3ISMC

Crystal structure of the endog/endogi complex: mechanism of endog inhibition
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
333
structure length
286
Chain Sequence
b'AQNDYTIGLVDPVKDYQKLIETRVQVDEIVDDDVTKENFDRTAAAARDVIWRLLFDEAGTSQSNTEKASQLLEEYRGDACFYDPTPYNEWIVKLRDEVLKKELLDFWRDVLVKKQLGPCWSRDSDLFDSDDTPPLEFYAHAGCTAPFAASLKVRLEEYRTLMKRFVIIVPDSVHQASVKKIAAAAREIIWKLLFDGTPSAEDQNKAAELLQEYKGDAGFYGPDDYNSWIFNLRDEVLTKELLDFWRDKMVKMELGPSCARDSDYYDNEDPLPFEFYEKAGCKAPFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG8862
publication title Crystal structure of the EndoG/EndoGI complex: mechanism of EndoG inhibition.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase inhibitor/hydrolase
total genus 94
structure length 286
sequence length 333
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2009-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08785 Ku_PK_bind Ku C terminal domain like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.240 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ku, C-terminal domain 3ismC02
1.25.40.240 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ku, C-terminal domain 3ismC01
1Q2ZA 1RW2A 3ISMC
chains in the Genus database with same CATH superfamily
3LKUA 2KATA 3ABKE 4ANWA 3UXGA 3AG3E 3LDZA 2F0YA 4U04A 3T8KA 4B93B 3SY2A 2DIWA 4HB5A 4O6FA 4UI9J 4AVXA 4CDMA 3ZW3A 5LCWJ 3QB2A 1SW6A 2EQXA 2WXLA 5ANLA 3CVWA 4XKBA 3V31A 5D66A 5J90A 3J5PA 3MV3B 5CECB 1Z3YA 1EPUA 1FVFA 3CVLA 1H6OA 4AP2A 1OCRE 2QYJA 3GZ2A 4W9RA 2IY0C 5BUZA 4UWGA 4HI8A 5BV0A 4K5BA 4HRLA 1HX8A 4JHRA 3ESLA 4AV7A 3ZYQA 5CRUA 3UT8A 1K1BA 4U8YD 2GRNB 2P9PG 4LEUA 4G8KA 1KPSB 3BQOA 3ONLA 2R02A 4MLPA 5EIDA 4EZLA 4HOSA 4FP7A 1Z6TA 3ULYA 1YCSB 3PEUB 3UPVA 4GPKA 5KJLA 4J8FA 4AIFA 4LG6A 3LVQE 2CHZA 3L82A 3PVLA 3U4TA 3PZDA 4KVMA 4U07A 3DEPA 1PY1A 2GROB 4JEUA 4KT6B 4NIKA 2VSNA 3V2OA 3EDTB 2VJ8A 2IU1A 4G24A 4XE0A 5CBNA 2XRZA 3P1UA 4WNGA 4OAUC 3ULEG 4G26A 4BWRA 2R05A 2IF4A 4LERA 4J8EA 4BESA 2VTBB 1WAO1 2ETAA 3PNTB 4U8VD 4YVOA 1NP7A 2QYUA 4M3OA 2Y0BG 4FC8A 1E8WA 3IHVA 2LXLA 2LAIA 3BUAA 4MS6A 3MX3A 2JEKA 3QARA 3HXFA 1U2VG 4U8HA 2KXPC 2ONDA 2C0MA 2IO3C 3RU0A 3KSLA 3LY7A 5H7PA 3KEAA 3LY9A 4JA9A 4FHKA 3SZ7A 3AG4E 4X8QA 1OUVA 2XZDG 5FIOA 3EIJA 2IJGX 1INZA 3FUHA 3HVEB 4JZYA 4G1TA 3AS5A 3TJPA 2E2EA 4DPRA 5AIJA 3CHRA 4OVVA 4GCNA 4I9EA 4N3BA 2FBNA 4JHKA 4GMJA 3TXNA 4J8DA 4WNFA 3APDA 5KBAA 5EIBE 1TNBA 4KVOA 3Q49B 3AG2E 3L17A 5EX0A 3E4BA 3HYMB 1NI1A 2V0PA 4LRZA 3DWLG 4GMRA 2M63A 2YNQA 3UT7A 3TG4A 3OXGA 4APOA 2GW1A 3ZVVA 3FFLA 5ENQD 3FU3A 3T5XA 3C3OA 4F1SA 2AXVA 1H0AA 1H6KA 5AARA 2GRPB 2L9BA 3ESKA 2IFUA 2ZU6B 4RVBA 3FUJA 5B1AE 2ILRA 2ZIRA 4WAFA 2KZTB 3DSTA 2V5QC 3JCKC 4DX2A 1EF1C 1H2UA 2H6IA 1DNPA 3C98A 4L2LA 3MEKA 4DX1A 4AXHA 4HOUA 3E37A 3ASDA 3PEVB 4GZCA 3DXKG 3IBEA 3IV0A 4Q69A 4C0EA 3DSUA 1TJFA 1QNFA 1H2VC 1TNYA 2XEHA 4D10C 1D8EA 3GYZA 1QBQA 4XZ4A 5CBOA 2WM9A 3RRMB 2KCVA 1A5EA 4I1MA 4K03A 3LJNA 4L7TA 4ABNA 4DJAA 3MJWA 5FQ8A 3KSQA 1OY3D 3B7RL 3LJ3A 1TNUA 2WXOA 3ZNGA 2WXGA 1WM5A 3L9TA 2A4ZA 3CKBA 4H7XA 2DWZA 3L54A 3IEGA 1ZB1A 4QFVA 3EIQC 3AG1E 2WMOA 3RRNB 3CHPA 3NAWA 1K1AA 1OWPA 3ONKA 4UI9K 3MKQA 4C9BB 3PS6A 1N0RA 2L0TB 4JXTA 5FINA 3FTUA 3CHOA 2XHEA 4UI9C 2WXPA 3PUJA 3FUEA 4LNGA 2J8SD 3OAWA 1EYHA 3QJZA 1PC2A 4B89A 4E85A 4A1SA 2P9LG 3G2TA 3QOUA 3DSWA 1ZU2A 5ENPD 3ZIMA 2QC9A 4HNAD 1UJJA 2DCPA 3IHYA 1FT2A 4UQXA 2R03A 4A63B 2QY7A 3RSEG 3FU0A 5JHBA 5ENNA 2OVFA 3UM1A 4BTAA 2WB2A 1S0PA 2P58C 2L0IA 2FO1E 4L9PA 4B0ZA 2YHCA 2LSVA 2WXNA 4J0UA 1SZAA 3KS2A 3CHMA 5CCMA 3LY8A 4XEIG 3HIZA 1HFAA 2LXMA 4GTMA 2B6CA 3UKRG 1WG0A 3DEOA 2XPZA 4ILGA 4IYPA 4MRUA 3FTZA 2PNNA 3Q5MA 4K5CA 4Y6CA 3R9MA 4CT4A 2XS8A 3TXMA 5JA4D 1YYHA 3UM2A 4GTRA 2AXUA 1SQMA 5CCLA 1HG5A 4UQYA 1PAQA 2Y1LE 1OT8A 4F6RD 4N5CA 1DCEA 4U0UA 5G2NA 2KCKA 2RD0A 2F8XK 3QAQA 4L2YA 4O1OA 2Q7FA 1U3DA 3E32A 1DCQA 4PH4B 2V5FA 5ENSD 3LYAA 2I6HA 4U63A 3ZXPA 2KBXA 1OCOE 1N4QA 4PDXA 3PH0C 2J9QA 3PE4A 2VGEA 3FH5A 3FULA 2GRMA 5HRYA 4KZ0A 3TWTA 5ITZF 4ZHBA 3PRZA 5B3SE 3Q78A 2LNIA 2X6JA 3D9KA 3ABME 5KNGA 3ULQA 2MRIA 2EINE 2HE0A 4U95D 3UINC 1ELRA 1AP7A 2HO1A 1O1RA 3PNLB 1MZCA 1V54E 4CYMD 1FT1A 2ETCA 4DLQA 2J4DA 3FHEA 5HKPA 2X38A 3UTMA 5FJYA 4TRQA 4XIFA 3ASHA 4G23A 3LXUX 3HXBA 4CT0A 1E90A 1MJ0A 4TXQA 3FY4A 1O5MA 4KZCA 4Q96A 4AJWA 4JVSA 2OCCE 3CVXA 2PM7A 2R5SA 1S64A 1E8XA 3DBSA 4RQIA 2XQ0A 1KZPA 3NOCD 4YVQC 2RG8A 3CLJA 3UIPC 2ZGDA 4Q94A 1LTXA 3FUDA 3SO8A 3T9KA 2B0OE 5D2MC 3LEWA 5FT9A 3RKVA 5LFAA 3MV2B 2IOSA 4AY6A 2DYSE 1MHQA 4CZ2D 3RIBA 4PS8A 2I2OA 4N2QA 1SZ9A 3GW4A 4XKCA 2OEWA 5AYWD 4HQDA 1H6PA 3TWSA 3ENEA 5A23A 4GA1A 3FUIA 3C3QA 1IXVA 5EYLA 2CFZA 1U3CA 4UWFA 1YA0A 4DRXE 1IHGA 2GRRB 3IKOB 4B94A 3JUEA 1TN6A 1E96B 2IONA 3OXLA 3L22A 3EHRA 1TN7A 4LNUD 3B7SA 3D9PA 1HF8A 5HS0A 1YMPA 3QC1A 2VGXA 2AWIA 2RFAA 5FQ7A 2AXZA 1OXJA 1DC2A 3FU5A 2BKGA 2C0LA 3EHQA 5G04C 3V79K 1Y6IA 3QWVA 4ANVA 4AY5A 5JMND 3HXDA 4CDNA 1WDYA 3T8MA 5KNHD 3L13A 3MA5A 4OYSA 3VTXA 4FA6A 1KT1A 5AAOA 1JWFA 1HZ4A 3CV0A 4CDRA 2NSZA 2XS1A 1ELWA 2CG3A 4E6HA 3BG0B 4GYOA 1NL4A 5HI7A 1NFIE 3RRUA 4WWOA 1DVPA 3CVQA 3SD5A 2WQHA 3SBSA 4EHMA 5CMYA 4A55A 4FLBA 4O1PA 3CHSA 1MX2A 2UY1A 4Z68A 5AJLA 3GZSA 3DSSA 2WXJA 5EYPF 4KBQA 2NXPA 4FHJA 2NC9A 5M72A 3PUKA 3D9LA 3ZUVB 1AWCB 3W9GA 2EIME 1E8YA 2R59A 2VQ2A 3FH8A 4FJZA 1E7VA 3QWPA 4ANXA 1HO8A 4NQ0A 1H19A 3WG7E 2IOLA 4EPZA 5E75A 4CGWA 5C1DA 3SQVA 4JW1A 3T5VA 2OEVA 4I1AA 4BY6A 4EBAA 4I9CA 1RZ4A 3JQ0A 3L6AA 2I9CA 2XPIA 4HXIA 3D3MA 1W3BA 3BU8A 3G2WA 4LUNU 4P29A 2YHEA 3AS4A 4O60A 4I6JA 1O1TA 3CQCB 5G55A 4TXPA 1QYMA 3QDNA 4L1BA 3DPDA 4B8CB 1UG3A 5FQ6A 4EBAG 3UM3A 4BX9A 2EILE 3DRAA 3LS8A 3FTWA 3FP3A 4GU5A 3CHQA 3B7TA 3G2VA 3FWVA 5D0OD 2WXIA 4ANUA 4A3TA 2XCBA 5CEDB 4H7YA 4YNDA 4GZ3A 2HR2A 3UUXA 2LAHA 3BG1B 4TV3A 1JPLA 2ETBA 3CSFA 2F37A 3AU5A 4UWHA 1UN8A 4HRNA 5T3RA 5G04J 1SA4A 4DUIA 1N95A 4GA2A 2IEJA 1MX6A 1X81A 3CGHA 2J08A 4DK5A 2EIKE 3IXEA 1N11A 3FUKA 3TWWA 3PZ4A 4CEMA 2VTBA 3Q15A 4I2ZA 5AQ7A 2BUGA 3L08A 4KYOB 2H6HA 1OWLA 3TG5A 3CVUA 4WWPA 4GZDA 2FULA 4I6GA 4KMOA 3PREA 1E7UA 2ZGGA 3ASNE 3Q73A 3ZFWA 3MZLB 2IQCA 2J4BA 1MQSA 3D9OA 1K3ZD 2XRYA 2I1JA 2QZAA 4RG6A 3HVEA 3LCAA 3KAEA 3QNKA 5LP0A 5BXOA 4HS2A 1XGWA 3TWVA 1G3NB 1ELKA 4MBGA 1IKND 2H6FA 1Z3XA 5ENTD 3ZXSA 2WQ6A 3CVNA 4J8YA 2XGMA 4G2VA 5AN8A 3ZYLA 4HLLA 4EZJA 3D9MA 1IHBA 3ZN3A 3L16A 1IQRA 3D9IA 5G05J 1Z5SC 1L5JA 4GTSA 3OXFA 3ZRHA 3ZU7B 5KJMA 4ILHB 4AEZC 3ML9A 3UX4A 3TWXA 1A17A 4MKTA 3FTSA 3LVRE 5E76A 3C5RA 3FH7A 2KC7A 3S7BA 1TN8A 5AQ9A 2GGFA 2PQRA 3C72A 2WXMA 4TUUA 2AW6A 1D8DA 4N3CA 3R7QA 3D9HA 3ZPJA 3CK7A 5BPPA 3B7UX 3Q7AA 2DZNA 4PS7A 5BT1A 3DSVA 2KZTA 2CHXA 4HBDA 3CEQA 3G2UA 3V2XA 2FF4A 4GA0A 4TXRA 5J08A 3SGHA 4XI0A 3J5QB 3NF1A 4BT9A 3E33A 5T8IA 2J49A 2WVIA 3ZYMA 4AOFA 4FULA 3ABLE 3HRAA 4BTBA 3FUNA 1NZNA 4ACKA 2DBAA 4GTOA 2X6IA 2WXRA 4HFGA 2OOEA 2WMNA 5IY5E 4A1GA 3FEXA 3NZSA 3C3RA 3DPYA 4JHJA 3G2SA 4PS3A 4KXKB 4R7LA 1LD8A 3ZHEB 5ANRA 4BT8A 3RO3A 3TGOA 3CIAA 4UWLA 2WPVA 2A5EA 4RLYA 3SFYA 2P9IG 3Q75A 2R2LA 3APCA 4WNEA 3V30A 3Q9NC 5CHEE 1FCHA 2F8YA 1N54A 2UWJG 2WXKA 4I17A 1ZBPA 4I43A 2CHWA 1P5QA 4GCOA 3CK8A 1WY6A 3I4GA 2BEDA 2V4HC 1RW2A 4DI3A 5CRVA 1OWNA 2VGYA 4UQZA 4I6EA 1N4PA 1E8ZA 5FTPA 4EZKA 4ME2A 5EDSA 3ZGQA 2NYJA 5ARGA 3ASFA 2VYIA 5AQAA 4F53A 1BU9A 3TWUA 4FLHA 3D9JA 4GZ5A 4BEPA 1BI7B 4FU3A 4Y6WA 3SFZA 3S2AA 2V8SE 4TUMA 2Y3AA 4GTQA 2MHKA 2EIJE 4GTPA 3FDHA 5A6CA 4UWKA 4B8AA 3NZUA 3Q7FA 2JABA 1H2TC 3HXCA 3B13A 1EDUA 3SI5A 1S63A 2WQ7A 1N4RA 3FTXA 1BI8B 3VTYA 2AVPA 3X2QE 1JUQA 2XGSA 5D0QD 3UI2A 4U0ZA 1UW4B 1OCZE 3MGBA 1VDYA 3E34A 4BETA 1JCSA 1TR4A 4EECA 1OWMA 1TNOA 4HRMB 2C2LA 2BF0X 4K5AB 3ML8A 5JJ7A 2P9NG 2L6BA 4F1PA 4FADA 4APFA 3UQ3A 2CG2A 3OTNA 3EUVA 2FEZA 5BV1A 3PZ2A 3RK6A 4C0MA 3I4RB 3SFXA 4GYWA 4GPMA 2VSYA 4J6IA 4I1OB 3FEYA 4LNBA 3SBTB 1GW6A 1KLXA 2FI7A 3APFA 4GTVA 3JYSA 3I5PA 4CRWA 1FPPA 4JD2G 1TNZA 5A7DB 5BNWA 3GZ1A 1OWOA 5EN5D 1KT0A 3PZ3A 1MX4A 3AAAC 2P9KG 3KD7A 3HDXA 3ZKJA 5LOZA 4L23A 1BD8A 3CVPA 5FZSA 3MKQB 3ISMC 3K9IA 1LD7A 1V55E 4BERA 4BX8A 1D9SA 2AJAA 3DXMG 2P9SG 3AU4A 3EU9A 2MYOA 4XX5A 4DX5D 1UOHA 2OV8A 2WXFA 4NURA 5FZRA 4N39A 1KZOA 4URKA 3VLEA 4K0RA 4QQIA 4DLOA 2XEEA 3B95A 3KEZA 4IN3B 5ENOD 5KWDA 4JEHA 5KCMA 3ZHEA 1JCQA 5KJNA 3HHMA 4DX7D 3Q9UC 3UIOC 5AJDA 1HU3A 1K8KG 4I2WA 3EHNA 3MKRA 3FUMA 2J07A 2X6FA 4YDEA 1O1SA 2LUHA 2KM4A 3U9WA 3MCXA 5ARFA 4G11A 4GAAA 4YDYA 4N3AA 2H6GA 2Y69E 3SNXA 1BPOA 3BEEA 2E0IA 3U3WA 4YDOA 5G05C 3RJVA 4BSZB 2MOWA 1S70B 2PM6A 2XEVA 3QKYA 2X6KA 1LF8A 4WUYA 3JXIA 3S7FA 5CEAA 2XPYA 4G25A 4ILIA 3O48A 1N9AA 1FVHA 1HS6A 4NACA 5JJ6A 3PZ1A 4HI9A 3RAUA 1Y8MA 2ZISA 2YQ8A 3LPZA 3ZYKA 3JQ1A 2P2CP 4J8SA 3SHFA 3TAXA 1N52A 3QWWA 4G8LA 5T4YA 1IQUA 4A3VA 2X6HA 3UKUG 2PL2A 1TEZA 1NA3A 2GRLA 2L6JA 3QK0A 3S7DA 1UN9A 3EHMA 1N94A 3PE3A 4N5QA 2X3MA 3JUIA 5BW8C 3UM0A 2V4LA 3PDNA 3UMVA 2GRQB 3FTVA 4GZ6A 2CFUA 4GYYA 3F6QA 3TWQA 3U64A 2WXQA 2PZIA 4RSYA 5DBKA 5DIZA 3FUFA 1OCCE 2I1KA 1HXIA 4WWNA 2Y4TA 4DX6D 1JCRA 3MYVA 4JB8P 3R7RA 4CCAA 4YDWA 1TJCA 4CGVA 4BSXA 3WXXA 5ENRD 2HYZA 3D9NA 3P2BA 2LO6A 2JLBA 4JC8A 3N71A 1B89A 3I3NA 5AQBA 2LSUA 2OVBA 4JPSA 5LCWC 1QZ2A 2PQNA 2P9UG 3CKCA 4GTTA 4ATZD 1TYQG 4IULA 1SA5A 2FO7A 2R17C 5FWQA 3JXJA 3HXEA 4OAVB 1IYGA 3U66A 2XCCA 4U96D 3Q47B 4PUCA 4BFRA 3EU5A 3S7JA 4V3IA 3VLFA 4LCTA 4LSZE 1JWGA 5EILA 4NRHB 5EX3A 5CERB 4WNDA 5JHAA 4JL0A 2XENA 1QQEA 4DI4A 3CR3A 3CVYA 3O4ZA 2QFCA 3NOGD 2RFMA 4EQFA 5FQ4A 5HQ8A 2VSOE 2XGOA 3AS8A 4FJYA 3CVVA 3R9AB 3B7BA 4HLEA 5LX8A 3E30A 4UUCA 3EJNA 3ASOE 4GMLA 5BXUA 4F3VA 2HM8A 5CMWA 1HG2A 4GB9A 4HORA 3FU6A 2VSXE 2DYRE 1N4SA 4RG9A 2WXHA 2VGXB 3ZEFA 5C2YA 3Q4AB 4ACLA 2A5UA 1BLXB 4HVBA 3ASGA 3Q79A 2Y4UA 1UJKA 2DVWA 3CSTA 3RO2A 4JA7A 4J7WA 4OVUA 3TWRA 4U7EB 1MYOA 1XNFA 2J09A 3HG0D 3URZA 2YINA 5FZQA 3TL5A 2BKKB 3AJIA 2XZTG 3CK9A 4ATGA 4C48B 5JJTA 1HE8A 4IRUA 3CQGB 5AENA 3SF4A 3UT4A 3NB2A 5B1BE 2DZOA 2BTDA 2IO2C 5EKQD 3NBNB 1HH8A 4N2SA 2ZXWE 4M7CA 1N0QA 4AM9A 3NQPA 4ZFHA 1Q2ZA 1SVXA 3W9FA 1X5BA 2KCLA 4HOQA 2RKKA 4F7AA 2UY1B 4U0SA 1NA0A 3VLDA 4XI9A 3DSXA 4HOTA 5KJKA 3FTYA
chains in the Genus database with same CATH topology
1Q2ZA 1RW2A 3ISMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q2Z A;  1RW2 A;  3ISM C; 
#chains in the Genus database with same CATH topology
 3LKU A;  2KAT A;  3ABK E;  4ANW A;  3UXG A;  3AG3 E;  3LDZ A;  2F0Y A;  4U04 A;  3T8K A;  4B93 B;  3SY2 A;  2DIW A;  4HB5 A;  4O6F A;  4UI9 J;  4AVX A;  4CDM A;  3ZW3 A;  5LCW J;  3QB2 A;  1SW6 A;  2EQX A;  2WXL A;  5ANL A;  3CVW A;  4XKB A;  3V31 A;  5D66 A;  5J90 A;  3J5P A;  3MV3 B;  5CEC B;  1Z3Y A;  1EPU A;  1FVF A;  3CVL A;  1H6O A;  4AP2 A;  1OCR E;  2QYJ A;  3GZ2 A;  4W9R A;  2IY0 C;  5BUZ A;  4UWG A;  4HI8 A;  5BV0 A;  4K5B A;  4HRL A;  1HX8 A;  4JHR A;  3ESL A;  4AV7 A;  3ZYQ A;  5CRU A;  3UT8 A;  1K1B A;  4U8Y D;  2GRN B;  2P9P G;  4LEU A;  4G8K A;  1KPS B;  3BQO A;  3ONL A;  2R02 A;  4MLP A;  5EID A;  4EZL A;  4HOS A;  4FP7 A;  1Z6T A;  3ULY A;  1YCS B;  3PEU B;  3UPV A;  4GPK A;  5KJL A;  4J8F A;  4AIF A;  4LG6 A;  3LVQ E;  2CHZ A;  3L82 A;  3PVL A;  3U4T A;  3PZD A;  4KVM A;  4U07 A;  3DEP A;  1PY1 A;  2GRO B;  4JEU A;  4KT6 B;  4NIK A;  2VSN A;  3V2O A;  3EDT B;  2VJ8 A;  2IU1 A;  4G24 A;  4XE0 A;  5CBN A;  2XRZ A;  3P1U A;  4WNG A;  4OAU C;  3ULE G;  4G26 A;  4BWR A;  2R05 A;  2IF4 A;  4LER A;  4J8E A;  4BES A;  2VTB B;  1WAO 1;  2ETA A;  3PNT B;  4U8V D;  4YVO A;  1NP7 A;  2QYU A;  4M3O A;  2Y0B G;  4FC8 A;  1E8W A;  3IHV A;  2LXL A;  2LAI A;  3BUA A;  4MS6 A;  3MX3 A;  2JEK A;  3QAR A;  3HXF A;  1U2V G;  4U8H A;  2KXP C;  2OND A;  2C0M A;  2IO3 C;  3RU0 A;  3KSL A;  3LY7 A;  5H7P A;  3KEA A;  3LY9 A;  4JA9 A;  4FHK A;  3SZ7 A;  3AG4 E;  4X8Q A;  1OUV A;  2XZD G;  5FIO A;  3EIJ A;  2IJG X;  1INZ A;  3FUH A;  3HVE B;  4JZY A;  4G1T A;  3AS5 A;  3TJP A;  2E2E A;  4DPR A;  5AIJ A;  3CHR A;  4OVV A;  4GCN A;  4I9E A;  4N3B A;  2FBN A;  4JHK A;  4GMJ A;  3TXN A;  4J8D A;  4WNF A;  3APD A;  5KBA A;  5EIB E;  1TNB A;  4KVO A;  3Q49 B;  3AG2 E;  3L17 A;  5EX0 A;  3E4B A;  3HYM B;  1NI1 A;  2V0P A;  4LRZ A;  3DWL G;  4GMR A;  2M63 A;  2YNQ A;  3UT7 A;  3TG4 A;  3OXG A;  4APO A;  2GW1 A;  3ZVV A;  3FFL A;  5ENQ D;  3FU3 A;  3T5X A;  3C3O A;  4F1S A;  2AXV A;  1H0A A;  1H6K A;  5AAR A;  2GRP B;  2L9B A;  3ESK A;  2IFU A;  2ZU6 B;  4RVB A;  3FUJ A;  5B1A E;  2ILR A;  2ZIR A;  4WAF A;  2KZT B;  3DST A;  2V5Q C;  3JCK C;  4DX2 A;  1EF1 C;  1H2U A;  2H6I A;  1DNP A;  3C98 A;  4L2L A;  3MEK A;  4DX1 A;  4AXH A;  4HOU A;  3E37 A;  3ASD A;  3PEV B;  4GZC A;  3DXK G;  3IBE A;  3IV0 A;  4Q69 A;  4C0E A;  3DSU A;  1TJF A;  1QNF A;  1H2V C;  1TNY A;  2XEH A;  4D10 C;  1D8E A;  3GYZ A;  1QBQ A;  4XZ4 A;  5CBO A;  2WM9 A;  3RRM B;  2KCV A;  1A5E A;  4I1M A;  4K03 A;  3LJN A;  4L7T A;  4ABN A;  4DJA A;  3MJW A;  5FQ8 A;  3KSQ A;  1OY3 D;  3B7R L;  3LJ3 A;  1TNU A;  2WXO A;  3ZNG A;  2WXG A;  1WM5 A;  3L9T A;  2A4Z A;  3CKB A;  4H7X A;  2DWZ A;  3L54 A;  3IEG A;  1ZB1 A;  4QFV A;  3EIQ C;  3AG1 E;  2WMO A;  3RRN B;  3CHP A;  3NAW A;  1K1A A;  1OWP A;  3ONK A;  4UI9 K;  3MKQ A;  4C9B B;  3PS6 A;  1N0R A;  2L0T B;  4JXT A;  5FIN A;  3FTU A;  3CHO A;  2XHE A;  4UI9 C;  2WXP A;  3PUJ A;  3FUE A;  4LNG A;  2J8S D;  3OAW A;  1EYH A;  3QJZ A;  1PC2 A;  4B89 A;  4E85 A;  4A1S A;  2P9L G;  3G2T A;  3QOU A;  3DSW A;  1ZU2 A;  5ENP D;  3ZIM A;  2QC9 A;  4HNA D;  1UJJ A;  2DCP A;  3IHY A;  1FT2 A;  4UQX A;  2R03 A;  4A63 B;  2QY7 A;  3RSE G;  3FU0 A;  5JHB A;  5ENN A;  2OVF A;  3UM1 A;  4BTA A;  2WB2 A;  1S0P A;  2P58 C;  2L0I A;  2FO1 E;  4L9P A;  4B0Z A;  2YHC A;  2LSV A;  2WXN A;  4J0U A;  1SZA A;  3KS2 A;  3CHM A;  5CCM A;  3LY8 A;  4XEI G;  3HIZ A;  1HFA A;  2LXM A;  4GTM A;  2B6C A;  3UKR G;  1WG0 A;  3DEO A;  2XPZ A;  4ILG A;  4IYP A;  4MRU A;  3FTZ A;  2PNN A;  3Q5M A;  4K5C A;  4Y6C A;  3R9M A;  4CT4 A;  2XS8 A;  3TXM A;  5JA4 D;  1YYH A;  3UM2 A;  4GTR A;  2AXU A;  1SQM A;  5CCL A;  1HG5 A;  4UQY A;  1PAQ A;  2Y1L E;  1OT8 A;  4F6R D;  4N5C A;  1DCE A;  4U0U A;  5G2N A;  2KCK A;  2RD0 A;  2F8X K;  3QAQ A;  4L2Y A;  4O1O A;  2Q7F A;  1U3D A;  3E32 A;  1DCQ A;  4PH4 B;  2V5F A;  5ENS D;  3LYA A;  2I6H A;  4U63 A;  3ZXP A;  2KBX A;  1OCO E;  1N4Q A;  4PDX A;  3PH0 C;  2J9Q A;  3PE4 A;  2VGE A;  3FH5 A;  3FUL A;  2GRM A;  5HRY A;  4KZ0 A;  3TWT A;  5ITZ F;  4ZHB A;  3PRZ A;  5B3S E;  3Q78 A;  2LNI A;  2X6J A;  3D9K A;  3ABM E;  5KNG A;  3ULQ A;  2MRI A;  2EIN E;  2HE0 A;  4U95 D;  3UIN C;  1ELR A;  1AP7 A;  2HO1 A;  1O1R A;  3PNL B;  1MZC A;  1V54 E;  4CYM D;  1FT1 A;  2ETC A;  4DLQ A;  2J4D A;  3FHE A;  5HKP A;  2X38 A;  3UTM A;  5FJY A;  4TRQ A;  4XIF A;  3ASH A;  4G23 A;  3LXU X;  3HXB A;  4CT0 A;  1E90 A;  1MJ0 A;  4TXQ A;  3FY4 A;  1O5M A;  4KZC A;  4Q96 A;  4AJW A;  4JVS A;  2OCC E;  3CVX A;  2PM7 A;  2R5S A;  1S64 A;  1E8X A;  3DBS A;  4RQI A;  2XQ0 A;  1KZP A;  3NOC D;  4YVQ C;  2RG8 A;  3CLJ A;  3UIP C;  2ZGD A;  4Q94 A;  1LTX A;  3FUD A;  3SO8 A;  3T9K A;  2B0O E;  5D2M C;  3LEW A;  5FT9 A;  3RKV A;  5LFA A;  3MV2 B;  2IOS A;  4AY6 A;  2DYS E;  1MHQ A;  4CZ2 D;  3RIB A;  4PS8 A;  2I2O A;  4N2Q A;  1SZ9 A;  3GW4 A;  4XKC A;  2OEW A;  5AYW D;  4HQD A;  1H6P A;  3TWS A;  3ENE A;  5A23 A;  4GA1 A;  3FUI A;  3C3Q A;  1IXV A;  5EYL A;  2CFZ A;  1U3C A;  4UWF A;  1YA0 A;  4DRX E;  1IHG A;  2GRR B;  3IKO B;  4B94 A;  3JUE A;  1TN6 A;  1E96 B;  2ION A;  3OXL A;  3L22 A;  3EHR A;  1TN7 A;  4LNU D;  3B7S A;  3D9P A;  1HF8 A;  5HS0 A;  1YMP A;  3QC1 A;  2VGX A;  2AWI A;  2RFA A;  5FQ7 A;  2AXZ A;  1OXJ A;  1DC2 A;  3FU5 A;  2BKG A;  2C0L A;  3EHQ A;  5G04 C;  3V79 K;  1Y6I A;  3QWV A;  4ANV A;  4AY5 A;  5JMN D;  3HXD A;  4CDN A;  1WDY A;  3T8M A;  5KNH D;  3L13 A;  3MA5 A;  4OYS A;  3VTX A;  4FA6 A;  1KT1 A;  5AAO A;  1JWF A;  1HZ4 A;  3CV0 A;  4CDR A;  2NSZ A;  2XS1 A;  1ELW A;  2CG3 A;  4E6H A;  3BG0 B;  4GYO A;  1NL4 A;  5HI7 A;  1NFI E;  3RRU A;  4WWO A;  1DVP A;  3CVQ A;  3SD5 A;  2WQH A;  3SBS A;  4EHM A;  5CMY A;  4A55 A;  4FLB A;  4O1P A;  3CHS A;  1MX2 A;  2UY1 A;  4Z68 A;  5AJL A;  3GZS A;  3DSS A;  2WXJ A;  5EYP F;  4KBQ A;  2NXP A;  4FHJ A;  2NC9 A;  5M72 A;  3PUK A;  3D9L A;  3ZUV B;  1AWC B;  3W9G A;  2EIM E;  1E8Y A;  2R59 A;  2VQ2 A;  3FH8 A;  4FJZ A;  1E7V A;  3QWP A;  4ANX A;  1HO8 A;  4NQ0 A;  1H19 A;  3WG7 E;  2IOL A;  4EPZ A;  5E75 A;  4CGW A;  5C1D A;  3SQV A;  4JW1 A;  3T5V A;  2OEV A;  4I1A A;  4BY6 A;  4EBA A;  4I9C A;  1RZ4 A;  3JQ0 A;  3L6A A;  2I9C A;  2XPI A;  4HXI A;  3D3M A;  1W3B A;  3BU8 A;  3G2W A;  4LUN U;  4P29 A;  2YHE A;  3AS4 A;  4O60 A;  4I6J A;  1O1T A;  3CQC B;  5G55 A;  4TXP A;  1QYM A;  3QDN A;  4L1B A;  3DPD A;  4B8C B;  1UG3 A;  5FQ6 A;  4EBA G;  3UM3 A;  4BX9 A;  2EIL E;  3DRA A;  3LS8 A;  3FTW A;  3FP3 A;  4GU5 A;  3CHQ A;  3B7T A;  3G2V A;  3FWV A;  5D0O D;  2WXI A;  4ANU A;  4A3T A;  2XCB A;  5CED B;  4H7Y A;  4YND A;  4GZ3 A;  2HR2 A;  3UUX A;  2LAH A;  3BG1 B;  4TV3 A;  1JPL A;  2ETB A;  3CSF A;  2F37 A;  3AU5 A;  4UWH A;  1UN8 A;  4HRN A;  5T3R A;  5G04 J;  1SA4 A;  4DUI A;  1N95 A;  4GA2 A;  2IEJ A;  1MX6 A;  1X81 A;  3CGH A;  2J08 A;  4DK5 A;  2EIK E;  3IXE A;  1N11 A;  3FUK A;  3TWW A;  3PZ4 A;  4CEM A;  2VTB A;  3Q15 A;  4I2Z A;  5AQ7 A;  2BUG A;  3L08 A;  4KYO B;  2H6H A;  1OWL A;  3TG5 A;  3CVU A;  4WWP A;  4GZD A;  2FUL A;  4I6G A;  4KMO A;  3PRE A;  1E7U A;  2ZGG A;  3ASN E;  3Q73 A;  3ZFW A;  3MZL B;  2IQC A;  2J4B A;  1MQS A;  3D9O A;  1K3Z D;  2XRY A;  2I1J A;  2QZA A;  4RG6 A;  3HVE A;  3LCA A;  3KAE A;  3QNK A;  5LP0 A;  5BXO A;  4HS2 A;  1XGW A;  3TWV A;  1G3N B;  1ELK A;  4MBG A;  1IKN D;  2H6F A;  1Z3X A;  5ENT D;  3ZXS A;  2WQ6 A;  3CVN A;  4J8Y A;  2XGM A;  4G2V A;  5AN8 A;  3ZYL A;  4HLL A;  4EZJ A;  3D9M A;  1IHB A;  3ZN3 A;  3L16 A;  1IQR A;  3D9I A;  5G05 J;  1Z5S C;  1L5J A;  4GTS A;  3OXF A;  3ZRH A;  3ZU7 B;  5KJM A;  4ILH B;  4AEZ C;  3ML9 A;  3UX4 A;  3TWX A;  1A17 A;  4MKT A;  3FTS A;  3LVR E;  5E76 A;  3C5R A;  3FH7 A;  2KC7 A;  3S7B A;  1TN8 A;  5AQ9 A;  2GGF A;  2PQR A;  3C72 A;  2WXM A;  4TUU A;  2AW6 A;  1D8D A;  4N3C A;  3R7Q A;  3D9H A;  3ZPJ A;  3CK7 A;  5BPP A;  3B7U X;  3Q7A A;  2DZN A;  4PS7 A;  5BT1 A;  3DSV A;  2KZT A;  2CHX A;  4HBD A;  3CEQ A;  3G2U A;  3V2X A;  2FF4 A;  4GA0 A;  4TXR A;  5J08 A;  3SGH A;  4XI0 A;  3J5Q B;  3NF1 A;  4BT9 A;  3E33 A;  5T8I A;  2J49 A;  2WVI A;  3ZYM A;  4AOF A;  4FUL A;  3ABL E;  3HRA A;  4BTB A;  3FUN A;  1NZN A;  4ACK A;  2DBA A;  4GTO A;  2X6I A;  2WXR A;  4HFG A;  2OOE A;  2WMN A;  5IY5 E;  4A1G A;  3FEX A;  3NZS A;  3C3R A;  3DPY A;  4JHJ A;  3G2S A;  4PS3 A;  4KXK B;  4R7L A;  1LD8 A;  3ZHE B;  5ANR A;  4BT8 A;  3RO3 A;  3TGO A;  3CIA A;  4UWL A;  2WPV A;  2A5E A;  4RLY A;  3SFY A;  2P9I G;  3Q75 A;  2R2L A;  3APC A;  4WNE A;  3V30 A;  3Q9N C;  5CHE E;  1FCH A;  2F8Y A;  1N54 A;  2UWJ G;  2WXK A;  4I17 A;  1ZBP A;  4I43 A;  2CHW A;  1P5Q A;  4GCO A;  3CK8 A;  1WY6 A;  3I4G A;  2BED A;  2V4H C;  1RW2 A;  4DI3 A;  5CRV A;  1OWN A;  2VGY A;  4UQZ A;  4I6E A;  1N4P A;  1E8Z A;  5FTP A;  4EZK A;  4ME2 A;  5EDS A;  3ZGQ A;  2NYJ A;  5ARG A;  3ASF A;  2VYI A;  5AQA A;  4F53 A;  1BU9 A;  3TWU A;  4FLH A;  3D9J A;  4GZ5 A;  4BEP A;  1BI7 B;  4FU3 A;  4Y6W A;  3SFZ A;  3S2A A;  2V8S E;  4TUM A;  2Y3A A;  4GTQ A;  2MHK A;  2EIJ E;  4GTP A;  3FDH A;  5A6C A;  4UWK A;  4B8A A;  3NZU A;  3Q7F A;  2JAB A;  1H2T C;  3HXC A;  3B13 A;  1EDU A;  3SI5 A;  1S63 A;  2WQ7 A;  1N4R A;  3FTX A;  1BI8 B;  3VTY A;  2AVP A;  3X2Q E;  1JUQ A;  2XGS A;  5D0Q D;  3UI2 A;  4U0Z A;  1UW4 B;  1OCZ E;  3MGB A;  1VDY A;  3E34 A;  4BET A;  1JCS A;  1TR4 A;  4EEC A;  1OWM A;  1TNO A;  4HRM B;  2C2L A;  2BF0 X;  4K5A B;  3ML8 A;  5JJ7 A;  2P9N G;  2L6B A;  4F1P A;  4FAD A;  4APF A;  3UQ3 A;  2CG2 A;  3OTN A;  3EUV A;  2FEZ A;  5BV1 A;  3PZ2 A;  3RK6 A;  4C0M A;  3I4R B;  3SFX A;  4GYW A;  4GPM A;  2VSY A;  4J6I A;  4I1O B;  3FEY A;  4LNB A;  3SBT B;  1GW6 A;  1KLX A;  2FI7 A;  3APF A;  4GTV A;  3JYS A;  3I5P A;  4CRW A;  1FPP A;  4JD2 G;  1TNZ A;  5A7D B;  5BNW A;  3GZ1 A;  1OWO A;  5EN5 D;  1KT0 A;  3PZ3 A;  1MX4 A;  3AAA C;  2P9K G;  3KD7 A;  3HDX A;  3ZKJ A;  5LOZ A;  4L23 A;  1BD8 A;  3CVP A;  5FZS A;  3MKQ B;  3ISM C;  3K9I A;  1LD7 A;  1V55 E;  4BER A;  4BX8 A;  1D9S A;  2AJA A;  3DXM G;  2P9S G;  3AU4 A;  3EU9 A;  2MYO A;  4XX5 A;  4DX5 D;  1UOH A;  2OV8 A;  2WXF A;  4NUR A;  5FZR A;  4N39 A;  1KZO A;  4URK A;  3VLE A;  4K0R A;  4QQI A;  4DLO A;  2XEE A;  3B95 A;  3KEZ A;  4IN3 B;  5ENO D;  5KWD A;  4JEH A;  5KCM A;  3ZHE A;  1JCQ A;  5KJN A;  3HHM A;  4DX7 D;  3Q9U C;  3UIO C;  5AJD A;  1HU3 A;  1K8K G;  4I2W A;  3EHN A;  3MKR A;  3FUM A;  2J07 A;  2X6F A;  4YDE A;  1O1S A;  2LUH A;  2KM4 A;  3U9W A;  3MCX A;  5ARF A;  4G11 A;  4GAA A;  4YDY A;  4N3A A;  2H6G A;  2Y69 E;  3SNX A;  1BPO A;  3BEE A;  2E0I A;  3U3W A;  4YDO A;  5G05 C;  3RJV A;  4BSZ B;  2MOW A;  1S70 B;  2PM6 A;  2XEV A;  3QKY A;  2X6K A;  1LF8 A;  4WUY A;  3JXI A;  3S7F A;  5CEA A;  2XPY A;  4G25 A;  4ILI A;  3O48 A;  1N9A A;  1FVH A;  1HS6 A;  4NAC A;  5JJ6 A;  3PZ1 A;  4HI9 A;  3RAU A;  1Y8M A;  2ZIS A;  2YQ8 A;  3LPZ A;  3ZYK A;  3JQ1 A;  2P2C P;  4J8S A;  3SHF A;  3TAX A;  1N52 A;  3QWW A;  4G8L A;  5T4Y A;  1IQU A;  4A3V A;  2X6H A;  3UKU G;  2PL2 A;  1TEZ A;  1NA3 A;  2GRL A;  2L6J A;  3QK0 A;  3S7D A;  1UN9 A;  3EHM A;  1N94 A;  3PE3 A;  4N5Q A;  2X3M A;  3JUI A;  5BW8 C;  3UM0 A;  2V4L A;  3PDN A;  3UMV A;  2GRQ B;  3FTV A;  4GZ6 A;  2CFU A;  4GYY A;  3F6Q A;  3TWQ A;  3U64 A;  2WXQ A;  2PZI A;  4RSY A;  5DBK A;  5DIZ A;  3FUF A;  1OCC E;  2I1K A;  1HXI A;  4WWN A;  2Y4T A;  4DX6 D;  1JCR A;  3MYV A;  4JB8 P;  3R7R A;  4CCA A;  4YDW A;  1TJC A;  4CGV A;  4BSX A;  3WXX A;  5ENR D;  2HYZ A;  3D9N A;  3P2B A;  2LO6 A;  2JLB A;  4JC8 A;  3N71 A;  1B89 A;  3I3N A;  5AQB A;  2LSU A;  2OVB A;  4JPS A;  5LCW C;  1QZ2 A;  2PQN A;  2P9U G;  3CKC A;  4GTT A;  4ATZ D;  1TYQ G;  4IUL A;  1SA5 A;  2FO7 A;  2R17 C;  5FWQ A;  3JXJ A;  3HXE A;  4OAV B;  1IYG A;  3U66 A;  2XCC A;  4U96 D;  3Q47 B;  4PUC A;  4BFR A;  3EU5 A;  3S7J A;  4V3I A;  3VLF A;  4LCT A;  4LSZ E;  1JWG A;  5EIL A;  4NRH B;  5EX3 A;  5CER B;  4WND A;  5JHA A;  4JL0 A;  2XEN A;  1QQE A;  4DI4 A;  3CR3 A;  3CVY A;  3O4Z A;  2QFC A;  3NOG D;  2RFM A;  4EQF A;  5FQ4 A;  5HQ8 A;  2VSO E;  2XGO A;  3AS8 A;  4FJY A;  3CVV A;  3R9A B;  3B7B A;  4HLE A;  5LX8 A;  3E30 A;  4UUC A;  3EJN A;  3ASO E;  4GML A;  5BXU A;  4F3V A;  2HM8 A;  5CMW A;  1HG2 A;  4GB9 A;  4HOR A;  3FU6 A;  2VSX E;  2DYR E;  1N4S A;  4RG9 A;  2WXH A;  2VGX B;  3ZEF A;  5C2Y A;  3Q4A B;  4ACL A;  2A5U A;  1BLX B;  4HVB A;  3ASG A;  3Q79 A;  2Y4U A;  1UJK A;  2DVW A;  3CST A;  3RO2 A;  4JA7 A;  4J7W A;  4OVU A;  3TWR A;  4U7E B;  1MYO A;  1XNF A;  2J09 A;  3HG0 D;  3URZ A;  2YIN A;  5FZQ A;  3TL5 A;  2BKK B;  3AJI A;  2XZT G;  3CK9 A;  4ATG A;  4C48 B;  5JJT A;  1HE8 A;  4IRU A;  3CQG B;  5AEN A;  3SF4 A;  3UT4 A;  3NB2 A;  5B1B E;  2DZO A;  2BTD A;  2IO2 C;  5EKQ D;  3NBN B;  1HH8 A;  4N2S A;  2ZXW E;  4M7C A;  1N0Q A;  4AM9 A;  3NQP A;  4ZFH A;  1Q2Z A;  1SVX A;  3W9F A;  1X5B A;  2KCL A;  4HOQ A;  2RKK A;  4F7A A;  2UY1 B;  4U0S A;  1NA0 A;  3VLD A;  4XI9 A;  3DSX A;  4HOT A;  5KJK A;  3FTY A; 
#chains in the Genus database with same CATH homology
 1Q2Z A;  1RW2 A;  3ISM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...