A;  2VGX B;  2KCL A;  4JL0 A;  3N71 A;  4N2Q A;  3EDT B;  3FFL A;  4N3C A;  3GW4 A;  3VTY A;  4GYY A;  4U0Z A;  1HXI A;  5KJN A;  5LCW J;  2BUG A;  3FP3 A;  5C1D A;  4JA7 A;  2XPI A;  3GZ2 A;  1WAO 1;  3TG5 A;  2GW1 A;  3Q15 A;  2PQN A;  1IHG A;  4GZ5 A;  2Y4T A;  1KT0 A;  5CHE E;  4N2S A;  2KC7 A;  4XIF A;  4GYW A;  4BTA A;  4J8F A;  5BW8 C;  3Q47 B;  4GA0 A;  3FWV A;  2VYI A;  2XGM A;  4GYO A;  4KXK B;  2HO1 A;  3RO2 A;  4J0U A;  3NF1 A;  2I6H A;  4UI9 K;  1WM5 A;  2XGO A;  3GZ1 A;  4N3B A;  3LPZ A;  1A17 A;  2HR2 A;  1ZBP A;  5CCL A;  3IEG A;  4GZ3 A;  3CVN A;  4GZ6 A;  5DBK A;  3RU0 A;  3UPV A;  3JYS A;  1XNF A;  5G04 C;  4J8E A;  5G04 J;  3AS4 A;  3Q5M A;  2XEV A;  5FZR A;  4IN3 B;  3U3W A;  4AIF A;  1B89 A;  2VGY A;  4N3A A; 
#chains in the Genus database with same CATH topology
 1HO8 A;  3CVV A;  3SBS A;  5AQA A;  1YMP A;  2LNI A;  3DPD A;  3UQ3 A;  3O4Z A;  2Y1L E;  1IHB A;  4BX9 A;  1MYO A;  3BQO A;  1KLX A;  2OCC E;  1NP7 A;  3TWW A;  5J90 A;  3FTZ A;  1D9S A;  4I1A A;  4UWG A;  1ZU2 A;  2J49 A;  2VTB B;  4JVS A;  1N4R A;  5ENQ D;  2LAI A;  4WNF A;  4F1P A;  1E96 B;  5JJ7 A;  3CK8 A;  3T9K A;  5FIN A;  3SZ7 A;  2JLB A;  4M7C A;  3QWV A;  3FH8 A;  4XI0 A;  1UG3 A;  1UN8 A;  2GRO B;  2OOE A;  1O5M A;  2GRM A;  3CIA A;  1EPU A;  5HQ8 A;  1OCC E;  4ILI A;  2KXP C;  4FUL A;  4KZ0 A;  1N0R A;  3CST A;  5ENO D;  3ZYQ A;  1Q2Z A;  5CEC B;  3PZ1 A;  3D9P A;  3CKB A;  3ZPJ A;  3V30 A;  1FT2 A;  2J9Q A;  4KYO B;  1H19 A;  3BEE A;  1QZ2 A;  2XGS A;  3MKR A;  2YHE A;  1TJF A;  2YIN A;  2WXK A;  3CV0 A;  2QZA A;  4W9R A;  5JMN D;  2X3M A;  1ZB1 A;  2WQ7 A;  3LCA A;  4O6F A;  4KT6 B;  5D0Q D;  1O1T A;  2HM8 A;  3Q4A B;  3MEK A;  2MOW A;  3TAX A;  5ARG A;  4K03 A;  3QC1 A;  3TXM A;  3PRZ A;  4I43 A;  4L1B A;  2XEH A;  4L7T A;  3UTM A;  4JW1 A;  3SNX A;  4HOU A;  3WXX A;  5AJD A;  1FT1 A;  4U0S A;  5FZS A;  3FUH A;  3MKQ A;  3ESK A;  5EN5 D;  2WXR A;  3PEU B;  3LKU A;  2WXL A;  3RRU A;  3S7D A;  3DSS A;  3P2B A;  3L17 A;  1W3B A;  2IOL A;  4GTR A;  2WXJ A;  4Z68 A;  1IQU A;  4BER A;  2RFA A;  2UY1 A;  2DYR E;  3S7B A;  3UI2 A;  3UIP C;  1N4P A;  3FU0 A;  5LCW C;  2NXP A;  3U4T A;  2KAT A;  3CK9 A;  3L6A A;  3ZN3 A;  3T8M A;  4AY5 A;  2P9L G;  2X38 A;  2WXM A;  3SGH A;  2VQ2 A;  3VTX A;  2GGF A;  3IXE A;  4JB8 P;  4UWK A;  4BWR A;  4A55 A;  4AEZ C;  4DI3 A;  2XCB A;  3Q79 A;  3IV0 A;  4GPM A;  1OWM A;  2Y3A A;  3SFY A;  3ZRH A;  2I1J A;  1UOH A;  4GPK A;  4NQ0 A;  4A63 B;  3LVQ E;  4NAC A;  4DLQ A;  5EKQ D;  3ULE G;  4J6I A;  2FF4 A;  2XS8 A;  4HRL A;  3HRA A;  3KD7 A;  4LG6 A;  4G1T A;  1MX2 A;  2WXN A;  3JQ0 A;  3I4R B;  1OXJ A;  2NSZ A;  3ZXP A;  1FCH A;  3CVQ A;  1UJK A;  1HFA A;  3E33 A;  1D8E A;  2MYO A;  4APO A;  4A1G A;  4HNA D;  4B89 A;  2FO7 A;  4GTM A;  3Q7F A;  1H0A A;  1N95 A;  2JEK A;  3E30 A;  1NA3 A;  2AXU A;  3QDN A;  4LEU A;  4H7Y A;  3CKC A;  2PQR A;  3RK6 A;  2E2E A;  5KJM A;  2GRQ B;  1SQM A;  4HFG A;  3ZNG A;  4HRN A;  2VSY A;  2UWJ G;  4EPZ A;  2P2C P;  2DZN A;  4DPR A;  3FH5 A;  4JD2 G;  2RD0 A;  1QYM A;  3N71 A;  4AJW A;  4N2Q A;  2FO1 E;  3DXK G;  2WVI A;  3EHQ A;  4QFV A;  2XRZ A;  2J09 A;  3EIQ C;  5KJN A;  1K1B A;  5BV1 A;  1JWG A;  2BUG A;  2OEV A;  5C1D A;  2XPI A;  3GZ2 A;  2WMN A;  1WAO 1;  2I9C A;  1N94 A;  4FLB A;  5EYL A;  2PQN A;  1IHG A;  2GRR B;  1KT0 A;  2X6K A;  3DXM G;  2L6B A;  2DYS E;  2EIM E;  4LSZ E;  5CBN A;  2LO6 A;  1UJJ A;  2OV8 A;  3RO2 A;  3HIZ A;  1VDY A;  4Q94 A;  1IKN D;  5HKP A;  3AAA C;  4GTT A;  1MHQ A;  1WM5 A;  1Z3Y A;  1O1R A;  2XGO A;  3HXB A;  4PUC A;  4N3B A;  1A17 A;  4AXH A;  1X5B A;  1JCS A;  2VSO E;  1Z5S C;  4K5A B;  4XE0 A;  1OWP A;  2L9B A;  1LD8 A;  1XNF A;  2P9K G;  1RW2 A;  4BSZ B;  3IHY A;  2XEE A;  4AV7 A;  3FU3 A;  1PY1 A;  1RZ4 A;  4HLL A;  3AS4 A;  3R7R A;  4IN3 B;  3FTV A;  4U96 D;  1OWO A;  3E32 A;  4C0E A;  2KM4 A;  1B89 A;  4IUL A;  4I1M A;  2VTB A;  1EDU A;  4FJY A;  5CCM A;  5FWQ A;  2XZT G;  2L6J A;  4G25 A;  5B1B E;  5HI7 A;  3ESL A;  3V31 A;  4GML A;  4CRW A;  3LVR E;  4TXP A;  4U95 D;  2WQH A;  3BU8 A;  3D9L A;  4ILG A;  4HI8 A;  4GTO A;  2LUH A;  3EJN A;  3NAW A;  3MV3 B;  5ENP D;  3MYV A;  4U8V D;  4Y6C A;  4N5C A;  4HOS A;  3LY7 A;  5FIO A;  3ZHE B;  5IY5 E;  3R9M A;  2A5E A;  3RRN B;  2IJG X;  5CRU A;  3Q9U C;  4Y6W A;  3ZUV B;  4WNG A;  5ARF A;  4BES A;  1JUQ A;  2YNQ A;  1TR4 A;  3CHR A;  4CDN A;  4HQD A;  3P1U A;  3B13 A;  3LS8 A;  1WG0 A;  3CVX A;  3NOG D;  3QAQ A;  4LNB A;  3FEX A;  1QQE A;  4A1S A;  3U66 A;  3JXJ A;  5FQ8 A;  2VSX E;  2XZD G;  3ONK A;  3V79 K;  4DX5 D;  5FTP A;  4U04 A;  2WXI A;  3JUI A;  4EZL A;  4JXT A;  3ABM E;  2P9S G;  4GA1 A;  2GRN B;  4JPS A;  3ULQ A;  5EDS A;  2ION A;  5AN8 A;  5HRY A;  4DX1 A;  3MCX A;  1OCR E;  3GYZ A;  2LXL A;  4TV3 A;  2X6H A;  4RG6 A;  3ZEF A;  1MX6 A;  5A7D B;  5EX3 A;  4HB5 A;  4LCT A;  2FEZ A;  3ASN E;  1SZA A;  4G8L A;  1HF8 A;  4LRZ A;  2Y4U A;  3T8K A;  3RAU A;  3ULY A;  4YVO A;  3PE3 A;  3JUE A;  4I1O B;  3TJP A;  2F8X K;  5JA4 D;  4G2V A;  4LNG A;  3TWQ A;  5B1A E;  3V2O A;  3B7B A;  3UM3 A;  1NFI E;  2F37 A;  3ASH A;  3UT4 A;  4U7E B;  4AY6 A;  3CVP A;  2IO2 C;  3G2W A;  3E37 A;  3FUE A;  2R05 A;  4K5B A;  1OCZ E;  2WB2 A;  4G8K A;  4N5Q A;  3TWV A;  2YQ8 A;  5B3S E;  3NZS A;  4UI9 C;  4DRX E;  4TXR A;  3B95 A;  1UN9 A;  3FUD A;  2XRY A;  3EIJ A;  2B6C A;  4O1P A;  5EX0 A;  3RRM B;  5AQ7 A;  2C0M A;  4EBA A;  3KSQ A;  4YDO A;  2YHC A;  4B93 B;  1Y8M A;  5AYW D;  3S7F A;  4AOF A;  2DBA A;  3I5P A;  4ANW A;  4OVV A;  3ZIM A;  4JEH A;  5G05 J;  2V5F A;  1HS6 A;  2XS1 A;  1KPS B;  5JJ6 A;  3FH7 A;  2ZIR A;  3NZU A;  1A5E A;  5ENR D;  3UM2 A;  3X2Q E;  5G2N A;  2P58 C;  3CEQ A;  2J07 A;  1TNU A;  3LJN A;  2AVP A;  2EIJ E;  3AG1 E;  3HXD A;  5EID A;  2ZGG A;  2LSV A;  5FJY A;  3SI5 A;  3PH0 C;  2P9U G;  3D9O A;  2KCK A;  4NUR A;  1PC2 A;  5ANL A;  4L23 A;  1NA0 A;  5CMY A;  3AS5 A;  4RLY A;  3KS2 A;  3LXU X;  2IY0 C;  4BT9 A;  2BKK B;  4I6G A;  3UKU G;  1IXV A;  2WPV A;  4WWP A;  3MV2 B;  1ELK A;  5AAR A;  5KCM A;  5KNH D;  3BUA A;  3FU6 A;  2BTD A;  2DWZ A;  2WXF A;  5A6C A;  5BNW A;  5E75 A;  4FHK A;  4CGW A;  3TWT A;  4ME2 A;  3IKO B;  4BT8 A;  4I9C A;  3BG0 B;  1HZ4 A;  3PVL A;  3ZXS A;  3T5V A;  4J8S A;  4F53 A;  4HXI A;  2V4L A;  4MLP A;  4PS8 A;  1D8D A;  1S0P A;  1S64 A;  3FEY A;  4RQI A;  1IQR A;  4JHR A;  2DCP A;  4PH4 B;  2KCL A;  5AQ9 A;  3MJW A;  4FP7 A;  1MJ0 A;  5CER B;  1TNB A;  2ETA A;  3L13 A;  3PZ4 A;  3GW4 A;  4GYY A;  4MBG A;  1HXI A;  2Y69 E;  2PNN A;  3DSV A;  3DEO A;  4P29 A;  4RSY A;  4MRU A;  2EQX A;  2OEW A;  2WXQ A;  1JCR A;  3QAR A;  3R7Q A;  2GW1 A;  3Q15 A;  2AJA A;  4UWF A;  1KZP A;  2KC7 A;  4J8F A;  3CGH A;  3ABL E;  4DLO A;  3B7T A;  2I2O A;  3NOC D;  2EIL E;  5HS0 A;  1NI1 A;  3PNL B;  2ILR A;  3KEA A;  3LPZ A;  4R7L A;  2HR2 A;  1ZBP A;  4I6J A;  3SHF A;  3CVN A;  4KVM A;  3UPV A;  1TNY A;  5G04 C;  4IYP A;  4KVO A;  1E7V A;  3ZW3 A;  1OCO E;  2DIW A;  5BV0 A;  2FUL A;  3UT7 A;  3LEW A;  4K0R A;  5A23 A;  4C9B B;  4ANV A;  4KZC A;  1INZ A;  2OVF A;  4ACK A;  3L08 A;  4E85 A;  1E7U A;  1V55 E;  3Q73 A;  3ZHE A;  3ZU7 B;  2GRP B;  5DIZ A;  3SY2 A;  4I2Z A;  1ELR A;  3ENE A;  3NQP A;  3L82 A;  4GMJ A;  4G24 A;  1N52 A;  5JJT A;  2V4H C;  2WMO A;  3UKR G;  3L54 A;  2V8S E;  1QBQ A;  4ANX A;  2XHE A;  3CVL A;  3SFZ A;  5EIB E;  4DI4 A;  3ASD A;  3MZL B;  3IHV A;  3S7J A;  5KNG A;  2CFU A;  1EYH A;  4MKT A;  4F6R D;  5ITZ F;  3GZS A;  4G26 A;  3NBN B;  4GTV A;  2ZIS A;  1E8W A;  3CHQ A;  3HG0 D;  3QWW A;  3F6Q A;  2H6G A;  1X81 A;  3PZ2 A;  1PAQ A;  3OTN A;  4YDE A;  4GCN A;  3AJI A;  4HRM B;  2XCC A;  5ENT D;  3LY9 A;  1FPP A;  3Q9N C;  3CVW A;  4PS3 A;  2H6I A;  3G2V A;  3K9I A;  1E8Y A;  3DST A;  4N39 A;  1OUV A;  4IRU A;  4XKC A;  3TG4 A;  3ZGQ A;  1TN7 A;  4QQI A;  4WUY A;  3QKY A;  4OVU A;  2PM7 A;  1K1A A;  5D2M C;  4CZ2 D;  2CG2 A;  3VLF A;  5JHB A;  3ASF A;  3FDH A;  2HYZ A;  4HI9 A;  3TGO A;  3FTX A;  1S63 A;  4ZHB A;  3D3M A;  4BEP A;  4ATG A;  1DC2 A;  4JZY A;  1Y6I A;  4L2Y A;  4URK A;  3D9K A;  1SW6 A;  4B8C B;  3FUN A;  1S70 B;  5D0O D;  3I4G A;  3MGB A;  1TJC A;  1AWC B;  4O1O A;  4PDX A;  2L0I A;  2VGX A;  1BU9 A;  1WY6 A;  3LY8 A;  2EIN E;  3RIB A;  4J8Y A;  3CLJ A;  3FTU A;  2R59 A;  1K3Z D;  4EBA G;  2B0O E;  3OXL A;  1SA4 A;  2WXG A;  1TYQ G;  4LUN U;  3AG3 E;  5E76 A;  1P5Q A;  4GU5 A;  3L22 A;  4BFR A;  4FA6 A;  3ONL A;  3E4B A;  4AVX A;  4HOT A;  1MX4 A;  4CDM A;  4MS6 A;  3MA5 A;  5FZQ A;  4B94 A;  1FVH A;  5KJK A;  1BI8 B;  5T8I A;  4BSX A;  3C3Q A;  3FUI A;  3ZYL A;  4WNE A;  3PRE A;  3TWS A;  3UUX A;  2CFZ A;  4YND A;  3ZFW A;  3HVE A;  4L9P A;  1ELW A;  1AP7 A;  3HXC A;  2RFM A;  5KJL A;  4RG9 A;  4OAU C;  4YVQ C;  5BXO A;  2OND A;  2J4D A;  1E8Z A;  2PZI A;  3KSL A;  1TEZ A;  1OT8 A;  2H6H A;  2ZGD A;  4F1S A;  1E90 A;  2PL2 A;  2QYU A;  3CVY A;  5M72 A;  3D9H A;  3CHP A;  3RKV A;  3CSF A;  4EZJ A;  4UQZ A;  4BTB A;  2QY7 A;  3BG1 B;  3SD5 A;  4E6H A;  4U8Y D;  3OAW A;  4LNU D;  4I9E A;  2EIK E;  2R2L A;  3ZKJ A;  3I3N A;  2WXO A;  3VLD A;  4F3V A;  3AU4 A;  3Q78 A;  4RVB A;  1H6O A;  2R17 C;  4UQY A;  4CDR A;  2E0I A;  3FUK A;  3UM1 A;  4HOR A;  4TUM A;  3FUM A;  2A4Z A;  3EHM A;  3HDX A;  1KT1 A;  2AXV A;  3D9M A;  3RSE G;  4ACL A;  3PE4 A;  3LJ3 A;  3UX4 A;  2Q7F A;  5CBO A;  4DX7 D;  2XQ0 A;  1H2T C;  4HBD A;  3FTW A;  5JHA A;  2IF4 A;  3CK7 A;  3DPY A;  4EZK A;  2CG3 A;  2FI7 A;  4YDW A;  2J4B A;  3DEP A;  2C2L A;  2VGX B;  2WXP A;  3TWU A;  3EDT B;  1QNF A;  4NIK A;  3PUJ A;  1KZO A;  3C5R A;  4N3C A;  3VTY A;  4U0Z A;  4Q96 A;  3MX3 A;  5T3R A;  4B8A A;  4JC8 A;  4OYS A;  2KBX A;  3FP3 A;  2AWI A;  3J5P A;  2XPY A;  4GZC A;  3TG5 A;  2F8Y A;  5FQ6 A;  2IQC A;  1U3D A;  3IBE A;  1XGW A;  4GZ5 A;  2Y4T A;  3EUV A;  3CR3 A;  4C48 B;  4JEU A;  4GYW A;  1DCE A;  5BW8 C;  3NB2 A;  4GA0 A;  4KXK B;  4FAD A;  3JQ1 A;  2QYJ A;  4WWN A;  2CHX A;  2NYJ A;  4V3I A;  5LP0 A;  2HO1 A;  4HVB A;  3DRA A;  3UT8 A;  2X6J A;  5AEN A;  2RG8 A;  3EHR A;  3FHE A;  4Q69 A;  1DCQ A;  2I6H A;  1DNP A;  3QNK A;  3HVE B;  3APD A;  3U64 A;  2VJ8 A;  5CCL A;  3QB2 A;  1BD8 A;  2OVB A;  4GZ6 A;  4I6E A;  3RU0 A;  4X8Q A;  2BKG A;  3DSW A;  3C72 A;  2XPZ A;  4J8E A;  3B7U X;  3D9J A;  1HX8 A;  2P9N G;  3Q5M A;  2KZT B;  2IU1 A;  3ISM C;  1G3N B;  3L16 A;  3C3O A;  3V2X A;  4UWH A;  3C3R A;  3AG4 E;  4CCA A;  3D9I A;  5CMW A;  5H7P A;  1JWF A;  4KMO A;  1EF1 C;  2VGY A;  3PZD A;  4WAF A;  2J08 A;  2LAH A;  3ASG A;  1BPO A;  5CED B;  4I2W A;  3AS8 A;  3AU5 A;  4CYM D;  2L0T B;  1N9A A;  2C0L A;  3FUL A;  4FLH A;  5ANR A;  1FVF A;  2CHZ A;  4XZ4 A;  4F7A A;  1N4Q A;  3KEZ A;  4XKB A;  1Z6T A;  1TNO A;  3HXF A;  2QFC A;  3UM0 A;  2WM9 A;  1LF8 A;  5LFA A;  2J8S D;  3L9T A;  5T4Y A;  4PS7 A;  4OAV B;  4HLE A;  3FTS A;  3O48 A;  3Q75 A;  4XEI G;  3RJV A;  1YA0 A;  2DVW A;  3JCK C;  1UW4 B;  3PUK A;  1N11 A;  5J08 A;  3UIN C;  5AJL A;  2P9P G;  3PS6 A;  4J8D A;  3HYM B;  4AP2 A;  3QWP A;  3EU9 A;  5C2Y A;  1L5J A;  5FQ4 A;  3R9A B;  4JA9 A;  4DK5 A;  1TNZ A;  4XX5 A;  1N54 A;  3SO8 A;  5KWD A;  3OXG A;  4GTP A;  1O1S A;  1DVP A;  4CT0 A;  3Q49 B;  4DJA A;  3AG2 E;  5EYP F;  1SVX A;  4TXQ A;  3ML8 A;  1K8K G;  4FC8 A;  2KCV A;  1N4S A;  4HS2 A;  4CGV A;  5BXU A;  2RKK A;  1U2V G;  3SF4 A;  4B0Z A;  3URZ A;  3UIO C;  3S2A A;  4UWL A;  2H6F A;  3DSX A;  4EHM A;  2IO3 C;  1BLX B;  4LER A;  1OWN A;  3CQC B;  3EU5 A;  4WND A;  3U9W A;  1HG2 A;  3QOU A;  1TN8 A;  1LTX A;  5FQ7 A;  1HU3 A;  2R03 A;  3FUF A;  2HE0 A;  4G23 A;  1TN6 A;  2A5U A;  3G2T A;  3RO3 A;  4FHJ A;  4M3O A;  5FT9 A;  3CHO A;  2PM6 A;  4AM9 A;  1MZC A;  2X6I A;  3TWR A;  4HOQ A;  2IFU A;  4KBQ A;  2WQ6 A;  4GA2 A;  2JAB A;  3UXG A;  5CRV A;  3W9G A;  1IYG A;  2AXZ A;  3W9F A;  2V0P A;  1N0Q A;  4U0U A;  1GW6 A;  5AAO A;  3FTY A;  4YDY A;  4BET A;  2P9I G;  2VSN A;  4C0M A;  4UUC A;  4UI9 J;  2MRI A;  5ENN A;  3MKQ B;  2LXM A;  2R5S A;  3HHM A;  3D9N A;  4DUI A;  3CQG B;  3APC A;  4BY6 A;  3OXF A;  5G05 C;  5D66 A;  5LOZ A;  4EQF A;  1JPL A;  1U3C A;  2UY1 B;  1YCS B;  1OY3 D;  2BF0 X;  2WXH A;  4GAA A;  5CEA A;  4FU3 A;  2BED A;  3SFX A;  3ABK E;  4ANU A;  1BI7 B;  3PDN A;  4O60 A;  2F0Y A;  3C98 A;  4A3T A;  1E8X A;  2IOS A;  3ML9 A;  3TXN A;  3LDZ A;  4DX2 A;  2I1K A;  1JCQ A;  3B7S A;  1YYH A;  5BPP A;  5BT1 A;  2ZXW E;  2AW6 A;  1H2U A;  5BUZ A;  3TL5 A;  3EHN A;  2GRL A;  4U07 A;  4GB9 A;  4ATZ D;  3CVU A;  4H7X A;  3DSU A;  2QC9 A;  3J5Q B;  3FU5 A;  3DBS A;  5KBA A;  3ZYK A;  4GTQ A;  4GTS A;  2CHW A;  1H6P A;  2LSU A;  4GMR A;  3SQV A;  4JHJ A;  2ETC A;  5AQB A;  2DZO A;  3G2U A;  3VLE A;  3QK0 A;  4GCO A;  4UQX A;  3KAE A;  4ILH B;  1NZN A;  3LYA A;  1HG5 A;  2ETB A;  4FJZ A;  3TWX A;  1V54 E;  4XI9 A;  4DX6 D;  4U8H A;  4I17 A;  4NRH B;  4L2L A;  3CHS A;  4CT4 A;  3QJZ A;  4JHK A;  1HH8 A;  3PEV B;  3FUJ A;  2NC9 A;  5LX8 A;  4ABN A;  2FBN A;  3ASO E;  5G55 A;  4D10 C;  2MHK A;  2VGE A;  4JL0 A;  3B7R L;  3FFL A;  4EEC A;  3ZYM A;  3DWL G;  4J7W A;  1H2V C;  3PNT B;  5LCW J;  1MQS A;  4U63 A;  1SA5 A;  2X6F A;  4JA7 A;  3HXE A;  3FY4 A;  2IEJ A;  2Y0B G;  1OWL A;  4GZD A;  2V5Q C;  3PZ3 A;  3E34 A;  4BX8 A;  5CHE E;  4ZFH A;  4N2S A;  4XIF A;  5AIJ A;  4BTA A;  5EIL A;  3Q47 B;  1SZ9 A;  3FWV A;  4WWO A;  2VYI A;  2XGM A;  4GYO A;  4A3V A;  3G2S A;  1WDY A;  2M63 A;  4J0U A;  4APF A;  4TUU A;  4TRQ A;  3ZVV A;  3NF1 A;  4UI9 K;  3SBT B;  2KZT A;  3GZ1 A;  5ENS D;  3IEG A;  4GZ3 A;  3T5X A;  4G11 A;  4K5C A;  3JXI A;  5DBK A;  3JYS A;  5G04 J;  3WG7 E;  2XEV A;  5FZR A;  3UMV A;  4CEM A;  2R02 A;  3Q7A A;  1NL4 A;  3U3W A;  1HE8 A;  3APF A;  2XEN A;  4AIF A;  1Z3X A;  4N3A A;  1H6K A;  3CHM A;  1LD7 A;  2ZU6 B; 
#chains in the Genus database with same CATH homology
 2OVF A;  2LAH A;  3ASG A;  4FJY A;  1HO8 A;  4ACK A;  5CCM A;  1BPO A;  3SBS A;  3CVV A;  3L08 A;  5FWQ A;  4E85 A;  1E7U A;  2L6J A;  2LNI A;  3DPD A;  3ZHE A;  4I2W A;  4G25 A;  3AS8 A;  3UQ3 A;  3AU5 A;  5DIZ A;  3O4Z A;  5HI7 A;  3ESL A;  4BX9 A;  4GML A;  4I2Z A;  4CRW A;  3LVR E;  2L0T B;  1ELR A;  2WQH A;  1KLX A;  1NP7 A;  3ENE A;  2C0L A;  3FUL A;  4FLH A;  5J90 A;  3D9L A;  4ILG A;  5ANR A;  3NQP A;  1FVF A;  3FTZ A;  3EJN A;  4G24 A;  1N52 A;  4GMJ A;  5JJT A;  2CHZ A;  4I1A A;  2WMO A;  4XZ4 A;  4F7A A;  3L54 A;  2V8S E;  4UWG A;  1ZU2 A;  4ANX A;  2XHE A;  2J49 A;  3CVL A;  3KEZ A;  2VTB B;  4JVS A;  4XKB A;  3MV3 B;  3SFZ A;  1Z6T A;  4DI4 A;  3ASD A;  3MYV A;  2LAI A;  3MZL B;  4WNF A;  4Y6C A;  3IHV A;  3S7J A;  4N5C A;  4HOS A;  1E96 B;  3LY7 A;  5JJ7 A;  2CFU A;  3CK8 A;  1EYH A;  3ZHE B;  2QFC A;  4MKT A;  2WM9 A;  1LF8 A;  3RRN B;  3SZ7 A;  5LFA A;  2JLB A;  3QWV A;  5T4Y A;  2IJG X;  4PS7 A;  3FH8 A;  4XI0 A;  4HLE A;  1UG3 A;  1UN8 A;  3FTS A;  4Y6W A;  3O48 A;  3GZS A;  3RJV A;  4WNG A;  5ARF A;  1JUQ A;  2OOE A;  1YA0 A;  4G26 A;  2GRM A;  2YNQ A;  3JCK C;  1UW4 B;  3CIA A;  3CHR A;  1EPU A;  4CDN A;  3PUK A;  5HQ8 A;  3P1U A;  4ILI A;  3B13 A;  3LS8 A;  5J08 A;  5AJL A;  1E8W A;  3CHQ A;  3QWW A;  4FUL A;  3PS6 A;  4KZ0 A;  3CVX A;  4J8D A;  3HYM B;  4AP2 A;  3QAQ A;  3QWP A;  5C2Y A;  1L5J A;  5FQ4 A;  1PAQ A;  3FEX A;  3OTN A;  3R9A B;  1QQE A;  4A1S A;  4GCN A;  3CST A;  4JA9 A;  3ZYQ A;  3U66 A;  5FQ8 A;  4DK5 A;  4XX5 A;  2XCC A;  2VSX E;  3LY9 A;  1N54 A;  3D9P A;  3CKB A;  3ONK A;  3CVW A;  4PS3 A;  5FTP A;  3ZPJ A;  4U04 A;  2WXI A;  3JUI A;  4EZL A;  3OXG A;  3G2V A;  3K9I A;  1E8Y A;  4JXT A;  4N39 A;  2J9Q A;  1OUV A;  1DVP A;  4IRU A;  4XKC A;  4GA1 A;  1H19 A;  3Q49 B;  4KYO B;  3TG4 A;  3BEE A;  3ZGQ A;  4CT0 A;  4DJA A;  4JPS A;  1QZ2 A;  3ULQ A;  2XGS A;  3MKR A;  3ML8 A;  3QKY A;  4WUY A;  4OVU A;  5EDS A;  2YHE A;  1TJF A;  2ION A;  2YIN A;  4FC8 A;  2PM7 A;  2KCV A;  4HS2 A;  2WXK A;  3CV0 A;  4CGV A;  4W9R A;  2CG2 A;  3VLF A;  5JHB A;  3MCX A;  3ASF A;  2X3M A;  3SF4 A;  3FDH A;  4B0Z A;  2WQ7 A;  2HYZ A;  3GYZ A;  4TV3 A;  3URZ A;  3TGO A;  3FTX A;  2X6H A;  4RG6 A;  3ZEF A;  3LCA A;  5A7D B;  3D3M A;  3S2A A;  4O6F A;  5EX3 A;  4UWL A;  4KT6 B;  4ATG A;  4LCT A;  5D0Q D;  2FEZ A;  3Q4A B;  2HM8 A;  4JZY A;  1Y6I A;  4L2Y A;  3MEK A;  4URK A;  3D9K A;  4LER A;  2MOW A;  1SZA A;  1OWN A;  3CQC B;  5ARG A;  4K03 A;  4WND A;  3FUN A;  3TAX A;  3U9W A;  1HF8 A;  4B8C B;  3QC1 A;  5D0O D;  3TXM A;  3I4G A;  4LRZ A;  2Y4U A;  1HG2 A;  3PRZ A;  3MGB A;  1TJC A;  3QOU A;  4I43 A;  4L1B A;  4PDX A;  5FQ7 A;  1HU3 A;  2L0I A;  4YVO A;  2VGX A;  3PE3 A;  4L7T A;  1WY6 A;  4I1O B;  3TJP A;  3FUF A;  4G23 A;  4JW1 A;  3LY8 A;  3SNX A;  3RIB A;  4HOU A;  2A5U A;  4G2V A;  3WXX A;  5AJD A;  4U0S A;  3G2T A;  3RO3 A;  4FHJ A;  5FZS A;  4M3O A;  3CLJ A;  5FT9 A;  3FUH A;  3MKQ A;  3ESK A;  3CHO A;  2R59 A;  3FTU A;  4EBA G;  2PM6 A;  2WXR A;  3PEU B;  4AM9 A;  2X6I A;  3ASH A;  3LKU A;  3OXL A;  3UT4 A;  4HOQ A;  2WXL A;  2IFU A;  3RRU A;  4AY6 A;  3CVP A;  4KBQ A;  3S7D A;  2WQ6 A;  4GA2 A;  3P2B A;  3L17 A;  2WXG A;  4LUN U;  1W3B A;  3G2W A;  1IYG A;  2AXZ A;  3FUE A;  2WB2 A;  2IOL A;  2V0P A;  5E76 A;  1P5Q A;  2WXJ A;  4GU5 A;  3L22 A;  4U0U A;  2YQ8 A;  1IQU A;  4BFR A;  3NZS A;  1GW6 A;  2UY1 A;  4UI9 C;  4FA6 A;  3FTY A;  3ONL A;  3S7B A;  2VSN A;  1UN9 A;  3E4B A;  3FUD A;  4C0M A;  3FU0 A;  4AVX A;  2XRY A;  4UI9 J;  4HOT A;  2MRI A;  4CDM A;  5ENN A;  3EIJ A;  3MKQ B;  4MS6 A;  3MA5 A;  5LCW C;  5EX0 A;  2NXP A;  5FZQ A;  3U4T A;  2KAT A;  3CK9 A;  3RRM B;  2R5S A;  3HHM A;  4B94 A;  3L6A A;  3D9N A;  1FVH A;  4HOR A;  2C0M A;  3ZN3 A;  3T8M A;  5KJK A;  4EBA A;  5T8I A;  4BSX A;  2YHC A;  3FUI A;  3CQG B;  4AY5 A;  3APC A;  4BY6 A;  3ZYL A;  2X38 A;  4WNE A;  3PRE A;  3UUX A;  3OXF A;  1Y8M A;  2WXM A;  2CFZ A;  5G05 C;  5AYW D;  3SGH A;  3S7F A;  4AOF A;  2VQ2 A;  3VTX A;  2GGF A;  4YND A;  3ZFW A;  2DBA A;  5LOZ A;  3HVE A;  4EQF A;  1JPL A;  1ELW A;  3I5P A;  4ANW A;  1U3C A;  2UY1 B;  4OVV A;  3ZIM A;  3TL5 A;  4JEH A;  5G05 J;  4UWK A;  2BF0 X;  4BWR A;  2WXH A;  2V5F A;  4A55 A;  4AEZ C;  1HS6 A;  5KJL A;  4GAA A;  4RG9 A;  4YVQ C;  4UI9 K;  4DI3 A;  2XCB A;  5JJ6 A;  3FH7 A;  4FU3 A;  3IV0 A;  3NZU A;  2OND A;  4ANU A;  5G2N A;  1OWM A;  2Y3A A;  2J4D A;  3ZRH A;  2P58 C;  3PDN A;  3CEQ A;  3C98 A;  4A3T A;  1E8X A;  2I1J A;  1E8Z A;  2IOS A;  2PZI A;  1TEZ A;  2J07 A;  4GPK A;  4NQ0 A;  3ML9 A;  4F1S A;  3LVQ E;  3TXN A;  3LDZ A;  4NAC A;  1E90 A;  2I1K A;  4DLQ A;  2PL2 A;  5EKQ D;  3B7S A;  5BPP A;  2AVP A;  5BT1 A;  4J6I A;  3CVY A;  2AW6 A;  2FF4 A;  3KD7 A;  4G1T A;  1H2U A;  5BUZ A;  5M72 A;  3CHP A;  2WXN A;  3RKV A;  3JQ0 A;  3CSF A;  2GRL A;  3EHN A;  3I4R B;  4U07 A;  2LSV A;  4UQZ A;  2NSZ A;  4EZJ A;  4BTB A;  2QY7 A;  4GB9 A;  5FJY A;  3BG1 B;  3CVU A;  3SD5 A;  4H7X A;  3SI5 A;  4E6H A;  3PH0 C;  3OAW A;  1FCH A;  3D9O A;  4I9E A;  3CVQ A;  1UJK A;  2KCK A;  3FU5 A;  4NUR A;  1PC2 A;  2WXO A;  3I3N A;  5ANL A;  4L23 A;  1HFA A;  3DBS A;  3ZYK A;  3VLD A;  1NA0 A;  2CHW A;  5CMY A;  3AS5 A;  2LSU A;  4F3V A;  4APO A;  3KS2 A;  4JHJ A;  3LXU X;  4BT9 A;  4A1G A;  3AU4 A;  4I6G A;  2WPV A;  2R17 C;  4RVB A;  4WWP A;  4UQY A;  4CDR A;  3G2U A;  4B89 A;  2E0I A;  3MV2 B;  3VLE A;  1ELK A;  2FO7 A;  3QK0 A;  3FUK A;  1H0A A;  5KCM A;  4GCO A;  2JEK A;  4UQX A;  3FU6 A;  2BTD A;  2WXF A;  3KAE A;  1NA3 A;  2AXU A;  3FUM A;  4ILH B;  2A4Z A;  1NZN A;  3EHM A;  3LYA A;  3QDN A;  3HDX A;  1KT1 A;  1HG5 A;  5A6C A;  2AXV A;  3D9M A;  4LEU A;  4H7Y A;  4ACL A;  3CKC A;  4FJZ A;  5BNW A;  5E75 A;  3PE4 A;  3LJ3 A;  4XI9 A;  3UX4 A;  4FHK A;  2Q7F A;  4U8H A;  4CGW A;  2PQR A;  4I17 A;  2XQ0 A;  4ME2 A;  3RK6 A;  2E2E A;  4NRH B;  1H2T C;  3IKO B;  4L2L A;  5KJM A;  1SQM A;  4BT8 A;  3CHS A;  4CT4 A;  4I9C A;  3FTW A;  4HFG A;  3QJZ A;  3BG0 B;  4JHK A;  1HH8 A;  3PEV B;  5JHA A;  1HZ4 A;  3PVL A;  3ZXS A;  2IF4 A;  3CK7 A;  2VSY A;  4EZK A;  3T5V A;  4J8S A;  4F53 A;  2UWJ G;  3FUJ A;  4EPZ A;  4HXI A;  2NC9 A;  2V4L A;  2CG3 A;  4MLP A;  5LX8 A;  4PS8 A;  2FI7 A;  4ABN A;  4DPR A;  1S0P A;  2FBN A;  3FEY A;  2J4B A;  1IQR A;  5G55 A;  3FH5 A;  4JHR A;  2C2L A;  2DCP A;  4D10 C;  2MHK A;  2VGX B;  2RD0 A;  4PH4 B;  2WXP A;  2KCL A;  4JL0 A;  3N71 A;  3MJW A;  4AJW A;  4FP7 A;  4N2Q A;  3EDT B;  1QNF A;  3B7R L;  3PUJ A;  3FFL A;  4EEC A;  3L13 A;  4N3C A;  3GW4 A;  3VTY A;  2WVI A;  4GYY A;  3ZYM A;  4QFV A;  2XRZ A;  4U0Z A;  1HXI A;  4Q96 A;  3MX3 A;  5T3R A;  4B8A A;  4P29 A;  2J09 A;  3EIQ C;  4RSY A;  4MRU A;  5KJN A;  2EQX A;  1H2V C;  3PNT B;  4JC8 A;  5BV1 A;  5LCW J;  1MQS A;  1JWG A;  2BUG A;  4OYS A;  4U63 A;  3FP3 A;  5C1D A;  2X6F A;  4JA7 A;  2AWI A;  2XPI A;  2XPY A;  3GZ2 A;  2WMN A;  3FY4 A;  4GZC A;  1WAO 1;  2I9C A;  2WXQ A;  5FQ6 A;  3TG5 A;  3QAR A;  2IQC A;  4FLB A;  3R7Q A;  2GW1 A;  3Q15 A;  1U3D A;  1OWL A;  2PQN A;  1IHG A;  4GZD A;  3IBE A;  4UWF A;  1XGW A;  4BX8 A;  4GZ5 A;  2Y4T A;  1KT0 A;  3CR3 A;  2X6K A;  5CHE E;  4N2S A;  2KC7 A;  4XIF A;  5AIJ A;  4JEU A;  4GYW A;  4BTA A;  4J8F A;  5BW8 C;  3CGH A;  3Q47 B;  1SZ9 A;  4GA0 A;  2LO6 A;  3FWV A;  4WWO A;  2VYI A;  1UJJ A;  2XGM A;  4GYO A;  4A3V A;  4KXK B;  4FAD A;  4DLO A;  3B7T A;  3G2S A;  3JQ1 A;  4WWN A;  2CHX A;  2I2O A;  2OV8 A;  4V3I A;  5LP0 A;  2HO1 A;  2M63 A;  3HIZ A;  4J0U A;  3RO2 A;  4HVB A;  3UT8 A;  2X6J A;  5AEN A;  4APF A;  2RG8 A;  3FHE A;  4TUU A;  4TRQ A;  4Q69 A;  1VDY A;  3ZVV A;  4Q94 A;  3NF1 A;  2I6H A;  3PNL B;  1DNP A;  3QNK A;  1MHQ A;  1WM5 A;  2XGO A;  1Z3Y A;  2KZT A;  3HVE B;  4PUC A;  3GZ1 A;  3SBT B;  2ILR A;  4N3B A;  3APD A;  3LPZ A;  2VJ8 A;  3U64 A;  1A17 A;  2HR2 A;  4R7L A;  1ZBP A;  4AXH A;  1X5B A;  3QB2 A;  3IEG A;  5CCL A;  2OVB A;  4GZ3 A;  4I6J A;  3SHF A;  3T5X A;  4G11 A;  3CVN A;  2VSO E;  4GZ6 A;  4KVM A;  4I6E A;  5DBK A;  3RU0 A;  3UPV A;  4XE0 A;  1OWP A;  3JYS A;  2L9B A;  1XNF A;  5G04 C;  2XPZ A;  4IYP A;  4KVO A;  4J8E A;  1E7V A;  3IHY A;  3B7U X;  3D9J A;  3FU3 A;  1HX8 A;  3ZW3 A;  2DIW A;  4AV7 A;  5BV0 A;  2FUL A;  5G04 J;  1PY1 A;  3AS4 A;  3Q5M A;  2XEV A;  3R7R A;  3UT7 A;  2KZT B;  3LEW A;  5FZR A;  3UMV A;  2IU1 A;  4IN3 B;  4K0R A;  4CEM A;  3L16 A;  5A23 A;  3FTV A;  3U3W A;  4UWH A;  1OWO A;  4CCA A;  3D9I A;  5CMW A;  1HE8 A;  3APF A;  1JWF A;  4C9B B;  4C0E A;  2KM4 A;  4KMO A;  1B89 A;  1EF1 C;  1Z3X A;  4IUL A;  4AIF A;  2VGY A;  4N3A A;  1H6K A;  3CHM A;  4I1M A;  2ZU6 B;  4ANV A;  2VTB A;  3PZD A;  4KZC A;  4WAF A;  1EDU A;  1INZ A;  2J08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...