4I6GA

A vertebrate cryptochrome with fad
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
490
structure length
476
Chain Sequence
b'ASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMELPKKPAVAVSSQQMESCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLEANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cryptochrome-2
molecule tags Transcription
source organism Mus musculus
publication title SCFFBXL3 ubiquitin ligase targets cryptochromes at their cofactor pocket.
pubmed doi rcsb
total genus 170
structure length 476
sequence length 490
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4i6gA03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i6gA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4i6gA01
5K0TA 4MLPA 1N2BA 2QUIA 4MW4A 4MW2A 1CT9A 1TFUA 4MUHA 4JXZA 3IOEA 3KT0A 1F9AA 5K0SA 5DEOA 3ND7A 3KT3A 4ZT3A 1IQRA 1F7UA 2A88A 1TYCA 1WXHA 3ZXIA 2X3FA 2A84A 3TZEA 4MVYA 2DETA 2IJGX 5BNZA 4NAUA 4ND6A 3GLVA 1KP2A 4ARCA 4JZYA 2QUHA 1EJ2A 1NP7A 2VTBB 4Q93A 5FO0A 1QTQA 1EFPA 4TS1A 4L2IA 1G8FA 1KORA 4JXXA 3IVCA 1VL2A 4MVCA 3N2YA 2HZ7A 1N2JA 4XSVA 3CLUC 1DNPA 4ZCTA 4DDKA 4J75A 3HMQA 4P2BA 1YUNA 2AZXA 1A8HA 2GKSA 5LM3A 4ZCPA 1XNJA 1JIKA 4F3RA 5EKDA 3L92A 1H3EA 1MOPA 3VGJA 1H1TA 2EJCA 1OWNA 4MWEA 1M8PA 1JECA 4QREA 2CV2A 3A4IA 5TS2A 3HV0A 3MUEA 1GAXA 3CLTD 3L93A 3OTWA 1NUPA 4J76A 2E89A 3PXUA 4ZT6A 2I1LA 3BL5A 3KT8A 4RPIA 4UZEA 1GN8A 2CUZA 1JEEA 3GUZA 2C5SA 1EXDA 1EUYA 2JANA 1J09A 2Z3VA 3IUEA 4I6GA 1TYDE 3CVYA 1T9GR 4G5YA 1KQNA 1J20A 1JIJA 4YMIA 4CQNA 3IDFA 1PFVA 3IMCA 1MJHA 3A04A 3AKZA 2H29A 3H97A 2CFOA 3IUBA 2A1TS 1I6LA 1O95C 3K32A 2PFSA 1I2DA 4MW1A 2PG3A 1O0CA 1K92A 1OD6A 4I6EA 1OWLA 1X8XA 1O97C 3IODA 1UFVA 1IQ0A 4GRIA 1O0BA 4NX2A 4R2MA 3FG9A 4EG3A 4L2IB 2QUKA 3AG6A 1QRUA 2E21A 4JFAA 1PFUA 4MWBA 1IHOA 4YP7A 1FFYA 1U7XA 4S1OA 5LFAA 1U3DA 2AG6A 3M5WA 4HJRA 4DJAA 1U3CA 3N9IA 1K97A 1ULHA 1COZA 4MW9A 1OWMA 1R6XA 2J07A 3LE8A 3HL4A 3Q12A 1WZ2A 4FZJA 1TEZA 1KQOA 4DNXA 4X0EA 3ELBA 2O5RA 2DPLA 1N2EA 4XFDA 4KKVA 4ZT2A 2CYBA 1IFXA 1ZH6A 3N05A 1YI8A 2IP1A 3DLAA 1G8HA 1N3LA 1U7DA 1MB2A 1OBCA 3D6UA 4JYZA 1B6TA 4EFKA 1ZUNA 1KAQA 1RQGA 1VBMA 1HYBA 4MVWA 4ZT7A 1H3NA 2DLCX 3P52A 5KHAA 1ZH0A 2QJFA 2YWCA 5H16A 4KR7A 2AKEA 3CLSC 4MULA 1V8FA 3TQIA 3VRHA 4OJMX 1PG0A 5TEWA 3AG5A 3MXTA 2PZAA 2A1UA 2PZ8A 4RUKA 3TZLA 1WXIA 2G36A 3IOBA 3IVGA 1EFVA 1JZSA 1M8KA 1U0BB 1J1UA 1J1ZA 4EF6A 3LCJA 2VTBA 3COWA 1H3FA 2NZ2A 1BS2A 4DDHA 2XRZA 1XNHA 3RJZA 3H99A 3ILVA 1MB9A 3A2KA 1I6KA 2WSIA 1PFYA 1NURA 4U63A 1WXFA 3ZIUA 2J4DA 1JMVA 3CLTC 4U8HA 4EG8A 1O97D 3G59A 1NUSA 3P0JA 2QTMA 4HK4A 1MBZA 1KKUA 2X1MA 1OWPA 1PFWA 5IHXA 3X1MA 2QUJA 3FH0A 1NYLA 1T6ZA 4GU5A 5AHWA 1S4MA 3FIUA 1N2IA 2A86A 3RHSA 1O6BA 1N75A 1K4MA 4WSOA 1G59A 3IMGA 3UK2A 4EG7A 2CV0A 1TQ8A 1O94D 4MQ6A 1VBNA 4K0RA 4R2LA 3RFFA 3X1KA 1JGTA 2QJTA 2OQ2A 1QQTA 3QTTA 4MUFA 2R5WA 3COYA 1JHDA 3QTBA 1QRTA 4PBSA 1PG2A 3MLAA 3CR8A 1GTRA 1WOYA 1JEDA 4ZCQA 4EG4A 1FYDA 3UOWA 4NAHA 1NUUA 5KWVA 4DDMA 5J59A 1Q11A 4ZT5A 3FWKA 2A7XA 2A1TR 4YP5A 1WQ3A 1IQUA 1WY5A 2BYTA 3U1VA 4YP6A 2YWBA 4U7JA 2TS1A 3IOCA 4HPWA 2WQ6A 3CLSD 5H7XA 3VU8A 2X0KA 1EUQA 1N2GA 1OWOA 4K03A 3CVVA 3TQOA 3P0IA 4PY2A 1GTSA 3SEQA 1GPMA 5HUHA 2YY5A 2DR2A 2ZUEA 1QJCA 3ZUGA 4EG5A 3ZJTA 1M8JA 1WJGA 4HJXA 4MUGA 4NATA 4NZPA 3ZGZA 3AFHA 3ZJUA 3N8HA 4QBTA 2E0IA 1R6UA 3FETA 4CDNA 4KR6A 2RE8A 2JA2A 1M8GA 1XNGA 1VBKA 2D54A 1T6YA 1QRSA 3PNVA 3CA8A 4MW6A 4OUDA 3TS1A 5J58A 4G5FA 4PBTA 4F4HA 1N1DA 3H9BA 3H9CA 2RD2A 1Q19A 1QU2A 3H05A 2DEUA 1F7VA 3CVXA 4R0NA 2VXOA 2CYAA 1D2RA 4MUNA 1ILEA 4KR9A 1KQPA 5F23A 4MUJA 3MMXA 3AIIA 3FHJA 4AS1A 1YIDA 3GMIA 2EL7A 2HMAA 5LLTA 3KT6A 3CLUD 3NBKA 3NBAA 3SP1A 1LW7A 2A1UB 4QRDA 1XJQA 1M8FA 1MAWA 1IH8A 2J08A 3IH5A 3NV7A 4Q16A 3CVUA 3PNBA 3UY4A 3HFJA 3FI0A 3A05A 2DXIA 4PBRA 2XRYA 1OBHA 4CT0A 2E18A 3DV2A 1G8GA 4NDAA 1JZQA 4MVXA 2V0GA 3MLBA 1YULA 1V47A 4G6ZA 1EE1A 1YIAA 1N78A 5HUJA 4DLPA 3UMVA 2DUMA 3LOQA 5DK4A 3SDBA 3HGMA 5FNZA 1NI5A 3SYTA 4E1AA 1QNFA 3SZ3A 3CLRC 1KR2A 4AQ7A 2V0CA 4XFJA 3COVA 2QTRA 1N77A 3CVWA 3HZRA 3ZJVA 2OV4A 2ZP1A 1LI5A 1J70A 1MC1A 2PIDA 3RK1A 5HG0A 3CLRD 3PNYA 1KH3A 1GZUA 4BWVA 1MRZA 1NZJA 4MAFA 2J09A 1K4KA 2WB2A 1M83A 3ZXSA 1SURA 1Q15A 4MWCA 1VLHA 1T6XA 4KPUB 2H2AA 2PXHA 2QTNA 3COZA 4A91A 1J21A 2YXNA 4ZCRA 1WKBA 1KH2A 2HGZA 5DB4A 3AL0C 4MUKA 4EG6A 4H3SA 1T9GS 3FY4A 1O95D 2J5BA 1M1ZA 3OP1A 4ARIA 1JIIA 5TEVA 1R6TA 5KCMA 1WQ4A 3INNA 3JXEA 2O8VA 3UC5A 2DERA 1IVSA 1O5TA 3S3TA 2ZUFA 3D6VA 3F3MA 2Z08A 3Q10A 4KPUA 3X1JA 2JAXA 2BTEA 3G5AA 4MUIA 1P7PA 4WNYA 2D13A 4ZT4A 2CSXA 1F4LA 1NUTA 2QJOA 3ISJA 2WQ7A 4MW5A 1N2OA 1KAMA 4ZCSA 5FO1A 4ND7A 1ZJWA 2A4MA 1N2HA 1WXGA 5DASA 1Y42X 1TYAE 3K9WA 3SZGA 1TYBE 3G6KA 5J5AA 1KP3A 3RBAA 3PRHA 1IRXA 4DE5A 1O96A 1WXEA 3I05A 3QE4A 2CT8A 3ND5A 3TNJA 2CYCA 2CV1A 2IELA 4I6JA 2GOYA 4OUDB 4MUEA 4MW0A 4CDMA 1KH1A 1EFVB 4YBRA 3FNRA 4MW7A 1O94C 2NSYA 3SEZA 3E27A 3RK0A 4EGAA 1I6MA 2X1LA 1YUMA 2D5BA 3P0HA 4EG1A 2PZBA 4MWDA 3IMEA 1MAUA 1NSYA 2Z09A 1GLNA 3DPIA 1O96B 3ND6A 5JBNA 1Q77A 1X6VA 2GM3A 3DO8A 1QU3A 3Q4GA 1EFPB 1NUQA 3FOCA 5TGTA 2B7LA 4UZFA 1JILA 1LI7A 3FDXA 3IVXA 5IJXA 3KFLA 3C8ZA
chains in the Genus database with same CATH superfamily
1P31A 2GPWA 1OXXK 2P78A 3ANLA 5K0TA 1FQWA 1JFVA 1JA9A 4YA6A 2YJGA 4MQEA 1PT9A 1OXUA 4K6MA 3G2UA 2PK3A 1YB5A 1SA4A 3IQEA 4M1YA 2AJBA 4MJ3A 4NLLA 3E30A 4OKNA 4URVR 1FW6A 1FNBA 4R1PA 1YMVA 1DFIA 5T4BA 1UWCA 1H6CA 1DJLA 2HJGA 1KMIY 2X3UA 3W5HA 1ZSYA 1IATA 5FHQA 4RLYA 2AE2A 1FXWA 2Q5LA 2Y1KA 4GZMA 5DX0A 5HE9A 3NGXA 4Q1CA 3S2EA 2I6QA 1FZQA 3W7VA 1XYYA 2XD9A 4H9GA 4MVJI 2A84A 4YP0A 4FW9A 3IUNA 3G2NA 2G83A 2GRNB 2BGMA 1N25A 2OOEA 1T2DA 3GPBA 4QOJA 4EUKA 4URFA 1CKEA 4DKXA 1SBZA 3W6ZA 1JKJB 3GLVA 5IN4A 4NCNA 3B20A 1D0IA 1NP7A 3MHPA 3IP9A 2O8FB 5DT2A 1NXXA 1W35A 2WWRA 3DYVA 4GL4A 4QDUA 4QUJA 3E3NA 1QTQA 1DJPA 3ZE1B 2IYPA 1KA9H 2ZATA 5K01A 1IU9A 4EDHA 1P2UA 2QV7A 2O0HA 5AAOA 4JUBA 1Z7BA 1A3CA 4MS4A 2IBTA 1ID8A 3ABME 1R74A 4B7ZA 1M9NA 3CRZA 2FGJA 2GW1A 1EZZA 2EG9A 1QG6A 3B70A 2BMEA 4CKEB 3DZIA 4JJAA 5DYWA 4ZCTA 1W1IA 4Y9RA 4LFAB 2F8SA 4MKIA 2FMHA 2AZXA 2IU6A 1S2NA 1QDUA 2QZ4A 3AFNA 1QWSA 3AI1A 4DLZA 3PPVA 3PQ3A 1T9AA 2DX7A 5EKDA 4L73A 2V58A 4YYZA 1H1TA 3NTOA 5SYNA 1BCRB 1IEWA 2BFMA 2VATA 2XRFA 4DLXA 3TMYA 2W4MA 1CG6A 4CM9A 3ZV6A 1EQ2A 3MUEA 3Q5DA 4NSNA 1P1RA 2GUGA 4LCEA 5BVHA 2F8TA 4RYDA 3CVQA 2VQ2A 2YQ8A 1A4IA 1J8VA 1JHMA 2RI0A 4MWSA 4KI7A 4PLCA 4GTQA 4PYQA 1F17A 1NVKA 1NE2A 2XNSA 2EKLA 3P1JA 4FC7A 4X3PA 2QL9A 4ZOEA 4EUSA 2GRAA 2C5SA 5I45A 3TFQA 1A9RA 4FMDF 1LBSA 4BO6A 1HFKA 4NXNB 3IHKA 5JD3A 1OASA 3V9PA 1NQTA 3QX8A 4M60A 3ZWBA 2X3YA 3IAM1 4FEEA 4EGCB 3BH0A 4PHHA 4AROA 5EKXA 5BW8C 2AV6A 1W4CA 2ZTMA 4U2FA 5TT1A 4YT4A 5IKPA 4GA1A 5AXAA 3EVTA 3MWFA 3EF3A 4W6ZA 5A4MS 1IB0A 2DECA 1EXWA 3S7ZA 4UUNA 3TG4A 3IUBA 3GAFA 3SF0A 1ZGAA 4BY9E 2YIMA 1A4XA 1W8IA 3WTBA 1IOVA 3TX2A 4OPMA 2ZXFA 5FNVF 2BL4A 3NXSA 4OXNA 2Y1EA 2H92A 3RKRA 1KOJA 3U7FB 3RVQA 1I7NA 5C18A 2QAGB 4J8DA 3H1FA 5T8IA 5AENA 5AVKA 4TKVB 4PRLA 4AJIA 2WR8A 3T9EA 3T1NA 4Q7QA 4O29A 1RXSA 2N1BA 3VOBA 9LDBA 1EDEA 2IPXA 2F17A 2G1KA 4RY2A 4C05A 3CUYA 2OBMA 4Z9AA 3PDUA 1QCCA 3G13A 3UCEA 4DTCA 4AKHA 5T6MA 2O2DA 4YQZA 1RRPA 3ZWMA 2C4VA 1KBOA 2ZRBA 4FDUA 1OB5A 3F8SA 4YJ2F 1FUUA 3NHSA 4ZVVA 5BY2A 3K5HA 3MGBA 3LKDA 4RKQA 4OXXA 4AUMA 3JQFA 2C3UA 2QSUA 1FSPA 3P7MA 3HSSA 3UM1A 2E6KA 5BOSB 4UHBA 1U3CA 3IDSA 4JVNA 1ELWA 3E4DA 5H3HA 4WINA 2Y1LA 2G80A 4IHJA 2QVCA 2Q6OA 4GFDA 3FFXA 3ZW9A 5JAZA 3AUKA 2QN8A 2Y99A 4Q19A 3AHFA 4Q47A 1J5EB 3ZD7A 1FLNA 5JHAA 1KYIA 2QE7D 2ZB3A 3BIOA 3G02A 1G7RA 4BFUA 4EJ0A 1P9OA 2A67A 2SCUA 5CXXA 1IN8A 2K6GA 4D0LB 3PX2A 1ONNA 4ZHSA 2IQCA 1M0WA 4HWOA 5TT0A 1EF1C 1FTQA 2P4SA 1U3TA 1UK7A 2GR9A 3HRHA 3KHKA 4HWSA 1FYFA 1GP2A 3VGPA 2DULA 5HMLA 1QUFA 1RKUA 3RYHA 3I5YA 1YDMA 3L5OA 4FX5A 4O2LA 4MX8A 4A4DA 2GM4A 3HCEA 3RV3A 1XD8A 3FTWA 1NULA 5AM0A 1NVXQ 4XQEA 4JT9A 1NNUA 3INRA 4Z53A 3X43A 4K9SA 2X3MA 3TBHA 1UAAA 3RASA 4P54A 4NCKA 1VFPA 2ZBUA 5KHAA 1NHGA 3FGZA 4LCTA 3TPFA 5AJUA 4DBLC 5L6MB 1QAQA 4LECA 5A5DA 4WCFA 1EBUA 1GZ7A 4C4XA 4GC9A 1QPZA 1TEHA 3WB1A 3SF4A 1PG0A 4FWIB 3LPCA 4PO1A 3BXGA 1PY1A 2IHZA 2XY4A 3Q1KA 4FFDA 4FUTA 5A3VA 3IOBA 1B73A 1IC6A 1YB4A 2FE1A 2Q4EA 1Q50A 1H2RS 2QSJA 3LQ1A 3PX3A 2FPGB 1C81A 3RAGA 3EFHA 5EX3A 4IDCA 4EF6A 3VR3A 1NQXA 2MHCA 4EK9A 2ZCJA 2YN2A 4A6XA 2VJNA 5FTNA 3WFJA 5JAMA 3VC7A 1Z7GA 4RLQA 2J3EA 3F3YA 3CHMA 1W46A 5HPYB 1W0JA 5D2CA 4B3TB 1V6SA 4RX1A 4HNRA 4O2BB 2RBGA 3QUQA 2DTEA 2JCYA 5HR5A 4OFZA 4FNMA 2P6NA 2AKEA 4N7JA 3IBCA 4IL5A 5FEUA 1SU7A 4CEJB 3A4LA 1RHRA 3F74A 1H42A 4C7MA 2KC7A 4NH0A 2G8NA 2TRSB 2ZWOA 4GNRA 4M0KA 1NY6A 4XPZA 3IPCA 2JFWA 2VJKA 3QFHA 1D4ZA 3EJNA 3FR8A 5IKMA 2UUBB 5JDIC 2X4GA 2JFUA 4HK4A 1YCSB 1DQSA 1MBZA 3PWSA 1O58A 3IP5A 4M89A 2C8LA 3LUCA 3AH8A 2PH3A 1K6EA 4DIBA 2AQ8A 5K6AA 3ORHA 1DADA 1KFEB 1W96A 3FOAA 5DO9A 3VV2A 4F9GA 3A28A 1E7YA 1T8RA 2GJ9A 4M0DA 4MYRA 1QHFA 1ZQ9A 2V54A 2X76A 3OZCA 3UANA 2I76A 3SVZA 2WXPA 4A82A 2ZAMA 1ZCBA 4RSGA 3CVJA 2QI9C 4P4LA 4Q05A 3RB8A 3RHSA 5AK6A 1O6BA 3UI2A 3FGPA 4HRMB 1JN0A 1HDEA 2BFWA 3CHOA 5B6JA 5JD6A 1YCFA 3H1EA 1T5DX 3LDGA 5JASA 3Q11A 1VHQA 3A4VA 1SOVA 4FR0A 1TJCA 2Q5CA 4BT8A 3SAJA 5GP1A 4XWGA 5ILGA 2JIRA 4H1WA 3BEEA 2AHOA 3RS5A 4YX9A 3A1NA 2V7TA 3KQMA 3PQCA 4YUZA 1KMQA 5CBKA 2P7HA 3TLXA 3FWVA 4L27A 1OMOA 4JVSB 3E5NA 4MQFA 5DSTA 3DBOB 4AJWA 3HB0A 3V9AA 4X7MA 5BN1A 1K7YA 2C2LA 3V2XA 2PH7A 3KCQA 5AKZA 2A0KA 2IOHA 3ZDQA 1KI6A 3LDHA 3MLAA 4WK2B 2B4RO 1XLVA 3MTAA 4O4HA 2QZZA 3NH6A 5EMMA 5ED0A 4AKIA 4WERA 1V48A 4EATA 1FYDA 2WPDD 1Z7WA 4PC1A 1C7IA 3D7RA 3R9IA 3LAWA 2J9FA 1OI2A 3TSWA 1R1DA 2NTVA 2RH8A 3HWWA 4DW8A 5KNHD 4RE6A 1CRLA 5JHBA 1Z5GA 4ZDWA 1CQPA 2IKQA 3JQEA 1C2YA 4R9UC 3ZHVA 2XXBA 3L0YA 8ABPA 3NUGA 2A9JA 3U1VA 4YP6A 4F4JA 4YRZA 3MS4A 6ADHA 3DWGA 3EC1A 2FF5A 5JANA 3FVRA 4OM8A 5LB4A 8GPBA 4YDQA 3EVBA 3F6SA 1H4SA 5JBIA 2P0EA 1OBVA 2FF7A 2VGYA 3B12A 3UB2A 1NLFA 3RJ5A 3CVVA 4B4DA 2OEWA 4LJ9A 4RULA 3DBSA 4M38A 3MBOA 2HRBA 4ZI2A 7ABPA 1BEEA 4HLEA 2QX7A 2FI1A 3NBYC 4CIXA 3WADA 1CDZA 4FSDA 4HJXA 4N03A 2DVMA 4GYYA 4HFNA 4DB2A 1VIAA 4BESA 1C1DB 2OHHA 3ES9A 3K70B 2L0TB 1WBDA 3RSCA 2X7JA 4W8HA 4QDXA 1K68A 5BQPA 1AKNA 2GRJA 1SIUA 3LF2A 4OL0A 2G1JA 3DTVD 2BR3A 1DWQA 4HQ0A 1EXVA 1UXOA 3LXUX 3FR7A 5HCUA 2ETCA 1VBKA 4DLOA 4JKOA 5I7EA 3FFTA 1THMA 4IXWA 4LMAA 1VE7A 5CECB 3B6JA 1ESNA 1LNQA 5JY6A 5J2UA 1FL9A 3CJTA 3MTBA 3PYLA 4URYR 3GBPA 1Z45A 3CR3C 3HI6A 2V8OA 3E33A 3CVXA 3VHRA 1KK0A 5HKBA 1AD2A 5KJLA 2BFCB 4OMFG 4IY1A 4RY0A 5K6AC 5DYNA 2QA5A 3B3QA 3BAFA 1UJ5A 4D8YA 3VJLA 1ODLA 5ESWA 5H59A 1J1IA 3KJZA 3L22A 4M6WB 1Q2XA 1OPRA 1EAYA 1S6YA 3AHDA 3QKSB 1W2GA 2CB0A 1HY3A 5COQA 5L3QB 3IV9A 1LC3A 5AJTA 1U81A 1XAJA 3JWHA 4E08A 4JA7A 1GPUA 1V3QE 1YR1A 2JRLA 4YLYA 2IIPA 2VUUA 2ZUTA 4ZOCA 3L1JA 3L84A 4FSHA 1N32B 5LZ9A 3SJUA 2NVOA 1TTPB 2ZSBA 3VNQA 5BNZA 1TN7A 3PPXA 5EJ4A 4AVXA 3LT4A 1OI4A 1GPDG 3OQIB 4DAOA 3M33A 2J9QA 5IKXA 3OO1A 2GJ4A 2REQA 1WDTA 4MVXA 5CLQA 5FL7A 2FR8C 3CVOA 5IANA 3TAUA 1SVUA 1NE7A 3QVGB 4IIBA 1GXSA 4LC0A 4EHMA 1T5IA 4LZOA 2ZIGA 4Q9DA 1KZPA 5FOXA 1WB9A 1KRWA 2NO7A 5KOJB 4HAWA 4Y9TA 3IQFA 5ES3A 3Q2KA 2PT9A 1R88A 2G5GX 3TVDA 2NP7A 1V1MA 3C98A 4TV9F 4IH4A 5CFZA 1ARZA 3TCKA 2BM1A 4G9EA 5DNDA 1F0NA 4YDRA 4HB4A 4QYIA 4EW6A 3HZRA 4ZRNA 2VS1A 1HR0B 3ZDYB 4EUFA 3D02A 1LY1A 1XQ6A 4KO2S 3CO5A 5EKUA 2HDOA 3D6MA 2WHQA 3A9RA 4Q3CA 3UFXB 1T5BA 4H7KA 1MRZA 1M0TA 2J9GA 5AJVB 2OCDA 1TM3E 1E2DA 3VO9A 1XTJA 3I8OA 1K7XB 3AVVA 3W78A 4FB4A 1MJ5A 3UW3A 1PNOA 3CCCA 4F6CA 4N54A 5HZGA 4RIFA 4MAAA 4BP9A 2QTNA 4JVMA 2BTDA 3M4NA 2B69A 4M1MA 5HZMA 3IJEB 2CHZA 4LWZA 1MTOA 2W37A 1WD5A 3L43A 2XYQA 4KRYA 4KDRA 4EW3A 4ENRA 4UCXA 2XUJA 3L05A 3NNNA 5HF9A 1E94E 4DF3A 2FRDA 4WWNA 1U0HC 3PITA 2I2OA 4IG9A 4BMOB 3U4QB 5K3AA 1M1ZA 2B9VA 3IKLA 3P9KA 2K7FA 1DCTA 4OX9B 1EP9A 3OP1A 4LY6A 1ONSA 4C2AA 3DBLA 3PDJA 3PI7A 1O9BA 3QYJA 1GQOA 4PR0A 1DRVA 3CCBA 3WV5A 3T3DA 4UREA 1GGMA 1M1NA 4TRQA 2HLHA 4HX2A 5BPHA 3UC5A 4V0QA 4AUEA 4RH3A 1O5TA 3SS8A 3GU3A 2QK4A 5I5EA 3D3JA 4J1SA 3CR3A 2ZS7A 1GG5A 4AM9A 3VPFA 2Q3BA 2OLJA 4UHHA 4ZOAA 4CIAA 3GGSA 2IP2A 3C7CB 1RZ4A 2WQ7A 2EJVA 1J0EA 4RD2A 4I2WA 4F97A 3BGOS 4LGYA 2Y92A 1OLSB 1BSVA 5KYYA 2HJRA 5TPWA 1X0VA 4F9FA 4NRHB 1EEXB 1OUMA 5DEIA 1AIPA 3WQQA 1TYBE 1F0PA 2FVYA 4US0R 2VYIA 1KP3A 2GKOA 2OC9A 4PRYA 2VDKB 1XT6A 3VR6A 1J2TA 4G5HA 4YDOA 2H16A 2QF7A 3OIUA 2CGEA 3E2PA 1GUAA 1EB8A 1I0ZA 4WJKB 1NFRA 2CYCA 4KH0A 4GP6A 4N6GA 2G9NA 3A0UA 1RWOA 1ZL2A 1EGAA 1FPQA 1TU0A 4PFKA 1PTKA 1QRDA 1E3LA 3DCIA 3VR3D 2Z2IA 2C7GA 1EFVB 3I8SA 1JZTA 4LFCB 2H65A 2FCRA 3AFOA 4R9SA 3CKCA 2AG5A 2BEJA 1WDLA 3JASB 3TJZA 3W6NA 3L13A 1NVAA 3FGOA 5A04A 4I9NA 1VSUA 3GEHA 3ROXA 3FJ1A 5KKCA 3B89A 3W8EA 1F0YA 1PS9A 5EE5B 1UC8A 5GJWC 1DMRA 1U5AA 4ZO6A 4B7CA 3FFWA 5JXJA 2V5FA 4DEXA 1U3WA 4IFTA 1Q1BA 2WXJA 1ZJ6A 2X7HA 1NF2A 3K0AB 4DMLA 4JA0A 1YKFA 4OXYA 2C78A 4M0MA 3HDTA 3W4IA 2ZIXB 3AFGA 4Z4HA 2E49A 2JFVA 3W4JA 5CB8A 4CM5A 3FOWA 2IY9A 1C7ZA 1EHYA 4LEUA 1RKBA 2ZWIA 1E5TA 2ORWA 3A37A 4Q1VA 1SVWA 1XLWA 2AKAB 2WFZA 3GG9A 4KLAA 4MNTA 2Y6VA 3HXDA 3LGSA 3PRKE 4K9KA 4MAMA 4EI2A 1YBFA 3UJPA 2QUBA 3N7TA 2QUIA 1JDZA 3WKCA 5FBVB 2QZAA 4CM8A 2IKSA 3DDUA 2BJHA 1H2UA 4LBZA 4WLNA 3U80A 1H6AA 1U8TA 1T29A 2B8WA 1SN7A 4XYLA 2JJ2A 1PL0A 4P08A 5T57A 1B76A 3TLGA 3AZQA 3DP7A 5KNGA 3DAFA 2UYCA 3DMDA 4R9NA 3KOUA 3ND7A 2W9XA 4Q34A 5JH7B 2IBSA 1JDVA 2HA2A 3B6EA 4OP1A 3OQOA 1QCDA 3I6QA 3DEHA 5EYLA 2XRMA 3A14A 3ZPJA 4G24A 4J94A 4L5BA 1LC0A 4A8HA 2HC9A 4V3IA 3HJTA 4X7RA 2X6QA 4S0XA 5LKRA 3RTGA 1J2UA 3U3OA 1V7PC 4KWIA 1O5IA 3ND9A 3WWYA 3A6KA 4TMFA 4O1OA 1L4NA 4KXXA 1CF4A 2HMVA 2EKQA 4EG0A 1E8NA 1WUJS 4D92A 3M81A 2D3TA 3I4CA 4KZKA 4YB8A 2HU7A 5HJ7A 1NRXA 5HVNA 2DU8A 3A9WA 1GNTA 4B31A 2BKAA 2WTXA 3A06A 3E82A 4QOEA 3TE6A 2J9ZB 3M6FA 1QG0A 2ENWA 3KDPA 4BWRA 4MHTA 4DG9A 4LVUA 4LOJA 4EKYA 5IBCA 3RYCB 2LAIA 2V5VA 5IJ0A 2VDUE 5G0WA 5EMJA 2ONYA 2ZJAA 4KQ6A 1XVLA 4B6FA 5B55A 1RYEA 5IUJC 2NPIA 4M4SA 4A6PA 3MT9A 4BKRA 3Q87B 3U1BA 3GLIA 3S2FA 4E4YA 1RKXA 1CJTC 5F98A 2XUIA 3P97A 4DQKA 5KNBD 1TMYA 1XDUA 2PQMA 2PMCA 3DMRA 2PUHA 2LGJA 3DEKA 3IC5A 3SPXA 3T3IA 1RJ9A 5AKJA 1ZI8A 3QAQA 3EAFA 3B8EA 3G68A 5DWDA 4TL8A 4R0MA 5JS8A 3S1LA 1ODFA 2VJMA 5EHZA 2XBMA 2UWJG 3BXXA 1E3IA 1N9GA 2OKGA 2I7DA 3M1AA 1XZQA 4CLRB 3D81A 4DR3B 3QG1A 4APFA 5LQCA 2BISA 2WWXA 4YALA 3U7QA 3BYZA 1YZNA 4EKGA 3ANTA 2Z3VA 2HNAA 3IUEA 5LMUB 4U8GA 3B53X 5ESDA 3ZQ4A 3CHQA 2MYPA 2HGSA 3EN0A 5JECA 2B78A 4WN9B 1E92A 1OR8A 4YRMA 1R9MA 1UDCA 2XWQA 1YXMA 1TJNA 1PGOA 2UDPA 4J07A 4RDXA 1YOBA 5AKXA 3V7NA 3MKRA 2Z4SA 4F21A 4FYMA 4A1FA 2ZI7A 4JBXA 2OG2A 2XV1A 3I72A 3E4BA 1SBCA 3EWAA 3A1FA 3SC4A 5FQOA 5KWSA 5F7ZA 4DLUA 4EITA 2OWEA 5B7PA 4HI8A 2ZWAA 3EVNA 3ORRA 3TECE 3LSTA 2JBAA 2Q3EA 4ANXA 1FTSA 1G8YA 1L8OA 2IUSA 4FU0A 3K0EA 3JV7A 1WLSA 2OXTA 3WGMA 2DLCX 1DSSG 2JHPA 1G5FA 3ZHYA 3SFYA 3WYGA 1QHXA 3FOEC 1IBKB 3DP9A 4QO7A 4MV4A 3GLRA 4CMIA 3D9HA 3U64A 2C5EA 3O4FA 1C14A 4FHDA 2CCGA 1JFTA 4QAJA 3ZNQA 4XCXA 3VTXA 4A92A 5J2TB 4ENQA 1NBMA 2OP0A 2Z98A 5IAOA 5E4FA 3BDIA 2WPNA 5GQSA 2WYWA 4Y2YA 5C8DA 4I3HA 1DTEA 1CUIA 1ECCA 3D8UA 1DCEA 1CQJA 3KJFA 4JFAA 5B7QA 4ZVUA 1HX8A 3H5AA 4F6LA 1YK0A 2YVQA 2O20A 2ROQA 1SZPA 4NFLA 4YP9A 4EGFA 4NARA 5K0ZA 3IIKA 2J0SA 2IX9A 5EIEA 1CB7A 1EVEA 2CXUA 4UU0A 2YV2A 3PHJA 1DKQA 3KKMA 2I3DA 4ZV4A 1TJ4A 1J0XO 3HCDA 3BBPA 2G0NA 2CE7A 2ISSD 1QB7A 2RGCA 2GCIA 3NRBA 1LPAB 3JXIA 5AW2A 3K8YA 5KX5A 2IYAA 3N0TA 3DL0A 1N36B 4BTEA 4HLUC 4KE9A 3VU1A 1SUAA 4B46A 3RBVA 5IWCA 4WI1A 2PN1A 3M1LA 3MKQB 3V3KA 4CLXA 3VKGA 1NN1A 4TL9A 4L9SA 1T25A 3WGOA 4DIDA 2WP8J 4J7WA 3I45A 1UC5B 3N53A 5D87A 3TTXA 3SYKA 1G8HA 2J3QA 2VNKA 1OBCA 2I54A 4A03A 1D2GA 2PCLA 4X1IB 4D25A 2GZ3A 2EGHA 3PUZA 4GLFA 4J1TA 5EL0A 4HOYA 5IAKA 2EW8A 1BOOA 2X9GA 1KO5A 1ST3A 1N4AA 3RG2A 4WN9A 1K8RA 3QW4B 4IQGA 4B09A 1I7DA 5B7GA 2Y0BA 2YUIA 2PMEA 2UXCB 3QQPA 4ZTZB 3RSHA 2VXYA 5LN1A 1KAGA 1KI2A 3JD0A 5FJIA 5JTUA 3I61A 3R7FA 1M2OA 1EP2B 5DRYA 2ZLBA 5I9MA 3IVGA 3ZWNA 4IIJA 4UNQA 5FJYA 4ND5A 3H8SA 1N2XA 3D8RA 4OU5A 2QTLA 2O7NA 4Y6PA 3S2ZA 3VC3A 3C3RA 3RC9A 1A88A 1RHQA 2KW5A 4EHLA 2ODEA 1P0IA 2IOYA 5SYMA 1XA3A 4BUCA 2J0EA 2HF9A 4ZXFA 1HM5A 5KQLA 3A2KA 4TL7A 4U63A 4UC0A 3DJYA 1R3DA 5HKLA 2AXVA 1UOEA 2VQ3A 3EUVA 2BOVA 2NUAA 1PZXA 1TF5A 2J3DA 3G59A 4LHWA 1WAO1 2WI8A 1JQJC 1ISMA 1KO4A 1OXKB 5EP1A 2GRQB 1RRCA 2Y27A 4FK8A 1UOQA 3VR6D 3VPCA 1ZM2A 4WLUA 3L1HA 4NACA 2XGOA 3I2JA 3TZHA 3MUFA 3HVRA 3GQVA 2HQBA 3U37A 5LQMA 4B3RB 1G6HA 3JQRA 4Y30A 3KLMX 4R1UA 4KFSA 2HSDA 3KL2A 3UENA 3DVLA 2G1PA 1GFZA 2TMKA 1HO8A 1DAOA 4HQLA 2AD1A 4YH1A 1RPAA 1LF5A 3PUWA 5KBYA 1JMYA 1TA4A 4JLOA 4PX3A 1FMTA 4OHBA 3O8NA 3PQEA 4LTMA 1VCHA 2JCGA 4TQGA 4B6RA 4JS0A 2RKWA 2X2EA 5ECGC 3SHFA 1NHWA 4A0SA 1U8UA 4C20A 4AXBA 4KXLA 4P3OA 4BO1A 2FZEA 1Z5VA 5AXBA 2Y1XA 1DTWA 4N3BA 1PZMA 2R7NA 3RK4A 4D7AA 1F0KA 3BERA 4N9QA 4Z8YA 1Y3IA 4HLUA 3T7AA 1XD9A 5DIZA 3HVEA 3TPZA 2GFHA 1XAIA 3DZJA 1TMOA 3AR5A 4IMIB 5BP7A 5KU1A 3P9NA 1JI0A 4XB2A 5C8VA 3RARA 4ML3A 3H5OA 4GC5A 3OZFA 3TN7A 2XJ9A 4ZIRA 3Q7AA 2YZNA 1AKWA 4HAOA 2ZIXA 3KJHA 1JF8A 1SULA 4ZT5A 5HWSA 1DDOA 3FWKA 4MLDA 2CC2A 3C5WP 1OFUX 4GVXA 3EK2A 2VUHB 4Z4CA 3NHYA 2AW6A 2RHWA 3BCRA 4TTTS 1E6UA 2JGMA 4AOFA 1QH8A 1L7BA 1R4MA 3U3RA 2BKKB 4U7JA 4RTQA 1Z2EA 3P9RA 1OX5A 2WD8A 1P2DA 2ZI5A 4N1AA 4OX9Y 1RWNA 3DW3X 2MINB 3CEMA 1ZGBA 3DMNA 2X4DA 3OZRA 4P7FA 2CLFB 3A6FA 1A9XA 3ZCPA 3N2LA 2ZIUB 4WCVA 3TZ6A 4D45A 3ICVA 4W9NC 2RAVA 2W2MA 4KQGA 5FNVA 3QXJA 1M5UA 2NYJA 3AG2E 4CF4A 2BJWA 1QCZA 1EU1A 2AYZA 1I3NA 1EJ0A 1RZRA 4AZ0B 3A6JA 3OQMA 4HFMA 4U7HA 5AM3A 3F67A 4Q3LA 3ITEA 3AEKB 2N1MA 3FMGA 5JDCA 4YRLA 4Y1RA 3LQRA 3PWZA 5GONB 2JVIA 4PE5B 3IRUA 3A9UA 4CF3A 4EX6A 5FA5A 2EJWA 1ADCA 1GKUB 5IVPA 3I4GA 1UPFA 3HBLA 2MYNA 2QPLA 4W5NA 5EFZA 2WHRA 1HDOA 4IOLA 1JAZA 2O8DA 1GQRA 3IKMB 4AD8A 3MINB 4J8FA 3FU0A 3ASGA 1FP2A 3DOUA 1YR8A 4RVUA 5BN4B 2VLIA 3SR3A 1BN6A 2RAPA 5F33A 4C5CA 2QHXA 3FX2A 2Y9MB 3QTLA 4RPGA 4URUR 4NDZA 3W6PA 2WXFA 3DOHA 3RREA 5L4SA 1E7VA 3G82C 2BMDA 4U7FA 5HKPA 3VU9A 5EIFA 4HL6A 3GRKA 1PJLA 3AJEA 3IHYA 3MOGA 1I1HA 3SJ7A 2BVNA 4TSFD 5AOVA 1DC7A 1L7EA 3A0RB 3DXZA 3GMIA 1E9BA 2AQKA 3ONWA 4KLNA 3RYFA 4WJLA 2WM3A 3CQCB 3W3AD 2X6IA 1IVNA 3L0SA 2R44A 3HKEA 5GJVC 1LW7A 4WK4B 1LV7A 3QVUA 4D2IA 2C2MA 1R0SA 1XE3A 1J8MF 4RSRA 4Z0HO 3T5PA 2W2KB 5C3MA 5ALWA 3C1AA 1YQWA 4D3YA 3QUBA 3CXUA 3EXEB 2FN9A 2FLVA 3WIOA 3OU6A 2CEKA 4G1UC 1S4QA 2HF2A 4BMZA 5H1YA 4ZI7F 1NWHA 4FYPA 3NHKA 3OXLA 2PX2A 1HPLA 3VLEA 3VR2D 3MCTA 4B3XA 1G8GA 4A63B 5DLEA 1N6KA 3NAWA 1OHHA 2QN6A 3VKWA 4CMJA 1Z2AA 3WNDA 5FV4A 1JBKA 3BH6A 1B0PA 4TMKA 1DCQA 2VJPA 3CNOA 5FQ7A 4NK4A 3NEYA 1ORHA 3KPJA 3HCBA 1AN0A 2FQWA 1QHHB 2WQZA 2ZI6A 2ZS9A 3GPCA 4UU8A 3Q7EA 1Z4OA 3R5SA 4ZYVA 1N5KA 3U4MA 1RBZA 5C31A 1I8TA 3CEPB 3I39X 3N0WA 2IWRA 5AUPB 2X0FA 2WWGA 3LL7A 5G55A 2B25A 1R8QA 1UQTA 2IXFA 3BWMA 3GLSA 3SNXA 3H2BA 2XCLA 2PUVA 2XA9A 3M83A 4P86A 4WXEA 2ORYA 1QPBA 2Q50A 2W2KA 2XA2A 4MKXA 1KARA 4MRMB 4F5ZA 2PUCA 1BVHA 1XP8A 4UM7A 3MCVA 1P4GA 4BZQA 1NW3A 3PD1A 5GM2A 4A27A 3LX4A 1T5HX 2RBEA 1SCNE 1ZC4A 1GZUA 2VJOA 4KR0A 4KOEC 4DRYA 2FPIB 2I67A 1NZJA 4Q4CA 4RJLA 2B3TA 3ED1A 2Q4TA 2WB2A 2J3MA 4H77A 1L5VA 2WSMA 3KPYA 1FQOA 3KEZA 4B73A 4M3OA 4Y67A 1JJVA 5JCOA 2VCYA 2WC1A 3ZNNA 1BJTA 3G9UA 1OZGA 1RWWA 4KGVA 3RAPR 3TI7A 4NZZA 4NBLA 1R0YA 1G5QA 1L8AA 2NVWA 2YRFA 3I9V6 3KOOA 5D84A 3LUKA 5K7SA 2HGZA 1RCTE 2NYRA 3OLZA 4BCCA 4BMCA 3BREA 3OEED 4WY2A 1NFIE 3FU5A 4GZ3A 4MRMA 4UW9A 3ZDZB 1E18A 1MC4A 2PZGA 4RPJA 5KSZA 1N94A 1E2BA 3A4MA 3PUJA 1I51A 2WHPB 2WXNA 4OYLA 2PS0A 3I83A 3N6XA 1SXJD 1F5NA 1VCNA 3DTVB 3OJOA 3H3FA 3F97A 2W6JA 4D4IA 1JLHA 4JODA 1MENA 4EAAA 3CQGB 4NWIA 5L3QA 3H5NA 2V7QA 1YVPA 3R0QA 3WGZA 5A0TA 4FNAA 4Z54A 2MU1A 1FUYB 2ZJOA 3LW7A 5CB0A 4DGSA 3E37A 2BI7A 1VKJA 1WE2A 3GLHE 2OWDA 3NHWA 3Q10A 1O8BA 2ZUFA 2CHGA 3G5AA 3PI6A 4C14A 4P29A 4RQBA 1VG1A 2D1FA 2EWWA 2D13A 4B93B 4XM1A 4WOBA 1OTYA 4MXDA 1CY2A 3QFTA 4WRRA 3WY9A 1JR3D 3I5UA 1RTKA 1MAAA 2O1EA 5BSWA 4MVJH 1X1DA 2HNKA 1AKTA 1WXGA 3F90A 5DASA 2R6HA 1TYAE 2JJYA 3PCRB 1NDHA 4IXNA 4HVAA 2QI9F 4BS9A 5D5HA 4V1CI 5K05A 1XU7A 5LOVF 1WZEA 4UU7A 3ISVA 5CJJA 4LDQA 3KVRA 2QGZA 3PG5A 1T2NA 2SBTA 2DHQA 2P2ZA 1YU6A 5FTJA 4CL0A 4Z3KA 4OHOA 4M0FA 1ZOSA 3QY9A 4CL2A 3HGTA 3FTVA 3ML1A 5CH3A 4KMSA 2OBXA 4ILGA 3B60A 3WLJA 5IF3A 1I94B 1JFLA 3LYHA 1DC5A 1Z33A 3OLVA 3RABA 1PZNA 2GGSA 1MB0A 2QLMA 3L46A 1KDZA 3ZDEA 4B44A 5KVAA 1YTUA 1KAEA 3NM5A 5DHRA 2DY1A 4JEIA 5KQRA 1JHZA 1PWZA 2ZYAA 2AUTA 1QOPB 4I1IA 3HZOA 4EGSA 1O4WA 3E27A 3HC7A 2PZIA 4YFVA 2D7JA 1RC8A 2JG3A 1ZW6A 2X1LA 3FOBA 4ZTUB 2IYLD 2D1YA 2PZBA 4Y6QA 3SNHA 1NMZA 4BNJA 1HG2A 1GGKA 2H7YA 1MAUA 3D9KA 2OHVA 3V34A 3HA3A 1Z63A 1P6XA 2I1VB 4Z4GA 4PLWA 1Z6ZA 2QRHA 4ZAWA 1MO2A 1VYHA 1C1XA 1VHJA 1MJGM 4IIFA 4Z0NA 5BQ5A 2ONJA 3WLPA 5LMCA 2PGNA 1XKTA 2X9LA 1UUFA 4GYOA 1U4NA 3HVIA 1X6VA 1Z17A 2LIVA 4II2A 4EEZA 4DADA 5IT5A 1D3AA 1VDMA 2BHSA 1U7OA 1Y8QB 2IYUA 5EIHA 3ASUA 3CZAA 3TDNA 3QFCA 3R74A 3T12A 2FJUA 4MW2A 5E2AA 3I9MA 3BRQA 3RLIA 2EKPA 3ZQJA 2ZK7A 121PA 3AI2A 4PZDA 4BUJA 2NV2B 5EC8A 4K28A 1U3VA 4UUMA 1A82A 3BIFA 3D2AA 4RZUA 3MWEA 3RHZA 5AHWA 3C3BA 3BE5A 4ACKA 1RXIA 1EK6A 1FNNA 3KT0A 4IO0A 4WWPA 2BGNA 3QEJA 4Y2PA 2QTBA 5DBFA 3LKUA 1A9TA 2X4LA 1NBIA 1PP4A 1RQ2A 2WAOA 4B48A 3HNRA 2DPHA 2Q7DA 1F06A 4ZQHA 1QP7A 3WRWA 1F7UA 3ZY4A 1UOHA 2IHVA 2NQ2C 3IJPA 1PL6A 2NX2A 2ZRPA 2ZU6A 2IE8A 2Z4TA 2RARA 3G2TA 4L5CA 5BQXA 2R03A 2BM0A 2H59A 4EUHA 1GWNA 1B93A 4EQ6B 4BLUA 1UPAA 2QE7A 4DMKA 3EVFA 1Y1QA 1OILA 1Z8FA 2WYVA 3Q3EA 4FGUA 4X00A 3WOHA 1GAWA 2XSZD 4F2PA 3AONB 3L0PA 4WZAE 5FUVA 3OT1B 3EIUA 4D80A 1UWVA 4XI9A 3OZIA 2ZZMA 2WUFA 4R2JA 1KORA 3IVCA 2H00A 2R7AA 1G42A 2QTTA 3PUYA 2WNHA 3FDJA 4I5DA 4F9TA 3IL2A 2BUBA 4RJIA 1YL7A 4HDOB 4X9XA 1A2BA 4V0SA 1YB6A 3NO4A 1II9A 2JFFA 3LFTA 3DF9A 2I1KA 3TFWA 3E7FA 2RB4A 5D5QA 1HDZA 4OB8A 2F7SA 1W4BA 3T5VA 3B7TA 3AUAA 3U39A 2QD5A 3T1HB 2HBZA 4HPXB 5GWXA 4BFTA 5ADUS 1BE6A 4MWEA 2EGUA 4HGRA 4X91A 5CAEB 2H7VA 3BMQB 3QX9A 4PVDA 2JHGA 1RXEA 5K8IA 3UYKA 2GZHA 4KJXA 2H06A 5JRDS 4PTZA 5D2MC 5AIBA 4CV1A 2WNSA 1GL7A 1TB4A 1G8AA 2D1RA 1BRMA 2WIDA 3B1VA 4NNJA 1P4JA 1QP8A 4M83A 3ZQ6A 4WHMA 2YBEA 3T9AA 3FA2A 1CP2A 3QYAA 4MB6A 3DHEA 3ZD9A 4UWGA 4WCFB 2JLXA 3ULKA 3CXRA 5CR9A 5DHFA 3TLCA 2RHJA 4L5IA 2P6RA 3OPVA 2HREA 5KTNA 3A1WA 3DT9A 1S63A 4AU1A 3M1YA 4O4JA 4Z1MD 2GAJA 1W0JD 2BUCA 3NQPA 1JSXA 4FYYA 3LJ3A 4R7LA 2P5SA 3Q2OA 5DCYA 5ALEA 4YMIA 2RIRA 3OEHA 1HXHA 3AM4A 3G2SA 2C61A 3EC2A 1PFVA 4RIHA 1SOMA 5LU9A 2A0FA 2BAGA 3PHIA 1NVFA 2GTHA 4HMPA 4HVTA 2B1GA 9ATCA 1JAXA 2PJRA 1K3FA 4DA6A 5KMGA 2ENUA 1CUGA 3WIUA 4H7XA 1S2GA 2C1ZA 4MV1A 3IHWA 3A9VA 2DR0A 3AF4A 1NASA 4LC9A 3WYBA 5AVTA 4TSFA 4WV3A 3KEQA 4PZYA 3J7AC 2UZAA 5JE8A 4WFQA 5FLYA 2UZ0A 1UFVA 2B34A 2PJDA 1IQ0A 1IG3A 3T7SA 5LD2C 4KVFA 3OESA 1CUEA 4JN6B 4C0EA 1S0PA 3TAXA 1XKLA 1C3JA 1PR5A 2CLKB 1MKYA 2WXIA 3D59A 4BB0A 2IHTA 4QJ3A 8ATCA 4DQLA 4D8UA 5KYXA 2QUKA 3COJA 1IK4A 4HDKB 3F4KA 3ESLA 1U90A 1NW7A 1HK7A 2DOKA 1Y7LA 3RD5A 2WUWE 1DWUA 4HWPA 1BKDR 4QECA 4CTOA 5BYAA 1AS0A 2X2PA 1M7BA 1AUVA 3A6HA 4OH7A 3B6IA 1BYIA 1CY1A 4NG4A 1HU3A 1LRLA 3LUDA 4ESOA 1MO6A 1PFQA 3O0TA 3AX6A 3GD7A 3VDXA 4LGMA 3N71A 4CKZA 2I91A 2PZMA 2JHFA 3KOYA 4UTOA 1AGPA 1GAQA 1Q0LA 2WA2A 1QGED 1HFEL 2YIJA 4FZJA 1GRQA 4DNXA 2RHMA 1A7KA 2X6HA 1RJGA 1XOIA 1IWPB 2O5RA 4GW3A 3CWZA 4Y8VA 1BXKA 1TC2A 5DF1A 2PO7A 2A5UA 5FI3A 5IC6A 4YPFA 3EW9A 4PHGA 3V1YA 2CYBA 5E75A 3GMSA 4JBNA 4XKCA 2Y67A 2RFMA 1N1EA 5EPEA 3G7NA 4YAKA 4ZV7A 1W29A 2HYIC 4JMPA 4UXIA 4YI3A 4G89A 4O02B 2QL7A 5ITZA 5JVDA 1EA5A 3PCTA 1CY4A 3LLUA 5HF5A 4F5EA 1QF6A 4GYWA 1LF8A 2CVHA 4JYZA 4TYNA 4W7IA 2A30A 1E6EA 3OM9A 4ARBA 4D3DA 5KTOA 4TZKA 1Q1GA 3PNMA 1ZISA 4R1SA 3WLEA 4DKJA 4JB0A 1FRNA 5FR2A 1OREA 4J49A 4R1LA 3I2YX 3DLPX 2FPPA 3LVBA 4RV5A 4K9OA 4X8OA 3HDQA 4FI3C 5CK4A 3ER6A 5FUXA 5TPZD 3K73O 1P1BA 3T54A 3V1NA 2C7PA 3EWIA 3QBEA 2P2CA 1V25A 4Z9YA 3KZCA 2FR0A 3L1IA 3LT2A 5TEWA 3SU8A 2D06A 3AYZB 3MXTA 3N3AC 5IYZF 1FVXA 3UMSA 3X2SA 2BGGA 3UKDA 2IONA 2QYSA 4KSBA 4P7KA 3DXKG 4Q03A 1JDBC 1F1JA 4WX2B 3ZUPA 1N1GA 1EFVA 1UBKS 2DHEA 3L49A 2LSUA 4PFJA 2PRZA 4GQBA 4RK4A 4L1KA 4RK1A 5CVVA 5AOCA 1D4OA 2V7QD 2CDRA 2Q0HA 1FDSA 1LS1A 3EJ6A 4D6PA 5ENNA 4YC7A 1SU6A 5TMPA 1NKTA 5HXAA 2XRZA 2XA1A 3N0VA 5T6BA 2X22A 2YIDA 1P73A 3QW2A 3GK3A 3C45A 3EVDA 2XXAB 2CKMA 4ACBA 3CGGA 2XMCA 3WISA 3WV4A 5B64A 4KCGA 1QQ6A 2J4DA 3GOQA 1L5LA 1J99A 3EXAA 1OXSC 3ZE7A 2OV1A 5L53A 1RC0A 2A35A 2E4UA 2I6GA 4R8MA 4E7PA 4R2HA 1RPTA 1P6QA 3F5SA 1AU9A 1SKUA 1Y7IA 2D5AA 1Z37A 1KZ6A 2A9OA 2PYIA 3CSUA 3U9TA 4AN0A 1LCIA 2W0SA 2FX5A 4K9MA 3CHPA 4AMGA 5GOTA 3SK0A 4GA2A 3S8EA 2ZXUA 1PSWA 1XLTA 1U94A 1J2RA 1G9SA 1LLUA 2XQJA 2IEDA 2CXPA 3HHEA 1RYMA 2R00A 5T3UA 4B47A 2E85A 2XF2A 1NYLA 3TIFA 3TW8A 1S1MA 3U31A 1S4MA 3BUSA 1OCRE 1IBRA 1Q7TA 1FP4B 3BZWA 1J22A 4I4TA 2VJCA 4N01A 5FZSA 2A86A 3B48A 4B6QA 2B4YA 1A69A 4FFBA 3KLPX 4LXTA 3BSSA 2QW1A 2YCLA 3CNNA 2NADA 3TH5A 2NUTA 2R25B 1AJEA 1QMGA 3F6RA 2ZSUA 3JAMA 3JUEA 3TTWA 1FVHA 3GY0A 3TKAA 5DBEX 4NE2A 4XOUA 2IH2A 3DV9A 4C0KA 1RAIA 4IVNA 2F0YA 1CUCA 1FRFS 4OVUA 1O94D 4ONEA 4AURA 3JRWA 5A6VA 1GFSA 1Q1EA 3CRW1 3LS2A 3AW9A 3GJYA 5EKSA 3S7BA 1Q1NA 1QQTA 2XUHA 3F8WA 3GJ4A 3OEEA 3QTTA 4I5GA 4JOQA 1HT0A 2UZIR 4UNSA 4CCWA 4D43A 4POOA 5B4VA 5FQ8A 3IEKA 3MW8A 2ODTX 1QRTA 1SD1A 4KNWA 2EIJE 3VH3A 5MF6A 4EBFA 2AF4C 4UMDA 2CW5A 4ZCQA 1HO3A 2OR3A 3CY6A 3EASA 4NG5A 4OMCA 4TKZA 1BNCA 1Z2OX 4ZEWA 1IOWA 2VPXA 2YJ4A 2RK4A 3NASA 8OHMA 1KO7A 3LCRA 3G89A 3M7IA 1NONA 4GKJB 2H63A 4ILEA 1GEGA 2ARKA 3QSGA 2A1TR 2P0YA 2P9CA 4MCHA 1ZLYA 3FDZA 4LRXA 4QGGA 4N6NA 5H5JA 4D9NA 5FPKA 3HA5A 1TGYA 3N2IA 2GNAA 1Y9AA 2NXNA 4B81A 5I7WA 4F4UA 2LAHA 1J97A 3VBCA 4BNXA 2J5RA 3G85A 3I1IA 4FCVA 4ZZ0A 2IZOA 3L18A 4YROA 3Q73A 3D9LA 4LDZA 1KIFA 4ZO4A 4CM8B 3TWQA 5AJDA 2P6UA 2IEBA 4BNVA 1CYDA 2D8MA 4IIDA 4AX4A 2X0KA 2BEVA 3AJ9A 2OA0A 1EK2A 4BV2A 1K6IA 3FVWA 5DBGA 5JTTA 3WQRA 3R5HA 3NP9A 2ZUEA 1JPJA 3W8RA 1QJCA 5CFOA 1ZB1A 1DJMA 1YZYA 1Q2ZA 3GJQA 3ACCA 3BXHA 4EG5A 3R09A 5FA8A 2BBSA 1AHHA 2HMUA 3GVIA 5L3ZA 1WAMA 2EFDB 1KETA 2W93A 3X1ZA 1S2LA 1E8XA 1Z2DA 3TLGB 1E0DA 5EIXA 3N8HA 3GPDG 2GPJA 4JJ7A 3AEQA 4NYIQ 1KMCA 4A7PA 5KPDA 4L95C 1SVOA 4COOA 4JAVC 4YVOA 1EYHA 3WMXA 2QLFA 2KI5A 2I62A 2Q3DA 3DNFA 3KKLA 4MI6A 2I2XB 2IV3A 2O7QA 4QBKA 4XVQA 5ANRB 4Q1EA 4Q9AA 4D5EA 1K8ZB 2IUYA 5EFOA 3ZZ1A 3SE7A 4GA0A 1YJBA 3ZZUA 3NBMA 5AQBA 4K05A 3K70C 4LY3A 1I0LA 4XZ3A 1ZS9A 5ENDA 4GP7A 3MRVA 4M7OA 4A0GA 4K0KB 4GT1A 1WCXA 5A0VA 2DH6A 3VC1A 1ORVA 4G4IA 3M4JA 1RCFA 4ADSG 2OUIA 4YAGA 1U2EA 2WABA 3DXYA 4LSZE 1NX9A 4BWGA 1QHGA 5JCPA 5K8VA 1E9FA 4LF7B 1YMPA 1BX0A 1LVHA 2WVIA 4MUJA 5GZ6A 3A7EA 1THGA 4A5OA 3S2IA 2QN2A 1DC8A 1I2ZA 1K9VF 4QXAA 4Q4LA 1XWIA 4R1NA 3TSCA 3OZDA 3QF7A 1E3DA 2BBTA 1P91A 2VUSA 2CLMB 1XC7A 5KVSA 3RWMB 3E3OA 5AKHA 1ZL0A 2H4YA 1V3TA 2YUTA 2GTIA 1L1QA 4UBNA 1LBIA 1FS5A 4YONB 3NU1A 2R97A 2X4IA 3QLJA 1MMFB 4M8IA 4TKLA 3TNFA 1WDWB 4IINA 4II7A 5JO9A 1Y33E 1KGSA 1ZH2A 3RKUA 2XH8A 4U0ZA 3V8MA 1OI3A 1THZA 4H1UA 1JZQA 4LNGA 4F7WA 3LJNA 3RF6A 4G6ZA 1TADA 1V47A 3ZFWA 3KHSA 3LZDA 4EJ6A 3T4UA 5AVJA 1KWKA 4FFMA 4MJXA 4YRPA 4D56A 1A8IA 4NCHA 5M72A 1QP0A 1R27A 2G6BA 3UF0A 3F6QA 2PVSA 3A9TA 2AZ4A 2JS7A 3MIIA 3QITA 4I08A 2W6MA 3UAYA 1GQSA 3HYCA 3A32A 2GWRA 2F1IA 3B3GA 1UJ4A 4HNSA 5F52A 3UWDA 6NULA 4IKOA 4LVOA 1MJFA 4AQ7A 2O8EA 2QLTA 4AV7A 1XRRA 2UYYA 2BJVA 1JALA 2XSZA 3ILHA 4KU4A 3NNSA 3NYQA 3K0BA 3PEWA 2OV4A 1BE1A 3ZKJA 4B4VA 4EZEA 1IN4A 3QUTA 3FSGA 2VT6A 3HB4X 4EB6A 5MN6A 3PFHA 5BUCA 1XD2A 1RLIA 1U11A 4C01A 4Q1DA 4UBMA 3FN4A 4RY8A 4FMCB 4J0CA 2EHJA 4P84A 5D66A 4R4JA 2C82A 3EZ6A 2GYYA 1IKND 5FI0B 2KM4A 3VMMA 1ORIA 4A3TA 3ZXSA 2QYUA 2IPLA 2KM1A 2PPLA 3G2LA 4L9AA 4AJ4A 3PJFA 5E9JA 1AZSC 5JJIA 3SSNA 4EW1A 1YKGA 4HH4A 4RHYA 1ORRA 5CT8A 2DLNA 2R8PA 1ML4A 1AOXA 1CJVC 1DCFA 2OCGA 1DBSA 2V59A 3KXIA 1GYPA 1HTTA 1AY0A 5DTIA 3RNLA 4YV1A 3L07A 4DCTA 1FFWA 2G72A 2HIAA 2EARA 2QT0A 3T3HA 1C1DA 3BOSA 4FZ3A 1ESEA 5BMVA 2WMNA 1HLGA 1MVLA 1ZGHA 1C29B 1NR5A 1T9ZA 2CHEA 1QGZA 3O47A 4GUDA 2IF0A 1UBNA 4Q4HA 5K0CA 4E0BA 4TYQA 4JYCA 3U81A 1E99A 2GBGA 3E8XA 1C3OB 5B4TA 2AMFA 4AIFA 4WVFA 1F6WA 1JP7A 3H3XA 3ZWYA 3R5JA 5NULA 2Q1TA 3TQCA 1QBKC 3YASA 2VHJA 3R8CA 2ERCA 1QS0B 3OMXA 4AF8A 4Z4IA 1DU4A 4MZXA 2BTEA 2O5CA 4NMLA 2A92A 1ZWLA 2Q6TA 4JJ4A 4UPEA 5B36A 3PZRA 1GKYA 5A3RA 3DFZA 4JLNA 2OAP1 4ZC8A 1NUTA 2BSXA 1CIJA 3AM5A 1HWYA 2VHTA 4J6FA 1B89A 2FW8A 3IAAA 5ILOA 1C1YA 1L8QA 4KTTE 3FYUC 1GNRA 5G1NA 3JW8A 3BGDA 1Y34E 4B3GA 3AR6A 1AV6A 1UDXA 3OSUA 4DWWA 1L5FA 3V2UA 3OOEA 4IUCS 3K09C 1JCRA 3ZWQA 3IPYA 5A2QA 5LLDA 3QEBZ 3TQFA 5FI5A 1P9NA 3ULYA 3I6MA 1KJ8A 2F55A 3KR2A 2WWWA 2ATEA 2EFJA 2X5KO 5G0SA 1EDBA 4BZZA 5HQ8A 3ZDAA 1JSZA 2YDXA 1NNSA 3UJ3X 2ZDQA 4URWR 4X84A 1C9NA 4I43A 4Z99A 4A23A 4BEBA 1IVYA 4DHEA 3GT4A 4MW0A 2J32A 1RI3A 4IIXA 3U9SA 1KJQA 4YBRA 3DLTA 3WGNA 1KXJA 5GIPE 3PNLB 1M34A 5FWQA 3HA7A 3ZU2A 2PA3A 4IHJF 4BBPA 4NNPA 3VVMA 4WKGA 4EGAA 2R751 1W4RA 2C4TA 1SA5A 4GXNA 1GA6A 3KQWA 4I1UA 4NFYA 4G8CA 1NN5A 5TQ0A 2NSHA 5T3RA 4AS3A 2JC3A 4JBYA 1FVOA 5JCJD 1Y8MA 4M8KA 5E6RB 5K20A 1CQIB 1W5AA 2D5IA 1TYZA 3GRYA 4EYSA 2SECE 2PQRA 4RGQA 4EHFA 3TD2A 4PTLA 2HEIA 1F2DA 4ILIA 2C94A 1H2TC 4QBGB 3CKKA 3TRJA 4XLLA 1DKNA 4QARA 4MGHA 1R66A 2R65A 1NUQA 4AX8A 4EY4A 3WNBA 1JJ7A 2EF1A 2JFNA 1SQ6A 1C8LA 4YCSA 3NHUA 3SD7A 1DEKA 1X9IA 2V4MA 2B3DA 5K4HA 1WG8A 4MW4A 2E48A 4IZ6A 2LPMA 1DQNA 1AKRA 2WYOA 3A25A 1DRUA 2HY7A 1DPFA 2R8RA 1OW3B 3CH6A 3CT6A 3H5IA 4DPKA 2BIFA 1PNQA 1X81A 2VYQA 3E84A 1N6OA 1O2DA 1G8MA 1GLGA 4L4YA 1MLDA 1RI1A 1XPRA 1MYOA 4UE6A 4EI9A 3GO4A 3LUGA 1GNPA 1MX4A 4ATZD 3JD2A 3Q3GE 3R44A 4NP6A 2ZUWA 4E5SA 2Z57A 2ZB8A 4B6JA 1ZCZA 4Q4HB 1SRQA 4WZBB 2H3EA 1DUVG 4K87A 2GXSA 4N0PA 3FAZA 4MVYA 4MS1A 2IJGX 1CQIA 2VRBA 4C07A 2PNJA 1E8YA 4JVSA 2DCMA 3CLVA 1JG1A 1YB7A 3GVCA 4MQFB 1U7UA 3I9JA 1RKQA 2F1JA 1WUYA 2OECA 2GESA 3VU3A 2SKEA 1C9DB 4AZVA 1X1TA 3RTAA 1XXHE 4L2IA 2FU5C 2WWTA 3JCZA 4QGSA 5M04A 2R84A 1ECLA 3F6PA 1XFDA 3MZLB 1LRJA 2XIQA 3KUKA 1CEEA 3FYUA 4QKQA 3FHLA 1NL3A 3DOCA 2HA3A 3BWVA 2WZDA 5EAIA 3UWKA 1EVQA 1NI3A 3L8CA 1XRPA 5T67A 1HEUA 5CGQB 2D00A 1OH6A 3WGTA 1OAOC 2PGDA 1QK3A 2YOFA 2DH5A 4EBAA 3ML9A 1H3EA 1SBYA 2ZYGA 3PIDA 2EKZA 4KXKB 3Q5EA 4LE1A 4LJ6A 4MQ5A 5LUBA 3A4IA 4UD6A 5IH7A 4C2UA 1WQ1R 4DRXE 2YHCA 13PKA 1CF2O 3MWLA 2D3WA 4MVJA 3V1LA 1GAXA 3EQ6A 2FOXA 2GN4A 3MCAA 5BWNA 4QPCA 3D9IA 1VIYA 3ASOE 2J7KA 2XMBA 1IMOA 1T9KA 3LO8A 3ZKWB 3PS9A 3U40A 2VDJA 2VTEA 4UAGA 3Q7IA 5LVAA 4JLBA 3A3KA 1X9GA 2IYRA 2J0VA 3SVLA 5FOTA 4BDSA 4XQ9A 3GFOA 5JCOC 2VHZA 1UG3A 4G5YA 1EGVB 1MCZA 1KYWA 2LKCA 5KJKA 3MYRA 1AB5A 3IYLW 2X23A 2RKBA 4JQCA 1BGVA 1SO8A 2WU8A 4FFVA 2YZ2A 1G8JA 2NZUG 1B7GO 1A2QA 1USUA 1WW2A 3QKTA 1PLKA 1E1CB 1OGYA 4L3OA 4RFSB 5F35A 4ECEA 2OVBA 2Q9AA 1BDBA 5AW6A 4FJ1A 2HK8A 4BNMA 4DBVO 3KU4A 4QPZA 3V4OA 3EIJA 1I30A 1D6JA 3IS3A 4MW1A 4DARA 4UQLA 4MYHA 3AAAC 2C2GA 1O77A 1DT5A 1GAJA 2P4HX 1VDZA 4FQ7A 2L6JA 1UBTS 2JGEA 2YW9A 2HA0A 5D3ZA 3FDHA 4ZICA 4IEIA 1CERA 3IODA 2XBLA 4OHUA 4MI9A 4ZAFA 4DCVA 5HF8A 4GRIA 3JTEA 2HOQA 3WGGA 2WOJA 1ETUA 1NTRA 2EV9A 2G5PA 2GN2A 4BVJA 1UF9A 4INZA 3UXMA 3OH8A 2XOEA 3PDHA 3FTSA 1X80B 3ENKA 4CMEC 4O0LA 1R4NA 5A05A 3RC7A 2FPOA 1WPXA 2PFKA 3JQGA 1ULBA 4JLUA 4L3VA 5C37A 3KJNA 4WACA 1PFUA 4DLAA 3EXEA 3ZD8A 4JLAA 4YJ2B 1IHOA 2CUNA 3Q49B 1IZZA 3QLVC 2NTNA 2YTZA 3VR5H 5MFZA 3VNVA 2GPBA 1GV1A 3VYVA 2I55A 2IC5A 1N4SA 1XCJA 5ELLA 3JWPA 2PSSA 4D4MA 1JWFA 4KE7A 1C80A 3PGXA 1PBNA 1EWVA 2QX9A 1DBQA 4OHMA 2VO1A 2VKQA 2DTXA 2XCQA 4YWHA 3I53A 3RIGA 3LF1A 4DJTA 3Q0EA 4DPLA 4YHHB 2YV4A 1S2DA 2QYTA 1EB9A 1EA7A 4MQEB 3K70D 1IJFA 4TLEA 3MNFA 4YLGA 1TN6A 1RACA 2NG1A 4WH0A 1L7OA 4HEJA 2VRCD 2EINE 1CZUA 1DDIA 3RO3A 1AGXA 4AQDA 5I5GA 1ZHFA 3EZ9A 1ECJA 2IZ5A 1CNEA 2MYTA 3BIXA 3F47A 1M0SA 3QOWA 1VKHA 4RMGA 1GUBA 1I7PA 3TR0A 1AKMA 2FPIA 4ESVA 1E5VA 1UBGA 4G63A 3RFTA 4Q7KA 3PHCA 4MVWA 1V7CA 3LWNA 1TKCA 3L7IA 2PSEA 3EEIA 3LWDA 5IUKC 4GTVA 3JQPA 3RFXA 1GZ6A 1U0NA 3LW8A 3ESAA 4EA6A 4WAFA 1XZIA 1L6RA 2J1LA 3A6PC 1GN9A 1TW3A 1XKQA 2EIXA 4XJVA 3VHXA 3PC8A 1LEHA 4KR7A 3DO5A 2GH1A 3QWAA 2IU4A 4M55A 4Q3BA 5K0GA 3PGJA 2A1UA 2PZ8A 3HXOA 1SKMA 5L9AA 4B2PA 2C5FA 2QZ9A 4Q6BA 5DRTA 4KOAA 1SC3A 1ZJZA 4U4AA 2C58A 2E5LB 3KZNA 2VGXB 1Z88A 1KZ7B 5TARA 2VDPB 2WSSA 3OLYA 3QVSA 2PMBA 4FI3F 3KFXA 4M0UA 1OROA 3SFXA 4O63O 4W5JA 1ZN8A 3EHDA 3H2YA 2P91A 4KN8A 5H81A 3RJZA 4DDHA 5JOQA 1X5BA 1A77A 3PNTB 1WUHS 4FFBB 1YR7A 2L17A 4EY7A 1VE3A 2SNIE 2HJSA 2VJAA 4IRMA 4AWXA 5C8XA 1IN6A 1WXFA 1VI5A 1C3EA 1XN1A 3R4VA 3SZOA 2MCFA 1IHYA 1P75A 2FEZA 4A1OA 4DUZB 1NW4A 1N5OX 3N6VA 4KQFA 3K5WA 2I6HA 5EWJB 4AG3A 4EG8A 3VYWA 4G65A 1BI7B 1E7UA 1AVTA 2ZUSA 3IO5A 3LQQA 4WKOA 4BVLA 3W4KA 4DLVA 4OQYA 5MGBA 4NENA 2J31A 4QGBA 5DCLA 2JGKA 4EI8A 3U13A 2C4KA 5COAA 2YYAA 2CZQA 5K5EA 3NDBB 4PSAA 2DHDA 1BCRA 1ZNYA 3OPNA 4RADA 4W1QA 1NYTA 5BYBA 2C0LA 3ETEA 3RJMA 2BGRA 4EFMA 3JZFA 4URXR 4K81B 1ZM4A 3S2GA 3K9QO 4CTNA 4R8KA 3K1TA 4TS3A 4CR7A 3CHRA 5HGXA 3H16A 4GVLA 4YVFA 3IDAA 5H70A 5IM4A 3CX4A 1JU9A 4EJFA 1H19A 2FMFA 4RTSA 4B8AA 3FU6A 1R6DA 4QSHA 1MV5A 4ZI7B 5KNDA 1NZDA 4AKTA 2CV0A 1SNYA 2BP7A 4W5OA 3D1JA 1JHYA 1KJWA 3WL4A 5ESRA 3RIXA 2YFKA 4DX6D 3C3AA 1Z0IA 3EWNA 3PYMA 1JV2B 2K2WA 1MC5A 4H2DA 4EF4A 3BXFA 5KREA 3QTBA 4EX7A 1TA9A 2AXPA 3HBAA 1LDMA 5A7DB 2L0IA 3AT1A 4IBOA 4RAQA 5E6SB 5E3IA 1NJ1A 3H4MA 4BN5A 1JEDA 2ILRA 3TWSA 3RF7A 1LDBA 3MB5A 5DI9A 1MTZA 4TV8F 5DTEA 1EFKA 5DBKA 2IYYA 1MIOB 3P9IA 5GIOE 1Q11A 2QLLA 2FK7A 3GJ5A 4HO1X 3P8ZA 1L1RA 2DBZA 2CXQA 5H8WA 1H65A 5FWYA 5L6LB 1II0A 1XLUA 1MB4A 1MXFA 2FR1A 3LPLA 4RA6B 2BYTA 5KYUA 2DC1A 1GCAA 4OMDA 3RBZA 3A9CA 4JHJA 3DQPA 1F14A 1ULTA 5FADA 3HV2A 4A9AA 1O9GA 1QQ5A 3HCCA 1J2EA 1CK4A 5BNTA 1YE3A 3ONEA 2FW6A 3FSRA 3T15A 1N2GA 3OJXA 3VVLA 2F1KA 1Y48E 1L4UA 1OZHA 5LQRA 5LXTB 1TAUA 3HY4A 1N8KA 1ZMRA 2YHSA 2Z3ZA 4J0QA 1KJIA 3D8BA 3L8HA 3SJBA 4FHZA 4B8CB 1K27A 4OFWA 3ZV5A 5ICCA 1A27A 1IPHA 3NOVA 1AQNA 4GB9A 1XHEA 2HJVA 1QQEA 2KZTB 2VDWB 4MDHA 1XKXA 3ZJUA 4RMNA 2E0IA 1NYQA 1X42A 5ADHA 3R9AB 1QYVA 3QZUA 4LNHA 4KFCA 1Q1AA 2Q2OA 3DEFA 3EDYA 5HDQA 4B76A 2FPMA 4L1BA 1BWSA 1F12A 3TWUA 1NVEA 2PWZA 4POAA 3ROEA 3QNKA 4A15A 3TOZA 2I8AA 1AHIA 3ELDA 3KE9A 2AS0A 4MKFA 1BA2A 4OUDA 3OHSX 2V97A 4LYFA 4OH1A 4PBTA 5MN4A 1JQ5A 2AUNA 4F4HA 1R18A 4PXAA 3DFUA 2NC9A 4YAJA 5CG1A 1M2JA 3LHFA 4G8JA 4QQFA 2AW3A 3VDRA 3MEKA 4LOLA 1IZ9A 4DUGA 4LVCA 3WMWA 3R9MA 1G2IA 2BCGY 2IOFA 4TTAA 5JWOA 3FI9A 4LJRA 5C7OO 5HMMA 4AJPA 4Z4FA 4C76A 4XVHA 3GJ7A 3QOXA 2GDZA 3ECCA 5LLSA 3SMQA 3V7UA 4GKBA 4OHYA 2C4WA 3MWDB 2AUMA 3DGEC 3T4PA 2OGTA 3CF2A 1T0HB 1F51E 3B9QA 3O3NB 3QKWA 2XZLA 1FJHA 1UODA 1KI3A 2MSDB 3NBKA 1FEZA 1GZSA 4HDQB 4IMJB 2QD3A 3M49A 3F8TA 1R0BA 1AURA 4I1OA 1AH2A 4J8SA 1WUTA 1TT5A 2ZPAA 4TTJA 3KSQA 3IH5A 1G7CA 1HC7A 3PZ4A 4LZPA 4P5DA 4C0LA 3AVOA 1ZOIA 1M76A 2IRWA 1FDUA 3GT3A 5ECWA 3CH7A 5DZSA 2ZWPA 3F5FA 5B58C 1UINA 3CUSA 4BEVA 2JH9A 2EP5A 3PP8A 1CEQA 3IPAA 4ZP1A 1UZLA 2A0UA 2QAIA 7ADHA 5L95A 1RCUA 1JWGA 3O8DA 1KDTA 4O6FA 2H9YA 3P2IA 2B4KA 1JR6A 4OFBA 5AVUA 2AOWA 4BFWA 2OO5C 5BT9A 2EKBA 2AQHA 2JRCA 3LQ2A 4DBZA 2J4CA 3ICPA 1E0KA 2DF8A 1KU6A 1TVEA 1XEXA 5HCNA 4C7BA 1VMIA 1Q0TA 4EYKA 2C1XA 1SVSA 3PENA 4MB0A 4FIZA 1JJIA 1VA4A 1N77A 1A4UA 3THYA 4P36A 4G8LA 4NC9A 5BRNA 2CMFA 2EWMA 3HKDB 4UTNA 3O1JC 2P1DA 2YBDA 3CR7A 1A7UA 2GCOA 2Q3CA 1DLIA 2VQDA 3PNYA 4TQ9A 5DWVA 4DMCA 3QE2A 5K3BA 2B8EA 3E1SA 1Z0KA 4TMTA 4HNQA 5DBIA 3F2VA 5BURA 1MUUA 5SZIA 1JJFA 5JATA 4GYKA 1LTQA 4K9PA 4FPXA 4UEOA 1OIXA 2QMZA 1H5QA 1Q15A 1UAGA 2ADOA 2QVLA 4YFYA 3OC0A 4Y6SA 5JVDF 4BO3A 4LG6A 3CX6A 4ENUA 3V4RA 4JITA 4Z4EA 4RL4A 1SW6A 4OQQA 5AFSA 2YXNA 2YHIB 3QWPA 1JIVA 1KH2A 4XJSA 5PGMA 4AMYA 3K9HA 1S8OA 4C4OA 2Q4BA 4DHWA 5KWEA 2B0CA 3AL0C 2YC2C 1WSWA 3UX4A 3V8BA 1DO2A 4ZI7A 2AWOA 2LDBA 2ZB4A 2AFHB 4PO9A 4Q3KA 3WWCA 1VHLA 2BFEA 2Q28A 2AFIA 2FRVA 2FZVA 1TQHA 2JVKA 3GARA 3JYPA 3KWJA 4IOMA 4NOLA 2ECOA 1ESDA 4WIAA 3CPHA 1DBVO 4TRNA 1UN9A 1E8MA 3NYWA 3FKJA 3MSCA 3AQIA 4PM4A 3OFKA 2JGIA 2UY1B 1ZUHA 3INNA 2XYRA 2AA3A 2X38A 4DL9A 4XOIA 4RD3A 3ZD6A 4BOYA 1UFOA 2Z56A 4X45A 1OCCE 2ZXEA 5D6NA 4CM3A 3A3PA 3RIYA 1ZAKA 3ZE9A 1Y3DE 1TT5B 3TVTA 1I7LA 4F8EA 3ISJA 2ZRFA 1EP1B 4MW5A 5A71A 1L5HA 5ARGA 1A71A 2OZPA 1CVRA 1B23P 3M6VA 3PR1A 4FGWA 4HAVA 3LFUA 2NTYC 3FEYA 2FH5B 1ES9A 3ROPA 4HYTA 4JL0A 4JDUA 2JAWA 4LYDA 5LMNB 4NPCA 2AWNA 2F4VB 4XCQA 3IAFA 2PX8A 1BDMA 3FCXA 3STUA 1O96A 5ALIA 4DA8A 3ND5A 1Z0UA 1TJPB 4UOZA 2OY0A 1SCBA 5HNKA 3NHAA 3N2NA 3UHFA 1K5DA 1JFFB 1RWXA 2JIBA 1J56A 3IRVA 4IRUB 5AVXA 3GLIE 4MUEA 4JFRA 3SX0A 4LNUD 2HD4A 3CT4A 5LOVB 5AQ7A 1LSOA 1SK9A 4CCAA 1N6IA 2GRMA 1RRKA 2VC2B 1ZCFA 2D5CA 1IMJA 1P39A 4QBFA 1L7NA 3SEZA 4YMVA 1DBPA 2QL6A 4G0XA 3SC2B 3ZDBA 1ENZA 4NH4A 4S2EA 4DGQA 4I1PA 1PIWA 1YUMA 2NGRA 2XT0A 2OO5A 3C3KA 1UMBB 5ALZA 4DYHA 4PIMA 3SXUB 4UTRA 3O83A 4ZQIA 1JXOA 1DRWA 3IMEA 1QBQA 2GROB 3CZCA 3K9GA 4EQ6A 2DHRA 2DG2A 1NG9A 4A6EA 2EZUA 1N7IA 1G3NB 4AQYB 5BSUA 4INOA 2OHFA 4HMQA 2H5JA 3HBJA 4GRAA 3TXNA 3SO8A 3MPOA 3KPWA 4N6OA 3Q4GA 1QU3A 2PY6A 2ONDA 1YKSA 1G5HA 5HTKA 5LYJA 1M66A 1YNOA 2PD3A 4G84A 4J1NA 4LRYA 4IZOA 3H1GA 3WKEA 3V42A 4G4SP 4YJFA 2LCIA 2C5BA 2DTDA 3EIHA 3BULA 3JALB 3MQ2A 3OZEA 4HGOA 2Q1XA 1YC5A 2CXOA 2IX3A 1A9SA 1KJYA 1XZBA 5KS2A 1R15A 4IXDA 1KZ9A 1VC2A 2JHAA 1H6OA 1C3XA 1RT9A 1T0PA 2V7GA 2YFQA 3JS5A 3LIPA 4FEYA 2C20A 3Q8KA 3L7JA 4ZEXA 1E2EA 2BGTA 4NBUA 4TLAA 4XUGB 3BL6A 4E2YA 1N95A 2QVZX 1BD4A 3OCWA 1TL7C 1UC4B 3PPIA 1SUCA 5EDSA 4F3CA 3L9TA 4OM7A 3OURA 5EWMA 3B1XA 2N47A 1S64A 1JEAA 2WHPA 4HTFA 2GK3A 3ZDCA 3DHNA 2GD1O 4B6GA 2DFKB 1TCBA 5C8YA 4LMBA 3NIWA 1JYFA 3G2VA 3BQ9A 4KXFB 1K1EA 2WT8A 4U8YD 1TW2A 2PTHA 1K08A 1SVKA 1LQ2A 2AR7A 2OZKA 3L9XA 4EGQA 1W49A 4GUAA 5FL3A 3CC8A 4B8ZA 2IIBA 3U66A 2MYOA 2IT1A 3PD7A 4V0LA 1KYQA 1FU4A 1HNXB 3CSTA 5ENTD 3NAQA 1Y6IA 4N5CA 2FSVC 2BRUA 3RFVA 1J07A 2ATCA 3ZDRA 4YI5A 5I4IA 1YMQA 2YHUA 4M22A 2W6ID 3NC1C 3PEEA 3TOCA 4PEVA 3WNZA 4G85A 1QGUB 1UOPA 2QRVA 4FOPA 3MCWA 1P81A 3WGHA 5JI3E 3DE3X 3B82A 1C7QA 2UYOA 1KC1A 1JXAA 2VFAA 2XWBF 1IPEA 3DPSA 1FMCA 1NP6A 4HRXA 3IP7A 3MAGA 1P1CA 4OHWA 3QVWA 4Y1EA 3ROFA 1GGFA 4CTJA 3ANYB 4FW8A 2ZZKA 5I7FA 5KYWA 2PMWB 1CUSA 5EIWA 2HLNA 4DR5B 4F1SA 1HMYA 3QKYA 2KJQA 5SV2A 4GGPA 7MDHA 1MOPA 3O4IA 4B4WA 3QNWA 1Y6FA 4RFSA 4NENB 4H0CA 4X71A 5ULLA 3SBXA 3E3MA 1C9MA 3Q9NC 1T2FA 5AW4A 3JR3A 1NQWA 3HV0A 1WULS 3AZPA 1AS2A 1UPTA 2JKZA 1N5JA 1TIKA 2X6KA 2XQ0A 1TMGE 2Q3LA 3L93A 2OQRA 4NV3A 4XEHA 3E9EA 4AJ9A 3JXJA 3BMCB 3FGNA 3LLCA 3NGMA 4ZOQI 5ABPA 3GCWA 9LDTA 5HW0A 4YPOA 2PLWA 3DBRB 3KTFA 3DG9A 3OJFA 3T4XA 1CS0A 3U19A 2D0DA 4TM8A 1EUYA 2JANA 3KOWA 5EVJA 2PT6A 3I5PA 3FSEA 4K88A 4FWTA 3UXYA 4EPRA 1RHMA 1YB1A 1YAHA 5FB3A 4DRZA 3AFIA 1J20A 3RAUA 2GJKA 1CY7A 2HCJB 4LRUA 4OQXA 1BD8A 1Z75A 5TQ2B 3UJBA 1UW4B 2AXNA 4QJIA 2YZ7A 1JQBA 2C5AA 2OCKA 3HB5X 1QZXA 3M2PA 2Q5OA 2WYHA 3OFJA 4WQMA 4YR7A 3T61A 4MV3A 4EA7A 3W1EA 5FTWA 4RDIA 4MHSA 4YJ2A 1FFSA 4MV0A 2ZGVA 3PQ4A 1NA0A 2F48A 1ENOA 3MJHA 1RM5A 3K32A 3P4YA 4BKPA 4C4SA 1Q95A 1AQ6A 1E3WB 1N2SA 3OOJA 5ANLA 1G20A 1PDWA 2JLCA 5EZYB 4R40A 3U48A 3WHIA 3IX7A 4BVKA 1PJZA 4P9NA 3D4IA 1YA0A 2FDXA 1BMDA 3IA2A 3SBDA 2F2TA 1X8XA 3WAJA 4B3SB 1CUBA 2FMKA 4E5YA 4X20B 4DR7B 4FCTA 1MDFA 2HN9A 3CGWA 1M3SA 1I4OA 2X19A 3VTYA 4NBVA 3TQRA 3BVPA 3SZRA 3UTCA 3EXFA 2FHPA 3B2EA 2ESRA 3OTIA 3N7UA 1HXIA 1J8YF 1V8ZA 3V1UA 5JAQA 3EDCA 4IDQA 4RHFA 1A96A 2B92A 1TF2A 1P8AA 2BH9A 2XBUA 3HCWA 3FFLA 2IW1A 2QM8A 2EAUA 5HSGA 2PWYA 1Q2UA 1X70A 1VHDA 4L9RA 1C2TA 3EUFA 4EYQA 2P2SA 4YP7A 4C43A 1LJLA 2BDUA 2CBZA 3QXCA 4UUQA 4MPDA 3UMYA 3QVTA 2PGOA 4IDAA 1ZVJA 3M5WA 1WR8A 5F1YA 3DOOA 5LR6A 2OM6A 3ANXA 2QU7A 1XQ1A 3UICA 4GOJA 1Z62A 1ULHA 1XZMA 2P35A 1R5NA 4M1ZA 4IHKA 1R6XA 1W76A 1QGAA 1ZD3A 3WDKA 2GEUA 4I46A 1WZ2A 4MOWA 5AKYA 5F5NA 1LJ8A 1XTVA 2D2EA 4OHVA 4EYGA 4IIYA 4LC1A 5DM2A 5CX1A 3PVSA 2C7VA 3LXRA 1UAYA 3H86A 4YK7A 4CTKA 2WXMA 1ZICA 5CDYA 3RS0A 4LFBB 4DM4A 5AW8A 3JVEA 2BD0A 4JD5A 5C80A 3TQSA 1GSIA 2GM9A 2XVYA 2A5GA 3WIEA 3CH5A 4K9NA 4RPLA 3WLSA 2ZJYA 3Q9NA 1IBLB 4W4TA 5KBAA 3H0CA 1HYBA 4KVOA 1F2VA 1J25A 4Q02A 4UVGA 3U56A 3PTAA 1X1EA 2RH9B 1QE3A 3BH7A 4R84A 4Z4QA 1CXZA 3JQDA 1SBHA 1MAHA 2PYZA 3N8DA 3OZXA 5GY7A 3U62A 3W3ZB 1EX1A 4A8TA 3HSYA 4DCMA 2VNIA 3IJ5A 4EMBA 3FCYA 1JEOA 3ZHSA 1AC5A 1GFIA 3GROA 2ZIFA 3F78A 2ATXA 2PZAA 3QOYA 1N0UA 1G2QA 3LX5A 4ER0A 2R8BA 1Q92A 1XZNA 4ZV9A 2QN7A 1L4YA 2Z6VA 3PU6A 1W4ZA 1KY5A 1ZESA 2F8MA 5D01A 5ALTA 4D57A 5CU7A 3HR4A 2H4JA 2R11A 2VSFA 4LOKA 4OL9A 4NBKA 4UM9D 1TI7A 2RFAA 3QF4B 1VJGA 1Z4KA 1VLZA 3T5AA 3UKUG 1JJAA 2FZLA 5TX7A 1DJOA 4KXUA 2YOHA 3NJ8A 2TYSB 4P33A 2CJFA 3KSAC 3HI4A 2IVFA 2ZS8A 4MLCA 1PR2A 3CJQA 3IUPA 3BWCA 3JQQA 4IIUA 1FDTA 3QEMB 4UULA 2Y4TA 3CPSA 4AZ0A 3GOHA 4KE6A 1ZNWA 4RY9A 4XB1A 1U8XX 3EZ2A 1O97D 4GTSA 4KVAA 4E94A 1Z73A 4HH3C 1KVSA 4YRSA 3N1UA 2QG4A 3ETHA 2OFOA 1Q16A 2R86A 2C2ZA 2YWEA 3GUYA 3R7BA 2D0IA 1PFWA 4A36A 3U0VA <