1IHBA

Crystal structure of p18-ink4c(ink6)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
156
structure length
156
Chain Sequence
WGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLIN-DEPENDENT KINASE 6 INHIBITOR
publication title Crystal structure of the CDK4/6 inhibitory protein p18INK4c provides insights into ankyrin-like repeat structure/function and tumor-derived p16INK4 mutations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle inhibitor
total genus 46
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1ihbA00
2FO1E 4U8YD 4CZ2D 4BESA 3TWXA 1N0RA 5ENTD 1MX4A 5KWDA 2ETBA 4QQIA 4B93B 1MX6A 3DEOA 4ZFHA 1SVXA 4QFVA 5AQ9A 3EHRA 3JXJA 3HG0D 2Y0BG 3JUEA 4HLLA 2L6BA 1NFIE 3NOGD 2KBXA 4BSZB 2HE0A 1SW6A 2BKKB 1BLXB 4JB8P 4ZHBA 1WG0A 3TWRA 1MX2A 3NOCD 1G3NB 4HQDA 4HI8A 2ETAA 3Q9UC 5EIBE 2J8SD 3V79K 1TR4A 3TWVA 3IXEA 5BXUA 5HKPA 3W9GA 2VGEA 2QC9A 2P2CP 2JABA 2XZTG 4LNUD 4RLYA 5EYPF 3TWUA 4F6RD 5AAOA 5ITZF 1D9SA 4G8LA 5HS0A 4OAVB 1IKND 4HRNA 4NIKA 2RFAA 1YCSB 4K5BA 2NYJA 4A63B 1UOHA 2XEEA 3ZNGA 3HRAA 3TWWA 5CECB 3B7BA 3DEPA 4HBDA 3Q9NC 3C5RA 5EIDA 4BERA 4DX6D 5CERB 1K3ZD 2RFMA 1BI7B 2B0OE 4HRLA 1BU9A 3F6QA 2XENA 3T9KA 3UTMA 3TWSA 5JMND 1BD8A 1K1AA 4UUCA 3ZKJA 4O60A 4U95D 2V4HC 5ENOD 2XEHA 5CBOA 1A5EA 2AJAA 4HI9A 2PNNA 3UI2A 2BKGA 5ENSD 5AQAA 5KNGA 4DX1A 3D9HA 2XZDG 4LSZE 5ENRD 3J5QB 1MJ0A 3SO8A 3UXGA 2DZNA 3JXIA 4O1PA 5HRYA 1YMPA 4HRMB 4BETA 3W9FA 4K5CA 2A5EA 3B95A 3V2OA 4G8KA 1QYMA 4TUMA 4GMRA 4J7WA 2MYOA 1AP7A 5FIOA 3V30A 1YYHA 1DCQA 4HNAD 2F37A 4DX7D 2V5QC 2F8YA 5EN5D 4DX2A 5AN8A 5EILA 5CBNA 4BEPA 5JA4D 1IXVA 2ETCA 5ENPD 1N11A 3LJNA 2ZGDA 4LG6A 4ATZD 2DWZA 5KNHD 1AWCB 1K1BA 1OY3D 3EU9A 3TWQA 2Y1LE 3EHQA 1BI8B 1IHBA 2DVWA 5CEAA 3V2XA 3TWTA 4DRXE 3NBNB 4J8YA 2DZOA 4Z68A 4DUIA 4O1OA 5ENQD 1OT8A 5BXOA 4OAUC 5AQ7A 2QYJA 3KEAA 3V31A 3ZUVB 4C48B 5AARA 3ZU7B 4HB5A 3AJIA 3AAAC 4U96D 5FINA 4N5QA 5KBAA 2KXPC 4F1PA 4YDWA 1N0QA 3J5PA 4U8VD 4DX5D 1MYOA 2F8XK 5AQBA 1WDYA 5CEDB 5D66A 5EYLA 4GPMA 1DC2A 3T8KA 2ZGGA 1S70B 4CYMD 4YDYA 4K5AB
chains in the Genus database with same CATH superfamily
4GTRA 1H0AA 2ETBA 3UQ3A 3CHRA 2A5UA 3CVPA 4PUCA 3B13A 3FUNA 3AU4A 4XE0A 3PVLA 3QB2A 5HS0A 4N5CA 1JWGA 2ILRA 4K5BA 3TG5A 1P5QA 4OVVA 3SHFA 3Q15A 4BY6A 3FTUA 2XENA 3TWSA 3HHMA 4FC8A 4HOSA 5EKQD 3CKCA 2DYRE 5AQAA 5EX3A 3EHNA 3RSEG 3LJ3A 3Q78A 1NA0A 2CHZA 3PREA 3LEWA 4ME2A 3DSWA 1KT1A 4LNGA 4BT9A 1OCZE 4JEUA 4GZ3A 2WXOA 3C72A 2HR2A 4DX7D 2IOLA 3TXNA 1TNUA 2IO2C 5KJNA 3E33A 3UUXA 3ULYA 5C1DA 3R9MA 5AQ7A 1N54A 4NURA 2WMNA 3D9IA 3KEAA 1O1RA 4LNBA 5M72A 3O4ZA 1FT2A 1OXJA 3PZ4A 1HU3A 3CHSA 2OCCE 4K5AB 3G2SA 3U9WA 4CGVA 2WXMA 1JCRA 2VYIA 5AQ9A 2OVFA 1KZPA 1NFIE 4C0MA 2L0TB 2J08A 4JHJA 2WXRA 4KVMA 4AXHA 5A7DB 3WG7E 3Q9UC 4I6JA 3FH7A 4RLYA 3TWUA 4WWOA 4G8LA 1O5MA 2XS8A 1UW4B 3ZRHA 2CFUA 3MJWA 2NYJA 3RK6A 1INZA 4EZJA 3CK8A 3D9LA 5CCLA 3R7QA 3QJZA 3PNLB 1OWLA 2XZDG 1U3CA 4LSZE 4D10C 1OCCE 2VQ2A 1Z3YA 2I1KA 2FO7A 3L22A 3AG2E 4YNDA 3ZYKA 3FUDA 5ARGA 3ULEG 2A5EA 1PY1A 2LO6A 3DBSA 3O48A 5T4YA 4HOUA 4WAFA 4L7TA 2XCCA 3PDNA 1IXVA 3DWLG 4CRWA 3RO3A 5KNHD 2WB2A 4DRXE 1H6KA 4Z68A 1TYQG 4N2QA 3MCXA 3FU3A 2P9PG 3PUJA 2XPYA 1HG2A 3IHVA 2ONDA 3FULA 1S70B 3CVLA 4U8HA 2VSYA 4RSYA 1N0RA 3SFZA 3ISMC 2KM4A 2Y0BG 2CHXA 5JJ7A 3RAUA 3PUKA 1A17A 4FU3A 1V55E 5BXUA 3ZVVA 3ASFA 2VGEA 4Y6CA 1D9SA 3CVUA 4NIKA 4JXTA 1EYHA 2LSUA 1RW2A 4L23A 4U07A 3ZYMA 3DPYA 5LP0A 3E4BA 4UUCA 3LS8A 2GGFA 2WXJA 3IV0A 4WNDA 5KNGA 3UM2A 4EBAA 4UWKA 4YVOA 3APDA 4RQIA 4K0RA 1DNPA 4FP7A 2WM9A 4UQXA 2ZIRA 4LRZA 4YVQC 4X8QA 3JYSA 5ENPD 1N11A 3BG0B 4LG6A 2YINA 1K1BA 1OY3D 2AXUA 4ATGA 3CR3A 5CEAA 4J8FA 4A55A 4F53A 4JA9A 4AV7A 3TL5A 1OT8A 3CIAA 3ZU7B 3AAAC 4GZ5A 3LXUX 2CHWA 4FLHA 1Z3XA 4NACA 1Z5SC 2VSOE 2OEWA 2F8XK 3FP3A 2X6JA 4BX8A 4QQIA 4B93B 4DI3A 4FA6A 1OUVA 3SQVA 2BF0X 3CGHA 4XIFA 2KBXA 2XEVA 5FQ6A 4ANUA 1ZB1A 3PE3A 3APCA 3CVNA 3PZ2A 2ETAA 3ONKA 1TJCA 3L08A 3FUMA 2UWJG 2GW1A 4RG6A 4CT0A 4WNGA 1N9AA 1YCSB 4ACLA 3HRAA 2JLBA 3ONLA 3E30A 3JQ1A 2WXLA 4N2SA 4GTOA 1BU9A 4J8DA 5KCMA 1BD8A 4MKTA 1EF1C 2L6JA 2XEHA 4H7XA 4JPSA 1NA3A 2C0LA 3LVRE 1N52A 5T3RA 3NZUA 1XGWA 3LJNA 1FT1A 1QNFA 2VJ8A 4EZKA 1BI8B 1IHBA 2LNIA 2WQHA 3MX3A 2CG2A 4W9RA 1H2TC 4P29A 2XCBA 4GYYA 5B3SE 5LX8A 4C48B 3CVXA 5FQ7A 2OEVA 3FFLA 3P2BA 2AXZA 4GZCA 2V8SE 3G2TA 2FEZA 2RKKA 4U8YD 2WQ7A 3ZPJA 2XRZA 3UM0A 2P9NG 2C0MA 4I2ZA 4PDXA 4I9EA 3ZFWA 1G3NB 1LD7A 4TXPA 4GAAA 3ZEFA 1UJKA 2RFAA 2BUGA 3APFA 3B7BA 4YDEA 1L5JA 1NL4A 2DBAA 4HXIA 2LAIA 3AS5A 4TRQA 2HO1A 1K1AA 4KYOB 1A5EA 3FHEA 4G23A 4IYPA 2VSXE 3ABKE 1WY6A 3SBTB 1D8EA 1SA5A 3UIOC 4BETA 1E8ZA 3QAQA 3W9FA 4WNEA 3AS8A 3UKRG 1TN8A 1QBQA 4I1OB 2CFZA 4RG9A 4PH4B 1FPPA 4J8YA 4AIFA 2IJGX 4PS3A 3I5PA 2HM8A 2XGSA 2H6HA 3HYMB 3JCKC 3U64A 3AU5A 3UPVA 4F7AA 5KBAA 4F1PA 2HYZA 4XEIG 4E6HA 2IOSA 1MX6A 2P58C 3KAEA 4N3BA 4HORA 2H6FA 1XNFA 2J07A 2KZTB 5CMYA 1ELWA 3MGBA 3ZW3A 1N4QA 5EIBE 2J8SD 1UG3A 2PQRA 4BTAA 4CEMA 4WUYA 3URZA 1O1TA 4OVUA 4O6FA 2KCKA 3C3RA 3UM1A 3FTXA 1UN8A 2RD0A 3RU0A 3UIPC 1D8DA 3FEXA 5ENNA 4F1SA 3C98A 3BEEA 2RFMA 1BI7B 5BV1A 5IY5E 5T8IA 3Q4AB 4AM9A 3TXMA 3EHMA 3L82A 3UI2A 1OCRE 2I2OA 5ANLA 5KJMA 3NQPA 1QYMA 3GW4A 1FCHA 2V5QC 3FTWA 4I6GA 3HXDA 4GTVA 1Y8MA 4DLQA 4V3IA 3PH0C 4J8EA 3LPZA 4C9BB 5KJLA 3CVQA 2IONA 4G24A 3CV0A 3UM3A 2Q7FA 3T5VA 5BXOA 2YQ8A 3V31A 2XPIA 3ZUVB 1EPUA 2AW6A 4GTSA 4JEHA 3LYAA 2H6GA 5G55A 2VSNA 4ANVA 5D66A 3DXKG 3CK7A 5JHAA 3VLEA 1YMPA 4JA7A 4MS6A 2FO1E 2IY0C 3L54A 3R9AB 1E8WA 2KZTA 3FUEA 4BWRA 1PC2A 3DEOA 3JXJA 4JHKA 4CCAA 3FY4A 3I4RB 1SW6A 3TWRA 3FU6A 2X6HA 5BUZA 5ANRA 4KZCA 2PM7A 5EYPF 3S7JA 2LUHA 4OAVB 3AG4E 3MYVA 4HOQA 3UT7A 4HOTA 3IHYA 4I9CA 5CCMA 1OWNA 4MLPA 4HFGA 5JMND 3QWVA 3S2AA 1WM5A 4PS7A 1U3DA 3LKUA 3PZDA 1B89A 2FULA 3ML9A 3J5QB 2I6HA 3B7UX 3FU5A 2WXPA 4Q69A 4GTQA 4GA2A 4BEPA 4G1TA 1JCQA 5EX0A 3HXCA 5CRVA 4I43A 4CGWA 5D0QD 2DZOA 1H6OA 5KJKA 3LY9A 4EBAG 1SQMA 5ENQD 3ZHEB 2OV8A 5A6CA 3EJNA 3PEUB 3UT8A 1BPOA 2KXPC 3J5PA 5AJDA 5EYLA 4I17A 2R17C 3PZ3A 3L16A 2JEKA 3FH5A 5HI7A 4DPRA 1OWPA 3SZ7A 3G2VA 2X3MA 4EHMA 3EDTB 3WXXA 4BSZB 2HE0A 4KBQA 1BLXB 3FUFA 4ZHBA 5AENA 4N39A 4HI8A 4GYOA 3IXEA 2WPVA 5HKPA 3W9GA 1TJFA 2JABA 2PL2A 4KT6B 3SF4A 3UKUG 1KPSB 1IKND 4HRNA 2XQ0A 1TNOA 2NSZA 3U3WA 4U0ZA 3CVWA 3R7RA 1N4PA 4WWNA 1MQSA 3DEPA 4BERA 3Q9NC 5CERB 5LCWJ 4HRLA 3UTMA 3F6QA 1E90A 3Q79A 1IQRA 4O60A 2IQCA 2AJAA 5ARFA 2J9QA 1E7VA 5E76A 3OAWA 3MZLB 5HRYA 4WWPA 4CDRA 2LXMA 2L9BA 1X5BA 4BFRA 3QKYA 3LVQE 1AP7A 5A23A 5EILA 5CBNA 3RO2A 4GPKA 4UWLA 3PE4A 3ZHEA 1HF8A 2YNQA 2F0YA 2WXNA 3V2XA 4O1OA 3GZ1A 3QK0A 3VTYA 3CK9A 3IBEA 2QYJA 5AARA 1V54E 2EIJE 1E96B 3BG1B 3BQOA 3QC1A 3ASOE 5D0OD 4CZ2D 1MX4A 2GRRB 1N94A 3AG3E 1ZU2A 3DPDA 4HLLA 1HFAA 1MX2A 4LUNU 4JD2G 5BPPA 4UQZA 2B6CA 4NRHB 2EIKE 2WXQA 1HXIA 1HX8A 4ILGA 4YDOA 4LCTA 2NXPA 4ACKA 3CSFA 4L9PA 1HO8A 2B0OE 4Q94A 4CT4A 4BT8A 3CQGB 3RRMB 5CBOA 4GZDA 3IKOB 4XKBA 3L9TA 1HZ4A 4FLBA 3U66A 2RG8A 3DRAA 4GA0A 1S64A 3FUKA 2DZNA 5G04C 3JXIA 4XKCA 4M3OA 1S63A 4NQ0A 2EILE 3ABME 1U2VG 2F37A 2IFUA 3PNTB 3QWWA 3EIQC 4GMJA 2KC7A 4AJWA 2R05A 3NB2A 3N71A 3HXBA 5FZSA 2ZU6B 5D2MC 3IEGA 2QFCA 3D9OA 5BNWA 3MV2B 4DK5A 5BV0A 4GPMA 3FUIA 2AVPA 2GROB 2H6IA 3EHRA 3HG0D 1TN6A 2E0IA 3MV3B 5FTPA 4JB8P 3FUJA 4Y6WA 4APOA 2V4LA 3CQCB 5HQ8A 3CHPA 1HG5A 2MOWA 4IULA 2EINE 4AEZC 3B7TA 2LAHA 4HLEA 2R03A 3ESLA 3L17A 1PAQA 4HBDA 4GU5A 2XPZA 3T9KA 2PQNA 3SFYA 5ENOD 3EUVA 4JC8A 4HI9A 1H6PA 1RZ4A 4TXRA 3TGOA 5FWQA 4JHRA 3CLJA 4JW1A 4G25A 3AS4A 3S7DA 3V2OA 3RRNB 5FIOA 1O1SA 2F8YA 2WXHA 3FU0A 4ILHB 3KD7A 3Q73A 1MZCA 5JHBA 4KVOA 3FUHA 3ZN3A 4GCNA 2P9SG 3SD5A 4I1MA 5AQBA 3UT4A 2DCPA 3QDNA 3PZ1A 4GMLA 4IRUA 3TWXA 2LXLA 1DVPA 4EQFA 4B0ZA 1SVXA 5G05C 4U63A 4U0SA 3FDHA 3E37A 2GRQB 1FVFA 2QC9A 1Y6IA 2M63A 1LF8A 3E32A 4IN3B 4A63B 5BW8C 3SBSA 1LD8A 4C0EA 3RIBA 3ASGA 3ZXPA 2L0IA 1ELKA 2DYSE 4UI9J 2PNNA 5G04J 1SZ9A 2X6IA 3UINC 2I9CA 4A3VA 3PRZA 3ZYLA 1SZAA 4EZLA 2XHEA 4UWGA 5G2NA 1YYHA 3Q5MA 4DX2A 5AN8A 3HXFA 1DCEA 3TG4A 3EU5A 2OVBA 2QY7A 1HH8A 4ILIA 5CRUA 2DWZA 5LCWC 2KCLA 4XX5A 1YA0A 4BX9A 5E75A 4HVBA 4PS8A 4OAUC 3EIJA 4J0UA 4GCOA 5FZQA 3QOUA 4M7CA 4FHKA 4YDWA 1N0QA 2XGMA 4U0UA 2WXKA 3KSQA 5CEDB 3GYZA 3VLDA 1UN9A 1IHGA 3PEVB 4UI9K 3TJPA 2X38A 3ZYQA 3CHOA 1KZOA 2WXGA 4L1BA 2Y4TA 1E7UA 3NOGD 3S7BA 2QZAA 2XS1A 5FJYA 3NOCD 2PM6A 5BT1A 3RRUA 4F3VA 4AOFA 5AAOA 2P2CP 4F6RD 1UJJA 4JZYA 1SA4A 3DSUA 4XZ4A 2J49A 4BTBA 3ASHA 3ZXSA 4LEUA 3ZKJA 4DLOA 1ZBPA 3CHMA 4HS2A 1HS6A 2WXFA 2ZXWE 2CG3A 2J09A 4G8KA 4J7WA 3LY7A 3V30A 2R02A 2IF4A 1TNYA 5EN5D 3VTXA 4A3TA 2ZGDA 1Q2ZA 2PZIA 3BUAA 3SFXA 4ABNA 2Y1LE 4CDMA 3NBNB 3BU8A 2EQXA 3ABLE 1W3BA 3AJIA 3OXGA 4I1AA 4JL0A 3LDZA 4UQYA 1JUQA 4ANWA 4CYMD 3FTSA 5G05J 5ENTD 2WXIA 2YHEA 3GZSA 4N3CA 4GTMA 3CVVA 3ML8A 4MBGA 4AY6A 4ZFHA 4QFVA 3T5XA 3JUEA 4LERA 4HQDA 5AIJA 1IYGA 2VGXB 4FJYA 3V79K 2EIME 5LFAA 1TNZA 4APFA 3SY2A 2XZTG 4K03A 1UOHA 5CECB 3OTNA 4TV3A 5EIDA 4B8AA 2WMOA 4U95D 1QZ2A 3PS6A 4DX1A 4H7YA 4I2WA 2KATA 4XI0A 5AJLA 4KXKB 3SO8A 3UXGA 3DXMG 2GRPB 5JJ6A 4DI4A 2P9KG 3ASDA 3NZSA 1DCQA 1NI1A 5H7PA 1H2UA 2P9IG 3B7RL 3G2UA 5B1BE 4U7EB 2UY1B 4KZ0A 3Q7FA 3VLFA 4I6EA 3DSXA 4L2YA 2Y69E 3EHQA 4TUUA 3CSTA 1IQUA 2I1JA 2WVIA 4U96D 1EDUA 2Y3AA 3C3QA 2LSVA 2MHKA 4DX5D 2FBNA 2NC9A 2X6FA 3HVEB 3T8KA 1S0PA 2ZGGA 3QNKA 4BESA 4N3AA 5KWDA 2YHCA 3DSVA 2VGXA 1E8YA 2E2EA 4GTTA 2A4ZA 3FTYA 5CHEE 2FI7A 3Q47B 1E8XA 1JCSA 4A1GA 3NAWA 3RJVA 3T8MA 5CMWA 3D3MA 2R59A 3ZNGA 3FWVA 2VGYA 3X2QE 3SGHA 4XI9A 1LTXA 1K3ZD 2ZISA 3FEYA 3FTVA 3SNXA 3MKQB 1KT0A 1ELRA 1Z6TA 2AWIA 1N4RA 4AY5A 2V4HC 4FADA 3L13A 4GB9A 4UWFA 3HDXA 4U04A 3FTZA 3I4GA 4FHJA 2J4BA 3JUIA 4O1PA 4B8CB 3HXEA 2UY1A 3NF1A 3QWPA 3OXFA 4K5CA 3MEKA 3D9PA 3B95A 4TUMA 4GMRA 3KEZA 2C2LA 3Q7AA 5JA4D 4FULA 2AXVA 3TWQA 4G11A 2MRIA 3P1UA 4UI9C 3D9NA 4DUIA 3D9KA 3LY8A 3HVEA 3E34A 1HE8A 3ENEA 2R5SA 1MYOA 2V0PA 1JWFA 2QYUA 4B89A 2IO3C 4GA1A 3GZ2A 3C3OA 2OOEA 2L6BA 2GRLA 3Q49B 2KCVA 3U4TA 1WG0A 4A1SA 3HIZA 1GW6A 2P9UG 4LNUD 5ITZF 4JVSA 2J4DA 3MKQA 2VTBB 3TWWA 3C5RA 4DX6D 4CDNA 2IU1A 5EDSA 3FH8A 1FVHA 4TXQA 4J8SA 3G2WA 2WQ6A 5J08A 3CEQA 1TN7A 5DBKA 5ENSD 4R7LA 3L6AA 3D9HA 3RKVA 1NZNA 4DJAA 4EECA 3OXLA 1MJ0A 3S7FA 4B94A 1K8KG 3DSSA 2V5FA 3B7SA 4HNAD 5FQ8A 3ZGQA 2ETCA 4J6IA 5DIZA 4EPZA 4WNFA 1MHQA 4ATZD 3CVYA 4Q96A 1N95A 3TWTA 1TNBA 2X6KA 3CKBA 1NP7A 3QARA 4HB5A 4G2VA 1H19A 4UWHA 3K9IA 3MKRA 3KSLA 1OCOE 1WDYA 3D9JA 4FJZA 3KS2A 5AYWD 2FF4A 4YDYA 2DIWA 1QQEA 3DSTA 1N4SA 4MRUA 1VDYA 1OWOA 4BSXA 4KMOA 2XRYA 3MA5A 3LCAA 2BKKB 2IEJA 5C2YA 2GRMA 1OWMA 4L2LA 2GRNB 4E85A 3ZIMA 3ESKA 1TR4A 3TWVA 2VTBA 3Q75A 3UMVA 3ULQA 2XGOA 3ASNE 5J90A 4AVXA 1H2VC 3JQ0A 2XEEA 3I3NA 4OYSA 1JPLA 3CHQA 4G26A 4GTPA 1X81A 5LOZA 2BTDA 4URKA 3D9MA 2BKGA 4RVBA 5ENRD 3TAXA 1TEZA 2BEDA 4HRMB 5FZRA 4ANXA 3AG1E 5FT9A 5B1AE 2MYOA 4GZ6A 5FQ4A 1AWCB 3EU9A 2Y4UA 2DVWA 5JJTA 4AP2A 1KLXA 2P9LG 5FINA 4N5QA 2R2LA 4GYWA 3SI5A 1DC2A 1WAO1 3UX4A 4U8VD
chains in the Genus database with same CATH topology
2FO1E 4U8YD 4CZ2D 4BESA 3TWXA 1N0RA 5ENTD 1MX4A 5KWDA 2ETBA 4QQIA 4B93B 1MX6A 3DEOA 4ZFHA 1SVXA 4QFVA 5AQ9A 3EHRA 3JXJA 3HG0D 2Y0BG 3JUEA 4HLLA 2L6BA 1NFIE 3NOGD 2KBXA 4BSZB 2HE0A 1SW6A 2BKKB 1BLXB 4JB8P 4ZHBA 1WG0A 3TWRA 1MX2A 3NOCD 1G3NB 4HQDA 4HI8A 2ETAA 3Q9UC 5EIBE 2J8SD 3V79K 1TR4A 3TWVA 3IXEA 5BXUA 5HKPA 3W9GA 2VGEA 2QC9A 2P2CP 2JABA 2XZTG 4LNUD 4RLYA 5EYPF 3TWUA 4F6RD 5AAOA 5ITZF 1D9SA 4G8LA 5HS0A 4OAVB 1IKND 4HRNA 4NIKA 2RFAA 1YCSB 4K5BA 2NYJA 4A63B 1UOHA 2XEEA 3ZNGA 3HRAA 3TWWA 5CECB 3B7BA 3DEPA 4HBDA 3Q9NC 3C5RA 5EIDA 4BERA 4DX6D 5CERB 1K3ZD 2RFMA 1BI7B 2B0OE 4HRLA 1BU9A 3F6QA 2XENA 3T9KA 3UTMA 3TWSA 5JMND 1BD8A 1K1AA 4UUCA 3ZKJA 4O60A 4U95D 2V4HC 5ENOD 2XEHA 5CBOA 1A5EA 2AJAA 4HI9A 2PNNA 3UI2A 2BKGA 5ENSD 5AQAA 5KNGA 4DX1A 3D9HA 2XZDG 4LSZE 5ENRD 3J5QB 1MJ0A 3SO8A 3UXGA 2DZNA 3JXIA 4O1PA 5HRYA 1YMPA 4HRMB 4BETA 3W9FA 4K5CA 2A5EA 3B95A 3V2OA 4G8KA 1QYMA 4TUMA 4GMRA 4J7WA 2MYOA 1AP7A 5FIOA 3V30A 1YYHA 1DCQA 4HNAD 2F37A 4DX7D 2V5QC 2F8YA 5EN5D 4DX2A 5AN8A 5EILA 5CBNA 4BEPA 5JA4D 1IXVA 2ETCA 5ENPD 1N11A 3LJNA 2ZGDA 4LG6A 4ATZD 2DWZA 5KNHD 1AWCB 1K1BA 1OY3D 3EU9A 3TWQA 2Y1LE 3EHQA 1BI8B 1IHBA 2DVWA 5CEAA 3V2XA 3TWTA 4DRXE 3NBNB 4J8YA 2DZOA 4Z68A 4DUIA 4O1OA 5ENQD 1OT8A 5BXOA 4OAUC 5AQ7A 2QYJA 3KEAA 3V31A 3ZUVB 4C48B 5AARA 3ZU7B 4HB5A 3AJIA 3AAAC 4U96D 5FINA 4N5QA 5KBAA 2KXPC 4F1PA 4YDWA 1N0QA 3J5PA 4U8VD 4DX5D 1MYOA 2F8XK 5AQBA 1WDYA 5CEDB 5D66A 5EYLA 4GPMA 1DC2A 3T8KA 2ZGGA 1S70B 4CYMD 4YDYA 4K5AB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FO1 E;  4U8Y D;  4CZ2 D;  4BES A;  3TWX A;  1N0R A;  5ENT D;  1MX4 A;  5KWD A;  2ETB A;  4QQI A;  4B93 B;  1MX6 A;  3DEO A;  4ZFH A;  1SVX A;  4QFV A;  5AQ9 A;  3EHR A;  3JXJ A;  3HG0 D;  2Y0B G;  3JUE A;  4HLL A;  2L6B A;  1NFI E;  3NOG D;  2KBX A;  4BSZ B;  2HE0 A;  1SW6 A;  2BKK B;  1BLX B;  4JB8 P;  4ZHB A;  1WG0 A;  3TWR A;  1MX2 A;  3NOC D;  1G3N B;  4HQD A;  4HI8 A;  2ETA A;  3Q9U C;  5EIB E;  2J8S D;  3V79 K;  1TR4 A;  3TWV A;  3IXE A;  5BXU A;  5HKP A;  3W9G A;  2VGE A;  2QC9 A;  2P2C P;  2JAB A;  2XZT G;  4LNU D;  4RLY A;  5EYP F;  3TWU A;  4F6R D;  5AAO A;  5ITZ F;  1D9S A;  4G8L A;  5HS0 A;  4OAV B;  1IKN D;  4HRN A;  4NIK A;  2RFA A;  1YCS B;  4K5B A;  2NYJ A;  4A63 B;  1UOH A;  2XEE A;  3ZNG A;  3HRA A;  3TWW A;  5CEC B;  3B7B A;  3DEP A;  4HBD A;  3Q9N C;  3C5R A;  5EID A;  4BER A;  4DX6 D;  5CER B;  1K3Z D;  2RFM A;  1BI7 B;  2B0O E;  4HRL A;  1BU9 A;  3F6Q A;  2XEN A;  3T9K A;  3UTM A;  3TWS A;  5JMN D;  1BD8 A;  1K1A A;  4UUC A;  3ZKJ A;  4O60 A;  4U95 D;  2V4H C;  5ENO D;  2XEH A;  5CBO A;  1A5E A;  2AJA A;  4HI9 A;  2PNN A;  3UI2 A;  2BKG A;  5ENS D;  5AQA A;  5KNG A;  4DX1 A;  3D9H A;  2XZD G;  4LSZ E;  5ENR D;  3J5Q B;  1MJ0 A;  3SO8 A;  3UXG A;  2DZN A;  3JXI A;  4O1P A;  5HRY A;  1YMP A;  4HRM B;  4BET A;  3W9F A;  4K5C A;  2A5E A;  3B95 A;  3V2O A;  4G8K A;  1QYM A;  4TUM A;  4GMR A;  4J7W A;  2MYO A;  1AP7 A;  5FIO A;  3V30 A;  1YYH A;  1DCQ A;  4HNA D;  2F37 A;  4DX7 D;  2V5Q C;  2F8Y A;  5EN5 D;  4DX2 A;  5AN8 A;  5EIL A;  5CBN A;  4BEP A;  5JA4 D;  1IXV A;  2ETC A;  5ENP D;  1N11 A;  3LJN A;  2ZGD A;  4LG6 A;  4ATZ D;  2DWZ A;  5KNH D;  1AWC B;  1K1B A;  1OY3 D;  3EU9 A;  3TWQ A;  2Y1L E;  3EHQ A;  1BI8 B;  1IHB A;  2DVW A;  5CEA A;  3V2X A;  3TWT A;  4DRX E;  3NBN B;  4J8Y A;  2DZO A;  4Z68 A;  4DUI A;  4O1O A;  5ENQ D;  1OT8 A;  5BXO A;  4OAU C;  5AQ7 A;  2QYJ A;  3KEA A;  3V31 A;  3ZUV B;  4C48 B;  5AAR A;  3ZU7 B;  4HB5 A;  3AJI A;  3AAA C;  4U96 D;  5FIN A;  4N5Q A;  5KBA A;  2KXP C;  4F1P A;  4YDW A;  1N0Q A;  3J5P A;  4U8V D;  4DX5 D;  1MYO A;  2F8X K;  5AQB A;  1WDY A;  5CED B;  5D66 A;  5EYL A;  4GPM A;  1DC2 A;  3T8K A;  2ZGG A;  1S70 B;  4CYM D;  4YDY A;  4K5A B; 
#chains in the Genus database with same CATH topology
 4GTR A;  1H0A A;  2ETB A;  3UQ3 A;  3CHR A;  2A5U A;  3CVP A;  4PUC A;  3B13 A;  3FUN A;  3AU4 A;  4XE0 A;  3PVL A;  3QB2 A;  5HS0 A;  4N5C A;  1JWG A;  2ILR A;  4K5B A;  3TG5 A;  1P5Q A;  4OVV A;  3SHF A;  3Q15 A;  4BY6 A;  3FTU A;  2XEN A;  3TWS A;  3HHM A;  4FC8 A;  4HOS A;  5EKQ D;  3CKC A;  2DYR E;  5AQA A;  5EX3 A;  3EHN A;  3RSE G;  3LJ3 A;  3Q78 A;  1NA0 A;  2CHZ A;  3PRE A;  3LEW A;  4ME2 A;  3DSW A;  1KT1 A;  4LNG A;  4BT9 A;  1OCZ E;  4JEU A;  4GZ3 A;  2WXO A;  3C72 A;  2HR2 A;  4DX7 D;  2IOL A;  3TXN A;  1TNU A;  2IO2 C;  5KJN A;  3E33 A;  3UUX A;  3ULY A;  5C1D A;  3R9M A;  5AQ7 A;  1N54 A;  4NUR A;  2WMN A;  3D9I A;  3KEA A;  1O1R A;  4LNB A;  5M72 A;  3O4Z A;  1FT2 A;  1OXJ A;  3PZ4 A;  1HU3 A;  3CHS A;  2OCC E;  4K5A B;  3G2S A;  3U9W A;  4CGV A;  2WXM A;  1JCR A;  2VYI A;  5AQ9 A;  2OVF A;  1KZP A;  1NFI E;  4C0M A;  2L0T B;  2J08 A;  4JHJ A;  2WXR A;  4KVM A;  4AXH A;  5A7D B;  3WG7 E;  3Q9U C;  4I6J A;  3FH7 A;  4RLY A;  3TWU A;  4WWO A;  4G8L A;  1O5M A;  2XS8 A;  1UW4 B;  3ZRH A;  2CFU A;  3MJW A;  2NYJ A;  3RK6 A;  1INZ A;  4EZJ A;  3CK8 A;  3D9L A;  5CCL A;  3R7Q A;  3QJZ A;  3PNL B;  1OWL A;  2XZD G;  1U3C A;  4LSZ E;  4D10 C;  1OCC E;  2VQ2 A;  1Z3Y A;  2I1K A;  2FO7 A;  3L22 A;  3AG2 E;  4YND A;  3ZYK A;  3FUD A;  5ARG A;  3ULE G;  2A5E A;  1PY1 A;  2LO6 A;  3DBS A;  3O48 A;  5T4Y A;  4HOU A;  4WAF A;  4L7T A;  2XCC A;  3PDN A;  1IXV A;  3DWL G;  4CRW A;  3RO3 A;  5KNH D;  2WB2 A;  4DRX E;  1H6K A;  4Z68 A;  1TYQ G;  4N2Q A;  3MCX A;  3FU3 A;  2P9P G;  3PUJ A;  2XPY A;  1HG2 A;  3IHV A;  2OND A;  3FUL A;  1S70 B;  3CVL A;  4U8H A;  2VSY A;  4RSY A;  1N0R A;  3SFZ A;  3ISM C;  2KM4 A;  2Y0B G;  2CHX A;  5JJ7 A;  3RAU A;  3PUK A;  1A17 A;  4FU3 A;  1V55 E;  5BXU A;  3ZVV A;  3ASF A;  2VGE A;  4Y6C A;  1D9S A;  3CVU A;  4NIK A;  4JXT A;  1EYH A;  2LSU A;  1RW2 A;  4L23 A;  4U07 A;  3ZYM A;  3DPY A;  5LP0 A;  3E4B A;  4UUC A;  3LS8 A;  2GGF A;  2WXJ A;  3IV0 A;  4WND A;  5KNG A;  3UM2 A;  4EBA A;  4UWK A;  4YVO A;  3APD A;  4RQI A;  4K0R A;  1DNP A;  4FP7 A;  2WM9 A;  4UQX A;  2ZIR A;  4LRZ A;  4YVQ C;  4X8Q A;  3JYS A;  5ENP D;  1N11 A;  3BG0 B;  4LG6 A;  2YIN A;  1K1B A;  1OY3 D;  2AXU A;  4ATG A;  3CR3 A;  5CEA A;  4J8F A;  4A55 A;  4F53 A;  4JA9 A;  4AV7 A;  3TL5 A;  1OT8 A;  3CIA A;  3ZU7 B;  3AAA C;  4GZ5 A;  3LXU X;  2CHW A;  4FLH A;  1Z3X A;  4NAC A;  1Z5S C;  2VSO E;  2OEW A;  2F8X K;  3FP3 A;  2X6J A;  4BX8 A;  4QQI A;  4B93 B;  4DI3 A;  4FA6 A;  1OUV A;  3SQV A;  2BF0 X;  3CGH A;  4XIF A;  2KBX A;  2XEV A;  5FQ6 A;  4ANU A;  1ZB1 A;  3PE3 A;  3APC A;  3CVN A;  3PZ2 A;  2ETA A;  3ONK A;  1TJC A;  3L08 A;  3FUM A;  2UWJ G;  2GW1 A;  4RG6 A;  4CT0 A;  4WNG A;  1N9A A;  1YCS B;  4ACL A;  3HRA A;  2JLB A;  3ONL A;  3E30 A;  3JQ1 A;  2WXL A;  4N2S A;  4GTO A;  1BU9 A;  4J8D A;  5KCM A;  1BD8 A;  4MKT A;  1EF1 C;  2L6J A;  2XEH A;  4H7X A;  4JPS A;  1NA3 A;  2C0L A;  3LVR E;  1N52 A;  5T3R A;  3NZU A;  1XGW A;  3LJN A;  1FT1 A;  1QNF A;  2VJ8 A;  4EZK A;  1BI8 B;  1IHB A;  2LNI A;  2WQH A;  3MX3 A;  2CG2 A;  4W9R A;  1H2T C;  4P29 A;  2XCB A;  4GYY A;  5B3S E;  5LX8 A;  4C48 B;  3CVX A;  5FQ7 A;  2OEV A;  3FFL A;  3P2B A;  2AXZ A;  4GZC A;  2V8S E;  3G2T A;  2FEZ A;  2RKK A;  4U8Y D;  2WQ7 A;  3ZPJ A;  2XRZ A;  3UM0 A;  2P9N G;  2C0M A;  4I2Z A;  4PDX A;  4I9E A;  3ZFW A;  1G3N B;  1LD7 A;  4TXP A;  4GAA A;  3ZEF A;  1UJK A;  2RFA A;  2BUG A;  3APF A;  3B7B A;  4YDE A;  1L5J A;  1NL4 A;  2DBA A;  4HXI A;  2LAI A;  3AS5 A;  4TRQ A;  2HO1 A;  1K1A A;  4KYO B;  1A5E A;  3FHE A;  4G23 A;  4IYP A;  2VSX E;  3ABK E;  1WY6 A;  3SBT B;  1D8E A;  1SA5 A;  3UIO C;  4BET A;  1E8Z A;  3QAQ A;  3W9F A;  4WNE A;  3AS8 A;  3UKR G;  1TN8 A;  1QBQ A;  4I1O B;  2CFZ A;  4RG9 A;  4PH4 B;  1FPP A;  4J8Y A;  4AIF A;  2IJG X;  4PS3 A;  3I5P A;  2HM8 A;  2XGS A;  2H6H A;  3HYM B;  3JCK C;  3U64 A;  3AU5 A;  3UPV A;  4F7A A;  5KBA A;  4F1P A;  2HYZ A;  4XEI G;  4E6H A;  2IOS A;  1MX6 A;  2P58 C;  3KAE A;  4N3B A;  4HOR A;  2H6F A;  1XNF A;  2J07 A;  2KZT B;  5CMY A;  1ELW A;  3MGB A;  3ZW3 A;  1N4Q A;  5EIB E;  2J8S D;  1UG3 A;  2PQR A;  4BTA A;  4CEM A;  4WUY A;  3URZ A;  1O1T A;  4OVU A;  4O6F A;  2KCK A;  3C3R A;  3UM1 A;  3FTX A;  1UN8 A;  2RD0 A;  3RU0 A;  3UIP C;  1D8D A;  3FEX A;  5ENN A;  4F1S A;  3C98 A;  3BEE A;  2RFM A;  1BI7 B;  5BV1 A;  5IY5 E;  5T8I A;  3Q4A B;  4AM9 A;  3TXM A;  3EHM A;  3L82 A;  3UI2 A;  1OCR E;  2I2O A;  5ANL A;  5KJM A;  3NQP A;  1QYM A;  3GW4 A;  1FCH A;  2V5Q C;  3FTW A;  4I6G A;  3HXD A;  4GTV A;  1Y8M A;  4DLQ A;  4V3I A;  3PH0 C;  4J8E A;  3LPZ A;  4C9B B;  5KJL A;  3CVQ A;  2ION A;  4G24 A;  3CV0 A;  3UM3 A;  2Q7F A;  3T5V A;  5BXO A;  2YQ8 A;  3V31 A;  2XPI A;  3ZUV B;  1EPU A;  2AW6 A;  4GTS A;  4JEH A;  3LYA A;  2H6G A;  5G55 A;  2VSN A;  4ANV A;  5D66 A;  3DXK G;  3CK7 A;  5JHA A;  3VLE A;  1YMP A;  4JA7 A;  4MS6 A;  2FO1 E;  2IY0 C;  3L54 A;  3R9A B;  1E8W A;  2KZT A;  3FUE A;  4BWR A;  1PC2 A;  3DEO A;  3JXJ A;  4JHK A;  4CCA A;  3FY4 A;  3I4R B;  1SW6 A;  3TWR A;  3FU6 A;  2X6H A;  5BUZ A;  5ANR A;  4KZC A;  2PM7 A;  5EYP F;  3S7J A;  2LUH A;  4OAV B;  3AG4 E;  3MYV A;  4HOQ A;  3UT7 A;  4HOT A;  3IHY A;  4I9C A;  5CCM A;  1OWN A;  4MLP A;  4HFG A;  5JMN D;  3QWV A;  3S2A A;  1WM5 A;  4PS7 A;  1U3D A;  3LKU A;  3PZD A;  1B89 A;  2FUL A;  3ML9 A;  3J5Q B;  2I6H A;  3B7U X;  3FU5 A;  2WXP A;  4Q69 A;  4GTQ A;  4GA2 A;  4BEP A;  4G1T A;  1JCQ A;  5EX0 A;  3HXC A;  5CRV A;  4I43 A;  4CGW A;  5D0Q D;  2DZO A;  1H6O A;  5KJK A;  3LY9 A;  4EBA G;  1SQM A;  5ENQ D;  3ZHE B;  2OV8 A;  5A6C A;  3EJN A;  3PEU B;  3UT8 A;  1BPO A;  2KXP C;  3J5P A;  5AJD A;  5EYL A;  4I17 A;  2R17 C;  3PZ3 A;  3L16 A;  2JEK A;  3FH5 A;  5HI7 A;  4DPR A;  1OWP A;  3SZ7 A;  3G2V A;  2X3M A;  4EHM A;  3EDT B;  3WXX A;  4BSZ B;  2HE0 A;  4KBQ A;  1BLX B;  3FUF A;  4ZHB A;  5AEN A;  4N39 A;  4HI8 A;  4GYO A;  3IXE A;  2WPV A;  5HKP A;  3W9G A;  1TJF A;  2JAB A;  2PL2 A;  4KT6 B;  3SF4 A;  3UKU G;  1KPS B;  1IKN D;  4HRN A;  2XQ0 A;  1TNO A;  2NSZ A;  3U3W A;  4U0Z A;  3CVW A;  3R7R A;  1N4P A;  4WWN A;  1MQS A;  3DEP A;  4BER A;  3Q9N C;  5CER B;  5LCW J;  4HRL A;  3UTM A;  3F6Q A;  1E90 A;  3Q79 A;  1IQR A;  4O60 A;  2IQC A;  2AJA A;  5ARF A;  2J9Q A;  1E7V A;  5E76 A;  3OAW A;  3MZL B;  5HRY A;  4WWP A;  4CDR A;  2LXM A;  2L9B A;  1X5B A;  4BFR A;  3QKY A;  3LVQ E;  1AP7 A;  5A23 A;  5EIL A;  5CBN A;  3RO2 A;  4GPK A;  4UWL A;  3PE4 A;  3ZHE A;  1HF8 A;  2YNQ A;  2F0Y A;  2WXN A;  3V2X A;  4O1O A;  3GZ1 A;  3QK0 A;  3VTY A;  3CK9 A;  3IBE A;  2QYJ A;  5AAR A;  1V54 E;  2EIJ E;  1E96 B;  3BG1 B;  3BQO A;  3QC1 A;  3ASO E;  5D0O D;  4CZ2 D;  1MX4 A;  2GRR B;  1N94 A;  3AG3 E;  1ZU2 A;  3DPD A;  4HLL A;  1HFA A;  1MX2 A;  4LUN U;  4JD2 G;  5BPP A;  4UQZ A;  2B6C A;  4NRH B;  2EIK E;  2WXQ A;  1HXI A;  1HX8 A;  4ILG A;  4YDO A;  4LCT A;  2NXP A;  4ACK A;  3CSF A;  4L9P A;  1HO8 A;  2B0O E;  4Q94 A;  4CT4 A;  4BT8 A;  3CQG B;  3RRM B;  5CBO A;  4GZD A;  3IKO B;  4XKB A;  3L9T A;  1HZ4 A;  4FLB A;  3U66 A;  2RG8 A;  3DRA A;  4GA0 A;  1S64 A;  3FUK A;  2DZN A;  5G04 C;  3JXI A;  4XKC A;  4M3O A;  1S63 A;  4NQ0 A;  2EIL E;  3ABM E;  1U2V G;  2F37 A;  2IFU A;  3PNT B;  3QWW A;  3EIQ C;  4GMJ A;  2KC7 A;  4AJW A;  2R05 A;  3NB2 A;  3N71 A;  3HXB A;  5FZS A;  2ZU6 B;  5D2M C;  3IEG A;  2QFC A;  3D9O A;  5BNW A;  3MV2 B;  4DK5 A;  5BV0 A;  4GPM A;  3FUI A;  2AVP A;  2GRO B;  2H6I A;  3EHR A;  3HG0 D;  1TN6 A;  2E0I A;  3MV3 B;  5FTP A;  4JB8 P;  3FUJ A;  4Y6W A;  4APO A;  2V4L A;  3CQC B;  5HQ8 A;  3CHP A;  1HG5 A;  2MOW A;  4IUL A;  2EIN E;  4AEZ C;  3B7T A;  2LAH A;  4HLE A;  2R03 A;  3ESL A;  3L17 A;  1PAQ A;  4HBD A;  4GU5 A;  2XPZ A;  3T9K A;  2PQN A;  3SFY A;  5ENO D;  3EUV A;  4JC8 A;  4HI9 A;  1H6P A;  1RZ4 A;  4TXR A;  3TGO A;  5FWQ A;  4JHR A;  3CLJ A;  4JW1 A;  4G25 A;  3AS4 A;  3S7D A;  3V2O A;  3RRN B;  5FIO A;  1O1S A;  2F8Y A;  2WXH A;  3FU0 A;  4ILH B;  3KD7 A;  3Q73 A;  1MZC A;  5JHB A;  4KVO A;  3FUH A;  3ZN3 A;  4GCN A;  2P9S G;  3SD5 A;  4I1M A;  5AQB A;  3UT4 A;  2DCP A;  3QDN A;  3PZ1 A;  4GML A;  4IRU A;  3TWX A;  2LXL A;  1DVP A;  4EQF A;  4B0Z A;  1SVX A;  5G05 C;  4U63 A;  4U0S A;  3FDH A;  3E37 A;  2GRQ B;  1FVF A;  2QC9 A;  1Y6I A;  2M63 A;  1LF8 A;  3E32 A;  4IN3 B;  4A63 B;  5BW8 C;  3SBS A;  1LD8 A;  4C0E A;  3RIB A;  3ASG A;  3ZXP A;  2L0I A;  1ELK A;  2DYS E;  4UI9 J;  2PNN A;  5G04 J;  1SZ9 A;  2X6I A;  3UIN C;  2I9C A;  4A3V A;  3PRZ A;  3ZYL A;  1SZA A;  4EZL A;  2XHE A;  4UWG A;  5G2N A;  1YYH A;  3Q5M A;  4DX2 A;  5AN8 A;  3HXF A;  1DCE A;  3TG4 A;  3EU5 A;  2OVB A;  2QY7 A;  1HH8 A;  4ILI A;  5CRU A;  2DWZ A;  5LCW C;  2KCL A;  4XX5 A;  1YA0 A;  4BX9 A;  5E75 A;  4HVB A;  4PS8 A;  4OAU C;  3EIJ A;  4J0U A;  4GCO A;  5FZQ A;  3QOU A;  4M7C A;  4FHK A;  4YDW A;  1N0Q A;  2XGM A;  4U0U A;  2WXK A;  3KSQ A;  5CED B;  3GYZ A;  3VLD A;  1UN9 A;  1IHG A;  3PEV B;  4UI9 K;  3TJP A;  2X38 A;  3ZYQ A;  3CHO A;  1KZO A;  2WXG A;  4L1B A;  2Y4T A;  1E7U A;  3NOG D;  3S7B A;  2QZA A;  2XS1 A;  5FJY A;  3NOC D;  2PM6 A;  5BT1 A;  3RRU A;  4F3V A;  4AOF A;  5AAO A;  2P2C P;  4F6R D;  1UJJ A;  4JZY A;  1SA4 A;  3DSU A;  4XZ4 A;  2J49 A;  4BTB A;  3ASH A;  3ZXS A;  4LEU A;  3ZKJ A;  4DLO A;  1ZBP A;  3CHM A;  4HS2 A;  1HS6 A;  2WXF A;  2ZXW E;  2CG3 A;  2J09 A;  4G8K A;  4J7W A;  3LY7 A;  3V30 A;  2R02 A;  2IF4 A;  1TNY A;  5EN5 D;  3VTX A;  4A3T A;  2ZGD A;  1Q2Z A;  2PZI A;  3BUA A;  3SFX A;  4ABN A;  2Y1L E;  4CDM A;  3NBN B;  3BU8 A;  2EQX A;  3ABL E;  1W3B A;  3AJI A;  3OXG A;  4I1A A;  4JL0 A;  3LDZ A;  4UQY A;  1JUQ A;  4ANW A;  4CYM D;  3FTS A;  5G05 J;  5ENT D;  2WXI A;  2YHE A;  3GZS A;  4N3C A;  4GTM A;  3CVV A;  3ML8 A;  4MBG A;  4AY6 A;  4ZFH A;  4QFV A;  3T5X A;  3JUE A;  4LER A;  4HQD A;  5AIJ A;  1IYG A;  2VGX B;  4FJY A;  3V79 K;  2EIM E;  5LFA A;  1TNZ A;  4APF A;  3SY2 A;  2XZT G;  4K03 A;  1UOH A;  5CEC B;  3OTN A;  4TV3 A;  5EID A;  4B8A A;  2WMO A;  4U95 D;  1QZ2 A;  3PS6 A;  4DX1 A;  4H7Y A;  4I2W A;  2KAT A;  4XI0 A;  5AJL A;  4KXK B;  3SO8 A;  3UXG A;  3DXM G;  2GRP B;  5JJ6 A;  4DI4 A;  2P9K G;  3ASD A;  3NZS A;  1DCQ A;  1NI1 A;  5H7P A;  1H2U A;  2P9I G;  3B7R L;  3G2U A;  5B1B E;  4U7E B;  2UY1 B;  4KZ0 A;  3Q7F A;  3VLF A;  4I6E A;  3DSX A;  4L2Y A;  2Y69 E;  3EHQ A;  4TUU A;  3CST A;  1IQU A;  2I1J A;  2WVI A;  4U96 D;  1EDU A;  2Y3A A;  3C3Q A;  2LSV A;  2MHK A;  4DX5 D;  2FBN A;  2NC9 A;  2X6F A;  3HVE B;  3T8K A;  1S0P A;  2ZGG A;  3QNK A;  4BES A;  4N3A A;  5KWD A;  2YHC A;  3DSV A;  2VGX A;  1E8Y A;  2E2E A;  4GTT A;  2A4Z A;  3FTY A;  5CHE E;  2FI7 A;  3Q47 B;  1E8X A;  1JCS A;  4A1G A;  3NAW A;  3RJV A;  3T8M A;  5CMW A;  3D3M A;  2R59 A;  3ZNG A;  3FWV A;  2VGY A;  3X2Q E;  3SGH A;  4XI9 A;  1LTX A;  1K3Z D;  2ZIS A;  3FEY A;  3FTV A;  3SNX A;  3MKQ B;  1KT0 A;  1ELR A;  1Z6T A;  2AWI A;  1N4R A;  4AY5 A;  2V4H C;  4FAD A;  3L13 A;  4GB9 A;  4UWF A;  3HDX A;  4U04 A;  3FTZ A;  3I4G A;  4FHJ A;  2J4B A;  3JUI A;  4O1P A;  4B8C B;  3HXE A;  2UY1 A;  3NF1 A;  3QWP A;  3OXF A;  4K5C A;  3MEK A;  3D9P A;  3B95 A;  4TUM A;  4GMR A;  3KEZ A;  2C2L A;  3Q7A A;  5JA4 D;  4FUL A;  2AXV A;  3TWQ A;  4G11 A;  2MRI A;  3P1U A;  4UI9 C;  3D9N A;  4DUI A;  3D9K A;  3LY8 A;  3HVE A;  3E34 A;  1HE8 A;  3ENE A;  2R5S A;  1MYO A;  2V0P A;  1JWF A;  2QYU A;  4B89 A;  2IO3 C;  4GA1 A;  3GZ2 A;  3C3O A;  2OOE A;  2L6B A;  2GRL A;  3Q49 B;  2KCV A;  3U4T A;  1WG0 A;  4A1S A;  3HIZ A;  1GW6 A;  2P9U G;  4LNU D;  5ITZ F;  4JVS A;  2J4D A;  3MKQ A;  2VTB B;  3TWW A;  3C5R A;  4DX6 D;  4CDN A;  2IU1 A;  5EDS A;  3FH8 A;  1FVH A;  4TXQ A;  4J8S A;  3G2W A;  2WQ6 A;  5J08 A;  3CEQ A;  1TN7 A;  5DBK A;  5ENS D;  4R7L A;  3L6A A;  3D9H A;  3RKV A;  1NZN A;  4DJA A;  4EEC A;  3OXL A;  1MJ0 A;  3S7F A;  4B94 A;  1K8K G;  3DSS A;  2V5F A;  3B7S A;  4HNA D;  5FQ8 A;  3ZGQ A;  2ETC A;  4J6I A;  5DIZ A;  4EPZ A;  4WNF A;  1MHQ A;  4ATZ D;  3CVY A;  4Q96 A;  1N95 A;  3TWT A;  1TNB A;  2X6K A;  3CKB A;  1NP7 A;  3QAR A;  4HB5 A;  4G2V A;  1H19 A;  4UWH A;  3K9I A;  3MKR A;  3KSL A;  1OCO E;  1WDY A;  3D9J A;  4FJZ A;  3KS2 A;  5AYW D;  2FF4 A;  4YDY A;  2DIW A;  1QQE A;  3DST A;  1N4S A;  4MRU A;  1VDY A;  1OWO A;  4BSX A;  4KMO A;  2XRY A;  3MA5 A;  3LCA A;  2BKK B;  2IEJ A;  5C2Y A;  2GRM A;  1OWM A;  4L2L A;  2GRN B;  4E85 A;  3ZIM A;  3ESK A;  1TR4 A;  3TWV A;  2VTB A;  3Q75 A;  3UMV A;  3ULQ A;  2XGO A;  3ASN E;  5J90 A;  4AVX A;  1H2V C;  3JQ0 A;  2XEE A;  3I3N A;  4OYS A;  1JPL A;  3CHQ A;  4G26 A;  4GTP A;  1X81 A;  5LOZ A;  2BTD A;  4URK A;  3D9M A;  2BKG A;  4RVB A;  5ENR D;  3TAX A;  1TEZ A;  2BED A;  4HRM B;  5FZR A;  4ANX A;  3AG1 E;  5FT9 A;  5B1A E;  2MYO A;  4GZ6 A;  5FQ4 A;  1AWC B;  3EU9 A;  2Y4U A;  2DVW A;  5JJT A;  4AP2 A;  1KLX A;  2P9L G;  5FIN A;  4N5Q A;  2R2L A;  4GYW A;  3SI5 A;  1DC2 A;  1WAO 1;  3UX4 A;  4U8V D; 
#chains in the Genus database with same CATH homology
 2FO1 E;  4U8Y D;  4CZ2 D;  4BES A;  3TWX A;  1N0R A;  5ENT D;  1MX4 A;  5KWD A;  2ETB A;  4QQI A;  4B93 B;  1MX6 A;  3DEO A;  4ZFH A;  1SVX A;  4QFV A;  5AQ9 A;  3EHR A;  3JXJ A;  3HG0 D;  2Y0B G;  3JUE A;  4HLL A;  2L6B A;  1NFI E;  3NOG D;  2KBX A;  4BSZ B;  2HE0 A;  1SW6 A;  2BKK B;  1BLX B;  4JB8 P;  4ZHB A;  1WG0 A;  3TWR A;  1MX2 A;  3NOC D;  1G3N B;  4HQD A;  4HI8 A;  2ETA A;  3Q9U C;  5EIB E;  2J8S D;  3V79 K;  1TR4 A;  3TWV A;  3IXE A;  5BXU A;  5HKP A;  3W9G A;  2VGE A;  2QC9 A;  2P2C P;  2JAB A;  2XZT G;  4LNU D;  4RLY A;  5EYP F;  3TWU A;  4F6R D;  5AAO A;  5ITZ F;  1D9S A;  4G8L A;  5HS0 A;  4OAV B;  1IKN D;  4HRN A;  4NIK A;  2RFA A;  1YCS B;  4K5B A;  2NYJ A;  4A63 B;  1UOH A;  2XEE A;  3ZNG A;  3HRA A;  3TWW A;  5CEC B;  3B7B A;  3DEP A;  4HBD A;  3Q9N C;  3C5R A;  5EID A;  4BER A;  4DX6 D;  5CER B;  1K3Z D;  2RFM A;  1BI7 B;  2B0O E;  4HRL A;  1BU9 A;  3F6Q A;  2XEN A;  3T9K A;  3UTM A;  3TWS A;  5JMN D;  1BD8 A;  1K1A A;  4UUC A;  3ZKJ A;  4O60 A;  4U95 D;  2V4H C;  5ENO D;  2XEH A;  5CBO A;  1A5E A;  2AJA A;  4HI9 A;  2PNN A;  3UI2 A;  2BKG A;  5ENS D;  5AQA A;  5KNG A;  4DX1 A;  3D9H A;  2XZD G;  4LSZ E;  5ENR D;  3J5Q B;  1MJ0 A;  3SO8 A;  3UXG A;  2DZN A;  3JXI A;  4O1P A;  5HRY A;  1YMP A;  4HRM B;  4BET A;  3W9F A;  4K5C A;  2A5E A;  3B95 A;  3V2O A;  4G8K A;  1QYM A;  4TUM A;  4GMR A;  4J7W A;  2MYO A;  1AP7 A;  5FIO A;  3V30 A;  1YYH A;  1DCQ A;  4HNA D;  2F37 A;  4DX7 D;  2V5Q C;  2F8Y A;  5EN5 D;  4DX2 A;  5AN8 A;  5EIL A;  5CBN A;  4BEP A;  5JA4 D;  1IXV A;  2ETC A;  5ENP D;  1N11 A;  3LJN A;  2ZGD A;  4LG6 A;  4ATZ D;  2DWZ A;  5KNH D;  1AWC B;  1K1B A;  1OY3 D;  3EU9 A;  3TWQ A;  2Y1L E;  3EHQ A;  1BI8 B;  1IHB A;  2DVW A;  5CEA A;  3V2X A;  3TWT A;  4DRX E;  3NBN B;  4J8Y A;  2DZO A;  4Z68 A;  4DUI A;  4O1O A;  5ENQ D;  1OT8 A;  5BXO A;  4OAU C;  5AQ7 A;  2QYJ A;  3KEA A;  3V31 A;  3ZUV B;  4C48 B;  5AAR A;  3ZU7 B;  4HB5 A;  3AJI A;  3AAA C;  4U96 D;  5FIN A;  4N5Q A;  5KBA A;  2KXP C;  4F1P A;  4YDW A;  1N0Q A;  3J5P A;  4U8V D;  4DX5 D;  1MYO A;  2F8X K;  5AQB A;  1WDY A;  5CED B;  5D66 A;  5EYL A;  4GPM A;  1DC2 A;  3T8K A;  2ZGG A;  1S70 B;  4CYM D;  4YDY A;  4K5A B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...