3ISMC

Crystal structure of the endog/endogi complex: mechanism of endog inhibition
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
333
structure length
286
Chain Sequence
AQNDYTIGLVDPVKDYQKLIETRVQVDEIVDDDVTKENFDRTAAAARDVIWRLLFDEAGTSQSNTEKASQLLEEYRGDACFYDPTPYNEWIVKLRDEVLKKELLDFWRDVLVKKQLGPCWSRDSDLFDSDDTPPLEFYAHAGCTAPFAASLKVRLEEYRTLMKRFVIIVPDSVHQASVKKIAAAAREIIWKLLFDGTPSAEDQNKAAELLQEYKGDAGFYGPDDYNSWIFNLRDEVLTKELLDFWRDKMVKMELGPSCARDSDYYDNEDPLPFEFYEKAGCKAPFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor/hydrolase
molecule keywords CG8862
publication title Crystal structure of the EndoG/EndoGI complex: mechanism of EndoG inhibition.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 94
structure length 286
sequence length 333
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2009-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08785 Ku_PK_bind Ku C terminal domain like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.240 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ku, C-terminal domain 3ismC02
1.25.40.240 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ku, C-terminal domain 3ismC01
1RW2A 3ISMC 1Q2ZA
chains in the Genus database with same CATH superfamily
4I43A 3UM1A 2C0MA 3ONKA 2J8SD 2A4ZA 4HOSA 3AS4A 2QZAA 5G2NA 3J5QB 5A6CA 4HB5A 2CHWA 4DX2A 3UM2A 3ESLA 5ITZF 2YINA 2XRZA 4GMJA 2J49A 4CRWA 2KM4A 5FT9A 2LNIA 3NQPA 3B7SA 5ANLA 1LD8A 1V55E 3FUFA 4G11A 1UN8A 1MX4A 1KT0A 4L9PA 3D9LA 4KZCA 2LXMA 3V30A 3TWSA 4FP7A 3RJVA 1LD7A 4N3BA 3PEVB 1E8XA 4TUUA 3ZUVB 3HXDA 4FC8A 5T8IA 4I1AA 4J6IA 2LSVA 3Q9NC 3TAXA 3CHRA 2WQHA 2FEZA 4JZYA 3V31A 3FULA 5AQ9A 4A3TA 4HOUA 3APDA 3WXXA 3HIZA 4G1TA 1S63A 1SZAA 3ZVVA 4HI8A 2UY1B 3AJIA 4UQZA 4GTQA 2XHEA 3FU3A 2IEJA 3GZ1A 4EECA 1HXIA 4U7EB 4BX8A 1WY6A 1ELKA 3U4TA 2LSUA 5BW8C 4N2SA 2VSNA 1SA5A 2Y69E 2OVBA 1INZA 4K03A 1XNFA 5BT1A 1SW6A 2J9QA 2XS8A 3HVEA 4G23A 5BUZA 4GTSA 5HQ8A 3CSTA 4G8LA 3QC1A 2OVFA 5FQ8A 1UJJA 2VSXE 1PY1A 4DPRA 2XPIA 4Q94A 4DI3A 4K0RA 1QNFA 3ONLA 2LXLA 3IHYA 4UWKA 3NZUA 5JMND 2DZOA 3PUKA 4X8QA 3NZSA 2AXUA 4G8KA 3FUKA 3S2AA 4HLLA 3QOUA 5JJTA 3FUHA 4GZ5A 3ZYKA 5FQ6A 2B0OE 2HYZA 4N5CA 2L6BA 4XZ4A 1PC2A 3LPZA 3AS8A 4TRQA 1UOHA 3FH5A 4I2WA 4ME2A 3VLFA 2FBNA 3KD7A 3KEZA 2RG8A 4I17A 3MX3A 4J7WA 5G05J 5AQ7A 1OWLA 3Q47B 4FU3A 3L22A 3EUVA 1ZB1A 4QFVA 1IQUA 3AS5A 4AEZC 3U3WA 4C0MA 3CHSA 1TN6A 4YVQC 2Q7FA 4RG6A 3VLDA 4DUIA 3VTYA 4Y6CA 1JWFA 3TWWA 2E2EA 5DIZA 3Q4AB 1K1AA 3ZGQA 3TWRA 5BNWA 4GYYA 4NACA 2Y0BG 2LAHA 3ZIMA 2KATA 5T4YA 3SNXA 3NBNB 3B13A 4GZ3A 2A5EA 3I4RB 1BLXB 4JHKA 4JEUA 4JL0A 3FDHA 4IYPA 3R9MA 4I1MA 4TXPA 5H7PA 5LCWC 2F37A 2GRMA 2CG3A 2F8YA 2FULA 2ZXWE 3ULEG 2ZIRA 5LCWJ 5FQ7A 4HBDA 4MBGA 3ZYQA 3TWXA 2L0TB 1UJKA 3ABLE 2FO7A 1HO8A 1UG3A 2LO6A 3QWPA 3UIOC 1JCSA 4H7XA 1HG5A 3DSWA 5J08A 3SFZA 3TWTA 5BXUA 4I6EA 3CV0A 3T8KA 4LNUD 3LKUA 4FHKA 4KBQA 2Y3AA 4N3AA 2IOSA 4JD2G 5EILA 5FZRA 4G2VA 4KZ0A 5HKPA 3TL5A 5FZQA 3PNTB 3B7BA 4KVMA 2AWIA 1N0RA 1OCOE 4KYOB 5AARA 3SBSA 3W9GA 4DX5D 3JUIA 4U8YD 4HRMB 2GRLA 2BTDA 2P9KG 3EIQC 1HFAA 2MOWA 1EPUA 5EYPF 2WXNA 1LF8A 3UKUG 4XKBA 1A17A 3CKBA 3ZRHA 1NFIE 5ARFA 2I1KA 2Y1LE 4IN3B 4WWOA 4BERA 2KBXA 3AU4A 5ENTD 5A23A 1JUQA 1OWMA 4U63A 3MCXA 4GCNA 3MV2B 1S64A 3KSLA 5EDSA 3DPDA 2V5FA 5BXOA 2CFUA 2EILE 1Y8MA 3FWVA 3FU0A 3LY8A 4JB8P 3FH7A 3UI2A 5CMYA 1U3CA 1BD8A 1X81A 4DX6D 4LSZE 2R05A 4J8SA 1EF1C 3JQ1A 5HS0A 1O1SA 4JXTA 3GYZA 3HDXA 1OXJA 1VDYA 4UI9J 2BF0X 2XGOA 3ASNE 1H6KA 3U9WA 3LCAA 4CZ2D 1SVXA 3KAEA 3BUAA 5D0OD 2CG2A 3PZ3A 3PZ1A 3QB2A 1HG2A 3CLJA 2P9LG 3UMVA 3PZ2A 4E6HA 2NC9A 4UWGA 5CEAA 1NL4A 3FUNA 1TNZA 3AG2E 1MYOA 4C48B 2HE0A 3FTUA 3ZN3A 2VYIA 4IRUA 4EBAG 4EBAA 2DYSE 5G55A 2VGXA 1N9AA 4G25A 2VTBA 2ZISA 1TN8A 5G04J 3TWVA 3APCA 3G2WA 5CEDB 1FT2A 5KNHD 1OUVA 4DI4A 4BTAA 3EHRA 3CK9A 2WVIA 5J90A 4WUYA 2EIME 3ABME 1NA0A 4AVXA 1JCRA 4RQIA 5CRVA 3FH8A 4BY6A 2PM7A 3ML8A 4GA2A 4DX7D 2WXPA 5FJYA 4JHRA 3S7BA 5KWDA 2IQCA 3DSTA 3S7JA 3UUXA 3ZU7B 4GTVA 1A5EA 2KZTA 5ENSD 3ABKE 1U2VG 3DXKG 2WXFA 2PQNA 2P9SG 2EQXA 5LX8A 4ACLA 3FEXA 3C98A 4GTMA 3QWWA 4RSYA 3E37A 3CVPA 3L08A 3Q49B 1JWGA 1O5MA 2V5QC 2ZU6B 5CMWA 4UWHA 5CRUA 5JJ7A 3SY2A 4KMOA 2CHZA 4O60A 3IBEA 4YDEA 3R7RA 5E76A 4A3VA 1QYMA 1MX6A 1H6PA 3RKVA 3FTYA 3QKYA 4J8YA 4WAFA 3CVYA 4P29A 1K8KG 1N95A 4GMLA 5LP0A 4J0UA 5HRYA 2CHXA 3TJPA 2YNQA 3FUIA 1H0AA 1W3BA 4O1OA 4BSZB 1O1TA 2WXOA 1N11A 5AAOA 4JEHA 3D9KA 2MYOA 4K5AB 4LG6A 2MHKA 3B7TA 1P5QA 1NZNA 2Y4TA 1TR4A 4XE0A 2IU1A 3TWUA 5FINA 3ZNGA 4A1SA 1AWCB 2IOLA 4JHJA 2M63A 4UWFA 1HF8A 2GGFA 3EJNA 4GB9A 2VJ8A 2WM9A 2WPVA 5EX0A 3SO8A 4CEMA 1H2VC 4PS8A 4GPMA 2DBAA 1LTXA 5C1DA 1KPSB 2C0LA 4BWRA 5JHAA 4LERA 4GTRA 1Y6IA 2X6HA 4HNAD 4A1GA 4BEPA 5KJKA 5CBNA 4A63B 3CQGB 3JXIA 1E7VA 3Q79A 3UX4A 5ENQD 4HQDA 4LCTA 3K9IA 4CYMD 3SFXA 2AJAA 3PS6A 1DVPA 4ANWA 3Q75A 5CBOA 3ASFA 1Z3XA 2P9PG 3P1UA 4Z68A 1BI7B 2IJGX 4PDXA 4M7CA 5B1BE 3DSVA 3UT4A 2WB2A 2RFMA 2WXLA 3G2SA 3T5VA 3D9OA 1IQRA 4FJZA 4FULA 5ENOD 5LOZA 1H2TC 4U96D 3ULYA 2CFZA 4F6RD 3LVRE 4TXRA 1BI8B 2EIKE 2I2OA 4F1SA 5D2MC 3L54A 2IO3C 3L13A 2WMOA 5AN8A 3RRNB 5A7DB 3MKRA 3UM3A 4HRNA 2GRPB 4XX5A 4OVVA 3TGOA 3CVLA 4BSXA 3R9AB 2ETBA 2P9NG 2XGMA 4PUCA 3ENEA 3EDTB 4U04A 4AM9A 1DNPA 1JPLA 4U0SA 1AP7A 3CR3A 3G2TA 4J8FA 2R2LA 3UTMA 1KZOA 2FF4A 4OAUC 2X6JA 3SD5A 3EU9A 4U07A 2YQ8A 2VGYA 2PM6A 2V4HC 3HRAA 1UW4B 2ZGGA 4ZFHA 3I3NA 1U3DA 3QNKA 1Z3YA 4EPZA 2YHEA 2C2LA 2XCCA 1IHGA 4NQ0A 2DCPA 3D9MA 3O48A 2XEEA 3SI5A 3SGHA 2BUGA 2X6FA 4PS7A 3HXFA 5M72A 2KCVA 4U95D 2GROB 3IV0A 4HVBA 4PS3A 3EHNA 2XEHA 4JW1A 4DJAA 4GAAA 3O4ZA 4ABNA 3CK7A 2L0IA 3ZHEB 1WDYA 3FP3A 3VLEA 3NB2A 4HLEA 4RVBA 4JA7A 3QAQA 2RFAA 4ATZD 4Y6WA 2P2CP 4AIFA 1IYGA 1D8DA 1L5JA 4I6JA 2WXMA 1JCQA 5AJLA 3HXEA 1N4RA 4DK5A 2F0YA 2XPYA 1DCEA 5JHBA 5CERB 4JC8A 3CGHA 4URKA 3FU5A 4XI0A 4UWLA 3UT7A 4H7YA 4ILHB 4YNDA 1N52A 1ELRA 3GZSA 1OCRE 4AY5A 3CKCA 5B3SE 4GTPA 4WNDA 4OYSA 1ELWA 4DLOA 4F7AA 1OT8A 3MKQB 4L2YA 2GRRB 5FIOA 4HFGA 4HORA 4M3OA 4C0EA 4AP2A 2HM8A 3B7RL 3CHQA 3FUDA 3E30A 3LXUX 3PZ4A 3LJ3A 2EIJE 4O1PA 3J5PA 2X6IA 3DSSA 4PH4B 2RKKA 4LUNU 4EQFA 2BKGA 3CVVA 2JABA 2BEDA 1KZPA 2GRQB 3Q7AA 4B89A 3ZW3A 4FLBA 5KNGA 3JUEA 4N5QA 5ARGA 1H6OA 3KEAA 4JA9A 4EZKA 3GZ2A 3AG4E 2IONA 4B93B 4YDOA 4ANXA 1HU3A 4XI9A 3UPVA 3BQOA 3DEOA 3RK6A 2J09A 4HOQA 2F8XK 4CT0A 1RZ4A 2WXJA 1FCHA 3AG3E 2LAIA 2GRNB 3CQCB 3NOCD 3HHMA 2XS1A 4GA0A 1OCZE 1SZ9A 2R02A 5AQBA 2DWZA 3CIAA 3AG1E 3CVWA 1D8EA 3APFA 4EZJA 2DYRE 3NAWA 4O6FA 3QDNA 3MV3B 1EDUA 4LNGA 5KCMA 5ANRA 2XCBA 3TG5A 2WQ6A 2VSOE 4GZCA 3DPYA 3FTSA 1YMPA 3CEQA 2H6GA 5ENNA 4QQIA 2QYJA 2OOEA 4GTOA 3TXNA 4MKTA 4L23A 3URZA 1TJFA 2YHCA 1H19A 2NXPA 4BETA 2J4DA 1TNBA 3E32A 1EYHA 2PNNA 4K5CA 4IULA 3DBSA 4CDNA 1OY3D 5KBAA 3QJZA 4L1BA 3SQVA 5CECB 3EU5A 3FHEA 3MEKA 1Q2ZA 2LUHA 3KSQA 3CVXA 3PZDA 2KC7A 4HOTA 3SFYA 4FLHA 5EN5D 3FUMA 4G24A 2I6HA 2IFUA 5D0QD 3N71A 2XPZA 4G26A 2ONDA 4GTTA 5JJ6A 3RRUA 4L7TA 4FJYA 4U8VD 1N54A 2NYJA 3TXMA 3D3MA 4DRXE 3CHMA 1N4SA 4JVSA 1TJCA 4GYOA 3B7UX 3V2XA 4N2QA 4ANUA 3QK0A 4KXKB 3T9KA 1WG0A 1MX2A 3G2VA 4HXIA 3E34A 3JQ0A 3UINC 4YVOA 3BU8A 5EIBE 1KT1A 3L82A 3NF1A 3RAUA 4R7LA 3L17A 1IHBA 3HVEB 2JLBA 2WQ7A 4BT8A 4BFRA 3IXEA 3P2BA 3LDZA 3CVQA 5BV0A 4CT4A 3V79K 4E85A 4AXHA 4GU5A 2AXVA 3UKRG 3PDNA 5EIDA 2XENA 4JPSA 4F1PA 3ML9A 4LRZA 3ASDA 3CVUA 1HE8A 1OCCE 3ZXPA 1XGWA 1KLXA 3WG7E 4CCAA 4CDMA 3FFLA 3GW4A 4K5BA 4LNBA 2H6FA 5D66A 3Q7FA 4J8DA 2VQ2A 2DIWA 3V2OA 4MLPA 3IEGA 1RW2A 2V0PA 4F3VA 5LFAA 4BX9A 4B8CB 4BT9A 3C3RA 4L2LA 1HS6A 5KJNA 5HI7A 4HS2A 5AQAA 3MJWA 1O1RA 3BG1B 2OEWA 4DLQA 3IKOB 2VGEA 4WWPA 3TWQA 3NOGD 4N3CA 3LJNA 1TYQG 5AIJA 2X38A 4J8EA 2KXPC 2L9BA 3RIBA 1FPPA 4I9CA 2JEKA 2QY7A 3FTXA 3JYSA 4ZHBA 2PL2A 3ZYLA 3Q78A 3LY7A 3BG0B 2OV8A 2KCKA 4NIKA 3QWVA 3OAWA 3SF4A 1Z6TA 1Z5SC 4OAVB 4UI9K 2ETCA 1NA3A 3DXMG 4C9BB 3B95A 4APFA 4ILIA 3FU6A 2UWJG 1IXVA 2V4LA 4A55A 5ENRD 2I9CA 3HXBA 3OXLA 1FVFA 4W9RA 3D9JA 2OEVA 4N39A 2ILRA 3EHQA 2R03A 2FO1E 4ILGA 2XZTG 2PQRA 2H6HA 2J4BA 5G05C 3X2QE 3C3OA 4XEIG 2QFCA 3FUEA 2UY1A 4F53A 3T5XA 1YA0A 2WXIA 4GA1A 2WMNA 1X5BA 3L9TA 3HG0D 1H2UA 2DVWA 5KJMA 3C5RA 1ZU2A 3FEYA 1BU9A 5FWQA 1N94A 4AV7A 3R7QA 3ZXSA 4LEUA 3ZFWA 4V3IA 3ZPJA 2X3MA 4DX1A 1E7UA 1DCQA 4UQYA 2IF4A 5EX3A 3Q15A 1S70B 4XIFA 4GCOA 4GYWA 4BTBA 2DZNA 3PRZA 3MZLB 2ETAA 2V8SE 5FTPA 3CSFA 1HZ4A 3W9FA 3L16A 2XQ0A 2XGSA 4GZ6A 2A5UA 3D9IA 2MRIA 5T3RA 4ACKA 1QQEA 4OVUA 1NI1A 3LEWA 5AYWD 3S7FA 3FTVA 1YCSB 1OWOA 1PAQA 4FADA 2P9IG 2R59A 2PZIA 1N4PA 4U8HA 1S0PA 4CGWA 3UXGA 3PREA 4I9EA 3S7DA 2QYUA 1G3NB 2GW1A 2HR2A 4I1OB 3ISMC 2HO1A 3Q73A 1DC2A 1QZ2A 2R17C 3LVQE 3MGBA 2WXRA 3CVNA 2VSYA 3PVLA 4NRHB 3FUJA 3JCKC 5FZSA 3L6AA 1E8ZA 4KT6B 1TNUA 1B89A 3PUJA 2XEVA 3RO2A 3F6QA 1MQSA 3RRMB 2WXQA 1MJ0A 3LS8A 2OCCE 3EHMA 4CGVA 4TV3A 2KCLA 2IY0C 3FY4A 5KJLA 1OWPA 4EHMA 3DEPA 3IHVA 1MZCA 2NSZA 4U0UA 3DRAA 3JXJA 5FQ4A 4Q96A 4ANVA 2QC9A 3KS2A 3PH0C 3DSXA 1TNOA 2XZDG 5B1AE 1N0QA 4GPKA 4MS6A 4NURA 2I1JA 3C3QA 2AW6A 4GMRA 4B94A 1YYHA 4FA6A 3ASOE 3PE3A 4D10C 3ZHEA 2J07A 2E0IA 4GZDA 2FI7A 3I4GA 3QARA 3UIPC 5AENA 2EINE 2VGXB 3PEUB 2VTBB 4EZLA 3DWLG 1NP7A 3FTWA 3ZKJA 1TN7A 2BKKB 2ZGDA 3DSUA 1FVHA 3MA5A 2RD0A 4MRUA 1OWNA 5EYLA 3SZ7A 3UM0A 2WXGA 3D9NA 4XKCA 1ZBPA 4UUCA 2J08A 3Q5MA 5CCMA 3ZYMA 3ZEFA 4WNGA 4AOFA 4WWNA 1K1BA 4UQXA 1HH8A 4TUMA 2KZTB 3E4BA 4UI9C 4HRLA 3AAAC 5CCLA 2P58C 2P9UG 3TG4A 5JA4D 5BPPA 3MKQA 3PE4A 4B0ZA 4I2ZA 3PNLB 3ESKA 3Q9UC 2WXKA 2Y4UA 1SA4A 3EIJA 3C72A 3SBTB 1MHQA 1E8YA 3CHPA 3RO3A 3HXCA 3BEEA 3FTZA 1BPOA 2XRYA 1QBQA 4AJWA 5IY5E 1N4QA 2B6CA 1E96B 2WXHA 3U64A 1TNYA 5ENPD 5G04C 3VTXA 3LYAA 2X6KA 4Q69A 2AVPA 1WM5A 3AU5A 4YDYA 4I6GA 3T8MA 3D9HA 4U0ZA 4WNFA 2AXZA 5C2YA 4APOA 5EKQD 5AJDA 4AY6A 4WNEA 3U66A 1V54E 3CHOA 3I5PA 4FHJA 3RSEG 4ATGA 4KVOA 2R5SA 4CDRA 1UN9A 5E75A 1K3ZD 3ULQA 2L6JA 4RLYA 1HX8A 1D9SA 3D9PA 3UQ3A 3UT8A 3LY9A 1E90A 1SQMA 3OXFA 4BESA 1E8WA 2IO2C 3G2UA 1GW6A 4YDWA 2H6IA 1WAO1 3ASGA 3OTNA 5BV1A 4TXQA 3E33A 3ASHA 3OXGA 1IKND 4B8AA 4RG9A 1FT1A 3RU0A 3SHFA 4HI9A 5DBKA 1TEZA 3CK8A 3MYVA 5CHEE 3HYMB
chains in the Genus database with same CATH topology
1RW2A 3ISMC 1Q2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RW2 A;  3ISM C;  1Q2Z A; 
#chains in the Genus database with same CATH topology
 4I43 A;  3UM1 A;  2C0M A;  3ONK A;  2J8S D;  2A4Z A;  4HOS A;  3AS4 A;  2QZA A;  5G2N A;  3J5Q B;  5A6C A;  4HB5 A;  2CHW A;  4DX2 A;  3UM2 A;  3ESL A;  5ITZ F;  2YIN A;  2XRZ A;  4GMJ A;  2J49 A;  4CRW A;  2KM4 A;  5FT9 A;  2LNI A;  3NQP A;  3B7S A;  5ANL A;  1LD8 A;  1V55 E;  3FUF A;  4G11 A;  1UN8 A;  1MX4 A;  1KT0 A;  4L9P A;  3D9L A;  4KZC A;  2LXM A;  3V30 A;  3TWS A;  4FP7 A;  3RJV A;  1LD7 A;  4N3B A;  3PEV B;  1E8X A;  4TUU A;  3ZUV B;  3HXD A;  4FC8 A;  5T8I A;  4I1A A;  4J6I A;  2LSV A;  3Q9N C;  3TAX A;  3CHR A;  2WQH A;  2FEZ A;  4JZY A;  3V31 A;  3FUL A;  5AQ9 A;  4A3T A;  4HOU A;  3APD A;  3WXX A;  3HIZ A;  4G1T A;  1S63 A;  1SZA A;  3ZVV A;  4HI8 A;  2UY1 B;  3AJI A;  4UQZ A;  4GTQ A;  2XHE A;  3FU3 A;  2IEJ A;  3GZ1 A;  4EEC A;  1HXI A;  4U7E B;  4BX8 A;  1WY6 A;  1ELK A;  3U4T A;  2LSU A;  5BW8 C;  4N2S A;  2VSN A;  1SA5 A;  2Y69 E;  2OVB A;  1INZ A;  4K03 A;  1XNF A;  5BT1 A;  1SW6 A;  2J9Q A;  2XS8 A;  3HVE A;  4G23 A;  5BUZ A;  4GTS A;  5HQ8 A;  3CST A;  4G8L A;  3QC1 A;  2OVF A;  5FQ8 A;  1UJJ A;  2VSX E;  1PY1 A;  4DPR A;  2XPI A;  4Q94 A;  4DI3 A;  4K0R A;  1QNF A;  3ONL A;  2LXL A;  3IHY A;  4UWK A;  3NZU A;  5JMN D;  2DZO A;  3PUK A;  4X8Q A;  3NZS A;  2AXU A;  4G8K A;  3FUK A;  3S2A A;  4HLL A;  3QOU A;  5JJT A;  3FUH A;  4GZ5 A;  3ZYK A;  5FQ6 A;  2B0O E;  2HYZ A;  4N5C A;  2L6B A;  4XZ4 A;  1PC2 A;  3LPZ A;  3AS8 A;  4TRQ A;  1UOH A;  3FH5 A;  4I2W A;  4ME2 A;  3VLF A;  2FBN A;  3KD7 A;  3KEZ A;  2RG8 A;  4I17 A;  3MX3 A;  4J7W A;  5G05 J;  5AQ7 A;  1OWL A;  3Q47 B;  4FU3 A;  3L22 A;  3EUV A;  1ZB1 A;  4QFV A;  1IQU A;  3AS5 A;  4AEZ C;  3U3W A;  4C0M A;  3CHS A;  1TN6 A;  4YVQ C;  2Q7F A;  4RG6 A;  3VLD A;  4DUI A;  3VTY A;  4Y6C A;  1JWF A;  3TWW A;  2E2E A;  5DIZ A;  3Q4A B;  1K1A A;  3ZGQ A;  3TWR A;  5BNW A;  4GYY A;  4NAC A;  2Y0B G;  2LAH A;  3ZIM A;  2KAT A;  5T4Y A;  3SNX A;  3NBN B;  3B13 A;  4GZ3 A;  2A5E A;  3I4R B;  1BLX B;  4JHK A;  4JEU A;  4JL0 A;  3FDH A;  4IYP A;  3R9M A;  4I1M A;  4TXP A;  5H7P A;  5LCW C;  2F37 A;  2GRM A;  2CG3 A;  2F8Y A;  2FUL A;  2ZXW E;  3ULE G;  2ZIR A;  5LCW J;  5FQ7 A;  4HBD A;  4MBG A;  3ZYQ A;  3TWX A;  2L0T B;  1UJK A;  3ABL E;  2FO7 A;  1HO8 A;  1UG3 A;  2LO6 A;  3QWP A;  3UIO C;  1JCS A;  4H7X A;  1HG5 A;  3DSW A;  5J08 A;  3SFZ A;  3TWT A;  5BXU A;  4I6E A;  3CV0 A;  3T8K A;  4LNU D;  3LKU A;  4FHK A;  4KBQ A;  2Y3A A;  4N3A A;  2IOS A;  4JD2 G;  5EIL A;  5FZR A;  4G2V A;  4KZ0 A;  5HKP A;  3TL5 A;  5FZQ A;  3PNT B;  3B7B A;  4KVM A;  2AWI A;  1N0R A;  1OCO E;  4KYO B;  5AAR A;  3SBS A;  3W9G A;  4DX5 D;  3JUI A;  4U8Y D;  4HRM B;  2GRL A;  2BTD A;  2P9K G;  3EIQ C;  1HFA A;  2MOW A;  1EPU A;  5EYP F;  2WXN A;  1LF8 A;  3UKU G;  4XKB A;  1A17 A;  3CKB A;  3ZRH A;  1NFI E;  5ARF A;  2I1K A;  2Y1L E;  4IN3 B;  4WWO A;  4BER A;  2KBX A;  3AU4 A;  5ENT D;  5A23 A;  1JUQ A;  1OWM A;  4U63 A;  3MCX A;  4GCN A;  3MV2 B;  1S64 A;  3KSL A;  5EDS A;  3DPD A;  2V5F A;  5BXO A;  2CFU A;  2EIL E;  1Y8M A;  3FWV A;  3FU0 A;  3LY8 A;  4JB8 P;  3FH7 A;  3UI2 A;  5CMY A;  1U3C A;  1BD8 A;  1X81 A;  4DX6 D;  4LSZ E;  2R05 A;  4J8S A;  1EF1 C;  3JQ1 A;  5HS0 A;  1O1S A;  4JXT A;  3GYZ A;  3HDX A;  1OXJ A;  1VDY A;  4UI9 J;  2BF0 X;  2XGO A;  3ASN E;  1H6K A;  3U9W A;  3LCA A;  4CZ2 D;  1SVX A;  3KAE A;  3BUA A;  5D0O D;  2CG2 A;  3PZ3 A;  3PZ1 A;  3QB2 A;  1HG2 A;  3CLJ A;  2P9L G;  3UMV A;  3PZ2 A;  4E6H A;  2NC9 A;  4UWG A;  5CEA A;  1NL4 A;  3FUN A;  1TNZ A;  3AG2 E;  1MYO A;  4C48 B;  2HE0 A;  3FTU A;  3ZN3 A;  2VYI A;  4IRU A;  4EBA G;  4EBA A;  2DYS E;  5G55 A;  2VGX A;  1N9A A;  4G25 A;  2VTB A;  2ZIS A;  1TN8 A;  5G04 J;  3TWV A;  3APC A;  3G2W A;  5CED B;  1FT2 A;  5KNH D;  1OUV A;  4DI4 A;  4BTA A;  3EHR A;  3CK9 A;  2WVI A;  5J90 A;  4WUY A;  2EIM E;  3ABM E;  1NA0 A;  4AVX A;  1JCR A;  4RQI A;  5CRV A;  3FH8 A;  4BY6 A;  2PM7 A;  3ML8 A;  4GA2 A;  4DX7 D;  2WXP A;  5FJY A;  4JHR A;  3S7B A;  5KWD A;  2IQC A;  3DST A;  3S7J A;  3UUX A;  3ZU7 B;  4GTV A;  1A5E A;  2KZT A;  5ENS D;  3ABK E;  1U2V G;  3DXK G;  2WXF A;  2PQN A;  2P9S G;  2EQX A;  5LX8 A;  4ACL A;  3FEX A;  3C98 A;  4GTM A;  3QWW A;  4RSY A;  3E37 A;  3CVP A;  3L08 A;  3Q49 B;  1JWG A;  1O5M A;  2V5Q C;  2ZU6 B;  5CMW A;  4UWH A;  5CRU A;  5JJ7 A;  3SY2 A;  4KMO A;  2CHZ A;  4O60 A;  3IBE A;  4YDE A;  3R7R A;  5E76 A;  4A3V A;  1QYM A;  1MX6 A;  1H6P A;  3RKV A;  3FTY A;  3QKY A;  4J8Y A;  4WAF A;  3CVY A;  4P29 A;  1K8K G;  1N95 A;  4GML A;  5LP0 A;  4J0U A;  5HRY A;  2CHX A;  3TJP A;  2YNQ A;  3FUI A;  1H0A A;  1W3B A;  4O1O A;  4BSZ B;  1O1T A;  2WXO A;  1N11 A;  5AAO A;  4JEH A;  3D9K A;  2MYO A;  4K5A B;  4LG6 A;  2MHK A;  3B7T A;  1P5Q A;  1NZN A;  2Y4T A;  1TR4 A;  4XE0 A;  2IU1 A;  3TWU A;  5FIN A;  3ZNG A;  4A1S A;  1AWC B;  2IOL A;  4JHJ A;  2M63 A;  4UWF A;  1HF8 A;  2GGF A;  3EJN A;  4GB9 A;  2VJ8 A;  2WM9 A;  2WPV A;  5EX0 A;  3SO8 A;  4CEM A;  1H2V C;  4PS8 A;  4GPM A;  2DBA A;  1LTX A;  5C1D A;  1KPS B;  2C0L A;  4BWR A;  5JHA A;  4LER A;  4GTR A;  1Y6I A;  2X6H A;  4HNA D;  4A1G A;  4BEP A;  5KJK A;  5CBN A;  4A63 B;  3CQG B;  3JXI A;  1E7V A;  3Q79 A;  3UX4 A;  5ENQ D;  4HQD A;  4LCT A;  3K9I A;  4CYM D;  3SFX A;  2AJA A;  3PS6 A;  1DVP A;  4ANW A;  3Q75 A;  5CBO A;  3ASF A;  1Z3X A;  2P9P G;  3P1U A;  4Z68 A;  1BI7 B;  2IJG X;  4PDX A;  4M7C A;  5B1B E;  3DSV A;  3UT4 A;  2WB2 A;  2RFM A;  2WXL A;  3G2S A;  3T5V A;  3D9O A;  1IQR A;  4FJZ A;  4FUL A;  5ENO D;  5LOZ A;  1H2T C;  4U96 D;  3ULY A;  2CFZ A;  4F6R D;  3LVR E;  4TXR A;  1BI8 B;  2EIK E;  2I2O A;  4F1S A;  5D2M C;  3L54 A;  2IO3 C;  3L13 A;  2WMO A;  5AN8 A;  3RRN B;  5A7D B;  3MKR A;  3UM3 A;  4HRN A;  2GRP B;  4XX5 A;  4OVV A;  3TGO A;  3CVL A;  4BSX A;  3R9A B;  2ETB A;  2P9N G;  2XGM A;  4PUC A;  3ENE A;  3EDT B;  4U04 A;  4AM9 A;  1DNP A;  1JPL A;  4U0S A;  1AP7 A;  3CR3 A;  3G2T A;  4J8F A;  2R2L A;  3UTM A;  1KZO A;  2FF4 A;  4OAU C;  2X6J A;  3SD5 A;  3EU9 A;  4U07 A;  2YQ8 A;  2VGY A;  2PM6 A;  2V4H C;  3HRA A;  1UW4 B;  2ZGG A;  4ZFH A;  3I3N A;  1U3D A;  3QNK A;  1Z3Y A;  4EPZ A;  2YHE A;  2C2L A;  2XCC A;  1IHG A;  4NQ0 A;  2DCP A;  3D9M A;  3O48 A;  2XEE A;  3SI5 A;  3SGH A;  2BUG A;  2X6F A;  4PS7 A;  3HXF A;  5M72 A;  2KCV A;  4U95 D;  2GRO B;  3IV0 A;  4HVB A;  4PS3 A;  3EHN A;  2XEH A;  4JW1 A;  4DJA A;  4GAA A;  3O4Z A;  4ABN A;  3CK7 A;  2L0I A;  3ZHE B;  1WDY A;  3FP3 A;  3VLE A;  3NB2 A;  4HLE A;  4RVB A;  4JA7 A;  3QAQ A;  2RFA A;  4ATZ D;  4Y6W A;  2P2C P;  4AIF A;  1IYG A;  1D8D A;  1L5J A;  4I6J A;  2WXM A;  1JCQ A;  5AJL A;  3HXE A;  1N4R A;  4DK5 A;  2F0Y A;  2XPY A;  1DCE A;  5JHB A;  5CER B;  4JC8 A;  3CGH A;  4URK A;  3FU5 A;  4XI0 A;  4UWL A;  3UT7 A;  4H7Y A;  4ILH B;  4YND A;  1N52 A;  1ELR A;  3GZS A;  1OCR E;  4AY5 A;  3CKC A;  5B3S E;  4GTP A;  4WND A;  4OYS A;  1ELW A;  4DLO A;  4F7A A;  1OT8 A;  3MKQ B;  4L2Y A;  2GRR B;  5FIO A;  4HFG A;  4HOR A;  4M3O A;  4C0E A;  4AP2 A;  2HM8 A;  3B7R L;  3CHQ A;  3FUD A;  3E30 A;  3LXU X;  3PZ4 A;  3LJ3 A;  2EIJ E;  4O1P A;  3J5P A;  2X6I A;  3DSS A;  4PH4 B;  2RKK A;  4LUN U;  4EQF A;  2BKG A;  3CVV A;  2JAB A;  2BED A;  1KZP A;  2GRQ B;  3Q7A A;  4B89 A;  3ZW3 A;  4FLB A;  5KNG A;  3JUE A;  4N5Q A;  5ARG A;  1H6O A;  3KEA A;  4JA9 A;  4EZK A;  3GZ2 A;  3AG4 E;  2ION A;  4B93 B;  4YDO A;  4ANX A;  1HU3 A;  4XI9 A;  3UPV A;  3BQO A;  3DEO A;  3RK6 A;  2J09 A;  4HOQ A;  2F8X K;  4CT0 A;  1RZ4 A;  2WXJ A;  1FCH A;  3AG3 E;  2LAI A;  2GRN B;  3CQC B;  3NOC D;  3HHM A;  2XS1 A;  4GA0 A;  1OCZ E;  1SZ9 A;  2R02 A;  5AQB A;  2DWZ A;  3CIA A;  3AG1 E;  3CVW A;  1D8E A;  3APF A;  4EZJ A;  2DYR E;  3NAW A;  4O6F A;  3QDN A;  3MV3 B;  1EDU A;  4LNG A;  5KCM A;  5ANR A;  2XCB A;  3TG5 A;  2WQ6 A;  2VSO E;  4GZC A;  3DPY A;  3FTS A;  1YMP A;  3CEQ A;  2H6G A;  5ENN A;  4QQI A;  2QYJ A;  2OOE A;  4GTO A;  3TXN A;  4MKT A;  4L23 A;  3URZ A;  1TJF A;  2YHC A;  1H19 A;  2NXP A;  4BET A;  2J4D A;  1TNB A;  3E32 A;  1EYH A;  2PNN A;  4K5C A;  4IUL A;  3DBS A;  4CDN A;  1OY3 D;  5KBA A;  3QJZ A;  4L1B A;  3SQV A;  5CEC B;  3EU5 A;  3FHE A;  3MEK A;  1Q2Z A;  2LUH A;  3KSQ A;  3CVX A;  3PZD A;  2KC7 A;  4HOT A;  3SFY A;  4FLH A;  5EN5 D;  3FUM A;  4G24 A;  2I6H A;  2IFU A;  5D0Q D;  3N71 A;  2XPZ A;  4G26 A;  2OND A;  4GTT A;  5JJ6 A;  3RRU A;  4L7T A;  4FJY A;  4U8V D;  1N54 A;  2NYJ A;  3TXM A;  3D3M A;  4DRX E;  3CHM A;  1N4S A;  4JVS A;  1TJC A;  4GYO A;  3B7U X;  3V2X A;  4N2Q A;  4ANU A;  3QK0 A;  4KXK B;  3T9K A;  1WG0 A;  1MX2 A;  3G2V A;  4HXI A;  3E34 A;  3JQ0 A;  3UIN C;  4YVO A;  3BU8 A;  5EIB E;  1KT1 A;  3L82 A;  3NF1 A;  3RAU A;  4R7L A;  3L17 A;  1IHB A;  3HVE B;  2JLB A;  2WQ7 A;  4BT8 A;  4BFR A;  3IXE A;  3P2B A;  3LDZ A;  3CVQ A;  5BV0 A;  4CT4 A;  3V79 K;  4E85 A;  4AXH A;  4GU5 A;  2AXV A;  3UKR G;  3PDN A;  5EID A;  2XEN A;  4JPS A;  4F1P A;  3ML9 A;  4LRZ A;  3ASD A;  3CVU A;  1HE8 A;  1OCC E;  3ZXP A;  1XGW A;  1KLX A;  3WG7 E;  4CCA A;  4CDM A;  3FFL A;  3GW4 A;  4K5B A;  4LNB A;  2H6F A;  5D66 A;  3Q7F A;  4J8D A;  2VQ2 A;  2DIW A;  3V2O A;  4MLP A;  3IEG A;  1RW2 A;  2V0P A;  4F3V A;  5LFA A;  4BX9 A;  4B8C B;  4BT9 A;  3C3R A;  4L2L A;  1HS6 A;  5KJN A;  5HI7 A;  4HS2 A;  5AQA A;  3MJW A;  1O1R A;  3BG1 B;  2OEW A;  4DLQ A;  3IKO B;  2VGE A;  4WWP A;  3TWQ A;  3NOG D;  4N3C A;  3LJN A;  1TYQ G;  5AIJ A;  2X38 A;  4J8E A;  2KXP C;  2L9B A;  3RIB A;  1FPP A;  4I9C A;  2JEK A;  2QY7 A;  3FTX A;  3JYS A;  4ZHB A;  2PL2 A;  3ZYL A;  3Q78 A;  3LY7 A;  3BG0 B;  2OV8 A;  2KCK A;  4NIK A;  3QWV A;  3OAW A;  3SF4 A;  1Z6T A;  1Z5S C;  4OAV B;  4UI9 K;  2ETC A;  1NA3 A;  3DXM G;  4C9B B;  3B95 A;  4APF A;  4ILI A;  3FU6 A;  2UWJ G;  1IXV A;  2V4L A;  4A55 A;  5ENR D;  2I9C A;  3HXB A;  3OXL A;  1FVF A;  4W9R A;  3D9J A;  2OEV A;  4N39 A;  2ILR A;  3EHQ A;  2R03 A;  2FO1 E;  4ILG A;  2XZT G;  2PQR A;  2H6H A;  2J4B A;  5G05 C;  3X2Q E;  3C3O A;  4XEI G;  2QFC A;  3FUE A;  2UY1 A;  4F53 A;  3T5X A;  1YA0 A;  2WXI A;  4GA1 A;  2WMN A;  1X5B A;  3L9T A;  3HG0 D;  1H2U A;  2DVW A;  5KJM A;  3C5R A;  1ZU2 A;  3FEY A;  1BU9 A;  5FWQ A;  1N94 A;  4AV7 A;  3R7Q A;  3ZXS A;  4LEU A;  3ZFW A;  4V3I A;  3ZPJ A;  2X3M A;  4DX1 A;  1E7U A;  1DCQ A;  4UQY A;  2IF4 A;  5EX3 A;  3Q15 A;  1S70 B;  4XIF A;  4GCO A;  4GYW A;  4BTB A;  2DZN A;  3PRZ A;  3MZL B;  2ETA A;  2V8S E;  5FTP A;  3CSF A;  1HZ4 A;  3W9F A;  3L16 A;  2XQ0 A;  2XGS A;  4GZ6 A;  2A5U A;  3D9I A;  2MRI A;  5T3R A;  4ACK A;  1QQE A;  4OVU A;  1NI1 A;  3LEW A;  5AYW D;  3S7F A;  3FTV A;  1YCS B;  1OWO A;  1PAQ A;  4FAD A;  2P9I G;  2R59 A;  2PZI A;  1N4P A;  4U8H A;  1S0P A;  4CGW A;  3UXG A;  3PRE A;  4I9E A;  3S7D A;  2QYU A;  1G3N B;  2GW1 A;  2HR2 A;  4I1O B;  3ISM C;  2HO1 A;  3Q73 A;  1DC2 A;  1QZ2 A;  2R17 C;  3LVQ E;  3MGB A;  2WXR A;  3CVN A;  2VSY A;  3PVL A;  4NRH B;  3FUJ A;  3JCK C;  5FZS A;  3L6A A;  1E8Z A;  4KT6 B;  1TNU A;  1B89 A;  3PUJ A;  2XEV A;  3RO2 A;  3F6Q A;  1MQS A;  3RRM B;  2WXQ A;  1MJ0 A;  3LS8 A;  2OCC E;  3EHM A;  4CGV A;  4TV3 A;  2KCL A;  2IY0 C;  3FY4 A;  5KJL A;  1OWP A;  4EHM A;  3DEP A;  3IHV A;  1MZC A;  2NSZ A;  4U0U A;  3DRA A;  3JXJ A;  5FQ4 A;  4Q96 A;  4ANV A;  2QC9 A;  3KS2 A;  3PH0 C;  3DSX A;  1TNO A;  2XZD G;  5B1A E;  1N0Q A;  4GPK A;  4MS6 A;  4NUR A;  2I1J A;  3C3Q A;  2AW6 A;  4GMR A;  4B94 A;  1YYH A;  4FA6 A;  3ASO E;  3PE3 A;  4D10 C;  3ZHE A;  2J07 A;  2E0I A;  4GZD A;  2FI7 A;  3I4G A;  3QAR A;  3UIP C;  5AEN A;  2EIN E;  2VGX B;  3PEU B;  2VTB B;  4EZL A;  3DWL G;  1NP7 A;  3FTW A;  3ZKJ A;  1TN7 A;  2BKK B;  2ZGD A;  3DSU A;  1FVH A;  3MA5 A;  2RD0 A;  4MRU A;  1OWN A;  5EYL A;  3SZ7 A;  3UM0 A;  2WXG A;  3D9N A;  4XKC A;  1ZBP A;  4UUC A;  2J08 A;  3Q5M A;  5CCM A;  3ZYM A;  3ZEF A;  4WNG A;  4AOF A;  4WWN A;  1K1B A;  4UQX A;  1HH8 A;  4TUM A;  2KZT B;  3E4B A;  4UI9 C;  4HRL A;  3AAA C;  5CCL A;  2P58 C;  2P9U G;  3TG4 A;  5JA4 D;  5BPP A;  3MKQ A;  3PE4 A;  4B0Z A;  4I2Z A;  3PNL B;  3ESK A;  3Q9U C;  2WXK A;  2Y4U A;  1SA4 A;  3EIJ A;  3C72 A;  3SBT B;  1MHQ A;  1E8Y A;  3CHP A;  3RO3 A;  3HXC A;  3BEE A;  3FTZ A;  1BPO A;  2XRY A;  1QBQ A;  4AJW A;  5IY5 E;  1N4Q A;  2B6C A;  1E96 B;  2WXH A;  3U64 A;  1TNY A;  5ENP D;  5G04 C;  3VTX A;  3LYA A;  2X6K A;  4Q69 A;  2AVP A;  1WM5 A;  3AU5 A;  4YDY A;  4I6G A;  3T8M A;  3D9H A;  4U0Z A;  4WNF A;  2AXZ A;  5C2Y A;  4APO A;  5EKQ D;  5AJD A;  4AY6 A;  4WNE A;  3U66 A;  1V54 E;  3CHO A;  3I5P A;  4FHJ A;  3RSE G;  4ATG A;  4KVO A;  2R5S A;  4CDR A;  1UN9 A;  5E75 A;  1K3Z D;  3ULQ A;  2L6J A;  4RLY A;  1HX8 A;  1D9S A;  3D9P A;  3UQ3 A;  3UT8 A;  3LY9 A;  1E90 A;  1SQM A;  3OXF A;  4BES A;  1E8W A;  2IO2 C;  3G2U A;  1GW6 A;  4YDW A;  2H6I A;  1WAO 1;  3ASG A;  3OTN A;  5BV1 A;  4TXQ A;  3E33 A;  3ASH A;  3OXG A;  1IKN D;  4B8A A;  4RG9 A;  1FT1 A;  3RU0 A;  3SHF A;  4HI9 A;  5DBK A;  1TEZ A;  3CK8 A;  3MYV A;  5CHE E;  3HYM B; 
#chains in the Genus database with same CATH homology
 1RW2 A;  3ISM C;  1Q2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...