4I6GA

A vertebrate cryptochrome with fad
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
490
structure length
476
Chain Sequence
ASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMELPKKPAVAVSSQQMESCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLEANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cryptochrome-2
publication title SCFFBXL3 ubiquitin ligase targets cryptochromes at their cofactor pocket.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 170
structure length 476
sequence length 490
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4i6gA03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i6gA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4i6gA01
3TZLA 4MWDA 1I6KA 1NUPA 4ZCTA 1NUSA 4EG7A 3UK2A 5K0TA 3DPIA 2QTNA 4GU5A 1H3NA 2A86A 4MVCA 1JMVA 4X0EA 4ZCPA 2J09A 1OBHA 3FIUA 1N78A 4PBTA 4ZT7A 4EG5A 4R2MA 3AG6A 2QUKA 2I1LA 1G8GA 1VBNA 4PBSA 4JXXA 2DR2A 1EFVB 2DETA 1B6TA 1JIJA 1N2IA 4OUDB 2CV2A 3FDXA 1F7VA 1I6LA 1K97A 1KAQA 1OWPA 2QTMA 3H99A 3ZIUA 1EFVA 1GTSA 5LM3A 4J75A 4OUDA 4HJRA 4RUKA 1U0BB 1JEEA 4XSVA 5LFAA 4MW9A 3RK0A 2H2AA 2E89A 2H29A 3RHSA 2VTBB 1M8PA 1PG0A 3MMXA 3VRHA 1O96B 1TYBE 2CSXA 4EG3A 1VLHA 1DNPA 3INNA 2Z09A 1O5TA 1N1DA 1P7PA 2XRZA 4MWEA 2VTBA 2O5RA 1O96A 2C5SA 1N2HA 3IMCA 3PXUA 4MUEA 4JZYA 4MUNA 3IVXA 3VU8A 2XRYA 1Y42X 2AKEA 3P0HA 1ZJWA 5DK4A 3AKZA 1NYLA 3RK1A 1NUTA 1WXFA 4CDNA 1TYAE 4I6JA 1TYCA 2D13A 1D2RA 4CDMA 5TS2A 1QJCA 3H97A 3G6KA 1V47A 3HGMA 3FY4A 3H05A 3COWA 4MW5A 2JANA 4CQNA 5TEWA 1YI8A 2E21A 1IQ0A 1COZA 1MJHA 2DERA 4MWBA 1JZQA 2A84A 1YUMA 4QRDA 1KH2A 1JIIA 3AG5A 1EE1A 3OTWA 1N75A 1QU2A 4UZEA 1JIKA 1NUQA 3Q12A 4DLPA 1O0BA 3MUEA 4MUHA 3FHJA 1ILEA 1O95C 1M8KA 4F4HA 4DDKA 1H3EA 1O95D 1O94D 2J08A 1T9GR 1G59A 1TFUA 3HV0A 3COYA 3L92A 1PFVA 1J20A 3IVGA 3PRHA 4TS1A 3AFHA 1Q77A 1J1ZA 1YIAA 4H3SA 1GLNA 4EF6A 4EG8A 3SDBA 4MWCA 5JBNA 1NP7A 1MC1A 1R6XA 5DASA 2YXNA 4ARCA 2X0KA 1TYDE 2GM3A 1CT9A 4MAFA 1OBCA 2X1LA 4RPIA 5FO0A 4HJXA 4E1AA 3HL4A 2A1TR 1JZSA 3E27A 4ZCQA 2JA2A 1Q19A 3UY4A 2DUMA 3FI0A 1IQRA 5KHAA 1U7DA 2BYTA 1QTQA 4MQ6A 4EGAA 3COZA 1MBZA 2JAXA 2PG3A 1T6YA 4A91A 1MAUA 2PFSA 3IODA 2A7XA 5DEOA 1O0CA 1O97D 3U1VA 2CV0A 4EG4A 2CV1A 3MLBA 2EL7A 2X3FA 5TEVA 4MUJA 2PIDA 5HUJA 3CLSD 1MAWA 4KKVA 2DPLA 1JILA 5F23A 4ARIA 1PG2A 1XNHA 2G36A 3LOQA 1X6VA 4ZT2A 3IMEA 2CT8A 1GTRA 2PZAA 3N8HA 1KQNA 5BNZA 4JXZA 3ND6A 3CVUA 3HMQA 1I6MA 4U7JA 4G6ZA 4FZJA 5FO1A 2V0CA 4G5FA 3PNYA 1N2JA 2GOYA 1OWNA 3IUBA 3K9WA 1KP2A 5IHXA 5J58A 4Q16A 2CUZA 3D6UA 2D5BA 2AG6A 3IVCA 2Z3VA 1Q15A 1GPMA 3CLUD 2CFOA 3KT6A 4NAUA 1M1ZA 4MW7A 5J5AA 2WB2A 3SP1A 2NZ2A 3LCJA 3ZJUA 5HG0A 5IJXA 3ZXSA 4MUKA 1EXDA 4WSOA 1WXIA 3A4IA 3X1JA 3IOCA 2VXOA 3CA8A 3QTBA 1M8GA 3HFJA 5LLTA 1J70A 2HGZA 4YMIA 4DDHA 1N2BA 4PY2A 3ZJVA 3A04A 2D54A 3FOCA 1GZUA 3NV7A 4MW2A 4AQ7A 3A05A 4DNXA 4R2LA 2AZXA 1JEDA 1VBKA 1YULA 1U3CA 4ZT6A 1KH3A 3SZGA 1FFYA 4MUIA 1JECA 1A8HA 4K0RA 1WOYA 1I2DA 3UMVA 3F3MA 1MB9A 4KR6A 1WKBA 5EKDA 3RFFA 5H16A 2X1MA 4ZT3A 3M5WA 4F3RA 1IH8A 4YBRA 1U7XA 2OQ2A 1IFXA 2YWCA 1IVSA 4I6GA 2R5WA 3RJZA 4EFKA 3CVVA 1WQ3A 1O6BA 2OV4A 3D6VA 4Q93A 1M83A 2QJTA 3A2KA 1O94C 1QRUA 1R6UA 4U63A 4JFAA 2TS1A 5DB4A 3Q10A 3RBAA 3ZUGA 5K0SA 1ULHA 3MLAA 3SEQA 2B7LA 1MB2A 3ILVA 4MW0A 4MVXA 4NX2A 1QQTA 3AIIA 2WQ6A 1ZUNA 3FETA 1WZ2A 2QUHA 4KPUB 3IH5A 3IDFA 1R6TA 1FYDA 2QUJA 1M8JA 2WSIA 2Z08A 4ZT4A 1N2EA 3P52A 3K32A 4HK4A 4WNYA 2WQ7A 1BS2A 1S4MA 4KPUA 4ND6A 4OJMX 2J5BA 1WXEA 3CLTD 1H3FA 4NZPA 1KH1A 1WJGA 4MW4A 1IHOA 2DLCX 1J1UA 1TQ8A 1G8HA 3FG9A 4KR9A 4EG6A 1NUUA 3ISJA 4MW6A 1JHDA 3Q4GA 1O97C 2PZ8A 1IRXA 1QRSA 3TZEA 1EUYA 1WY5A 1NZJA 1ZH6A 2GKSA 3IUEA 1RQGA 1QRTA 3QE4A 3CLSC 2IELA 4NDAA 2ZUFA 1XJQA 3SZ3A 2RE8A 2YWBA 4J76A 2RD2A 4DE5A 2BTEA 2IJGX 3KT0A 1IQUA 4U8HA 1UFVA 4ZT5A 1T6ZA 2EJCA 4AS1A 2J4DA 2CYBA 3L93A 5AHWA 4QBTA 3TQOA 2V0GA 1LW7A 2NSYA 3MXTA 1G8FA 3UC5A 2PXHA 1J21A 2E0IA 3COVA 3H9CA 3KT3A 3G5AA 4YP6A 1KAMA 1X8XA 1OD6A 4GRIA 3TQIA 3SYTA 1YIDA 3IOEA 2J07A 2DXIA 4NAHA 2QJFA 1KQOA 4XFJA 3ND5A 4DDMA 3P0IA 1K4MA 3FWKA 4BWVA 4K03A 1QU3A 1OWMA 3NBKA 4I6EA 4MVYA 3CLUC 1EFPB 4P2BA 3OP1A 4MLPA 1QNFA 2CYCA 4MUGA 5FNZA 1KORA 4ZCSA 3ELBA 1EFPA 1U3DA 3ZXIA 3QTTA 5TGTA 1OWOA 4L2IB 4MVWA 3FNRA 2A88A 4KR7A 1F9AA 2CYAA 1PFUA 3P0JA 3JXEA 3X1KA 1SURA 3CVXA 2E18A 4L2IA 4S1OA 3AL0C 4EG1A 1N2OA 1TEZA 3DO8A 3PNVA 4MW1A 3ND7A 1H1TA 3KFLA 3CR8A 2DEUA 1N77A 3TS1A 1ZH0A 1XNGA 3TNJA 3ZGZA 5HUHA 1J09A 3FH0A 4ZCRA 3GMIA 1MOPA 1NI5A 3CLRC 3GUZA 1NSYA 3N9IA 1N2GA 4XFDA 5J59A 3VGJA 3CLRD 1F4LA 1WXHA 3H9BA 3IMGA 1KQPA 1VBMA 2QJOA 4CT0A 3BL5A 1PFWA 2QTRA 3CVWA 2A4MA 1NURA 1K92A 4NATA 1GN8A 1WQ4A 1F7UA 4MUFA 1HYBA 2QUIA 1T9GS 5KCMA 3DV2A 1KKUA 3ZJTA 2HMAA 1VL2A 3C8ZA 1JGTA 1LI5A 1YUNA 3GLVA 3IOBA 4YP5A 1N3LA 3G59A 1OWLA 2PZBA 4R0NA 3CLTC 4DJAA 2HZ7A 1T6XA 5KWVA 1LI7A 3LE8A 3HZRA 1EUQA 4YP7A 2A1TS 3CVYA 3PNBA 4ND7A 3UOWA 1KP3A 1K4KA 1V8FA 1XNJA 3N05A 3S3TA 3SEZA 3N2YA 2A1UB 1Q11A 1EJ2A 5H7XA 3X1MA 1M8FA 4HPWA 2O8VA 3DLAA 2ZP1A 4UZFA 1WXGA 2ZUEA 4QREA 4G5YA 2A1UA 1PFYA 3I05A 3KT8A 1KR2A 2YY5A 2IP1A 4JYZA 1MRZA 4MULA 4PBRA 1GAXA 3NBAA
chains in the Genus database with same CATH superfamily
2QR5A 5H3CA 3DL4A 3UK2A 1PBNA 2N46A 4EEXA 3DPIA 4GKBA 4BLQA 4A0QA 4YV0A 4O1IA 3V1KA 2FPPB 4P8RA 1DAMA 3DJYA 1YZKA 1G5TA 4BRWA 2J9FB 3AYXB 2GPJA 2GB4A 4EG3A 2IP2A 3MA0A 5KOHA 2RSLA 1E79D 3AMVA 1BLXB 3QFCA 4HSEA 2G4CA 4W8HA 2WHPB 3E4BA 3AS8A 3IT0A 5H02A 4CXMA 1VHWA 1P9RA 2ZR7A 5JE8A 1IQ0A 1QG0A 4KRFA 2Q4TA 4IRUB 5JASA 3WQQA 3E5MA 3DEAA 2YHAA 3DKIA 2NZWA 5CVTA 2HRRA 3GJTA 5B57C 3CVQA 3RGWS 2VSYA 1U4NA 5L3SB 5E4TA 1W7AA 2VOJA 2RFMA 1J20A 4MCJA 2F9FA 1Z0UA 4DDUA 2IIBA 4H9GA 3M9LA 4MWCA 4BCDA 3B1VA 2QW0X 3V31A 3RKRA 2X2EA 3GG2A 1TK9A 2XUFA 2YJGA 1J06A 4QDKA 2QZ9A 2E4YA 3OZCA 4MLCA 2BI8A 4FEEA 5KTPA 5HRUA 4OATA 3OQPA 4QDXA 5KU1A 3MG9A 3CZ5A 5EKQD 1J2UA 1O87A 3ESQA 3LKDA 4C9BA 4C3ZA 3AM1A 3EN0A 2BP7B 3FYHA 2JCGA 4L75A 5DHUA 5D0OD 3DEHA 4OXYA 4PAQA 1YR2A 1M2OA 2Q6IA 2VSXE 1H2UA 2X2FA 2B3DA 3W2HA 3LO8A 4H7YA 3KXLA 1MB3A 3OVMA 4RZSA 2AOUA 1RAHA 5J4VA 1CY4A 4YFVA 3KPWA 1T8TA 1YRQA 4TV9B 2IZ6A 1GCOA 1R64A 2PAFA 4ZOAA 1XA3A 3N6XA 1WQ3A 1EUCA 4LFCB 2Z56A 4CQLB 1TT5A 4V38A 4O2BB 3LQKA 1JQAA 4RS3A 2X6TA 1C2YA 1ZKDA 3RIBA 3HN6A 4G86A 4UVHA 5TQ2A 3WQBA 5GOZA 1Y1TA 4QIHA 1WXEA 4Q96A 1SOAA 5BN3B 2C8LA 1J1UA 3RYCA 3IAM6 5AUQA 5BR4A 3VH2A 5EIBC 1RTKA 4JBIA 4OL0A 4Z9XA 4R1TA 1L4NA 5AR1A 5GV8A 2HY7A 2PV7A 1ORDA 1VFNA 2QRVB 4JOBA 1ZN2A 4I50F 3IAHA 3H86A 2ETCA 5E9WA 2B83A 4I5DA 4D0GA 3QK0A 1PYOA 4E5SA 5IG2A 1A1SA 1RYDA 3I8SA 2C20A 4M0DA 1Z4MA 5LLSA 4PZCA 3L4BA 3VNRA 1OX4A 5ALRA 3UMBA 1X14A 4BNYA 5BSMA 3VYSB 3G2LA 3MELA 2CDNA 3AVWA 2CLMB 1Z2EA 3CW9A 4S1OA 2HCFA 5KSYA 1UK6A 2J8ZA 1E0JA 3PEEA 3RRMA 2X8AA 3N2LA 3Q6MA 5HE9A 3BH6A 4CIVA 1WZUA 2JKYA 3HHEA 3N5CA 3GMIA 4IGKA 1E9SA 3MW8A 3H9BA 2YZNA 2QC9A 9GPBA 3CVWA 4L5JA 1SXJE 1OJLA 1ZS9A 4Z7OB 1VMIA 3QVXA 1L7MA 1HZJA 2R03A 1Y5NA 2BZSA 1X7ZB 4B44A 4IJ6A 2M6KA 1N0RA 2PKQP 3IJPA 1B43A 2IU3A 4XIGS 1ZCJA 4EYEA 4ZZ2A 4DSTA 3G9QA 4BYGA 2XB9A 1CJVC 2PJZA 2KE5A 3ROPA 3WSTA 3N1UA 4R7LA 1EAMA 1LI4A 1MFPA 3ZVKA 3OT5A 3DTVD 1YE5A 4AX8A 4QTZA 3F8SA 3SNKA 2G0TA 5EQTA 3SC6A 5B58T 5MDHA 3DMHA 4BMZA 3BSFA 4EDFA 1GV0A 1Y9ZA 1FJXA 3PUZA 5KOHB 2F9MA 1Q74A 4R01A 4ED9A 5T7BA 4B09A 3WRXA 2KPOA 4QAQA 3CGWA 2C1XA 4RM2A 3UM9A 1G5PA 4Q6BA 2XDYA 1KZGB 1QJCA 2GMWA 2FN3A 4CI0B 3BT7A 1E8XA 5FPSA 3OJ0A 4MW5A 1VIMA 4EY3A 3UXHA 2KXPC 3C3WA 4JS0A 1O7JA 1G8AA 2ZS8A 3H4IA 2FN7A 2Q5LA 1B73A 1ATIA 1DT3A 4GM1A 4AWAA 2H5JA 2NQ2C 3KJIA 4FR5A 4CJXA 1R0XA 2WBLC 5E4YA 4EHMA 3SS9X 4RGVA 3DA8A 1NUHA 2JC3A 1WDLA 3WOHA 2C54A 3UWDA 2NVOA 4E1AA 3OQNA 2GK4A 1MGPA 3NO4A 2XW6A 4DUIA 4EYKA 3NHAA 4OLFA 2JEOA 3I9OA 3BCHA 3QJGA 4AEZC 1KVUA 2WHRA 1FNNA 1YDHA 1CEEA 1SD1A 1R0ZA 4W7HA 1PWXA 4C9BB 3IMEA 5B7QA 3TL2A 3LI2A 5G2OA 2C77A 1M2OB 1NBWB 1QLWA 3EWNA 2ZPUA 4DBLE 2BZGA 5AW2A 5JUWA 1QPBA 1NXWA 5G2NA 3WMGA 5HPYB 4PCUA 3TR0A 3W77A 1TN8A 2AOUB 3CA8A 2IYOA 3R5TA 4YMIA 4N3BA 2QPLA 5ECGC 1THTA 3LHDA 5JNSA 4DNXA 3R5SA 3A10A 1QIHA 3RT7A 4JI5B 3I9V1 3R3VA 3RFFA 3ZCQA 2NO7A 2DP4E 1CUSA 1TT5B 2FX2A 3QZUA 1QORA 4JH0A 2FPSA 3TLGA 1T1JA 4LY3A 2FCRA 4ZFHA 4BEWA 3OO1A 3P94A 4RF5A 1L7BA 3A6JA 2VPYA 2J3KA 5TQ2B 1CNMA 2CDBA 3EB9A 3B82A 3FM9A 2QZ4A 2X8JA 2NYRA 3GWGA 1XAIA 2YS6A 2RC5A 4Y2XA 3RYCB 2I4TA 3OSZA 6LDHA 2JAHA 3FTNA 4JSYA 3Q79A 4OIMA 4QD3A 4AQDA 1C0EA 3D2AA 1T0IA 5FT9A 3LDFA 5IX8A 2XQVA 1XB2A 1OXTA 4U8YD 5I7EA 3A6ZA 2BT4A 4KQHA 4Y1EA 1OXBB 1U7PA 4IILA 1BHO1 4K5CA 3ZHOA 4DILA 3BG1B 2VA9A 5D2CA 1EX1A 3ON5A 1OX4B 3EISA 1YDFA 2F3PA 1T8SA 4GPKA 3IPAA 5A4IS 2EGGA 1RD4A 3G2JA 5FOXA 2BGKA 1JYSA 1D3AA 4P22A 4PN3A 1EEXB 4N2SA 3NIWA 4CHGA 5BYBA 3RRMB 4G9GA 1MQSA 3F3KA 1Y6FA 3T3DA 3WAGA 4DLYA 4LI0A 1EBFA 5CGZA 1X92A 1OUVA 1I0ZA 4QARA 2ZW9A 3ADBA 3BWDD 3B12A 3ZZMA 3FMVA 2QJOA 2ZI6A 4KIJA 3T9AA 2IZ1A 2FMHA 3CUTA 1MO4A 1C9JA 4IMIB 5EZYF 3IO3A 2DUUA 4CNQA 1XZQA 2HMAA 2G5GX 1NFIE 2D8MA 1IKND 3HHPA 3CONA 5C8DA 4D8UA 1DKPA 3F7NA 2PXCA 3OMWA 5JXGA 1LBSA 1G5IA 4YT8A 4WLOA 2Z2XA 2I6UA 4DYVA 9MHTA 1P5HA 1N1EA 2R68A 2MIIA 2HA4A 1ZN7A 3LLUA 2DCMA 3ISMC 3BPSA 2I6QA 1PS9A 4FGSA 3UOAB 3HG7A 1V3TA 4OMDA 3RCBA 3U0BA 2WAMA 3QU4A 3G49A 4PBSA 4WZBA 3U19A 4ZVVA 5EDSA 5SZHB 5H81A 3KELA 3ETJA 5EMMA 1JLRA 1Z3YA 2PWAA 2H29A 2DH6A 4R8MA 1X1DA 4LOLA 2CSXA 4ILHB 2RAPA 3S40A 1E66A 3NFYA 5JCXA 2XCLA 3BQMB 3ZE7A 4OK6A 1VB5A 5BRAA 3QPVA 1SKAA 1OH5A 3IIJA 3WRWA 3R7QA 1P7VA 1S2MA 2F1IA 3H97A 4YYEA 5AICA 3VTKA 1KDPA 1LSJA 2PBFA 4NCAA 4EP1A 3I62A 5J4YA 2DULA 1UZMA 4AMYA 1SB9A 3TX2A 3VVLA 2QOEA 4YT2A 2QLBA 3MUEA 2AG5A 3U7GA 3ELWA 3PRHA 5IYZF 1DC3A 4D6YA 2ARKA 4Y2TA 1KEUA 4R68A 1KXZA 2XWPA 3B3QA 3Q3HA 1AQ6A 1EGMB 1L8LA 2ID9A 1FPMA 4QECA 2YMMA 4KEAA 4B79A 1PQ4A 4D82A 3TD9A 3R4VA 4YJDA 5CK4A 2EYQA 5ALMA 1Z74A 4XJXA 4KQMA 3FZEA 4BVEA 3EDYA 3LKBA 1Y1LA 5I9BA 1ULBA 1KQNA 4RG9A 2PYZA 2Y71A 1A9ZA 1C3OA 1GKLA 2YHEA 3B1KA 3JASA 5B3AA 4MYCA 3A37A 1GGFA 2FU5C 1X9HA 3KT6A 4PYMA 4TTSA 1BI7B 1XLTA 2KLBA 5ALNA 1MX1A 1T8PA 4KN5A 3ZEAA 5IEBA 4H1WA 1I33A 4YDSA 2XGGA 1YASA 3F3MA 4OHMA 2FRDA 1QHXA 1IHBA 2D59A 2IX9A 2JCXA 4PW0A 3TLGB 2C96A 4DSOA 5DYIA 2CCKA 3MRSA 3NS7A 3ML9A 4W1PA 5TPWA 1E4VA 1AC5A 5B1BE 2I1KA 2X8JB 3DNFA 3DPSA 2ZRQA 4WXPA 1NVDA 2PHZA 1L1QA 3KEGA 1Z6TA 2AE1A 4MKFA 1GTG1 2CN1A 3RS2A 4V0MA 1QH8A 3IDFA 4ABTA 5HBRA 5CX1B 3UHOA 3G9UA 1JFSA 5F52A 4CGVA 1WDYA 2ZIAA 2ZK7A 4BRZA 1EG2A 3H0EA 2H1SA 1EX9A 1NZJA 5AQ1A 2ZDQA 1OB2A 2EJCA 5HDQA 4INJA 1E63A 5LQMA 3KUUA 5FJJA 4F6CA 3BBPA 4QFMA 5AOCA 4A2PA 4M1EA 4FHJA 1UBLS 2C4UA 2WVAA 1H2XA 5F2NA 1E9FA 5B64A 4ZVRA 2A0XA 1DV2A 4M7RA 4Q19A 1E2GA 3FH7A 4HI0E 4TMXA 3HJHA 3CG4A 4P08A 1QVVA 1X80A 1SQGA 2CD7A 1ZP6A 2X4GA 6YASA 2QAGA 2O1WA 4G01B 3UB2A 4Q9JA 4OHVA 4J6EA 3T54A 1ESNA 3F6PA 4FN4A 2PKYX 2ZAMA 4GXNA 1G7TA 1PR0A 1PS0A 2OBLA 3R3HA 5LZ4A 1C1YA 3OIFA 4NYMQ 4HN9A 1PQYA 4MITA 1UN8A 2DWQA 5JSUA 3QXXA 1XHFA 1SVWA 4ND1A 3UANA 3UGTA 3RWBA 4BKQA 3GLUA 4GCOA 1OXXK 4EMTA 2BFPA 2LAHA 3T1TA 2P5TB 3PNTB 2AX3A 1J99A 1NYQA 3FI9A 1U5BA 2LPMA 4BNTA 1F4VA 3K8ZA 5CX4A 2YIMA 5EYLA 5JJIA 2WQZA 1KT1A 5JXHA 2WAYA 2HNBA 5EEGA 3HY3A 3ZV6A 1W5TA 3CKBA 1UZUA 2A9KA 3EZ2A 3JD2A 4NZNA 1XEWX 5AK5A 4LVOA 2XD4A 3I52A 1PFGA 3IBEA 4WZBB 4LNUA 3OFKA 3NASA 1TLFA 2F4VB 2QLTA 2VP6A 1OWPA 3FMIA 2B9EA 1JDNA 2PZKA 4BNDB 1TX4B 1VMEA 3VRHA 1B0ZA 3D4IA 1U0FA 5LL6P 3FLEA 4PZPA 1CUXA 4CL2A 2W2LD 2GBGA 1Z8NA 3WGIA 1ZUWA 5K0CA 3I39X 1FS5A 1O6CA 4B82A 3MTQA 2O0MA 1G60A 5DPMA 5IBPA 1R0BA 1HRDA 3FXAA 1ISJA 4GT1A 4J7WA 3R7LA 2XCSB 4D92A 2G1PA 1PL6A 2Q3BA 4UBKA 4EPZA 3OTWA 5KNDH 1XPOA 1MOSA 3Q12A 4HADA 1T10A 5JY6A 3NM6B 4CL0A 1FXWA 4IDOA 1V3VA 2REOA 1DLJA 2W42A 5JBNA 2OAEA 1A5TA 5I3CA 2BBOA 5DMHA 4IN3B 4URXR 4C0HA 4II7A 2JHPA 5J2UF 3QMWA 5GTDA 2V65A 2XUPA 4PTLA 3BXHA 2C97A 4MI6A 5LR6A 2PCLA 3EXIB 1W36C 3CY6A 3FIJA 1C3OB 1U28C 3HUFA 3JASB 4LV6A 4LV5B 3S29A 2HTFA 4ZOBA 1HDEA 5AXDA 1OLSA 4RDIA 1PW7A 2YY6A 3NAWA 3OOYA 2FP4A 5HG0A 1VP3A 2X8BA 3LLVA 3GRUA 4G8BA 4BEBA 4LFAB 4KE8A 3BWBA 1HZZA 4UARA 3EXHA 2EIJE 3LGAA 3A3KA 4B3DA 1USVA 4ENWA 2FZLA 5A6CA 4ESOA 1JI0A 2C07A 5TPWB 2IEGA 3H1TA 4C06A 2JVJA 1RJFA 1EA5A 1YCDA 5ICEA 4W5OA 2JAOA 1ECBA 1QH8B 5DU2A 3IMFA 3AHIA 1BX3A 4US0R 1SUSA 3MPOA 2DFKB 2NXNA 3QA9A 4C20A 3CLTD 2PUBA 4AWXA 2I3GA 4J7CA 2V7QD 3WRYA 3OWXA 3D3KA 2ZYWX 3B1FA 5IAJA 3PXXA 2XCBA 3BD6A 4FS3A 3DQQA 4QGGA 1OE0A 1NVKA 4HQ0A 5KTOA 1T2EA 3ZHUA 1M6HA 3FF1A 3GELA 3W9YA 2VTVA 3A9CA 2VAXA 5E9QA 4CM8A 4B4DA 3AK4A 1EPUA 1X80B 2Q5HA 1Z5GA 1DBWA 3OFJA 2QAGB 4EHBA 2IU4A 3QOUA 1NLFA 4O29A 3C8HA 4D9JA 4NI5A 5LDHA 2WJ4A 2VUSA 3ZHEA 4K5QA 4JLOA 3MB5A 3FH0A 2NQ8A 5GM1A 3CLRD 3D8NA 5AQBA 3Q7FA 3VSAA 2FFJA 1DCEA 4P29A 3E8XA 2Z3ZA 3BL5A 3TZHA 2ZI5A 1G2IA 3U66A 5CITA 1JHYA 2XMPA 3SMQA 1U5BB 3LZDA 1X1SA 3KIPA 4PFSA 4BTBA 3NRBA 2B7BA 4JLVA 5JHBA 5A1TA 2ZRAA 4OYYA 1DDIA 4E51A 3N05A 1FNMA 4GWLA 1JTVA 3KSMA 4CEHA 5AQ7A 4ZAWA 3NYRA 3FJ1A 5HM6A 5IDVA 4DC1A 2DR3A 3PEYA 4TKVA 2X3YA 4ZCTA 1ISMA 4JVSA 3ORSA 4LNUB 1OAKA 4H1HA 4YCDA 1JR4A 2OGSA 1I1OA 5AOVA 3VNBA 5BSRA 4S2EA 4D9GA 1X1EA 3UQZA 2OM6A 1IXVA 4DV3B 3ETHA 3EW7A 3O1LA 3I6BA 4LCJA 3UUEA 3USZA 3EEQA 4II3A 4EUEA 2NXPA 4GA1A 3ONVA 1PG0A 3CSSA 3GGPA 4DJEC 4HLEA 3TOSA 4TGLA 1ONNA 3SR0A 2DWOA 1UKVY 4QC2A 1CR1A 3VO8A 4HDRA 2IYAA 2YINC 1EVYA 4QUAA 3TZBA 3BMNA 3O74A 1I1QB 1RP1A 3L6BA 1UM8A 2NN3C 2Q5OA 3C6MA 4P34A 1DKMA 1QAOA 2WW8A 4I14A 2WF8A 1XMJA 3GAZA 1I0IA 3ZW9A 2WVGA 4RMIA 3VPGA 2NVUA 3PGJA 4CMEC 1TCAA 4KP7A 4JBGA 3KU1A 3IVGA 5FAXA 2OGUA 5T8KC 3VLDA 1AKWA 3SHTA 1O4VA 4FGKA 1JDZA 4GNRA 2WPVA 1UW4B 5FO0A 2ST1A 4KODA 2QVBA 2WD8A 2M9MA 2O6LA 1UADA 3Q3VA 4Q00A 6PFKA 1NNEA 1SQ0A 1NDQA 2YFYA 3PFFA 1A77A 4JKOA 3IE1A 3TNYA 4UWFA 3UKRG 3WZMA 1HE3A 2JFQA 1TJFA 5AXBA 1TRHA 3MQ4A 1D2GA 2QM3A 1IMOA 4MGKR 3T5GA 4KWCA 3AI2A 1OLSB 5REQA 2NYVA 3G6WA 4ISBA 1QANA 5IAAA 1V4NA 1FNSA 4ZAGA 5AHXA 2P65A 2FP4B 4AP9A 4JVNA 4NAUA 3B89A 3WXMA 3MZ0A 3ZJUA 3DF7A 2ILRA 1BDHA 3PWTA 4ZRDA 5CBOA 3PPXA 1XRJA 2PR7A 1DJNA 3EXHB 1XNQB 3PI7A 2RH9B 5E7MA 4JJFA 3ZDCA 3JQ0A 4H6XA 4Y2GA 4A1SA 2AR0A 4R2LA 1YULA 1TF5A 3AEYA 4ABYA 4YAIA 4BAUA 1SQMA 4FMDF 1WKBA 3EGCA 3MT8A 1X2EA 2RAVA 1BX1A 4BFSA 1XMIA 2ZBQA 1UBUS 2NZYA 2EIXA 3NHKA 1MIOA 4HTFA 3PDCA 3UAXA 1OAOC 2BVNA 4TTAA 2VDLB 4FM9A 2I87A 3V1UA 3MERA 1K8RA 1NWHA 1DQNA 3H2GA 4MW4A 4DC9A 4GZCA 1C8KA 4JT2A 5EWJA 3MV3B 1QXSA 3BH7A 2E85A 3TWQA 2I7CA 3R20A 4APOA 3HG0D 4J76A 2BZ1A 1T6ZA 2G1AA 2H1FA 5GIPE 1JZTA 3QWWA 2O5EA 5TSDA 3EF3A 2OO5C 1LK0A 2XZLA 1Y4SA 5BV8A 4CM8B 1P60A 1CEYA 1AZTA 2A0KA 3EIQC 2VNSA 4OXRA 3EHRA 4V24A 1UOOA 4BNVA 4YMVA 1EGHA 1RXVA 3N2EA 2NAPA 1XPJA 3GGSA 5F7XA 1V1MA 1PYGA 4CTNA 3FWNA 3QEJA 1IEQA 4HRXA 5DMXA 4Q3AA 3ZHEB 4V1CI 3AW9A 3KWJA 2C0CA 1WDMA 4JJ4A 3WG9A 1V4VA 4RENA 1PNRA 3EIXA 1ZCBA 2ONYA 3LDAA 1YZTA 4NYJQ 3CF2A 1CW2B 3AGQA 3WB2A 4RY0A 4ZODA 4YGXB 1TZCA 4FS8A 3CW2A 2W6JD 4R1OA 3I4CA 2YQ5A 3U3MA 4CKZA 3SR3A 1T0JB 1NPDA 2VWHA 4IQ0A 1T2FA 1GL6A 3ML8A 2C92A 3WXBA 3VHXA 4LHWA 4RMGA 4CEHB 3LRTA 2R8EA 3P32A 4TTJA 2VHYA 2PKQO 1CRQA 1MW9X 1TUBA 4TKVB 5AHRA 3VH1A 3AESA 4Q1EA 1C0PA 1NAIA 3C43A 2WU4A 4JVSB 1CDDA 2H65A 2Q27A 3WMFA 1FF9A 3M1LA 1PZEA 1S0PA 4XIIA 3VZPA 3VX4A 3NB0A 5CLQA 2WWIA 1XN1A 1IN6A 4NK5A 5EHZA 4WFIA 2QE7D 3RV3A 2B9VA 1GZ5A 3C3OA 2AS0A 2QTCA 3IE0A 4H60A 2EFDB 2DPXA 1NXPA 1NZNA 4GI3A 1ESMA 2RHLA 3OTQA 1ZM4A 1CY8A 2ZRHA 3QEBZ 1XGWA 4MRNA 5CLLA 4XYGA 3WJ2A 1KTIA 2H2AA 4Q4HA 1H2FA 4HDRB 4LDRA 4QEDA 1J7KA 2RGXA 1N1DA 1ZAYA 3UK7A 2P9FA 1SZAA 5EIHA 4TWRA 2V5UA 1ODIA 2JF0A 3BMNB 1V11A 2BR5A 4GX2A 1YGPA 2VAMA 3PHBE 2M6RA 3SBSA 3WK7A 4CKEA 2NVUB 4CM1A 1KH2A 4EENA 3BF8A 5TQVA 4XWYA 4OQYA 4UZEA 4HYTA 2G7ZA 2IXEA 3DXZA 3JRXA 4UUBA 3T7EA 3FUIA 5IVPA 2IOFA 4BTAA 4AZ0A 2G25A 4DQXA 4NWIA 3IHVA 2Q1WA 4HFMA 3PQ2A 2R1UA 2QEQA 3SNHA 1SJ9A 1SUFA 5HKKA 5TF0A 1U7DA 4LZZA 1PL0A 4MGHA 1W59A 1GNPA 4JJ7A 4ZZIA 5DEOA 1FP2A 3PPIA 3B78A 3B8HA 2AN9A 4AUMA 3DTNA 5REQB 3JQQA 4FMPA 3H16A 3JRWA 1I4OA 3HADA 5FO1A 1P1CA 3FSGD 3LY7A 3JVUA 4G8JA 1Q44A 3FX2A 2O3RA 4Y6LA 3ND9A 2GN0A 1PD1A 1JA9A 4QOHA 2P0EA 4EH1A 3EGEA 5JT1A 5KNCH 1VRWA 2AT1A 2JW5A 2COEA 5KQGA 1E64A 3LHKA 1DFGA 3F5SA 2BDTA 2BFCA 5EGSA 4LY6A 1VG9B 4NBTA 4JL6A 5DLPA 3R5FA 4DHEA 2VYND 3F6BX 4C6SA 4FDLA 1PL8A 3C98A 1MIOB 4HTFB 2QT1A 2ZLBA 3IP7A 1X15A 1KBZA 1KEEA 4Z51A 2B82A 3N70A 3QE9Y 1L3BA 1PVVA 2NUPA 2ZJ3A 4WCFC 4DV0B 2AWOA 4JLNA 5EWJB 2FP3A 1MB4A 1W581 1H3FA 1P80A 5B3SE 1M2FA 1LNZA 3FUCA 5DYTA 5TLSA 4MW6A 3A1VA 4NBRA 3KWLA 3SDZA 2GF2A 4EUNA 4GMHA 2PT7A 4PYNA 2DBVO 2IUSA 3UT0A 4GR5A 3DZCA 3UYKA 2MOWA 4C30A 1J8MF 3B60A 3OCUA 1B26A 3KWMA 2QTZA 4JBYA 5DW0A 1X7XA 1WMBA 3HYTA 5DM0A 1V1MB 1E0DA 4H4DA 2B2NA 5EXXA 3GHYA 5AVYA 3CT4A 1Y5MA 1UZLA 1F3LA 3TIIA 4UNSA 4B2YA 4MARA 1SVMA 3D7SA 4I8IA 1OIVA 3EHDA 2ZIWB 2BAGA 5LQCA 3H84A 1OBVA 3GEGA 2XEHA 4ZRMA 4TLEA 2NSDA 1YR6A 1NBIA 4Z86A 3VAZA 4J9UE 2CK3D 3M33A 2Q45A 2X2OA 4DJ5X 1RMYA 1YZHA 3AR5A 4L28A 5IKEA 1TYQG 1JGTA 3IP3A 3VHXB 4GQIA 2GVDC 1QB7A 4M88A 4RIHA 3H4VA 3NP7A 2GSDA 2R44A 2MSLA 3IBTA 1ADCA 4KU4A 4EJMA 3OZAA 2OOKA 3QBVA 4ZKEA 1TUBB 3FFXA 3AESB 5IDXA 1QF6A 4AIIA 2YHIA 1T6NA 2PPLA 3JWJA 3OM0A 1T9BA 3EDTB 1NVWQ 4OQNA 3EXAA 1DXHA 1XTPA 1UP7A 1N6HA 5JALA 4OHXA 4J1NA 1TC2A 4F8YA 3RFTA 1NLYA 3GJ6A 3QXHA 3EMKA 2ZDGA 5LJLA 5TY0A 3EGXA 1T2VA 1LY1A 1UKEA 4Q4HB 3GDWA 2H4WA 5HKAA 2RGEA 3UNXA 3WL5A 4KN6A 5DM1A 4IR7A 1WB6A 3RFXA 1M3SA 2R1TA 1Z39A 3ZVNA 1ZJ6A 3U40A 1BS9A 1GN9A 1MEJA 2I8LA 2NXEA 5FRDA 1EBUA 2QRJA 1V11B 1WHSA 2WWYA 4AVXA 1IEVA 4RV5A 1SVOA 4C7XA 4D1YA 2DPMA 3MIIA 1VPLA 1LCIA 1RU3A 4CKEB 1OYVA 1ULZA 5KDDA 3Q7PA 3G2NA 2O05A 1COZA 3URMA 4HH3C 4FYYA 1UG3A 2J6BA 2AN4A 4HGYA 2CLCX 5HF5A 1UT6A 1FDIA 4OB7A 4HRNA 4AZ0B 4MPDA 2YKGA 4OFBA 2XDQA 3GAFA 4PHTA 1VFPA 4D4LA 5ALQA 3BGOS 4Q66C 4EG8A 4ESEA 1CBUA 4OOEA 1Q16A 2GD6A 4B81A 2WF7A 1V7CA 1MQ8B 5C8YA 1QTQA 3COZA 2AXVA 5KMGA 2B99A 3VAYA 4CM7A 5F4BA 2XGSA 4C7OA 1F6BA 1XZIA 1C14A 4MB0A 4GOKA 1JILA 3X1DA 4N41A 1E8YA 1VLQA 5ALGA 2NU9A 3UIEA 4LSZA 1PDOA 2OBXA 2OV6A 2GBLA 5CERB 4DR3B 2JS7A 3SYRA 4LBYA 4J07A 4XWKA 4PAGA 5BYKA 1K06A 1X9IA 3PSAA 3FGPA 4DA7A 2UUPA 1P81A 1SG6A 1QS0A 2E1RA 1E94E 1ABBA 2NZ2A 2B8NA 1IK6A 1IN7A 2BFCB 1RLJA 1Z2PX 4QBKA 1QFSA 4WY2A 3HKEA 1S64A 2OWDA 2IS4A 2R1VB 4U8GA 1E6KA 1T35A 3TBKA 1KOGA 1LPNA 5JSQA 2ZE8A 5H16A 4M1TA 1KEEB 2ZIUB 2FRVA 4IKOA 1Z62A 4DM4A 2VG8A 1O6BA 4LHEA 4TL8A 1JIQA 4QX6A 3DOHA 1L5HA 1J90A 2NUPB 4UHJA 4M55A 2IXFA 2QZSA 4UD6A 1C7FA 1CVIA 3OCVA 3NR2A 2FPGA 5JXJA 5AJYA 1PQUA 1GG2A 1Q0HA 1KH1A 2I2DA 2A5JA 5IC6A 4F5YA 5AW5A 1OFIA 5HZGA 4MKRA 3FTXA 1C1XA 1FFCA 4GAEA 1I3LA 3ZK7A 1XYYA 4TQUS 3L13A 2FBNA 1OD6A 2OCCE 2NTYC 1X7XB 4RBNA 3L7LA 2MSWA 3HVRA 5FR2A 1RWMA 3FTCA 3HYNA 5JD4A 2HLDD 4Q9LA 4NYIQ 4BAGA 1UKZA 3CT6A 4D7AA 1FJ2A 4DWOA 3MJFA 2EBUA 1QIIA 3NXKA 4MRRA 1WUHS 3L0YA 1BJTA 3PYMA 1I6WA 4UQLA 1C3LA 2ONJA 4F4IA 1BWQA 3DZBA 4E1VA 1AQLA 4K9PA 3FPHA 3KQTA 2P4SA 3G9ZA 1XCJA 3F6EX 2C2XA 1BMDA 4YRDA 1N4PA 3SJAA 2Q41A 5IVHA 4HXFB 1W93A 5EHQA 4R3UC 2H06A 1SHJA 2MSKA 5EP1A 4M38A 4RL4A 3BFJA 1QSGA 3UO8B 3PREA 1REQA 1IY2A 3SJUA 1X1BA 3G2SA 3RT9A 1CF2O 3VPCA 3UI2A 2VHJA 2YHIB 3Q75A 1U99A 2LDXA 2IUUA 1K7CA 1EJ2A 5CPFA 4C7BA 4P7GA 4N03A 1VL6A 3CU5A 3E2IA 3MYVA 2NW6A 1D7AA 3G7UA 4U0SA 5ISMA 3GK3A 1Q21A 4WBSA 2Q6TA 4GDFA 4D74A 2X5OA 2V4HC 1W5BA 1OXKB 3EGXB 2FW8A 3FPGA 3AUJB 3AEXA 2DETA 3TMAA 4D4MA 2R1TB 2FQ1A 3GFVA 2PTGA 4D4GA 1HYEA 3AI3A 1G8KA 4RVFA 5HTKA 1WHSB 3Q9NC 3AR2A 3FCEA 1CWUA 1OU4A 1A9SA 1VMDA 4MUEA 1YQWA 2PUEA 4X7PA 3K72B 3JYOA 3DZJA 4HQNA 4Z53A 1DEKA 2BSQA 4JW1A 1Q2XA 3C3QA 3EEFA 4OKNA 1Y4UA 3CR7A 3KRTA 1DWQA 3LBFA 2DZNA 1Q5PA 3FR7A 1D09A 4II2A 2O6HA 4AMUA 1WSAA 4LQ4A 4QXMA 1P75A 1KYTA 4QELA 2GXSA 5DX8A 1QGAA 3M89A 3IAXA 3D9KA 2XDQB 2PGXA 4MRAA 4RJIA 1TEXA 4QLAA 4TXNA 4PXYA 4GL2A 2X6KA 1H6CA 2W2PA 3I6ZA 4MTCA 3RARA 2K2QB 4OQQA 1F48A 5C8YB 1NVTA 5KMGB 2JA2A 1QYIA 4C7OB 2RH5A 2QL5A 1XFDA 2OZPA 1VGQA 3ROZA 1COWD 2YVUA 2VF8A 1UWLA 1WUJS 2HBZA 5BMVF 3K94A 2NU9B 4HDMA 1KI2A 2JHFA 2QP3A 5D8DA 1KLXA 1SHUX 3MOIA 1VGVA 4I5EA 1UMCA 1L2TA 1P73A 4LG1A 4IIYA 4IZHA 4EPXA 4U2FA 1F0KA 3UUGA 1AHIA 3D0RA 3SICE 1QS0B 1OWNA 3HU3A 3TTVA 3B6JA 1W29A 3MXOA 3KLOA 1A3CA 2YV3A 4ZHSA 4OFZA 3HKEB 5L7YA 5JYDA 4IYRA 1OT8A 2Q0SA 2W43A 4BFWA 3DMTC 1L7EA 3O8NA 1V95A 1K6EA 3A05A 1C7RA 2YCLA 2ZJ4A 1W88A 4BNMA 4G36A 2H9IA 2PKXA 1IH8A 4AJHA 2Q3HA 5C18A 1GYQA 1L5HB 1U7ZA 5D1NA 4AKGA 1GM5A 5I01A 2WZQA 3U6BA 1Y6GA 3FR8A 4MDHA 3WWZA 1JFRA 2FPGB 3KSUA 2YW2A 1QP0A 4TX1A 4C22A 4XUGB 1ZVKA 3CR3A 2ZBRA 2F0YA 1GT6A 1ICEA 5LP6F 1UPUA 5IAOA 4IDEA 2HD4A 1C1XB 1V8ZA 1U1IA 1XV5A 4N8SA 2VPPA 1R15A 3A3PA 3PF9A 2HADA 1K27A 1Q22A 2I5PO 3AY0A 3MXTA 5HS6A 2ZJ2A 2E0IA 3LC7O 2JIDA 1PR5A 1U3TA 5HF6A 4P80A 2XT0A 4IH1A 1UQUA 2DX7A 3CH6A 1JEOA 2Y1DA 1Q91A 2FZ5A 5FNZA 3O4HA 3NVKI 3D9LA 2W2KA 3W8RA 2YJ5A 1JDJA 4BZWA 5IMSA 1TTTA 4ZYTA 3KYBA 3TWRA 3QK7A 4EUHA 2Q5EA 3UPUA 1OUMA 3LQ4A 4QYTA 4NQRA 2XLCA 4LISA 1Q6ZA 5EJGA 3ZGZA 4KLCA 4FWBA 5G05C 4YJKA 1JQ5A 4KK3A 4PRZA 4O60A 4EHDA 4RLFA 3D3JA 1E9EA 1U8CB 1TCBA 3PITA 3U2QA 4Y6PA 4W5RA 4U6QA 2QFCA 3H6KA 3VPSA 1REQB 1K75A 4EL0A 2EP8A 3PE4A 2FUEA 3DV2A 3H6HA 1DCKA 1BEZA 3ZNQA 4E21A 3IVAA 3ZI0A 1QQEA 1W8DA 4CEMA 2MSCB 4L4SA 2K7ZA 1KMCA 2P1ZA 5KSPA 1CU1A 2GPYA 2DJIA 4EZIA 1PZFA 1MTOA 3OAWA 3GH1A 3BWCA 3RNOA 3O3MB 3ROKA 1F0YA 3ANNA 4F71A 1XE3A 4DT1A 4FKMA 5D84A 1CUWA 2V7WA 3T5PA 4G63A 3OCCA 3LFHA 3R44A 1KAQA 1MH9A 4HHEA 1ZH8A 1R1DA 2VSQA 5AJDA 4K86A 2A9JA 6ABPA 4RK0A 4DCUA 3OLWA 5E1MA 3JY6A 3H2KA 4DYHA 4QOJA 3FTUA 3X2EA 4W1SA 4FSHA 2PX6A 2J4CA 1N6RA 3IMCA 3KKMA 3QOWA 5DJ5A 4ZTBA 4RZIA 1PR2A 4WNIA 4HF7A 1TYAE 1GITA 4D9EA 4ME2A 1XZAA 2E2WA 4RV4A 1Z0ZA 2CZQA 1SW6A 4QBHA 4FHFA 2UYHA 3OPVA 3GA5A 2VH1A 4HGRA 4OHBA 2VQDA 4D9IA 4P6VF 2R6ZA 1A27A 3UT5A 4UM7A 2XMRA 4D10C 5CIWA 4MLZA 3RRJA 5DVZA 2OPBA 2C2BA 1WAO1 2HMTA 1P4AA 3KKNA 3DMFA 3C87A 4PAOA 3WGOA 4GC9A 2YXNA 3ZHZA 1JJIA 3O48A 2ZZKA 4DUGD 1VKNA 2EJTA 3K20A 5CX1A 4N39A 3RUAA 3RUEA 5HK9A 5I7AA 3FNBA 4BB0A 1FCHA 3AR9A 4EGAA 3A2MA 1IZ7A 3ZD7A 1IYGA 2XZDA 2ZJ5A 4HDMB 2BFOA 5SZJA 2ZT6A 2WAOA 4EAQA 5JTTA 1NBMA 3LXRA 3BRSA 3EVNA 1UMCB 3PV0A 1E9CA 1XZKA 3N2GA 4GPTA 2CLIB 1MJGM 2V4UA 4NENA 3VDRA 4Y2YA 3WS7A 2J33A 2Z1DA 2QSUA 3RASA 1JUDA 3IIKA 4F6RD 2ZI4A 4LJKA 4OJYA 4N6GA 2E7ZA 3EASA 2GOYA 5DTMA 2XUZA 4RWEA 1XU4A 5HQJA 1LV8A 3GRZA 2V98A 1WXWA 4Q4CA 1YRYE 1M1ZA 2QSJA 1L9KA 5AKEA 3G2WA 1Z5SC 1E8WA 4BV8A 3C3DA 2CFSA 1II0A 2L9BA 3QLUA 1DIBA 1W88B 2R59A 5C1DA 1K3ZD 4G07A 3DULA 3HACA 5C46F 2AZXA 2P4UA 3ZE9A 4Q24A 1CZHA 3IEKA 5E2AA 1NKSA 2QQFA 2G63A 1TZMA 1HSOA 3CS3A 2WUGA 2QTAA 4KB5A 3ZHCA 3TXYA 1R6UA 4U63A 5EHGA 3RUFA 1JA1A 1KYZA 3F3YA 1GPBA 1HDOA 4H7FA 4DSZA 1NG1A 1ISIA 1QE5A 1EDEA 3FUWA 3QWAA 2B0OE 3CZCA 1IN1A 5AOBA 1GZ3A 2MYOA 3SEFA 1A72A 3AKEA 4UHKA 1ZOSA 3ZCUA 1I01A 5C7YA 4E6HA 4TRMA 2C7OA 3C5EA 2ZSHA 2ZXFA 2DYKA 4BY6A 3I12A 5AVUA 2BELA 2FPMA 4Y9TA 1GNTA 1X7GA 4XWOA 3T8KA 2DSNA 4M3NA 2F3UA 4FE4A 3QOYA 5JMTA 4TRRA 1N4SA 4JOCA 5LN1A 5AJHA 1N6IA 1ECGA 1RHUA 3HXLA 2W2KB 4N5HX 1EZZA 3DOJA 3D1JA 3UV6A 2O3QA 5J4KA 5IKMA 4R9SA 3HKCA 4ITRC 5E1DA 4BNDA 1FRNA 4AN4A 3PNVA 4HS9A 2OAGA 2ZUVA 4BL5A 4P35A 4WLFA 1USGA 1EDDA 5HUHA 3UJAA 2H51A 5EE3A 4JB3A 2XVMA 3WGGA 4MP8A 3VH3A 4AJIA 4RQIA 3LIPA 3WJ7A 1PFWA 4E5MA 2Y0BA 4BEPA 2Z8XA 3UICA 3GLHE 2VNIA 2C2YA 3PBKA 5BR8B 1US8A 1AKTA 1KKUA 2NNWB 4RNCA 3AF2A 4TUMA 3IBGA 2P5YA 4UTRA 3ITDA 4MGZR 3PUJA 3AG4E 4JI6B 1UJMA 4IG4A 3DGEC 3P2IA 7ADHA 4OI1A 3B7TA 4HAXA 2FWMX 2HYIC 1X87A 1DAOA 4J91A 3RPEA 5CCEA 3T5MA 5JPDA 1Y5IA 4AURA 2EF0A 1EK1A 5NLLA 4DARA 4DT1B 1NIPA 1ZMRA 3K16A 4RSRA 5AVXA 2ZB3A 5CA1A 2IDKA 1J49A 1WPXA 1B8PA 3W8NA 4B3GA 4R2XA 2CHWA 1GYRA 4YDWA 3EXIA 4FFWA 1INZA 3IKOB 4J75A 1O8CA 3QNKA 5M5BA 1AWCB 4KQXA 3KLNA 2P91A 1W4CA 3IEMA 2PY6A 2JJQA 4NAVA 1N1GA 1VZ3A 3RKSA 4RTRA 1Z07A 1SUAA 5CXXA 1MO3A 1NF8A 1FDTA 3O26A 1QO0A 5H59A 1XCLA 3C45A 1AG9A 2AXZA 1SQ6A 1QQBA 1EWVA 1YFLA 3V42A 3UJBA 5KWDA 5EXDA 1ES9A 2FUNB 5LWQA 3UT5B 2I6GA 4WESA 3DEYX 1BDMA 4X9XA 1DXQA 1E6CA 1I3CA 1Y6IA 3FPBA 4EZJA 2FWJA 5F9FA 2HQSA 1E3IA 3B9BA 1M6EX 3OPYA 4K8RB 4B3CA 3ENWA 1J1ZA 2W37A 1U1GA 1ZNWA 5FBHA 2FW7A 5TVKA 1T8YA 2PUJA 1RJGA 1SXJC 4JLSA 1JHRA 2J9XB 3N8GA 4M1WA 3SM3A 1IIBA 3TWSA 3VLEA 2KI5A 5LZ7A 2VQ3A 2DY0A 4EYOA 3GOQA 5EILA 3N2GB 1EVZA 4NENB 3LUKA 4JXTA 3HZOA 3EDQA 7MDHA 4KXXA 3R0IA 5DOZA 2VLIA 3EZXA 2ZWAA 1SHLA 4NQZA 2ZUSA 4RZ2A 1W4AA 5A7GA 1CULC 2VK8A 4WNFA 4OBWA 4GXQA 3IJRA 4CDGA 4J3JA 2H1OA 3RB8A 3B5IA 4OBXA 3K0HA 1O8BA 3W2FA 4MKZA 2B4AA 3TVYA 1QTRA 3GC6A 4RPKA 3OJCA 2ATXA 3MJSA 1XP5A 1LPOA 3K9IA 3UJHA 2HCBA 3HU1A 2C8VA 1J8VA 3CB4A 1VSQA 4J7UA 3V1TC 4QDZA 2AN3A 1PJ2A 3ML1A 4IDHA 2FZCA 3LT1A 4JJZA 4N54A 2G5PA 3BJRA 5GJWC 1NR1A 1E4YA 3VJRA 1Q17A 2EIME 4AVYA 2JK1A 2EKQA 1C8LA 2ERCA 3FTQA 2VHVA 4PNHA 5JSYA 1QUEA 4NXMB 1S63A 3QY9A 3ZOKA 4B3XA 3KD3A 5LQNA 3WLAA 3NT2A 1E6EA 3GY0A 1PNQA 1GNSA 2DWUA 5K0GA 1UKYA 3MJCA 1DBRA 1EVJA 4IO0A 3GG9A 3AHGA 1SNYA 4F1KA 2QQEA 4KVFA 4M7OA 1RQGA 4K9MA 3V3KA 5F5LA 4M9UA 2NG1A 1H8ED 2PM8A 1GAWA 4CR6A 2RGYA 3KT0A 2Y1CA 3PCTA 4MVJH 4EKGA 4FGUA 2I4RA 3IDQA 3CKKA 1AV7A 2GRAA 2ZBDA 4CIAA 3GROA 5H3LA 1HOXA 2QM7A 1N8NA 3ORFA 1BMFA 2PUHA 1L5NA 1L4MA 4L0QA 1H93A 1I4DD 3HKCB 1S2GA 3ZN2A 4ACBA 1SCAA 1XMVA 1HDCA 3JXJA 3DKPA 4EMBA 1HURA 4QPNA 2W5UA 4M9SA 3ZY6A 1OXUA 3W5SA 4OLBA 1ODLA 2HBRA 3DLIA 1DDOA 3LXUX 3S7FA 1I36A 1FE8A 3FW1A 4ZEMA 1JT9A 4DBLC 4Y2QA 1HH8A 1MOPA 1TNYA 4QQFA 3IMGA 3JTMA 1AV6A 1H66A 1US8B 4QJ3A 2I67A 1ONPA 3DR3A 3PQ5A 4IH9A 3KXPA 1ZD9A 1FUIA 2HHAA 1PTJC 3Q11A 3Q7RA 2WJ6A 3G68A 2WWXA 1LWNA 621PA 2PZBA 4WFJA 5J5VA 4LJ6A 1KDZA 3OCZA 5CNIA 1JG2A 2IS1A 3CNLA 1IULA 2R87A 1VI5A 2L2QA 3ZWOA 1SRRA 3CEPB 3TPZA 1WTAA 3HPRA 2A1UA 1Z73A 4B33A 3BGSA 2DFPA 2ZIFA 1Y3HA 3NB2A 3G02A 4E32A 4EBAA 1VSUA 3VTFA 3NTVA 4C0KA 5CA1B 4U9IS 1G2QA 3U37A 1N78A 3V1MA 1NR7A 1PTKA 3TNDA 5AXCA 1GHTA 3T15A 1YR9A 4P4SA 3VOSA 1MX5A 2R5NA 4C01A 4Q3EA 4DREA 4HB2A 4NESA 3GGDA 2H0AA 4V2UA 2E89A 5IF9A 3Q3IA 1XTSA 4V0SA 1ZO8A 4UWGA 2WF5A 3PXGA 3PC4A 5FYQA 3MGBA 3LBYA 3VM6A 1UKAA 5JOQA 2JJMA 5ANLA 5CRIA 5DHAA 5IAKA 2F00A 4BQQA 4GTMA 4HPJB 3UATA 4WESB 3FWYA 2JFXA 4MI1A 2JAWA 5DTIA 1RNLA 4IHJA 2QTVA 4ZJZA 3HRIA 5F2EA 3KQOA 2XYRA 3OPYB 2AFHA 4R40A 1POXA 1HDYA 3L1IA 5LMZA 1H2TC 1ZK1A 3IRVA 4QUDA 2OM2A 3CLVA 4RDCA 1O89A 4NV1A 5AW0A 1FQWA 2ZTVA 4RY9A 4H18A 1PAUA 3STTA 2LAIA 2I2AA 3WFZA 3C41J 1T6YA 3OZRA 1CUCA 2ZXUA 5GOTA 4I9NA 4EHAA 4UVEA 4ESHA 2UU9B 5BWMA 2ZWIA 1AQIA 3KUCA 3CLSD 3PNPA 3WWEA 3LDZA 4G2TA 2PUFA 2OXCA 4RORA 3OLQA 2G5CA 1GWNA 1E1KA 2GHQA 4OYSA 4Q4JA 3VYUB 2H8GA 4O25A 4E11A 2PQ0A 2COKA 4J94A 1X38A 4WINA 3D9PA 1G20A 3GR6A 4KN9S 1J6UA 4GPD1 3MMNA 2UXCB 1VMKA 4MS6A 2VBIA 3VNAA 3HVJA 2VAVA 1B1AA 1CX9B 1VDYA 4XOUA 4P84A 5K0NA 3R3YA 1PGNA 2DBZA 4L3VA 4OHUA 9ATCA 1R6DA 3DONA 3M6LA 3HB5X 4RULA 4OQZA 1RKQA 4P7JA 1TVMA 1VIVA 3D43A 3TTWA 3OX3A 2D3TA 1M2EA 4K3UA 3HB1A 1N0QA 3HJAA 1DTSA 1N4DA 2XOEA 3B5JA 3ISVA 1Z4IA 2XQ0A 1BH6A 3M6IA 3GV0A 3A28A 2BH2A 1M8JA 5K09A 5EJ9A 3MHTA 3D3QA 1S4MA 1ORTA 1G3IA 3TG4A 1GU7A 3SPXA 4ZOLA 1UJJA 4M0PA 4NK4A 1G21E 1T1GA 2JFBA 3UJ3X 4DWWA 2NU8A 5CA0F 5DZSA 3K5HA 5FOVA 4ZZ0A 4CCAA 2X6IA 4GZLA 4BN4A 3C3JA 3ZWWA 4L9WA 3AVYA 2C2WA 3DNPA 4DY6A 2PNFA 4RLSA 4KZKA 4EECA 2VUIB 3ULEG 1GCGA 3E6AA 1V7PC 4HUJA 1QGUA 1NW6A 4U1RA 2WAAA 4NH4A 4UPEA 3O95A 3QW4B 4LZWA 3ESKA 4PINA 2JVIA 1PWZA 4MCAA 4DZRA 1OA0A 1IB0A 1VL8A 1SCIA 4CV3A 1TAQA 1KERA 4WN3A 3N6RA 3CBGA 1YHYA 2VP5A 4E2ZA 4JEUA 4NSNA 3L6UA 5B4TA 4A27A 3BOSA 2YWXA 4OL9A 1QONA 3IAEA 5TJ9A 4WNEA 1BC5A 4RLHA 3VI4B 2XVXA 5JJ6A 2YNMD 5JO0A 3ZE6A 3Q0IA 2KMLA 3FZYA 2HEGA 2B6CA 2J8SD 3IPRA 2VNHA 2HV9A 5A3VA 4YAKA 2A1UB 1PHPA 1PUJA 2SKDA 2P0AA 4S3MA 1IM8A 2OUIA 3QHQA 3GLFA 1C4KA 2B6NA 2OYCA 3E7DA 3IUJA 4KLZA 2J3IA 2PZMA 2IYVA 1T5BA 1TK3A 1G5FA 4P4SB 1HH4A 2AK2A 3G5UA 2V45A 1SD5A 1FT2A 1C3XA 4IQGA 1RXCA 3FDXA 4IIDA 1WO8A 3P4YA 1WKVA 4N40A 3DAHA 2V54A 4M1ZA 2OO7A 2ETXA 5JWRA 1ADJA 1ZVJA 3CF4G 1BFDA 1I7QB 2XUOA 5KC8A 1GA1A 1U8EA 3T1OA 2VC2B 4Y2SA 4JP1A 2H4XA 3Q2IA 5KYUA 1WG0A 4B8ZA 4KFRA 2IVFA 4HAIA 5J47A 4X7RA 4AAYA 1P39A 4IHJB 2QTVB 3W6ZA 2HA6A 4S04A 3F8TA 4U0ZA 2DHCA 4AO7A 4RSYA 3DT9A 4Z0TA 2J9ZB 2AFHB 5D6OA 1B74A 3IKVA 4Q4LA 5B6IA 1T9KA 3CH4B 1ZI6A 5I3ZA 3RVDA 4FLBA 2BKXA 2PMEA 1OCZE 1RRCA 1UP6A 2W83A 4F4HA 2YMLA 1BPOA 2GDZA 5E0OA 4DRZA 3BTVA 1L5WA 1EVIA 1TF2A 2AVDA 4QU9A 5AW4A 2EKLA 2H3HA 3E5HA 2ZE5A 5FKJA 3I5XA 2HH9A 4GKVA 1F38A 5AJTA 4HNUA 1NPTO 2DSTA 3GRCA 5E7QA 4XEHA 3CTPA 2L0TB 3UVEA 3AH8A 3LAWA 1P6UA 2P6PA 3RVLA 1K2VN 4F06A 3CUEF 1CZUA 4TVBA 3Q85A 4GHWA 4Q4JB 1MJNA 3N2ZB 4BC1A 2R5SA 2BGMA 3GMSA 2EFGA 2VF5X 3ZH9B 2O2DA 3B5EA 1G20B 1MAHA 1SBTA 1P44A 2QKYA 2NXJA 2IU0A 4X95A 2B1RA 2CFOA 3QBDA 3T7RA 1AGYA 3AZPA 2D0DA 3BMXA 5BV2P 3QYAA 5DEIA 1CUZA 4BPBA 3GRPA 3BB4A 3GYBA 4GTVA 2ATEA 4IXTA 4WL0A 1FRZA 1EJ0A 4MUIA 3ZPJA 4GE3A 2YWCA 3QUAA 1MX6A 4YJ2F 1DE0A 1GT91 1GP2A 3WNCA 3JW8A 4ZOLB 3MJVA 1XDGA 4G09A 2QD2A 4DSNA 1E5TA 2NU8B 1GRCA 1LPPA 2C2KA 3VV2A 3WGQA 2VYVA 5EKXA 5FLEX 4PC1A 1A9TA 4N7MA 2ZYTX 4R7ZA 1KPGA 2IYXA 3OJFA 4K5BA 2O2XA 5DIZA 2HTEA 3LSTA 1J22A 4XLZA 3W5AA 1FW8A 5AHOA 3AG1E 4W5JA 1JKXA 1HKUA 1QGUB 2P9GA 3PDJA 4UMVA 1ONBA 3RIYA 1U94A 2HJ9A 4D8VA 3MTBA 2VATA 3D2LA 1RKBA 5EZ6B 4PLFA 3LQFA 1HLFA 4D3SA 4WE3A 4WWNA 3E0QA 2C3YA 1WMEA 2BGRA 4MINA 4JUFA 2C9MA 4KBFA 3W8EA 1HNWB 1FX1A 1RR6A 4BMPB 3LF2A 4WKNA 1JSXA 4CLOA 4YP1A 3LY5A 1RZ4A 3VGJA 4YWJA 3GJ3A 1KYXA 3ZWQA 4TLLB 1JLSA 4IP0A 3K0EA 4RVGA 1ZISA 4PS7A 1GFZA 4QPZA 2QYTA 3NJ4A 1TJCA 5EUMA 5EZSA 3ILYA 2Y3AA 3C6YA 1D4FA 4R7TA 3BN3A 4FMCB 4WEQA 3LGXA 1AE1A 3AUSA 4HDOB 2Y92A 2ERYA 1TLTA 3EPHA 3QQ5A 3TL3A 1GEEA 3N2YA 2YXDA 4DV2B 1SQ5A 4M9RA 2YJTD 4H7JA 4IINA 3GLFB 3EHEA 4WJLA 2WYWA 4I0WB 1UDBA 4L5BA 1YCHA 3RNLA 1QG6A 3HJCA 4D99A 2BMJA 1SHTX 4BO6A 1UMBA 4L7QA 1WB4A 3L8HA 1UFQA 1EXMA 4P1ZA 3I2YX 3HNRA 3W6UA 4RXUA 5I9SA 1EHIA 3HSSA 4OSPA 3G2UA 4IHAA 2LW7A 2Q50A 5G55A 4HB5A 3L77A 3SF0A 2HM7A 2W0MA 5IK2D 5KYUB 2IPNA 1VG0B 1VJDA 2C5SA 4YB8A 3TTUA 4D9HA 1TVKA 2HPHA 1NUTA 1HLGA 3VNUA 2IPOA 1K66A 4MH0R 4HNHA 3AIKA 5KNDA 1RLMA 1J2JA 2R1VA 1FTQA 4NPAA 4GKJB 5AVVA 4L6CA 3AYZB 2MT9A 3U4CA 3TGWA 1QIFA 4Z4IA 3F5MA 2L19A 3AG2E 4FT4A 2ISCA 1H9CA 4GSLA 3LX6A 1SEVA 3SR4A 1FYVA 3HI6A 1O2DA 4DNFA 2VDOB 4WK0B 3SYMA 3BWEA 4YASA 1XD2A 2BKUA 3T3EA 4AZ3A 3TLJA 3G17A 1DAPA 1OYOA 3NC1C 2YZ7A 4W63A 2I3DA 2AXEA 1HT1E 4AS2A 2X3FA 4TSFD 4ENUA 3H9UA 1MAWA 2QMQA 3I1YA 4D3FA 4B45A 5JYBA 1GU0A 4BMCA 4WVLA 4CF5A 4EYSA 3MUFA 2WTUA 1KAGA 2DLDA 3C39A 4LHZA 3MGCA 2CLLB 4HWOA 5H70A 1BGXT 1C0KA 1VL1A 1MUUA 3WTCA 2GAIA 3H8VA 4ECEA 5IUJC 3C85A 2CUZA 4MQUA 1GG9A 3Q1LA 4JYBA 2V6BA 1Q84A 4PO9A 3NHFA 4KUHA 1V26A 1G66A 1UCFA 2FQQA 3SD5A 4MV5A 2Q4OA 3D5TA 2PQ2A 4R0MA 5DN6A 1U6IA 3I5PA 2VRCA 3ETDA 1AZWA 1EBBA 4IJVA 1V9SA 3OMXA 4I1UA 2QJTA 5A7HA 1E2EA 2HF8A 2AG1A 1HXIA 2BGTA 1P0IA 5JCOC 2HCJB 4PNEA 4UDOA 3WE7A 1WMDA 4CF3A 2ZDHA 1XAGA 3R0VA 3DWEX 3J5QB 1JYFA 5DH9A 3SOZA 2HPZA 1DKLA 4RGBA 4Y2UA 1ZPDA 4KNWA 3C3MA 4FA6A 3E3MA 3IT2A 1UDWA 4C5BA 3R5KA 4FWIB 3HXCA 4CKBA 2HMUA 2UZAA 1IYZA 1XP8A 2Q1YA 2VIIA 2SCUA 4AV7A 4MA5A 5L51A 3NZSA 2FZWA 2ZSDA 3FB1A 2GTHA 2QI9F 2V6MA 2A5DA 4YDRA 5DHQA 1EE2A 1QOZA 3UGQA 3WKCA 4HGNA 4GTQA 2CYCA 4ENVA 2DYSE 4EKDA 1YRAA 3I64A 2PMWB 3PJRA 5EXPA 4MKGA 1J07A 5IC4A 1S7CA 5AP9A 4CLOB 1GPNA 3S68A 4Y6OA 4V0KA 4HZUA 5A7DB 4GZDA 4JQZA 3I30X 4B7XA 1CUFA 3CCCA 2I91A 3D7KA 4X61A 4BX8A 3NBUA 5H83A 4JCCA 2GK3A 4MO2A 2GEBA 3DNMA 3V97A 1G64A 4XGRA 2JIRA 2N42A 2QTTA 4Z4HA 1U0LA 4GX1A 1EFAA 2DCUA 2LXLA 2RMKA 3H8SA 5EIXA 4EHNA 4BBPA 3W9GA 1KP3A 4OVKA 4QHYA 4RH1A 4JP5A 5H7XA 3RO2A 1QZZA 2ZEJA 1L4EA 4R1NA 5A6SA 4IQ8A 2WVHA 1UMBB 4AJ9A 3E03A 4WV3A 3VO2A 4U96D 1S02A 1ZU2A 3LQRA 3K9GA 2PQNA 4YAJA 2RCNA 2BMWA 4YACA 4V03A 2WIBA 5EQDA 3MTDA 3ZLVA 1ZH2A 2XS8A 4A0FA 2APJA 4XD7D 3NG1A 3BFXA 3W79A 4DEYA 5AKKA 1WVMA 2OE2A 1P1RA 4QDJA 2PX0A 1YV9A 1JA0A 3W9UA 4TV9F 1ZU5A 5FPPA 1TYBE 5DHSA 3PHJA 2IY0C 2LVBA 3EK2A 2RGNC 2V9CA 1TVKB 3E8MA 4TWAA 3PTZA 2C4MA 4MUNA 1Y42X 4O2BF 2V59A 1ZJ4A 4TLAA 4OFXA 4WXYB 1FLVA 3R2JA 5DK6A 2NPOA 5LVAA 4G25A 3OTIA 2J49A 3I04A 4BMYA 5AUPB 5JV5A 4O6VA 2N3ZA 3N58A 1FVFA 2DWCA 2FX3A 4KQIA 3RRFA 1PR3A 2J7PA 4LJAA 3H9JA 3R5XA 3AKYA 5CM8B 1IY1A 5DF1A 2CDRA 1E20A 5BO5A 3L6DA 2SICE 5FLYA 2Q8PA 1PLLA 5FOQA 3MIZA 2M63A 1F4PA 4TS3A 3EW9A 4UUPA 1WCV1 4QBGB 3I9LA 1XD2B 1OV6A 3G2MA 4AZ3B 4FDTA 1ZGGA 1BHQ1 1SA0A 3E7PA 1Y7IA 3LCUA 1E18A 1L4UA 4I9FA 1DTWA 2AXPA 1IZZA 4B9EA 2QMYA 2XGJA 4DQUA 3O3OB 1TGVA 1YFZA 4CE6A 2ZSJA 3I2KA 2JGKA 1ECCA 3RS9A 4B5LA 2ACKA 1C50A 5JTUA 2FSUA 3T7KA 3AUYA 4ANUA 4FFVA 1JFLA 3RJVA 1DEHA 4GVLA 3BXPA 2GPNA 2ZPAA 2IDJA 2JRCA 4R3WA 4PIPA 3Q47B 2O3JA 4RVHA 4EGCB 2W6NA 4GEGA 2EQ5A 3IOCA 1XKLA 3HBFA 1ENZA 3KZOA 3OFNA 5A2GA 3RANA 4DDHA 3WKBA 3BQNB 2Y0EA 3I6MA 1SIOA 2IYPA 3N76A 3SZGA 1FFEA 1ZGCA 4LDNA 1DG3A 2FULA 2QF7A 4I6GA 2WSYB 2R5WA 1M83A 4M60A 1X39A 2B1IA 3O92A 1N2CA 1RPNA 4UHCA 1TE2A 4NX2A 2RH8A 4X24A 2JCVA 2VL7A 4C4AA 1JKFA 4D4IA 5DWDA 2QR2A 2Y6VA 3QOFA 2E6KA 4X62B 3SQXA 1HEYA 5LMNB 4Z9FA 4DMMA 1K08A 3Q4GA 2DF8A 3EVCA 3PDUA 4CKBB 2AMFA 2HSZA 2WWHA 3BE6A 2MR5A 2Q0HA 4DE5A 3IQXA 2SCUB 1U28A 5ALHA 2P2NA 2P2GA 3KM0A 3E4CA 1F5SA 2WIJA 4MGYR 1DWPA 2ZAYA 5KPDA 4KIFA 5AN8A 2QV0A 3CV0A 2X22A 3BTSA 4D6PA 1QPGA 2R7KA 3E58A 3L5KA 4DR2B 2RDMA 3BXGA 1MJ0A 2EP7A 4EJSA 2G88A 4I4TF 3UEOA 4RVBA 4Q9KA 5AQ9A 4U7EB 1MRSA 4RD2A 4OP3A 3NOXA 3AIMA 4G5OA 1EK6A 2PVPA 4HZUB 3U7IA 5ES3A 3A6KA 2BJWA 2XA9A 421PA 2ZYIA 4E94A 4FX5A 3DDCA 1QFJA 3GRYA 5E8RA 3PL1A 3RVRA 4RTOA 5EIAA 1KHHA 1JB1A 3ZGYA 4ABNA 3JQAA 4LK3A 3P26A 3LT5A 5GVRA 2BBWA 1S8AA 3LZ6A 3GFGA 4BX2A 1HQKA 2IY7A 5GMOA 4DI3A 1FTNA 1YT5A 2B3TA 3M6XA 2O5VA 3OY7A 1VKHA 3LO5A 1HE1C 1SUIA 1U7TA 5A6SB 4WBXC 3WL6A 2IQ5A 1CUGA 3KHTA 4LHXA 1LW6E 3UJ7A 2NM0A 1RAIA 1P33A 1TW3A 4GX5A 3NIBA 4DBVO 4M0UA 1NRWA 3LWBA 1T26A 5EJEA 1JKJA 4IWXA 4DBZA 4MJ3A 2E4AA 2AXNA 5T57A 2AD5A 3UHJA 4MP6A 4S1TA 4S12A 4JODA 1LBHA 1F6WA 2OXFA 3CN7A 4Q21A 5JCJA 3ZXXA 3WGJA 1O5TA 3OEEA 2P9LG 2IYYA 3S2IA 2QXUA 4N8DA 1ZD3A 3FROA 2ACEA 3FOAA 3FDZA 1EP2B 3CRW1 5EKTA 2PANA 2QUBA 2P35A 3BSSA 1PVOA 3KSZO 3GEMA 2NO9A 3B1WA 2JFNA 3DYVA 3CHRA 1Y3IA 4TL6A 1JIKA 1S2OA 3R76A 3R7AA 3AI1A 1V5GA 2VJBA 3M8KA 3L92A 4ESVA 1X8LA 3V4SA 1SA0B 4MMXB 5BSEA 4TXRA 4R6XA 3GNSA 4X84A 5HZHA 3G2PA 4HQLA 4KPYA 2BGIA 1NJGA 1DTWB 1NMYA 3ZXUB 3K5WA 3S8EA 1AMNA 4RY2A 4INZA 4HO1X 1PY1A 5CMWA 1OPXA 4KDCA 3O3CA 4RKEA 4NNJA 4J8DA 1P9LA 1L7DA 3TFQA 4DLAA 2WUDA 3BRWD 4CMIA 4EKNB 2X9LA 1JTFA 6ADHA 1DOHA 3ZK8A 5IPFA 3LRXA 3OZIA 4PXSA 1P4HA 2VQSA 4B75A 5KNCA 4RW0A 1OKKA 2GPBA 1V45E 3LS2A 4EI9A 3QJYA 1M2WA 1I8TA 2YINA 4BE7B 3RJTA 2GPSA 4GA0A 4ZARA 2QY9A 1SA4A 5TMBA 3KZNA 1TQDA 4K0RA 3QU5A 3E9QA 3QLEA 3W78A 2DT5A 4J0EA 2VAWA 5DGIA 4RH3A 4QTUB 2GJAA 1D9ZA 2QLMA 4CMEA 1A2KC 1N2CB 2QVCA 4BQOA 13PKA 2GK6A 1BWSA 3ENEA 5T8KA 3VR3D 3MLAA 3L8DA 3V3TA 4BB6A 4J0JA 1LS1A 4HB0A 2WTAA 3RSSA 3IJEB 2WQ7A 3I5MA 3SOPA 3L82A 3FAKA 4S24A 3G5LA 3FG9A 3EZGA 3EAQA 3ASGA 3ABKE 3LU1A 1W36B 2CLFB 2P9BA 2QN8A 3WK5A 4RZHA 4LRZA 4CMAA 4HWRA 5JS1A 2IOYA 4BTLA 4Y67A 3U9TA 3ZY3A 4ZZ3A 1RCFA 2EJWA 2CKDA 4NV0A 2IIQA 4XYLA 2I0FA 2I7DA 5KJFA 3FMPB 1CFJA 4E7OA 2WTEA 2PO5A 4AWBA 2QRPA 5I4BA 1XN4A 3P1JA 4EJSB 2CLDX 3WNDA 1YAJA 5G1NA 4OI2A 3EGIA 5BWOA 4HQOA 2P40A 1TM5E 2B4KA 2ZXEA 5DHFA 3JQAB 4O3FA 3GUZA 4V3IA 2ZVJA 3C7CB 3R9WA 4A82A 3I76A 3CHYA 4M0MA 3AL2A 2J0QA 3Q5DA 3RTGA 1R4MA 4ZDWA 1DADA 3STUA 1JJAA 3L1HA 2IBTA 1DJMA 3PFKA 2AVNA 2BKVA 3MT9A 1ECJA 2H7YA 3H87A 5CVJA 3KHUA 4A8JC 4MVJP 2QL7A 4K9KA 4CTKA 2OO5A 2QDKA 4E7PA 1EB9A 5SYMA 1K63A 3UXYA 1JKJB 2GYUA 4JJKA 1KI7A 2ZVDA 3N0TA 3V8EA 5M72A 3GZSA 1RAGA 5GIOE 4JI2B 5KOIA 3ZBTA 1T0PA 2EGUA 1BD8A 4BO8A 1YZUA 5KNBD 5K9ZA 3ZQJA 4HOTA 1RM3A 3HWSA 1MQ9A 3Q2OA 4FYIA 1RBMA 2H52A 3U4QA 5JJ5A 3WWCA 2BL4A 4G4SP 3WLEA 3FDZB 3K0SA 4HMOA 3FCCA 1YR1A 2AKEA 1ZD4A 2NU6A 3OTHA 2QRQA 5BURA 4D26A 4CLHA 1Y81A 4WDQA 1TKBA 4FDMA 4PLGA 3L4JA 3TIGA 2DLNA 3BYZA 3KNZA 3VR4H 1P61B 1ESCA 1QR6A 1ZK3A 4I55A 3E4DA 4GMGA 1EZ1A 4RHEA 2WE7A 1PUIA 5K0ZA 2HIAA 4BO2A 3CFYA 3KHSA 1Z88A 1HXHA 4I2VA 1UEXC 4LJSA 2QRGA 4KWIA 5MHTA 1VJGA 4BNGA 1T3GA 5B2ZA 2GLTA 2R79A 4Q3OA 2A5YB 4CMIB 4L7TA 4H3VA 5KQPA 4U04A 3HRKA 2XXBA 1NXXA 3L7MA 4BVBA 1C2TA 2QN3A 2EIHA 1BDJA 2XAUA 4B8CB 4TV8A 4UAGA 1A7UA 2H63A 3PI6A 1G9XA 2YDYA 2QX9A 4PSVA 3ZYLA 2I03A 2IYUA 4A1FA 1F9EA 2ZBEA 1XFAA 5BOVA 3HLKA 5EAIA 3IHYA 2UZ0A 3HZHA 4Q7QA 5NULA 3WHIA 4X3PA 1Q2ZA 4PY2A 2D54A 1EU1A 1E1LA 3GT3A 2C3PA 1B8UA 4H4EA 4Y0NA 4CIXA 2X1VA 2BE9A 4WOKA 4QO7A 4IY1A 1UR5A 3NHUA 3FDHA 5CB0A 2DQSA 3E70C 4G5GA 2CNWD 2P2ZA 3ZV7A 5COBA 2RJNA 4RL6A 5ENRD 5C52B 2JLAA 2IZ5A 4MW0A 3KETA 3L82B 1R6TA 2YWDA 5AJZA 2H54A 3RT1A 1G7RA 3MAGA 4M37A 4ALJA 2KCVA 3GLKA 3M6WA 1QO7A 2VWQA 3DE3X 3GZJA 3QUTA 5JHGB 4XI0A 5L3RA 3LCAA 1GSHA 2NO1A 4YP6A 3TQIA 3LVQE 1SOUA 3DHWC 3ZU3A 3QFTA 1XROA 1IOWA 4BMXA 3DSWA 2O7QA 4BQSA 2Y4UA 3DB2A 3VJLA 3D6AA 5FUWA 1Y89A 2D1TA 3LY9A 3IQWA 4UW9A 3QWPA 5IZCC 5EKUA 3I9NA 5BPHA 3RD5A 3Q88A 1I4WA 2AJBA 4HBZA 3V8QA 4MYRA 2WAXA 3NWJA 1FL9A 2WLSA 3B36A 1KO8A 3FZNA 1I7LA 5ALDA 4AF6A 4C7JA 3ZWBA 2CL7X 2XNCA 3OIYA 2QJWA 1DJPA 1TJNA 4C0BA 2OYSA 2ZSAA 4HMQA 2R86A 5LDGA 2V97A 2JI4A 1CKEA 4NFYA 2RHGB 4GMLA 1HC7A 3P5SA 5BP7A 1R4MB 4RCZA 1HDZA 2BLNA 4WCFA 3WY9A 1M2JA 3X44A 3ORRA 1KZ9A 3GLVA 1P4JA 1M74A 1KMHA 1ZA1A 2EL9A 1GGJA 1RI2A 3IIMA 3CVYA 1NA0A 2IZ0A 1C7EA 1YKGA 4DGSA 1RFLA 4HORA 2O59A 4FP7A 3CZMA 3IPYA 3LQ1A 5LIRA 2HBYA 3HXTA 4RPHA 1U1DA 5CNJA 2W2XA 1H0KA 4HR7A 4GU5A 1PP4A 2P30A 4ID3A 5B1DA 4OQLA 5I7FA 1VYHA 1ZRMA 4GWGA 1KY2A 1HO8A 3P9QA 4XSHA 1Y1RA 3U4QB 1T5OA 3OZUA 2XWBF 2A5FA 3L22A 2H00A 3GX1A 2ZBFA 2ZISA 3TPFA 3ZZNA 1EHCA 3Q40A 2HAEA 5HVNA 3FVVA 5CVEA 3T5VA 2NU6B 3W2GA 2IEYA 4HWPA 3OX1A 5C4IA 4MB6A 1T4BA 3HQ4O 1GPUA 3QV1A 4GBGA 3NNSA 1YKFA 3UXEA 2J9QA 3A6EA 4W7SA 5ENOD 2MU1A 4I5FA 3D9HA 1V7QA 3QHAA 4CG1A 3WJ1A 1PX0A 5CFQA 3VC7A 1PJSA 2P9UG 3WLHA 4JYCA 3MS4A 1IB6A 5BN5A 2GJ4A 2EQXA 4I55B 4IHQA 3FP3A 5ITVA 3GLTA 1NVMB 1H94A 3TLMA 1A5AB 4JBLA 3LEWA 1WQ1R 2WHXA 3U3JA 4E5YA 3PZRA 1GSIA 1D8DA 3EQZA 1SO8A 4IIVA 1MC1A 2WXNA 2A0FA 1ABEA 1EM6A 1DB3A 2EKDA 4JNCA 5E1BA 3AEUA 1WBDA 1LF8A 4CIYA 1D2AA 3BRCA 4BMNA 3EEIA 3RC1A 4BATA 1LVUA 1ZD5A 3LRPA 5L3QA 3UJDA 1N8KA 1NA5A 4CF7A 2PK3A 1YBMA 2L18A 2CHXA 4TV8B 3I9V6 3MK31 1UOEA 2I1VB 3QG1A 2BFBA 1U2DC 1FUYB 1YQTA 4INOA 1B0UA 1FS6A 1Q15A 4BGDA 4BLRA 1BD3A 1RWNA 1IJEA 2YHBA 1YK1A 2C7VA 2O4CA 3DS8A 1JQDA 4JLMA 2AE2A 1U8FO 5FBQB 1HNXB 2CHUA 4F85A 3FUMA 3RIXA 1J9ZA 1DAKA 3K1YA 4GQBA 1OYWA 3OCWA 3KQQA 3HM2A 5EIWA 4LF4B 2VQ2A 1YQGA 1OOEA 1R9MA 1WUTA 4YBRA 3HPQA 4HGQA 3K9FC 4PZ0A 5JAHA 5AW3A 4POAA 1Y9EA 5A4DA 1Q1AA 4CG3A 1ZUD1 1IM2A 2Q4RA 2DAPA 5T5QA 2VZ9A 1DIOB 2XCRB 5BRNA 2E48A 3H6GA 4RTMA 3ZCPA 4D25A 2BI7A 3O1JC 3AR6A 3VHQA 3R7WA 3CINA 1T3SA 2X0IA 2CVHA 3QELA 4JEHA 2X9NA 3CVLA 2CUNA 5ALUA 1TYEB 2ZR9A 3L9TA 4E5VA 5K8CA 2PLNA 3CHQA 1ZH6A 3VU0A 4PGAA 5FWDA 2RE8A 2EGHA 1O5MA 4IEIA 3U4HA 5JISA 1Y9DA 4LMPA 3KBOA 1M34E 3MWDA 3AU9A 4YCLA 3JD0A 2WKPA 1CQZA 1KOJA 1L3IA 1HE5A 4YAGA 1Z18A 2GCGA 4W1RA 2Q1SA 2QN6A 4IJ5A 3I01M 1DC7A 2J32A 2QVXX 2A6PA 4WADA 1XDSA 1PEYA 4AJEA 1OZFA 3EHNA 3A9VA 1YAHA 2IKQA 3WLJA 5K45A 3DOOA 2DUWA 1FXWF 2J3DA 3R0JA 3CR8A 4X41A 4ZQEA 1MZPA 3TLEA 2NPIA 4PC7A 2E5FA 1OH6A 4ND5A 1M5TA 4FE3A 5TT0A 1LEHA 4E2FA 2KC7A 4TKMA 3P97A 1FDWA 4WCFB 2IYTA 2NO5A 1R27A 4AYWA 4YRZA 2FWPA 4KJZA 1WU7A 1KMHB 2V7GA 4COKA 3D9QX 2O54A 4FHDA 3QLTA 1Q7RA 4KW7A 1SEPA 4X00A 3ZS8A 3OE1A 4ZO9A 3L1VA 3RRXA 3V33A 5JROA 3MILA 4CIWA 1PK7A 1FDOA 3CIFA 4MDYA 4ZYWA 4J0GA 2CMFA 1WXGA 1NJ2A 3L7CA 1NNUA 4Z8XA 3FSEA 4O1MA 2GI4A 2W6ZA 1F1BA 2DFLA 5JSFA 2X5XA 4DW8A 2G3YA 5U9CA 2O2HA 4W9RA 4PSAA 5AQEA 2FW6A 4JXXA 1WA5A 3ANSA 1KC1A 5G41A 2NZVG 3RQSA 1IJBA 3RRUA 3EIJA 4UXJA 3LPNA 4XKBA 1QUFA 2Q3EA 2AEMA 5D7NA 3UAYA 3TG8A 4LCTA 4C0QC 4ZYYA 4X44A 2F3SA 2P69A 3IUQA 4NJMA 5GONA 4LGCA 5B7NA 4AZWA 1L8XA 1HY3A 5FINA 4J4TA 1QH1A 3RSHA 5BN5B 2VTKA 1V9LA 5TEWA 4U2BA 3ZU4A 4DJTA 2FOLA 3GVCA 4C0MA 5CDYA 5D1HA 5CURA 3DBSA 4KMRA 5JANA 1IVNA 4JEMA 4PAWA 3LFUA 4DWVA 1E7SA 1NQAO 4E4YA 1AS0A 3IDSA 4UMDA 4JLDA 1SOWA 1F0PA 4GI1A 4KACA 1X70A 5FTMA 1H2BA 1Y6JA 3P2BA 1B8NA 1O1YA 4FYJA 3AEUB 3JZMA 1C0LA 2I2WA 2XB6A 2VYCA 2QRNA 2RI6A 2P3QA 4E70A 5L3QB 3UK0A 1KKMA 1EQAA 1SG0A 3RUDA 4CQJA 1YCFA 3HEBA 1V3QE 2CFCA 1Z6PA 4L5YA 5FXMA 1DKUA 2G70A 2GZ2A 4BO0A 4OH7A 4PR3A 2F3QA 2BFBB 2XB4A 1M76A 5CHEE 1N7JA 1IBRA 1SCNE 3DT6A 6GPBA 5DSZA 3Q9NA 3OOSA 4ZMRA 2NSZA 2O0JA 5CVVA 4DVGA 2O06A 4WKOA 4N0MA 1KI1A 2B2CA 3NRJA 5JYCA 4HOUA 1A0OA 2PS1A 3HE3A 5HJ5A 4LZJA 3PR3A 1K2WA 3IOMA 2X0DA 3PR2B 2NVBA 5LWHA 4RHYA 3QPCA 3M5WA 1N32B 3T4EA 3STWA 3HJTA 2WSSA 2QD1A 2ZQ5A 2UUBB 2P9ZA 4XQ9A 4MROA 1HL7A 1X1CA 5EE5B 4Y6GB 5KYWA 1VA5A 4O2RA 3CRQA 1GW6A 3FNEA 1E1MA 3QPBA 5B1IA 3R7WB 2O7NA 4HDQB