5ENQD

Mbx3132 bound structure of bacterial efflux pump.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
162
structure length
162
Chain Sequence
HHHHHHGSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug efflux pump subunit AcrB,Multidrug efflux pump sub
publication title Molecular basis for inhibition of AcrB multidrug efflux pump by novel and powerful pyranopyridine derivatives.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transport protein
total genus 51
structure length 162
sequence length 162
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2015-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5enqD00
5KNHD 4DX7D 4K5BA 1IHBA 2F8YA 3TWRA 5ENQD 1DC2A 1MJ0A 2B0OE 1MX4A 2BKGA 5EILA 4JB8P 2F8XK 4U8VD 3V2OA 5ENTD 4YDYA 4HQDA 3SO8A 3ZKJA 1WDYA 3NBNB 4F1PA 2JABA 4LSZE 1SVXA 2MYOA 2V4HC 5EIDA 4U8YD 3DEOA 1G3NB 4C48B 3JXJA 1DCQA 3C5RA 3TWXA 3EHRA 3V2XA 3V30A 2VGEA 4TUMA 4HRLA 3W9FA 1N0QA 1K1BA 4G8KA 2L6BA 3V31A 5KBAA 5AAOA 5JMND 1AWCB 4OAVB 1A5EA 1K1AA 2KXPC 2Y1LE 1YYHA 3UI2A 2RFAA 2XENA 3Q9NC 2J8SD 4O1OA 2V5QC 2ZGDA 2DZNA 3LJNA 4LNUD 1NFIE 5EN5D 3JXIA 5BXUA 5CECB 3B7BA 2QC9A 4J8YA 4O1PA 2XEEA 4YDWA 4HRNA 4DX2A 2A5EA 1BLXB 3D9HA 4GMRA 5HS0A 5BXOA 5HKPA 4DRXE 5ENOD 1MX2A 4K5AB 5ENRD 4O60A 5EIBE 1SW6A 4UUCA 2P2CP 2PNNA 3TWVA 4BSZB 3EHQA 1TR4A 2RFMA 3TWWA 1OY3D 5D66A 4GPMA 4QFVA 4BERA 2KBXA 4ATZD 3UTMA 2BKKB 1UOHA 1D9SA 4F6RD 2NYJA 1OT8A 3F6QA 4QQIA 5KNGA 1S70B 3KEAA 4RLYA 4HB5A 3ZUVB 3HG0D 3NOGD 2FO1E 1BD8A 3IXEA 4G8LA 4U95D 3UXGA 3ZNGA 5CBNA 1MX6A 2ZGGA 5AN8A 2XEHA 3J5PA 5AARA 2DZOA 2XZDG 4BESA 3EU9A 5ITZF 5CERB 5AQBA 1QYMA 4NIKA 3JUEA 5EYPF 4OAUC 2DVWA 5FINA 2AJAA 4Z68A 2ETBA 3TWTA 4B93B 3B95A 3T9KA 2HE0A 5EYLA 1N11A 1IXVA 2ETAA 1YCSB 4HNAD 4HI8A 5CBOA 4CZ2D 4K5CA 3AAAC 4HBDA 5ENPD 3J5QB 1YMPA 4DX1A 3HRAA 4BETA 4DX5D 4U96D 3T8KA 2Y0BG 1BU9A 4LG6A 2DWZA 5AQ9A 4N5QA 3Q9UC 4DUIA 1N0RA 4HI9A 3NOCD 4ZFHA 4J7WA 5FIOA 3TWUA 5HRYA 5KWDA 4BEPA 1AP7A 5CEDB 4A63B 1MYOA 1WG0A 3AJIA 2F37A 1BI8B 4CYMD 3TWQA 3DEPA 2QYJA 1BI7B 1IKND 5AQ7A 4DX6D 1K3ZD 4HRMB 3TWSA 3W9GA 3V79K 4HLLA 2XZTG 5CEAA 5AQAA 5JA4D 2ETCA 5ENSD 3ZU7B 4ZHBA
chains in the Genus database with same CATH superfamily
3LCAA 2LO6A 1H2TC 1OWMA 4F53A 1N4SA 2YHCA 3HXBA 3V2OA 2VJ8A 3SO8A 3UINC 2CFZA 4LSZE 4GTOA 4N3BA 1D8DA 3CQGB 4U8YD 4CRWA 3V30A 2OOEA 3W9FA 4DLQA 4YNDA 3CLJA 2AXUA 1A5EA 1U3CA 1E7VA 2VQ2A 5B1AE 2JLBA 2LNIA 3Q9NC 3L54A 1JCRA 3DSSA 3G2UA 3ML8A 4MS6A 3SBTB 1BPOA 2C2LA 3QOUA 4M3OA 1NZNA 2WXGA 3DXMG 4F6RD 4HOSA 1DCEA 2R05A 3VLFA 5BNWA 1HF8A 2MRIA 3O48A 5T3RA 1MX6A 3Q5MA 5AN8A 1RZ4A 3EU9A 5ITZF 3UUXA 2VTBB 4IULA 4ME2A 2ETAA 4WWOA 1IQUA 3R9MA 4GTVA 3OXGA 4LG6A 1JUQA 3U66A 3TWUA 4HVBA 5T4YA 3ONLA 2QYJA 3E37A 1B89A 4HRMB 4RG9A 1UW4B 3V79K 2X6KA 4AXHA 3ABKE 1FVHA 4GTTA 4K0RA 4UQYA 3T8MA 3ZEFA 5EIDA 3CK7A 5KJNA 5B3SE 1JWGA 3ZYQA 3FTZA 4XKCA 1PAQA 4N2SA 4WWNA 3QAQA 3ZXPA 3UPVA 2P9SG 3IKOB 2VYIA 3PEVB 3G2SA 4PUCA 4O1PA 4YDEA 4U0ZA 4EZLA 4RVBA 4PS7A 1NL4A 3U9WA 4O60A 2PNNA 2V4LA 3NQPA 5DIZA 3HIZA 1KZOA 3I5PA 4JEUA 3MEKA 4L2YA 4KBQA 3BQOA 2XPZA 1UOHA 4MRUA 3MKQA 4N3AA 4I2ZA 3MV2B 3ESLA 4HB5A 3APDA 4XX5A 3NOGD 2FO1E 3DWLG 3PZDA 3CKBA 1O1SA 3FTUA 4U0UA 4BFRA 2BTDA 3T9KA 1N11A 3PDNA 2E2EA 3JUIA 3E30A 3PRZA 3FUMA 4WNDA 3Q9UC 3UT7A 4DPRA 2A4ZA 5LCWC 1RW2A 2L0IA 4TRQA 2LAHA 2ZU6B 5DBKA 5ENNA 4GA1A 1HXIA 4GB9A 5ENSD 1HU3A 3ASFA 3HXFA 3E33A 2UY1A 4LUNU 2KCLA 3Q7AA 3L6AA 3RJVA 5LFAA 2XS1A 4KT6B 3V2XA 2VGEA 4JHRA 1UN8A 2FI7A 3IV0A 3PE4A 4UQXA 4XEIG 3T5VA 1S63A 2EIME 1NFIE 5EN5D 4I6GA 3L13A 4ILHB 3B7BA 2QC9A 2I1JA 4ACKA 4MBGA 4HRNA 1OWPA 2AXVA 4GMRA 1OCOE 1LTXA 2J08A 1V54E 4PH4B 4CDNA 4U7EB 1OT8A 2X6HA 1LD7A 3FEXA 1IYGA 3IXEA 4UI9K 2XRZA 4E6HA 4MLPA 5E76A 1ZU2A 3CV0A 4WWPA 4GMJA 3UM3A 4JEHA 5CBOA 2YHEA 2XGSA 1TNUA 1OWOA 3DPYA 2X3MA 1FVFA 4HOUA 4G2VA 3Q15A 5JJ6A 5AQ7A 2WXQA 2VSXE 3O4ZA 5J08A 4U8VD 3FP3A 3EIQC 2RG8A 1SZ9A 2C0LA 3NAWA 3C5RA 3E32A 3RO2A 1QNFA 4GTSA 3AG2E 3UI2A 3Q7FA 2J8SD 5LP0A 3D9KA 1QBQA 5CECB 3ASDA 2RKKA 2IU1A 4BSZB 3BG0B 3KEZA 3EHQA 4XKBA 1HE8A 3I4RB 3ASGA 3OXFA 5EX0A 5G04C 3F6QA 5KNGA 1OWLA 3KEAA 4RLYA 4U95D 1Z6TA 1E8WA 2J9QA 3TL5A 4CGVA 3QDNA 1TNBA 2NSZA 4UI9C 3AG4E 4K5CA 3EUVA 4JL0A 1HFAA 2QYUA 4CDRA 4WAFA 1YA0A 1MQSA 4C0MA 2XGMA 4DUIA 3PREA 3D9JA 3ZHEA 5FTPA 5FIOA 1WG0A 4AY6A 4CYMD 3LS8A 2XQ0A 3SHFA 3APCA 3TWSA 4LERA 5J90A 3DSUA 1E8XA 2GROB 5EDSA 2ETCA 3MKRA 4B0ZA 1H2UA 4GTPA 4KVOA 3ZPJA 5LCWJ 1TN7A 2V4HC 1OCCE 2XCCA 4LNBA 2QZAA 4GCOA 3CK9A 1NI1A 4I43A 3WXXA 1TNZA 3FH7A 2XENA 4ANWA 2KZTA 1ELKA 3LJNA 3QJZA 5JHAA 4XI9A 2V5FA 1FT2A 3ONKA 4UQZA 5C2YA 4YDWA 3VLDA 1GW6A 4DRXE 4E85A 5ENOD 3G2WA 1SW6A 5FQ4A 3ZN3A 3ZIMA 4U07A 4J0UA 2KBXA 3Q49B 3UTMA 2FF4A 3FUDA 3UXGA 3FH8A 3HXEA 4F1SA 5AARA 1IHGA 4ANXA 3SF4A 5FINA 4R7LA 5A23A 3CIAA 5BPPA 4TXQA 5BV0A 3PE3A 4DX1A 3DPDA 2IOLA 4DLOA 5H7PA 2YINA 3AU5A 4EZJA 2ILRA 4ABNA 5KWDA 5HRYA 2GRNB 5G2NA 3ZRHA 2NXPA 1TJFA 3FHEA 5KNHD 3PNLB 3LY8A 1N52A 4ANVA 3EJNA 4JD2G 4Q96A 3ZKJA 4AIFA 4DK5A 3BG1B 5CHEE 1HO8A 5LOZA 4EECA 4O6FA 2V8SE 5FQ6A 3V31A 1AWCB 4OAVB 2WMNA 1KT0A 1KT1A 4A3TA 1H19A 2YNQA 2FBNA 3C72A 3EHNA 4KVMA 5AJDA 4UUCA 4YDOA 4GPMA 4I6EA 2EQXA 2FO7A 2IY0C 2WXNA 1HH8A 1S64A 3UM1A 4GAAA 4KYOB 2J09A 3SFXA 2L6JA 1Z3YA 1SQMA 2I6HA 3PH0C 3X2QE 3ZNGA 4GCNA 4OVVA 4UWFA 3HVEB 4XIFA 3I3NA 4GTRA 1ZBPA 3SFZA 3L17A 4J8FA 1OXJA 1QZ2A 5EKQD 4U96D 2P58C 2Y0BG 3FTYA 5AQ9A 4WNGA 5G04J 1N0RA 4KMOA 3UMVA 2OEWA 3ZXSA 1XGWA 4A63B 3FUKA 4J6IA 4JA9A 4HLLA 2ZIRA 2IONA 4UI9J 1IHBA 2F8YA 1MJ0A 4J8EA 5EILA 4JB8P 4U04A 3OAWA 2PQNA 4D10C 1DNPA 4C48B 3EHRA 3LVRE 4G8KA 3AG1E 3C3OA 3B7SA 5AAOA 3LDZA 4APOA 2HO1A 3D9MA 2Y1LE 1PC2A 5BXUA 3ASOE 3KSQA 3RK6A 1TYQG 4L2LA 5KCMA 2P2CP 4UWGA 2QFCA 3FUNA 3FUFA 4XE0A 3UIPC 4ATZD 4WUYA 2AVPA 2Y4UA 5A6CA 3U64A 5CCLA 3FY4A 2PZIA 3E4BA 4J8DA 2JEKA 1U2VG 2RD0A 4OAUC 4GZCA 1TEZA 3UT8A 2P9KG 1VDYA 3DSXA 3DSWA 2CFUA 4CGWA 2P9LG 3FUJA 3LY9A 3FUEA 4C0EA 3LVQE 3LJ3A 2VGXA 4CEMA 1BU9A 2DWZA 1UJJA 5AJLA 4J7WA 1AP7A 4BEPA 1TNYA 1H2VC 3TWQA 2MOWA 2XZTG 3L22A 5EYLA 1W3BA 4K5BA 1FCHA 4I2WA 2BKGA 2F8XK 3OTNA 3P1UA 5ENTD 3NBNB 4IYPA 4L9PA 1Z5SC 1N0QA 4FU3A 4PS8A 5CCMA 3UQ3A 1YYHA 2X6FA 5FQ8A 1SZAA 3SY2A 1Y6IA 5AIJA 4J8YA 1TJCA 3FU6A 1BLXB 5HKPA 4GZ3A 3FWVA 4XZ4A 5EIBE 2MHKA 2FULA 3QNKA 5FZSA 4QFVA 3ZYLA 2AW6A 4X8QA 4Y6WA 3ZYMA 4EZKA 4GTQA 1P5QA 2DZOA 2XZDG 4G1TA 3EIJA 2WPVA 4UWHA 5EYPF 3ISMC 3CVWA 1EPUA 3CHPA 3EDTB 5FQ7A 2WQ6A 3HDXA 3HRAA 3T8KA 2EIKE 2WQHA 3Q79A 4HFGA 3ULEG 3JYSA 4N5QA 3ABME 4DI4A 5CEDB 1MYOA 3UKRG 1KLXA 2H6FA 4DX6D 2NC9A 3LY7A 1E7UA 4OVUA 3QB2A 3LXUX 2WXHA 3UX4A 4N39A 2J4BA 3KD7A 1LD8A 2VTBA 4KZ0A 2JABA 2MYOA 2CG2A 4TUMA 2ZXWE 3PZ2A 1K1BA 5KBAA 3QWVA 2EILE 4AJWA 4JC8A 5KJKA 4M7CA 2R59A 3UM0A 5ANRA 2ZGDA 2WXMA 3RRNB 3CVUA 1E8ZA 1OCRE 1D8EA 5BXOA 1IQRA 3ESKA 3TWVA 4Y6CA 3TG5A 3PZ3A 3TWWA 3TXNA 3EU5A 4K03A 4U8HA 1INZA 3PEUB 4NURA 1D9SA 2LAIA 3CHMA 4GTMA 4F7AA 1U3DA 5CBNA 2XEHA 5CERB 4EBAG 5M72A 2AJAA 3TWTA 3RSEG 2HE0A 1NA0A 4JVSA 3CVYA 4HI8A 3MJWA 5KJLA 3FTWA 3CVLA 3ENEA 4G23A 3FH5A 1H6KA 1ZB1A 4NQ0A 3S7BA 3D3MA 3RIBA 2LXMA 3LKUA 1FPPA 1N4PA 3FTXA 4JA7A 5G05C 4AEZC 4L1BA 4LRZA 5CEAA 4JW1A 3VTXA 2BUGA 5AQAA 4NRHB 1N95A 4N2QA 3L08A 1DC2A 3DBSA 2YQ8A 5E75A 3Q78A 4CT4A 4GA2A 1X81A 1E90A 4DJAA 3RU0A 4G11A 1N4QA 4BT8A 3SFYA 4I9EA 2WB2A 2CHWA 2WVIA 3RAUA 4AP2A 2ONDA 1Q2ZA 3CVNA 3JXIA 3NB2A 3CR3A 3G2TA 3D9OA 1N94A 2KCKA 3Q4AB 5AYWD 2IO3C 1V55E 4YVOA 3MCXA 1SA5A 2PM6A 3BEEA 3SBSA 2CG3A 2E0IA 2HM8A 3AS5A 3CVVA 4N3CA 4LNGA 4ILGA 2OVFA 4BESA 4NIKA 4WNFA 3DSVA 4P29A 4GA0A 1IXVA 3RKVA 3FFLA 3PVLA 4CDMA 2M63A 1YMPA 1EYHA 2XS8A 4HI9A 4EBAA 4ZFHA 4FADA 4JPSA 4B8AA 3NZSA 3ZVVA 3FEYA 4EQFA 5G55A 5BV1A 1BI7B 1K3ZD 2BEDA 4I6JA 2DCPA 4FJYA 2P9PG 3FUIA 3IHVA 3PUKA 2X6JA 2I9CA 1MX4A 3MKQB 4TUUA 1SVXA 2P9UG 3GYZA 4J8SA 4GZ6A 2WXOA 2Q7FA 3AS8A 1QQEA 4HRLA 4UWLA 3MV3B 3D9IA 3G2VA 3B7TA 4I1MA 3U4TA 1K8KG 2DYSE 1JCSA 1E96B 4GYYA 3SGHA 1LF8A 4NACA 1L5JA 3AU4A 2DYRE 1TR4A 3C98A 2XGOA 1WM5A 2H6GA 3GZ2A 2CHZA 2BKKB 3FULA 1OWNA 5ARFA 4TXRA 3B13A 3UT4A 3Q73A 1EF1C 3ZUVB 3LPZA 3TAXA 3CHSA 4G24A 2UY1B 2L0TB 2DVWA 3IHYA 3R7RA 3URZA 5D0OD 4HS2A 3GZ1A 3RRUA 4HLEA 1H6PA 3I4GA 3J5QB 2QY7A 5CRVA 4FLHA 2I1KA 3T5XA 3DSTA 4BTAA 5CMWA 5AENA 1FT1A 3DEPA 1KZPA 1IKND 4FC8A 4A3VA 1N9AA 3QC1A 4N5CA 3PS6A 1O5MA 3ZGQA 3MYVA 1TN8A 3PNTB 4Q94A 1WY6A 4YVQC 2L9BA 4BSXA 2LXLA 4JHJA 3DEOA 2BF0X 5BUZA 3P2BA 2GRRB 2AWIA 2WXRA 5G05J 2V5QC 4TV3A 2WXPA 4LNUD 1TN6A 3CGHA 5KJMA 5FZQA 4JHKA 1TNOA 1KPSB 3L82A 2R02A 4JZYA 2IQCA 5ENRD 4AM9A 4W9RA 1UN9A 3GZSA 4BERA 2KCVA 4FJZA 3KAEA 4EHMA 2R03A 1HX8A 5HQ8A 2GRQB 5D2MC 2KATA 3FTSA 3HG0D 4GMLA 4OYSA 4G8LA 4KXKB 4HOTA 3VTYA 3JUEA 3CK8A 4UWKA 3L9TA 5JJTA 2GRPB 2IO2C 3U3WA 1H0AA 3HHMA 5T8IA 4HNAD 2GW1A 1XNFA 2R5SA 3CHOA 1O1RA 5ENPD 3S7DA 3EHMA 1ELWA 1O1TA 4I1AA 4APFA 5BW8C 3S2AA 2F37A 1BI8B 2F0YA 2GRLA 3AG3E 4URKA 4WNEA 3BU8A 2WXFA 1Y8MA 1UJKA 2XHEA 4H7XA 3FU0A 3S7JA 3CVXA 5IY5E 4HORA 5HI7A 1X5BA 2IFUA 3B7UX 4HQDA 1WDYA 4ANUA 2Y69E 3TWXA 4L23A 1HS6A 3NZUA 3TG4A 4H7YA 1K1AA 1OCZE 5B1BE 1JCQA 3MGBA 2I2OA 3Q75A 2DZNA 2ZISA 4HXIA 1OUVA 4GU5A 3ZFWA 2A5EA 5HS0A 3IEGA 3ZHEB 2WXLA 3KS2A 4RQIA 3CHRA 2WQ7A 4ACLA 4ATGA 4BWRA 5FWQA 3CVQA 3KSLA 2Y3AA 5LX8A 4CT0A 3J5PA 5FJYA 2ETBA 3CEQA 3PZ1A 2LUHA 4XI0A 3UIOC 2H6HA 4G25A 4AY5A 3SNXA 2KZTB 2OEVA 2H6IA 3AJIA 1Z3XA 3LYAA 4BX9A 3LEWA 5D0QD 4IRUA 1MZCA 1PY1A 4FHKA 3ZU7B 3FTVA 4IN3B 3HXCA 2B0OE 5BT1A 3QWPA 3ZYKA 3HVEA 2J07A 4YDYA 2UWJG 2B6CA 1G3NB 2OCCE 4BTBA 4BX8A 4U0SA 5CRUA 4LCTA 3QWWA 3SZ7A 4AOFA 3C3QA 2HYZA 4O1OA 4BY6A 3ZW3A 2CHXA 4MKTA 3CQCB 3DRAA 5A7DB 2XEEA 4TXPA 3WG7E 3B7RL 4A1GA 3E34A 2IEJA 2PQRA 1MX2A 2WMOA 1OY3D 2Y4TA 4PS3A 4GZDA 3PZ4A 3FU3A 3FDHA 2WM9A 4ILIA 3AS4A 4V3IA 3SQVA 2J49A 3HYMB 4GZ5A 3MA5A 3CKCA 2FEZA 3S7FA 3BUAA 5ANLA 3RRMB 1E8YA 4HBDA 4FP7A 3MX3A 3UM2A 4DX5D 3FU5A 3GW4A 3ULQA 4PDXA 2EINE 2KM4A 2DIWA 2J4DA 5JJ7A 3TGOA 1JPLA 3D9PA 2DBAA 3RO3A 3MZLB 4ZHBA 4DX7D 3JQ1A 4L7TA 3TWRA 4FA6A 2P9NG 2AXZA 2VSOE 3TXMA 4Q69A 3PUJA 1DCQA 5FZRA 4DI3A 3SI5A 5JMND 2VSNA 4C9BB 4B8CB 2KXPC 4A1SA 2IF4A 1S0PA 3JQ0A 2VGYA 1JWFA 4G26A 3NF1A 3APFA 3ASNE 4K5AB 2RFMA 5D66A 3ML9A 2WXJA 3R7QA 2P9IG 2NYJA 1N54A 2GRMA 1A17A 3Q47B 4QQIA 2OV8A 3C3RA 2HR2A 4BT9A 3OXLA 2IOSA 2R17C 3ULYA 4EPZA 1NA3A 4I1OB 1DVPA 3UKUG 1HG2A 5AQBA 1QYMA 2OVBA 2PM7A 2GGFA 3IBEA 4FLBA 4I17A 5EX3A 3B95A 4A55A 4HOQA 1ELRA 2V0PA 4CZ2D 2WXKA 3CVPA 3AAAC 1HZ4A 2IJGX 3FUHA 3L16A 2XCBA 2PL2A 2R2LA 2XRYA 1WAO1 2KC7A 4RG6A 1H6OA 5ENQD 3SD5A 1HG5A 4AVXA 4F1PA 3CHQA 3JCKC 5JHBA 4GPKA 3ABLE 3JXJA 4B94A 3CSTA 4U63A 4KZCA 2LSUA 2L6BA 3D9LA 2XPIA 3CSFA 3R9AB 2RFAA 2VSYA 3QK0A 3D9NA 2XPYA 1N4RA 2VGXB 5ARGA 2A5UA 4DX2A 3D9HA 2WXIA 3QKYA 1SA4A 4F3VA 4B89A 4LEUA 2X6IA 4GYOA 4RSYA 2X38A 1S70B 3VLEA 1BD8A 2EIJE 2ZGGA 4FULA 3ASHA 4JXTA 2LSVA 2XEVA 4Z68A 4B93B 3K9IA 3QARA 4I9CA 1YCSB 3N71A 3TJPA 1UG3A 4BETA 4AV7A 5FT9A 4CCAA 3NOCD 3HXDA 5CMYA 2C0MA 1MHQA 1EDUA 3W9GA 4GYWA 1NP7A 4FHJA 3DXKG 5JA4D 5C1DA
chains in the Genus database with same CATH topology
5KNHD 4DX7D 4K5BA 1IHBA 2F8YA 3TWRA 5ENQD 1DC2A 1MJ0A 2B0OE 1MX4A 2BKGA 5EILA 4JB8P 2F8XK 4U8VD 3V2OA 5ENTD 4YDYA 4HQDA 3SO8A 3ZKJA 1WDYA 3NBNB 4F1PA 2JABA 4LSZE 1SVXA 2MYOA 2V4HC 5EIDA 4U8YD 3DEOA 1G3NB 4C48B 3JXJA 1DCQA 3C5RA 3TWXA 3EHRA 3V2XA 3V30A 2VGEA 4TUMA 4HRLA 3W9FA 1N0QA 1K1BA 4G8KA 2L6BA 3V31A 5KBAA 5AAOA 5JMND 1AWCB 4OAVB 1A5EA 1K1AA 2KXPC 2Y1LE 1YYHA 3UI2A 2RFAA 2XENA 3Q9NC 2J8SD 4O1OA 2V5QC 2ZGDA 2DZNA 3LJNA 4LNUD 1NFIE 5EN5D 3JXIA 5BXUA 5CECB 3B7BA 2QC9A 4J8YA 4O1PA 2XEEA 4YDWA 4HRNA 4DX2A 2A5EA 1BLXB 3D9HA 4GMRA 5HS0A 5BXOA 5HKPA 4DRXE 5ENOD 1MX2A 4K5AB 5ENRD 4O60A 5EIBE 1SW6A 4UUCA 2P2CP 2PNNA 3TWVA 4BSZB 3EHQA 1TR4A 2RFMA 3TWWA 1OY3D 5D66A 4GPMA 4QFVA 4BERA 2KBXA 4ATZD 3UTMA 2BKKB 1UOHA 1D9SA 4F6RD 2NYJA 1OT8A 3F6QA 4QQIA 5KNGA 1S70B 3KEAA 4RLYA 4HB5A 3ZUVB 3HG0D 3NOGD 2FO1E 1BD8A 3IXEA 4G8LA 4U95D 3UXGA 3ZNGA 5CBNA 1MX6A 2ZGGA 5AN8A 2XEHA 3J5PA 5AARA 2DZOA 2XZDG 4BESA 3EU9A 5ITZF 5CERB 5AQBA 1QYMA 4NIKA 3JUEA 5EYPF 4OAUC 2DVWA 5FINA 2AJAA 4Z68A 2ETBA 3TWTA 4B93B 3B95A 3T9KA 2HE0A 5EYLA 1N11A 1IXVA 2ETAA 1YCSB 4HNAD 4HI8A 5CBOA 4CZ2D 4K5CA 3AAAC 4HBDA 5ENPD 3J5QB 1YMPA 4DX1A 3HRAA 4BETA 4DX5D 4U96D 3T8KA 2Y0BG 1BU9A 4LG6A 2DWZA 5AQ9A 4N5QA 3Q9UC 4DUIA 1N0RA 4HI9A 3NOCD 4ZFHA 4J7WA 5FIOA 3TWUA 5HRYA 5KWDA 4BEPA 1AP7A 5CEDB 4A63B 1MYOA 1WG0A 3AJIA 2F37A 1BI8B 4CYMD 3TWQA 3DEPA 2QYJA 1BI7B 1IKND 5AQ7A 4DX6D 1K3ZD 4HRMB 3TWSA 3W9GA 3V79K 4HLLA 2XZTG 5CEAA 5AQAA 5JA4D 2ETCA 5ENSD 3ZU7B 4ZHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KNH D;  4DX7 D;  4K5B A;  1IHB A;  2F8Y A;  3TWR A;  5ENQ D;  1DC2 A;  1MJ0 A;  2B0O E;  1MX4 A;  2BKG A;  5EIL A;  4JB8 P;  2F8X K;  4U8V D;  3V2O A;  5ENT D;  4YDY A;  4HQD A;  3SO8 A;  3ZKJ A;  1WDY A;  3NBN B;  4F1P A;  2JAB A;  4LSZ E;  1SVX A;  2MYO A;  2V4H C;  5EID A;  4U8Y D;  3DEO A;  1G3N B;  4C48 B;  3JXJ A;  1DCQ A;  3C5R A;  3TWX A;  3EHR A;  3V2X A;  3V30 A;  2VGE A;  4TUM A;  4HRL A;  3W9F A;  1N0Q A;  1K1B A;  4G8K A;  2L6B A;  3V31 A;  5KBA A;  5AAO A;  5JMN D;  1AWC B;  4OAV B;  1A5E A;  1K1A A;  2KXP C;  2Y1L E;  1YYH A;  3UI2 A;  2RFA A;  2XEN A;  3Q9N C;  2J8S D;  4O1O A;  2V5Q C;  2ZGD A;  2DZN A;  3LJN A;  4LNU D;  1NFI E;  5EN5 D;  3JXI A;  5BXU A;  5CEC B;  3B7B A;  2QC9 A;  4J8Y A;  4O1P A;  2XEE A;  4YDW A;  4HRN A;  4DX2 A;  2A5E A;  1BLX B;  3D9H A;  4GMR A;  5HS0 A;  5BXO A;  5HKP A;  4DRX E;  5ENO D;  1MX2 A;  4K5A B;  5ENR D;  4O60 A;  5EIB E;  1SW6 A;  4UUC A;  2P2C P;  2PNN A;  3TWV A;  4BSZ B;  3EHQ A;  1TR4 A;  2RFM A;  3TWW A;  1OY3 D;  5D66 A;  4GPM A;  4QFV A;  4BER A;  2KBX A;  4ATZ D;  3UTM A;  2BKK B;  1UOH A;  1D9S A;  4F6R D;  2NYJ A;  1OT8 A;  3F6Q A;  4QQI A;  5KNG A;  1S70 B;  3KEA A;  4RLY A;  4HB5 A;  3ZUV B;  3HG0 D;  3NOG D;  2FO1 E;  1BD8 A;  3IXE A;  4G8L A;  4U95 D;  3UXG A;  3ZNG A;  5CBN A;  1MX6 A;  2ZGG A;  5AN8 A;  2XEH A;  3J5P A;  5AAR A;  2DZO A;  2XZD G;  4BES A;  3EU9 A;  5ITZ F;  5CER B;  5AQB A;  1QYM A;  4NIK A;  3JUE A;  5EYP F;  4OAU C;  2DVW A;  5FIN A;  2AJA A;  4Z68 A;  2ETB A;  3TWT A;  4B93 B;  3B95 A;  3T9K A;  2HE0 A;  5EYL A;  1N11 A;  1IXV A;  2ETA A;  1YCS B;  4HNA D;  4HI8 A;  5CBO A;  4CZ2 D;  4K5C A;  3AAA C;  4HBD A;  5ENP D;  3J5Q B;  1YMP A;  4DX1 A;  3HRA A;  4BET A;  4DX5 D;  4U96 D;  3T8K A;  2Y0B G;  1BU9 A;  4LG6 A;  2DWZ A;  5AQ9 A;  4N5Q A;  3Q9U C;  4DUI A;  1N0R A;  4HI9 A;  3NOC D;  4ZFH A;  4J7W A;  5FIO A;  3TWU A;  5HRY A;  5KWD A;  4BEP A;  1AP7 A;  5CED B;  4A63 B;  1MYO A;  1WG0 A;  3AJI A;  2F37 A;  1BI8 B;  4CYM D;  3TWQ A;  3DEP A;  2QYJ A;  1BI7 B;  1IKN D;  5AQ7 A;  4DX6 D;  1K3Z D;  4HRM B;  3TWS A;  3W9G A;  3V79 K;  4HLL A;  2XZT G;  5CEA A;  5AQA A;  5JA4 D;  2ETC A;  5ENS D;  3ZU7 B;  4ZHB A; 
#chains in the Genus database with same CATH topology
 3LCA A;  2LO6 A;  1H2T C;  1OWM A;  4F53 A;  1N4S A;  2YHC A;  3HXB A;  3V2O A;  2VJ8 A;  3SO8 A;  3UIN C;  2CFZ A;  4LSZ E;  4GTO A;  4N3B A;  1D8D A;  3CQG B;  4U8Y D;  4CRW A;  3V30 A;  2OOE A;  3W9F A;  4DLQ A;  4YND A;  3CLJ A;  2AXU A;  1A5E A;  1U3C A;  1E7V A;  2VQ2 A;  5B1A E;  2JLB A;  2LNI A;  3Q9N C;  3L54 A;  1JCR A;  3DSS A;  3G2U A;  3ML8 A;  4MS6 A;  3SBT B;  1BPO A;  2C2L A;  3QOU A;  4M3O A;  1NZN A;  2WXG A;  3DXM G;  4F6R D;  4HOS A;  1DCE A;  2R05 A;  3VLF A;  5BNW A;  1HF8 A;  2MRI A;  3O48 A;  5T3R A;  1MX6 A;  3Q5M A;  5AN8 A;  1RZ4 A;  3EU9 A;  5ITZ F;  3UUX A;  2VTB B;  4IUL A;  4ME2 A;  2ETA A;  4WWO A;  1IQU A;  3R9M A;  4GTV A;  3OXG A;  4LG6 A;  1JUQ A;  3U66 A;  3TWU A;  4HVB A;  5T4Y A;  3ONL A;  2QYJ A;  3E37 A;  1B89 A;  4HRM B;  4RG9 A;  1UW4 B;  3V79 K;  2X6K A;  4AXH A;  3ABK E;  1FVH A;  4GTT A;  4K0R A;  4UQY A;  3T8M A;  3ZEF A;  5EID A;  3CK7 A;  5KJN A;  5B3S E;  1JWG A;  3ZYQ A;  3FTZ A;  4XKC A;  1PAQ A;  4N2S A;  4WWN A;  3QAQ A;  3ZXP A;  3UPV A;  2P9S G;  3IKO B;  2VYI A;  3PEV B;  3G2S A;  4PUC A;  4O1P A;  4YDE A;  4U0Z A;  4EZL A;  4RVB A;  4PS7 A;  1NL4 A;  3U9W A;  4O60 A;  2PNN A;  2V4L A;  3NQP A;  5DIZ A;  3HIZ A;  1KZO A;  3I5P A;  4JEU A;  3MEK A;  4L2Y A;  4KBQ A;  3BQO A;  2XPZ A;  1UOH A;  4MRU A;  3MKQ A;  4N3A A;  4I2Z A;  3MV2 B;  3ESL A;  4HB5 A;  3APD A;  4XX5 A;  3NOG D;  2FO1 E;  3DWL G;  3PZD A;  3CKB A;  1O1S A;  3FTU A;  4U0U A;  4BFR A;  2BTD A;  3T9K A;  1N11 A;  3PDN A;  2E2E A;  3JUI A;  3E30 A;  3PRZ A;  3FUM A;  4WND A;  3Q9U C;  3UT7 A;  4DPR A;  2A4Z A;  5LCW C;  1RW2 A;  2L0I A;  4TRQ A;  2LAH A;  2ZU6 B;  5DBK A;  5ENN A;  4GA1 A;  1HXI A;  4GB9 A;  5ENS D;  1HU3 A;  3ASF A;  3HXF A;  3E33 A;  2UY1 A;  4LUN U;  2KCL A;  3Q7A A;  3L6A A;  3RJV A;  5LFA A;  2XS1 A;  4KT6 B;  3V2X A;  2VGE A;  4JHR A;  1UN8 A;  2FI7 A;  3IV0 A;  3PE4 A;  4UQX A;  4XEI G;  3T5V A;  1S63 A;  2EIM E;  1NFI E;  5EN5 D;  4I6G A;  3L13 A;  4ILH B;  3B7B A;  2QC9 A;  2I1J A;  4ACK A;  4MBG A;  4HRN A;  1OWP A;  2AXV A;  4GMR A;  1OCO E;  1LTX A;  2J08 A;  1V54 E;  4PH4 B;  4CDN A;  4U7E B;  1OT8 A;  2X6H A;  1LD7 A;  3FEX A;  1IYG A;  3IXE A;  4UI9 K;  2XRZ A;  4E6H A;  4MLP A;  5E76 A;  1ZU2 A;  3CV0 A;  4WWP A;  4GMJ A;  3UM3 A;  4JEH A;  5CBO A;  2YHE A;  2XGS A;  1TNU A;  1OWO A;  3DPY A;  2X3M A;  1FVF A;  4HOU A;  4G2V A;  3Q15 A;  5JJ6 A;  5AQ7 A;  2WXQ A;  2VSX E;  3O4Z A;  5J08 A;  4U8V D;  3FP3 A;  3EIQ C;  2RG8 A;  1SZ9 A;  2C0L A;  3NAW A;  3C5R A;  3E32 A;  3RO2 A;  1QNF A;  4GTS A;  3AG2 E;  3UI2 A;  3Q7F A;  2J8S D;  5LP0 A;  3D9K A;  1QBQ A;  5CEC B;  3ASD A;  2RKK A;  2IU1 A;  4BSZ B;  3BG0 B;  3KEZ A;  3EHQ A;  4XKB A;  1HE8 A;  3I4R B;  3ASG A;  3OXF A;  5EX0 A;  5G04 C;  3F6Q A;  5KNG A;  1OWL A;  3KEA A;  4RLY A;  4U95 D;  1Z6T A;  1E8W A;  2J9Q A;  3TL5 A;  4CGV A;  3QDN A;  1TNB A;  2NSZ A;  4UI9 C;  3AG4 E;  4K5C A;  3EUV A;  4JL0 A;  1HFA A;  2QYU A;  4CDR A;  4WAF A;  1YA0 A;  1MQS A;  4C0M A;  2XGM A;  4DUI A;  3PRE A;  3D9J A;  3ZHE A;  5FTP A;  5FIO A;  1WG0 A;  4AY6 A;  4CYM D;  3LS8 A;  2XQ0 A;  3SHF A;  3APC A;  3TWS A;  4LER A;  5J90 A;  3DSU A;  1E8X A;  2GRO B;  5EDS A;  2ETC A;  3MKR A;  4B0Z A;  1H2U A;  4GTP A;  4KVO A;  3ZPJ A;  5LCW J;  1TN7 A;  2V4H C;  1OCC E;  2XCC A;  4LNB A;  2QZA A;  4GCO A;  3CK9 A;  1NI1 A;  4I43 A;  3WXX A;  1TNZ A;  3FH7 A;  2XEN A;  4ANW A;  2KZT A;  1ELK A;  3LJN A;  3QJZ A;  5JHA A;  4XI9 A;  2V5F A;  1FT2 A;  3ONK A;  4UQZ A;  5C2Y A;  4YDW A;  3VLD A;  1GW6 A;  4DRX E;  4E85 A;  5ENO D;  3G2W A;  1SW6 A;  5FQ4 A;  3ZN3 A;  3ZIM A;  4U07 A;  4J0U A;  2KBX A;  3Q49 B;  3UTM A;  2FF4 A;  3FUD A;  3UXG A;  3FH8 A;  3HXE A;  4F1S A;  5AAR A;  1IHG A;  4ANX A;  3SF4 A;  5FIN A;  4R7L A;  5A23 A;  3CIA A;  5BPP A;  4TXQ A;  5BV0 A;  3PE3 A;  4DX1 A;  3DPD A;  2IOL A;  4DLO A;  5H7P A;  2YIN A;  3AU5 A;  4EZJ A;  2ILR A;  4ABN A;  5KWD A;  5HRY A;  2GRN B;  5G2N A;  3ZRH A;  2NXP A;  1TJF A;  3FHE A;  5KNH D;  3PNL B;  3LY8 A;  1N52 A;  4ANV A;  3EJN A;  4JD2 G;  4Q96 A;  3ZKJ A;  4AIF A;  4DK5 A;  3BG1 B;  5CHE E;  1HO8 A;  5LOZ A;  4EEC A;  4O6F A;  2V8S E;  5FQ6 A;  3V31 A;  1AWC B;  4OAV B;  2WMN A;  1KT0 A;  1KT1 A;  4A3T A;  1H19 A;  2YNQ A;  2FBN A;  3C72 A;  3EHN A;  4KVM A;  5AJD A;  4UUC A;  4YDO A;  4GPM A;  4I6E A;  2EQX A;  2FO7 A;  2IY0 C;  2WXN A;  1HH8 A;  1S64 A;  3UM1 A;  4GAA A;  4KYO B;  2J09 A;  3SFX A;  2L6J A;  1Z3Y A;  1SQM A;  2I6H A;  3PH0 C;  3X2Q E;  3ZNG A;  4GCN A;  4OVV A;  4UWF A;  3HVE B;  4XIF A;  3I3N A;  4GTR A;  1ZBP A;  3SFZ A;  3L17 A;  4J8F A;  1OXJ A;  1QZ2 A;  5EKQ D;  4U96 D;  2P58 C;  2Y0B G;  3FTY A;  5AQ9 A;  4WNG A;  5G04 J;  1N0R A;  4KMO A;  3UMV A;  2OEW A;  3ZXS A;  1XGW A;  4A63 B;  3FUK A;  4J6I A;  4JA9 A;  4HLL A;  2ZIR A;  2ION A;  4UI9 J;  1IHB A;  2F8Y A;  1MJ0 A;  4J8E A;  5EIL A;  4JB8 P;  4U04 A;  3OAW A;  2PQN A;  4D10 C;  1DNP A;  4C48 B;  3EHR A;  3LVR E;  4G8K A;  3AG1 E;  3C3O A;  3B7S A;  5AAO A;  3LDZ A;  4APO A;  2HO1 A;  3D9M A;  2Y1L E;  1PC2 A;  5BXU A;  3ASO E;  3KSQ A;  3RK6 A;  1TYQ G;  4L2L A;  5KCM A;  2P2C P;  4UWG A;  2QFC A;  3FUN A;  3FUF A;  4XE0 A;  3UIP C;  4ATZ D;  4WUY A;  2AVP A;  2Y4U A;  5A6C A;  3U64 A;  5CCL A;  3FY4 A;  2PZI A;  3E4B A;  4J8D A;  2JEK A;  1U2V G;  2RD0 A;  4OAU C;  4GZC A;  1TEZ A;  3UT8 A;  2P9K G;  1VDY A;  3DSX A;  3DSW A;  2CFU A;  4CGW A;  2P9L G;  3FUJ A;  3LY9 A;  3FUE A;  4C0E A;  3LVQ E;  3LJ3 A;  2VGX A;  4CEM A;  1BU9 A;  2DWZ A;  1UJJ A;  5AJL A;  4J7W A;  1AP7 A;  4BEP A;  1TNY A;  1H2V C;  3TWQ A;  2MOW A;  2XZT G;  3L22 A;  5EYL A;  1W3B A;  4K5B A;  1FCH A;  4I2W A;  2BKG A;  2F8X K;  3OTN A;  3P1U A;  5ENT D;  3NBN B;  4IYP A;  4L9P A;  1Z5S C;  1N0Q A;  4FU3 A;  4PS8 A;  5CCM A;  3UQ3 A;  1YYH A;  2X6F A;  5FQ8 A;  1SZA A;  3SY2 A;  1Y6I A;  5AIJ A;  4J8Y A;  1TJC A;  3FU6 A;  1BLX B;  5HKP A;  4GZ3 A;  3FWV A;  4XZ4 A;  5EIB E;  2MHK A;  2FUL A;  3QNK A;  5FZS A;  4QFV A;  3ZYL A;  2AW6 A;  4X8Q A;  4Y6W A;  3ZYM A;  4EZK A;  4GTQ A;  1P5Q A;  2DZO A;  2XZD G;  4G1T A;  3EIJ A;  2WPV A;  4UWH A;  5EYP F;  3ISM C;  3CVW A;  1EPU A;  3CHP A;  3EDT B;  5FQ7 A;  2WQ6 A;  3HDX A;  3HRA A;  3T8K A;  2EIK E;  2WQH A;  3Q79 A;  4HFG A;  3ULE G;  3JYS A;  4N5Q A;  3ABM E;  4DI4 A;  5CED B;  1MYO A;  3UKR G;  1KLX A;  2H6F A;  4DX6 D;  2NC9 A;  3LY7 A;  1E7U A;  4OVU A;  3QB2 A;  3LXU X;  2WXH A;  3UX4 A;  4N39 A;  2J4B A;  3KD7 A;  1LD8 A;  2VTB A;  4KZ0 A;  2JAB A;  2MYO A;  2CG2 A;  4TUM A;  2ZXW E;  3PZ2 A;  1K1B A;  5KBA A;  3QWV A;  2EIL E;  4AJW A;  4JC8 A;  5KJK A;  4M7C A;  2R59 A;  3UM0 A;  5ANR A;  2ZGD A;  2WXM A;  3RRN B;  3CVU A;  1E8Z A;  1OCR E;  1D8E A;  5BXO A;  1IQR A;  3ESK A;  3TWV A;  4Y6C A;  3TG5 A;  3PZ3 A;  3TWW A;  3TXN A;  3EU5 A;  4K03 A;  4U8H A;  1INZ A;  3PEU B;  4NUR A;  1D9S A;  2LAI A;  3CHM A;  4GTM A;  4F7A A;  1U3D A;  5CBN A;  2XEH A;  5CER B;  4EBA G;  5M72 A;  2AJA A;  3TWT A;  3RSE G;  2HE0 A;  1NA0 A;  4JVS A;  3CVY A;  4HI8 A;  3MJW A;  5KJL A;  3FTW A;  3CVL A;  3ENE A;  4G23 A;  3FH5 A;  1H6K A;  1ZB1 A;  4NQ0 A;  3S7B A;  3D3M A;  3RIB A;  2LXM A;  3LKU A;  1FPP A;  1N4P A;  3FTX A;  4JA7 A;  5G05 C;  4AEZ C;  4L1B A;  4LRZ A;  5CEA A;  4JW1 A;  3VTX A;  2BUG A;  5AQA A;  4NRH B;  1N95 A;  4N2Q A;  3L08 A;  1DC2 A;  3DBS A;  2YQ8 A;  5E75 A;  3Q78 A;  4CT4 A;  4GA2 A;  1X81 A;  1E90 A;  4DJA A;  3RU0 A;  4G11 A;  1N4Q A;  4BT8 A;  3SFY A;  4I9E A;  2WB2 A;  2CHW A;  2WVI A;  3RAU A;  4AP2 A;  2OND A;  1Q2Z A;  3CVN A;  3JXI A;  3NB2 A;  3CR3 A;  3G2T A;  3D9O A;  1N94 A;  2KCK A;  3Q4A B;  5AYW D;  2IO3 C;  1V55 E;  4YVO A;  3MCX A;  1SA5 A;  2PM6 A;  3BEE A;  3SBS A;  2CG3 A;  2E0I A;  2HM8 A;  3AS5 A;  3CVV A;  4N3C A;  4LNG A;  4ILG A;  2OVF A;  4BES A;  4NIK A;  4WNF A;  3DSV A;  4P29 A;  4GA0 A;  1IXV A;  3RKV A;  3FFL A;  3PVL A;  4CDM A;  2M63 A;  1YMP A;  1EYH A;  2XS8 A;  4HI9 A;  4EBA A;  4ZFH A;  4FAD A;  4JPS A;  4B8A A;  3NZS A;  3ZVV A;  3FEY A;  4EQF A;  5G55 A;  5BV1 A;  1BI7 B;  1K3Z D;  2BED A;  4I6J A;  2DCP A;  4FJY A;  2P9P G;  3FUI A;  3IHV A;  3PUK A;  2X6J A;  2I9C A;  1MX4 A;  3MKQ B;  4TUU A;  1SVX A;  2P9U G;  3GYZ A;  4J8S A;  4GZ6 A;  2WXO A;  2Q7F A;  3AS8 A;  1QQE A;  4HRL A;  4UWL A;  3MV3 B;  3D9I A;  3G2V A;  3B7T A;  4I1M A;  3U4T A;  1K8K G;  2DYS E;  1JCS A;  1E96 B;  4GYY A;  3SGH A;  1LF8 A;  4NAC A;  1L5J A;  3AU4 A;  2DYR E;  1TR4 A;  3C98 A;  2XGO A;  1WM5 A;  2H6G A;  3GZ2 A;  2CHZ A;  2BKK B;  3FUL A;  1OWN A;  5ARF A;  4TXR A;  3B13 A;  3UT4 A;  3Q73 A;  1EF1 C;  3ZUV B;  3LPZ A;  3TAX A;  3CHS A;  4G24 A;  2UY1 B;  2L0T B;  2DVW A;  3IHY A;  3R7R A;  3URZ A;  5D0O D;  4HS2 A;  3GZ1 A;  3RRU A;  4HLE A;  1H6P A;  3I4G A;  3J5Q B;  2QY7 A;  5CRV A;  4FLH A;  2I1K A;  3T5X A;  3DST A;  4BTA A;  5CMW A;  5AEN A;  1FT1 A;  3DEP A;  1KZP A;  1IKN D;  4FC8 A;  4A3V A;  1N9A A;  3QC1 A;  4N5C A;  3PS6 A;  1O5M A;  3ZGQ A;  3MYV A;  1TN8 A;  3PNT B;  4Q94 A;  1WY6 A;  4YVQ C;  2L9B A;  4BSX A;  2LXL A;  4JHJ A;  3DEO A;  2BF0 X;  5BUZ A;  3P2B A;  2GRR B;  2AWI A;  2WXR A;  5G05 J;  2V5Q C;  4TV3 A;  2WXP A;  4LNU D;  1TN6 A;  3CGH A;  5KJM A;  5FZQ A;  4JHK A;  1TNO A;  1KPS B;  3L82 A;  2R02 A;  4JZY A;  2IQC A;  5ENR D;  4AM9 A;  4W9R A;  1UN9 A;  3GZS A;  4BER A;  2KCV A;  4FJZ A;  3KAE A;  4EHM A;  2R03 A;  1HX8 A;  5HQ8 A;  2GRQ B;  5D2M C;  2KAT A;  3FTS A;  3HG0 D;  4GML A;  4OYS A;  4G8L A;  4KXK B;  4HOT A;  3VTY A;  3JUE A;  3CK8 A;  4UWK A;  3L9T A;  5JJT A;  2GRP B;  2IO2 C;  3U3W A;  1H0A A;  3HHM A;  5T8I A;  4HNA D;  2GW1 A;  1XNF A;  2R5S A;  3CHO A;  1O1R A;  5ENP D;  3S7D A;  3EHM A;  1ELW A;  1O1T A;  4I1A A;  4APF A;  5BW8 C;  3S2A A;  2F37 A;  1BI8 B;  2F0Y A;  2GRL A;  3AG3 E;  4URK A;  4WNE A;  3BU8 A;  2WXF A;  1Y8M A;  1UJK A;  2XHE A;  4H7X A;  3FU0 A;  3S7J A;  3CVX A;  5IY5 E;  4HOR A;  5HI7 A;  1X5B A;  2IFU A;  3B7U X;  4HQD A;  1WDY A;  4ANU A;  2Y69 E;  3TWX A;  4L23 A;  1HS6 A;  3NZU A;  3TG4 A;  4H7Y A;  1K1A A;  1OCZ E;  5B1B E;  1JCQ A;  3MGB A;  2I2O A;  3Q75 A;  2DZN A;  2ZIS A;  4HXI A;  1OUV A;  4GU5 A;  3ZFW A;  2A5E A;  5HS0 A;  3IEG A;  3ZHE B;  2WXL A;  3KS2 A;  4RQI A;  3CHR A;  2WQ7 A;  4ACL A;  4ATG A;  4BWR A;  5FWQ A;  3CVQ A;  3KSL A;  2Y3A A;  5LX8 A;  4CT0 A;  3J5P A;  5FJY A;  2ETB A;  3CEQ A;  3PZ1 A;  2LUH A;  4XI0 A;  3UIO C;  2H6H A;  4G25 A;  4AY5 A;  3SNX A;  2KZT B;  2OEV A;  2H6I A;  3AJI A;  1Z3X A;  3LYA A;  4BX9 A;  3LEW A;  5D0Q D;  4IRU A;  1MZC A;  1PY1 A;  4FHK A;  3ZU7 B;  3FTV A;  4IN3 B;  3HXC A;  2B0O E;  5BT1 A;  3QWP A;  3ZYK A;  3HVE A;  2J07 A;  4YDY A;  2UWJ G;  2B6C A;  1G3N B;  2OCC E;  4BTB A;  4BX8 A;  4U0S A;  5CRU A;  4LCT A;  3QWW A;  3SZ7 A;  4AOF A;  3C3Q A;  2HYZ A;  4O1O A;  4BY6 A;  3ZW3 A;  2CHX A;  4MKT A;  3CQC B;  3DRA A;  5A7D B;  2XEE A;  4TXP A;  3WG7 E;  3B7R L;  4A1G A;  3E34 A;  2IEJ A;  2PQR A;  1MX2 A;  2WMO A;  1OY3 D;  2Y4T A;  4PS3 A;  4GZD A;  3PZ4 A;  3FU3 A;  3FDH A;  2WM9 A;  4ILI A;  3AS4 A;  4V3I A;  3SQV A;  2J49 A;  3HYM B;  4GZ5 A;  3MA5 A;  3CKC A;  2FEZ A;  3S7F A;  3BUA A;  5ANL A;  3RRM B;  1E8Y A;  4HBD A;  4FP7 A;  3MX3 A;  3UM2 A;  4DX5 D;  3FU5 A;  3GW4 A;  3ULQ A;  4PDX A;  2EIN E;  2KM4 A;  2DIW A;  2J4D A;  5JJ7 A;  3TGO A;  1JPL A;  3D9P A;  2DBA A;  3RO3 A;  3MZL B;  4ZHB A;  4DX7 D;  3JQ1 A;  4L7T A;  3TWR A;  4FA6 A;  2P9N G;  2AXZ A;  2VSO E;  3TXM A;  4Q69 A;  3PUJ A;  1DCQ A;  5FZR A;  4DI3 A;  3SI5 A;  5JMN D;  2VSN A;  4C9B B;  4B8C B;  2KXP C;  4A1S A;  2IF4 A;  1S0P A;  3JQ0 A;  2VGY A;  1JWF A;  4G26 A;  3NF1 A;  3APF A;  3ASN E;  4K5A B;  2RFM A;  5D66 A;  3ML9 A;  2WXJ A;  3R7Q A;  2P9I G;  2NYJ A;  1N54 A;  2GRM A;  1A17 A;  3Q47 B;  4QQI A;  2OV8 A;  3C3R A;  2HR2 A;  4BT9 A;  3OXL A;  2IOS A;  2R17 C;  3ULY A;  4EPZ A;  1NA3 A;  4I1O B;  1DVP A;  3UKU G;  1HG2 A;  5AQB A;  1QYM A;  2OVB A;  2PM7 A;  2GGF A;  3IBE A;  4FLB A;  4I17 A;  5EX3 A;  3B95 A;  4A55 A;  4HOQ A;  1ELR A;  2V0P A;  4CZ2 D;  2WXK A;  3CVP A;  3AAA C;  1HZ4 A;  2IJG X;  3FUH A;  3L16 A;  2XCB A;  2PL2 A;  2R2L A;  2XRY A;  1WAO 1;  2KC7 A;  4RG6 A;  1H6O A;  5ENQ D;  3SD5 A;  1HG5 A;  4AVX A;  4F1P A;  3CHQ A;  3JCK C;  5JHB A;  4GPK A;  3ABL E;  3JXJ A;  4B94 A;  3CST A;  4U63 A;  4KZC A;  2LSU A;  2L6B A;  3D9L A;  2XPI A;  3CSF A;  3R9A B;  2RFA A;  2VSY A;  3QK0 A;  3D9N A;  2XPY A;  1N4R A;  2VGX B;  5ARG A;  2A5U A;  4DX2 A;  3D9H A;  2WXI A;  3QKY A;  1SA4 A;  4F3V A;  4B89 A;  4LEU A;  2X6I A;  4GYO A;  4RSY A;  2X38 A;  1S70 B;  3VLE A;  1BD8 A;  2EIJ E;  2ZGG A;  4FUL A;  3ASH A;  4JXT A;  2LSV A;  2XEV A;  4Z68 A;  4B93 B;  3K9I A;  3QAR A;  4I9C A;  1YCS B;  3N71 A;  3TJP A;  1UG3 A;  4BET A;  4AV7 A;  5FT9 A;  4CCA A;  3NOC D;  3HXD A;  5CMY A;  2C0M A;  1MHQ A;  1EDU A;  3W9G A;  4GYW A;  1NP7 A;  4FHJ A;  3DXK G;  5JA4 D;  5C1D A; 
#chains in the Genus database with same CATH homology
 5KNH D;  4DX7 D;  4K5B A;  1IHB A;  2F8Y A;  3TWR A;  5ENQ D;  1DC2 A;  1MJ0 A;  2B0O E;  1MX4 A;  2BKG A;  5EIL A;  4JB8 P;  2F8X K;  4U8V D;  3V2O A;  5ENT D;  4YDY A;  4HQD A;  3SO8 A;  3ZKJ A;  1WDY A;  3NBN B;  4F1P A;  2JAB A;  4LSZ E;  1SVX A;  2MYO A;  2V4H C;  5EID A;  4U8Y D;  3DEO A;  1G3N B;  4C48 B;  3JXJ A;  1DCQ A;  3C5R A;  3TWX A;  3EHR A;  3V2X A;  3V30 A;  2VGE A;  4TUM A;  4HRL A;  3W9F A;  1N0Q A;  1K1B A;  4G8K A;  2L6B A;  3V31 A;  5KBA A;  5AAO A;  5JMN D;  1AWC B;  4OAV B;  1A5E A;  1K1A A;  2KXP C;  2Y1L E;  1YYH A;  3UI2 A;  2RFA A;  2XEN A;  3Q9N C;  2J8S D;  4O1O A;  2V5Q C;  2ZGD A;  2DZN A;  3LJN A;  4LNU D;  1NFI E;  5EN5 D;  3JXI A;  5BXU A;  5CEC B;  3B7B A;  2QC9 A;  4J8Y A;  4O1P A;  2XEE A;  4YDW A;  4HRN A;  4DX2 A;  2A5E A;  1BLX B;  3D9H A;  4GMR A;  5HS0 A;  5BXO A;  5HKP A;  4DRX E;  5ENO D;  1MX2 A;  4K5A B;  5ENR D;  4O60 A;  5EIB E;  1SW6 A;  4UUC A;  2P2C P;  2PNN A;  3TWV A;  4BSZ B;  3EHQ A;  1TR4 A;  2RFM A;  3TWW A;  1OY3 D;  5D66 A;  4GPM A;  4QFV A;  4BER A;  2KBX A;  4ATZ D;  3UTM A;  2BKK B;  1UOH A;  1D9S A;  4F6R D;  2NYJ A;  1OT8 A;  3F6Q A;  4QQI A;  5KNG A;  1S70 B;  3KEA A;  4RLY A;  4HB5 A;  3ZUV B;  3HG0 D;  3NOG D;  2FO1 E;  1BD8 A;  3IXE A;  4G8L A;  4U95 D;  3UXG A;  3ZNG A;  5CBN A;  1MX6 A;  2ZGG A;  5AN8 A;  2XEH A;  3J5P A;  5AAR A;  2DZO A;  2XZD G;  4BES A;  3EU9 A;  5ITZ F;  5CER B;  5AQB A;  1QYM A;  4NIK A;  3JUE A;  5EYP F;  4OAU C;  2DVW A;  5FIN A;  2AJA A;  4Z68 A;  2ETB A;  3TWT A;  4B93 B;  3B95 A;  3T9K A;  2HE0 A;  5EYL A;  1N11 A;  1IXV A;  2ETA A;  1YCS B;  4HNA D;  4HI8 A;  5CBO A;  4CZ2 D;  4K5C A;  3AAA C;  4HBD A;  5ENP D;  3J5Q B;  1YMP A;  4DX1 A;  3HRA A;  4BET A;  4DX5 D;  4U96 D;  3T8K A;  2Y0B G;  1BU9 A;  4LG6 A;  2DWZ A;  5AQ9 A;  4N5Q A;  3Q9U C;  4DUI A;  1N0R A;  4HI9 A;  3NOC D;  4ZFH A;  4J7W A;  5FIO A;  3TWU A;  5HRY A;  5KWD A;  4BEP A;  1AP7 A;  5CED B;  4A63 B;  1MYO A;  1WG0 A;  3AJI A;  2F37 A;  1BI8 B;  4CYM D;  3TWQ A;  3DEP A;  2QYJ A;  1BI7 B;  1IKN D;  5AQ7 A;  4DX6 D;  1K3Z D;  4HRM B;  3TWS A;  3W9G A;  3V79 K;  4HLL A;  2XZT G;  5CEA A;  5AQA A;  5JA4 D;  2ETC A;  5ENS D;  3ZU7 B;  4ZHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...