4I6GA

A vertebrate cryptochrome with fad
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
490
structure length
476
Chain Sequence
ASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMELPKKPAVAVSSQQMESCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLEANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cryptochrome-2
publication title SCFFBXL3 ubiquitin ligase targets cryptochromes at their cofactor pocket.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 170
structure length 476
sequence length 490
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4i6gA03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i6gA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4i6gA01
4XFDA 1WY5A 4P2BA 1EUQA 4UZFA 5JBNA 3SP1A 2TS1A 1KH3A 1WXFA 4MAFA 1YUMA 1J20A 1O0BA 3X1JA 1GLNA 4MW1A 3P52A 1VBKA 1QU3A 1U7DA 3L93A 1H3EA 4ZT6A 3MUEA 4KKVA 4J75A 2PZAA 3OP1A 2CV2A 2E89A 1PG2A 1I6KA 1MB9A 1EFPA 3FH0A 4MVYA 3NBKA 4EG5A 4KR7A 1QNFA 3AG5A 3H9BA 1K4KA 3IMEA 1T9GS 5F23A 3RFFA 3E27A 3AL0C 2IELA 1YULA 1WKBA 3SZ3A 1JEEA 4NDAA 1D2RA 2JA2A 3CLSD 4BWVA 4QBTA 1COZA 1LI5A 2CV1A 5K0TA 5IHXA 3L92A 1EE1A 4OUDA 1QTQA 3VU8A 1N78A 2CV0A 3G5AA 1JMVA 1NP7A 1KP3A 2HZ7A 1WZ2A 1LI7A 3PXUA 1K97A 4PBRA 3CLTD 1G59A 1JHDA 2V0GA 4EG1A 1J1UA 2ZUFA 2X0KA 4EG7A 3IMCA 5DK4A 3CLRD 3S3TA 4KR6A 1KKUA 2QTNA 3ZXSA 4DLPA 2J08A 3RBAA 3IUBA 3A4IA 1EFPB 4MW2A 4NX2A 1JEDA 2PZ8A 4MWBA 5KHAA 3HFJA 3INNA 1N75A 1QQTA 4QRDA 2A4MA 4NATA 1G8HA 2NZ2A 1M1ZA 1OBHA 3CLUC 3H97A 4DDMA 4DJAA 1OWLA 3LE8A 4WNYA 4ZCPA 2VXOA 3ILVA 4WSOA 1NI5A 2Z08A 4MWEA 1I6LA 3P0IA 3SYTA 5HUHA 4CDNA 3FWKA 3UC5A 1NUUA 1O94C 1KP2A 1YUNA 3IVXA 4A91A 2EJCA 5FO1A 3VRHA 1H3NA 2CYAA 3RJZA 4AQ7A 4KPUA 4GRIA 1QJCA 1JIJA 4U8HA 3DLAA 4MW0A 5DASA 1OBCA 4J76A 4XSVA 4G5FA 1ULHA 1WOYA 1EXDA 4DNXA 4HJXA 1K4MA 4NZPA 2A86A 3SEQA 3VGJA 1NUQA 1O95D 5FO0A 1R6UA 3A04A 1GN8A 4PBTA 1R6TA 2AG6A 3X1KA 1N2JA 1WQ4A 4H3SA 5TGTA 3SZGA 1GTRA 4HJRA 2VTBA 3ZUGA 3JXEA 4KR9A 2ZUEA 1CT9A 1IQ0A 4MWDA 2GM3A 2JAXA 1O6BA 1OWNA 4F4HA 1QU2A 1TYAE 4K0RA 2YWCA 4AS1A 3ZGZA 1QRTA 1G8GA 2QTMA 1V8FA 1WXHA 1WXIA 5FNZA 1Q77A 3MMXA 4ZT3A 4HK4A 3CVWA 3ND5A 4YP7A 3UK2A 4KPUB 4ARCA 1VL2A 1OWPA 4ZT5A 2PXHA 4YP5A 2A7XA 1J09A 1ZH0A 1K92A 3IUEA 2QJTA 1M8KA 4S1OA 1YIDA 1WJGA 3MXTA 3SDBA 4MUKA 3FNRA 1MAWA 1PFVA 2YWBA 1U0BB 4FZJA 3ISJA 2DLCX 1XJQA 1F7VA 1Y42X 2DPLA 2JANA 1MJHA 2OV4A 3UOWA 4MUGA 1UFVA 1XNGA 3H05A 4ARIA 3PNBA 2ZP1A 3CLSC 3M5WA 1KAMA 1VBNA 4ZT7A 1TYDE 1IQRA 4EG4A 1U7XA 3ND7A 4MW7A 3ZJUA 1FFYA 1JGTA 4DE5A 1NUPA 1T9GR 4G6ZA 1WQ3A 1IVSA 2DETA 2VTBB 3GLVA 4R2MA 1TEZA 4XFJA 1M8JA 4F3RA 4MUFA 1O97C 2QUIA 3TNJA 3FG9A 4DDKA 3COVA 5DEOA 5EKDA 3IMGA 3KFLA 1J1ZA 3CLRC 3IOEA 4ZCQA 4MUIA 4EF6A 2A1TS 1WXEA 1JZSA 3COWA 3F3MA 3FIUA 1GAXA 2D5BA 1R6XA 2PFSA 4EFKA 4EGAA 3N8HA 3RHSA 2CT8A 3HZRA 3CVXA 4JXXA 1G8FA 4R0NA 2B7LA 1N2GA 2CFOA 4ZT4A 2Z09A 1KH2A 4MULA 2D54A 2X1LA 1ZJWA 3CVVA 4ND7A 4DDHA 3D6VA 2H29A 1LW7A 3LCJA 3COYA 1XNJA 2I1LA 4MW9A 1MBZA 2PIDA 3BL5A 1OWMA 1QRUA 1Q15A 1B6TA 3MLBA 2XRZA 1IFXA 1IHOA 2O5RA 2XRYA 2CSXA 4RUKA 2R5WA 1F4LA 1JZQA 4MVWA 1GTSA 5AHWA 2E0IA 1IH8A 4MWCA 1N1DA 3IVGA 2QUJA 1ZUNA 4U63A 1N2EA 2X3FA 3NBAA 1Q19A 1QRSA 3NV7A 4ZCRA 1NUSA 1F9AA 2E21A 5H16A 4ZCSA 1MC1A 1PFYA 3FY4A 3TQOA 4NAUA 1T6XA 4RPIA 1O94D 3N9IA 1O95C 3U1VA 3KT8A 2YXNA 2AKEA 1S4MA 5J59A 3TZLA 2H2AA 2QJFA 1I2DA 1N2IA 3FI0A 3P0HA 3TQIA 3ZIUA 3PNVA 1ILEA 4YP6A 2HGZA 1JECA 2WQ6A 3AKZA 4Q16A 4PBSA 1WXGA 2OQ2A 3KT3A 4ZCTA 5LFAA 3IDFA 4CDMA 3IOCA 3QTTA 1XNHA 1HYBA 1U3CA 3SEZA 5KCMA 1OD6A 3DO8A 1GPMA 1NUTA 1M83A 4EG3A 2J07A 3QE4A 1N77A 4MUJA 3A2KA 2IJGX 2A1UA 4R2LA 3G59A 5IJXA 5KWVA 1H3FA 1U3DA 3AG6A 3CVUA 2NSYA 2QTRA 3Q12A 3IH5A 1KQNA 3HGMA 3MLAA 2J5BA 5J5AA 1PFWA 1YIAA 1ZH6A 2BYTA 3PNYA 4MUNA 5K0SA 1KQOA 1KQPA 4MVCA 5TEWA 2DXIA 1PG0A 3Q4GA 1VLHA 3FOCA 1RQGA 3CVYA 4EG8A 2IP1A 1MB2A 2QUKA 1OWOA 2EL7A 2QUHA 4Q93A 5J58A 1TFUA 1SURA 2QJOA 3FHJA 4QREA 3D6UA 1IQUA 4I6JA 3CLTC 1JILA 4L2IA 5H7XA 1N2OA 3H99A 1V47A 3GMIA 5HG0A 1NURA 3HV0A 1N2BA 3N2YA 3UMVA 5TEVA 4JXZA 2G36A 3X1MA 3I05A 1T6ZA 3IOBA 1NZJA 4MW4A 4OJMX 5LLTA 1TYCA 1MAUA 3CA8A 1FYDA 3A05A 4MUEA 4UZEA 1P7PA 4G5YA 4NAHA 1O96A 2A1UB 1X8XA 4U7JA 1O0CA 2DEUA 4CQNA 3G6KA 3RK1A 1F7UA 4MUHA 3UY4A 1MRZA 1J21A 1I6MA 2GOYA 1JIIA 3OTWA 4ZT2A 2J4DA 4K03A 2V0CA 1YI8A 2C5SA 1KORA 1X6VA 1PFUA 1EUYA 1IRXA 1A8HA 1O97D 4JZYA 2HMAA 4MW6A 4E1AA 2A88A 2A1TR 3C8ZA 3K32A 4ND6A 1EFVA 3AFHA 4YBRA 1DNPA 4MLPA 4YMIA 1KR2A 2YY5A 1M8PA 4HPWA 2DR2A 1TQ8A 3AIIA 4JYZA 4I6GA 3N05A 3H9CA 3ZJTA 3ZXIA 2J09A 4MQ6A 2WSIA 4L2IB 3RK0A 1KAQA 1MOPA 5BNZA 1NYLA 2D13A 3CLUD 3HL4A 2CYBA 1EJ2A 3IODA 3COZA 4JFAA 2DUMA 3P0JA 2GKSA 2PG3A 4MVXA 2DERA 4X0EA 3GUZA 4OUDB 1O96B 1H1TA 3ZJVA 2RD2A 4PY2A 3CR8A 1Q11A 1M8FA 2O8VA 2AZXA 2BTEA 2A84A 2WQ7A 5DB4A 2CUZA 1JIKA 3IVCA 2CYCA 1NSYA 4EG6A 1GZUA 3FDXA 2WB2A 3LOQA 3DPIA 1J70A 2E18A 3PRHA 3TS1A 2PZBA 3ND6A 3FETA 2RE8A 1VBMA 1TYBE 1EFVB 3K9WA 3DV2A 5LM3A 5HUJA 4GU5A 1N3LA 1BS2A 1M8GA 1T6YA 5TS2A 3KT6A 3ELBA 2X1MA 4CT0A 4MW5A 4I6EA 3QTBA 1N2HA 1O5TA 2Z3VA 3Q10A 1KH1A 3HMQA 3KT0A 4TS1A 3TZEA
chains in the Genus database with same CATH superfamily
5CK4A 3TKYA 2ZT7A 2YHEA 1V96A 1EDDA 2NU6B 3HBMA 4A1FA 1DQPA 4B4UA 2R0QC 1UPCA 1OV4A 2Q4RA 1U7DA 1Y5MA 2VCEA 1BTOA 3LL4A 2LUHA 3GNQA 4FZRA 2W6PA 1BYIA 1P0MA 5FTPA 4GA2A 4EHHA 2JHPA 3T38A 3UM0A 5TSDA 2IS6A 4G5XA 1WM5A 3RI3A 4JI6B 2CV1A 3E61A 4KZPA 3VR4D 3KS2A 5AIJA 2OWDA 4XYBA 2XZLA 3ITKA 3L8EA 5I5EA 4JNKA 1RRCA 1JG6A 2W6OA 2RD0A 3JD1A 3SY8A 3MD0A 4DUYB 3HBLA 2GD1O 1VKHA 1KQ3A 1E2GA 2CD7A 1T8WA 3VX3A 1SBQA 3OPXA 3LUDA 4QO7A 4OEHA 2R8OA 2D0DA 2ICAA 4QVGA 3LVBA 2WRZA 2ONCA 5H4GA 5JCPA 2GDJA 5B7PA 2HL6A 1N2CB 2QZ9A 3N0XA 4EEXA 1BI8B 4F56A 5CK5A 1YB1A 2XNJA 4LXGA 1YONA 2N9UA 3ZDQA 1SD5A 3VNUA 5JBIA 2ZAIA 1T24A 2XE7A 4LRTB 3R9XB 2JA1A 1PQ4A 3EMBA 2CLMB 1SB8A 1FTNA 2D6FA 4MYRA 1O58A 4JUCA 3FWVA 3FH8A 3X2EA 1ZH0A 1JUQA 4KFRA 1J6UA 2VYVD 4CEJB 3N5KA 2VPPA 3UKOA 1KDYA 1DAMA 1V95A 4LECA 3DULA 2R25B 1FTQA 1ZWKA 2JJQA 2WXPA 1PS0A 1DIOB 5AW8A 4YVFA 3ZDEA 1VJDA 2ZUDA 4YAWA 3COVA 2R6AA 2F3UA 1STOA 4C1BA 1PV1A 1H05A 4JR2A 1Y6JA 4B3DA 3LXXA 4PHTA 5ARCA 2ZS9A 1C9NA 1O08A 3EPRA 3CY6A 4J0HA 5FF9A 3W78A 4FINA 2Z09A 2H29A 3GJQA 4C6SA 1S3SA 4NYMR 5IASA 1FMLA 4EARA 2FPMA 4YP9A 3FDIA 1MO4A 1ZINA 2Z4RA 3P5SA 1KOLA 3C8MA 3ZZ1A 4CL8A 1T6XA 3TAXA 1C1DB 4H7DA 1CFZA 4HFGA 2O3SA 1H6AA 2RH4A 1ZSVA 4WNGA 4MV5A 4NZNA 4I43A 2H5EA 4N2QA 1F20A 3ZZUA 3A6ZA 2RONA 3FLMA 4AXBA 1XLUA 5AW7A 1W93A 2QW0X 4IHAA 5CDUA 3FPJA 3R7BA 3BMXA 5JVDB 4L74A 3ZE2B 1FYVA 4IOLA 4JR1A 1Z4OA 2PGOA 2X9NA 3EXG2 5I7OA 1N9AA 1PG5A 3TWSA 2I4RA 3H0EA 3KAKA 1WWKA 3I01A 4R7LA 5AW4A 1XSEA 1NURA 3UC9A 3UPUA 4UWKA 3DE0X 3L7YA 1TNDA 1BS9A 1EGVB 4LPSA 2E4UA 3ZXYA 3LZ6A 1JAXA 3LYLA 1SXIA 4ZVSA 1C30A 5EIEA 1WF3A 4HB3A 4I4TF 3KQYA 1D8AA 1EFVA 3RSSA 5COQA 2RG1A 4FUTA 4B3RB 2O20A 1R4ZA 2HCBA 1LQUA 1CS4C 2F1IA 3OPVA 4YRNA 4IVNA 2GSDA 2HWWA 2JGMA 2G9UA 2P90A 2EERA 4QDJA 2ZBFA 3AFNA 3AVWA 4N47A 3J81A 3A06A 4D57A 5FBRB 2DZDA 4G09A 3JQFA 3V97A 3E2MA 1TK2A 4AX4A 3R3YA 1AA9A 1DCQA 1NMSA 3FXAA 2ESRA 3LWBA 1XWWA 2ODBA 4KOAA 4RJIA 4OGWA 1T5BA 1A77A 1O0BA 3K9CA 5G2OA 1ISIA 1GKUB 5KU1A 5K99A 2W2QA 3CH5A 1HG5A 2IT1A 2ODEA 1Z6TA 4H1HA 3A7DA 3LQKA 4DF3A 3IKLA 1BRMA 1PNRA 5IVKA 1RWMA 1GCOA 2I8CA 4TL9A 4BVLA 1ORDA 4DR2B 2MSKA 4RJLA 2GTIA 1ACMA 3L82B 3IXQA 2WXKA 3PNKA 2WJAA 3KSUA 4F85A 1FMJA 3FWPA 3KU1A 1QZ3A 2ZJ0A 3A9WA 1RI1A 4DANA 5C37A 5KTPA 4TUYB 4IQ8A 4R2KA 3SR4A 4F8EA 4OXYA 3LBHA 4E0BA 1RZ3A 5BSTA 5EZSA 2VRWA 4UFPA 3L04A 5E1BA 4HV4A 1T3HA 2ODNA 4IVQA 4DXDA 3THYB 4BQEA 4KUHA 2V5VA 3L49A 3AVPA 4E94A 3RSLA 4POOA 1FL9A 3S70A 5ALJA 3NGLA 1NUQA 1RLUA 3FAZA 4NJEB 4I0WB 4Q3KA 3B3JA 3PGLA 4MJ3A 4MPJA 4Y2SA 1C3VA 2TMDA 1RW2A 3V8EA 3E9ZA 2R8XA 4K5AB 3Q7PA 3RYHA 5L45A 1Q7CA 1UK7A 3CKYA 4HWOA 1EXVA 5SYMA 3I1JA 3Q6NA 1VHTA 3AONB 2OOKA 2H5LA 4FCTA 2CHUA 4PPQA 2EWVA 2NSJA 1QDUA 4KH0A 3AM3A 4I4TA 1KBZA 3ETDA 2RSLA 1F6WA 3MWDA 2NQTA 3WRYC 1NF8A 4TXNA 3HXDA 5DM0A 5FTMA 1KRHA 1DEHA 1V71A 1Q0SA 2IC5A 2XQGA 3RYFB 3OCWA 4XWOA 5ICCA 3HA2A 1G9TA 4HFMA 3STVA 4DA8A 4RHEA 1XPUA 3T5VA 2K7ZA 5A3SA 3ACBA 2QU8A 5BSWA 4Z1MD 4EYEA 1Q22A 1ZA1A 3MT9A 3X1XA 2BFBA 1N4DA 1VSQA 4RCZA 4GEGA 1F9AA 1G8AA 4RTSA 5AM0A 3FLEA 1IKND 4LI3X 5AK3A 2EHDA 1KDRA 2D3WA 1WXGA 2AA3A 5B3AA 4A3TA 3NNDA 4W4TA 2BFEB 3EGCA 4QYTA 2D06A 2C98A 1HNWB 4EQZA 3RTBA 4YUAA 1ETHA 3HDTA 4RKYA 4KC0A 3UMYA 4KVAA 3LRPA 3MLAA 3MKQA 3NTLA 1R0LA 1KQPA 5F7JA 4AF7A 5B2EA 5K0FA 1JKMA 2Q0XA 5BQPA 2PSJA 3D54D 2VWGA 3QKSA 4JVLA 1R3UA 1T1EA 5BOSB 5D84A 3GMIA 3OZUA 4FLBA 4XVHA 4AS3A 5JJBA 3MYRA 4RYDA 2LDBA 4NOMA 4DZTA 2V3WA 3A1CA 3W6ZA 2VRCD 3B6MA 3KQQA 3QE9Y 2X3MA 4CMGA 5FOQA 2YWJA 4PRLA 4ZHBA 4ZJZA 3BMCB 1MUUA 1IJBA 4YASA 3SLGA 3APDA 3A31A 1QKKA 5DO9A 1CRZA 2OZVA 3EDQA 1KVSA 5KYKA 1BZYA 1Q7RA 2HK7A 1QGDA 1ITZA 3UOAB 2ATVA 4XVQA 3TTSA 1CZKA 1N4QA 3TGWA 3DHEA 1BXGA 1OGYA 1ZONA 1GY8A 4JDUA 4MPDA 3G5LA 2G70A 1Z0AA 4MUYA 3BKXA 1N36B 2IODA 4XUDA 2VL7A 1ACJA 5AHRA 4JJ4A 3EGWA 3DHWC 3Q79A 4JL8A 2E5WA 3UWMA 4F7AA 1GW6A 3CVJA 5C8YF 3BD6A 5TY0A 1IHGA 2GN0A 1JZTA 2PZIA 1DGQA 1LTHR 4PTZA 4DX6D 3OU2A 5C2YA 2BEDA 3S5JA 1QU3A 3M6AA 3FUHA 1XG5A 2Y77A 4AROA 3CTPA 3ULKA 3HDXA 3GLRA 3B13B 1HETA 2IELA 2VP0A 5CAEB 3ZRHA 1NA3A 4EMBA 2O07A 2Q28A 3I09A 3TLCA 1FTYA 1EQUA 1YJXA 3ZV6A 4XTCS 3H3XA 4IJVA 1T36B 3S7TA 4G0NA 4WFQA 3AEUB 3CRQA 3NG1A 5TS3A 1W5FA 1HH8A 4YDWA 3V7NA 3I6MA 2HRBA 5G0WA 3UAXA 2VHXA 4NX2A 1JQDA 3QEKA 3QE3A 3LLSA 2A92A 3L8GA 2F4VB 3V3TA 3AL3A 5DTIA 1QGUB 1RVDA 2EQAA 5E7MA 3T34A 1EXMA 5DBIA 3VZRA 2EQXA 1ZN8A 2G8LA 1IY1A 4W8GA 4EL5A 3GELA 1H3NA 3AF3A 4LV8B 4RTLA 3TL6A 4GRIA 3QDNA 4DX7D 2PVSA 4F6LA 1CTQA 5EXEA 3EGVA 4CRWA 2ZI6A 3H1GA 2R8BA 4RVUA 1EXDA 3QKUA 3CUTA 3U61B 1U94A 2IU3A 2NP6A 3K20A 1SC1A 2CXQA 4RTPA 1Z75A 2EJUA 4LZOA 1E0SA 1T0UA 1IY0A 5CT8A 2VHYA 2PSHA 4ICIA 1IONA 2Z95A 2LZ0A 1A5ZA 5AKLA 1F2UB 1OWPA 1HH4A 1A4XA 1EGQA 4Y9DA 4INJA 4DILA 5C9ZA 4NCAA 1RKVA 3UV3A 2J3HA 4K46A 3ND7A 2QAIA 3EW7A 1RHMA 1T9GR 5T57A 2YQ4A 2OBYA 3O4VA 4MPTA 3BSSA 3GJ0A 5L6MB 4FSHA 3L5OA 1YFZA 2X0IA 1QIEA 1IUNA 4CQMB 1ULZA 1JZSA 2WVHA 1R4NB 1KBOA 2EC5A 4Z8YA 3VISA 2D8MA 3NZEA 1M6VA 2GB4A 3BXPA 2N47A 3CVVA 2BMWA 3OQOA 5DX0A 3B20A 1H6PA 2IYVA 4D98A 4IIXA 3NUQA 4DA4A 4K5BA 1G5IA 4E2WA 3FWNA 4ZHQB 4M6WA 5C8YA 2FRVA 2PX5A 4KJXA 3H04A 3FVRA 3HP7A 3PNVA 2TYSB 4Y2RA 1HNZB 3UJCA 3OVMA 1OIXA 3H3JA 1RU3A 1H6DA 4MI6A 2Q6IA 2ZPUA 2W58A 2L82A 1OX5A 2WF8A 5JHHB 2P9IG 1ZEMA 1VDZA 1NBMD 3U4QA 4Q4CA 3OT5A 4F6RD 1XUOA 5BYAA 3C97A 1AX9A 3AR2A 3ZU2A 1ZM4A 3FKSA 4JITA 4ZEWA 4D4MA 3CVYA 3JQQA 4L8LA 3U4TA 5AKHA 1UKBA 4AQDA 3CUSA 1J2UA 3DZGA 3HTXA 3TR5A 1L5JA 1C0EA 4G5YA 1X8XA 4U7JA 1Z0KA 3P32A 5DXJA 1YQWA 3G6KA 4TZKA 1A9YA 5CYOA 2W4QA 4XCXA 5ANLA 1KORA 4N6GA 2FPPA 5AM4A 3REOA 4KXNA 1GWNA 4LBWA 2QTVB 3RYTC 2VATA 1SXJD 2AN9A 2C7BA 5EAIA 5I7WA 2CYBA 1X7WA 4D79A 3P0JA 4MINA 3DEKA 3M1LA 1MJGM 1XN1A 3OLXA 4QFMA 4UE6A 3OMWA 1QV6A 3R3JA 3L1KA 3CTMA 2X15A 4JAVC 3V4VB 3D9JA 3KQMA 1QH8B 3OLCX 8GPBA 4UWGA 3IVAA 3UN1A 1U9YA 4LHYA 4WRRA 5CT5A 4BNMA 4QUJA 1FC0A 5EVJA 4FGUA 2X7JA 2HDWA 1QNFA 1Y3AA 1B8VA 3IMEA 5D00A 4WIAA 5C4MA 2VI5A 4DNFA 5L4SA 5B30A 4QYWA 5HQ3A 1L2TA 2COUA 1B1CA 2WPNA 2V7TA 4UM8B 1ESCA 2BGGA 3Q5DA 4UPVA 4RA9A 2FW9A 2HRDA 4ZQIA 4KX3A 2RGRA 2VGXB 3DEAA 2IA5A 1LC0A 2WJ6A 1FJ2A 2WV7A 5K0EA 3RREA 3SVZA 3DL2A 3VTZA 1TM2A 4LMBA 2Z04A 1NF3A 1NAIA 3SYTA 4QOHA 3TNDA 3BSWA 4A91A 4YHBA 4FUQA 1OCEA 1ADYA 5K6TA 4BNUA 2D0OB 3L77A 3G49A 5K3CA 2YJ5A 5FUYA 1H6OA 4BESA 4CEIB 1ZN7A 2P62A 4X1IB 1OAOA 3AUYA 2VA8A 4PLVA 2Z43A 1BMDA 2JH3A 3LHIA 1JJBA 2GAFA 1NXWA 1XJ5A 1DCMA 1OFTA 4C76A 1SCJA 2FGKA 3Q7RA 3PF9A 1HE8A 3U81A 3V42A 3E84A 3PRJA 2OHGA 4JCCA 1M9NA 2WP8J 3A14A 3C14C 3SDBA 1GAWA 2VYFA 5DP1A 4I2WA 3FOBA 4QBGB 1RIFA 3OEED 4EDHA 1MG5A 1AGXA 2WU4A 1IJEA 4NCBA 2ZUTA 3DDOA 2A9OA 1ZOPA 3QIAA 1UOEA 1P19A 4TPKA 3PBKA 2CFTA 2JGDA 3CLRC 3H5OA 1XQVA 5AVKA 2GKGA 3IALA 1PSDA 5GQSA 1F38A 4UVIA 3VSCA 3EDMA 5J4LA 1NE7A 2D0PB 5ETJA 4WY8A 421PA 2MSWA 3S1AA 1K7EB 5IC6A 3NO4A 1Z7WA 2PMFA 3DVQX 4LJ9A 2P75A 2O5RA 2NV0A 1BQ4A 1NPYA 1WUTA 2ZR8A 5AW1A 3CH7A 4Y6RA 5D66A 5FD8A 4NAUA 4QDUA 4U4AA 5FORA 1HEYA 3Q9LA 1OXKB 4MVJM 5F9FA 1CDOA 3IEIA 2H57A 2JF0A 5KOIA 5AUNB 5JWHA 1BVUA 2WU0A 5DIFA 3SKXA 4REMA 4B3JA 2IPLA 2DP4E 5ITSA 4F1PA 5AVWA 3BXZA 4A7PA 2VK1A 3D0RA 2I2WA 3ABRB 3HGMA 5IX8A 4M37A 5CLIA 3IEXA 3WLQA 1DRWA 1UC5B 1NLZA 2EKBA 2X8WA 1PG0A 3B89A 2QJOA 5GZ1A 2ZANA 4OI1A 2HMVA 3D4NA 1NBAA 1KZ1A 1X39A 2EARA 4BPRA 1EVYA 2QD1A 3ZHXA 4N5DA 2ZRQA 1T8YA 1LNSA 3B48A 3HO8A 2GYYA 2Y1CA 2MYNA 3KU4A 1YI8A 1TA4A 4M2LA 3ZTWA 5ENOD 4WZBE 2BMAA 5K0GA 1SU4A 3Q3IA 1M6EX 4WY5A 1MQ8B 3IUNA 1MNAA 3VUEA 1FU7A 1LPBB 3GCDA 5GV8A 2B37A 3DBHA 3EXHB 1WCWA 5TIIA 1YA6A 3MJWA 3UJ6A 4KQ2A 3IILA 2WDPA 2IYWA 3OUUA 5FKJA 1HI9A 4A0QA 3CSDA 3PRHA 1CBUA 3N2KA 4QT4A 3VJKA 2YJGA 3VVMA 3DCNA 3K09A 4R9NA 1XZMA 4Q9LA 2VT6A 1WMSA 3UV7A 1WHSB 1O5TA 3G8BA 1II8B 4OJNA 2NO5A 1RKUA 1NG1A 4A2CA 3G68A 2ORWA 4G1TA 5BPFA 2A58A 2ZRMA 2E6UX 1Y37A 3NEJA 1E3WB 1X80B 3ROPA 5CLJA 4ARSA 2ATIA 3WYNA 1FOEB 2WJPA 4ND8A 4GVPA 2HLDD 2J30A 4M1MA 4UHEA 4JLPA 5IM5A 3GGGA 1HLDA 4OL0A 4W9RA 2GF9A 2YX1A 1QR6A 4XXHA 5D1NA 2ZI3A 4PBRA 2RGNA 1JHDA 4U7HA 1ZESA 5EC8A 1HTWA 1B8PA 2EFEB 3HNOA 4WNIA 1M5UA 3UQ3A 1RWQA 1B14A 1D0SA 3TF5A 1Z2AA 4DPRA 4KUEA 1Y6GA 1YO6A 5F5NA 3E70C 4MQ4A 4EHLA 4A5SA 2GRPB 1A97A 4B3SB 4ZALA 5HCIA 4KG7A 3RUFA 1L5OA 4ZPJA 1T3ZA 5IABA 3A9CA 2ZWPA 2G72A 4U2KA 3IIEA 1SA0A 4ZYYA 4LVNA 2CZGA 3SNKA 5C5DA 3CRRA 5ADVA 1T1IA 1PWZA 4JXKA 3RUAA 3NHRA 3D1VA 2JAPA 4BGIA 1S70B 3PK0A 1W1UA 3ZHSA 4TSKA 4CDGA 1R8YA 4MRUA 5JFGA 2D4AA 2X77A 5LA6F 2C2BA 3FHOA 3K05A 2QPTA 3GD5A 4OMCA 2JLWA 4DR7B 4UMDA 4FZJA 2DH6A 3KALA 3TPZA 4B6FA 5AI8A 4NH4A 2I5PO 5I4KA 1IXYA 3PSHA 1YFLA 1GAJA 3VR3D 4EUEA 4NDNE 4MEJA 4HH3C 1BX0A 1H4SA 1JQAA 3HRIA 2CHXA 3RS8A 4A6XA 3UM9A 4FFRA 3M34A 2YQ5A 1SHKA 3OLVA 1E61A 1XWFA 2NP7A 1CF4A 2PUVA 2ZDHA 1R74A 4GD3Q 3EDOA 3W6UA 5BVHA 2QM8A 5AQ9A 2R7NA 4JCOA 1CJCA 2GRJA 3PC2A 2XGMA 3KJZA 1RXCA 3TQRA 1PR0A 1FFEA 4BV2A 3S2UA 5DNCA 1YZTA 1DIGA 1T9KA 1G6OA 3QJYA 4AKSA 3QUCA 3PUYA 3WLNA 3RM3A 1VMDA 1V0JA 2FZWA 1GGHA 2QV7A 3LUGA 1BHJA 1US8B 1FPPA 3ROFA 3A1DA 3N9IA 4WWHA 1KNXA 1S4MA 3ID6C 1IPHA 1MW8X 1UAAA 1LXCA 5L9AA 1Z83A 3SIPA 2FEXA 1P3DA 3EVAA 3N07A 2DC1A 3APCA 3N8NA 3F8WA 3WYAA 4JB2A 2IJGX 1XD9A 5A5GA 3H0KA 3P9XA 2ZJYA 3Q12A 1KMHA 1E59A 4IX1A 5THKA 3W5VA 2ZRIA 2DSNA 3QVLA 2WMDA 1NDQA 4F4FA 1Y4SA 1RNLA 3PI7A 3E05A 1D1PA 3VYSB 1H69A 5BPHA 4N7JA 3S1LA 5AVSA 4H6VA 4ERXA 4G81A 3L4EA 3BWBA 3GVXA 2VJOA 1YA0A 3C1TA 2V9CA 4HQ0A 2RBEA 3RFUA 5LP6F 1HZZA 2X5OA 3W1VA 3PCXA 3B7RL 3TEJA 4JL6A 5T67A 4DLRA 5EJ5A 1GR0A 3ADBA 2Z6UA 2LE0A 4KACA 4A92A 3JYSA 3UJDA 1U80A 3NUGA 3IE0A 1JH9A 4RZXA 1ZD2P 1NYLA 4DVJA 3N6RA 4HLNA 4YN3A 3F78A 4GC5A 4O3FA 3LYHA 3S8MA 2XWJI 1RD4A 5I45A 1XCBA 1J99A 1IVNA 3X2QE 1Z4KA 4FS8A 3UICA 2WXJA 2GROB 4IDGA 1FX0B 3OTHA 1USIA 3WBJA 3AH8A 4PZAA 5LA6A 3VZDA 4RL4A 1GNQA 1Q0UA 5EJMA 1YUMA 4YYEA 1J20A 3MIZA 4B2IA 4MKRA 4KQGA 4MARA 3G5TA 3B12A 3SLKA 3SX0A 5HGXA 1B74A 2PQ2A 1JWFA 1YRWA 2VK8A 1FA9A 4ECAA 3AW8A 3L92A 3CB2A 5TQVA 4RXTA 1NP7A 1L4YA 1S8NA 2PZGA 3VKFA 4BP1A 1ISPA 1IN4A 1INLA 3TRFA 3Q7IA 4C0AC 2C5EA 1GPAA 2A9RA 1IEXA 4RS3A 2OECA 3IR6A 3V46A 2FMTA 3CXRA 2WJWA 5GM2A 4B4OA 4Z3DA 1GRNA 3F6EX 3D2BA 1W75A 2IZ6A 1KMNA 2V7VA 5IWCA 1SG0A 2ZSFA 10MHA 2NIPA 2W2PA 4HAWA 4DG9A 5BSMA 4ZVTA 2FUCA 3QYAA 3NT4A 4TYYA 1Q1GA 1HR0B 3B3FA 4H1VA 3I8OA 1WDKA 3OETA 1OREA 3H2IA 1WQ4A 1SY7A 3BFJA 3LFUA 3MCZA 2FWMX 2EYQA 2I6XA 1SC9A 3AETB 5I4CA 4MQEB 2QZPA 4RTQA 3NHAA 1KOFA 1KI2A 1K3UB 4KT6B 3PNLA 2CVOA 4NS4A 5FBWB 4V0SA 1KK1A 2DOKA 3RNOA 2KZTB 1M8KA 2BKUA 2DUNA 4GYWA 2GBLA 2W98A 2E1RA 1QFJA 2RHHA 2WIDA 4MVJI 5LP6A 4ZV4A 4UULA 4TLDA 1JSRA 4KFTA 4O0MA 5DGIA 1PGOA 4QJ4A 3AR4A 1XPJA 1O77A 1KWKA 4PG7A 4XSHA 1E8NA 5A23A 4MLDA 2Z98A 5CURA 3WMWA 4RGVA 1Z5NA 5HTOA 2RHJA 5EZYF 5IXYA 2DPHA 4JKIA 4LCTA 2OO3A 3CVPA 3LW7A 5AYWD 4UAJA 4AM8A 4KXQA 3V2HA 3I64A 4ZMRA 1EB8A 4UBIA 4OM7A 3ESKA 2WIGA 1E4EB 2BW0A 1L7OA 4G9BA 3CVQA 2VHZA 4JROA 4Y6GB 1I7SB 2ZG6A 2W6ZA 5SYNA 1KI7A 5I7VA 3OTQA 3HCPA 2C58A 1DZ3A 3DMDA 4H60A 4CIYA 2R96A 2V7QD 2DG2A 4G24A 4YJFB 1NUTA 2J07A 3U6KA 4EO9A 2JABA 4FYWA 1SNYA 3F3KA 2P77A 3NI2A 3IV7A 3EGDA 3ONFA 4LI0A 3BTSA 3ZTTA 1MX3A 5I8PA 1W48A 3D6UA 5TMPA 4DCSA 1V3VA 2ZTHA 4TTPA 1RT9A 3GYBA 3CHPA 1LVHA 2FUG6 2BKGA 2G4CA 1LV7A 3URKA 4DV0B 1TM7E 4JKOA 5ALLA 1ZCAA 3B5JA 1TAUA 3OEHD 3EA4A 2OYCA 3GDOA 1GKYA 1SHTX 4HNAB 3C6MA 2ZIAA 2IY8A 3URZA 5JNTA 2WUGA 5CFQA 5TQ0B 1B1AA 3E48A 1LV8A 3A37A 2P78A 1O6GA 1KYWA 4W1RA 3A3OA 4XR4A 1G0OA 2BGLA 3PZ2A 4U2DA 3VAZA 5JHBA 2X9GA 3MLEA 2W6JA 3TI7A 2WUWE 4BDSA 4PGAA 3B5IA 3A1WA 5KTNA 3CNLA 3NHLA 3DQQA 1U3FA 1TO2E 3RGGA 2CWWA 4G25A 3RS9A 4M7CA 1NSTA 2O6HA 3QLUC 3H5VA 4W1QA 3GAFA 3ZWCA 1Z34A 4BLWA 5J90A 4LJSA 1OH5A 3HO6A 1TN7A 1WMEA 4BQIA 5HZHA 3IMFA 5EIBE 1CR6A 5JT1A 5EKQD 3F6CA 3JD0A 2FQWA 3E5NA 3T3IA 2W5UA 4IQFA 2BFDA 3FOAA 5JA4D 3NH9A 2F8YA 5MN6A 4L4XA 3HXMA 1NE2A 3OJFA 1OY3D 5EZYA 1GTMA 1WHTB 3CYFA 1DRJA 1WPRA 4IIGA 4FDUA 4CV3A 4GMDA 5GIPE 3RTGA 1YZHA 3TXYA 2XA9A 3NM6B 1EVEA 3RKVA 1QZXA 4R7GA 4ZXFA 4F3NA 4HN4B 1JFFB 1WLYA 2QZZA 1FYEA 2IHJA 1D6JA 5B2ZA 1IIRA 5ALSA 4OX9Y 1JKJA 1MJGA 1ZCZA 2VDLB 2YNQA 1RAGA 3ZVLA 5JJ7A 1M2VB 2Z9BA 4PCLA 1O6CA 3VU9A 3SOPA 1V7CA 2DCPA 1GZ4A 1PR4A 1Q57A 1FVOA 1EK0A 3GRCA 1OYOA 2XS8A 1VYVA 3T9BA 1KPGA 1AQ6A 4QEDA 1AB5A 4BXOA 1T3LA 4H7YA 3PDCA 2WE7A 1B26A 1EWVA 4TVBA 4HQOA 3VO8A 2ZWIA 3ZVMA 5GP1A 3EQZA 3H7IA 5KNCD 3REQA 1DAHA 1AB6A 3WP1B 3C5EA 4V02A 2GHQA 3DWIA 3R8XA 4YP5A 3ASOE 3QEOA 4Z6KA 5DKFA 1X7GA 1M2OB 1OCRE 2QPAA 1A04A 3HLYA 4H7JA 4R2IA 4XYGA 2RKWA 2GD2A 4JBGA 3D9KA 1XE3A 2P4SA 4MVJE 3H19A 1KEZA 1SBHA 4AJHA 4OPMA 3OM0A 3ZE6A 3D3KA 6ABPA 3BJRA 1L8LA 5B36A 1JQEA 2JAOA 2C4TA 2FSVA 2Q3LA 2FZVA 3D4LA 4W1SA 2B2NA 2OO5C 1TAHA 1GTZA 4LZJA 1P18A 4TLEA 2UXCB 1RJDA 1MB4A 3MRXA 3RADC 2L0IA 1Z8FA 1E1NA 3I9FA 1VGRA 3CEAA 3T3NA 2XHEA 3U3WA 4BLTA 4OYLA 5A9SA 2HHLA 3CNHA 3M3PA 1PNVA 5C18A 1Y1TA 2AKEA 4GTRA 1DJQA 2H06A 2I7DA 2Y1EA 1X7XB 2VUHB 4PIPA 3I5YA 5KNCH 3R6GA 1E2BA 3CONA 3U3KA 2JLVA 5SZJA 2B1GA 1C2TA 2FKNA 3JQ6A 4PWYA 2FZGA 1U3DA 3JQAD 2R85A 1L4FA 4EGCB 3IH5A 2Q0SA 3CO0S 2QDKA 1RWWA 3HZOA 2OYRA 2JI8A 3QUAA 4EQ6A 1MJFA 4UCWA 3VDXA 3DYIA 2HA5A 4KDRA 3KKMA 5T3UA 3R5XA 3AHEA 3GXOA 2G5GX 4AVYA 3QA3E 3I05A 1QX4A 4AF8A 2MDTA 5F1OA 4I9CA 2PX6A 3WKAA 3PWTA 1L5WA 4UUQA 4E5YA 1XF1A 2DWUA 2AXEA 1QMPA 2O59A 4XIGS 5ECGC 2ZXFA 4I8DA 3T9EA 4RY8A 2AQKA 1XU4A 3Q1LA 2CXOA 3FBGA 1UJMA 3FFAA 3ESYA 4ND5A 4JFAA 4A03A 3I2FA 2ZWVA 1RM5A 1YQUA 1VA5A 1Z4QA 4R9UC 1Z08A 2VQDA 4D9MA 3KQNA 2X40A 2V6BA 3K9WA 5BR7A 4O2LA 3FFBA 5BUCA 3GFOA 4B45A 2X22A 4L7VA 4AZSA 4D74A 4CKXA 2G83A 1M2HA 2UZIR 4XX0A 3VFDA 3L18A 2YJ3A 1GSHA 5ALWA 1VG8A 1DO0A 4MRPA 4NOJA 3HFRA 3TIXB 3DOCA 1DT5A 1KK3A 4ZEOA 3GQBA 4DY4A 1X1RA 4BMVA 2WUFA 5CBKA 4P83A 3VKVA 4AZWA 1U2VG 4I1OA 3RRBA 9MHTA 3MWEA 2XQJA 1HFKA 2PUCA 3C3AA 1W34A 3LUJA 1JWAB 5TV2A 1MJ0A 4OB6A 3INRA 3VR6A 1TL7C 3ISVA 2OVFA 1P5QA 2X0KA 2ZYHA 1RXEA 1ZJ6A 4NMXB 5D2CA 4ATZD 4PCVA 4Q39A 2JGAA 2REBA 4LSZE 3U9SA 4ER5A 3D9OA 2GCOB 1W5SA 5CBOA 3SOZA 1EVLA 4KKXB 2GBIA 3TOCA 4AIIA 3DGEC 1JVNA 1XX6A 3L8YA 1CUDA 1XZDA 1XFDA 2VF7A 4YCCA 3HXOA 1OZ0A 1QJCA 3TLZA 1R0XA 1ZITA 3UTDA 4UC0A 2P9LG 4OCZA 3C5CA 4UUPA 2IEAA 2HIMA 3V8PA 4LZNA 3UVEA 2RKKA 2A9PA 3CNOA 3RKRA 4UEJA 1TM4E 3BK2A 4ZZ1A 2A86A 1RADA 4S04A 2P3SA 2PIAA 2WJYA 2C20A 2JAXA 3ORYA 2QTTA 4C2UA 5FNZA 4O0LA 1ZMTA 3QU4A 1KE1A 1U8UA 2X6RA 3AU9A 3KKLA 4GI1A 2DLCX 3ENWA 4AVXA 1RBQA 4HOSA 5TX7A 3C3QA 1TEXA 4D8YA 5HRYA 5AM1A 1IAVA 3JRXA 2XUJA 1LTKA 1GDDA 4J0KA 4RPJA 6REQA 2QYOA 1U02A 1AF4A 1EPUA 4EF6A 2RK4A 4P4SA 2P9BA 5D2MC 3C6YA 3CBGA 1BAPA 3BXOA 3L4SO 1PV2A 4BO6A 2IXGA 2WT9A 1JIXA 1NIPA 2PHZA 4QICA 5JS1A 1U8AA 1KQGA 4MWOA 1EB9A 3R9MA 3H5TA 1Y8RB 4B8CB 3FGOA 4A8JC 1BOOA 4PNEA 1Y9DA 1UAGA 1AWCB 1UBKS 4BZZA 2C84A 2C4MA 2WNSA 3DOHA 1ZAYA 3U7HB 4OMFG 5T3YA 1M1YB 2H1VA 1Y0BA 2QU7A 4D4LA 4IN3B 2DY1A 2XUAA 2KS6A 1BXRA 4PVDA 1PW5A 3KNZA 5J63A 2VXBA 2IUTA 4QGSA 3UIEA 4D9EA 1YIAA 3ZY5A 2QGFA 1GNPA 3LDZA 3CZQA 4QXQA 5TMEA 4R7ZA 3EC2A 1X19A 3KELA 4XEHA 2IEYA 3SD5A 2QUHA 4K1LA 3UW1A 1KSGA 5FQNA 2Q1TA 3W8RA 3HV0A 1DFGA 1BU5A 3FPSA 2JIZD 4PO3X 5I7AA 1GNSA 1EM8A 1E7MA 2B21A 3SWWA 1GL7A 3ZCUA 4I1RA 5CDHA 1XRPA 3KBBA 4Z4IA 4E1AA 2ZRPA 4GFDA 4QXOA 3JW8A 2QMEA 1Y5IA 1SZJG 3HDVA 4EPRA 1L5HA 2XCCA 3ETGA 4R41A 4DXHA 2CVQA 1UW4B 3SQDA 3CUWA 3DOEA 5CB4F 3STUA 1RPJA 5K5EA 5I4IA 4R8VA 1WABA 4ZYLA 5FJIA 2Q5CA 3H8JA 4CV1A 4RKWA 3EXIA 4EG6A 4GTMA 3DFMA 4J0EA 2OAP1 5JSYA 2CLLB 4XH9B 5EE0A 4WASA 1EF1C 3V2OA 4B4KA 4QDKA 4AP5A 4Z4EA 3IUMA 2HM8A 2RCYA 3T1OA 2CVFA 3D8SA 1LFDB 5E76A 2ASVA 3CKKA 2P9NG 2FW6A 3U0VA 3X1JA 4GO1A 2FQ1A 4BNLA 3WZ2A 3TLEA 3MZLB 1Q20A 4C3UA 2A6PA 1E1QA 2P30A 5EPEA 3STYA 2PCLA 4D9FA 5I9SA 2HDNB 1JEEA 2HT6A 3GEIA 2FQYA 2RI1A 3ZEAA 3VA7A 3CLSD 4R51A 4A26A 2V6FA 3B7SA 3SS7X 2VDNB 1BN7A 4HDRB 621PA 1EFPB 2G67A 1GNTA 2G9VA 2D1RA 3R6DA 2HIGA 3VDMA 2A5EA 1KYIA 3LE8A 1G17A 1UBNA 4Z4FA 4DNQA 3S2FA 1OC2A 4L28A 2EU8A 2NU7B 2W2NA 3BJIC 2CYAA 3RK4A 1T4GA 4HDOB 2G0AA 3G1UA 2PGAA 1A5BB 3V4OA 5DASA 1Y3IA 4LFAB 1A8IA 3I4RB 5IYZF 3P4XA 3ZKAA 1N0RA 5EQTA 1IBSA 4L4ZA 3L01A 5HF9A 2NTVA 2VP3A 5JYDA 3BCRA 1T5OA 4LUNU 3X2FA 3GMSA 2VSOE 4BKUA 1FTSA 2QZJA 2X14A 4AMVA 5DI3A 1MVLA 2Y3IA 4BX9A 4GOXA 2X2OA 3AU5A 3QBVA 2CDAA 4PG6A 2IE0A 4N2SA 3ILYA 5JFTA 4FB4A 4XE0A 4XD7D 3S2AA 4OFWA 2FW7A 5K8CA 3WLRA 4ZQEA 5KO2A 1YCFA 2YRWA 4ID9A 5K20A 1DARA 1P7WA 4KBQA 4L57A 1JFTA 1ZHFA 4JHKA 4RD2A 3PZ3A 4S1PA 3COWA 4KI7A 4KQFA 4HWPA 2K5UA 1JW9B 4OKSA 4W5RA 3AEKB 2NTYC 4R1MA 4UWHA 1FUEA 4IKEA 3BQOA 4FVTA 5J08A 3D8TA 4UOQA 5CB4A 4Q9IA 3KCQA 4AAYA 2ZRHA 4PLZA 4RFSB 3I2HA 3U3RA 3ZIAD 3KZXA 3WZLA 1HYQA 4I14A 1A4IA 4GYOA 4RD4A 4F8JA 4P86A 3QJGA 1HSZA 4DLOA 3OFJA 3SC4A 3BWYA 4DYHA 5E2IA 5DNEA 2C97A 3OZBA 5EUCA 4YP6A 1ZGJA 3OZAA 1IMJA 3RPEA 3QTTA 4BTLA 1V41E 3AUTA 5KCMA 3QQPA 1PDVA 1RLIA 3MV3B 6ADHA 3LT4A 2GVZC 3QQ5A 3JQ0A 4EELA 3O91A 2TMGA 1D07A 5A05A 4GTQA 1W87A 4Q05A 4IDQA 4QX6A 5IULC 3PE3A 1WAO1 2XVYA 4Q1AA 4WXHA 5EGSA 2C1EA 5BW6B 3UT4A 1F4VA 1DWUA 4F5WA 1P1FA 4JXJA 1QDEA 3F7MA 1JR4A 3F98A 4J0CA 5E1DA 1QNLA 4ITVA 1TKCA 2DT5A 1V5EA 2VJAA 1ACLA 3PUHA 4K9DA 3DOJA 4RMNA 4EUHA 5AW9A 3L0SA 2F00A 4HLCA 1I3NA 4UBMA 2X3UA 4E5SA 1N95A 3QC1A 5KJNA 3ASHA 4E11A 3R0IA 2I9KA 3IHLA 1AZSC 5IYZA 2EZ4A 3C3BA 2PUFA 2YWXA 2GD6A 4EJ0A 1XVIA 3IKMB 4JY7A 4MQLA 4G0UA 3SXUB 1E32A 5BRAA 4RORA 4ZOBA 4FGWA 2C3UA 4JKYA 3UGQA 2B9EA 2IEIA 2XNKA 1USUA 3MJEA 3UWOA 3BTOA 1BFDA 4BO8A 4EGJA 1HG0A 4EZBA 3WSWA 1HQCA 4EJMA 4IMJB 3H5LA 1MX1A 3FPEA 3KSLA 1U1DA 1IWPB 2CNKA 2FOLA 5B1DA 3G2MA 4Y2GA 1P4AA 1RKQA 3QNKA 3P2OA 1GKIA 3WDLA 1W0JA 2BEVA 1N78A 4NONA 3KB8A 3HCCA 4HAVA 2D2VA 5BQ3A 3WIBA 1VIYA 2X0FA 4BQNA 4F60A 3DBSA 1P0PA 2XDAA 3LDHA 3GAAA 4PYRA 1FFAA 4AZ0B 4N5IX 4G4SO 3I4LA 2BCJQ 5EG5A 3L02A 2BMEA 1EE9A 2C29D 3ZHZA 5AAOA 2WD7A 2J0EA 4ACAA 1M72A 4HGRA 3WL6A 2P2SA 1JS1X 1AMUA 1MOZA 2I3ZA 4BTAA 4XAQA 2EKQA 4XTRA 3WQSB 2XUPA 1JV2B 2QP9X 5BVGB 4CNBA 2XD4A 3GPLA 3RTEA 1ZR2A 3S7ZA 4TT3A 4OGKA 3FB1A 1SHZA 1SBIA 2ST1A 2XWQA 4BU1A 4EFMA 4WAFA 4M7WA 3P19A 2X7XA 1RI3A 2A7XA 1KZYC 1QG0A 2C31A 4HRXA 3OZFA 4G85A 4NEHB 5H5JA 3W5AA 1P81A 1S2OA 4TTAA 1W2HA 1JGTA 1YZQA 2DM6A 2VCHA 2D8AA 3HJGA 3O1LA 1KZ6A 5DXAA 2Z5GA 3UJ3X 1W9MA 4FDLA 1BCSB 3EBPA 1E1RD 2QRHA 4JWKA 5KYWA 1SCIA 4RK0A 1WZCA 4R83A 3RHSA 2CLIB 1IOVA 1O1SA 1E9VA 1OLSA 4YMTA 4WCFA 5H1YA 4QASA 3BPSA 3HKEB 4E4YA 3BB4A 1ISGA 3K5HA 2G09A 5K03A 2AFHB 1Z5GA 2RK3A 3DQPA 1VGVA 2YDYA 1F12A 2RFMA 4JIGA 3TMAA 1EA7A 4TXJA 4PYJA 4GBJA 4EX6A 3ONNA 5KPJA 4WLNA 2QJFA 3TQIA 5CXQA 2ZWOA 4MQFA 3PNSA 2E48A 4WESA 3ZE8A 4O2RA 5J1SB 4RVSA 4P92A 4J7XA 2M32A 1HDCA 2AZMA 4LCJA 2Y4NA 5TEWA 3RAGA 1RBZA 4KAXA 2IP1A 4IGFA 1VB3A 4X97A 4ZQGA 5BXOA 1VHQA 5LCWJ 4DGQA 1M6YA 3C3MA 2H2GA 2OZEA 3OJLA 2P4EA 3LXRA 1RLJA 3JQFC 4GOKA 5IJWA 4OXKA 1LTQA 2JAHA 1EVJA 4J16A 3VPFA 1ZL2A 4P7KA 2VJCA 3HN2A 1OX6A 5C34B 4IIJF 2QRLA 2H51A 4JI7B 3W6OA 4P0QB 3KTOA 1PJQA 1BKDR 4C4ZA 1RXWA 3AU4A 1NV9A 3JARB 2JGJA 1TEHA 1YBAA 3H2BA 4PYMA 1EJ2A 2P9SG 5IDXA 3U4CA 2ZAYA 1SUSA 2TRSB 1I8TA 2C4NA 1TNBA 4ABNA 4KHZA 4LQ4A 3O8QB 4OGFA 5K09A 5HKKD 4I4IA 3BHJA 2XYGA 2JFHA 1Y5NA 3PZ4A 2FEAA 2I4NA 4PNZA 2X6IA 5PNTA 4YCAA 4O4HF 3QTBA 1R8QA 1KOJA 2HR1A 2CLEB 3M1YA 2BDUA 4PO1A 4IKOA 2VYCA 2Y99A 1PN3A 4BFSA 2UUBB 4GR4A 1TMYA 1MQ9A 4GP6A 2Y3AA 3KYCB 1SKMA 2D1TA 4FYHA 4DCMA 4BGEA 1H8HA 5KINB 1E60A 2AI3A 1RAEA 2H6GA 1P29A 5C1PA 1L7AA 2QQFA 4X1YB 2NXNA 5TC4A 1LI7A 1U28A 4V0KA 3K9LA 1NQVA 4BNNA 4YUXA 1KMIY 5KVCA 2I1KA 2YBEA 4IQ0A 2AJBA 2P58C 3BXEA 1PDWA 1C8LA 2CK3D 3KZOA 4Y1EA 3TKLA 2MMCA 4F2HA 1QYIA 2PV0A 1A8SA 4UTZA 1ZU2A 1P4GA 2QLMA 5A7FA 1ENOA 4MR8B 2PUWA 4YAEA 2WD8A 1U2DA 1G8SA 5B55A 1G7TA 3QWBA 3FZEA 1TF5A 2BTQB 2C7OA 1TW3A 1VLVA 4RMIA 2KWIA 3WAKA 2XPZA 3WA6A 5CCDA 1QC5B 4LXHA 1AY0A 2V4LA 4KR9A 2JGLA 4HN2A 1L1FA 1APBA 4KODA 3T7KA 4UHKA 3EHDA 3FMIA 1XJWA 3LOPA 3WHIA 1RM0A 5EINA 1JDVA 2IXBA 4LJ5A 2J0SA 2WHPB 2HWXA 2QJTA 5F73A 4H31A 4DBZA 1HORA 4OXRA 3LC2O 4I1UA 1IM2A 1LLDA 2J3LA 3QGMA 4NABA 4BNDB 4DMKA 2I66A 4G6ZA 3H2ZA 4YTEA 1FRQA 4LRUA 3AF4A 3I1FA 1Y8CA 4IIJA 3PFIA 2FMIA 4DMUB 4L5YA 2C4HA 3Q3JB 1XTPA 3SJCA 2AC7A 3TLBA 5REQB 1GNLA 4CV2A 3K6KA 5E7QA 5AI4A 3VKGA 1R6AA 3NBMA 2ID4A 3JVVA 1F1BA 3GEMA 2H07A 4L3WA 3PQ8A 3UJ9A 5A4MS 3ENQA 3PHLA 1Y1LA 2FKAA 4Q1FA 3U7RA 2BTOA 3CZCA 1Q1QA 2DECA 3LH5A 4RUKA 5FCDA 1II9A 2BFWA 2F37A 1BJKA 4L0MA 4LOKA 4U63A 5AK6A 4AG5A 1Q19A 4UD2A 1L5SA 4O4HA 4YS6A 1CU1A 2YVLA 4UXHA 1O94D 2FWJA 4DNPA 3M2TA 5BYBA 3NIFB 1GLVA 1RZUA 2C2LA 3I8SA 3B7WA 1FP6A 3EIFA 3KEQA 2BJWA 3RIHA 4ERNA 1P1IA 3ANXA 3FBWA 1RFGE 4BTEA 3O1JC 2IHKA 2PRSA 3OTGA 1J00A 1U7WA 4B1FA 4ZI5A 1UN8A 2QC9A 1XZNA 5ENSD 1UF9A 1I3CA 2Q6TA 5AKIA 4RY0A 13PKA 4AG6A 7REQA 2ZI7A 1ECGA 1X9GA 5DM4A 1CEQA 4WCDA 3J5PA 4MV1A 4IIYA 4DB2A 4H7PA 1VL0A 3QI7A 1RXYA 5JZMA 1EVZA 2FP3A 5F98A 4GTSA 4LC1A 3IV6A 1XPOA 2EBFX 3LT1A 4F06A 2ZT5A 1LD3A 3IIJA 4CMAA 2NO1A 1P0IA 3ZBPA 5KWEA 4BV3A 4JMLA 4UAVA 3G0DA 1PQPA 4EHAA 3SG0A 2GJSA 5ED4A 2FUG1 1RBMA 1YU6A 4C87A 5A7GA 5ALDA 2IZ0A 2I3GA 3TLXA 4YPOA 5KJMA 4JQCA 5M2QA 2C88A 1PI3A 6Q21A 3LOQA 2Q27A 2C2WA 1N4RA 1SU6A 5CX1A 1JG7A 3CKMA 3H11B 3FDZB 4KXMA 4CT5A 4WZBA 2I2AA 4RD0A 3G0BA 1JNYA 4J0IA 3UWDA 4C06A 3SHVA 4BMSA 5B7NA 4CG1A 5I7EA 5HQTA 4A10A 5BT8A 1E2DA 3MA5A 2F62A 3D4BA 1FCJA 5CCBA 2CXUA 1A9PA 1JDTA 3TJZA 5DSZA 2NYAA 4BDTA 2JJ2A 2I0FA 2P2CP 3VH1A 3FM9A 5A04A 3VZQA 1D03A 4PEVA 5G0SA 5BNTA 3FH5A 2YICA 5JFOA 1L5NA 3DG9A 1CQZA 2IOFK 4HXIA 1KF0A 3BXGA 4CEMA 4I81A 2EKLA 1U0SY 3M70A 1RHRA 4INPA 3EVFA 1Y9AA 2HA7A 5LNK6 1SOUA 4PR3A 3KQTA 5E9WA 4DDMA 5BV0A 1XZPA 2SBTA 2PRYA 4INAA 5AKZA 2ECOA 2PMBA 3V6MA 3OAWA 1EWRA 4WZAE 5FUVA 2W70A 1LFAA 4DIMA 5HKPA 3MS7A 3V7YA 4JP3A 4BQQA 4OOEA 1ZIDA 3CMMA 1ZC3A 4LYAA 4QD3A 3JQBA 3WLKX 2NPIA 1NFQA 2GN6A 1DAIA 2ERXA 2X6TA 2H6IA 4PVCA 3RO3A 4PYNA 3RSQA 3NOQA 4RJJA 4BMDA 3S2IA 4LKOA 4FYPA 1C9DB 2ZUEA 1IATA 1H9AA 3CQCB 3EG9A 4I5DA 1YJQA 4LDJA 4F4HA 1SU7A 4D0RA 4WGGA 5EJ8A 3ZX4A 4DUIA 3DAFA 3RYIA 4GH5A 2OD2A 3ND5A 1JH8A 5IEBA 1PJTA 3DTVA 3R3VA 3RSGA 1FSZA 3FNRA 1Y6QA 1FCHA 1E2UA 1JAHA 1NVUQ 5B4VA 3IHTA 2Q7XA 1U7TA 3QTLA 4AKTA 3U37A 4GBMA 3FKJA 5B3JA 1PR1A 4H2DA 1WBJB 4XRGA 1TUIA 4J8EA 1C3XA 3VLDA 1XTKA 4IIUA 5DNVA 1KZOA 5GV7A 4OA5A 4ZJUA 3MBKA 1H1LA 1V37A 3O26A 4UM5A 1VHDA 3WADA 3FNBA 1RQNA 1P1RA 1KI6A 3FP3A 1HOXA 2HPAA 4BZPA 4KMSA 1FPQA 4MS3A 3EWAA 2CMHA 1ZOSA 1ZJWA 4DDHA 4CKCB 3R77A 4FXOA 1W36D 1NQTA 3Q4AB 4PX3A 4AKGA 1X7ZA 4QFBA 3SJUA 1ZISA 4C08A 1VRVA 1W8DA 4KYVA 1MIHA 2V6MA 1KDZA 2J9RA 4D4HA 4NFYA 4WXEA 3F2IA 1K6IA 4IHKA 1Z33A 1IB6A 1ILEA 3RAJA 3OICA 1G20B 2ENUA 4GZ5A 1MXHA 1A2OA 3UFBA 2NO9A 2O52A 5LYYA 2G63A 3H1EA 5M3BA 3DAYA 4ZVLA 2UY1A 1ZO8A 4H4DA 1G4UR 2H1LA 4YV1A 1J2RA 2Q2VA 4IIBA 1QGZA 2QD3A 4WLFA 4WZAA 5JSQA 2PQ6A 1JSXA 3KQWA 3PQ5A 1KVRA 2OZPA 1H66A 3V8NA 5FZRA 3U1BA 1CSEE 3CZ5A 4F72A 1JQ3A 5DLDA 2VLBA 1P2BA 1YKSA 3PQ4A 4Y67A 4UU1A 4PZEA 4G0WA 2C2YA 4RLYA 1J21A 1FMCA 1JXAA 4HDNA 2ISSD 3ULYA 1NMZA 4FFBA 3KUDA 1UPTA 4H4CA 4CM4A 4BB5A 4LGYA 3NW9A 4N41A 5HRUA 1KIMA 1WMBA 2PTGA 4B85A 4FHEA 1HNXB 4NKRA 4N5CA 2ZSKA 4E08A 4R2HA 1H5UA 1XO1A 3W9BA 5A1JA 2A84A 1AGNA 4KAAA 2O5CA 2PA3A 4W8OA 5TR9A 2EF1A 3R3SA 1N6KA 4JYBA 1XBTA 3WGNA 2BBWA 4LTDA 1T9HA 1VJTA 2FRDA 1E4VA 3LX5A 1YZVA 1RI4A 2IV3A 4LPKA 3BMNA 1A9OA 1PVDA 2OBFA 2ZB4A 1UODA 4J9VA 1QF7A 1EWTA 3K1TA 1JHPA 3ZHQA 5E2AA 4ILEA 2LO6A 3FLBA 1SUCA 5AVUA 3LPNA 1ECFA 3BHIA 1DTEA 3P97A 3UGKA 1FTGA 4ND1A 5LX8A 1YIOA 2NNLD 4FNGA 2BFFA 4C9BA 3DLPX 2Q1YA 5G05C 1YQXA 3LP8A 4AMUA 1P39A 4N7MA 4ROTA 1OAOC 1T1JA 2VBCA 2BOVA 3L8CA 4XKCA 3EQ6A 1M54A 3ROXA 3X44A 4WV3A 1K6JA 2I71A 4MWBA 1CY2A 3NWEA 1Y48E 5ALZA 4W6ZA 1N3BA 4U8VD 1F14A 1K08A 4MZXA 4DX5D 2HUNA 3ZYMA 5IM4F 3FZGA 4EHFA 1P44A 5JZBA 4EW6A 1UQRA 1M2NA 2DYSE 4P7JA 2CXPA 4IXNA 4DMMA 3V4PB 3NPMA 1R4AA 1W88B 4B33A 2UV8A 2YHCA 3LA6A 1AKMA 2O2JA 4AKHA 3DTTA 3U7IA 4MLZA 3TDNA 1JBQA 3FRJA 1KEVA 3EC7A 3G0IA 3T5DA 1NW5A 2MHKA 1EWYA 2G4LA 3FTSA 5ERYA 2YWCA 1J9EA 4BMOB 3N7TA 3U9TA 3UT7A 4JGBA 2NXPA 1FXSA 3OWXA 2C1XA 2O7NA 3PXAA 1PGPA 4PS8A 4REQA 3E9RA 1PBNA 1Z0UA 1SEPA 1EHYA 3GU3A 3GLGE 3R3WA 4UDYX 1IQRA 1CP2A 3UWPA 2GZSA 4KVMA 3HKBA 2BAGA 4APOA 3SQXA 8ADHA 4DLSA 3AMVA 4B7CA 1XMSA 1P45A 4Q3LA 1T5SA 1OI4A 5JSZA 4YWJA 3N8HA 2QUZA 1XMXA 1XZKA 3R6WA 1TRKA 5IVIA 1KY3A 3D6VA 4EGSA 2JDID 4CG2A 1IIBA 4BUCA 3C3YA 4OYYA 2WXQA 1IHOA 1FF9A 4L23A 3AEXA 1WBBA 2R86A 1GUYA 1GZ7A 4CEHB 3BSYA 3JZMA 2J48A 2V8SE 2PS3A 4AZ3A 1OKKD 3IPCA 3K8YA 5FFMA 1UEJA 1K75A 2O1SA 4N5MA 5CUQA 4XLZA 1QSGA 3UINC 5D01A 2INGX 2C77A 4IUYA 1OA0A 3DSUA 4NJMA 5JO0A 2G25A 2ZRNA 3IIIA 3ASDA 5FR2A 3S7JA 5KHOC 2ZJ5A 1VJ5A 2DKFA 1TJ4A 4EAAA 3J7TA 2R4UA 3O8OB 3K9NA 4Y6WA 3Q7TA 4EG8A 4LMPA 4C7JA 3MWYW 1AUVA 5CDGA 3QAQA 3B8HA 3CZMA 4P32A 3ZWDA 1VG0B 3I37X 1QUFA 3Q75A 3AGQA 1NULA 1ORWA 3K09C 2LKCA 2FO7A 2XA2A 5AUQA 2ONJA 5HHTA 3NRBA 4ATGA 4P34A 1QX3A 5EIAA 5IM4A 5C1DA 1KI9A 2I99A 3HB5X 2YL2A 3K35A 2FPIA 2E6KA 1XQYA 1CETA 3CKBA 5JU6A 3WKEA 1C8BA 2HU8A 3GLGA 3AIMA 1SCNE 1RCTE 2RG8A 1KS2A 5J2UF 1RSZA 2AG0A 4W1PA 2WF7A 3P2YA 2GRMA 2R60A 2W43A 2FY8A 2ETXA 3GEHA 1TYBE 3PPVA 2WIFA 3G5UA 2AN3A 3OKPA 2RGNC 1T6YA 4MVJF 1E3IA 1JHMA 3AAAC 4QOEA 1QFMA 1XYVA 1YK1A 3KKQA 3K8OE 4MKFA 1L3IA 3QIVA 1OMOA 2PD3A 4UUOA 3CX8A 4PU0A 3NIGB 4HAUA 1PP4A 2UXBB 1BHO1 1H22A 4NWIA 5ITWA 2MYUA 4G0QA 1P8AA 2E3JA 1WPGA 1E2MA 2JPDA 3VR1A 5EA2A 3O7WA 2UZ1A 2PH7A 2LAHA 1OA1A 4TV9B 5CB0A 2W2KB 4BVJA 4ZOQI 3CLRD 4E6HA 3MUNA 4D81A 3TW8B 1AK9A 2X38A 3U44B 4JA2A 3QE0A 2A4MA 3I12A 2Q0HA 1M3SA 5KSPA 4TRMA 4EB6A 4WCVA 4BJ5A 2CLKB 2GXQA 4DV1B 3T5GA 4YAOA 2GUGA 1XJ0A 4AJEA 5THQA 5FTNA 4RDHA 5TARA 3KOXA 1OI7A 4FMCB 3MOSA 3T1NA 4OL9A 1D1SA 3EIHA 1LQTA 4CCAA 4CFZA 4Q94A 1QO0A 4H3SA 1IN8A 4X6XA 4D99A 3PEYA 2I65A 4BE4A 5ARFA 3HP1A 4QTZA 3BXXA 1GQOA 3TSZA 1V8FA 2QNIA 1LLUA 3MMXA 1W73A 2CCGA 3TOSA 3N0VA 2VZLA 1KEPA 5JV5A 3PG5A 3SHWA 4MUGA 1EUDA 3EIOA 1KIFA 4KO1S 1OTXA 4X45A 4CPDA 3CCFA 1ST2A 2EFCB 5EFOA 5ALMA 5A0FA 2GCNA 3B78A 2YRXA 4NENB 4BKMA 4YEDA 1G3IA 1NJFA 2IEBA 2XLCA 2VWPA 2UZ3A 4AO8A 1QVZA 3FYUB 2QX6A 2P11A 3EXEB 2O4CA 1N5IA 2IIQA 4I5EA 5J2UA 5LP1A 3OLZA 1KPHA 3KL4A 4CTJA 1B4DA 1K3TA 4GA1A 3IDZA 3ZXXA 4GR5A 3RT1A 2OHXA 1E5XA 1MHTA 3MVEA 4ILHB 4IIFA 1W4CA 2AC2A 3O0TA 5TB5A 2WC1A 3NBAA 2I6GA 1MO5A 4DEVA 4MVJA 4BGDA 2ORED 1E2QA 4A0GA 5EIDA 3AI2A 1QFZA 4G2TA 1I2DA 1OROA 2HXSA 1DJLA 3GFFA 1EQAA 1T9DA 3CX7A 1HZZC 1POWA 4JOBA 1JQLB 3HG7A 1PX0A 1DOZA 1BDHA 2CHGA 1EDUA 1NJ6A 4UBKA 4XW2A 3SBXA 5HXAA 1VLHA 2I6FA 4BX3A 3GARA 3WK5A 4R0MA 1BCRB 5FV4A 3WXBA 3N2GB 3DE2X 3QK0A 1AV7A 2QGNA 4Y7CA 3MKRA 1JMKC 2FBNA 3NV9A 4JC8A 1MGPA 2J9FA 2W6ID 4OJQA 1NZDA 5BT9A 4PG5A 5EY5B 2O23A 5WRFA 2NTJA 1IHUA 3VI4B 3JX9A 1OT3A 2HF7A 2PKXA 2A5UA 2Q3HA 4NEQA 4RACA 2ZUUA 3UA4A 3WIUA 1YS6A 4GOLD 2I34A 1QIFA 4WNCA 2DFVA 2P9UG 3PQ7A 2BGWA 3ENEA 1E96B 4K81B 3ILSA 2VPQA 2E18A 2BGMA 5FT9A 4WOCA 2PRZA 1SVLA 3L0YA 2W7TA 2ZYIA 1GRRA 1IK4A 4BLQA 1FQOA 3R7LA 1T2CA 5FTKA 4D0GA 2B1IA 3LNTA 3KSZO 4BCCA 4TYWA 1CQJA 1IJFA 1HV8A 2PH1A 3LS2A 4C14A 5HEKA 4GLFA 4FSDA 2BKXA 5CDYA 2MHCA 3UCXA 1J2EA 4MRRA 1H2RS 2OLKA 1WZEA 2W83A 3JVDA 3WIVA 1H2VC 3QJ5A 3MWKA 1L0BA 4K9KA 3WYEA 4BFXA 1V5GA 1Z37A 2J0UB 3VPHA 4TYQA 1NDUA 4X65B 5IJ0A 4WJZA 5KMGB 1SKBA 3QSYA 3B8EA 2Q3FA 4KIWA 5TNXA 3LPLA 2HCTA 3D1JA 4BRWA 5CT6A 4N1AA 2ZQYA 1IXZA 3VPCA 1IBCA 4TV8F 1OZHA 1YD7A 4J4HA 3QBDA 3AVUA 5CFMA 4RQBA 4APFA 4DJAA 1NXPA 1OWLA 2FF5A 2UYYA 3EH1A 5H3HA 4KTVE 1QHXA 1UMDA 4PHHA 1R0KA 2AYXA 2GBLC 3FGNA 2REQB 1T2UA 1EYZA 4FJ1A 2DCMA 3EB9A 2FMUA 5LP6C 3SF8B 5JSHA 2WMOA 2ZSUA 3OE5A 1UDAA 1ZK0A 4EHNA 3HZZA 3BRQA 2C9MA 5HS6A 2VGYA 5FOVA 3NGXA 4YV0A 4KQCA 3BJZA 5DNAA 4TTIA 1K8XB 1JPVA 2VNHA 1M2FA 2WXHA 4LSZA 3BHNA 3AIKA 3I0NA 4WW0A 4YRRA 1WXIA 2BM0A 3K72B 4D9NA 1KETA 1OJ7A 2QORA 3EVDA 3OPYI 3UMGA 1SZCA 4YJ3F 4WZZA 1U0BB 3THWA 2JIQA 5JXWA 4JEHA 2A5DA 4DC1A 3VVBA 3FUDA 3LT5A 4IYPA 5MFPA 3HYCA 1KFKB 1WU8A 2VTBB 3EE6A 1O9GA 4G9EA 2QUIA 4XWGA 4NZMA 2PGJA 4OXQA 2NUTB 4DY6A 4Z4GA 3KSBC 1Z25A 3WGYA 2XKKA 1X3LA 3BA1A 3GV0A 4BQFA 3ML8A 1NR5A 4EFKA 2QA5A 1V11A 4QNNA 4HS9A 3D3NA 2NSDA 5ARBA 3ZW7A 1C3OA 4RVNA 5JD6A 2SECE 1CJVC 4WKOA 2PL1A 2VPIA 5F35A 4CN9A 1E77A 4M0PA 2A7QA 3U4DA 2RAPA 2JGNA 4LNAA 1QZUA 1ZOIA 1QHHB 3WNCA 5D8DA 1FFXB 4LOAA 3AVVA 2Z3ZA 4F2GA 2AX4A 4HWGA 3P26A 4D8WA 4JP5A 3Q5EA 1TVKB 3CRW1 4IG9A 3T5PA 2XEHA 2LIVA 1QAOA 4DVGA 5KKAA 2VP5A 4HRAA 2REOA 5JC1A 3LQ1A 1LGYA 1KKMA 4RV9A 2OXCA 4O4LF 4N3AA 2VXYA 4PC6A 4JI3B 3FZNA 4Z53A 1Y1SA 4CM9D 1N6HA 2IKQA 4X91A 2BDEA 5M34A 2A94A 1AHIA 3JQGB 2NC9A 1OFUA 2P7IA 1S9HA 3ZU7B 1ZICA 1J23A 4K9LA 2QN9A 4OO3A 3DNMA 1S2NA 1GUDA 4Y2VA 1NVDA 1HDRA 3O8RA 3K0AB 1XDBA 1L8AA 1XTSA 2ECFA 1ES9A 4TV8A 5HOEA 4L95C 3AF1A 2WSSA 4KXVA 1C0LA 2VF8A 3VC3A 2H1SA 1XYYA 1A98A 3ZVKA 2DHCA 3QPBA 2H08A 3O84A 3PEUB 2QR3A 2AMJA 2RIRA 5KX5B 3KEAA 4A3VA 2EIKE 4E6EA 2PG3A 3NTXA 3CT6A 1E2NA 3CR8A 1NLFA 2C7QA 2DLDA 4ZQFA 4WEQA 1T26A 1B3BA 3DMHA 1SVMA 4IVRA 5EN5D 4G1FA 3QW4B 4FDVA 2WHYA 1PZEA 4B3IA 5J2TB 1P4SA 1AH2A 3K2BA 4RXMA 4TYPA 3RHZA 4L2LA 1UOHA 3KG2A 4DHWA 3DSWA 1N6IA 5FLKA 3O0DA 5JHGB 1GPDG 4FDAA 4II7A 3U3ZA 5G0VA 3DMPA 4XFDA 1QR2A 1Z5VA 3ZWVA 1NTRA 4JJIA 1SQ5A 4YJ3A 2J4FA 3HACA 1Z0ZA 4FONA 5GJVC 3NHMA 4FN4A 3DLBA 3JYOA 3S7BA 4RPHA 3IUJA 1ANKA 1QH0A 4Y0AA 2YJTD 4JP1A 1AKUA 3TWWA 2ADOA 3PVCA 1NNLA 3VTKA 3VI3B 1KR5A 1TNZA 1KAHA 5K0NA 2LTAA 2Q4DA 3JPWA 3WL7A 4ZOAA 1TJCA 5DTJA 1U6KA 3RRUA 4D45A 4EP1A 4WA7A 1DQSA 3OD1A 4ZI7B 3P4YA 3EHEA 2R7MA 5G04C 2VT7A 4R84A 3B9QA 1LBHA 2OBMA 1I0ZA 1YBVA 4O1PA 2ZZNA 2FJUA 3EEQA 3AYXB 1K7YA 4LW8A 3UC5A 2JVJA 5B53A 3DT6A 1KP2A 3AS8A 2EAUA 2XCSB 5H70A 2V7WA 3DLAA 4R1NA 4OHBA 1V6CA 1UJ6A 1L4LA 3KX2A 2GD0A 5FL3A 1EGMB 5JCJD 5T6BA 4TN1A 5JD3A 4O4LA 1VJRA 3E3OA 2V3VA 3SQLA 4ESVA 1F4PA 2XSZD 2FSVC 3ZHYA 1K3FA 4V2UA 3CN7A 3PTZA 3UH1A 4YUYA 5EIBC 3C6QA 2B4TO 3B52X 1VL2A 5BMOA 2BM1A 3LTNC 2BV3A 2OKCA 1S4QA 2ZJ7A 2XMZA 2FPRA 3V9AA 1WVGA 3VZCA 4L27A 3FF4A 2ZIEA 1RW4A 2W2LA 3LFHA 1I2ZA 3RTCA 4XB1A 5TPWA 5ALNA 2DAPA 4U04A 4MYUA 2J4BA 2XZPA 5JO9A 4Z8XA 2IP4A 4GSKA 5FEUA 2WPDA 1Z2NX 4Q21A 3V48A 4YO8A 2VSOA 2C0LA 4I9UA 1YKFA 2IUSA 1JPNA 1SG6A 2WIJA 1KAOA 2OV6A 4XB2A 4FJYA 4FK8A 2QMUA 1B6TA 5DN9A 3RANA 3OZIA 2WICA 2VUTA 2YQ8A 4JLSA 1RTKA 4HUQA 4EO4A 3E1GA 4EUKA 1DBRA 2E21A 4RQIA 5GMOA 2NQ8A 3LK6A 3FI0A 2VPWA 5B1EA 2M1XA 4QT0A 2RC6A 3N2EA 3ZQKA 4XQ9A 5CM2Z 3DOOA 1BD4A 4N82A 2OUKA 4DHEA 5LFAA 3QWPA 5J47A 3JAWA 4PRKA 3LG2A 3AVOA 4IWXA 3PUXA 4A2QA 4LNUA 3BDAA 1NI4A 4AT1A 1XOIA 1V9CA 3HY6A 1YK0A 4XJVA 1HURA 5FLEX 3DBRB 2B4RO 2FH5B 3GP8A 3QMVA 2ZYVX 1S3FA 2XT6A 2QX4A 3MGAA 3MUFA 4ZDWA 1F06A 4O2BF 4JVOA 3PQ3A 3BGDA 1ZGBA 3KOMA 3BG1B 4O1MA 3DZBA 1O0CA 2DEUA 4CQNA 3H87A 2QT9A 2GCPA 1ZXXA 3G2PA 1XALA 2DKOA 1IRXA 3KYDA 5EX3A 4XB6B 1ZK3A 4EKIA 1C29B 5T4EA 1X81A 3OPYA 3QFCA 4K40A 4NBTA 3WB9A 3GHYA 1I2BA 5TT1A 2BKKB 4PY2A 2EW1A 3TN7A 4RG9A 4D44A 5L7YA 1I0LA 3IVCA 2CYCA 8MHTA 1QPGA 5JH7B 2UUAB 1NMQA 1OF1A 3RIMA 1D2CA 1ZXBA 4NU8X 1W1WA 1GUFA 1G98A 4D3DA 4X20A 1ELOA 1XEWX 2V1UA 4JVMA 1YDEA 3CJTA 1N2HA 4CTOA 1Z7EA 4JA7A 1ZW1A 3EVTA 2JI9A 3ENVA 2R47A 5JI3E 4KNVA 1Z6YA 1BGWA 2DF8A 2QD5A 4CHTA 5LQSA 2IYOA 2V3CC 1OTHA 4AO7A 3OZVA 4DRXB 4V1CI 3TLYA 2O8CA 2QY7A 2J9ZB 4M87A 2UVPB 1NQAO 1OE0A 3E4BA 3P9YA 5JJLA 1I14A 4G89A 4D9GA 4F96A 3PKJA 4I36A 3M1AA 1YBFA 2ZUFA 4JQYA 1WXDA 2ZIFA 1X14A 4JUAA 1J0BA 2NUAA 1BFKA 3IPRA 3AF6A 4LF6B 4IDDA 5IJAA 1XVLA 4BB0A 4BBZA 1YRAA 3PVLA 1PK7A 2LKDA 4PLPA 1JA1A 1I6LA 1EFTA 4MV0A 4OKIA 3EJWA 5EP3A 1T2FA 2I1JA 4OH7A 4CLOA 3QU9A 2QX8A 1Y5RA 4J7UA 5CERB 5LNK1 3AF5A 1GR1A 1LDNA 2ONZA 1ENPA 2YHIA 3GFVA 3IRVA 3C3EA 3BJEA 3BBPA 2H2HA 1JU9A 3JWPA 3I6IA 3DMTA 5HX7A 2IOYA 1FT2A 1HTBA 1XMQB 1Z5SC 4J8YA 1O6BA 4ZIRA 4QNMA 4CM8A 1A8PA 4A6PA 3W3AH 4D02A 1UM9B 5BN4B 2FCRA 3TPCA 3BGWA 4A2WA 1HL3A 1WU7A 3ABSB 3LX4A 3F1LA 5MGNA 4O2BA 1AUOA 4HAXA 2P91A 2IEJA 3NC4A 5B1AE 1F8FA 1XRLA 2WAXA 3U40A 4RVCA 4Z3KA 2QRNA 4GMHA 1AUQA 2ZRKA 3I2GA 3BRWA 1TTPB 2Z58A 2R8PA 4US0R 4DLYA 2DMRA 2EDAA 1JBKA 3GB9A 2DBRA 4PSVA 4X8HA 5EXXA 1C1YA 2HYIC 3M4NA 2J41A 1IG0A 3HI4A 2OP0A 2XCLA 3CNEA 2CG3A 5FBHA 3WGHA 2I87A 4U7DA 3FTNA 5ESDA 5AJUA 4YCBA 4EK9A 2ZYDA 4RE5A 3QUBA 4EVIA 3PQ2A 2ISCA 2Q3MA 1DTWA 3KDSE 1JHUA 1N7HA 2ZJZA 4UTNA 3R7NA 4BJ6A 4IV5A 3ZU6A 4P98A 4B48A 4WBSA 1XHLA 3OQ1A 4GUDA 4QU0A 2IO2C 3LK7A 3I52A 4F6RB 5E3IA 2XNCA 3JZAA 1PGJA 3EIQA 2F6RA 4G2VA 3SMVA 5BSHA 4RQAA 2D2FA 2IYEA 5G02A 5K8UA 2BMVA 2VBGA 3N87A 4ESOA 1XDGA 2WKQA 4JELA 2AF3C 5A6CA 4S0XA 2QPOA 4WY2A 1QP8A 4OI4A 1MVNA 4IR7A 1RHUA 2AB0A 3INGA 2PANA 2HBZA 2JCGA 1BW9A 4P82A 4EZIA 4MR7A 1B42A 2O48X 5J58A 2DKNA 3PEVB 3ZCTA 4DLKA 2BC9A 4PHGA 3ZI4A 3RRFA 3JQRA 4MJXA 1BU8A 3LHDA 3UAZA 3L7KA 1SXJB 2B6HA 1MAUA 5COAA 3EODA 5EUBA 3R44A 1P3JA 4UI9C 2PAFA 4JLJA 3ESLA 4QM7A 3W0LB 2ZIZA 2QMQA 4HI0E 1S0UA 2VAVA 3E9NA 3BYZA 4FOSA 2AD1A 1O7JA 4FC7A 4TMFA 4TUUA 1A3CA 2F8XK 5FULA 3UWSA 1Z6QA 3IT1A 3HVEA 5NLLA 1W49A 3AIIA 3RE1A 3GA7A 3H9CA 2BFOA 2J09A 3HR7A 5T4FA 1MOPA 1IBLB 2DX7A 2QMYA 2V54A 3BDIA 4G5RA 5DBEX 1XZCA 1KJWA 4H3HB 2DBQA 2AHOA 4ZCLA 3ZY4A 3QELB 1SA4A 4ATNA 4LN1A 3HJUA 2JGIA 1GO2A 4MUMA 3DE6X 2AQ8A 1VP9A 3A9RA 4BO1A 5ENTD 4DW8A 4AKEA 2ZB7A 4JN6B 4CKBB 3OMLA 3GNSA 3BG0B 2R1TA 4MAAA 2EKDA 5D85A 2RAFA 4EA7A 4WK2B 2CHVA 1C0KA 3MOGA 2WKRA 2C2XA 1DKRA 2GBGA 5FWYB 1I51A 4ZVUA 1JFVA 2QP4A 4OP3A 1UBTS 4ZPXA 3WK4A 1RE0A 3N6XA 2PUJA 4CFYA 2EZ9A 5C31A 3DW3X 3ME5A 4AJLA 1IXRC 2QZSA 3M89A 5DK4A 3UUGA 2OC4A 1KKUA 5L3SA 1AQYA 3RTAA 2QN1A 3DPUA 1YU9A 4J7AA 5DM70 1JEDA 4M9ZA 1JIVA 4F38A 3A2NA 5ECWA 4G26A 5CDSA 2ZYAA 1ZS9A 5FBVB 3CS3A 4GOND 2RHDA 5B37A 1W7AA 5E6SB 1DRKA 2HADA 3U3XA 3NTUA 1QQ5A 3P96A 1I24A 4MA5A 5AOCA 4AQ7A 3PA8A 121PA 3NHBA 5T4BA 1G1AA 1CJSA 1X3SA 2IUFA 1SCAA 1Z73A 2IXFA 3BMQB 4KK4A 2ZJBA 2JIMA 1YE5A 5HR5A 1U81A 4EY4A 2GDZA 4Z9YA 1E9CA 1QIDA 4LZLA 4HX5A 1G42A 3B3QA 3O47A 2G40A 1DXYA 2AR7A 1KP9A 3O74A 1E9AA 1QHEA 3QX9A 1Y81A 1Y8QB 3GJYA 4GSYA 1IHXA 5IJZA 1P2SA 1UFVA 4KH1A 3H05A 3ABZA 3F8TA 3T7AA 5JMTA 3KJXA 2H17A 1R9JA 1IUOA 1UM8A 2XB2A 1O97C 4F21A 1Y5LA 2XUFA 1S89A 3AVXA 3UGJA 4MDYA 4YJKA 3VTAA 2CDBA 4JP2A 3DBLB 3F3MA 5K0BA 1THTA 2B78A 4V39A 3GZNB 2OY0A 5E9AA 2NVWA 5FOSA 1JHXA 3AUSA 3VOTA 5IW8A 2AWOA 1XVUA 1RAAA 3HKCA 2O8FB 2YS7A 2DUWA 3BOSA 2Q21A 1QYDA 5CRUA 3PZBA 1NUSA 1YI0A 1RZVA 3H6GA 1O4WA 3ORFA 3LPAA 2C59A 3Q3CA 3U1VA 3MTJA 3NX4A 3ULEG 5D87A 1C8KA 4DYDA 2WQ6A 4TXLA 4ER3A 3FOEC 4KIJA 1XRNA 4ZQBA 3G2JA 1E1CA 4DT1B 3NU1A 1R66A 1BKSB 4GWKA 3D9MA 1DLJA 3DHVA 3BQ9A 2CWDA 3AR8A 2KXPC 2OXRA 2GN2A 3GFGA 3C4JA 3DLIA 2WINI 3BB3A 4L2IA 4ND2A 4XGNA 5TJ9A 4KI0A 4R7TA 4XPIB 2G36A 1KK0A 2X58A 3Q47B 2BE7A 3BZBA 3A05A 4PC2A 4KGZA 3GT4A 4GUAA 1N57A 4GL4A 2X0NA 3WK7A 2ZITA 2YVAA 1BGVA 3NJ4A 2WWXA 1VMIA 4Q3DA 3FSGA 2VH1A 5EMKA 3FYDA 5AKKA 2G5CA 5TMBA 4XWTA 1U90A 3KKKA 5JMOA 1ECCA 2NZJA 3NRJA 3P1UA 4MDHA 1L4UA 1VECA 5DTEA 4MIYA 1Q7EA 4ADSG 1M66A 1JJAA 2XIJA 2OUIA 4E7OA 1XGWA 3VSBA 4MVXA 1GEGA 3CSUA 4MP6A 2C2MA 4HNHA 3ZJVA 4FI3F 2JK0A 3MQ4A 3H2JA 4NXNB 3L0PA 4QPNA 3B3AA 4QUHA 1ODFA 5E6RB 1CQWA 4V38A 1ESMA 2OCGA 2OP1A 1FPMA 4QUBA 4R1TA 2WXIA 4WKNA 2C83A 3W7VA 4KE7A 4XCQA 1GLNA 4CIBA 2GGSA 2P3QA 1VBKA 1H3EA 4KKVA 1YE3A 2O8NA 1NT4A 4Q4JA 5JPDA 3CHYA 5EWJA 4OB8A 4KFSA 5IVDA 4JZKA 2HJ9A 1JR6A 3CHMA 5DCYA 2VJMA 1G5HA 1KYYA 2ETCA 4WK6A 1M6WA 3DE4X 3WO0A 3IP7A 4BFTA 1ND5A 3ZU4A 4O25A 1GZ6A 4JODA 2V5QC 2FAXA 4PIVA 3VOBA 5KC9A 2VJKA 1KJ9A 3FTYA 5AVRA 3D7NA 5A2GA 4M88A 4YMVA 4FQ7A 3H2YA 2BZ1A 2VLIA 5KQLA 1P4HA 3LQQA 1PY1A 2CBXA 2AMLA 5CIWA 3TFQA 2I6SA 3RF6A 1Z2EA 1CEYA 4RZHA 3ZTYA 3DV0B 1SWVA 1BQEA 3V55A