5ENQD

Mbx3132 bound structure of bacterial efflux pump.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
162
structure length
162
Chain Sequence
HHHHHHGSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Multidrug efflux pump subunit AcrB,Multidrug efflux pump sub
publication title Molecular basis for inhibition of AcrB multidrug efflux pump by novel and powerful pyranopyridine derivatives.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 51
structure length 162
sequence length 162
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2015-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5enqD00
2AJAA 3TWUA 2RFMA 3KEAA 3TWXA 1BI8B 1OY3D 3T8KA 3ZU7B 3W9FA 4LSZE 3EU9A 2ETCA 4UUCA 4C48B 3TWTA 5ENTD 3ZKJA 4J8YA 4ZHBA 3W9GA 5ITZF 2F8XK 1N11A 5AQ7A 1AWCB 2DWZA 3DEPA 1DCQA 3B7BA 3TWVA 1DC2A 2J8SD 4QQIA 1UOHA 3T9KA 4ATZD 4LNUD 2BKGA 3UI2A 4DX6D 4U8VD 3D9HA 5KNHD 3V2XA 5CEDB 4TUMA 1MYOA 1G3NB 5AN8A 3TWRA 5HKPA 3UTMA 5CEAA 1MX6A 2ETBA 2QC9A 4QFVA 4DX7D 5CBOA 4CZ2D 3EHQA 1OT8A 4HI9A 1TR4A 4A63B 1SW6A 2XZTG 2BKKB 3NOCD 2HE0A 4BSZB 2L6BA 4CYMD 4HBDA 3Q9UC 3TWSA 4HRLA 5ENQD 1MX2A 1S70B 4RLYA 4DX5D 4F6RD 1WG0A 5CECB 2V5QC 2F8YA 5D66A 2DZNA 3Q9NC 4BESA 1A5EA 2NYJA 5FINA 3ZUVB 4JB8P 2Y0BG 2DVWA 2JABA 4LG6A 5AAOA 4K5AB 4U8YD 3SO8A 4ZFHA 3J5QB 5AQAA 5KBAA 3AAAC 1YCSB 4K5BA 5CERB 3DEOA 2PNNA 1IXVA 1AP7A 1NFIE 3NOGD 3F6QA 1IHBA 2KXPC 2MYOA 4DX1A 1MJ0A 2XZDG 2DZOA 3LJNA 4BEPA 5ENOD 4DUIA 1BD8A 3V79K 3IXEA 3V30A 3UXGA 4BETA 3HG0D 5EILA 2Y1LE 2ETAA 2QYJA 5BXUA 3AJIA 4GMRA 5JMND 5ENSD 3TWWA 3TWQA 1N0RA 5AQBA 4HI8A 4O60A 5EYPF 4G8LA 4BERA 4N5QA 3B95A 3JUEA 4HRMB 2KBXA 1N0QA 5KNGA 1K1AA 4J7WA 5BXOA 1SVXA 1K1BA 5KWDA 4DX2A 3HRAA 5EIBE 4O1PA 4F1PA 3J5PA 2B0OE 4Z68A 2A5EA 5AQ9A 4HQDA 2F37A 5HRYA 4HB5A 4HRNA 4B93B 4G8KA 2XEEA 2P2CP 2XEHA 5HS0A 2RFAA 1BI7B 3V2OA 5EIDA 5JA4D 3NBNB 1IKND 4DRXE 1QYMA 4GPMA 3JXIA 4HNAD 4OAVB 4U96D 4YDYA 4NIKA 5EYLA 4K5CA 1MX4A 1WDYA 4HLLA 5FIOA 1BU9A 5AARA 4YDWA 3EHRA 1D9SA 5ENPD 2V4HC 3ZNGA 1BLXB 5ENRD 5EN5D 4O1OA 3C5RA 2VGEA 3JXJA 1YMPA 2XENA 4U95D 3V31A 1K3ZD 1YYHA 4OAUC 2ZGGA 5CBNA 2FO1E 2ZGDA
chains in the Genus database with same CATH superfamily
3CHPA 5FQ8A 3BEEA 2IOLA 1JPLA 5ITZF 1OXJA 5AQ7A 4JA9A 2OV8A 4I1MA 3NB2A 3UTMA 4CCAA 4QFVA 1TNUA 1LTXA 3NZSA 3QOUA 2L6BA 2JLBA 1VDYA 3SBTB 1BPOA 3ZPJA 4BESA 4Q96A 4G24A 2KCVA 2OOEA 3PZ1A 4AJWA 3MCXA 4AVXA 3L22A 4A1GA 2L0TB 2VTBB 2WXJA 3L08A 3AG2E 4G2VA 2XCCA 3E32A 4KMOA 2JEKA 3RSEG 5ANLA 1SZ9A 3FP3A 3CR3A 4FADA 5BXOA 3MKRA 3KSLA 1FT2A 4H7XA 4HQDA 5B3SE 4HOSA 3ASOE 3QWPA 4APFA 4JVSA 1QYMA 4HNAD 3PDNA 3S7BA 5EYLA 4MLPA 1Y8MA 2FEZA 4N3AA 4AY5A 5LP0A 1NA3A 4JPSA 4FC8A 4JHJA 3G2VA 3DSSA 4DI4A 3HVEB 3ZU7B 2GROB 4LSZE 1NZNA 5ENTD 2VTBA 3CVYA 4CDMA 4BTBA 5CMWA 3MYVA 3LCAA 4R7LA 5G55A 2BEDA 4GZ3A 3UX4A 3LPZA 2NC9A 1G3NB 4O6FA 5BV0A 4BFRA 3AS8A 2P9IG 4FHJA 5D2MC 4RLYA 2FF4A 3UUXA 4N2QA 2DYSE 3ZUVB 2JABA 2HR2A 4TV3A 5LCWC 3ZRHA 5ENOD 3CVXA 4CEMA 1N52A 5AJLA 3HVEA 4FJZA 2KZTB 5JMND 3FUFA 1E96B 3NF1A 2NSZA 4GZ6A 3R9MA 2IJGX 4L2LA 3C3OA 3ZHEB 3JCKC 3FUJA 3UKRG 3AG4E 2H6HA 5E75A 4B89A 4DRXE 2LNIA 3QARA 4A55A 3ULEG 3IV0A 4E6HA 1OWMA 3FU5A 4HS2A 2AW6A 4MKTA 4PDXA 2A4ZA 3SHFA 2ZGDA 2RFMA 4I2WA 5BV1A 3ZYMA 3MKQA 3S7FA 4M7CA 2XRYA 3SFYA 3HXBA 2GRQB 2X38A 4A1SA 2R05A 3ZFWA 4G23A 3CLJA 1ELRA 3Q78A 4A3TA 4AV7A 2HM8A 3LY7A 1HXIA 5AAOA 3APCA 4KBQA 4G1TA 2DZOA 4KZ0A 1E90A 3AG3E 1BD8A 4FLBA 2HO1A 2EIKE 2IEJA 2I6HA 5JHBA 1N0QA 1QQEA 5EX0A 4PH4B 2I1JA 3FUDA 4F1PA 3Q49B 2B0OE 1X5BA 3SI5A 3RRNB 4BY6A 2XEEA 4ILGA 4UWKA 4Y6WA 3KEZA 2DBAA 4JEUA 4NIKA 2ONDA 4FLHA 3BU8A 3PEUB 4JZYA 5ENPD 4HVBA 4GYOA 2XGMA 3L6AA 3FEXA 4C0EA 5T3RA 4DJAA 1KZOA 2AVPA 4F53A 4EZKA 2LSVA 3FTXA 4BX9A 4WAFA 4I1AA 1E8WA 3FEYA 3W9GA 4RVBA 1NL4A 4B8CB 5HQ8A 5FZRA 1EPUA 2L9BA 4U8VD 1JCQA 3HXFA 2I9CA 1SQMA 4HOUA 1TJCA 3CKCA 4HI9A 3QJZA 4ME2A 4UQYA 1EYHA 5G05J 3U64A 3CK7A 2ZIRA 4ANXA 4ILHB 4KZCA 2EILE 1IHBA 5A6CA 4U7EB 4BEPA 4DUIA 2F0YA 3QNKA 1S63A 5ARFA 1KPSB 3KSQA 4EBAA 4IULA 5KJNA 1SA5A 3ZYQA 4J0UA 4N39A 3RIBA 2AWIA 1O1RA 1FPPA 2J4BA 2A5EA 2X6FA 4RQIA 3GZ2A 4B93B 1BI7B 4PS7A 4LRZA 2Y3AA 2R59A 2P9SG 2OEVA 2P9PG 2WVIA 3UM0A 2H6IA 3ZNGA 1BLXB 1TNOA 3SD5A 4I2ZA 4U95D 1YYHA 5CCLA 2AJAA 5E76A 2E0IA 2WXNA 3UM3A 4BWRA 1N94A 4WNEA 4BT9A 4I6JA 5FZQA 3T9KA 5FT9A 5BNWA 4ABNA 1MHQA 3ZGQA 2XGOA 2WM9A 4CYMD 3P2BA 4HBDA 4U63A 5CCMA 3E4BA 2DYRE 5FQ6A 1IYGA 2FO7A 3NQPA 3URZA 4TXPA 3KD7A 5EX3A 5H7PA 1L5JA 1H0AA 3VLDA 2VYIA 1V55E 3ESLA 2BTDA 2V4LA 5FWQA 4BETA 5EILA 2Y1LE 2OEWA 4L1BA 4F1SA 4FU3A 3E37A 3TWWA 4PS8A 1E7UA 3SF4A 4MBGA 4XIFA 5LFAA 1WY6A 4I9CA 3FWVA 4N5CA 1SVXA 4O1PA 2PQNA 3SQVA 2P2CP 2LUHA 3CIAA 3S2AA 1HF8A 2BUGA 4OAVB 4U96D 3FTSA 1SZAA 2GRPB 3LJ3A 4EPZA 4GTTA 3ZYKA 1P5QA 3ONLA 4NRHB 4OAUC 4APOA 4JC8A 3UT4A 3WXXA 4L9PA 3TWUA 3W9FA 3CVVA 5D0OD 4TXQA 2WQ6A 1UOHA 2YNQA 2GRLA 3D9HA 3S7JA 1HH8A 4U0SA 3ULQA 2CHZA 2UWJG 4CZ2D 3CHQA 3FUHA 1SW6A 2KCKA 4HRLA 3S7DA 1S70B 5G04J 2Y4UA 2F8YA 1Z3YA 4ANWA 1DCEA 1H6KA 3B7UX 4ZFHA 4HLEA 1U3CA 2NXPA 5CERB 2R02A 3ZW3A 2VSXE 3Q7FA 3PUJA 3FY4A 3MV2B 1UN9A 1HG2A 3Q73A 1OUVA 4L23A 1HO8A 4UWFA 4HRMB 3QB2A 1NI1A 3G2UA 4HOTA 2V5FA 3D9MA 3ENEA 3CKBA 4G8KA 1JCRA 3EDTB 4G25A 4XKCA 1K8KG 4GYWA 3NBNB 1XNFA 3MV3B 3PNLB 4YDWA 4DLQA 2V4HC 3P1UA 1XGWA 1H2TC 3V31A 3O48A 1FCHA 3Q4AB 1OWPA 2IOSA 3LXUX 2WXFA 3TWTA 4A3VA 2XGSA 5LOZA 5C1DA 3T5XA 5HKPA 2C2LA 5AYWD 1OCCE 5JHAA 1IHGA 3UQ3A 3HHMA 3QDNA 3Q9UC 2HYZA 4HFGA 3FTWA 4ANUA 4X8QA 2XHEA 1MQSA 4G26A 5ARGA 4U8YD 3J5QB 4YNDA 2CFZA 1YA0A 2IF4A 4WUYA 2XPYA 3G2TA 1FT1A 4GZCA 1Z3XA 1PY1A 3UIOC 4XI9A 2GRNB 4NACA 4AEZC 3APFA 3LJNA 2P9NG 1HU3A 5DBKA 4LCTA 5C2YA 4XI0A 3N71A 3TJPA 3CVWA 4GTQA 4BERA 4PS3A 5D0QD 3JUEA 4J7WA 3C3QA 5ENNA 4JHKA 4DX2A 5EIBE 4HOQA 3LVRE 4U0ZA 4GTPA 3RAUA 5T4YA 4B8AA 1N9AA 2I2OA 5HS0A 3QC1A 4YDYA 3MKQB 2X6IA 4I9EA 4XX5A 4U07A 4O1OA 1H6OA 5JJTA 3RO2A 3UM1A 3IHVA 2VJ8A 3KEAA 3TWXA 4I17A 3D9JA 4J8FA 3UT8A 4AM9A 4ZHBA 3CQGB 4BSXA 1N4QA 1N4PA 3B7BA 1EF1C 4L2YA 4EBAG 4GTOA 1MYOA 3UM2A 3D9IA 3FULA 2MHKA 2XQ0A 1E8XA 3TG5A 4BSZB 2CHWA 3ESKA 4DX5D 4F6RD 3MA5A 5D66A 3I5PA 2YINA 2QY7A 2WB2A 4LG6A 5AJDA 5B1AE 3SO8A 3CK8A 4GA0A 3TXNA 3JQ0A 3DEOA 3FTZA 4JL0A 5AIJA 2OVBA 4UI9J 3SBSA 3UXGA 2EINE 3ZXSA 3EHMA 2GRRB 2GW1A 5ENSD 3OAWA 5CHEE 3B95A 3TG4A 1UG3A 2KM4A 2X3MA 3PREA 1ZBPA 4GMJA 2H6FA 3FH8A 2RKKA 3LY9A 3VTYA 3L16A 3HXCA 4BX8A 3LYAA 3ZVVA 1BU9A 1D9SA 3BG1B 2WXGA 3VTXA 1N4RA 3UT7A 1UJKA 3Q15A 2WXPA 3DXMG 2XCBA 4GTVA 2XRZA 2J4DA 4FULA 4TXRA 3LY8A 3FUKA 5BUZA 1PC2A 2OCCE 4F7AA 3HXDA 2ZXWE 4ACLA 4N2SA 3JYSA 2XS8A 1OCRE 5AN8A 1S64A 3QAQA 3U9WA 4RG6A 2AXUA 3DSVA 2WXRA 3EHQA 3PE3A 2V5QC 3Q9NC 1A5EA 4N3BA 2XS1A 2RD0A 2Y0BG 1IQRA 4K5AB 3FHEA 3UINC 4JD2G 2IFUA 2ILRA 3L13A 4K5BA 3NOGD 3Q79A 3D9OA 4DX1A 2XZDG 2YQ8A 3PRZA 3AU5A 3R7RA 4LUNU 3SNXA 2XPZA 4N5QA 2WXLA 4OVUA 2XEVA 2VGYA 4YVOA 2QFCA 4WWNA 2ZU6B 5AENA 4J8EA 1KT0A 4GTMA 2A5UA 3G2SA 3JUIA 1W3BA 4CT4A 3ABME 3FUEA 4EHMA 2E2EA 3MX3A 4XEIG 1WDYA 3FUIA 5FIOA 5AARA 3CQCB 3EHRA 4KYOB 2IONA 3JXJA 4DPRA 1TN7A 3NZUA 2ZGGA 3TWRA 2FO1E 3CHRA 3TXMA 3EU9A 1KLXA 4UUCA 3ZXPA 2LAHA 3DPYA 4GMLA 3ONKA 2PZIA 4UWHA 2WMOA 3R9AB 3L82A 1ELWA 2J07A 3DSUA 3I3NA 3WG7E 2LAIA 3GZ1A 4A63B 2L6JA 4WWPA 2CFUA 4I6EA 4WNDA 2EIJE 3EUVA 2Q7FA 2R2LA 5AQAA 2EIME 1AP7A 1NFIE 4Q94A 1Y6IA 3ML9A 3IXEA 1D8DA 3EJNA 3PH0C 4URKA 3EIQC 4GA1A 2ETAA 3TWQA 4XZ4A 1INZA 4EZLA 1NA0A 3TL5A 1LD8A 3FTVA 1TEZA 3SGHA 2KC7A 2PL2A 1OCZE 2J49A 3AG1E 1N54A 1DVPA 2VQ2A 4IRUA 3CHMA 2P9UG 4GCOA 3TAXA 4GPMA 1B89A 2VGXB 3ZN3A 4AY6A 3CEQA 1MX4A 1NP7A 3D9PA 1UN8A 2VGEA 1HX8A 3ASNE 1K3ZD 3K9IA 1N95A 1KZPA 2I1KA 4XKBA 1OY3D 2BF0X 2PM7A 3UIPC 2VSNA 4OYSA 4J8YA 3Q5MA 4EQFA 3CV0A 4B94A 4GTSA 1E8ZA 4TUMA 3FTYA 3L54A 4LNGA 4TUUA 4D10C 5LCWJ 1JWFA 1TR4A 3O4ZA 5IY5E 4E85A 5CECB 1DNPA 2VGXA 5LX8A 4EZJA 4BT8A 2LXMA 3FDHA 1FVHA 2P58C 1IXVA 2PNNA 2M63A 2IQCA 4DI3A 3PE4A 4OVVA 5G05C 5FQ7A 3HG0D 5A23A 2EQXA 4HI8A 4H7YA 4AOFA 1KT1A 4CT0A 4GB9A 4CDRA 1TJFA 5M72A 2VSYA 5KNGA 4CGWA 2J9QA 1OWNA 4AP2A 2WXHA 5KWDA 1K1BA 3CK9A 1JWGA 1OWOA 2UY1A 5HRYA 4GU5A 3ASGA 1O1SA 5DIZA 4HLLA 3D9NA 3UKUG 1X81A 3AS5A 4UWGA 3C5RA 3OTNA 3QK0A 3CGHA 3I4RB 3FU6A 3T8KA 4LNBA 3D9KA 3DSXA 3HIZA 4PUCA 4Q69A 5EDSA 3C98A 3JQ1A 2DWZA 3TWVA 1DCQA 4U04A 4ATZD 1RW2A 2BKGA 4AXHA 2GGFA 2R5SA 1E8YA 4GTRA 4M3OA 3PEVB 4ATGA 3BQOA 5JJ6A 1EDUA 2WXOA 5JJ7A 4J6IA 3NOCD 2HE0A 4GA2A 4JHRA 5ENQD 1MX2A 1HG5A 1TN6A 4P29A 2KATA 4K03A 2NYJA 5FINA 4YVQC 2ZISA 4DLOA 3ISMC 4ANVA 1YCSB 3B13A 2C0LA 1A17A 2MYOA 4K0RA 2B6CA 3PUKA 4AIFA 2LXLA 1IQUA 2Y4TA 4CRWA 4YDOA 3LKUA 3ZYLA 3APDA 4G11A 2J08A 4HB5A 3PZ3A 3ZEFA 4C9BB 1H6PA 3LDZA 2CG2A 2P9KG 3QWVA 1Z6TA 2FBNA 3DWLG 2WXMA 3NAWA 1HZ4A 1V54E 5CBNA 1BI8B 3PZDA 3FU0A 2ETCA 1HE8A 4C48B 2C0MA 4FP7A 2F8XK 3KAEA 1N11A 3LVQE 1HS6A 1QNFA 3MEKA 5KNHD 2QZAA 3V2XA 4GZDA 3PNTB 5KJKA 1LD7A 3SFZA 3CSFA 3CSTA 3DSWA 3T8MA 1FVFA 2BKKB 5J90A 4J8SA 4JB8P 1U3DA 3LS8A 3TGOA 2R03A 2OVFA 1UJJA 3U4TA 3ASHA 4U0UA 4L7TA 5G04C 4TRQA 3UPVA 2GRMA 5T8IA 3OXGA 2WQHA 2QYJA 3BUAA 5KCMA 5AQBA 3X2QE 4U8HA 5BT1A 2PQRA 3B7TA 4GAAA 3EHNA 3ASDA 1MZCA 2X6KA 1JCSA 3E30A 4JA7A 5CRUA 2IO2C 2VSOE 2L0IA 3QKYA 1WAO1 3RK6A 4JW1A 4FJYA 5HI7A 3C72A 4C0MA 3PZ4A 2F37A 3GW4A 3AS4A 1IKND 2R17C 3UMVA 3ZIMA 3RU0A 2KZTA 1Z5SC 3RJVA 4K5CA 4MRUA 3CHOA 3G2WA 5EN5D 2DIWA 4GZ5A 4RG9A 1O5MA 1E7VA 4XE0A 3ZHEA 1H2UA 3RRUA 4KT6B 1O1TA 2YHCA 4Y6CA 1S0PA 4HORA 3QWWA 2J09A 5FZSA 3DEPA 1DC2A 4QQIA 3IHYA 2Y69E 4HXIA 4LNUD 3CHSA 3UI2A 2QYUA 5CEDB 3BG0B 2CHXA 2P9LG 5CEAA 3FUMA 1HFAA 4EECA 1TNYA 2MRIA 4IYPA 4BTAA 5CBOA 3FUNA 1OT8A 2AXVA 1H19A 4LERA 3U66A 1TNZA 1D8EA 1TNBA 3B7SA 3AAAC 3ASFA 4FHKA 1QZ2A 5J08A 3F6QA 3I4GA 1MJ0A 2IO3C 3B7RL 3RKVA 3RO3A 1TN8A 3AJIA 4GMRA 3DRAA 3OXFA 3Q47B 3DBSA 5KJMA 2RG8A 5FQ4A 3CVLA 1K1AA 2WXQA 1RZ4A 3SZ7A 5BW8C 3IEGA 4Z68A 4UI9K 4CGVA 3D3MA 4I43A 3V2OA 5EIDA 5JA4D 3CVUA 1OWLA 2X6JA 3JXIA 3DSTA 4IN3B 1N4SA 2FI7A 2AXZA 2KCLA 1GW6A 2DCPA 3L9TA 5CMYA 1PAQA 3D9LA 3AU4A 3FFLA 4UWLA 2WXIA 4WWOA 4I6GA 4MS6A 3C3RA 3OXLA 4UQXA 3GZSA 4YDEA 4JXTA 3ZKJA 4I1OB 1AWCB 3HYMB 3DXKG 2J8SD 1UW4B 3U3WA 4DX6D 4ILIA 3PVLA 2LO6A 2ETBA 3PZ2A 2IU1A 2XZTG 3TWSA 4F3VA 3MJWA 1WG0A 2DZNA 3MZLB 1H2VC 2DVWA 3KS2A 5KBAA 1JUQA 1QBQA 1U2VG 4RSYA 2LSUA 4FA6A 3V79K 4J8DA 2V8SE 3V30A 2WMNA 4NQ0A 4WNFA 5FJYA 5BXUA 4W9RA 5FTPA 3PS6A 3HDXA 4B0ZA 2PM6A 3CVPA 1Q2ZA 3HRAA 2XPIA 3IBEA 4UI9C 3J5PA 2X6HA 1OCOE 3R7QA 4GPKA 2RFAA 3SFXA 4DK5A 3FH5A 4NURA 4UQZA 3VLEA 5G2NA 4KVMA 1WM5A 3T5VA 2WPVA 2KXPC 3IKOB 5CRVA 2IY0C 4GCNA 2FULA 3SY2A 4V3IA 3L17A 3Q7AA 5KJLA 2CG3A 3CVQA 3MGBA 1MX6A 4KXKB 2QC9A 4N3CA 4LEUA 4DX7D 3Q75A 4JEHA 5B1BE 3LEWA 3E34A 5BPPA 3ML8A 3ULYA 1ZB1A 3RRMB 1TYQG 2UY1B 4KVOA 4ACKA 2MOWA 3ABLE 1N0RA 4CDNA 4O60A 4GYYA 3FU3A 5EYPF 4G8LA 2KBXA 1LF8A 3E33A 5A7DB 3CVNA 3ABKE 2V0PA 2YHEA 1ELKA 3EIJA 5AQ9A 2WQ7A 3HXEA 5EKQD 2H6GA 4HRNA 2XEHA 3GYZA 3FTUA 3VLFA 3DPDA 3EU5A 2WXKA 3FH7A 1SA4A 5ENRD 1YMPA 1ZU2A 2XENA 4WNGA 5ANRA
chains in the Genus database with same CATH topology
2AJAA 3TWUA 2RFMA 3KEAA 3TWXA 1BI8B 1OY3D 3T8KA 3ZU7B 3W9FA 4LSZE 3EU9A 2ETCA 4UUCA 4C48B 3TWTA 5ENTD 3ZKJA 4J8YA 4ZHBA 3W9GA 5ITZF 2F8XK 1N11A 5AQ7A 1AWCB 2DWZA 3DEPA 1DCQA 3B7BA 3TWVA 1DC2A 2J8SD 4QQIA 1UOHA 3T9KA 4ATZD 4LNUD 2BKGA 3UI2A 4DX6D 4U8VD 3D9HA 5KNHD 3V2XA 5CEDB 4TUMA 1MYOA 1G3NB 5AN8A 3TWRA 5HKPA 3UTMA 5CEAA 1MX6A 2ETBA 2QC9A 4QFVA 4DX7D 5CBOA 4CZ2D 3EHQA 1OT8A 4HI9A 1TR4A 4A63B 1SW6A 2XZTG 2BKKB 3NOCD 2HE0A 4BSZB 2L6BA 4CYMD 4HBDA 3Q9UC 3TWSA 4HRLA 5ENQD 1MX2A 1S70B 4RLYA 4DX5D 4F6RD 1WG0A 5CECB 2V5QC 2F8YA 5D66A 2DZNA 3Q9NC 4BESA 1A5EA 2NYJA 5FINA 3ZUVB 4JB8P 2Y0BG 2DVWA 2JABA 4LG6A 5AAOA 4K5AB 4U8YD 3SO8A 4ZFHA 3J5QB 5AQAA 5KBAA 3AAAC 1YCSB 4K5BA 5CERB 3DEOA 2PNNA 1IXVA 1AP7A 1NFIE 3NOGD 3F6QA 1IHBA 2KXPC 2MYOA 4DX1A 1MJ0A 2XZDG 2DZOA 3LJNA 4BEPA 5ENOD 4DUIA 1BD8A 3V79K 3IXEA 3V30A 3UXGA 4BETA 3HG0D 5EILA 2Y1LE 2ETAA 2QYJA 5BXUA 3AJIA 4GMRA 5JMND 5ENSD 3TWWA 3TWQA 1N0RA 5AQBA 4HI8A 4O60A 5EYPF 4G8LA 4BERA 4N5QA 3B95A 3JUEA 4HRMB 2KBXA 1N0QA 5KNGA 1K1AA 4J7WA 5BXOA 1SVXA 1K1BA 5KWDA 4DX2A 3HRAA 5EIBE 4O1PA 4F1PA 3J5PA 2B0OE 4Z68A 2A5EA 5AQ9A 4HQDA 2F37A 5HRYA 4HB5A 4HRNA 4B93B 4G8KA 2XEEA 2P2CP 2XEHA 5HS0A 2RFAA 1BI7B 3V2OA 5EIDA 5JA4D 3NBNB 1IKND 4DRXE 1QYMA 4GPMA 3JXIA 4HNAD 4OAVB 4U96D 4YDYA 4NIKA 5EYLA 4K5CA 1MX4A 1WDYA 4HLLA 5FIOA 1BU9A 5AARA 4YDWA 3EHRA 1D9SA 5ENPD 2V4HC 3ZNGA 1BLXB 5ENRD 5EN5D 4O1OA 3C5RA 2VGEA 3JXJA 1YMPA 2XENA 4U95D 3V31A 1K3ZD 1YYHA 4OAUC 2ZGGA 5CBNA 2FO1E 2ZGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AJA A;  3TWU A;  2RFM A;  3KEA A;  3TWX A;  1BI8 B;  1OY3 D;  3T8K A;  3ZU7 B;  3W9F A;  4LSZ E;  3EU9 A;  2ETC A;  4UUC A;  4C48 B;  3TWT A;  5ENT D;  3ZKJ A;  4J8Y A;  4ZHB A;  3W9G A;  5ITZ F;  2F8X K;  1N11 A;  5AQ7 A;  1AWC B;  2DWZ A;  3DEP A;  1DCQ A;  3B7B A;  3TWV A;  1DC2 A;  2J8S D;  4QQI A;  1UOH A;  3T9K A;  4ATZ D;  4LNU D;  2BKG A;  3UI2 A;  4DX6 D;  4U8V D;  3D9H A;  5KNH D;  3V2X A;  5CED B;  4TUM A;  1MYO A;  1G3N B;  5AN8 A;  3TWR A;  5HKP A;  3UTM A;  5CEA A;  1MX6 A;  2ETB A;  2QC9 A;  4QFV A;  4DX7 D;  5CBO A;  4CZ2 D;  3EHQ A;  1OT8 A;  4HI9 A;  1TR4 A;  4A63 B;  1SW6 A;  2XZT G;  2BKK B;  3NOC D;  2HE0 A;  4BSZ B;  2L6B A;  4CYM D;  4HBD A;  3Q9U C;  3TWS A;  4HRL A;  5ENQ D;  1MX2 A;  1S70 B;  4RLY A;  4DX5 D;  4F6R D;  1WG0 A;  5CEC B;  2V5Q C;  2F8Y A;  5D66 A;  2DZN A;  3Q9N C;  4BES A;  1A5E A;  2NYJ A;  5FIN A;  3ZUV B;  4JB8 P;  2Y0B G;  2DVW A;  2JAB A;  4LG6 A;  5AAO A;  4K5A B;  4U8Y D;  3SO8 A;  4ZFH A;  3J5Q B;  5AQA A;  5KBA A;  3AAA C;  1YCS B;  4K5B A;  5CER B;  3DEO A;  2PNN A;  1IXV A;  1AP7 A;  1NFI E;  3NOG D;  3F6Q A;  1IHB A;  2KXP C;  2MYO A;  4DX1 A;  1MJ0 A;  2XZD G;  2DZO A;  3LJN A;  4BEP A;  5ENO D;  4DUI A;  1BD8 A;  3V79 K;  3IXE A;  3V30 A;  3UXG A;  4BET A;  3HG0 D;  5EIL A;  2Y1L E;  2ETA A;  2QYJ A;  5BXU A;  3AJI A;  4GMR A;  5JMN D;  5ENS D;  3TWW A;  3TWQ A;  1N0R A;  5AQB A;  4HI8 A;  4O60 A;  5EYP F;  4G8L A;  4BER A;  4N5Q A;  3B95 A;  3JUE A;  4HRM B;  2KBX A;  1N0Q A;  5KNG A;  1K1A A;  4J7W A;  5BXO A;  1SVX A;  1K1B A;  5KWD A;  4DX2 A;  3HRA A;  5EIB E;  4O1P A;  4F1P A;  3J5P A;  2B0O E;  4Z68 A;  2A5E A;  5AQ9 A;  4HQD A;  2F37 A;  5HRY A;  4HB5 A;  4HRN A;  4B93 B;  4G8K A;  2XEE A;  2P2C P;  2XEH A;  5HS0 A;  2RFA A;  1BI7 B;  3V2O A;  5EID A;  5JA4 D;  3NBN B;  1IKN D;  4DRX E;  1QYM A;  4GPM A;  3JXI A;  4HNA D;  4OAV B;  4U96 D;  4YDY A;  4NIK A;  5EYL A;  4K5C A;  1MX4 A;  1WDY A;  4HLL A;  5FIO A;  1BU9 A;  5AAR A;  4YDW A;  3EHR A;  1D9S A;  5ENP D;  2V4H C;  3ZNG A;  1BLX B;  5ENR D;  5EN5 D;  4O1O A;  3C5R A;  2VGE A;  3JXJ A;  1YMP A;  2XEN A;  4U95 D;  3V31 A;  1K3Z D;  1YYH A;  4OAU C;  2ZGG A;  5CBN A;  2FO1 E;  2ZGD A; 
#chains in the Genus database with same CATH topology
 3CHP A;  5FQ8 A;  3BEE A;  2IOL A;  1JPL A;  5ITZ F;  1OXJ A;  5AQ7 A;  4JA9 A;  2OV8 A;  4I1M A;  3NB2 A;  3UTM A;  4CCA A;  4QFV A;  1TNU A;  1LTX A;  3NZS A;  3QOU A;  2L6B A;  2JLB A;  1VDY A;  3SBT B;  1BPO A;  3ZPJ A;  4BES A;  4Q96 A;  4G24 A;  2KCV A;  2OOE A;  3PZ1 A;  4AJW A;  3MCX A;  4AVX A;  3L22 A;  4A1G A;  2L0T B;  2VTB B;  2WXJ A;  3L08 A;  3AG2 E;  4G2V A;  2XCC A;  3E32 A;  4KMO A;  2JEK A;  3RSE G;  5ANL A;  1SZ9 A;  3FP3 A;  3CR3 A;  4FAD A;  5BXO A;  3MKR A;  3KSL A;  1FT2 A;  4H7X A;  4HQD A;  5B3S E;  4HOS A;  3ASO E;  3QWP A;  4APF A;  4JVS A;  1QYM A;  4HNA D;  3PDN A;  3S7B A;  5EYL A;  4MLP A;  1Y8M A;  2FEZ A;  4N3A A;  4AY5 A;  5LP0 A;  1NA3 A;  4JPS A;  4FC8 A;  4JHJ A;  3G2V A;  3DSS A;  4DI4 A;  3HVE B;  3ZU7 B;  2GRO B;  4LSZ E;  1NZN A;  5ENT D;  2VTB A;  3CVY A;  4CDM A;  4BTB A;  5CMW A;  3MYV A;  3LCA A;  4R7L A;  5G55 A;  2BED A;  4GZ3 A;  3UX4 A;  3LPZ A;  2NC9 A;  1G3N B;  4O6F A;  5BV0 A;  4BFR A;  3AS8 A;  2P9I G;  4FHJ A;  5D2M C;  4RLY A;  2FF4 A;  3UUX A;  4N2Q A;  2DYS E;  3ZUV B;  2JAB A;  2HR2 A;  4TV3 A;  5LCW C;  3ZRH A;  5ENO D;  3CVX A;  4CEM A;  1N52 A;  5AJL A;  3HVE A;  4FJZ A;  2KZT B;  5JMN D;  3FUF A;  1E96 B;  3NF1 A;  2NSZ A;  4GZ6 A;  3R9M A;  2IJG X;  4L2L A;  3C3O A;  3ZHE B;  3JCK C;  3FUJ A;  3UKR G;  3AG4 E;  2H6H A;  5E75 A;  4B89 A;  4DRX E;  2LNI A;  3QAR A;  4A55 A;  3ULE G;  3IV0 A;  4E6H A;  1OWM A;  3FU5 A;  4HS2 A;  2AW6 A;  4MKT A;  4PDX A;  2A4Z A;  3SHF A;  2ZGD A;  2RFM A;  4I2W A;  5BV1 A;  3ZYM A;  3MKQ A;  3S7F A;  4M7C A;  2XRY A;  3SFY A;  3HXB A;  2GRQ B;  2X38 A;  4A1S A;  2R05 A;  3ZFW A;  4G23 A;  3CLJ A;  1ELR A;  3Q78 A;  4A3T A;  4AV7 A;  2HM8 A;  3LY7 A;  1HXI A;  5AAO A;  3APC A;  4KBQ A;  4G1T A;  2DZO A;  4KZ0 A;  1E90 A;  3AG3 E;  1BD8 A;  4FLB A;  2HO1 A;  2EIK E;  2IEJ A;  2I6H A;  5JHB A;  1N0Q A;  1QQE A;  5EX0 A;  4PH4 B;  2I1J A;  3FUD A;  4F1P A;  3Q49 B;  2B0O E;  1X5B A;  3SI5 A;  3RRN B;  4BY6 A;  2XEE A;  4ILG A;  4UWK A;  4Y6W A;  3KEZ A;  2DBA A;  4JEU A;  4NIK A;  2OND A;  4FLH A;  3BU8 A;  3PEU B;  4JZY A;  5ENP D;  4HVB A;  4GYO A;  2XGM A;  3L6A A;  3FEX A;  4C0E A;  5T3R A;  4DJA A;  1KZO A;  2AVP A;  4F53 A;  4EZK A;  2LSV A;  3FTX A;  4BX9 A;  4WAF A;  4I1A A;  1E8W A;  3FEY A;  3W9G A;  4RVB A;  1NL4 A;  4B8C B;  5HQ8 A;  5FZR A;  1EPU A;  2L9B A;  4U8V D;  1JCQ A;  3HXF A;  2I9C A;  1SQM A;  4HOU A;  1TJC A;  3CKC A;  4HI9 A;  3QJZ A;  4ME2 A;  4UQY A;  1EYH A;  5G05 J;  3U64 A;  3CK7 A;  2ZIR A;  4ANX A;  4ILH B;  4KZC A;  2EIL E;  1IHB A;  5A6C A;  4U7E B;  4BEP A;  4DUI A;  2F0Y A;  3QNK A;  1S63 A;  5ARF A;  1KPS B;  3KSQ A;  4EBA A;  4IUL A;  5KJN A;  1SA5 A;  3ZYQ A;  4J0U A;  4N39 A;  3RIB A;  2AWI A;  1O1R A;  1FPP A;  2J4B A;  2A5E A;  2X6F A;  4RQI A;  3GZ2 A;  4B93 B;  1BI7 B;  4PS7 A;  4LRZ A;  2Y3A A;  2R59 A;  2P9S G;  2OEV A;  2P9P G;  2WVI A;  3UM0 A;  2H6I A;  3ZNG A;  1BLX B;  1TNO A;  3SD5 A;  4I2Z A;  4U95 D;  1YYH A;  5CCL A;  2AJA A;  5E76 A;  2E0I A;  2WXN A;  3UM3 A;  4BWR A;  1N94 A;  4WNE A;  4BT9 A;  4I6J A;  5FZQ A;  3T9K A;  5FT9 A;  5BNW A;  4ABN A;  1MHQ A;  3ZGQ A;  2XGO A;  2WM9 A;  4CYM D;  3P2B A;  4HBD A;  4U63 A;  5CCM A;  3E4B A;  2DYR E;  5FQ6 A;  1IYG A;  2FO7 A;  3NQP A;  3URZ A;  4TXP A;  3KD7 A;  5EX3 A;  5H7P A;  1L5J A;  1H0A A;  3VLD A;  2VYI A;  1V55 E;  3ESL A;  2BTD A;  2V4L A;  5FWQ A;  4BET A;  5EIL A;  2Y1L E;  2OEW A;  4L1B A;  4F1S A;  4FU3 A;  3E37 A;  3TWW A;  4PS8 A;  1E7U A;  3SF4 A;  4MBG A;  4XIF A;  5LFA A;  1WY6 A;  4I9C A;  3FWV A;  4N5C A;  1SVX A;  4O1P A;  2PQN A;  3SQV A;  2P2C P;  2LUH A;  3CIA A;  3S2A A;  1HF8 A;  2BUG A;  4OAV B;  4U96 D;  3FTS A;  1SZA A;  2GRP B;  3LJ3 A;  4EPZ A;  4GTT A;  3ZYK A;  1P5Q A;  3ONL A;  4NRH B;  4OAU C;  4APO A;  4JC8 A;  3UT4 A;  3WXX A;  4L9P A;  3TWU A;  3W9F A;  3CVV A;  5D0O D;  4TXQ A;  2WQ6 A;  1UOH A;  2YNQ A;  2GRL A;  3D9H A;  3S7J A;  1HH8 A;  4U0S A;  3ULQ A;  2CHZ A;  2UWJ G;  4CZ2 D;  3CHQ A;  3FUH A;  1SW6 A;  2KCK A;  4HRL A;  3S7D A;  1S70 B;  5G04 J;  2Y4U A;  2F8Y A;  1Z3Y A;  4ANW A;  1DCE A;  1H6K A;  3B7U X;  4ZFH A;  4HLE A;  1U3C A;  2NXP A;  5CER B;  2R02 A;  3ZW3 A;  2VSX E;  3Q7F A;  3PUJ A;  3FY4 A;  3MV2 B;  1UN9 A;  1HG2 A;  3Q73 A;  1OUV A;  4L23 A;  1HO8 A;  4UWF A;  4HRM B;  3QB2 A;  1NI1 A;  3G2U A;  4HOT A;  2V5F A;  3D9M A;  3ENE A;  3CKB A;  4G8K A;  1JCR A;  3EDT B;  4G25 A;  4XKC A;  1K8K G;  4GYW A;  3NBN B;  1XNF A;  3MV3 B;  3PNL B;  4YDW A;  4DLQ A;  2V4H C;  3P1U A;  1XGW A;  1H2T C;  3V31 A;  3O48 A;  1FCH A;  3Q4A B;  1OWP A;  2IOS A;  3LXU X;  2WXF A;  3TWT A;  4A3V A;  2XGS A;  5LOZ A;  5C1D A;  3T5X A;  5HKP A;  2C2L A;  5AYW D;  1OCC E;  5JHA A;  1IHG A;  3UQ3 A;  3HHM A;  3QDN A;  3Q9U C;  2HYZ A;  4HFG A;  3FTW A;  4ANU A;  4X8Q A;  2XHE A;  1MQS A;  4G26 A;  5ARG A;  4U8Y D;  3J5Q B;  4YND A;  2CFZ A;  1YA0 A;  2IF4 A;  4WUY A;  2XPY A;  3G2T A;  1FT1 A;  4GZC A;  1Z3X A;  1PY1 A;  3UIO C;  4XI9 A;  2GRN B;  4NAC A;  4AEZ C;  3APF A;  3LJN A;  2P9N G;  1HU3 A;  5DBK A;  4LCT A;  5C2Y A;  4XI0 A;  3N71 A;  3TJP A;  3CVW A;  4GTQ A;  4BER A;  4PS3 A;  5D0Q D;  3JUE A;  4J7W A;  3C3Q A;  5ENN A;  4JHK A;  4DX2 A;  5EIB E;  4HOQ A;  3LVR E;  4U0Z A;  4GTP A;  3RAU A;  5T4Y A;  4B8A A;  1N9A A;  2I2O A;  5HS0 A;  3QC1 A;  4YDY A;  3MKQ B;  2X6I A;  4I9E A;  4XX5 A;  4U07 A;  4O1O A;  1H6O A;  5JJT A;  3RO2 A;  3UM1 A;  3IHV A;  2VJ8 A;  3KEA A;  3TWX A;  4I17 A;  3D9J A;  4J8F A;  3UT8 A;  4AM9 A;  4ZHB A;  3CQG B;  4BSX A;  1N4Q A;  1N4P A;  3B7B A;  1EF1 C;  4L2Y A;  4EBA G;  4GTO A;  1MYO A;  3UM2 A;  3D9I A;  3FUL A;  2MHK A;  2XQ0 A;  1E8X A;  3TG5 A;  4BSZ B;  2CHW A;  3ESK A;  4DX5 D;  4F6R D;  3MA5 A;  5D66 A;  3I5P A;  2YIN A;  2QY7 A;  2WB2 A;  4LG6 A;  5AJD A;  5B1A E;  3SO8 A;  3CK8 A;  4GA0 A;  3TXN A;  3JQ0 A;  3DEO A;  3FTZ A;  4JL0 A;  5AIJ A;  2OVB A;  4UI9 J;  3SBS A;  3UXG A;  2EIN E;  3ZXS A;  3EHM A;  2GRR B;  2GW1 A;  5ENS D;  3OAW A;  5CHE E;  3B95 A;  3TG4 A;  1UG3 A;  2KM4 A;  2X3M A;  3PRE A;  1ZBP A;  4GMJ A;  2H6F A;  3FH8 A;  2RKK A;  3LY9 A;  3VTY A;  3L16 A;  3HXC A;  4BX8 A;  3LYA A;  3ZVV A;  1BU9 A;  1D9S A;  3BG1 B;  2WXG A;  3VTX A;  1N4R A;  3UT7 A;  1UJK A;  3Q15 A;  2WXP A;  3DXM G;  2XCB A;  4GTV A;  2XRZ A;  2J4D A;  4FUL A;  4TXR A;  3LY8 A;  3FUK A;  5BUZ A;  1PC2 A;  2OCC E;  4F7A A;  3HXD A;  2ZXW E;  4ACL A;  4N2S A;  3JYS A;  2XS8 A;  1OCR E;  5AN8 A;  1S64 A;  3QAQ A;  3U9W A;  4RG6 A;  2AXU A;  3DSV A;  2WXR A;  3EHQ A;  3PE3 A;  2V5Q C;  3Q9N C;  1A5E A;  4N3B A;  2XS1 A;  2RD0 A;  2Y0B G;  1IQR A;  4K5A B;  3FHE A;  3UIN C;  4JD2 G;  2IFU A;  2ILR A;  3L13 A;  4K5B A;  3NOG D;  3Q79 A;  3D9O A;  4DX1 A;  2XZD G;  2YQ8 A;  3PRZ A;  3AU5 A;  3R7R A;  4LUN U;  3SNX A;  2XPZ A;  4N5Q A;  2WXL A;  4OVU A;  2XEV A;  2VGY A;  4YVO A;  2QFC A;  4WWN A;  2ZU6 B;  5AEN A;  4J8E A;  1KT0 A;  4GTM A;  2A5U A;  3G2S A;  3JUI A;  1W3B A;  4CT4 A;  3ABM E;  3FUE A;  4EHM A;  2E2E A;  3MX3 A;  4XEI G;  1WDY A;  3FUI A;  5FIO A;  5AAR A;  3CQC B;  3EHR A;  4KYO B;  2ION A;  3JXJ A;  4DPR A;  1TN7 A;  3NZU A;  2ZGG A;  3TWR A;  2FO1 E;  3CHR A;  3TXM A;  3EU9 A;  1KLX A;  4UUC A;  3ZXP A;  2LAH A;  3DPY A;  4GML A;  3ONK A;  2PZI A;  4UWH A;  2WMO A;  3R9A B;  3L82 A;  1ELW A;  2J07 A;  3DSU A;  3I3N A;  3WG7 E;  2LAI A;  3GZ1 A;  4A63 B;  2L6J A;  4WWP A;  2CFU A;  4I6E A;  4WND A;  2EIJ E;  3EUV A;  2Q7F A;  2R2L A;  5AQA A;  2EIM E;  1AP7 A;  1NFI E;  4Q94 A;  1Y6I A;  3ML9 A;  3IXE A;  1D8D A;  3EJN A;  3PH0 C;  4URK A;  3EIQ C;  4GA1 A;  2ETA A;  3TWQ A;  4XZ4 A;  1INZ A;  4EZL A;  1NA0 A;  3TL5 A;  1LD8 A;  3FTV A;  1TEZ A;  3SGH A;  2KC7 A;  2PL2 A;  1OCZ E;  2J49 A;  3AG1 E;  1N54 A;  1DVP A;  2VQ2 A;  4IRU A;  3CHM A;  2P9U G;  4GCO A;  3TAX A;  4GPM A;  1B89 A;  2VGX B;  3ZN3 A;  4AY6 A;  3CEQ A;  1MX4 A;  1NP7 A;  3D9P A;  1UN8 A;  2VGE A;  1HX8 A;  3ASN E;  1K3Z D;  3K9I A;  1N95 A;  1KZP A;  2I1K A;  4XKB A;  1OY3 D;  2BF0 X;  2PM7 A;  3UIP C;  2VSN A;  4OYS A;  4J8Y A;  3Q5M A;  4EQF A;  3CV0 A;  4B94 A;  4GTS A;  1E8Z A;  4TUM A;  3FTY A;  3L54 A;  4LNG A;  4TUU A;  4D10 C;  5LCW J;  1JWF A;  1TR4 A;  3O4Z A;  5IY5 E;  4E85 A;  5CEC B;  1DNP A;  2VGX A;  5LX8 A;  4EZJ A;  4BT8 A;  2LXM A;  3FDH A;  1FVH A;  2P58 C;  1IXV A;  2PNN A;  2M63 A;  2IQC A;  4DI3 A;  3PE4 A;  4OVV A;  5G05 C;  5FQ7 A;  3HG0 D;  5A23 A;  2EQX A;  4HI8 A;  4H7Y A;  4AOF A;  1KT1 A;  4CT0 A;  4GB9 A;  4CDR A;  1TJF A;  5M72 A;  2VSY A;  5KNG A;  4CGW A;  2J9Q A;  1OWN A;  4AP2 A;  2WXH A;  5KWD A;  1K1B A;  3CK9 A;  1JWG A;  1OWO A;  2UY1 A;  5HRY A;  4GU5 A;  3ASG A;  1O1S A;  5DIZ A;  4HLL A;  3D9N A;  3UKU G;  1X81 A;  3AS5 A;  4UWG A;  3C5R A;  3OTN A;  3QK0 A;  3CGH A;  3I4R B;  3FU6 A;  3T8K A;  4LNB A;  3D9K A;  3DSX A;  3HIZ A;  4PUC A;  4Q69 A;  5EDS A;  3C98 A;  3JQ1 A;  2DWZ A;  3TWV A;  1DCQ A;  4U04 A;  4ATZ D;  1RW2 A;  2BKG A;  4AXH A;  2GGF A;  2R5S A;  1E8Y A;  4GTR A;  4M3O A;  3PEV B;  4ATG A;  3BQO A;  5JJ6 A;  1EDU A;  2WXO A;  5JJ7 A;  4J6I A;  3NOC D;  2HE0 A;  4GA2 A;  4JHR A;  5ENQ D;  1MX2 A;  1HG5 A;  1TN6 A;  4P29 A;  2KAT A;  4K03 A;  2NYJ A;  5FIN A;  4YVQ C;  2ZIS A;  4DLO A;  3ISM C;  4ANV A;  1YCS B;  3B13 A;  2C0L A;  1A17 A;  2MYO A;  4K0R A;  2B6C A;  3PUK A;  4AIF A;  2LXL A;  1IQU A;  2Y4T A;  4CRW A;  4YDO A;  3LKU A;  3ZYL A;  3APD A;  4G11 A;  2J08 A;  4HB5 A;  3PZ3 A;  3ZEF A;  4C9B B;  1H6P A;  3LDZ A;  2CG2 A;  2P9K G;  3QWV A;  1Z6T A;  2FBN A;  3DWL G;  2WXM A;  3NAW A;  1HZ4 A;  1V54 E;  5CBN A;  1BI8 B;  3PZD A;  3FU0 A;  2ETC A;  1HE8 A;  4C48 B;  2C0M A;  4FP7 A;  2F8X K;  3KAE A;  1N11 A;  3LVQ E;  1HS6 A;  1QNF A;  3MEK A;  5KNH D;  2QZA A;  3V2X A;  4GZD A;  3PNT B;  5KJK A;  1LD7 A;  3SFZ A;  3CSF A;  3CST A;  3DSW A;  3T8M A;  1FVF A;  2BKK B;  5J90 A;  4J8S A;  4JB8 P;  1U3D A;  3LS8 A;  3TGO A;  2R03 A;  2OVF A;  1UJJ A;  3U4T A;  3ASH A;  4U0U A;  4L7T A;  5G04 C;  4TRQ A;  3UPV A;  2GRM A;  5T8I A;  3OXG A;  2WQH A;  2QYJ A;  3BUA A;  5KCM A;  5AQB A;  3X2Q E;  4U8H A;  5BT1 A;  2PQR A;  3B7T A;  4GAA A;  3EHN A;  3ASD A;  1MZC A;  2X6K A;  1JCS A;  3E30 A;  4JA7 A;  5CRU A;  2IO2 C;  2VSO E;  2L0I A;  3QKY A;  1WAO 1;  3RK6 A;  4JW1 A;  4FJY A;  5HI7 A;  3C72 A;  4C0M A;  3PZ4 A;  2F37 A;  3GW4 A;  3AS4 A;  1IKN D;  2R17 C;  3UMV A;  3ZIM A;  3RU0 A;  2KZT A;  1Z5S C;  3RJV A;  4K5C A;  4MRU A;  3CHO A;  3G2W A;  5EN5 D;  2DIW A;  4GZ5 A;  4RG9 A;  1O5M A;  1E7V A;  4XE0 A;  3ZHE A;  1H2U A;  3RRU A;  4KT6 B;  1O1T A;  2YHC A;  4Y6C A;  1S0P A;  4HOR A;  3QWW A;  2J09 A;  5FZS A;  3DEP A;  1DC2 A;  4QQI A;  3IHY A;  2Y69 E;  4HXI A;  4LNU D;  3CHS A;  3UI2 A;  2QYU A;  5CED B;  3BG0 B;  2CHX A;  2P9L G;  5CEA A;  3FUM A;  1HFA A;  4EEC A;  1TNY A;  2MRI A;  4IYP A;  4BTA A;  5CBO A;  3FUN A;  1OT8 A;  2AXV A;  1H19 A;  4LER A;  3U66 A;  1TNZ A;  1D8E A;  1TNB A;  3B7S A;  3AAA C;  3ASF A;  4FHK A;  1QZ2 A;  5J08 A;  3F6Q A;  3I4G A;  1MJ0 A;  2IO3 C;  3B7R L;  3RKV A;  3RO3 A;  1TN8 A;  3AJI A;  4GMR A;  3DRA A;  3OXF A;  3Q47 B;  3DBS A;  5KJM A;  2RG8 A;  5FQ4 A;  3CVL A;  1K1A A;  2WXQ A;  1RZ4 A;  3SZ7 A;  5BW8 C;  3IEG A;  4Z68 A;  4UI9 K;  4CGV A;  3D3M A;  4I43 A;  3V2O A;  5EID A;  5JA4 D;  3CVU A;  1OWL A;  2X6J A;  3JXI A;  3DST A;  4IN3 B;  1N4S A;  2FI7 A;  2AXZ A;  2KCL A;  1GW6 A;  2DCP A;  3L9T A;  5CMY A;  1PAQ A;  3D9L A;  3AU4 A;  3FFL A;  4UWL A;  2WXI A;  4WWO A;  4I6G A;  4MS6 A;  3C3R A;  3OXL A;  4UQX A;  3GZS A;  4YDE A;  4JXT A;  3ZKJ A;  4I1O B;  1AWC B;  3HYM B;  3DXK G;  2J8S D;  1UW4 B;  3U3W A;  4DX6 D;  4ILI A;  3PVL A;  2LO6 A;  2ETB A;  3PZ2 A;  2IU1 A;  2XZT G;  3TWS A;  4F3V A;  3MJW A;  1WG0 A;  2DZN A;  3MZL B;  1H2V C;  2DVW A;  3KS2 A;  5KBA A;  1JUQ A;  1QBQ A;  1U2V G;  4RSY A;  2LSU A;  4FA6 A;  3V79 K;  4J8D A;  2V8S E;  3V30 A;  2WMN A;  4NQ0 A;  4WNF A;  5FJY A;  5BXU A;  4W9R A;  5FTP A;  3PS6 A;  3HDX A;  4B0Z A;  2PM6 A;  3CVP A;  1Q2Z A;  3HRA A;  2XPI A;  3IBE A;  4UI9 C;  3J5P A;  2X6H A;  1OCO E;  3R7Q A;  4GPK A;  2RFA A;  3SFX A;  4DK5 A;  3FH5 A;  4NUR A;  4UQZ A;  3VLE A;  5G2N A;  4KVM A;  1WM5 A;  3T5V A;  2WPV A;  2KXP C;  3IKO B;  5CRV A;  2IY0 C;  4GCN A;  2FUL A;  3SY2 A;  4V3I A;  3L17 A;  3Q7A A;  5KJL A;  2CG3 A;  3CVQ A;  3MGB A;  1MX6 A;  4KXK B;  2QC9 A;  4N3C A;  4LEU A;  4DX7 D;  3Q75 A;  4JEH A;  5B1B E;  3LEW A;  3E34 A;  5BPP A;  3ML8 A;  3ULY A;  1ZB1 A;  3RRM B;  1TYQ G;  2UY1 B;  4KVO A;  4ACK A;  2MOW A;  3ABL E;  1N0R A;  4CDN A;  4O60 A;  4GYY A;  3FU3 A;  5EYP F;  4G8L A;  2KBX A;  1LF8 A;  3E33 A;  5A7D B;  3CVN A;  3ABK E;  2V0P A;  2YHE A;  1ELK A;  3EIJ A;  5AQ9 A;  2WQ7 A;  3HXE A;  5EKQ D;  2H6G A;  4HRN A;  2XEH A;  3GYZ A;  3FTU A;  3VLF A;  3DPD A;  3EU5 A;  2WXK A;  3FH7 A;  1SA4 A;  5ENR D;  1YMP A;  1ZU2 A;  2XEN A;  4WNG A;  5ANR A; 
#chains in the Genus database with same CATH homology
 2AJA A;  3TWU A;  2RFM A;  3KEA A;  3TWX A;  1BI8 B;  1OY3 D;  3T8K A;  3ZU7 B;  3W9F A;  4LSZ E;  3EU9 A;  2ETC A;  4UUC A;  4C48 B;  3TWT A;  5ENT D;  3ZKJ A;  4J8Y A;  4ZHB A;  3W9G A;  5ITZ F;  2F8X K;  1N11 A;  5AQ7 A;  1AWC B;  2DWZ A;  3DEP A;  1DCQ A;  3B7B A;  3TWV A;  1DC2 A;  2J8S D;  4QQI A;  1UOH A;  3T9K A;  4ATZ D;  4LNU D;  2BKG A;  3UI2 A;  4DX6 D;  4U8V D;  3D9H A;  5KNH D;  3V2X A;  5CED B;  4TUM A;  1MYO A;  1G3N B;  5AN8 A;  3TWR A;  5HKP A;  3UTM A;  5CEA A;  1MX6 A;  2ETB A;  2QC9 A;  4QFV A;  4DX7 D;  5CBO A;  4CZ2 D;  3EHQ A;  1OT8 A;  4HI9 A;  1TR4 A;  4A63 B;  1SW6 A;  2XZT G;  2BKK B;  3NOC D;  2HE0 A;  4BSZ B;  2L6B A;  4CYM D;  4HBD A;  3Q9U C;  3TWS A;  4HRL A;  5ENQ D;  1MX2 A;  1S70 B;  4RLY A;  4DX5 D;  4F6R D;  1WG0 A;  5CEC B;  2V5Q C;  2F8Y A;  5D66 A;  2DZN A;  3Q9N C;  4BES A;  1A5E A;  2NYJ A;  5FIN A;  3ZUV B;  4JB8 P;  2Y0B G;  2DVW A;  2JAB A;  4LG6 A;  5AAO A;  4K5A B;  4U8Y D;  3SO8 A;  4ZFH A;  3J5Q B;  5AQA A;  5KBA A;  3AAA C;  1YCS B;  4K5B A;  5CER B;  3DEO A;  2PNN A;  1IXV A;  1AP7 A;  1NFI E;  3NOG D;  3F6Q A;  1IHB A;  2KXP C;  2MYO A;  4DX1 A;  1MJ0 A;  2XZD G;  2DZO A;  3LJN A;  4BEP A;  5ENO D;  4DUI A;  1BD8 A;  3V79 K;  3IXE A;  3V30 A;  3UXG A;  4BET A;  3HG0 D;  5EIL A;  2Y1L E;  2ETA A;  2QYJ A;  5BXU A;  3AJI A;  4GMR A;  5JMN D;  5ENS D;  3TWW A;  3TWQ A;  1N0R A;  5AQB A;  4HI8 A;  4O60 A;  5EYP F;  4G8L A;  4BER A;  4N5Q A;  3B95 A;  3JUE A;  4HRM B;  2KBX A;  1N0Q A;  5KNG A;  1K1A A;  4J7W A;  5BXO A;  1SVX A;  1K1B A;  5KWD A;  4DX2 A;  3HRA A;  5EIB E;  4O1P A;  4F1P A;  3J5P A;  2B0O E;  4Z68 A;  2A5E A;  5AQ9 A;  4HQD A;  2F37 A;  5HRY A;  4HB5 A;  4HRN A;  4B93 B;  4G8K A;  2XEE A;  2P2C P;  2XEH A;  5HS0 A;  2RFA A;  1BI7 B;  3V2O A;  5EID A;  5JA4 D;  3NBN B;  1IKN D;  4DRX E;  1QYM A;  4GPM A;  3JXI A;  4HNA D;  4OAV B;  4U96 D;  4YDY A;  4NIK A;  5EYL A;  4K5C A;  1MX4 A;  1WDY A;  4HLL A;  5FIO A;  1BU9 A;  5AAR A;  4YDW A;  3EHR A;  1D9S A;  5ENP D;  2V4H C;  3ZNG A;  1BLX B;  5ENR D;  5EN5 D;  4O1O A;  3C5R A;  2VGE A;  3JXJ A;  1YMP A;  2XEN A;  4U95 D;  3V31 A;  1K3Z D;  1YYH A;  4OAU C;  2ZGG A;  5CBN A;  2FO1 E;  2ZGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...