3RO3A

Crystal structure of lgn/minscuteable complex
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
159
structure length
159
Chain Sequence
SRAAQGRAFGNLGNTHYLLGNFRDAVIAHEQRLLIAKEFGDKAAERIAYSNLGNAYIFLGEFETASEYYKKTLLLARQLKDRAVEAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIAQELKDRIGEGRACWSLGNAYTALGNHDQAMHFAEKHLEISREV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title LGN/mInsc and LGN/NuMA complex structures suggest distinct functions in asymmetric cell division for the Par3/mInsc/LGN and G[alpha]i/LGN/NuMA pathways
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords G-protein-signaling modulator 2
total genus 74
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2011-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13176 TPR_7 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ro3A00
4XI9A 1W3BA 3GYZA 3AS5A 4HOTA 3AS4A 3RJVA 2XGMA 2FBNA 1HXIA 5CCMA 4O6FA 3Q5MA 3CVNA 4W9RA 4UI9J 4U0UA 3LKUA 2Q7FA 5A7DB 4YNDA 2NC9A 5ARFA 2YQ8A 2ONDA 3OXFA 3ASHA 4WUYA 3FWVA 4I1AA 5LCWC 4ABNA 4HORA 3KAEA 2FEZA 3QWPA 3TAXA 3LCAA 3BEEA 3TG5A 3U3WA 1Y8MA 3ASFA 1P5QA 2VQ2A 1KT1A 3CVQA 4JA9A 3SF4A 4G23A 3ZFWA 4F3VA 3SZ7A 5A6CA 2HO1A 4XIFA 5EKQD 2YHCA 4CDRA 1IYGA 5KJKA 5EX3A 1XNFA 3JYSA 4AY6A 5JJ6A 4GZ5A 5FT9A 4JA7A 5G05J 4I9EA 5JJTA 1IHGA 2XCCA 3IEGA 5ARGA 5HQ8A 5M72A 2VYIA 3GZ1A 2HYZA 3QWWA 2C0LA 2OOEA 1TJCA 3QWVA 4U04A 2IF4A 2JLBA 4GPKA 3CK8A 2HR2A 4G1TA 5FZSA 4I9CA 4I2WA 3ZHEA 3TGOA 3LPZA 2UWJG 4LEUA 4NQ0A 4UI9K 5FZQA 3S7DA 3CV0A 1HZ4A 1KT0A 2GW1A 4H7XA 4I2ZA 4RG6A 4YVOA 5LCWJ 2R5SA 2VSYA 2AVPA 4G2VA 3RO3A 2PZIA 3VTXA 2FF4A 5EX0A 4BT8A 2PQNA 4I17A 4BTBA 3OXLA 3LY7A 4WNGA 3ZHEB 3QKYA 3RKVA 3CKCA 3CKBA 3N71A 4GZ6A 5DBKA 5G04J 4N3BA 4U07A 4H7YA 3KS2A 2Y4TA 3OXGA 2KCVA 3FFLA 1ELRA 5FZRA 2XPIA 3FP3A 3MA5A 4G26A 4JL0A 4N39A 3R9AB 4YVQC 3NF1A 4UQYA 4N5CA 2DBAA 2KCLA 3KD7A 3UUXA 2FO7A 3RO2A 3RU0A 4AY5A 5BT1A 1QZ2A 4KXKB 4WNDA 1NA0A 4HOSA 4AIFA 4WNFA 3CK9A 3MKRA 2LSVA 3TG4A 4GCNA 1HH8A 3GW4A 5D0OD 5CHEE 5BNWA 1ZU2A 2KCKA 2J9QA 2PQRA 2VGXB 2I6HA 2BUGA 4GZ3A 4UI9C 4B94A 5FJYA 3O48A 2KATA 2VGYA 3ULQA 3Q49B 1PC2A 3HYMB 1ELWA 3CK7A 3Q47B 4HOQA 5FTPA 4GCOA 2WQHA 2E2EA 1YA0A 2FI7A 4BTAA 4GYOA 1OUVA 5G04C 4U0SA 3ZN3A 3ZGQA 2V5FA 2XGSA 1QQEA 2XGOA 3AS8A 3CVPA 4N3AA 2UY1A 4GA0A 5D0QD 2P58C 1FCHA 2WPVA 3ZPJA 4EQFA 3QDNA 5HI7A 5C1DA 2VGXA 3CEQA 4U0ZA 3S7FA 3ESKA 5JJ7A 5G05C 3UPVA 4G24A 4AM9A 3QOUA 2LNIA 3UQ3A 4XI0A 3MV2B 3URZA 3MEKA 2Y4UA 3LY9A 4KYOB 5DIZA 3CVLA 3PDNA 4G25A 3EDTB 2QFCA 3U4TA 3VTYA 4BWRA 4UQXA 4J8DA 4J8FA 4GA2A 2L6JA 2KC7A 1NZNA 3MV3B 4J0UA 1WAO1 4CGWA 4APOA 4WNEA 5KJMA 3S7BA 2C0MA 3PE4A 2IFUA 4NRHB 1B89A 4GA1A 3GZ2A 4Y6WA 1WM5A 4GYWA 4RG9A 5AYWD 2XCBA 1KLXA 4N2SA 1A17A 3LYAA 4HOUA 3RIBA 4IN3B 2MHKA 1NA3A 4KBQA 2PL2A 4UQZA 3S7JA 1E96B 2UY1B 2C2LA 4BT9A 4CGVA 2VSNA 3PE3A 4J8EA 4ME2A 2XEVA 1ZBPA 4N3CA 5KJLA 5KJNA 3Q15A 4JHRA 4Y6CA 3WXXA 5BW8C 4N2QA 5CCLA 2LSUA 4GYYA 3LY8A 4A1SA 3ASDA 3E4BA 3K9IA 3ASGA 3Q4AB
chains in the Genus database with same CATH superfamily
3AS5A 3FH7A 4O6FA 2R17C 3LKUA 2ONDA 4ACLA 4K5CA 2AXZA 1IXVA 1P5QA 4PS8A 4CZ2D 4G8KA 2DYRE 4XIFA 4UWKA 1X81A 2WXRA 1IHGA 2XCCA 1ZB1A 1UJKA 2IY0C 4HNAD 3LS8A 4UI9K 3SBTB 2XS8A 2NSZA 3FUHA 1JPLA 3DPDA 4JL0A 4UWGA 3RO2A 3RU0A 3UT7A 4GTMA 4LNGA 1AWCB 4KVOA 4HFGA 3BG1B 2PM6A 4GZDA 3ULQA 5AJDA 3PNLB 4U95D 4GCOA 2X6IA 1EDUA 4G24A 2JABA 4KYOB 2BKGA 3G2SA 5C2YA 5B1AE 3CVXA 3UM1A 4OYSA 2WXIA 4RG9A 4N2SA 2CHXA 4JHJA 3RIBA 2X6FA 2RFAA 4ZHBA 4HB5A 3FU0A 5FZRA 1NP7A 2WQ7A 2MOWA 5EIDA 5A7DB 3B95A 4L7TA 4CEMA 1KPSB 3E37A 3BEEA 3U3WA 4GTOA 2JEKA 1H0AA 3EUVA 4I9EA 3V2XA 2H6IA 1H2VC 1N4SA 3HXCA 4XE0A 3CVWA 3CV0A 3TL5A 4FA6A 4PUCA 4BT8A 4I17A 4DI3A 5DBKA 4CT4A 3AG3E 3KS2A 1ELRA 1GW6A 1OT8A 1JCRA 3UMVA 4G11A 4XEIG 2WXPA 1ZU2A 2J9QA 3DPYA 3J5QB 5CMYA 1ELWA 5ENOD 2WQHA 1Q2ZA 3ZGQA 2XGSA 5D0QD 1IQUA 3FTVA 2Y4UA 2QFCA 4FP7A 3MV3B 1G3NB 4CGWA 4GA1A 1K8KG 2V4HC 3MYVA 4TRQA 4I6EA 1OCZE 1NA3A 3HIZA 3LVQE 4BX9A 4XI9A 2EILE 4W9RA 2L9BA 2R03A 2V8SE 3FY4A 3FWVA 5D2MC 3RK6A 3KAEA 2LAIA 2A5EA 2HO1A 4J7WA 2QYUA 4FC8A 3CIAA 1PY1A 2X6HA 4HI9A 1H2UA 4WWPA 4EZJA 3ZYMA 3QWVA 3TWXA 3ZHEA 4YVOA 2ETCA 2P9UG 3AU4A 1OWMA 5CEDB 1BI8B 4TUUA 4IRUA 3CKCA 2WB2A 2Y4TA 3CHOA 2L6BA 2BTDA 3MA5A 1VDYA 3JQ1A 3SFYA 1MQSA 5BNWA 1SA5A 4IULA 3MZLB 5FJYA 3B7TA 4GTRA 2R2LA 5G04C 2XEHA 2P58C 4BSXA 3FUDA 2EINE 3URZA 5DIZA 3ASNE 3DRAA 4IYPA 2LAHA 4J0UA 1H6KA 3PZDA 1OWPA 4A3VA 5E76A 5BV1A 3MJWA 3LYAA 4DUIA 2XQ0A 3Q9NC 1E96B 2YHEA 3FUMA 1V55E 1ZBPA 4FU3A 3UINC 4M3OA 3LY8A 4BSZB 1LTXA 4WNFA 5HS0A 3G2VA 3CVUA 3X2QE 2VSOE 3U66A 3DXMG 1OY3D 4R7LA 3SI5A 1Y8MA 2BF0X 1KZPA 3CVQA 4KT6B 3UKUG 4F3VA 4I1OB 4CDRA 2PM7A 4FLBA 5IY5E 1EPUA 4KZCA 2YNQA 1FVHA 3BG0B 5BXOA 4GMJA 3G2TA 4A63B 5KBAA 2IU1A 4H7XA 4RG6A 3T5VA 2XRYA 3KEZA 4N3BA 4HRNA 2P9KG 3NF1A 3QJZA 4O60A 3UUXA 3C72A 3V31A 4AIFA 4JW1A 2RG8A 4RVBA 4Z68A 3ESLA 3B7BA 3HVEA 3RRUA 3APFA 4LERA 1N0RA 4FHJA 4U0SA 3PNTB 1E7UA 4JD2G 4N3AA 3MCXA 3ESKA 2GGFA 4L9PA 5G05C 5HRYA 3UQ3A 5BT1A 1TNYA 1N0QA 4J8DA 2KC7A 1N11A 4WNEA 2IJGX 2R02A 3FEYA 4C0MA 2XZTG 4Y6WA 1A17A 4IN3B 4OAVB 2XEVA 3IXEA 3Q75A 3Q15A 3HRAA 3L13A 3LJ3A 5T3RA 1HF8A 2DCPA 4PS7A 2YINA 3I4RB 2NC9A 4WUYA 5LCWC 2XEEA 5KWDA 4TXRA 3ENEA 3ZFWA 2P9IG 3V2OA 4GB9A 4HI8A 5EX3A 4AY6A 1YYHA 3FUJA 5HQ8A 3PVLA 2LXLA 2HYZA 1MYOA 2WXFA 4B0ZA 1OWLA 4EBAA 1OCRE 1H6PA 1HZ4A 1Z3XA 4JZYA 3HHMA 4B89A 4X8QA 1TR4A 4BEPA 3FP3A 3R9AB 3PS6A 2QYJA 4N5CA 2DBAA 2KCLA 3UM0A 2IOLA 3CQGB 2M63A 4JB8P 1JUQA 2X38A 3EIJA 5FQ6A 2KCKA 4QFVA 4B8CB 5J08A 2RFMA 4C9BB 5CECB 4DX5D 4TXPA 5AN8A 2B0OE 1OUVA 1QQEA 3LXUX 1EYHA 3S7FA 5JJ7A 2V5QC 2VTBA 3VTYA 4TV3A 2LXMA 4GA2A 1PAQA 4A55A 1WM5A 3IHYA 1E8XA 2CFUA 3FTSA 2HM8A 4D10C 1O1RA 4HRLA 3TWTA 4DK5A 1IKND 3Q78A 3CHRA 3U9WA 1HFAA 4HOTA 5HKPA 1HXIA 3C3OA 3ZYQA 4DLOA 1QNFA 3UIPC 4JPSA 4UI9J 2ZU6B 5CBOA 3EU5A 3OXFA 2ETAA 3ULEG 3QB2A 3QWPA 3TAXA 3VLFA 3PZ3A 3L08A 4ILGA 1AP7A 5ANRA 2WXJA 5A6CA 1ELKA 1XNFA 3JYSA 2OV8A 4U8VD 2ZISA 3DEPA 4I9CA 3B7RL 2WQ6A 4O1PA 1Z6TA 4APFA 2XENA 2J4BA 1K1AA 3ZXSA 4O1OA 3JXIA 2KZTB 2GROB 3V30A 2I2OA 3FTUA 3U64A 2CG2A 2PQRA 2BUGA 4B94A 3ZRHA 4PS3A 4J8YA 4BERA 3Q47B 2VTBB 3CK7A 3EHMA 1BU9A 3SGHA 2V0PA 2X6JA 5KNHD 4ATGA 4MKTA 4GPMA 3FUFA 3FEXA 4AM9A 3CVLA 3U4TA 5FQ7A 4HLLA 4KBQA 3ASOE 3D9KA 4ZFHA 3PUKA 1RW2A 3WXXA 5BW8C 1SQMA 4CT0A 3NZSA 4MS6A 5ANLA 2XS1A 5FQ4A 3UM2A 3B7UX 2J8SD 1MX6A 5LFAA 1Z5SC 3PZ1A 3ZKJA 3SF4A 3SZ7A 3KSQA 3HDXA 3UT4A 1O1TA 4B93B 3CHQA 3ZU7B 5ARGA 2IEJA 1E90A 1S0PA 2LUHA 3R7RA 3LPZA 3MKQB 3UTMA 1UG3A 4N5QA 3CHSA 2FF4A 4DPRA 2WVIA 4WNGA 4U07A 3PREA 3OXGA 4GTPA 2WXGA 1HE8A 4L2YA 3KEAA 3SHFA 3KD7A 2J4DA 3TG4A 1HH8A 5D0OD 2OCCE 5CRUA 4U7EB 1S70B 4AOFA 3PRZA 4JVSA 1YA0A 3ZIMA 4E6HA 4KVMA 1DC2A 5E75A 5BV0A 4LG6A 3CEQA 1BPOA 1TNUA 5G2NA 2EIJE 5FWQA 3FUKA 4I6JA 2L6JA 4BETA 1B89A 1SZ9A 3GZ2A 5AYWD 3EJNA 4HOUA 3D9LA 2PL2A 4BT9A 2IQCA 1TYQG 2VJ8A 2DVWA 5T8IA 3MKQA 3RRNB 1TN7A 3SQVA 4GTQA 4EZKA 2WXQA 3CVNA 3G2WA 3CSTA 5B1BE 3J5PA 1NL4A 4HORA 2VSXE 3RAUA 4JA9A 3EHNA 3I3NA 3PEVB 4JHKA 4LUNU 3ZW3A 3BQOA 2BKKB 1UOHA 1D8DA 1TNBA 3DSSA 3WG7E 2XRZA 2XPYA 1U3CA 2IF4A 1E8WA 2UWJG 3T5XA 2P9NG 4HQDA 3UI2A 2AJAA 3VTXA 2CFZA 4EHMA 3QKYA 5G04J 1D8EA 5A23A 2P2CP 5JMND 1SVXA 4AY5A 3V79K 2CG3A 2GRLA 1WY6A 4UI9C 4K5AB 4LNBA 3AG2E 3D9OA 3ABME 4TXQA 3QK0A 3DEOA 1MHQA 1FVFA 4LSZE 3MV2B 4C48B 1NZNA 1OXJA 5AQ9A 2GRQB 2IFUA 4LCTA 3SO8A 4F7AA 1IHBA 1N52A 4ILIA 1TNOA 3GYZA 1E7VA 1RZ4A 2P9LG 3TXNA 3L9TA 2H6GA 2OEWA 4GU5A 5AAOA 3O4ZA 4CRWA 4JC8A 3HG0D 3IV0A 1N95A 5EKQD 4F53A 3IEGA 2PNNA 2C0LA 3P2BA 4I2WA 3FTWA 4BX8A 3S7DA 3T8KA 5BUZA 3FH8A 4YDWA 3TGOA 4HVBA 2ZGDA 4FADA 2Y0BG 4NURA 3B7SA 2ZIRA 4GCNA 3FU6A 4WAFA 3SD5A 3L82A 3ISMC 2WXKA 3APDA 3JXJA 5AJLA 1HO8A 4BTAA 2XGOA 4GTVA 3BUAA 3QDNA 3UKRG 3UPVA 1BLXB 1JWGA 3E34A 4APOA 4GYWA 4CDMA 1KLXA 3NQPA 2ZGGA 3VLEA 2UY1B 5BPPA 4XZ4A 5D66A 4MLPA 5CEAA 1TEZA 4DI4A 3K9IA 4OVUA 3RJVA 2XGMA 3HVEB 1DVPA 4A1GA 3UXGA 4WWOA 4YDEA 1L5JA 2AWIA 4U63A 4YNDA 2ETBA 3D9HA 4I1AA 5EN5D 4ABNA 1MX4A 1KT1A 2R59A 1WDYA 1DCEA 3CHPA 3TWUA 1N54A 5LP0A 3ZXPA 2FULA 4U04A 1MJ0A 1HS6A 2HR2A 1N4RA 4NQ0A 4HRMB 2PQNA 1TN6A 2XZDG 3AAAC 4G26A 1DCQA 2WMOA 4BY6A 1Y6IA 1QZ2A 2IOSA 5ENPD 3T9KA 2R05A 4F1SA 3CVVA 4GZCA 2QY7A 5KCMA 4G8LA 4I6GA 5FIOA 2H6FA 3TWVA 2I9CA 3JUIA 3FDHA 4FJYA 4XKBA 1UN8A 4K0RA 2VGXA 1H6OA 4F1PA 3LJNA 5LX8A 1INZA 3PDNA 4EECA 1K1BA 4K5BA 1UN9A 5JHBA 4AVXA 1SZAA 2RKKA 1LD7A 2MHKA 2A5UA 1HG2A 4UQZA 3S7JA 5AQAA 1N94A 4UWFA 4YDYA 2E0IA 4GYYA 2IO3C 3E4BA 3QOUA 3Q4AB 2DIWA 3D9IA 3GZSA 1HU3A 2FBNA 3E32A 4LNUD 3HXDA 5ARFA 2WM9A 4GTSA 2NYJA 4AV7A 4Q96A 2FEZA 4K03A 1BD8A 3D9NA 3Q7FA 5JA4D 5EIBE 3E30A 1IYGA 2YHCA 2WXLA 4ACKA 3D9JA 4KZ0A 3FU3A 4HBDA 5AQ7A 3DBSA 3EIQC 1KT0A 2R5SA 4DJAA 1S63A 2DZOA 3FH5A 1OCOE 3ZHEB 3LY7A 4GZ6A 2MRIA 3OTNA 2QZAA 1FPPA 2CHWA 3FTXA 4KXKB 4CDNA 3LVRE 3MKRA 3Q9UC 5ENSD 3SY2A 3GW4A 5J90A 2VGXB 2I6HA 2Y69E 3C98A 2VGYA 4U8HA 1PC2A 5FTPA 3EU9A 2E2EA 3W9FA 3AS8A 2UY1A 3IBEA 3L6AA 3CGHA 3VLDA 4XI0A 4FHKA 3LY9A 2IO2C 4J8FA 1HG5A 4B8AA 1YMPA 1LF8A 4JEUA 1TN8A 4FJZA 2C2LA 3DXKG 4FLHA 4CGVA 4I1MA 1N4PA 4UWLA 5KJLA 4N2QA 5ITZF 4M7CA 2NXPA 4DX1A 4JXTA 5CCMA 2F0YA 3CQCB 3D3MA 3NOGD 1S64A 4L23A 1LD8A 3ASFA 1N9AA 3DSVA 4G23A 2XHEA 5JJ6A 3EHRA 5M72A 2VYIA 3GZ1A 2OOEA 3SFZA 5FINA 3QAQA 5FZSA 3ZYKA 3PEUB 3P1UA 2WXOA 3FUIA 4AXHA 4JEHA 1XGWA 4U96D 4BTBA 3RKVA 3AU5A 4HXIA 3ONKA 4LRZA 2KBXA 4UQYA 2F8YA 3ZYLA 5CHEE 4URKA 3JCKC 4P29A 3SFXA 4OVVA 1KZOA 5LOZA 1N4QA 1QBQA 3CVPA 3ZPJA 3APCA 5AIJA 5C1DA 5HI7A 4DX6D 2AXVA 4BFRA 1MZCA 3EDTB 4EPZA 3UT8A 4QQIA 4AJWA 3ULYA 3EHQA 4UWHA 4V3IA 1IQRA 4EBAG 3E33A 1JWFA 3W9GA 3FHEA 4Y6CA 2LSUA 3ASDA 5H7PA 3ASGA 4RQIA 3D9PA 4C0EA 3MGBA 3TWQA 3NB2A 2CHZA 4GMRA 3L22A 4YDOA 4DX2A 4GZ5A 5G05J 1E8ZA 4PDXA 1Z3YA 3ZEFA 2EIME 1WG0A 5FQ8A 3PUJA 3TWWA 3R7QA 5EX0A 3KSLA 1V54E 3CKBA 2WMNA 3HXBA 4H7YA 5CBNA 3FFLA 2P9SG 4N39A 2QC9A 2WXNA 5AENA 1NA0A 4GZ3A 4L1BA 5EILA 3IHVA 3IKOB 4E85A 4F6RD 4BESA 4ANWA 2V5FA 3FU5A 4U0ZA 2V4LA 4J6IA 3PZ4A 3G2UA 2OVFA 1SA4A 3Q7AA 5KJMA 1QYMA 2AXUA 4OAUC 4ILHB 4MBGA 3NOCD 4N3CA 3FTYA 3I5PA 4JHRA 4U8YD 4A1SA 3PH0C 4EZLA 2B6CA 4NIKA 3I4GA 3DWLG 3CHMA 3C3RA 4XX5A 5EYPF 3CVYA 2J49A 3LCAA 3TG5A 2DWZA 2GRMA 3NAWA 3B13A 4ANVA 1EF1C 2X3MA 3L54A 1YCSB 5EDSA 5B3SE 5FT9A 3C3QA 3FUEA 1H2TC 1TJCA 4GTTA 2ZXWE 1UW4B 3DSUA 3L16A 4GAAA 5FZQA 4HS2A 5KJNA 1NFIE 2LO6A 3N71A 1U3DA 1TNZA 3NBNB 1HX8A 2OEVA 2DZNA 4WNDA 4AP2A 2I1JA 3FUNA 2KZTA 2J09A 2EIKE 1OWNA 2GRRB 4HOQA 3AJIA 3RRMB 3TWSA 3CSFA 3TWRA 4GMLA 5BXUA 3TJPA 1FT1A 3ONLA 4WWNA 2XPZA 2KM4A 4BWRA 4G25A 3S2AA 5G55A 2AW6A 3S7BA 1JCSA 2A4ZA 2H6HA 5ENNA 2VSNA 4J8EA 4DX7D 3MX3A 2VGEA 2GRNB 4HLEA 3ABKE 5CCLA 1W3BA 4TUMA 5CRVA 3Q5MA 5CERB 2J08A 3DSTA 2I1KA 3ZVVA 4UUCA 2Y1LE 2VQ2A 3BU8A 5KJKA 4DLQA 3Q73A 2GRPB 4JA7A 4ATZD 1O1SA 4AEZC 2HE0A 3CK8A 4G1TA 2WXMA 5T4YA 2J07A 4LEUA 2GW1A 3Q79A 3RO3A 1A5EA 5KNGA 3QC1A 2KCVA 4J8SA 2KXPC 1OWOA 2FO7A 3FULA 3OAWA 5ENQD 4Q94A 1MX2A 3C5RA 4Q69A 3D9MA 2LSVA 5CMWA 3L17A 3O48A 3ABLE 1E8YA 2ILRA 3DSWA 2FI7A 3ZN3A 1O5MA 2BEDA 2LNIA 3R9MA 4UQXA 2DYSE 1WAO1 3PE4A 3JQ0A 4I43A 4EQFA 3LEWA 4ANUA 4DRXE 5ENTD 3QARA 2Y3AA 3DSXA 4A3TA 3JUEA 3AS4A 3ML9A 2P9PG 1H19A 2L0TB 2EQXA 1X5BA 1SW6A 4U0UA 3AG4E 2Q7FA 2L0IA 2YQ8A 3ASHA 4ANXA 2IONA 4CYMD 1FT2A 3ZNGA 4RLYA 2F37A 3CR3A 5EYLA 5JJTA 2RD0A 3QWWA 4XKCA 4GPKA 2FO1E 2JLBA 4MRUA 3LDZA 2F8XK 3PZ2A 5LCWJ 4I2ZA 1TJFA 2VSYA 2AVPA 4G2VA 2PZIA 1JCQA 4HOSA 3OXLA 3UIOC 3ZUVB 3UM3A 5JHAA 2XPIA 3RSEG 4KMOA 3CLJA 4YVQC 3TXMA 1U2VG 2X6KA 3CK9A 3UX4A 4L2LA 2KATA 5AARA 3Q49B 3HYMB 5AQBA 2OVBA 5ENRD 4GYOA 4FULA 1K3ZD 4GA0A 1FCHA 2WPVA 4CCAA 1BI7B 3SNXA 3FTZA 3MEKA 1DNPA 3F6QA 4NACA 2WXHA 1D9SA 1NI1A 2C0MA 4PH4B 4NRHB 3NZUA 2XCBA 4RSYA 3HXFA 3T8MA 3PE3A 4ME2A 1UJJA 3AG1E 3SBSA 2MYOA 1OCCE 3ML8A 3HXEA 3QNKA
chains in the Genus database with same CATH topology
1HF8A 2DCPA 4PS7A 2YINA 3GYZA 1E7VA 3AS5A 4C0EA 3TXNA 3FH7A 4O6FA 2R17C 3I4RB 3MGBA 3LKUA 2NC9A 4GU5A 2ONDA 4WUYA 4ACLA 5LCWC 3O4ZA 4CRWA 2AXZA 2CHZA 4JC8A 1P5QA 3ENEA 4PS8A 3IV0A 3L22A 3ZFWA 4XIFA 5EKQD 4UWKA 4GB9A 4F53A 5EX3A 4AY6A 4GZ5A 2WXRA 5G05J 1E8ZA 3FUJA 1IHGA 4PDXA 2XCCA 3IEGA 5HQ8A 3PVLA 1UJKA 1Z3YA 2HYZA 3ZEFA 2C0LA 3P2BA 2WXFA 4B0ZA 1OWLA 3LS8A 4EBAA 5FQ8A 4I2WA 3PUJA 3FTWA 4BX8A 3S7DA 4UI9K 3SBTB 1HZ4A 1Z3XA 4JZYA 5BUZA 3R7QA 3FH8A 5EX0A 3HHMA 3TGOA 4B89A 4HVBA 2NSZA 3CKBA 3FUHA 2WMNA 4H7YA 3FFLA 1JPLA 3DPDA 3FP3A 4JL0A 4N39A 3R9AB 3PS6A 4N5CA 2DBAA 4FADA 2KCLA 4UWGA 2WXNA 3RO2A 3RU0A 2IOLA 3UT7A 5AENA 1NA0A 4KVOA 4NURA 3B7SA 3CQGB 2M63A 4GCNA 1JUQA 2X38A 4HFGA 3BG1B 3EIJA 2KCKA 3FU6A 4GZ3A 4QFVA 2PM6A 5FQ6A 4B8CB 5J08A 4WAFA 4L1BA 3SD5A 4C9BB 4GZDA 3ULQA 3IHVA 5AJDA 2WXKA 3APDA 3PNLB 3IKOB 4GCOA 4E85A 5AJLA 2X6IA 1HO8A 4BTAA 1EDUA 1OUVA 4ANWA 2V5FA 1QQEA 2XGOA 3LXUX 3FU5A 3QDNA 4U0ZA 1EYHA 3S7FA 2V4LA 5JJ7A 3UPVA 4G24A 4J6IA 1JWGA 2VTBA 4KYOB 3VTYA 3G2UA 2OVFA 4TV3A 3G2SA 4GA2A 5C2YA 3CVXA 4APOA 1PAQA 5KJMA 4OYSA 2WXIA 4A55A 1WM5A 4GYWA 4RG9A 3IHYA 4CDMA 1KLXA 4N2SA 2CHXA 1E8XA 2AXUA 3NQPA 4JHJA 3RIBA 3VLEA 2CFUA 3FTSA 2HM8A 4ILHB 4D10C 2X6FA 2UY1B 5BPPA 4DK5A 4N3CA 4XZ4A 4MLPA 1TEZA 3FTYA 3I5PA 4JHRA 3FU0A 3CHRA 4A1SA 4DI4A 3U9WA 3K9IA 3PH0C 5FZRA 4EZLA 3I4GA 1HFAA 4OVUA 4HOTA 3RJVA 2XGMA 3CHMA 1HXIA 3HVEB 4XX5A 1DVPA 3ZYQA 1NP7A 4A1GA 1QNFA 4DLOA 2WQ7A 3CVYA 4WWOA 2MOWA 1L5JA 4JPSA 2AWIA 4U63A 4UI9J 2ZU6B 5A7DB 4CEMA 4L7TA 4YNDA 2J49A 3OXFA 4I1AA 4ABNA 3QB2A 3QWPA 3TAXA 3VLFA 3LCAA 3BEEA 3TG5A 3U3WA 2GRMA 3L08A 4ILGA 1KT1A 2JEKA 3B13A 5ANRA 2WXJA 4ANVA 1EF1C 5A6CA 2X3MA 1H0AA 3L54A 2R59A 1ELKA 1XNFA 3JYSA 5EDSA 5FT9A 3CHPA 1N54A 4I9EA 2OV8A 5LP0A 1H2VC 3FUEA 1H2TC 2FULA 1TJCA 4U04A 4XE0A 1HS6A 2HR2A 1UW4B 3CVWA 3L16A 4I9CA 4GAAA 4NQ0A 5FZQA 3B7RL 3CV0A 2WQ6A 3TL5A 4FA6A 1Z6TA 4PUCA 4APFA 4HS2A 2J4BA 3ZXSA 4BT8A 2PQNA 4I17A 4DI3A 5KJNA 2LO6A 3N71A 5DBKA 4CT4A 1U3DA 3KS2A 1ELRA 2KZTB 1GW6A 4G26A 4GPKA 2I2OA 1HX8A 2WMOA 3FTUA 3UMVA 4BY6A 3U64A 1Y6IA 1QZ2A 4WNDA 2CG2A 4AP2A 2I1JA 2IOSA 4G11A 3FUNA 2KZTA 2WXPA 2J09A 1ZU2A 4F1SA 2J9QA 2PQRA 4GZCA 3CVVA 2BUGA 4B94A 2QY7A 5KCMA 3ZRHA 4I6GA 5CMYA 4PS3A 3Q47B 2VTBB 1OWNA 1ELWA 3CK7A 3EHMA 4HOQA 3SGHA 2V0PA 2WQHA 3RRMB 2I9CA 3ZGQA 2X6JA 2XGSA 3JUIA 4ATGA 3CSFA 4MKTA 3FDHA 4FJYA 4GMLA 4XKBA 1UN8A 4K0RA 5D0QD 3FUFA 1IQUA 2VGXA 3TJPA 3FEXA 4AM9A 3ONLA 4WWNA 3FTVA 2XPZA 2Y4UA 5LX8A 1INZA 2KM4A 4BWRA 3CVLA 3PDNA 4G25A 3S2AA 2QFCA 3U4TA 5FQ7A 4FP7A 5G55A 4EECA 3MV3B 1UN9A 4CGWA 4AVXA 2AW6A 5JHBA 3S7BA 4GA1A 3MYVA 1SZAA 2A4ZA 4TRQA 4I6EA 5ENNA 2MHKA 2A5UA 1HG2A 1NA3A 3HIZA 4KBQA 4UQZA 3S7JA 2VSNA 4J8EA 3D9KA 3LVQE 4BX9A 4UWFA 3MX3A 3PUKA 2E0IA 3WXXA 5BW8C 4HLEA 5CCLA 4GYYA 1SQMA 3E4BA 3QOUA 3Q4AB 4CT0A 2DIWA 3NZSA 3D9IA 4XI9A 1W3BA 4MS6A 5ANLA 3GZSA 1HU3A 2FBNA 3Q5MA 4W9RA 5FQ4A 2L9BA 3B7UX 2J08A 5ARFA 2I1KA 3ZVVA 2V8SE 2WM9A 4AV7A 3FY4A 3FWVA 4Q96A 3RK6A 3KAEA 2FEZA 2LAIA 4K03A 5LFAA 2VQ2A 3D9NA 3SF4A 3SZ7A 2HO1A 1IYGA 3HDXA 2YHCA 3UT4A 5KJKA 4FC8A 2WXLA 3CIAA 3CHQA 4DLQA 4ACKA 1PY1A 3D9JA 4JA7A 2X6HA 4KZ0A 3FU3A 5ARGA 1H2UA 1E90A 3DBSA 4WWPA 4EZJA 1S0PA 3QWVA 3ZYMA 4AEZC 3CK8A 4G1TA 3ZHEA 2WXMA 5T4YA 3R7RA 3EIQC 3LPZA 3MKQB 2J07A 4LEUA 2GW1A 1KT0A 1UG3A 4YVOA 2R5SA 4DJAA 3RO3A 3AU4A 1OWMA 3CHSA 3FH5A 2FF4A 4DPRA 4TUUA 2WVIA 3ZHEB 3LY7A 4WNGA 4IRUA 3CKCA 4GZ6A 2MRIA 4U07A 3PREA 2WB2A 2Y4TA 3OTNA 3OXGA 2KCVA 3CHOA 3QC1A 4J8SA 2BTDA 3MA5A 2WXGA 1OWOA 2CHWA 1HE8A 4L2YA 1VDYA 3SHFA 3KD7A 3JQ1A 2FO7A 3FULA 3FTXA 3OAWA 4KXKB 4CDNA 2J4DA 1MQSA 4Q94A 4Q69A 3LVRE 3MKRA 3D9MA 2LSVA 3TG4A 5BNWA 1HH8A 3GW4A 5D0OD 5CMWA 5J90A 4IULA 2VGXB 2I6HA 3MZLB 3L17A 3C98A 5FJYA 3O48A 2VGYA 3B7TA 4U8HA 1PC2A 5FTPA 4AOFA 1E8YA 2ILRA 3PRZA 4JVSA 2E2EA 1YA0A 2FI7A 3ZIMA 4E6HA 4KVMA 5E75A 3ZN3A 5G04C 3AS8A 2UY1A 5BV0A 2P58C 3IBEA 4BSXA 3CEQA 3L6AA 1BPOA 3CGHA 3VLDA 2LNIA 5G2NA 3FUDA 4XI0A 3URZA 4FHKA 3LY9A 5DIZA 5FWQA 3FUKA 4UQXA 4I6JA 4J8FA 2L6JA 1HG5A 4IYPA 2LAHA 4B8AA 4J0UA 1WAO1 1H6KA 3PZDA 1OWPA 3JQ0A 3PE4A 4I43A 4A3VA 1B89A 1SZ9A 3GZ2A 4EQFA 5E76A 5AYWD 5BV1A 3EJNA 3LEWA 3MJWA 3LYAA 1LF8A 4HOUA 4ANUA 3D9LA 2XQ0A 3QARA 2PL2A 4JEUA 4BT9A 1E96B 4FJZA 2C2LA 2IQCA 2YHEA 4FLHA 4CGVA 3FUMA 1ZBPA 4I1MA 4UWLA 4FU3A 5KJLA 2VJ8A 2Y3AA 4M3OA 4N2QA 3LY8A 5T8IA 2NXPA 4WNFA 3MKQA 3RRNB 4A3TA 3AS4A 4JXTA 3ML9A 3G2VA 5CCMA 4EZKA 2WXQA 1H19A 3CVNA 2L0TB 2EQXA 1X5BA 3CVUA 3G2WA 2VSOE 4U0UA 2Q7FA 3CSTA 3CQCB 2L0IA 2YQ8A 3U66A 3ASHA 3D3MA 4R7LA 4ANXA 4HORA 2VSXE 3SI5A 2IONA 4L23A 1Y8MA 3ASFA 2BF0X 3CVQA 4JA9A 3EHNA 4KT6B 4G23A 3I3NA 3PEVB 4F3VA 4JHKA 4LUNU 3CR3A 4I1OB 4CDRA 2PM7A 2XHEA 3ZW3A 5JJ6A 4FLBA 1EPUA 4KZCA 5JJTA 5M72A 2RD0A 2VYIA 3GZ1A 3QWWA 4XKCA 2OOEA 2YNQA 2XRZA 3SFZA 2XPYA 1U3CA 3QAQA 2IF4A 1FVHA 2JLBA 1E8WA 3BG0B 4MRUA 5FZSA 3ZYKA 3LDZA 3G2TA 4GMJA 2UWJG 2IU1A 3T5XA 3PEUB 3P1UA 4H7XA 5LCWJ 2WXOA 4I2ZA 3FUIA 1TJFA 4RG6A 4JEHA 4AXHA 2VSYA 2AVPA 4G2VA 1XGWA 2PZIA 3VTXA 2XRYA 3T5VA 2CFZA 4BTBA 4HOSA 3OXLA 3QKYA 3RKVA 3AU5A 3KEZA 5G04J 4N3BA 5A23A 4HXIA 5JHAA 2XPIA 3ONKA 3CLJA 4KMOA 4LRZA 4YVQC 3NF1A 3QJZA 4UQYA 3TXMA 3UUXA 4AY5A 3ZYLA 2CG3A 4AIFA 4JW1A 2GRLA 2X6KA 3CK9A 2RG8A 4RVBA 1WY6A 5CHEE 3UX4A 4URKA 3ESLA 3JCKC 4L2LA 4UI9C 3HVEA 4P29A 3RRUA 2KATA 3Q49B 3HYMB 3D9OA 3APFA 4LERA 4OVVA 3QK0A 2OVBA 5LOZA 4GYOA 4FHJA 4FULA 4U0SA 3PNTB 1E7UA 3CVPA 4N3AA 3ZPJA 3APCA 4GA0A 1MHQA 5AIJA 1FCHA 2WPVA 4CCAA 5C1DA 5HI7A 3MCXA 3SNXA 1FVFA 3ESKA 2GGFA 5G05C 3FTZA 2AXVA 3UQ3A 3MV2B 3MEKA 1DNPA 4BFRA 5BT1A 3EDTB 4NACA 4J8DA 4EPZA 2WXHA 2KC7A 1NZNA 3UT8A 4WNEA 2IJGX 4AJWA 4PH4B 2C0MA 3FEYA 2IFUA 3NZUA 4NRHB 4C0MA 4Y6WA 4LCTA 2XCBA 1A17A 4RSYA 4UWHA 4IN3B 4V3IA 4F7AA 3T8MA 1IQRA 4EBAG 3PE3A 4ME2A 2XEVA 1UJJA 1JWFA 3Q15A 3FHEA 3SBSA 4Y6CA 3L13A 3LJ3A 1N52A 3ML8A 2LSUA 5T3RA 3ASDA 4ILIA 3ASGA 3QNKA 3D9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XI9 A;  1W3B A;  3GYZ A;  3AS5 A;  4HOT A;  3AS4 A;  3RJV A;  2XGM A;  2FBN A;  1HXI A;  5CCM A;  4O6F A;  3Q5M A;  3CVN A;  4W9R A;  4UI9 J;  4U0U A;  3LKU A;  2Q7F A;  5A7D B;  4YND A;  2NC9 A;  5ARF A;  2YQ8 A;  2OND A;  3OXF A;  3ASH A;  4WUY A;  3FWV A;  4I1A A;  5LCW C;  4ABN A;  4HOR A;  3KAE A;  2FEZ A;  3QWP A;  3TAX A;  3LCA A;  3BEE A;  3TG5 A;  3U3W A;  1Y8M A;  3ASF A;  1P5Q A;  2VQ2 A;  1KT1 A;  3CVQ A;  4JA9 A;  3SF4 A;  4G23 A;  3ZFW A;  4F3V A;  3SZ7 A;  5A6C A;  2HO1 A;  4XIF A;  5EKQ D;  2YHC A;  4CDR A;  1IYG A;  5KJK A;  5EX3 A;  1XNF A;  3JYS A;  4AY6 A;  5JJ6 A;  4GZ5 A;  5FT9 A;  4JA7 A;  5G05 J;  4I9E A;  5JJT A;  1IHG A;  2XCC A;  3IEG A;  5ARG A;  5HQ8 A;  5M72 A;  2VYI A;  3GZ1 A;  2HYZ A;  3QWW A;  2C0L A;  2OOE A;  1TJC A;  3QWV A;  4U04 A;  2IF4 A;  2JLB A;  4GPK A;  3CK8 A;  2HR2 A;  4G1T A;  5FZS A;  4I9C A;  4I2W A;  3ZHE A;  3TGO A;  3LPZ A;  2UWJ G;  4LEU A;  4NQ0 A;  4UI9 K;  5FZQ A;  3S7D A;  3CV0 A;  1HZ4 A;  1KT0 A;  2GW1 A;  4H7X A;  4I2Z A;  4RG6 A;  4YVO A;  5LCW J;  2R5S A;  2VSY A;  2AVP A;  4G2V A;  3RO3 A;  2PZI A;  3VTX A;  2FF4 A;  5EX0 A;  4BT8 A;  2PQN A;  4I17 A;  4BTB A;  3OXL A;  3LY7 A;  4WNG A;  3ZHE B;  3QKY A;  3RKV A;  3CKC A;  3CKB A;  3N71 A;  4GZ6 A;  5DBK A;  5G04 J;  4N3B A;  4U07 A;  4H7Y A;  3KS2 A;  2Y4T A;  3OXG A;  2KCV A;  3FFL A;  1ELR A;  5FZR A;  2XPI A;  3FP3 A;  3MA5 A;  4G26 A;  4JL0 A;  4N39 A;  3R9A B;  4YVQ C;  3NF1 A;  4UQY A;  4N5C A;  2DBA A;  2KCL A;  3KD7 A;  3UUX A;  2FO7 A;  3RO2 A;  3RU0 A;  4AY5 A;  5BT1 A;  1QZ2 A;  4KXK B;  4WND A;  1NA0 A;  4HOS A;  4AIF A;  4WNF A;  3CK9 A;  3MKR A;  2LSV A;  3TG4 A;  4GCN A;  1HH8 A;  3GW4 A;  5D0O D;  5CHE E;  5BNW A;  1ZU2 A;  2KCK A;  2J9Q A;  2PQR A;  2VGX B;  2I6H A;  2BUG A;  4GZ3 A;  4UI9 C;  4B94 A;  5FJY A;  3O48 A;  2KAT A;  2VGY A;  3ULQ A;  3Q49 B;  1PC2 A;  3HYM B;  1ELW A;  3CK7 A;  3Q47 B;  4HOQ A;  5FTP A;  4GCO A;  2WQH A;  2E2E A;  1YA0 A;  2FI7 A;  4BTA A;  4GYO A;  1OUV A;  5G04 C;  4U0S A;  3ZN3 A;  3ZGQ A;  2V5F A;  2XGS A;  1QQE A;  2XGO A;  3AS8 A;  3CVP A;  4N3A A;  2UY1 A;  4GA0 A;  5D0Q D;  2P58 C;  1FCH A;  2WPV A;  3ZPJ A;  4EQF A;  3QDN A;  5HI7 A;  5C1D A;  2VGX A;  3CEQ A;  4U0Z A;  3S7F A;  3ESK A;  5JJ7 A;  5G05 C;  3UPV A;  4G24 A;  4AM9 A;  3QOU A;  2LNI A;  3UQ3 A;  4XI0 A;  3MV2 B;  3URZ A;  3MEK A;  2Y4U A;  3LY9 A;  4KYO B;  5DIZ A;  3CVL A;  3PDN A;  4G25 A;  3EDT B;  2QFC A;  3U4T A;  3VTY A;  4BWR A;  4UQX A;  4J8D A;  4J8F A;  4GA2 A;  2L6J A;  2KC7 A;  1NZN A;  3MV3 B;  4J0U A;  1WAO 1;  4CGW A;  4APO A;  4WNE A;  5KJM A;  3S7B A;  2C0M A;  3PE4 A;  2IFU A;  4NRH B;  1B89 A;  4GA1 A;  3GZ2 A;  4Y6W A;  1WM5 A;  4GYW A;  4RG9 A;  5AYW D;  2XCB A;  1KLX A;  4N2S A;  1A17 A;  3LYA A;  4HOU A;  3RIB A;  4IN3 B;  2MHK A;  1NA3 A;  4KBQ A;  2PL2 A;  4UQZ A;  3S7J A;  1E96 B;  2UY1 B;  2C2L A;  4BT9 A;  4CGV A;  2VSN A;  3PE3 A;  4J8E A;  4ME2 A;  2XEV A;  1ZBP A;  4N3C A;  5KJL A;  5KJN A;  3Q15 A;  4JHR A;  4Y6C A;  3WXX A;  5BW8 C;  4N2Q A;  5CCL A;  2LSU A;  4GYY A;  3LY8 A;  4A1S A;  3ASD A;  3E4B A;  3K9I A;  3ASG A;  3Q4A B; 
#chains in the Genus database with same CATH topology
 3AS5 A;  3FH7 A;  4O6F A;  2R17 C;  3LKU A;  2OND A;  4ACL A;  4K5C A;  2AXZ A;  1IXV A;  1P5Q A;  4PS8 A;  4CZ2 D;  4G8K A;  2DYR E;  4XIF A;  4UWK A;  1X81 A;  2WXR A;  1IHG A;  2XCC A;  1ZB1 A;  1UJK A;  2IY0 C;  4HNA D;  3LS8 A;  4UI9 K;  3SBT B;  2XS8 A;  2NSZ A;  3FUH A;  1JPL A;  3DPD A;  4JL0 A;  4UWG A;  3RO2 A;  3RU0 A;  3UT7 A;  4GTM A;  4LNG A;  1AWC B;  4KVO A;  4HFG A;  3BG1 B;  2PM6 A;  4GZD A;  3ULQ A;  5AJD A;  3PNL B;  4U95 D;  4GCO A;  2X6I A;  1EDU A;  4G24 A;  2JAB A;  4KYO B;  2BKG A;  3G2S A;  5C2Y A;  5B1A E;  3CVX A;  3UM1 A;  4OYS A;  2WXI A;  4RG9 A;  4N2S A;  2CHX A;  4JHJ A;  3RIB A;  2X6F A;  2RFA A;  4ZHB A;  4HB5 A;  3FU0 A;  5FZR A;  1NP7 A;  2WQ7 A;  2MOW A;  5EID A;  5A7D B;  3B95 A;  4L7T A;  4CEM A;  1KPS B;  3E37 A;  3BEE A;  3U3W A;  4GTO A;  2JEK A;  1H0A A;  3EUV A;  4I9E A;  3V2X A;  2H6I A;  1H2V C;  1N4S A;  3HXC A;  4XE0 A;  3CVW A;  3CV0 A;  3TL5 A;  4FA6 A;  4PUC A;  4BT8 A;  4I17 A;  4DI3 A;  5DBK A;  4CT4 A;  3AG3 E;  3KS2 A;  1ELR A;  1GW6 A;  1OT8 A;  1JCR A;  3UMV A;  4G11 A;  4XEI G;  2WXP A;  1ZU2 A;  2J9Q A;  3DPY A;  3J5Q B;  5CMY A;  1ELW A;  5ENO D;  2WQH A;  1Q2Z A;  3ZGQ A;  2XGS A;  5D0Q D;  1IQU A;  3FTV A;  2Y4U A;  2QFC A;  4FP7 A;  3MV3 B;  1G3N B;  4CGW A;  4GA1 A;  1K8K G;  2V4H C;  3MYV A;  4TRQ A;  4I6E A;  1OCZ E;  1NA3 A;  3HIZ A;  3LVQ E;  4BX9 A;  4XI9 A;  2EIL E;  4W9R A;  2L9B A;  2R03 A;  2V8S E;  3FY4 A;  3FWV A;  5D2M C;  3RK6 A;  3KAE A;  2LAI A;  2A5E A;  2HO1 A;  4J7W A;  2QYU A;  4FC8 A;  3CIA A;  1PY1 A;  2X6H A;  4HI9 A;  1H2U A;  4WWP A;  4EZJ A;  3ZYM A;  3QWV A;  3TWX A;  3ZHE A;  4YVO A;  2ETC A;  2P9U G;  3AU4 A;  1OWM A;  5CED B;  1BI8 B;  4TUU A;  4IRU A;  3CKC A;  2WB2 A;  2Y4T A;  3CHO A;  2L6B A;  2BTD A;  3MA5 A;  1VDY A;  3JQ1 A;  3SFY A;  1MQS A;  5BNW A;  1SA5 A;  4IUL A;  3MZL B;  5FJY A;  3B7T A;  4GTR A;  2R2L A;  5G04 C;  2XEH A;  2P58 C;  4BSX A;  3FUD A;  2EIN E;  3URZ A;  5DIZ A;  3ASN E;  3DRA A;  4IYP A;  2LAH A;  4J0U A;  1H6K A;  3PZD A;  1OWP A;  4A3V A;  5E76 A;  5BV1 A;  3MJW A;  3LYA A;  4DUI A;  2XQ0 A;  3Q9N C;  1E96 B;  2YHE A;  3FUM A;  1V55 E;  1ZBP A;  4FU3 A;  3UIN C;  4M3O A;  3LY8 A;  4BSZ B;  1LTX A;  4WNF A;  5HS0 A;  3G2V A;  3CVU A;  3X2Q E;  2VSO E;  3U66 A;  3DXM G;  1OY3 D;  4R7L A;  3SI5 A;  1Y8M A;  2BF0 X;  1KZP A;  3CVQ A;  4KT6 B;  3UKU G;  4F3V A;  4I1O B;  4CDR A;  2PM7 A;  4FLB A;  5IY5 E;  1EPU A;  4KZC A;  2YNQ A;  1FVH A;  3BG0 B;  5BXO A;  4GMJ A;  3G2T A;  4A63 B;  5KBA A;  2IU1 A;  4H7X A;  4RG6 A;  3T5V A;  2XRY A;  3KEZ A;  4N3B A;  4HRN A;  2P9K G;  3NF1 A;  3QJZ A;  4O60 A;  3UUX A;  3C72 A;  3V31 A;  4AIF A;  4JW1 A;  2RG8 A;  4RVB A;  4Z68 A;  3ESL A;  3B7B A;  3HVE A;  3RRU A;  3APF A;  4LER A;  1N0R A;  4FHJ A;  4U0S A;  3PNT B;  1E7U A;  4JD2 G;  4N3A A;  3MCX A;  3ESK A;  2GGF A;  4L9P A;  5G05 C;  5HRY A;  3UQ3 A;  5BT1 A;  1TNY A;  1N0Q A;  4J8D A;  2KC7 A;  1N11 A;  4WNE A;  2IJG X;  2R02 A;  3FEY A;  4C0M A;  2XZT G;  4Y6W A;  1A17 A;  4IN3 B;  4OAV B;  2XEV A;  3IXE A;  3Q75 A;  3Q15 A;  3HRA A;  3L13 A;  3LJ3 A;  5T3R A;  1HF8 A;  2DCP A;  4PS7 A;  2YIN A;  3I4R B;  2NC9 A;  4WUY A;  5LCW C;  2XEE A;  5KWD A;  4TXR A;  3ENE A;  3ZFW A;  2P9I G;  3V2O A;  4GB9 A;  4HI8 A;  5EX3 A;  4AY6 A;  1YYH A;  3FUJ A;  5HQ8 A;  3PVL A;  2LXL A;  2HYZ A;  1MYO A;  2WXF A;  4B0Z A;  1OWL A;  4EBA A;  1OCR E;  1H6P A;  1HZ4 A;  1Z3X A;  4JZY A;  3HHM A;  4B89 A;  4X8Q A;  1TR4 A;  4BEP A;  3FP3 A;  3R9A B;  3PS6 A;  2QYJ A;  4N5C A;  2DBA A;  2KCL A;  3UM0 A;  2IOL A;  3CQG B;  2M63 A;  4JB8 P;  1JUQ A;  2X38 A;  3EIJ A;  5FQ6 A;  2KCK A;  4QFV A;  4B8C B;  5J08 A;  2RFM A;  4C9B B;  5CEC B;  4DX5 D;  4TXP A;  5AN8 A;  2B0O E;  1OUV A;  1QQE A;  3LXU X;  1EYH A;  3S7F A;  5JJ7 A;  2V5Q C;  2VTB A;  3VTY A;  4TV3 A;  2LXM A;  4GA2 A;  1PAQ A;  4A55 A;  1WM5 A;  3IHY A;  1E8X A;  2CFU A;  3FTS A;  2HM8 A;  4D10 C;  1O1R A;  4HRL A;  3TWT A;  4DK5 A;  1IKN D;  3Q78 A;  3CHR A;  3U9W A;  1HFA A;  4HOT A;  5HKP A;  1HXI A;  3C3O A;  3ZYQ A;  4DLO A;  1QNF A;  3UIP C;  4JPS A;  4UI9 J;  2ZU6 B;  5CBO A;  3EU5 A;  3OXF A;  2ETA A;  3ULE G;  3QB2 A;  3QWP A;  3TAX A;  3VLF A;  3PZ3 A;  3L08 A;  4ILG A;  1AP7 A;  5ANR A;  2WXJ A;  5A6C A;  1ELK A;  1XNF A;  3JYS A;  2OV8 A;  4U8V D;  2ZIS A;  3DEP A;  4I9C A;  3B7R L;  2WQ6 A;  4O1P A;  1Z6T A;  4APF A;  2XEN A;  2J4B A;  1K1A A;  3ZXS A;  4O1O A;  3JXI A;  2KZT B;  2GRO B;  3V30 A;  2I2O A;  3FTU A;  3U64 A;  2CG2 A;  2PQR A;  2BUG A;  4B94 A;  3ZRH A;  4PS3 A;  4J8Y A;  4BER A;  3Q47 B;  2VTB B;  3CK7 A;  3EHM A;  1BU9 A;  3SGH A;  2V0P A;  2X6J A;  5KNH D;  4ATG A;  4MKT A;  4GPM A;  3FUF A;  3FEX A;  4AM9 A;  3CVL A;  3U4T A;  5FQ7 A;  4HLL A;  4KBQ A;  3ASO E;  3D9K A;  4ZFH A;  3PUK A;  1RW2 A;  3WXX A;  5BW8 C;  1SQM A;  4CT0 A;  3NZS A;  4MS6 A;  5ANL A;  2XS1 A;  5FQ4 A;  3UM2 A;  3B7U X;  2J8S D;  1MX6 A;  5LFA A;  1Z5S C;  3PZ1 A;  3ZKJ A;  3SF4 A;  3SZ7 A;  3KSQ A;  3HDX A;  3UT4 A;  1O1T A;  4B93 B;  3CHQ A;  3ZU7 B;  5ARG A;  2IEJ A;  1E90 A;  1S0P A;  2LUH A;  3R7R A;  3LPZ A;  3MKQ B;  3UTM A;  1UG3 A;  4N5Q A;  3CHS A;  2FF4 A;  4DPR A;  2WVI A;  4WNG A;  4U07 A;  3PRE A;  3OXG A;  4GTP A;  2WXG A;  1HE8 A;  4L2Y A;  3KEA A;  3SHF A;  3KD7 A;  2J4D A;  3TG4 A;  1HH8 A;  5D0O D;  2OCC E;  5CRU A;  4U7E B;  1S70 B;  4AOF A;  3PRZ A;  4JVS A;  1YA0 A;  3ZIM A;  4E6H A;  4KVM A;  1DC2 A;  5E75 A;  5BV0 A;  4LG6 A;  3CEQ A;  1BPO A;  1TNU A;  5G2N A;  2EIJ E;  5FWQ A;  3FUK A;  4I6J A;  2L6J A;  4BET A;  1B89 A;  1SZ9 A;  3GZ2 A;  5AYW D;  3EJN A;  4HOU A;  3D9L A;  2PL2 A;  4BT9 A;  2IQC A;  1TYQ G;  2VJ8 A;  2DVW A;  5T8I A;  3MKQ A;  3RRN B;  1TN7 A;  3SQV A;  4GTQ A;  4EZK A;  2WXQ A;  3CVN A;  3G2W A;  3CST A;  5B1B E;  3J5P A;  1NL4 A;  4HOR A;  2VSX E;  3RAU A;  4JA9 A;  3EHN A;  3I3N A;  3PEV B;  4JHK A;  4LUN U;  3ZW3 A;  3BQO A;  2BKK B;  1UOH A;  1D8D A;  1TNB A;  3DSS A;  3WG7 E;  2XRZ A;  2XPY A;  1U3C A;  2IF4 A;  1E8W A;  2UWJ G;  3T5X A;  2P9N G;  4HQD A;  3UI2 A;  2AJA A;  3VTX A;  2CFZ A;  4EHM A;  3QKY A;  5G04 J;  1D8E A;  5A23 A;  2P2C P;  5JMN D;  1SVX A;  4AY5 A;  3V79 K;  2CG3 A;  2GRL A;  1WY6 A;  4UI9 C;  4K5A B;  4LNB A;  3AG2 E;  3D9O A;  3ABM E;  4TXQ A;  3QK0 A;  3DEO A;  1MHQ A;  1FVF A;  4LSZ E;  3MV2 B;  4C48 B;  1NZN A;  1OXJ A;  5AQ9 A;  2GRQ B;  2IFU A;  4LCT A;  3SO8 A;  4F7A A;  1IHB A;  1N52 A;  4ILI A;  1TNO A;  3GYZ A;  1E7V A;  1RZ4 A;  2P9L G;  3TXN A;  3L9T A;  2H6G A;  2OEW A;  4GU5 A;  5AAO A;  3O4Z A;  4CRW A;  4JC8 A;  3HG0 D;  3IV0 A;  1N95 A;  5EKQ D;  4F53 A;  3IEG A;  2PNN A;  2C0L A;  3P2B A;  4I2W A;  3FTW A;  4BX8 A;  3S7D A;  3T8K A;  5BUZ A;  3FH8 A;  4YDW A;  3TGO A;  4HVB A;  2ZGD A;  4FAD A;  2Y0B G;  4NUR A;  3B7S A;  2ZIR A;  4GCN A;  3FU6 A;  4WAF A;  3SD5 A;  3L82 A;  3ISM C;  2WXK A;  3APD A;  3JXJ A;  5AJL A;  1HO8 A;  4BTA A;  2XGO A;  4GTV A;  3BUA A;  3QDN A;  3UKR G;  3UPV A;  1BLX B;  1JWG A;  3E34 A;  4APO A;  4GYW A;  4CDM A;  1KLX A;  3NQP A;  2ZGG A;  3VLE A;  2UY1 B;  5BPP A;  4XZ4 A;  5D66 A;  4MLP A;  5CEA A;  1TEZ A;  4DI4 A;  3K9I A;  4OVU A;  3RJV A;  2XGM A;  3HVE B;  1DVP A;  4A1G A;  3UXG A;  4WWO A;  4YDE A;  1L5J A;  2AWI A;  4U63 A;  4YND A;  2ETB A;  3D9H A;  4I1A A;  5EN5 D;  4ABN A;  1MX4 A;  1KT1 A;  2R59 A;  1WDY A;  1DCE A;  3CHP A;  3TWU A;  1N54 A;  5LP0 A;  3ZXP A;  2FUL A;  4U04 A;  1MJ0 A;  1HS6 A;  2HR2 A;  1N4R A;  4NQ0 A;  4HRM B;  2PQN A;  1TN6 A;  2XZD G;  3AAA C;  4G26 A;  1DCQ A;  2WMO A;  4BY6 A;  1Y6I A;  1QZ2 A;  2IOS A;  5ENP D;  3T9K A;  2R05 A;  4F1S A;  3CVV A;  4GZC A;  2QY7 A;  5KCM A;  4G8L A;  4I6G A;  5FIO A;  2H6F A;  3TWV A;  2I9C A;  3JUI A;  3FDH A;  4FJY A;  4XKB A;  1UN8 A;  4K0R A;  2VGX A;  1H6O A;  4F1P A;  3LJN A;  5LX8 A;  1INZ A;  3PDN A;  4EEC A;  1K1B A;  4K5B A;  1UN9 A;  5JHB A;  4AVX A;  1SZA A;  2RKK A;  1LD7 A;  2MHK A;  2A5U A;  1HG2 A;  4UQZ A;  3S7J A;  5AQA A;  1N94 A;  4UWF A;  4YDY A;  2E0I A;  4GYY A;  2IO3 C;  3E4B A;  3QOU A;  3Q4A B;  2DIW A;  3D9I A;  3GZS A;  1HU3 A;  2FBN A;  3E32 A;  4LNU D;  3HXD A;  5ARF A;  2WM9 A;  4GTS A;  2NYJ A;  4AV7 A;  4Q96 A;  2FEZ A;  4K03 A;  1BD8 A;  3D9N A;  3Q7F A;  5JA4 D;  5EIB E;  3E30 A;  1IYG A;  2YHC A;  2WXL A;  4ACK A;  3D9J A;  4KZ0 A;  3FU3 A;  4HBD A;  5AQ7 A;  3DBS A;  3EIQ C;  1KT0 A;  2R5S A;  4DJA A;  1S63 A;  2DZO A;  3FH5 A;  1OCO E;  3ZHE B;  3LY7 A;  4GZ6 A;  2MRI A;  3OTN A;  2QZA A;  1FPP A;  2CHW A;  3FTX A;  4KXK B;  4CDN A;  3LVR E;  3MKR A;  3Q9U C;  5ENS D;  3SY2 A;  3GW4 A;  5J90 A;  2VGX B;  2I6H A;  2Y69 E;  3C98 A;  2VGY A;  4U8H A;  1PC2 A;  5FTP A;  3EU9 A;  2E2E A;  3W9F A;  3AS8 A;  2UY1 A;  3IBE A;  3L6A A;  3CGH A;  3VLD A;  4XI0 A;  4FHK A;  3LY9 A;  2IO2 C;  4J8F A;  1HG5 A;  4B8A A;  1YMP A;  1LF8 A;  4JEU A;  1TN8 A;  4FJZ A;  2C2L A;  3DXK G;  4FLH A;  4CGV A;  4I1M A;  1N4P A;  4UWL A;  5KJL A;  4N2Q A;  5ITZ F;  4M7C A;  2NXP A;  4DX1 A;  4JXT A;  5CCM A;  2F0Y A;  3CQC B;  3D3M A;  3NOG D;  1S64 A;  4L23 A;  1LD8 A;  3ASF A;  1N9A A;  3DSV A;  4G23 A;  2XHE A;  5JJ6 A;  3EHR A;  5M72 A;  2VYI A;  3GZ1 A;  2OOE A;  3SFZ A;  5FIN A;  3QAQ A;  5FZS A;  3ZYK A;  3PEU B;  3P1U A;  2WXO A;  3FUI A;  4AXH A;  4JEH A;  1XGW A;  4U96 D;  4BTB A;  3RKV A;  3AU5 A;  4HXI A;  3ONK A;  4LRZ A;  2KBX A;  4UQY A;  2F8Y A;  3ZYL A;  5CHE E;  4URK A;  3JCK C;  4P29 A;  3SFX A;  4OVV A;  1KZO A;  5LOZ A;  1N4Q A;  1QBQ A;  3CVP A;  3ZPJ A;  3APC A;  5AIJ A;  5C1D A;  5HI7 A;  4DX6 D;  2AXV A;  4BFR A;  1MZC A;  3EDT B;  4EPZ A;  3UT8 A;  4QQI A;  4AJW A;  3ULY A;  3EHQ A;  4UWH A;  4V3I A;  1IQR A;  4EBA G;  3E33 A;  1JWF A;  3W9G A;  3FHE A;  4Y6C A;  2LSU A;  3ASD A;  5H7P A;  3ASG A;  4RQI A;  3D9P A;  4C0E A;  3MGB A;  3TWQ A;  3NB2 A;  2CHZ A;  4GMR A;  3L22 A;  4YDO A;  4DX2 A;  4GZ5 A;  5G05 J;  1E8Z A;  4PDX A;  1Z3Y A;  3ZEF A;  2EIM E;  1WG0 A;  5FQ8 A;  3PUJ A;  3TWW A;  3R7Q A;  5EX0 A;  3KSL A;  1V54 E;  3CKB A;  2WMN A;  3HXB A;  4H7Y A;  5CBN A;  3FFL A;  2P9S G;  4N39 A;  2QC9 A;  2WXN A;  5AEN A;  1NA0 A;  4GZ3 A;  4L1B A;  5EIL A;  3IHV A;  3IKO B;  4E85 A;  4F6R D;  4BES A;  4ANW A;  2V5F A;  3FU5 A;  4U0Z A;  2V4L A;  4J6I A;  3PZ4 A;  3G2U A;  2OVF A;  1SA4 A;  3Q7A A;  5KJM A;  1QYM A;  2AXU A;  4OAU C;  4ILH B;  4MBG A;  3NOC D;  4N3C A;  3FTY A;  3I5P A;  4JHR A;  4U8Y D;  4A1S A;  3PH0 C;  4EZL A;  2B6C A;  4NIK A;  3I4G A;  3DWL G;  3CHM A;  3C3R A;  4XX5 A;  5EYP F;  3CVY A;  2J49 A;  3LCA A;  3TG5 A;  2DWZ A;  2GRM A;  3NAW A;  3B13 A;  4ANV A;  1EF1 C;  2X3M A;  3L54 A;  1YCS B;  5EDS A;  5B3S E;  5FT9 A;  3C3Q A;  3FUE A;  1H2T C;  1TJC A;  4GTT A;  2ZXW E;  1UW4 B;  3DSU A;  3L16 A;  4GAA A;  5FZQ A;  4HS2 A;  5KJN A;  1NFI E;  2LO6 A;  3N71 A;  1U3D A;  1TNZ A;  3NBN B;  1HX8 A;  2OEV A;  2DZN A;  4WND A;  4AP2 A;  2I1J A;  3FUN A;  2KZT A;  2J09 A;  2EIK E;  1OWN A;  2GRR B;  4HOQ A;  3AJI A;  3RRM B;  3TWS A;  3CSF A;  3TWR A;  4GML A;  5BXU A;  3TJP A;  1FT1 A;  3ONL A;  4WWN A;  2XPZ A;  2KM4 A;  4BWR A;  4G25 A;  3S2A A;  5G55 A;  2AW6 A;  3S7B A;  1JCS A;  2A4Z A;  2H6H A;  5ENN A;  2VSN A;  4J8E A;  4DX7 D;  3MX3 A;  2VGE A;  2GRN B;  4HLE A;  3ABK E;  5CCL A;  1W3B A;  4TUM A;  5CRV A;  3Q5M A;  5CER B;  2J08 A;  3DST A;  2I1K A;  3ZVV A;  4UUC A;  2Y1L E;  2VQ2 A;  3BU8 A;  5KJK A;  4DLQ A;  3Q73 A;  2GRP B;  4JA7 A;  4ATZ D;  1O1S A;  4AEZ C;  2HE0 A;  3CK8 A;  4G1T A;  2WXM A;  5T4Y A;  2J07 A;  4LEU A;  2GW1 A;  3Q79 A;  3RO3 A;  1A5E A;  5KNG A;  3QC1 A;  2KCV A;  4J8S A;  2KXP C;  1OWO A;  2FO7 A;  3FUL A;  3OAW A;  5ENQ D;  4Q94 A;  1MX2 A;  3C5R A;  4Q69 A;  3D9M A;  2LSV A;  5CMW A;  3L17 A;  3O48 A;  3ABL E;  1E8Y A;  2ILR A;  3DSW A;  2FI7 A;  3ZN3 A;  1O5M A;  2BED A;  2LNI A;  3R9M A;  4UQX A;  2DYS E;  1WAO 1;  3PE4 A;  3JQ0 A;  4I43 A;  4EQF A;  3LEW A;  4ANU A;  4DRX E;  5ENT D;  3QAR A;  2Y3A A;  3DSX A;  4A3T A;  3JUE A;  3AS4 A;  3ML9 A;  2P9P G;  1H19 A;  2L0T B;  2EQX A;  1X5B A;  1SW6 A;  4U0U A;  3AG4 E;  2Q7F A;  2L0I A;  2YQ8 A;  3ASH A;  4ANX A;  2ION A;  4CYM D;  1FT2 A;  3ZNG A;  4RLY A;  2F37 A;  3CR3 A;  5EYL A;  5JJT A;  2RD0 A;  3QWW A;  4XKC A;  4GPK A;  2FO1 E;  2JLB A;  4MRU A;  3LDZ A;  2F8X K;  3PZ2 A;  5LCW J;  4I2Z A;  1TJF A;  2VSY A;  2AVP A;  4G2V A;  2PZI A;  1JCQ A;  4HOS A;  3OXL A;  3UIO C;  3ZUV B;  3UM3 A;  5JHA A;  2XPI A;  3RSE G;  4KMO A;  3CLJ A;  4YVQ C;  3TXM A;  1U2V G;  2X6K A;  3CK9 A;  3UX4 A;  4L2L A;  2KAT A;  5AAR A;  3Q49 B;  3HYM B;  5AQB A;  2OVB A;  5ENR D;  4GYO A;  4FUL A;  1K3Z D;  4GA0 A;  1FCH A;  2WPV A;  4CCA A;  1BI7 B;  3SNX A;  3FTZ A;  3MEK A;  1DNP A;  3F6Q A;  4NAC A;  2WXH A;  1D9S A;  1NI1 A;  2C0M A;  4PH4 B;  4NRH B;  3NZU A;  2XCB A;  4RSY A;  3HXF A;  3T8M A;  3PE3 A;  4ME2 A;  1UJJ A;  3AG1 E;  3SBS A;  2MYO A;  1OCC E;  3ML8 A;  3HXE A;  3QNK A; 
#chains in the Genus database with same CATH homology
 1HF8 A;  2DCP A;  4PS7 A;  2YIN A;  3GYZ A;  1E7V A;  3AS5 A;  4C0E A;  3TXN A;  3FH7 A;  4O6F A;  2R17 C;  3I4R B;  3MGB A;  3LKU A;  2NC9 A;  4GU5 A;  2OND A;  4WUY A;  4ACL A;  5LCW C;  3O4Z A;  4CRW A;  2AXZ A;  2CHZ A;  4JC8 A;  1P5Q A;  3ENE A;  4PS8 A;  3IV0 A;  3L22 A;  3ZFW A;  4XIF A;  5EKQ D;  4UWK A;  4GB9 A;  4F53 A;  5EX3 A;  4AY6 A;  4GZ5 A;  2WXR A;  5G05 J;  1E8Z A;  3FUJ A;  1IHG A;  4PDX A;  2XCC A;  3IEG A;  5HQ8 A;  3PVL A;  1UJK A;  1Z3Y A;  2HYZ A;  3ZEF A;  2C0L A;  3P2B A;  2WXF A;  4B0Z A;  1OWL A;  3LS8 A;  4EBA A;  5FQ8 A;  4I2W A;  3PUJ A;  3FTW A;  4BX8 A;  3S7D A;  4UI9 K;  3SBT B;  1HZ4 A;  1Z3X A;  4JZY A;  5BUZ A;  3R7Q A;  3FH8 A;  5EX0 A;  3HHM A;  3TGO A;  4B89 A;  4HVB A;  2NSZ A;  3CKB A;  3FUH A;  2WMN A;  4H7Y A;  3FFL A;  1JPL A;  3DPD A;  3FP3 A;  4JL0 A;  4N39 A;  3R9A B;  3PS6 A;  4N5C A;  2DBA A;  4FAD A;  2KCL A;  4UWG A;  2WXN A;  3RO2 A;  3RU0 A;  2IOL A;  3UT7 A;  5AEN A;  1NA0 A;  4KVO A;  4NUR A;  3B7S A;  3CQG B;  2M63 A;  4GCN A;  1JUQ A;  2X38 A;  4HFG A;  3BG1 B;  3EIJ A;  2KCK A;  3FU6 A;  4GZ3 A;  4QFV A;  2PM6 A;  5FQ6 A;  4B8C B;  5J08 A;  4WAF A;  4L1B A;  3SD5 A;  4C9B B;  4GZD A;  3ULQ A;  3IHV A;  5AJD A;  2WXK A;  3APD A;  3PNL B;  3IKO B;  4GCO A;  4E85 A;  5AJL A;  2X6I A;  1HO8 A;  4BTA A;  1EDU A;  1OUV A;  4ANW A;  2V5F A;  1QQE A;  2XGO A;  3LXU X;  3FU5 A;  3QDN A;  4U0Z A;  1EYH A;  3S7F A;  2V4L A;  5JJ7 A;  3UPV A;  4G24 A;  4J6I A;  1JWG A;  2VTB A;  4KYO B;  3VTY A;  3G2U A;  2OVF A;  4TV3 A;  3G2S A;  4GA2 A;  5C2Y A;  3CVX A;  4APO A;  1PAQ A;  5KJM A;  4OYS A;  2WXI A;  4A55 A;  1WM5 A;  4GYW A;  4RG9 A;  3IHY A;  4CDM A;  1KLX A;  4N2S A;  2CHX A;  1E8X A;  2AXU A;  3NQP A;  4JHJ A;  3RIB A;  3VLE A;  2CFU A;  3FTS A;  2HM8 A;  4ILH B;  4D10 C;  2X6F A;  2UY1 B;  5BPP A;  4DK5 A;  4N3C A;  4XZ4 A;  4MLP A;  1TEZ A;  3FTY A;  3I5P A;  4JHR A;  3FU0 A;  3CHR A;  4A1S A;  4DI4 A;  3U9W A;  3K9I A;  3PH0 C;  5FZR A;  4EZL A;  3I4G A;  1HFA A;  4OVU A;  4HOT A;  3RJV A;  2XGM A;  3CHM A;  1HXI A;  3HVE B;  4XX5 A;  1DVP A;  3ZYQ A;  1NP7 A;  4A1G A;  1QNF A;  4DLO A;  2WQ7 A;  3CVY A;  4WWO A;  2MOW A;  1L5J A;  4JPS A;  2AWI A;  4U63 A;  4UI9 J;  2ZU6 B;  5A7D B;  4CEM A;  4L7T A;  4YND A;  2J49 A;  3OXF A;  4I1A A;  4ABN A;  3QB2 A;  3QWP A;  3TAX A;  3VLF A;  3LCA A;  3BEE A;  3TG5 A;  3U3W A;  2GRM A;  3L08 A;  4ILG A;  1KT1 A;  2JEK A;  3B13 A;  5ANR A;  2WXJ A;  4ANV A;  1EF1 C;  5A6C A;  2X3M A;  1H0A A;  3L54 A;  2R59 A;  1ELK A;  1XNF A;  3JYS A;  5EDS A;  5FT9 A;  3CHP A;  1N54 A;  4I9E A;  2OV8 A;  5LP0 A;  1H2V C;  3FUE A;  1H2T C;  2FUL A;  1TJC A;  4U04 A;  4XE0 A;  1HS6 A;  2HR2 A;  1UW4 B;  3CVW A;  3L16 A;  4I9C A;  4GAA A;  4NQ0 A;  5FZQ A;  3B7R L;  3CV0 A;  2WQ6 A;  3TL5 A;  4FA6 A;  1Z6T A;  4PUC A;  4APF A;  4HS2 A;  2J4B A;  3ZXS A;  4BT8 A;  2PQN A;  4I17 A;  4DI3 A;  5KJN A;  2LO6 A;  3N71 A;  5DBK A;  4CT4 A;  1U3D A;  3KS2 A;  1ELR A;  2KZT B;  1GW6 A;  4G26 A;  4GPK A;  2I2O A;  1HX8 A;  2WMO A;  3FTU A;  3UMV A;  4BY6 A;  3U64 A;  1Y6I A;  1QZ2 A;  4WND A;  2CG2 A;  4AP2 A;  2I1J A;  2IOS A;  4G11 A;  3FUN A;  2KZT A;  2WXP A;  2J09 A;  1ZU2 A;  4F1S A;  2J9Q A;  2PQR A;  4GZC A;  3CVV A;  2BUG A;  4B94 A;  2QY7 A;  5KCM A;  3ZRH A;  4I6G A;  5CMY A;  4PS3 A;  3Q47 B;  2VTB B;  1OWN A;  1ELW A;  3CK7 A;  3EHM A;  4HOQ A;  3SGH A;  2V0P A;  2WQH A;  3RRM B;  2I9C A;  3ZGQ A;  2X6J A;  2XGS A;  3JUI A;  4ATG A;  3CSF A;  4MKT A;  3FDH A;  4FJY A;  4GML A;  4XKB A;  1UN8 A;  4K0R A;  5D0Q D;  3FUF A;  1IQU A;  2VGX A;  3TJP A;  3FEX A;  4AM9 A;  3ONL A;  4WWN A;  3FTV A;  2XPZ A;  2Y4U A;  5LX8 A;  1INZ A;  2KM4 A;  4BWR A;  3CVL A;  3PDN A;  4G25 A;  3S2A A;  2QFC A;  3U4T A;  5FQ7 A;  4FP7 A;  5G55 A;  4EEC A;  3MV3 B;  1UN9 A;  4CGW A;  4AVX A;  2AW6 A;  5JHB A;  3S7B A;  4GA1 A;  3MYV A;  1SZA A;  2A4Z A;  4TRQ A;  4I6E A;  5ENN A;  2MHK A;  2A5U A;  1HG2 A;  1NA3 A;  3HIZ A;  4KBQ A;  4UQZ A;  3S7J A;  2VSN A;  4J8E A;  3D9K A;  3LVQ E;  4BX9 A;  4UWF A;  3MX3 A;  3PUK A;  2E0I A;  3WXX A;  5BW8 C;  4HLE A;  5CCL A;  4GYY A;  1SQM A;  3E4B A;  3QOU A;  3Q4A B;  4CT0 A;  2DIW A;  3NZS A;  3D9I A;  4XI9 A;  1W3B A;  4MS6 A;  5ANL A;  3GZS A;  1HU3 A;  2FBN A;  3Q5M A;  4W9R A;  5FQ4 A;  2L9B A;  3B7U X;  2J08 A;  5ARF A;  2I1K A;  3ZVV A;  2V8S E;  2WM9 A;  4AV7 A;  3FY4 A;  3FWV A;  4Q96 A;  3RK6 A;  3KAE A;  2FEZ A;  2LAI A;  4K03 A;  5LFA A;  2VQ2 A;  3D9N A;  3SF4 A;  3SZ7 A;  2HO1 A;  1IYG A;  3HDX A;  2YHC A;  3UT4 A;  5KJK A;  4FC8 A;  2WXL A;  3CIA A;  3CHQ A;  4DLQ A;  4ACK A;  1PY1 A;  3D9J A;  4JA7 A;  2X6H A;  4KZ0 A;  3FU3 A;  5ARG A;  1H2U A;  1E90 A;  3DBS A;  4WWP A;  4EZJ A;  1S0P A;  3QWV A;  3ZYM A;  4AEZ C;  3CK8 A;  4G1T A;  3ZHE A;  2WXM A;  5T4Y A;  3R7R A;  3EIQ C;  3LPZ A;  3MKQ B;  2J07 A;  4LEU A;  2GW1 A;  1KT0 A;  1UG3 A;  4YVO A;  2R5S A;  4DJA A;  3RO3 A;  3AU4 A;  1OWM A;  3CHS A;  3FH5 A;  2FF4 A;  4DPR A;  4TUU A;  2WVI A;  3ZHE B;  3LY7 A;  4WNG A;  4IRU A;  3CKC A;  4GZ6 A;  2MRI A;  4U07 A;  3PRE A;  2WB2 A;  2Y4T A;  3OTN A;  3OXG A;  2KCV A;  3CHO A;  3QC1 A;  4J8S A;  2BTD A;  3MA5 A;  2WXG A;  1OWO A;  2CHW A;  1HE8 A;  4L2Y A;  1VDY A;  3SHF A;  3KD7 A;  3JQ1 A;  2FO7 A;  3FUL A;  3FTX A;  3OAW A;  4KXK B;  4CDN A;  2J4D A;  1MQS A;  4Q94 A;  4Q69 A;  3LVR E;  3MKR A;  3D9M A;  2LSV A;  3TG4 A;  5BNW A;  1HH8 A;  3GW4 A;  5D0O D;  5CMW A;  5J90 A;  4IUL A;  2VGX B;  2I6H A;  3MZL B;  3L17 A;  3C98 A;  5FJY A;  3O48 A;  2VGY A;  3B7T A;  4U8H A;  1PC2 A;  5FTP A;  4AOF A;  1E8Y A;  2ILR A;  3PRZ A;  4JVS A;  2E2E A;  1YA0 A;  2FI7 A;  3ZIM A;  4E6H A;  4KVM A;  5E75 A;  3ZN3 A;  5G04 C;  3AS8 A;  2UY1 A;  5BV0 A;  2P58 C;  3IBE A;  4BSX A;  3CEQ A;  3L6A A;  1BPO A;  3CGH A;  3VLD A;  2LNI A;  5G2N A;  3FUD A;  4XI0 A;  3URZ A;  4FHK A;  3LY9 A;  5DIZ A;  5FWQ A;  3FUK A;  4UQX A;  4I6J A;  4J8F A;  2L6J A;  1HG5 A;  4IYP A;  2LAH A;  4B8A A;  4J0U A;  1WAO 1;  1H6K A;  3PZD A;  1OWP A;  3JQ0 A;  3PE4 A;  4I43 A;  4A3V A;  1B89 A;  1SZ9 A;  3GZ2 A;  4EQF A;  5E76 A;  5AYW D;  5BV1 A;  3EJN A;  3LEW A;  3MJW A;  3LYA A;  1LF8 A;  4HOU A;  4ANU A;  3D9L A;  2XQ0 A;  3QAR A;  2PL2 A;  4JEU A;  4BT9 A;  1E96 B;  4FJZ A;  2C2L A;  2IQC A;  2YHE A;  4FLH A;  4CGV A;  3FUM A;  1ZBP A;  4I1M A;  4UWL A;  4FU3 A;  5KJL A;  2VJ8 A;  2Y3A A;  4M3O A;  4N2Q A;  3LY8 A;  5T8I A;  2NXP A;  4WNF A;  3MKQ A;  3RRN B;  4A3T A;  3AS4 A;  4JXT A;  3ML9 A;  3G2V A;  5CCM A;  4EZK A;  2WXQ A;  1H19 A;  3CVN A;  2L0T B;  2EQX A;  1X5B A;  3CVU A;  3G2W A;  2VSO E;  4U0U A;  2Q7F A;  3CST A;  3CQC B;  2L0I A;  2YQ8 A;  3U66 A;  3ASH A;  3D3M A;  4R7L A;  4ANX A;  4HOR A;  2VSX E;  3SI5 A;  2ION A;  4L23 A;  1Y8M A;  3ASF A;  2BF0 X;  3CVQ A;  4JA9 A;  3EHN A;  4KT6 B;  4G23 A;  3I3N A;  3PEV B;  4F3V A;  4JHK A;  4LUN U;  3CR3 A;  4I1O B;  4CDR A;  2PM7 A;  2XHE A;  3ZW3 A;  5JJ6 A;  4FLB A;  1EPU A;  4KZC A;  5JJT A;  5M72 A;  2RD0 A;  2VYI A;  3GZ1 A;  3QWW A;  4XKC A;  2OOE A;  2YNQ A;  2XRZ A;  3SFZ A;  2XPY A;  1U3C A;  3QAQ A;  2IF4 A;  1FVH A;  2JLB A;  1E8W A;  3BG0 B;  4MRU A;  5FZS A;  3ZYK A;  3LDZ A;  3G2T A;  4GMJ A;  2UWJ G;  2IU1 A;  3T5X A;  3PEU B;  3P1U A;  4H7X A;  5LCW J;  2WXO A;  4I2Z A;  3FUI A;  1TJF A;  4RG6 A;  4JEH A;  4AXH A;  2VSY A;  2AVP A;  4G2V A;  1XGW A;  2PZI A;  3VTX A;  2XRY A;  3T5V A;  2CFZ A;  4BTB A;  4HOS A;  3OXL A;  3QKY A;  3RKV A;  3AU5 A;  3KEZ A;  5G04 J;  4N3B A;  5A23 A;  4HXI A;  5JHA A;  2XPI A;  3ONK A;  3CLJ A;  4KMO A;  4LRZ A;  4YVQ C;  3NF1 A;  3QJZ A;  4UQY A;  3TXM A;  3UUX A;  4AY5 A;  3ZYL A;  2CG3 A;  4AIF A;  4JW1 A;  2GRL A;  2X6K A;  3CK9 A;  2RG8 A;  4RVB A;  1WY6 A;  5CHE E;  3UX4 A;  4URK A;  3ESL A;  3JCK C;  4L2L A;  4UI9 C;  3HVE A;  4P29 A;  3RRU A;  2KAT A;  3Q49 B;  3HYM B;  3D9O A;  3APF A;  4LER A;  4OVV A;  3QK0 A;  2OVB A;  5LOZ A;  4GYO A;  4FHJ A;  4FUL A;  4U0S A;  3PNT B;  1E7U A;  3CVP A;  4N3A A;  3ZPJ A;  3APC A;  4GA0 A;  1MHQ A;  5AIJ A;  1FCH A;  2WPV A;  4CCA A;  5C1D A;  5HI7 A;  3MCX A;  3SNX A;  1FVF A;  3ESK A;  2GGF A;  5G05 C;  3FTZ A;  2AXV A;  3UQ3 A;  3MV2 B;  3MEK A;  1DNP A;  4BFR A;  5BT1 A;  3EDT B;  4NAC A;  4J8D A;  4EPZ A;  2WXH A;  2KC7 A;  1NZN A;  3UT8 A;  4WNE A;  2IJG X;  4AJW A;  4PH4 B;  2C0M A;  3FEY A;  2IFU A;  3NZU A;  4NRH B;  4C0M A;  4Y6W A;  4LCT A;  2XCB A;  1A17 A;  4RSY A;  4UWH A;  4IN3 B;  4V3I A;  4F7A A;  3T8M A;  1IQR A;  4EBA G;  3PE3 A;  4ME2 A;  2XEV A;  1UJJ A;  1JWF A;  3Q15 A;  3FHE A;  3SBS A;  4Y6C A;  3L13 A;  3LJ3 A;  1N52 A;  3ML8 A;  2LSU A;  5T3R A;  3ASD A;  4ILI A;  3ASG A;  3QNK A;  3D9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...