5ENQD

Mbx3132 bound structure of bacterial efflux pump.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
162
structure length
162
Chain Sequence
HHHHHHGSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug efflux pump subunit AcrB,Multidrug efflux pump sub
publication title Molecular basis for inhibition of AcrB multidrug efflux pump by novel and powerful pyranopyridine derivatives.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transport protein
total genus 51
structure length 162
sequence length 162
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2015-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5enqD00
1MYOA 1BI7B 3TWTA 4O1PA 4HRNA 1IKND 3EHQA 4ATZD 1AWCB 5EILA 2XEEA 5CBOA 1K1BA 3HRAA 4HRLA 5ITZF 1MJ0A 3V2OA 3UI2A 4HBDA 2XEHA 4C48B 5AQ9A 5CEAA 3TWVA 1SVXA 5CECB 1AP7A 4DX5D 1D9SA 3AJIA 3Q9NC 3T9KA 5BXUA 1DC2A 2HE0A 2KXPC 4LG6A 2A5EA 4BSZB 5AQBA 1N0QA 3TWWA 4CYMD 1TR4A 2QC9A 2V5QC 5FINA 3TWXA 1YYHA 3ZNGA 4DUIA 4ZFHA 4HI9A 4U96D 2P2CP 2DZNA 4HLLA 2RFAA 3EU9A 4BERA 1BLXB 3NOGD 4YDWA 3JXIA 5CERB 1WG0A 3AAAC 2BKGA 2XENA 3IXEA 4HB5A 1MX6A 4J8YA 1DCQA 1YMPA 4F6RD 4K5BA 2L6BA 3Q9UC 3JUEA 4O1OA 2Y1LE 5CEDB 2J8SD 1OY3D 4BEPA 5HKPA 1N0RA 1OT8A 3NOCD 4U95D 3TWRA 5BXOA 4HRMB 4DX7D 2ETAA 3KEAA 3B95A 2ZGDA 1BU9A 4RLYA 1G3NB 4BESA 4A63B 2ETCA 2PNNA 4DRXE 4OAUC 1MX2A 4U8YD 1IXVA 2JABA 5AQ7A 5KNGA 2XZTG 5KWDA 4GMRA 3HG0D 1UOHA 2B0OE 3F6QA 4HQDA 5HS0A 3SO8A 2MYOA 5ENRD 2XZDG 4K5AB 5AARA 4CZ2D 4F1PA 3C5RA 4YDYA 5ENOD 4K5CA 4OAVB 4G8LA 2BKKB 5ENSD 1S70B 2VGEA 5ENQD 1SW6A 3ZU7B 4O60A 3TWQA 1YCSB 2ETBA 5EYLA 4ZHBA 2FO1E 5ENTD 2Y0BG 4TUMA 3B7BA 3V31A 2AJAA 2F8YA 3V79K 3UTMA 4N5QA 2DZOA 1N11A 1BI8B 3EHRA 1BD8A 4G8KA 3W9FA 4B93B 2ZGGA 4LSZE 4QQIA 2V4HC 3TWUA 4DX6D 3W9GA 5AN8A 4GPMA 5CBNA 1A5EA 5KBAA 1K1AA 3D9HA 3ZKJA 1MX4A 3UXGA 4BETA 3DEPA 5EIBE 5KNHD 1QYMA 1NFIE 3J5QB 3NBNB 4Z68A 5JA4D 2RFMA 5HRYA 5FIOA 4NIKA 5AAOA 1WDYA 4DX2A 2F8XK 4U8VD 5AQAA 5EIDA 4DX1A 2DVWA 3JXJA 3V30A 3DEOA 5D66A 3J5PA 2QYJA 3ZUVB 4HI8A 3V2XA 1K3ZD 4QFVA 5ENPD 3LJNA 3TWSA 2NYJA 4J7WA 4JB8P 4LNUD 4UUCA 2DWZA 3T8KA 2F37A 4HNAD 2KBXA 5EN5D 5EYPF 5JMND 1IHBA
chains in the Genus database with same CATH superfamily
2XPZA 2YQ8A 5CMYA 4I1MA 3APDA 1K1BA 1SZAA 5FJYA 2IOLA 3TG4A 4HBDA 1HE8A 3Q7FA 1OCRE 5G05C 4EBAG 2ILRA 3C3RA 1JPLA 2P58C 2WQ6A 5AQBA 1TR4A 1KT1A 1OWOA 2KC7A 4HI9A 5CMWA 4BWRA 2VTBB 3MJWA 1WG0A 3CK7A 3KSQA 3EHMA 3N71A 2EIME 3PZ2A 3ONKA 4A1SA 3EU5A 5HKPA 3CKCA 3FTXA 2FULA 3CVYA 1G3NB 1EYHA 3HXCA 4UWFA 2CFZA 3DXKG 4EPZA 4HOSA 3HVEA 4JW1A 1TEZA 4A3TA 2XRZA 1H2TC 3FH8A 4AVXA 4U07A 2LXLA 4ANUA 1N94A 1N4PA 4J0UA 3CHOA 3LCAA 3KD7A 1V55E 3X2QE 5BPPA 3B7UX 3AS4A 4I1AA 2J07A 3RKVA 4BSXA 4DK5A 5FT9A 3SGHA 1TNYA 4DX2A 4FA6A 4EBAA 3UKRG 2QYJA 4HI8A 5B3SE 3OXLA 4L2LA 2J4BA 4WUYA 4P29A 3CVUA 4O1PA 1FVFA 2EIJE 1LTXA 4CCAA 3TWVA 3R7QA 3PUKA 2RD0A 4JA7A 4ZFHA 5FZQA 2KCLA 3AG3E 5ANRA 3CQGB 3L9TA 1IQUA 4GZ5A 3UM2A 3AS8A 1UW4B 1MX6A 4YDOA 1DCQA 2J9QA 1KLXA 3AU5A 4KXKB 2J49A 3NOCD 3HDXA 4J8SA 2FO7A 3NF1A 4A63B 3SI5A 3ML8A 3L16A 5CCLA 1NA0A 2JABA 3FFLA 1EF1C 2GRPB 1XGWA 4UWHA 5H7PA 4G26A 5AARA 4XKCA 3LKUA 4K5CA 4OAVB 3I3NA 3OAWA 4ILGA 5AJLA 5AENA 2R05A 4O60A 3ASGA 5HI7A 3BQOA 3JQ1A 3C72A 2FBNA 4KVMA 3D9KA 4TXQA 4LNBA 4B93B 4LUNU 1K1AA 3IBEA 5KNHD 3TXNA 4PS3A 4YVOA 2DVWA 3PUJA 2WXJA 3QC1A 3ZGQA 3AG1E 4L7TA 3TWSA 3D9OA 3E4BA 3CVXA 3DSXA 3QNKA 4C9BB 2HO1A 3EHQA 4W9RA 3EIJA 2L9BA 1MJ0A 4GU5A 3HXEA 1SVXA 3ML9A 2KXPC 3ZXSA 4RQIA 3JQ0A 5JHBA 3U3WA 2V5QC 3TWXA 3KAEA 4HS2A 4A1GA 5T3RA 4JHKA 5T8IA 5EKQD 4HB5A 3PRZA 3QKYA 5LP0A 2L6BA 3FUDA 3UM1A 4BEPA 2KZTB 4WWPA 4HOUA 2L0TB 3SD5A 4KMOA 2XZTG 4EHMA 4G23A 3TL5A 5ENRD 4IULA 1O1TA 3DRAA 3Q47B 3SFZA 3IKOB 4JEUA 2WMNA 3FEXA 2RKKA 2IOSA 3MX3A 4MRUA 4PS8A 5CHEE 3Q7AA 4UQZA 4UWGA 3DPDA 3Q79A 3FUEA 3PNLB 4GZ6A 2I1KA 5FQ4A 3ZKJA 3PE4A 1NFIE 2OVFA 4DX1A 2P9KG 2KATA 4RVBA 4XI9A 3HHMA 4G8LA 4F53A 1HF8A 3U9WA 5KJLA 5JJ6A 1MHQA 3CHMA 2R17C 3UI2A 3NZUA 1D8EA 4KZCA 4DX5D 1FPPA 1DC2A 2H6GA 1KZPA 3TG5A 5CERB 2DIWA 3ESKA 3RO2A 3HXDA 3UIPC 4I6GA 2GRQB 1YMPA 3T8MA 3Q9UC 4TV3A 3CV0A 3QB2A 4CGVA 3AG2E 3E34A 4FADA 4U95D 3CK9A 4YDEA 2BF0X 1KZOA 4HORA 2PZIA 4BX8A 3CHSA 4DI3A 1DVPA 1IHGA 4CZ2D 1FCHA 5T4YA 2BEDA 1HX8A 2X6KA 3DSUA 1YCSB 4AJWA 3V31A 4U8HA 2LSVA 1OCOE 2IEJA 3URZA 4LSZE 2V4HC 3HVEB 2Y4TA 3OXGA 3ZVVA 2I2OA 3D3MA 3LXUX 3ULQA 2DYSE 4G25A 4MKTA 2WB2A 2WXIA 2IJGX 4JZYA 4HFGA 3L6AA 3ZIMA 1INZA 4DI4A 2AWIA 5FQ8A 5EILA 4I43A 3V2OA 1GW6A 3D9NA 3B13A 5CEAA 1SQMA 4OVVA 3UINC 3CLJA 4JD2G 4M3OA 2LXMA 2WXQA 1HZ4A 2EILE 3L17A 1NZNA 2ZISA 4J8DA 3NOGD 2AXUA 1UJJA 4G11A 1TN8A 3PS6A 4NACA 5CCMA 4GCNA 4V3IA 3ZRHA 3CGHA 1BU9A 2PNNA 1OCZE 2MHKA 1H2UA 3RU0A 2C0LA 2VQ2A 5AIJA 4J8EA 4TUUA 5EDSA 2V0PA 4HLEA 2CG2A 2C0MA 5B1AE 4ABNA 1KPSB 3BG1B 3OTNA 2X38A 5J08A 4N2QA 1MQSA 4LERA 3QDNA 2IO2C 1N11A 4FC8A 3S7BA 4QQIA 3SFXA 3DPYA 4GTOA 3FU5A 4L1BA 4FLHA 4J8FA 4UI9J 5AQAA 1OWLA 3EDTB 2NYJA 5FZSA 3UUXA 4AV7A 3T8KA 2WXPA 1EPUA 3MCXA 4G2VA 4EZLA 4ME2A 2WM9A 3T9KA 3DSSA 3BU8A 3CSTA 2OOEA 1IYGA 2QC9A 5G04J 3PREA 3VLEA 2DZNA 5EX3A 4GTTA 1FT1A 3I5PA 3CVPA 3SQVA 3ZYQA 3PE3A 4J8YA 1ELKA 3UM3A 4OVUA 3ULEG 3Q73A 2Q7FA 3UIOC 3GZ2A 4CRWA 2VSOE 3QWPA 3MKQA 3RRNB 3FUFA 4ACLA 4GMRA 4HXIA 4UQXA 2MYOA 3BG0B 1N4RA 4N39A 4YDYA 1S70B 1N54A 2IU1A 2DBAA 1ELRA 1VDYA 3L08A 4XEIG 2DZOA 3UT8A 3EHRA 4WNFA 3EUVA 1ZU2A 1MX4A 5D0QD 4I6JA 1UN8A 2ONDA 2RFMA 4DPRA 3S7JA 4I9EA 1Y6IA 1TNBA 2CFUA 5LFAA 2ZU6B 3R9AB 1NA3A 5G2NA 4BX9A 5BW8C 5G55A 2FI7A 1OUVA 3FU3A 2WXOA 2XS1A 3OXFA 4WNDA 3KSLA 2XCCA 2GRNB 2UY1B 1E7UA 1X81A 1OXJA 2BKGA 1DCEA 3FEYA 3QAQA 4M7CA 2FF4A 3UT7A 2GRRB 2A5UA 1PC2A 3MZLB 2ETAA 3B95A 3SFYA 3TXMA 2NC9A 3WG7E 3HG0D 5HS0A 2BUGA 1FT2A 5ENOD 4WNGA 2LAIA 4RSYA 3G2WA 4PH4B 3FTUA 5ENTD 5KJNA 1LD7A 4XKBA 3FUMA 4N5QA 4XIFA 4AY6A 2OVBA 5AN8A 3VTXA 1PAQA 3J5QB 2VGXA 3G2SA 3EJNA 3HXFA 5DBKA 4U04A 2J09A 3V30A 1LF8A 2XGMA 2YHCA 3LJ3A 1OWNA 3JCKC 5EN5D 5BV1A 3APCA 5EYPF 5JMND 5C2YA 2X3MA 2XEEA 3FUKA 2R5SA 2F0YA 3SZ7A 3U4TA 4GTSA 2J4DA 3Q49B 5BT1A 3TWWA 4LNGA 4GA0A 5AJDA 3PZDA 1YYHA 2LAHA 2P9SG 2P2CP 4U63A 4MBGA 2RFAA 2WXRA 2ZIRA 3ZHEB 2XEVA 2AXZA 4GTPA 4LEUA 5CEDB 2P9LG 3UX4A 3GZ1A 4N3CA 3PZ1A 4RLYA 3PEUB 4Q69A 3GW4A 4GYOA 2ZXWE 5FQ6A 2VSNA 3HIZA 1HS6A 4UI9K 4HQDA 4AXHA 1O5MA 2X6FA 2DYRE 4K5AB 4GPKA 3QK0A 2H6IA 4K03A 1HG2A 4EZKA 1H6PA 3DSVA 3VTYA 2XS8A 1JWFA 4PUCA 4GZCA 2Y69E 4F7AA 1BD8A 2ZGGA 1P5QA 3DEPA 3TJPA 1QYMA 4Z68A 3LY8A 1JUQA 3ZYLA 1E7VA 3RIBA 4GB9A 2LSUA 4MLPA 3UKUG 5FTPA 1HG5A 4TXRA 3RRUA 2XHEA 3LVRE 4Q96A 4JXTA 1E90A 2VSYA 3TWTA 1JWGA 3DSTA 3SBTB 4ATZD 1L5JA 3CVQA 4AP2A 1AP7A 5ARFA 1HO8A 1N4QA 3U66A 3FUJA 2XQ0A 4ATGA 2KCVA 3D9PA 3C3QA 3RRMB 4O6FA 4URKA 2OV8A 3KEAA 5CRUA 2AW6A 4PS7A 3ZEFA 2ETCA 4NURA 2EINE 3SO8A 5JHAA 4GA1A 5LX8A 2GRMA 1U3DA 5KCMA 3TWQA 2JEKA 2FO1E 1TNZA 3CHPA 2AJAA 1QZ2A 3HYMB 2V8SE 3MKQB 3UMVA 2PM6A 1N95A 1S64A 2L6JA 1JCRA 3FY4A 3D9LA 1ZB1A 3I4RB 5FQ7A 3C3OA 3FP3A 3L54A 4FULA 2J08A 3DEOA 3T5VA 4GA2A 3FDHA 2OCCE 1XNFA 4JL0A 4HRNA 1HFAA 3C98A 4K0RA 3MKRA 3LEWA 3I4GA 5BUZA 4L9PA 3Q9NC 2HE0A 2CHWA 2XPYA 3ASOE 3SF4A 3MV3B 3EIQC 4U0ZA 3CSFA 4FJZA 4K5BA 2NXPA 4IYPA 3ASNE 1N0RA 1OT8A 1H6OA 1HH8A 5ANLA 4IN3B 1MX2A 3LYAA 1UOHA 1H19A 3CKBA 1OCCE 2IO3C 4ACKA 3FUNA 3FTYA 2IY0C 5ENSD 2I9CA 2IF4A 2EQXA 3MA5A 3G2TA 3ULYA 1TYQG 3NZSA 2H6FA 5EYLA 2Y0BG 1H6KA 3B7BA 2F8YA 3V79K 1SA4A 1TN7A 4BT9A 2XCBA 4RG6A 3WXXA 3TWUA 5KBAA 4GZ3A 2KZTA 5CRVA 4NIKA 2FEZA 3JXJA 2GRLA 5ENPD 3PEVB 3D9MA 2WXKA 1TJCA 2KBXA 3FTZA 1WAO1 3EHNA 4JHRA 3HXBA 3L82A 4JPSA 5CECB 4UI9C 1D9SA 2QYUA 5A6CA 2A5EA 4BT8A 4LCTA 4C0MA 3NB2A 1Z3XA 4ILHB 3ZPJA 1E96B 1NI1A 4EZJA 3ASDA 1V54E 2DCPA 5C1DA 3PVLA 3APFA 1X5BA 2GROB 5G04C 5E76A 3ABME 4JC8A 5AQ7A 5LCWJ 1K8KG 5A7DB 3AU4A 1E8XA 4MS6A 5JJTA 3FTWA 1SA5A 3Q75A 3RK6A 4TUMA 4CT0A 2P9PG 1BI8B 5J90A 3ZYMA 4GMLA 4HVBA 4DX6D 3FTSA 3G2VA 3CQCB 3LS8A 3UXGA 4BETA 4U0UA 4JVSA 5HRYA 5FIOA 3S7FA 5G05J 1WDYA 4B8CB 2XPIA 4H7XA 4FHJA 1K3ZD 1N9AA 4UUCA 1RW2A 3CHQA 3VLDA 4RG9A 2PL2A 1TNUA 1QQEA 3E37A 1IKND 1TJFA 4HRLA 3ASHA 5FZRA 3TAXA 2XEHA 3FU6A 2P9UG 4GAAA 4A55A 3D9IA 3UQ3A 3FH7A 4X8QA 2AXVA 2RG8A 1Z6TA 4GTMA 4I2WA 2CG3A 4YDWA 3JXIA 3FTVA 4I9CA 3ASFA 3IXEA 3IHYA 4B94A 4F6RD 4Y6CA 4O1OA 3DXMG 2J8SD 2WQHA 3QWWA 4WWOA 1Z5SC 3L13A 3TWRA 5BXOA 4HRMB 4DX7D 4OAUC 4GTVA 4U8YD 1H0AA 4Y6WA 5KNGA 1HU3A 2YNQA 2XZDG 4KBQA 3R9MA 5FWQA 2QY7A 3B7TA 3PDNA 3RJVA 2ETBA 4G24A 4LRZA 3S2AA 1LD8A 4F3VA 5HQ8A 3E32A 3UTMA 4B89A 2PM7A 4UWLA 4GMJA 2KCKA 1QBQA 3ENEA 3LY7A 1E8ZA 3ISMC 2R02A 4GYWA 3NBNB 3B7SA 3RAUA 3QARA 4DLQA 3CHRA 5D66A 3DSWA 3P2BA 4GCOA 4J7WA 3ESLA 3FU0A 4ANXA 3ONLA 4ILIA 3U64A 3BEEA 3PZ4A 3AG4E 4CGWA 4AY5A 1MZCA 5B1BE 1EDUA 3UT4A 3LPZA 3SY2A 4C48B 3CK8A 5DIZA 4ANWA 2WXNA 2YHEA 4DUIA 3O48A 3ZNGA 3GZSA 4U96D 3PZ3A 2R59A 4PDXA 5LOZA 3NAWA 4AEZC 4HOQA 3LY9A 4I6EA 3DBSA 4FLBA 3FHEA 4FP7A 5BV0A 1O1SA 3PH0C 3SNXA 2E2EA 4UWKA 2X6HA 2CHZA 1IXVA 4GTRA 3ZFWA 2B0OE 3CVVA 4NQ0A 3O4ZA 3C5RA 2X6JA 3DWLG 5A23A 2BKKB 4APFA 3ZXPA 2Y4UA 4G1TA 2L0IA 3D9JA 2VYIA 2X6IA 1U3CA 1S63A 1RZ4A 4GPMA 3D9HA 2H6HA 4I17A 1FVHA 3JUIA 5AAOA 3MEKA 2F8XK 4N2SA 4B0ZA 2VTBA 2V4LA 1UN9A 4JB8P 3MV2B 4TXPA 2LO6A 2DWZA 5D0OD 4CDMA 1Y8MA 4FHKA 5BNWA 4XZ4A 3GYZA 2C2LA 2IONA 4N3BA 3HRAA 5ITZF 1ZBPA 4OYSA 4KVOA 2GW1A 1N52A 5BXUA 1N4SA 3QJZA 1N0QA 4AM9A 4HLLA 3CVLA 3MYVA 2M63A 4U7EB 1BLXB 5D2MC 3G2UA 3QOUA 3K9IA 2WXLA 4N5CA 1W3BA 5E75A 3IHVA 4J6IA 4CT4A 3SBSA 3FUIA 4CEMA 4JEHA 4WWNA 2UWJG 3E30A 2ZGDA 4DRXE 2OEVA 4CDRA 5IY5E 2QZAA 1IQRA 4AIFA 3F6QA 1YA0A 1OWPA 3UM0A 4F1PA 3Q4AB 2XGOA 5ENQD 1Q2ZA 4ZHBA 2UY1A 1TNOA 4APOA 1ELWA 3SHFA 1E8WA 4U0SA 4BY6A 2IFUA 1JCQA 3IEGA 3ZN3A 3JYSA 2HM8A 1BPOA 5JA4D 4UQYA 1H2VC 5ENNA 2LNIA 2GGFA 4EECA 4BTBA 4QFVA 2QFCA 4R7LA 4N3AA 2HYZA 4A3VA 1MYOA 4F1SA 3CVWA 4DLOA 1TN6A 2E0IA 3ABLE 3AJIA 4H7YA 4GYYA 3UPVA 4CYMD 5KJKA 2EIKE 3RO3A 2LUHA 4BTAA 4KT6B 4XI0A 3EU9A 3ABKE 4YNDA 3AAAC 4WAFA 4L23A 1U2VG 2Y1LE 3LVQE 4BFRA 1UJKA 1OY3D 4KYOB 2AVPA 3PNTB 1E8YA 4BESA 4KZ0A 3BUAA 2WVIA 2PQNA 3MGBA 4XX5A 1DNPA 2WPVA 2MOWA 2WXGA 4CDNA 3ZU7B 2WQ7A 2HR2A 5ARGA 2WMOA 1OWMA 3L22A 3ZHEA 4YVQC 4NRHB 4G8KA 3W9FA 1NL4A 3W9GA 2A4ZA 5AYWD 4I2ZA 4DJAA 3R7RA 4XE0A 5KJMA 2V5FA 4U8VD 1B89A 2VJ8A 5EX0A 3J5PA 2WXHA 3ZUVB 3LDZA 3AS5A 3LJNA 3CIAA 3Q15A 4LNUD 4GZDA 2F37A 2B6CA 4HNAD 2R03A 1IHBA 1BI7B 1SZ9A 2XRYA 4WNEA 2KM4A 1AWCB 3E33A 5CBOA 1A17A 2IQCA 3Q78A 3KEZA 1WY6A 1Z3YA 2R2LA 1KT0A 3NQPA 5AQ9A 3RSEG 4HOTA 4LG6A 4BSZB 2OEWA 5FINA 2JLBA 3Q5MA 1WM5A 2MRIA 3CVNA 3KS2A 4B8AA 4BERA 4JA9A 4EQFA 3FH5A 3FWVA 2PQRA 1S0PA 2XENA 1QNFA 3JUEA 3VLFA 4C0EA 2P9NG 2WXMA 4Q94A 2WXFA 2VGXB 3CEQA 2CHXA 2YINA 2NSZA 1D8DA 1HXIA 5JJ7A 3ZW3A 5KWDA 3S7DA 3FULA 1UG3A 3ZYKA 4IRUA 1JCSA 2Y3AA 4E85A 4D10C 1O1RA 2BTDA 2VGEA 1SW6A 3T5XA 3P1UA 4ANVA 4AOFA 3FUHA 3TGOA 4GTQA 4I1OB 4TRQA 4E6HA 1NP7A 4JHJA 2XGSA 5LCWC 2VGYA 1A5EA 5CBNA 5EIBE 4FU3A 1PY1A 2VSXE 5EIDA 4FJYA 3IV0A 2I6HA 2P9IG 3V2XA 2I1JA 4L2YA 3QWVA 3B7RL 3CR3A 5M72A
chains in the Genus database with same CATH topology
1MYOA 1BI7B 3TWTA 4O1PA 4HRNA 1IKND 3EHQA 4ATZD 1AWCB 5EILA 2XEEA 5CBOA 1K1BA 3HRAA 4HRLA 5ITZF 1MJ0A 3V2OA 3UI2A 4HBDA 2XEHA 4C48B 5AQ9A 5CEAA 3TWVA 1SVXA 5CECB 1AP7A 4DX5D 1D9SA 3AJIA 3Q9NC 3T9KA 5BXUA 1DC2A 2HE0A 2KXPC 4LG6A 2A5EA 4BSZB 5AQBA 1N0QA 3TWWA 4CYMD 1TR4A 2QC9A 2V5QC 5FINA 3TWXA 1YYHA 3ZNGA 4DUIA 4ZFHA 4HI9A 4U96D 2P2CP 2DZNA 4HLLA 2RFAA 3EU9A 4BERA 1BLXB 3NOGD 4YDWA 3JXIA 5CERB 1WG0A 3AAAC 2BKGA 2XENA 3IXEA 4HB5A 1MX6A 4J8YA 1DCQA 1YMPA 4F6RD 4K5BA 2L6BA 3Q9UC 3JUEA 4O1OA 2Y1LE 5CEDB 2J8SD 1OY3D 4BEPA 5HKPA 1N0RA 1OT8A 3NOCD 4U95D 3TWRA 5BXOA 4HRMB 4DX7D 2ETAA 3KEAA 3B95A 2ZGDA 1BU9A 4RLYA 1G3NB 4BESA 4A63B 2ETCA 2PNNA 4DRXE 4OAUC 1MX2A 4U8YD 1IXVA 2JABA 5AQ7A 5KNGA 2XZTG 5KWDA 4GMRA 3HG0D 1UOHA 2B0OE 3F6QA 4HQDA 5HS0A 3SO8A 2MYOA 5ENRD 2XZDG 4K5AB 5AARA 4CZ2D 4F1PA 3C5RA 4YDYA 5ENOD 4K5CA 4OAVB 4G8LA 2BKKB 5ENSD 1S70B 2VGEA 5ENQD 1SW6A 3ZU7B 4O60A 3TWQA 1YCSB 2ETBA 5EYLA 4ZHBA 2FO1E 5ENTD 2Y0BG 4TUMA 3B7BA 3V31A 2AJAA 2F8YA 3V79K 3UTMA 4N5QA 2DZOA 1N11A 1BI8B 3EHRA 1BD8A 4G8KA 3W9FA 4B93B 2ZGGA 4LSZE 4QQIA 2V4HC 3TWUA 4DX6D 3W9GA 5AN8A 4GPMA 5CBNA 1A5EA 5KBAA 1K1AA 3D9HA 3ZKJA 1MX4A 3UXGA 4BETA 3DEPA 5EIBE 5KNHD 1QYMA 1NFIE 3J5QB 3NBNB 4Z68A 5JA4D 2RFMA 5HRYA 5FIOA 4NIKA 5AAOA 1WDYA 4DX2A 2F8XK 4U8VD 5AQAA 5EIDA 4DX1A 2DVWA 3JXJA 3V30A 3DEOA 5D66A 3J5PA 2QYJA 3ZUVB 4HI8A 3V2XA 1K3ZD 4QFVA 5ENPD 3LJNA 3TWSA 2NYJA 4J7WA 4JB8P 4LNUD 4UUCA 2DWZA 3T8KA 2F37A 4HNAD 2KBXA 5EN5D 5EYPF 5JMND 1IHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MYO A;  1BI7 B;  3TWT A;  4O1P A;  4HRN A;  1IKN D;  3EHQ A;  4ATZ D;  1AWC B;  5EIL A;  2XEE A;  5CBO A;  1K1B A;  3HRA A;  4HRL A;  5ITZ F;  1MJ0 A;  3V2O A;  3UI2 A;  4HBD A;  2XEH A;  4C48 B;  5AQ9 A;  5CEA A;  3TWV A;  1SVX A;  5CEC B;  1AP7 A;  4DX5 D;  1D9S A;  3AJI A;  3Q9N C;  3T9K A;  5BXU A;  1DC2 A;  2HE0 A;  2KXP C;  4LG6 A;  2A5E A;  4BSZ B;  5AQB A;  1N0Q A;  3TWW A;  4CYM D;  1TR4 A;  2QC9 A;  2V5Q C;  5FIN A;  3TWX A;  1YYH A;  3ZNG A;  4DUI A;  4ZFH A;  4HI9 A;  4U96 D;  2P2C P;  2DZN A;  4HLL A;  2RFA A;  3EU9 A;  4BER A;  1BLX B;  3NOG D;  4YDW A;  3JXI A;  5CER B;  1WG0 A;  3AAA C;  2BKG A;  2XEN A;  3IXE A;  4HB5 A;  1MX6 A;  4J8Y A;  1DCQ A;  1YMP A;  4F6R D;  4K5B A;  2L6B A;  3Q9U C;  3JUE A;  4O1O A;  2Y1L E;  5CED B;  2J8S D;  1OY3 D;  4BEP A;  5HKP A;  1N0R A;  1OT8 A;  3NOC D;  4U95 D;  3TWR A;  5BXO A;  4HRM B;  4DX7 D;  2ETA A;  3KEA A;  3B95 A;  2ZGD A;  1BU9 A;  4RLY A;  1G3N B;  4BES A;  4A63 B;  2ETC A;  2PNN A;  4DRX E;  4OAU C;  1MX2 A;  4U8Y D;  1IXV A;  2JAB A;  5AQ7 A;  5KNG A;  2XZT G;  5KWD A;  4GMR A;  3HG0 D;  1UOH A;  2B0O E;  3F6Q A;  4HQD A;  5HS0 A;  3SO8 A;  2MYO A;  5ENR D;  2XZD G;  4K5A B;  5AAR A;  4CZ2 D;  4F1P A;  3C5R A;  4YDY A;  5ENO D;  4K5C A;  4OAV B;  4G8L A;  2BKK B;  5ENS D;  1S70 B;  2VGE A;  5ENQ D;  1SW6 A;  3ZU7 B;  4O60 A;  3TWQ A;  1YCS B;  2ETB A;  5EYL A;  4ZHB A;  2FO1 E;  5ENT D;  2Y0B G;  4TUM A;  3B7B A;  3V31 A;  2AJA A;  2F8Y A;  3V79 K;  3UTM A;  4N5Q A;  2DZO A;  1N11 A;  1BI8 B;  3EHR A;  1BD8 A;  4G8K A;  3W9F A;  4B93 B;  2ZGG A;  4LSZ E;  4QQI A;  2V4H C;  3TWU A;  4DX6 D;  3W9G A;  5AN8 A;  4GPM A;  5CBN A;  1A5E A;  5KBA A;  1K1A A;  3D9H A;  3ZKJ A;  1MX4 A;  3UXG A;  4BET A;  3DEP A;  5EIB E;  5KNH D;  1QYM A;  1NFI E;  3J5Q B;  3NBN B;  4Z68 A;  5JA4 D;  2RFM A;  5HRY A;  5FIO A;  4NIK A;  5AAO A;  1WDY A;  4DX2 A;  2F8X K;  4U8V D;  5AQA A;  5EID A;  4DX1 A;  2DVW A;  3JXJ A;  3V30 A;  3DEO A;  5D66 A;  3J5P A;  2QYJ A;  3ZUV B;  4HI8 A;  3V2X A;  1K3Z D;  4QFV A;  5ENP D;  3LJN A;  3TWS A;  2NYJ A;  4J7W A;  4JB8 P;  4LNU D;  4UUC A;  2DWZ A;  3T8K A;  2F37 A;  4HNA D;  2KBX A;  5EN5 D;  5EYP F;  5JMN D;  1IHB A; 
#chains in the Genus database with same CATH topology
 2XPZ A;  2YQ8 A;  5CMY A;  4I1M A;  3APD A;  1K1B A;  1SZA A;  5FJY A;  2IOL A;  3TG4 A;  4HBD A;  1HE8 A;  3Q7F A;  1OCR E;  5G05 C;  4EBA G;  2ILR A;  3C3R A;  1JPL A;  2P58 C;  2WQ6 A;  5AQB A;  1TR4 A;  1KT1 A;  1OWO A;  2KC7 A;  4HI9 A;  5CMW A;  4BWR A;  2VTB B;  3MJW A;  1WG0 A;  3CK7 A;  3KSQ A;  3EHM A;  3N71 A;  2EIM E;  3PZ2 A;  3ONK A;  4A1S A;  3EU5 A;  5HKP A;  3CKC A;  3FTX A;  2FUL A;  3CVY A;  1G3N B;  1EYH A;  3HXC A;  4UWF A;  2CFZ A;  3DXK G;  4EPZ A;  4HOS A;  3HVE A;  4JW1 A;  1TEZ A;  4A3T A;  2XRZ A;  1H2T C;  3FH8 A;  4AVX A;  4U07 A;  2LXL A;  4ANU A;  1N94 A;  1N4P A;  4J0U A;  3CHO A;  3LCA A;  3KD7 A;  1V55 E;  3X2Q E;  5BPP A;  3B7U X;  3AS4 A;  4I1A A;  2J07 A;  3RKV A;  4BSX A;  4DK5 A;  5FT9 A;  3SGH A;  1TNY A;  4DX2 A;  4FA6 A;  4EBA A;  3UKR G;  2QYJ A;  4HI8 A;  5B3S E;  3OXL A;  4L2L A;  2J4B A;  4WUY A;  4P29 A;  3CVU A;  4O1P A;  1FVF A;  2EIJ E;  1LTX A;  4CCA A;  3TWV A;  3R7Q A;  3PUK A;  2RD0 A;  4JA7 A;  4ZFH A;  5FZQ A;  2KCL A;  3AG3 E;  5ANR A;  3CQG B;  3L9T A;  1IQU A;  4GZ5 A;  3UM2 A;  3AS8 A;  1UW4 B;  1MX6 A;  4YDO A;  1DCQ A;  2J9Q A;  1KLX A;  3AU5 A;  4KXK B;  2J49 A;  3NOC D;  3HDX A;  4J8S A;  2FO7 A;  3NF1 A;  4A63 B;  3SI5 A;  3ML8 A;  3L16 A;  5CCL A;  1NA0 A;  2JAB A;  3FFL A;  1EF1 C;  2GRP B;  1XGW A;  4UWH A;  5H7P A;  4G26 A;  5AAR A;  4XKC A;  3LKU A;  4K5C A;  4OAV B;  3I3N A;  3OAW A;  4ILG A;  5AJL A;  5AEN A;  2R05 A;  4O60 A;  3ASG A;  5HI7 A;  3BQO A;  3JQ1 A;  3C72 A;  2FBN A;  4KVM A;  3D9K A;  4TXQ A;  4LNB A;  4B93 B;  4LUN U;  1K1A A;  3IBE A;  5KNH D;  3TXN A;  4PS3 A;  4YVO A;  2DVW A;  3PUJ A;  2WXJ A;  3QC1 A;  3ZGQ A;  3AG1 E;  4L7T A;  3TWS A;  3D9O A;  3E4B A;  3CVX A;  3DSX A;  3QNK A;  4C9B B;  2HO1 A;  3EHQ A;  4W9R A;  3EIJ A;  2L9B A;  1MJ0 A;  4GU5 A;  3HXE A;  1SVX A;  3ML9 A;  2KXP C;  3ZXS A;  4RQI A;  3JQ0 A;  5JHB A;  3U3W A;  2V5Q C;  3TWX A;  3KAE A;  4HS2 A;  4A1G A;  5T3R A;  4JHK A;  5T8I A;  5EKQ D;  4HB5 A;  3PRZ A;  3QKY A;  5LP0 A;  2L6B A;  3FUD A;  3UM1 A;  4BEP A;  2KZT B;  4WWP A;  4HOU A;  2L0T B;  3SD5 A;  4KMO A;  2XZT G;  4EHM A;  4G23 A;  3TL5 A;  5ENR D;  4IUL A;  1O1T A;  3DRA A;  3Q47 B;  3SFZ A;  3IKO B;  4JEU A;  2WMN A;  3FEX A;  2RKK A;  2IOS A;  3MX3 A;  4MRU A;  4PS8 A;  5CHE E;  3Q7A A;  4UQZ A;  4UWG A;  3DPD A;  3Q79 A;  3FUE A;  3PNL B;  4GZ6 A;  2I1K A;  5FQ4 A;  3ZKJ A;  3PE4 A;  1NFI E;  2OVF A;  4DX1 A;  2P9K G;  2KAT A;  4RVB A;  4XI9 A;  3HHM A;  4G8L A;  4F53 A;  1HF8 A;  3U9W A;  5KJL A;  5JJ6 A;  1MHQ A;  3CHM A;  2R17 C;  3UI2 A;  3NZU A;  1D8E A;  4KZC A;  4DX5 D;  1FPP A;  1DC2 A;  2H6G A;  1KZP A;  3TG5 A;  5CER B;  2DIW A;  3ESK A;  3RO2 A;  3HXD A;  3UIP C;  4I6G A;  2GRQ B;  1YMP A;  3T8M A;  3Q9U C;  4TV3 A;  3CV0 A;  3QB2 A;  4CGV A;  3AG2 E;  3E34 A;  4FAD A;  4U95 D;  3CK9 A;  4YDE A;  2BF0 X;  1KZO A;  4HOR A;  2PZI A;  4BX8 A;  3CHS A;  4DI3 A;  1DVP A;  1IHG A;  4CZ2 D;  1FCH A;  5T4Y A;  2BED A;  1HX8 A;  2X6K A;  3DSU A;  1YCS B;  4AJW A;  3V31 A;  4U8H A;  2LSV A;  1OCO E;  2IEJ A;  3URZ A;  4LSZ E;  2V4H C;  3HVE B;  2Y4T A;  3OXG A;  3ZVV A;  2I2O A;  3D3M A;  3LXU X;  3ULQ A;  2DYS E;  4G25 A;  4MKT A;  2WB2 A;  2WXI A;  2IJG X;  4JZY A;  4HFG A;  3L6A A;  3ZIM A;  1INZ A;  4DI4 A;  2AWI A;  5FQ8 A;  5EIL A;  4I43 A;  3V2O A;  1GW6 A;  3D9N A;  3B13 A;  5CEA A;  1SQM A;  4OVV A;  3UIN C;  3CLJ A;  4JD2 G;  4M3O A;  2LXM A;  2WXQ A;  1HZ4 A;  2EIL E;  3L17 A;  1NZN A;  2ZIS A;  4J8D A;  3NOG D;  2AXU A;  1UJJ A;  4G11 A;  1TN8 A;  3PS6 A;  4NAC A;  5CCM A;  4GCN A;  4V3I A;  3ZRH A;  3CGH A;  1BU9 A;  2PNN A;  1OCZ E;  2MHK A;  1H2U A;  3RU0 A;  2C0L A;  2VQ2 A;  5AIJ A;  4J8E A;  4TUU A;  5EDS A;  2V0P A;  4HLE A;  2CG2 A;  2C0M A;  5B1A E;  4ABN A;  1KPS B;  3BG1 B;  3OTN A;  2X38 A;  5J08 A;  4N2Q A;  1MQS A;  4LER A;  3QDN A;  2IO2 C;  1N11 A;  4FC8 A;  3S7B A;  4QQI A;  3SFX A;  3DPY A;  4GTO A;  3FU5 A;  4L1B A;  4FLH A;  4J8F A;  4UI9 J;  5AQA A;  1OWL A;  3EDT B;  2NYJ A;  5FZS A;  3UUX A;  4AV7 A;  3T8K A;  2WXP A;  1EPU A;  3MCX A;  4G2V A;  4EZL A;  4ME2 A;  2WM9 A;  3T9K A;  3DSS A;  3BU8 A;  3CST A;  2OOE A;  1IYG A;  2QC9 A;  5G04 J;  3PRE A;  3VLE A;  2DZN A;  5EX3 A;  4GTT A;  1FT1 A;  3I5P A;  3CVP A;  3SQV A;  3ZYQ A;  3PE3 A;  4J8Y A;  1ELK A;  3UM3 A;  4OVU A;  3ULE G;  3Q73 A;  2Q7F A;  3UIO C;  3GZ2 A;  4CRW A;  2VSO E;  3QWP A;  3MKQ A;  3RRN B;  3FUF A;  4ACL A;  4GMR A;  4HXI A;  4UQX A;  2MYO A;  3BG0 B;  1N4R A;  4N39 A;  4YDY A;  1S70 B;  1N54 A;  2IU1 A;  2DBA A;  1ELR A;  1VDY A;  3L08 A;  4XEI G;  2DZO A;  3UT8 A;  3EHR A;  4WNF A;  3EUV A;  1ZU2 A;  1MX4 A;  5D0Q D;  4I6J A;  1UN8 A;  2OND A;  2RFM A;  4DPR A;  3S7J A;  4I9E A;  1Y6I A;  1TNB A;  2CFU A;  5LFA A;  2ZU6 B;  3R9A B;  1NA3 A;  5G2N A;  4BX9 A;  5BW8 C;  5G55 A;  2FI7 A;  1OUV A;  3FU3 A;  2WXO A;  2XS1 A;  3OXF A;  4WND A;  3KSL A;  2XCC A;  2GRN B;  2UY1 B;  1E7U A;  1X81 A;  1OXJ A;  2BKG A;  1DCE A;  3FEY A;  3QAQ A;  4M7C A;  2FF4 A;  3UT7 A;  2GRR B;  2A5U A;  1PC2 A;  3MZL B;  2ETA A;  3B95 A;  3SFY A;  3TXM A;  2NC9 A;  3WG7 E;  3HG0 D;  5HS0 A;  2BUG A;  1FT2 A;  5ENO D;  4WNG A;  2LAI A;  4RSY A;  3G2W A;  4PH4 B;  3FTU A;  5ENT D;  5KJN A;  1LD7 A;  4XKB A;  3FUM A;  4N5Q A;  4XIF A;  4AY6 A;  2OVB A;  5AN8 A;  3VTX A;  1PAQ A;  3J5Q B;  2VGX A;  3G2S A;  3EJN A;  3HXF A;  5DBK A;  4U04 A;  2J09 A;  3V30 A;  1LF8 A;  2XGM A;  2YHC A;  3LJ3 A;  1OWN A;  3JCK C;  5EN5 D;  5BV1 A;  3APC A;  5EYP F;  5JMN D;  5C2Y A;  2X3M A;  2XEE A;  3FUK A;  2R5S A;  2F0Y A;  3SZ7 A;  3U4T A;  4GTS A;  2J4D A;  3Q49 B;  5BT1 A;  3TWW A;  4LNG A;  4GA0 A;  5AJD A;  3PZD A;  1YYH A;  2LAH A;  2P9S G;  2P2C P;  4U63 A;  4MBG A;  2RFA A;  2WXR A;  2ZIR A;  3ZHE B;  2XEV A;  2AXZ A;  4GTP A;  4LEU A;  5CED B;  2P9L G;  3UX4 A;  3GZ1 A;  4N3C A;  3PZ1 A;  4RLY A;  3PEU B;  4Q69 A;  3GW4 A;  4GYO A;  2ZXW E;  5FQ6 A;  2VSN A;  3HIZ A;  1HS6 A;  4UI9 K;  4HQD A;  4AXH A;  1O5M A;  2X6F A;  2DYR E;  4K5A B;  4GPK A;  3QK0 A;  2H6I A;  4K03 A;  1HG2 A;  4EZK A;  1H6P A;  3DSV A;  3VTY A;  2XS8 A;  1JWF A;  4PUC A;  4GZC A;  2Y69 E;  4F7A A;  1BD8 A;  2ZGG A;  1P5Q A;  3DEP A;  3TJP A;  1QYM A;  4Z68 A;  3LY8 A;  1JUQ A;  3ZYL A;  1E7V A;  3RIB A;  4GB9 A;  2LSU A;  4MLP A;  3UKU G;  5FTP A;  1HG5 A;  4TXR A;  3RRU A;  2XHE A;  3LVR E;  4Q96 A;  4JXT A;  1E90 A;  2VSY A;  3TWT A;  1JWG A;  3DST A;  3SBT B;  4ATZ D;  1L5J A;  3CVQ A;  4AP2 A;  1AP7 A;  5ARF A;  1HO8 A;  1N4Q A;  3U66 A;  3FUJ A;  2XQ0 A;  4ATG A;  2KCV A;  3D9P A;  3C3Q A;  3RRM B;  4O6F A;  4URK A;  2OV8 A;  3KEA A;  5CRU A;  2AW6 A;  4PS7 A;  3ZEF A;  2ETC A;  4NUR A;  2EIN E;  3SO8 A;  5JHA A;  4GA1 A;  5LX8 A;  2GRM A;  1U3D A;  5KCM A;  3TWQ A;  2JEK A;  2FO1 E;  1TNZ A;  3CHP A;  2AJA A;  1QZ2 A;  3HYM B;  2V8S E;  3MKQ B;  3UMV A;  2PM6 A;  1N95 A;  1S64 A;  2L6J A;  1JCR A;  3FY4 A;  3D9L A;  1ZB1 A;  3I4R B;  5FQ7 A;  3C3O A;  3FP3 A;  3L54 A;  4FUL A;  2J08 A;  3DEO A;  3T5V A;  4GA2 A;  3FDH A;  2OCC E;  1XNF A;  4JL0 A;  4HRN A;  1HFA A;  3C98 A;  4K0R A;  3MKR A;  3LEW A;  3I4G A;  5BUZ A;  4L9P A;  3Q9N C;  2HE0 A;  2CHW A;  2XPY A;  3ASO E;  3SF4 A;  3MV3 B;  3EIQ C;  4U0Z A;  3CSF A;  4FJZ A;  4K5B A;  2NXP A;  4IYP A;  3ASN E;  1N0R A;  1OT8 A;  1H6O A;  1HH8 A;  5ANL A;  4IN3 B;  1MX2 A;  3LYA A;  1UOH A;  1H19 A;  3CKB A;  1OCC E;  2IO3 C;  4ACK A;  3FUN A;  3FTY A;  2IY0 C;  5ENS D;  2I9C A;  2IF4 A;  2EQX A;  3MA5 A;  3G2T A;  3ULY A;  1TYQ G;  3NZS A;  2H6F A;  5EYL A;  2Y0B G;  1H6K A;  3B7B A;  2F8Y A;  3V79 K;  1SA4 A;  1TN7 A;  4BT9 A;  2XCB A;  4RG6 A;  3WXX A;  3TWU A;  5KBA A;  4GZ3 A;  2KZT A;  5CRV A;  4NIK A;  2FEZ A;  3JXJ A;  2GRL A;  5ENP D;  3PEV B;  3D9M A;  2WXK A;  1TJC A;  2KBX A;  3FTZ A;  1WAO 1;  3EHN A;  4JHR A;  3HXB A;  3L82 A;  4JPS A;  5CEC B;  4UI9 C;  1D9S A;  2QYU A;  5A6C A;  2A5E A;  4BT8 A;  4LCT A;  4C0M A;  3NB2 A;  1Z3X A;  4ILH B;  3ZPJ A;  1E96 B;  1NI1 A;  4EZJ A;  3ASD A;  1V54 E;  2DCP A;  5C1D A;  3PVL A;  3APF A;  1X5B A;  2GRO B;  5G04 C;  5E76 A;  3ABM E;  4JC8 A;  5AQ7 A;  5LCW J;  1K8K G;  5A7D B;  3AU4 A;  1E8X A;  4MS6 A;  5JJT A;  3FTW A;  1SA5 A;  3Q75 A;  3RK6 A;  4TUM A;  4CT0 A;  2P9P G;  1BI8 B;  5J90 A;  3ZYM A;  4GML A;  4HVB A;  4DX6 D;  3FTS A;  3G2V A;  3CQC B;  3LS8 A;  3UXG A;  4BET A;  4U0U A;  4JVS A;  5HRY A;  5FIO A;  3S7F A;  5G05 J;  1WDY A;  4B8C B;  2XPI A;  4H7X A;  4FHJ A;  1K3Z D;  1N9A A;  4UUC A;  1RW2 A;  3CHQ A;  3VLD A;  4RG9 A;  2PL2 A;  1TNU A;  1QQE A;  3E37 A;  1IKN D;  1TJF A;  4HRL A;  3ASH A;  5FZR A;  3TAX A;  2XEH A;  3FU6 A;  2P9U G;  4GAA A;  4A55 A;  3D9I A;  3UQ3 A;  3FH7 A;  4X8Q A;  2AXV A;  2RG8 A;  1Z6T A;  4GTM A;  4I2W A;  2CG3 A;  4YDW A;  3JXI A;  3FTV A;  4I9C A;  3ASF A;  3IXE A;  3IHY A;  4B94 A;  4F6R D;  4Y6C A;  4O1O A;  3DXM G;  2J8S D;  2WQH A;  3QWW A;  4WWO A;  1Z5S C;  3L13 A;  3TWR A;  5BXO A;  4HRM B;  4DX7 D;  4OAU C;  4GTV A;  4U8Y D;  1H0A A;  4Y6W A;  5KNG A;  1HU3 A;  2YNQ A;  2XZD G;  4KBQ A;  3R9M A;  5FWQ A;  2QY7 A;  3B7T A;  3PDN A;  3RJV A;  2ETB A;  4G24 A;  4LRZ A;  3S2A A;  1LD8 A;  4F3V A;  5HQ8 A;  3E32 A;  3UTM A;  4B89 A;  2PM7 A;  4UWL A;  4GMJ A;  2KCK A;  1QBQ A;  3ENE A;  3LY7 A;  1E8Z A;  3ISM C;  2R02 A;  4GYW A;  3NBN B;  3B7S A;  3RAU A;  3QAR A;  4DLQ A;  3CHR A;  5D66 A;  3DSW A;  3P2B A;  4GCO A;  4J7W A;  3ESL A;  3FU0 A;  4ANX A;  3ONL A;  4ILI A;  3U64 A;  3BEE A;  3PZ4 A;  3AG4 E;  4CGW A;  4AY5 A;  1MZC A;  5B1B E;  1EDU A;  3UT4 A;  3LPZ A;  3SY2 A;  4C48 B;  3CK8 A;  5DIZ A;  4ANW A;  2WXN A;  2YHE A;  4DUI A;  3O48 A;  3ZNG A;  3GZS A;  4U96 D;  3PZ3 A;  2R59 A;  4PDX A;  5LOZ A;  3NAW A;  4AEZ C;  4HOQ A;  3LY9 A;  4I6E A;  3DBS A;  4FLB A;  3FHE A;  4FP7 A;  5BV0 A;  1O1S A;  3PH0 C;  3SNX A;  2E2E A;  4UWK A;  2X6H A;  2CHZ A;  1IXV A;  4GTR A;  3ZFW A;  2B0O E;  3CVV A;  4NQ0 A;  3O4Z A;  3C5R A;  2X6J A;  3DWL G;  5A23 A;  2BKK B;  4APF A;  3ZXP A;  2Y4U A;  4G1T A;  2L0I A;  3D9J A;  2VYI A;  2X6I A;  1U3C A;  1S63 A;  1RZ4 A;  4GPM A;  3D9H A;  2H6H A;  4I17 A;  1FVH A;  3JUI A;  5AAO A;  3MEK A;  2F8X K;  4N2S A;  4B0Z A;  2VTB A;  2V4L A;  1UN9 A;  4JB8 P;  3MV2 B;  4TXP A;  2LO6 A;  2DWZ A;  5D0O D;  4CDM A;  1Y8M A;  4FHK A;  5BNW A;  4XZ4 A;  3GYZ A;  2C2L A;  2ION A;  4N3B A;  3HRA A;  5ITZ F;  1ZBP A;  4OYS A;  4KVO A;  2GW1 A;  1N52 A;  5BXU A;  1N4S A;  3QJZ A;  1N0Q A;  4AM9 A;  4HLL A;  3CVL A;  3MYV A;  2M63 A;  4U7E B;  1BLX B;  5D2M C;  3G2U A;  3QOU A;  3K9I A;  2WXL A;  4N5C A;  1W3B A;  5E75 A;  3IHV A;  4J6I A;  4CT4 A;  3SBS A;  3FUI A;  4CEM A;  4JEH A;  4WWN A;  2UWJ G;  3E30 A;  2ZGD A;  4DRX E;  2OEV A;  4CDR A;  5IY5 E;  2QZA A;  1IQR A;  4AIF A;  3F6Q A;  1YA0 A;  1OWP A;  3UM0 A;  4F1P A;  3Q4A B;  2XGO A;  5ENQ D;  1Q2Z A;  4ZHB A;  2UY1 A;  1TNO A;  4APO A;  1ELW A;  3SHF A;  1E8W A;  4U0S A;  4BY6 A;  2IFU A;  1JCQ A;  3IEG A;  3ZN3 A;  3JYS A;  2HM8 A;  1BPO A;  5JA4 D;  4UQY A;  1H2V C;  5ENN A;  2LNI A;  2GGF A;  4EEC A;  4BTB A;  4QFV A;  2QFC A;  4R7L A;  4N3A A;  2HYZ A;  4A3V A;  1MYO A;  4F1S A;  3CVW A;  4DLO A;  1TN6 A;  2E0I A;  3ABL E;  3AJI A;  4H7Y A;  4GYY A;  3UPV A;  4CYM D;  5KJK A;  2EIK E;  3RO3 A;  2LUH A;  4BTA A;  4KT6 B;  4XI0 A;  3EU9 A;  3ABK E;  4YND A;  3AAA C;  4WAF A;  4L23 A;  1U2V G;  2Y1L E;  3LVQ E;  4BFR A;  1UJK A;  1OY3 D;  4KYO B;  2AVP A;  3PNT B;  1E8Y A;  4BES A;  4KZ0 A;  3BUA A;  2WVI A;  2PQN A;  3MGB A;  4XX5 A;  1DNP A;  2WPV A;  2MOW A;  2WXG A;  4CDN A;  3ZU7 B;  2WQ7 A;  2HR2 A;  5ARG A;  2WMO A;  1OWM A;  3L22 A;  3ZHE A;  4YVQ C;  4NRH B;  4G8K A;  3W9F A;  1NL4 A;  3W9G A;  2A4Z A;  5AYW D;  4I2Z A;  4DJA A;  3R7R A;  4XE0 A;  5KJM A;  2V5F A;  4U8V D;  1B89 A;  2VJ8 A;  5EX0 A;  3J5P A;  2WXH A;  3ZUV B;  3LDZ A;  3AS5 A;  3LJN A;  3CIA A;  3Q15 A;  4LNU D;  4GZD A;  2F37 A;  2B6C A;  4HNA D;  2R03 A;  1IHB A;  1BI7 B;  1SZ9 A;  2XRY A;  4WNE A;  2KM4 A;  1AWC B;  3E33 A;  5CBO A;  1A17 A;  2IQC A;  3Q78 A;  3KEZ A;  1WY6 A;  1Z3Y A;  2R2L A;  1KT0 A;  3NQP A;  5AQ9 A;  3RSE G;  4HOT A;  4LG6 A;  4BSZ B;  2OEW A;  5FIN A;  2JLB A;  3Q5M A;  1WM5 A;  2MRI A;  3CVN A;  3KS2 A;  4B8A A;  4BER A;  4JA9 A;  4EQF A;  3FH5 A;  3FWV A;  2PQR A;  1S0P A;  2XEN A;  1QNF A;  3JUE A;  3VLF A;  4C0E A;  2P9N G;  2WXM A;  4Q94 A;  2WXF A;  2VGX B;  3CEQ A;  2CHX A;  2YIN A;  2NSZ A;  1D8D A;  1HXI A;  5JJ7 A;  3ZW3 A;  5KWD A;  3S7D A;  3FUL A;  1UG3 A;  3ZYK A;  4IRU A;  1JCS A;  2Y3A A;  4E85 A;  4D10 C;  1O1R A;  2BTD A;  2VGE A;  1SW6 A;  3T5X A;  3P1U A;  4ANV A;  4AOF A;  3FUH A;  3TGO A;  4GTQ A;  4I1O B;  4TRQ A;  4E6H A;  1NP7 A;  4JHJ A;  2XGS A;  5LCW C;  2VGY A;  1A5E A;  5CBN A;  5EIB E;  4FU3 A;  1PY1 A;  2VSX E;  5EID A;  4FJY A;  3IV0 A;  2I6H A;  2P9I G;  3V2X A;  2I1J A;  4L2Y A;  3QWV A;  3B7R L;  3CR3 A;  5M72 A; 
#chains in the Genus database with same CATH homology
 1MYO A;  1BI7 B;  3TWT A;  4O1P A;  4HRN A;  1IKN D;  3EHQ A;  4ATZ D;  1AWC B;  5EIL A;  2XEE A;  5CBO A;  1K1B A;  3HRA A;  4HRL A;  5ITZ F;  1MJ0 A;  3V2O A;  3UI2 A;  4HBD A;  2XEH A;  4C48 B;  5AQ9 A;  5CEA A;  3TWV A;  1SVX A;  5CEC B;  1AP7 A;  4DX5 D;  1D9S A;  3AJI A;  3Q9N C;  3T9K A;  5BXU A;  1DC2 A;  2HE0 A;  2KXP C;  4LG6 A;  2A5E A;  4BSZ B;  5AQB A;  1N0Q A;  3TWW A;  4CYM D;  1TR4 A;  2QC9 A;  2V5Q C;  5FIN A;  3TWX A;  1YYH A;  3ZNG A;  4DUI A;  4ZFH A;  4HI9 A;  4U96 D;  2P2C P;  2DZN A;  4HLL A;  2RFA A;  3EU9 A;  4BER A;  1BLX B;  3NOG D;  4YDW A;  3JXI A;  5CER B;  1WG0 A;  3AAA C;  2BKG A;  2XEN A;  3IXE A;  4HB5 A;  1MX6 A;  4J8Y A;  1DCQ A;  1YMP A;  4F6R D;  4K5B A;  2L6B A;  3Q9U C;  3JUE A;  4O1O A;  2Y1L E;  5CED B;  2J8S D;  1OY3 D;  4BEP A;  5HKP A;  1N0R A;  1OT8 A;  3NOC D;  4U95 D;  3TWR A;  5BXO A;  4HRM B;  4DX7 D;  2ETA A;  3KEA A;  3B95 A;  2ZGD A;  1BU9 A;  4RLY A;  1G3N B;  4BES A;  4A63 B;  2ETC A;  2PNN A;  4DRX E;  4OAU C;  1MX2 A;  4U8Y D;  1IXV A;  2JAB A;  5AQ7 A;  5KNG A;  2XZT G;  5KWD A;  4GMR A;  3HG0 D;  1UOH A;  2B0O E;  3F6Q A;  4HQD A;  5HS0 A;  3SO8 A;  2MYO A;  5ENR D;  2XZD G;  4K5A B;  5AAR A;  4CZ2 D;  4F1P A;  3C5R A;  4YDY A;  5ENO D;  4K5C A;  4OAV B;  4G8L A;  2BKK B;  5ENS D;  1S70 B;  2VGE A;  5ENQ D;  1SW6 A;  3ZU7 B;  4O60 A;  3TWQ A;  1YCS B;  2ETB A;  5EYL A;  4ZHB A;  2FO1 E;  5ENT D;  2Y0B G;  4TUM A;  3B7B A;  3V31 A;  2AJA A;  2F8Y A;  3V79 K;  3UTM A;  4N5Q A;  2DZO A;  1N11 A;  1BI8 B;  3EHR A;  1BD8 A;  4G8K A;  3W9F A;  4B93 B;  2ZGG A;  4LSZ E;  4QQI A;  2V4H C;  3TWU A;  4DX6 D;  3W9G A;  5AN8 A;  4GPM A;  5CBN A;  1A5E A;  5KBA A;  1K1A A;  3D9H A;  3ZKJ A;  1MX4 A;  3UXG A;  4BET A;  3DEP A;  5EIB E;  5KNH D;  1QYM A;  1NFI E;  3J5Q B;  3NBN B;  4Z68 A;  5JA4 D;  2RFM A;  5HRY A;  5FIO A;  4NIK A;  5AAO A;  1WDY A;  4DX2 A;  2F8X K;  4U8V D;  5AQA A;  5EID A;  4DX1 A;  2DVW A;  3JXJ A;  3V30 A;  3DEO A;  5D66 A;  3J5P A;  2QYJ A;  3ZUV B;  4HI8 A;  3V2X A;  1K3Z D;  4QFV A;  5ENP D;  3LJN A;  3TWS A;  2NYJ A;  4J7W A;  4JB8 P;  4LNU D;  4UUC A;  2DWZ A;  3T8K A;  2F37 A;  4HNA D;  2KBX A;  5EN5 D;  5EYP F;  5JMN D;  1IHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...