1IHBA

Crystal structure of p18-ink4c(ink6)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
156
structure length
156
Chain Sequence
WGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle inhibitor
molecule keywords CYCLIN-DEPENDENT KINASE 6 INHIBITOR
publication title Crystal structure of the CDK4/6 inhibitory protein p18INK4c provides insights into ankyrin-like repeat structure/function and tumor-derived p16INK4 mutations.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1ihbA00
2MYOA 1WG0A 3W9GA 2A5EA 3J5QB 4HB5A 2ETBA 5CECB 5JMND 5EIBE 2FO1E 5KWDA 1OY3D 4RLYA 2BKKB 2JABA 1K1AA 5ENTD 3ZKJA 3T8KA 3TWWA 3ZUVB 5ENPD 2F8YA 1MX4A 3UI2A 4U96D 5ENOD 1DC2A 3EHRA 3B7BA 4GMRA 3HG0D 5ENQD 4OAVB 2B0OE 1OT8A 3ZU7B 4TUMA 3EU9A 4DX7D 3C5RA 4NIKA 1N0QA 4K5AB 2J8SD 4J7WA 2RFAA 1SW6A 2AJAA 5KNGA 3D9HA 3TWRA 4CYMD 5BXUA 4BERA 5AQAA 2QYJA 2V4HC 5D66A 2DZNA 3UTMA 4B93B 2V5QC 1NFIE 4DRXE 1BLXB 5AQ9A 3AAAC 5BXOA 5CBNA 5JA4D 3LJNA 5AN8A 3Q9NC 3TWVA 3UXGA 4DX1A 2ETAA 2F37A 4U8YD 5KNHD 4CZ2D 1BI7B 4U8VD 3TWTA 5HKPA 4G8KA 5AQBA 5FINA 3TWSA 3DEPA 2DVWA 2BKGA 5ENSD 3W9FA 3KEAA 4ZHBA 2F8XK 3SO8A 3IXEA 4HI8A 4HI9A 3T9KA 2P2CP 5ENRD 3F6QA 3HRAA 4A63B 3TWXA 1UOHA 5FIOA 3DEOA 3JUEA 1AWCB 1G3NB 5CEDB 5EIDA 2KBXA 3B95A 4LNUD 1TR4A 4YDYA 3NOGD 1YYHA 3EHQA 4DX2A 4DX5D 3J5PA 4HRLA 1YMPA 1MJ0A 1K3ZD 1A5EA 3TWQA 2HE0A 4K5BA 5HRYA 5AQ7A 5AARA 4HRMB 4O1OA 3ZNGA 4F6RD 4LG6A 1IHBA 4BSZB 4Z68A 1IXVA 4GPMA 3V79K 5CBOA 3JXIA 1N11A 5EYPF 2L6BA 4LSZE 4YDWA 4HRNA 1N0RA 4HLLA 2XENA 4BETA 2RFMA 5EYLA 5HS0A 3V2XA 1SVXA 4F1PA 2KXPC 3V2OA 1BD8A 4JB8P 5KBAA 2QC9A 3NOCD 4UUCA 2XEEA 1K1BA 4QFVA 5CEAA 4J8YA 1BU9A 2VGEA 5EN5D 5EILA 4HBDA 1D9SA 3TWUA 1AP7A 3NBNB 3JXJA 4OAUC 1BI8B 1DCQA 2NYJA 3V30A 1WDYA 5ITZF 4QQIA 4C48B 4HNAD 1MYOA 2Y1LE 4ZFHA 2DWZA 2XZDG 2ZGDA 1MX2A 1QYMA 4HQDA 4DX6D 2Y0BG 3AJIA 4N5QA 1MX6A 2DZOA 1S70B 4U95D 4BESA 4ATZD 4BEPA 4G8LA 2ZGGA 2ETCA 4K5CA 3V31A 2XZTG 4O60A 5CERB 2PNNA 2XEHA 5AAOA 1YCSB 4O1PA 4DUIA 1IKND 3Q9UC
chains in the Genus database with same CATH superfamily
2LSUA 3CVLA 5EIBE 4FJZA 5EDSA 5KWDA 2RG8A 1V55E 4XZ4A 2WXJA 4XX5A 3FTXA 3N71A 3EHRA 3TAXA 2FBNA 3R9MA 3EU9A 2IO2C 5BNWA 5BXUA 3CVNA 4KMOA 4HOQA 1OCOE 5E75A 1D8EA 3DSTA 3MKQA 1N52A 5FINA 3I4RB 3W9FA 3KEAA 2P9NG 2X3MA 3RRUA 4AY6A 3UT7A 4I6JA 2GW1A 4AM9A 1N4PA 2EILE 4U0ZA 3ML8A 2NSZA 1H2VC 2HR2A 1E7UA 1RW2A 2KZTB 4L2LA 3G2SA 4ABNA 1BU9A 3CHSA 4EZLA 3RJVA 1E8YA 4GMJA 3L16A 3B13A 1MYOA 2I9CA 2WXNA 4LUNU 4WUYA 2ZGDA 4HQDA 3SHFA 2DZOA 3PE3A 5KJLA 4JHKA 2PZIA 5AJDA 2A5EA 4JHJA 4JW1A 1OY3D 3ZKJA 4GA2A 1FT2A 5EX0A 1TNOA 5EKQD 4G1TA 3C5RA 4NIKA 4AP2A 4X8QA 4UI9J 4DRXE 1OWNA 1TN8A 1HFAA 4DI4A 2WQHA 1ELKA 2IEJA 3SF4A 5HQ8A 3ZW3A 2F37A 2X6FA 5ENNA 3VLEA 4MRUA 2FI7A 1W3BA 3I5PA 3MKRA 5FTPA 2BUGA 3F6QA 4K03A 3FUKA 1UOHA 1OCCE 4J8FA 4OYSA 1S64A 4HRLA 1LD8A 4KT6B 4ANWA 4O1OA 3ZYKA 4G25A 3APFA 2WXOA 3AS4A 5CBOA 2VSNA 2L6BA 1X81A 4YDWA 3JQ1A 2V4LA 5HS0A 2I2OA 2QC9A 4DLOA 5CEAA 2CHZA 5EN5D 2LNIA 3DSSA 3R9AB 2QYUA 4LCTA 2NYJA 3TXMA 1OWMA 5DIZA 3KSQA 2ZGGA 3ABLE 1TN7A 5LCWC 3HXCA 4XI9A 4U0UA 2QZAA 3UX4A 3GZ2A 2GRMA 3DWLG 5ENPD 4CT4A 3P2BA 5LX8A 4JZYA 4B0ZA 2WMOA 4DJAA 3O48A 4RG9A 1O5MA 3PZ2A 2V0PA 4GZ3A 4CYMD 5AQAA 3RU0A 5D66A 4RG6A 3QARA 4EECA 1N54A 1OWLA 3ZYQA 4UWLA 2IY0C 4U8VD 4CGVA 4GTRA 4LRZA 4UWHA 2BKGA 1EPUA 4FJYA 4ZHBA 3FU6A 3RO2A 5G04C 4TRQA 3NQPA 1Z3XA 2E0IA 3FDHA 3C3OA 3CVQA 3PRZA 2IFUA 1UN8A 3OXLA 1MJ0A 3LEWA 3LKUA 3LXUX 4KBQA 4F6RD 5LOZA 3UM3A 2LAIA 4ILHB 4LSZE 2IONA 5KBAA 2GROB 4CT0A 3K9IA 2Y4UA 3Q78A 4ILGA 4CGWA 3SFXA 3CHMA 2BEDA 2Y1LE 2ZU6B 4U04A 4F53A 4J8EA 4FHKA 2WXMA 1E90A 4EZJA 3FUDA 3I3NA 4K5CA 3FEYA 3T5VA 2WXHA 3Q9UC 5KJNA 1HE8A 4K0RA 5A7DB 2FO1E 1K1AA 3FTUA 2WB2A 2KM4A 3TXNA 4AIFA 3U4TA 2C2LA 2DIWA 4BY6A 2MRIA 3HG0D 5BV1A 5D0OD 4BERA 3ESLA 4KVOA 1FPPA 2WXLA 1K8KG 3Q9NC 4UQXA 2OV8A 4G8KA 4JD2G 4H7XA 3TWSA 5J90A 3LY9A 4L2YA 1G3NB 2KBXA 1TR4A 4UWKA 3UKUG 4IYPA 5G55A 3FTSA 3MX3A 4TV3A 2IF4A 1O1RA 2F0YA 3FTZA 1U2VG 3R7RA 1BPOA 4GZCA 4N39A 4F1PA 2WXGA 2XEEA 3L82A 5EILA 3OXFA 3IHVA 3C3QA 4HOSA 4JXTA 5IY5E 5J08A 2DWZA 2QFCA 4OVVA 4WWNA 4MLPA 4C0EA 4V3IA 4WAFA 3RRMB 1S0PA 3FWVA 2AW6A 3CIAA 4LERA 4DUIA 3QAQA 2GRPB 4BX8A 2R2LA 4DLQA 4JHRA 4U96D 4BWRA 3LPZA 4I1OB 4BFRA 4OAVB 3ZU7B 3S2AA 3FH7A 5FZSA 4E85A 5JJ6A 1OWOA 5AQ9A 5CRUA 3E32A 4HXIA 4G24A 3MA5A 2QY7A 1FCHA 1Y8MA 2ILRA 3DEPA 3HIZA 4GZ6A 5AJLA 1A17A 3FTWA 4LNGA 3DEOA 1AWCB 1YYHA 3EHQA 1FVHA 4AV7A 3U66A 4J8DA 2XRYA 3O4ZA 3FU3A 4AEZC 2P9PG 4IULA 1H2UA 4F1SA 3UQ3A 4GA1A 2WM9A 4XI0A 2L0IA 1OXJA 2NC9A 2OCCE 4UQYA 3CEQA 3VLFA 3TJPA 5HI7A 5FT9A 4HBDA 2WXRA 4XIFA 3FEXA 1WDYA 3JQ0A 4M7CA 2PM7A 3LCAA 3BG1B 3CKCA 4PS8A 3CLJA 3Q73A 3UIOC 3HXDA 4BX9A 5A6CA 3RRNB 2BKKB 1B89A 2L0TB 4DK5A 3QB2A 4L9PA 5D2MC 3QWPA 4FP7A 4K5AB 2QYJA 3Q4AB 1HF8A 3IBEA 5FWQA 3HVEA 3AG1E 3LVQE 5AN8A 2VYIA 3NAWA 4YVQC 4U8YD 1HO8A 5HKPA 3ONLA 3RSEG 4HVBA 1N4RA 3DSWA 3FY4A 3U3WA 1N4SA 2H6IA 3RO3A 4YDYA 1HH8A 4C0MA 3SFZA 3RK6A 4N5CA 1WM5A 1EDUA 2IO3C 2CFZA 3V79K 1HU3A 5E76A 5JJTA 1D8DA 5EYLA 4GTVA 3AS8A 3CV0A 1OWPA 3NZUA 3PEVB 1O1SA 3EUVA 2VGEA 3TWUA 1TJCA 2PQRA 3PZ1A 2OVBA 4JL0A 4QQIA 1H6KA 1N95A 2NXPA 3CHRA 4JC8A 5LP0A 1S70B 3FUEA 3WXXA 4G8LA 2WQ7A 2ETCA 5FQ6A 3KD7A 4A1SA 4J6IA 3ULQA 3MGBA 3QOUA 2J4BA 3PZ3A 5FZRA 4MS6A 3FTVA 4RSYA 5CECB 4RLYA 2P58C 1HXIA 2EINE 4HS2A 3UI2A 2P9KG 2WQ6A 2XRZA 3FUMA 4FADA 4JA9A 5CRVA 3Q7FA 3G2WA 2H6HA 3UT8A 4Y6WA 4J0UA 1DVPA 3TWVA 3ASOE 4DX1A 2OOEA 3DSXA 3JYSA 4I6EA 4TXRA 3GZSA 3MZLB 3PEUB 3SO8A 2V8SE 3X2QE 2P2CP 4B8CB 4ME2A 3HRAA 2HO1A 4CCAA 4LNUD 4GZDA 5ANLA 2XHEA 5FQ8A 5H7PA 3CHOA 1JCQA 2XPIA 3KAEA 2BF0X 3FH5A 4Z68A 3UM1A 4EPZA 2R5SA 3RIBA 5BUZA 4UI9C 3G2VA 1TN6A 2PQNA 2L6JA 3CSFA 4JB8P 4PS7A 2R02A 2KZTA 1K1BA 4YDEA 2EIJE 3T5XA 5CCMA 2R59A 1DCQA 2YHEA 4HNAD 2AVPA 1JWFA 3TG5A 3ASGA 4J8SA 2RKKA 3ZYLA 3S7BA 3AU5A 2ZIRA 3ESKA 4KVMA 3ZRHA 3PREA 3ZUVB 3PUJA 5ENTD 3TWWA 3ABKE 4WWPA 2F8YA 3FULA 2J07A 4GMRA 3NZSA 1TEZA 4JPSA 4TUMA 2J08A 2H6FA 2VTBB 2J8SD 2XPZA 1KZOA 3HDXA 4MKTA 3D9LA 3EDTB 2A5UA 3QWWA 3AAAC 4FC8A 3LJNA 4DPRA 3UXGA 3PS6A 1IYGA 2WXQA 1Q2ZA 5AQBA 3FP3A 1V54E 4BTAA 5JJ7A 1PC2A 1WAO1 4G26A 2LXLA 3SD5A 1KPSB 5AQ7A 2IQCA 1VDYA 3PH0C 2J49A 4LG6A 4G23A 3HXBA 3FFLA 2FULA 1UJJA 4I6GA 3CHPA 2KXPC 3NOCD 4MBGA 2AXZA 2B6CA 3CVPA 1D9SA 3DBSA 3SGHA 2XGSA 1OCZE 3G2UA 4GPKA 2ZISA 1UG3A 2Y0BG 3FUJA 2FF4A 2P9IG 2MHKA 3SZ7A 2PNNA 3PUKA 3U9WA 1XNFA 4BT9A 4U8HA 4OVUA 2L9BA 5B1BE 3Q49B 1LF8A 4UWGA 3ASDA 1X5BA 2P9SG 3Q47B 3SY2A 4U0SA 2X6KA 3C72A 3OTNA 3QNKA 1N4QA 5ENQD 2J4DA 1KT1A 4Q94A 4GCNA 4GAAA 3FH8A 4B93B 2DZNA 4A1GA 3CHQA 2UY1A 3HYMB 3KEZA 4YVOA 4GTPA 2XQ0A 3WG7E 2VGYA 4U07A 3ENEA 3S7DA 5BW8C 1IHGA 3IXEA 5C1DA 3BU8A 3VLDA 3CVWA 1NP7A 5FIOA 5T3RA 5CEDB 2EIME 3ZXPA 3B7SA 3LYAA 3ASFA 2XPYA 4HOTA 5CCLA 2XENA 3ULEG 4GCOA 3V2XA 5ARFA 1RZ4A 1DCEA 3LY8A 3FUNA 4NURA 4N2SA 3UPVA 3CGHA 3PVLA 2XEHA 2R03A 5CMWA 5AAOA 4GTMA 2XS1A 1NI1A 3J5QB 2JLBA 3C98A 4G11A 2RD0A 4GA0A 3B7BA 3TG4A 4UWFA 2RFAA 3ISMC 3IV0A 4FLBA 3ZHEA 2XEVA 4I1MA 2YINA 1E7VA 1TNYA 3UINC 2EQXA 2AXUA 3ML9A 4FHJA 5B3SE 2LSVA 4F7AA 3DXMG 4EBAG 3J5PA 3ULYA 1YMPA 3EIJA 4A3TA 4N2QA 2LUHA 2CHWA 5HRYA 1UW4B 2PL2A 3ZNGA 1E8XA 1ZB1A 4XKCA 1OCRE 4BTBA 3CVUA 4BT8A 2E2EA 4N3CA 3SNXA 1N94A 3ZIMA 3ASHA 1SZAA 3QJZA 2RFMA 2X6HA 3Q15A 4KZCA 1TNUA 2KCKA 4C9BB 4WNDA 1HX8A 3FUFA 1NA3A 4N3AA 3SQVA 2I1JA 5ITZF 1SQMA 2BTDA 1JCRA 3MV2B 1LD7A 2C0LA 2DBAA 4U7EB 4YNDA 3E4BA 2XGMA 3E34A 3L17A 2ETBA 3ZXSA 3B7TA 4ATGA 1DC2A 2HYZA 4CRWA 3VTYA 5G05J 3NB2A 1OT8A 1NZNA 3IEGA 4DX7D 4KYOB 3DRAA 1H6PA 1MZCA 5ANRA 3PZ4A 5JHBA 3MCXA 2OEVA 3ONKA 3MKQB 1BI7B 3TWTA 4GTSA 3EIQC 2VSXE 2DVWA 3FHEA 4NQ0A 5BV0A 5AENA 2UWJG 1UN9A 1HG5A 3B95A 3GZ1A 3NOGD 2AXVA 2XCCA 3AG4E 1JPLA 5FJYA 3UM2A 2GRQB 4BSXA 4HOUA 1IXVA 3U64A 3UIPC 5LFAA 3L13A 3DPDA 3T8MA 2OEWA 2CHXA 4GTTA 4XKBA 4G2VA 3BG0B 3GYZA 1MQSA 1E8WA 4PH4B 2H6GA 4ILIA 1BI8B 3B7RL 3BQOA 3CK9A 1HS6A 2XZDG 3QWVA 1FT1A 4YDOA 1HG2A 3LDZA 1MX6A 3CR3A 4BEPA 1FVFA 4RVBA 4O6FA 4AY5A 4URKA 3QDNA 4HB5A 5JMND 2VGXA 4GYOA 2GRNB 1H2TC 1YA0A 3KS2A 3APCA 4AVXA 4DI3A 3EHMA 1NA0A 2XS8A 4KXKB 3AS5A 3LVRE 4L23A 5CBNA 1SW6A 3E33A 2V4HC 3UTMA 1BLXB 4IN3B 3IHYA 5KNHD 3SFYA 4CZ2D 1H19A 4A55A 5JHAA 3VTXA 3GW4A 5AYWD 3QC1A 3APDA 5DBKA 2VSOE 4HI8A 3ASNE 4HI9A 4AJWA 3RKVA 3EU5A 4ACLA 4LEUA 5EIDA 3CK8A 4DX5D 2CG3A 1A5EA 4EQFA 4K5BA 3SI5A 4PUCA 4GYWA 2CFUA 4TUUA 1N9AA 4JEUA 3JXIA 4M3OA 3UT4A 4BETA 2HM8A 3V2OA 2I1KA 4AXHA 4I1AA 2YNQA 3PNTB 4HFGA 1O1TA 3S7FA 2KCLA 3MYVA 1SZ9A 4APFA 1AP7A 4PS3A 3L08A 3D3MA 2MOWA 4C48B 4CDNA 3S7JA 4H7YA 5ARGA 1UJKA 4I9EA 4I9CA 4NRHB 5KJMA 2OVFA 4BESA 2X38A 3UKRG 5AIJA 1PY1A 2MYOA 2IOSA 5C2YA 4EBAA 4P29A 1JCSA 5ENOD 2V5FA 3LY7A 2KATA 3QK0A 3B7UX 3DSUA 1H6OA 3CVVA 4F3VA 3KSLA 2ONDA 1N0QA 2WMNA 3D9JA 4J7WA 2AJAA 4NACA 5JA4D 3URZA 5T4YA 3HXFA 3CQGB 4APOA 4WNGA 1PAQA 1OUVA 1HZ4A 4XEIG 3OAWA 4ANUA 1KT0A 2DYSE 3UM0A 4XE0A 2Y4TA 5FZQA 3Q75A 4JA7A 5LCWJ 4A3VA 1L5JA 2FEZA 2AWIA 1TNZA 3BUAA 3DXKG 3I4GA 3R7QA 3RAUA 3DSVA 4HRMB 4GTOA 4I2ZA 2PM6A 3SBTB 5BPPA 1ELWA 1E8ZA 1N11A 4HRNA 1N0RA 1P5QA 4ACKA 4FA6A 2XCBA 4I2WA 5FQ4A 3FUIA 2FO7A 4JEHA 5B1AE 3ZFWA 3P1UA 2VSYA 4GZ5A 4J8YA 2GRRB 1GW6A 2Y3AA 3ABME 2EIKE 4E6HA 3JXJA 2R17C 3MEKA 4ZFHA 1H0AA 1QYMA 4JVSA 3AJIA 5A23A 3CVYA 3D9NA 5G04J 2IU1A 2XZTG 4O60A 1YCSB 2UY1B 2P9LG 3HXEA 4GTQA 4N3BA 2CG2A 4WNFA 2WXIA 3C3RA 3T8KA 1MX4A 4UI9K 2XGOA 2J09A 1Z3YA 2Q7FA 3TWRA 4CEMA 3D9HA 4FU3A 2VTBA 3Q79A 2X6IA 1QQEA 5M72A 1NL4A 2KCVA 1U3DA 2M63A 2LO6A 4R7LA 2A4ZA 4D10C 3ZGQA 5ENRD 3ZEFA 4I43A 4FLHA 4PDXA 4DX2A 1K3ZD 4B8AA 3TWQA 3HHMA 3L54A 2X6JA 4Q96A 5CMYA 3BEEA 1ELRA 1Z5SC 3IKOB 2LXMA 4UQZA 4UUCA 2IOLA 3FTYA 4L1BA 4EZKA 3CK7A 1IQUA 1MHQA 2YQ8A 3NBNB 1EF1C 1MX2A 4DX6D 4WWOA 4TXQA 4N5QA 1JUQA 4ATZD 3V31A 3FU5A 3ZHEB 3MV3B 3ZPJA 2R05A 4O1PA 1IKND 1DNPA 4TXPA 2JABA 3DPYA 3CKBA 3TL5A 4I17A 4EHMA 4L7TA 4AOFA 1KZPA 1XGWA 2GGFA 1SA5A 3L6AA 3EHNA 4ANVA 5BT1A 2V5QC 1NFIE 2P9UG 2IJGX 3ZVVA 2KC7A 3G2TA 5BXOA 2ETAA 3ZN3A 3JUIA 3TGOA 3D9MA 4CDMA 2J9QA 5ENSD 3T9KA 1KLXA 2I6HA 5D0QD 4A63B 2ZXWE 3TWXA 3PNLB 3UMVA 3D9PA 3JUEA 3UUXA 3CVXA 4W9RA 3PE4A 5EX3A 4U63A 3EJNA 1WY6A 3LJ3A 5CHEE 3SBSA 4BSZB 4FULA 2C0MA 3JCKC 1E96B 3PZDA 1Y6IA 4RQIA 3ZYMA 4LNBA 4QFVA 3OXGA 3NF1A 2JEKA 3V30A 4HLEA 3L9TA 3FU0A 3D9IA 5T8IA 5FQ7A 4ANXA 4U95D 1Z6TA 4WNEA 1SA4A 1WG0A 3W9GA 4GU5A 3D9KA 2WXFA 4GB9A 3D9OA 1TNBA 2B0OE 2YHCA 3E37A 5KNGA 3QKYA 3AG3E 2VJ8A 3HVEB 1S63A 2GRLA 2WXPA 3FUHA 1IQRA 1LTXA 2DCPA 1TYQG 4KZ0A 3E30A 2F8XK 3Q5MA 1ZBPA 3CSTA 2Y69E 4IRUA 1TJFA 2WPVA 4GMLA 4CDRA 4Y6CA 1QBQA 1JWGA 2HE0A 3Q7AA 1QNFA 5AARA 5G05C 4Q69A 2DYRE 2LAHA 1IHBA 3L22A 2WVIA 4GPMA 1QZ2A 5EYPF 1ZU2A 4HLLA 1SVXA 1BD8A 4B89A 2VQ2A 3AU4A 3CQCB 4B94A 4HORA 3PDNA 2VGXB 1U3CA 4OAUC 2WXKA 3AG2E 1EYHA 3LS8A 5G2NA 4GYYA 5KJKA 1INZA 3MJWA 5CERB 5KCMA
chains in the Genus database with same CATH topology
2MYOA 1WG0A 3W9GA 2A5EA 3J5QB 4HB5A 2ETBA 5CECB 5JMND 5EIBE 2FO1E 5KWDA 1OY3D 4RLYA 2BKKB 2JABA 1K1AA 5ENTD 3ZKJA 3T8KA 3TWWA 3ZUVB 5ENPD 2F8YA 1MX4A 3UI2A 4U96D 5ENOD 1DC2A 3EHRA 3B7BA 4GMRA 3HG0D 5ENQD 4OAVB 2B0OE 1OT8A 3ZU7B 4TUMA 3EU9A 4DX7D 3C5RA 4NIKA 1N0QA 4K5AB 2J8SD 4J7WA 2RFAA 1SW6A 2AJAA 5KNGA 3D9HA 3TWRA 4CYMD 5BXUA 4BERA 5AQAA 2QYJA 2V4HC 5D66A 2DZNA 3UTMA 4B93B 2V5QC 1NFIE 4DRXE 1BLXB 5AQ9A 3AAAC 5BXOA 5CBNA 5JA4D 3LJNA 5AN8A 3Q9NC 3TWVA 3UXGA 4DX1A 2ETAA 2F37A 4U8YD 5KNHD 4CZ2D 1BI7B 4U8VD 3TWTA 5HKPA 4G8KA 5AQBA 5FINA 3TWSA 3DEPA 2DVWA 2BKGA 5ENSD 3W9FA 3KEAA 4ZHBA 2F8XK 3SO8A 3IXEA 4HI8A 4HI9A 3T9KA 2P2CP 5ENRD 3F6QA 3HRAA 4A63B 3TWXA 1UOHA 5FIOA 3DEOA 3JUEA 1AWCB 1G3NB 5CEDB 5EIDA 2KBXA 3B95A 4LNUD 1TR4A 4YDYA 3NOGD 1YYHA 3EHQA 4DX2A 4DX5D 3J5PA 4HRLA 1YMPA 1MJ0A 1K3ZD 1A5EA 3TWQA 2HE0A 4K5BA 5HRYA 5AQ7A 5AARA 4HRMB 4O1OA 3ZNGA 4F6RD 4LG6A 1IHBA 4BSZB 4Z68A 1IXVA 4GPMA 3V79K 5CBOA 3JXIA 1N11A 5EYPF 2L6BA 4LSZE 4YDWA 4HRNA 1N0RA 4HLLA 2XENA 4BETA 2RFMA 5EYLA 5HS0A 3V2XA 1SVXA 4F1PA 2KXPC 3V2OA 1BD8A 4JB8P 5KBAA 2QC9A 3NOCD 4UUCA 2XEEA 1K1BA 4QFVA 5CEAA 4J8YA 1BU9A 2VGEA 5EN5D 5EILA 4HBDA 1D9SA 3TWUA 1AP7A 3NBNB 3JXJA 4OAUC 1BI8B 1DCQA 2NYJA 3V30A 1WDYA 5ITZF 4QQIA 4C48B 4HNAD 1MYOA 2Y1LE 4ZFHA 2DWZA 2XZDG 2ZGDA 1MX2A 1QYMA 4HQDA 4DX6D 2Y0BG 3AJIA 4N5QA 1MX6A 2DZOA 1S70B 4U95D 4BESA 4ATZD 4BEPA 4G8LA 2ZGGA 2ETCA 4K5CA 3V31A 2XZTG 4O60A 5CERB 2PNNA 2XEHA 5AAOA 1YCSB 4O1PA 4DUIA 1IKND 3Q9UC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MYO A;  1WG0 A;  3W9G A;  2A5E A;  3J5Q B;  4HB5 A;  2ETB A;  5CEC B;  5JMN D;  5EIB E;  2FO1 E;  5KWD A;  1OY3 D;  4RLY A;  2BKK B;  2JAB A;  1K1A A;  5ENT D;  3ZKJ A;  3T8K A;  3TWW A;  3ZUV B;  5ENP D;  2F8Y A;  1MX4 A;  3UI2 A;  4U96 D;  5ENO D;  1DC2 A;  3EHR A;  3B7B A;  4GMR A;  3HG0 D;  5ENQ D;  4OAV B;  2B0O E;  1OT8 A;  3ZU7 B;  4TUM A;  3EU9 A;  4DX7 D;  3C5R A;  4NIK A;  1N0Q A;  4K5A B;  2J8S D;  4J7W A;  2RFA A;  1SW6 A;  2AJA A;  5KNG A;  3D9H A;  3TWR A;  4CYM D;  5BXU A;  4BER A;  5AQA A;  2QYJ A;  2V4H C;  5D66 A;  2DZN A;  3UTM A;  4B93 B;  2V5Q C;  1NFI E;  4DRX E;  1BLX B;  5AQ9 A;  3AAA C;  5BXO A;  5CBN A;  5JA4 D;  3LJN A;  5AN8 A;  3Q9N C;  3TWV A;  3UXG A;  4DX1 A;  2ETA A;  2F37 A;  4U8Y D;  5KNH D;  4CZ2 D;  1BI7 B;  4U8V D;  3TWT A;  5HKP A;  4G8K A;  5AQB A;  5FIN A;  3TWS A;  3DEP A;  2DVW A;  2BKG A;  5ENS D;  3W9F A;  3KEA A;  4ZHB A;  2F8X K;  3SO8 A;  3IXE A;  4HI8 A;  4HI9 A;  3T9K A;  2P2C P;  5ENR D;  3F6Q A;  3HRA A;  4A63 B;  3TWX A;  1UOH A;  5FIO A;  3DEO A;  3JUE A;  1AWC B;  1G3N B;  5CED B;  5EID A;  2KBX A;  3B95 A;  4LNU D;  1TR4 A;  4YDY A;  3NOG D;  1YYH A;  3EHQ A;  4DX2 A;  4DX5 D;  3J5P A;  4HRL A;  1YMP A;  1MJ0 A;  1K3Z D;  1A5E A;  3TWQ A;  2HE0 A;  4K5B A;  5HRY A;  5AQ7 A;  5AAR A;  4HRM B;  4O1O A;  3ZNG A;  4F6R D;  4LG6 A;  1IHB A;  4BSZ B;  4Z68 A;  1IXV A;  4GPM A;  3V79 K;  5CBO A;  3JXI A;  1N11 A;  5EYP F;  2L6B A;  4LSZ E;  4YDW A;  4HRN A;  1N0R A;  4HLL A;  2XEN A;  4BET A;  2RFM A;  5EYL A;  5HS0 A;  3V2X A;  1SVX A;  4F1P A;  2KXP C;  3V2O A;  1BD8 A;  4JB8 P;  5KBA A;  2QC9 A;  3NOC D;  4UUC A;  2XEE A;  1K1B A;  4QFV A;  5CEA A;  4J8Y A;  1BU9 A;  2VGE A;  5EN5 D;  5EIL A;  4HBD A;  1D9S A;  3TWU A;  1AP7 A;  3NBN B;  3JXJ A;  4OAU C;  1BI8 B;  1DCQ A;  2NYJ A;  3V30 A;  1WDY A;  5ITZ F;  4QQI A;  4C48 B;  4HNA D;  1MYO A;  2Y1L E;  4ZFH A;  2DWZ A;  2XZD G;  2ZGD A;  1MX2 A;  1QYM A;  4HQD A;  4DX6 D;  2Y0B G;  3AJI A;  4N5Q A;  1MX6 A;  2DZO A;  1S70 B;  4U95 D;  4BES A;  4ATZ D;  4BEP A;  4G8L A;  2ZGG A;  2ETC A;  4K5C A;  3V31 A;  2XZT G;  4O60 A;  5CER B;  2PNN A;  2XEH A;  5AAO A;  1YCS B;  4O1P A;  4DUI A;  1IKN D;  3Q9U C; 
#chains in the Genus database with same CATH topology
 2LSU A;  3CVL A;  5EIB E;  4FJZ A;  5EDS A;  5KWD A;  2RG8 A;  1V55 E;  4XZ4 A;  2WXJ A;  4XX5 A;  3FTX A;  3N71 A;  3EHR A;  3TAX A;  2FBN A;  3R9M A;  3EU9 A;  2IO2 C;  5BNW A;  5BXU A;  3CVN A;  4KMO A;  4HOQ A;  1OCO E;  5E75 A;  1D8E A;  3DST A;  3MKQ A;  1N52 A;  5FIN A;  3I4R B;  3W9F A;  3KEA A;  2P9N G;  2X3M A;  3RRU A;  4AY6 A;  3UT7 A;  4I6J A;  2GW1 A;  4AM9 A;  1N4P A;  2EIL E;  4U0Z A;  3ML8 A;  2NSZ A;  1H2V C;  2HR2 A;  1E7U A;  1RW2 A;  2KZT B;  4L2L A;  3G2S A;  4ABN A;  1BU9 A;  3CHS A;  4EZL A;  3RJV A;  1E8Y A;  4GMJ A;  3L16 A;  3B13 A;  1MYO A;  2I9C A;  2WXN A;  4LUN U;  4WUY A;  2ZGD A;  4HQD A;  3SHF A;  2DZO A;  3PE3 A;  5KJL A;  4JHK A;  2PZI A;  5AJD A;  2A5E A;  4JHJ A;  4JW1 A;  1OY3 D;  3ZKJ A;  4GA2 A;  1FT2 A;  5EX0 A;  1TNO A;  5EKQ D;  4G1T A;  3C5R A;  4NIK A;  4AP2 A;  4X8Q A;  4UI9 J;  4DRX E;  1OWN A;  1TN8 A;  1HFA A;  4DI4 A;  2WQH A;  1ELK A;  2IEJ A;  3SF4 A;  5HQ8 A;  3ZW3 A;  2F37 A;  2X6F A;  5ENN A;  3VLE A;  4MRU A;  2FI7 A;  1W3B A;  3I5P A;  3MKR A;  5FTP A;  2BUG A;  3F6Q A;  4K03 A;  3FUK A;  1UOH A;  1OCC E;  4J8F A;  4OYS A;  1S64 A;  4HRL A;  1LD8 A;  4KT6 B;  4ANW A;  4O1O A;  3ZYK A;  4G25 A;  3APF A;  2WXO A;  3AS4 A;  5CBO A;  2VSN A;  2L6B A;  1X81 A;  4YDW A;  3JQ1 A;  2V4L A;  5HS0 A;  2I2O A;  2QC9 A;  4DLO A;  5CEA A;  2CHZ A;  5EN5 D;  2LNI A;  3DSS A;  3R9A B;  2QYU A;  4LCT A;  2NYJ A;  3TXM A;  1OWM A;  5DIZ A;  3KSQ A;  2ZGG A;  3ABL E;  1TN7 A;  5LCW C;  3HXC A;  4XI9 A;  4U0U A;  2QZA A;  3UX4 A;  3GZ2 A;  2GRM A;  3DWL G;  5ENP D;  4CT4 A;  3P2B A;  5LX8 A;  4JZY A;  4B0Z A;  2WMO A;  4DJA A;  3O48 A;  4RG9 A;  1O5M A;  3PZ2 A;  2V0P A;  4GZ3 A;  4CYM D;  5AQA A;  3RU0 A;  5D66 A;  4RG6 A;  3QAR A;  4EEC A;  1N54 A;  1OWL A;  3ZYQ A;  4UWL A;  2IY0 C;  4U8V D;  4CGV A;  4GTR A;  4LRZ A;  4UWH A;  2BKG A;  1EPU A;  4FJY A;  4ZHB A;  3FU6 A;  3RO2 A;  5G04 C;  4TRQ A;  3NQP A;  1Z3X A;  2E0I A;  3FDH A;  3C3O A;  3CVQ A;  3PRZ A;  2IFU A;  1UN8 A;  3OXL A;  1MJ0 A;  3LEW A;  3LKU A;  3LXU X;  4KBQ A;  4F6R D;  5LOZ A;  3UM3 A;  2LAI A;  4ILH B;  4LSZ E;  2ION A;  5KBA A;  2GRO B;  4CT0 A;  3K9I A;  2Y4U A;  3Q78 A;  4ILG A;  4CGW A;  3SFX A;  3CHM A;  2BED A;  2Y1L E;  2ZU6 B;  4U04 A;  4F53 A;  4J8E A;  4FHK A;  2WXM A;  1E90 A;  4EZJ A;  3FUD A;  3I3N A;  4K5C A;  3FEY A;  3T5V A;  2WXH A;  3Q9U C;  5KJN A;  1HE8 A;  4K0R A;  5A7D B;  2FO1 E;  1K1A A;  3FTU A;  2WB2 A;  2KM4 A;  3TXN A;  4AIF A;  3U4T A;  2C2L A;  2DIW A;  4BY6 A;  2MRI A;  3HG0 D;  5BV1 A;  5D0O D;  4BER A;  3ESL A;  4KVO A;  1FPP A;  2WXL A;  1K8K G;  3Q9N C;  4UQX A;  2OV8 A;  4G8K A;  4JD2 G;  4H7X A;  3TWS A;  5J90 A;  3LY9 A;  4L2Y A;  1G3N B;  2KBX A;  1TR4 A;  4UWK A;  3UKU G;  4IYP A;  5G55 A;  3FTS A;  3MX3 A;  4TV3 A;  2IF4 A;  1O1R A;  2F0Y A;  3FTZ A;  1U2V G;  3R7R A;  1BPO A;  4GZC A;  4N39 A;  4F1P A;  2WXG A;  2XEE A;  3L82 A;  5EIL A;  3OXF A;  3IHV A;  3C3Q A;  4HOS A;  4JXT A;  5IY5 E;  5J08 A;  2DWZ A;  2QFC A;  4OVV A;  4WWN A;  4MLP A;  4C0E A;  4V3I A;  4WAF A;  3RRM B;  1S0P A;  3FWV A;  2AW6 A;  3CIA A;  4LER A;  4DUI A;  3QAQ A;  2GRP B;  4BX8 A;  2R2L A;  4DLQ A;  4JHR A;  4U96 D;  4BWR A;  3LPZ A;  4I1O B;  4BFR A;  4OAV B;  3ZU7 B;  3S2A A;  3FH7 A;  5FZS A;  4E85 A;  5JJ6 A;  1OWO A;  5AQ9 A;  5CRU A;  3E32 A;  4HXI A;  4G24 A;  3MA5 A;  2QY7 A;  1FCH A;  1Y8M A;  2ILR A;  3DEP A;  3HIZ A;  4GZ6 A;  5AJL A;  1A17 A;  3FTW A;  4LNG A;  3DEO A;  1AWC B;  1YYH A;  3EHQ A;  1FVH A;  4AV7 A;  3U66 A;  4J8D A;  2XRY A;  3O4Z A;  3FU3 A;  4AEZ C;  2P9P G;  4IUL A;  1H2U A;  4F1S A;  3UQ3 A;  4GA1 A;  2WM9 A;  4XI0 A;  2L0I A;  1OXJ A;  2NC9 A;  2OCC E;  4UQY A;  3CEQ A;  3VLF A;  3TJP A;  5HI7 A;  5FT9 A;  4HBD A;  2WXR A;  4XIF A;  3FEX A;  1WDY A;  3JQ0 A;  4M7C A;  2PM7 A;  3LCA A;  3BG1 B;  3CKC A;  4PS8 A;  3CLJ A;  3Q73 A;  3UIO C;  3HXD A;  4BX9 A;  5A6C A;  3RRN B;  2BKK B;  1B89 A;  2L0T B;  4DK5 A;  3QB2 A;  4L9P A;  5D2M C;  3QWP A;  4FP7 A;  4K5A B;  2QYJ A;  3Q4A B;  1HF8 A;  3IBE A;  5FWQ A;  3HVE A;  3AG1 E;  3LVQ E;  5AN8 A;  2VYI A;  3NAW A;  4YVQ C;  4U8Y D;  1HO8 A;  5HKP A;  3ONL A;  3RSE G;  4HVB A;  1N4R A;  3DSW A;  3FY4 A;  3U3W A;  1N4S A;  2H6I A;  3RO3 A;  4YDY A;  1HH8 A;  4C0M A;  3SFZ A;  3RK6 A;  4N5C A;  1WM5 A;  1EDU A;  2IO3 C;  2CFZ A;  3V79 K;  1HU3 A;  5E76 A;  5JJT A;  1D8D A;  5EYL A;  4GTV A;  3AS8 A;  3CV0 A;  1OWP A;  3NZU A;  3PEV B;  1O1S A;  3EUV A;  2VGE A;  3TWU A;  1TJC A;  2PQR A;  3PZ1 A;  2OVB A;  4JL0 A;  4QQI A;  1H6K A;  1N95 A;  2NXP A;  3CHR A;  4JC8 A;  5LP0 A;  1S70 B;  3FUE A;  3WXX A;  4G8L A;  2WQ7 A;  2ETC A;  5FQ6 A;  3KD7 A;  4A1S A;  4J6I A;  3ULQ A;  3MGB A;  3QOU A;  2J4B A;  3PZ3 A;  5FZR A;  4MS6 A;  3FTV A;  4RSY A;  5CEC B;  4RLY A;  2P58 C;  1HXI A;  2EIN E;  4HS2 A;  3UI2 A;  2P9K G;  2WQ6 A;  2XRZ A;  3FUM A;  4FAD A;  4JA9 A;  5CRV A;  3Q7F A;  3G2W A;  2H6H A;  3UT8 A;  4Y6W A;  4J0U A;  1DVP A;  3TWV A;  3ASO E;  4DX1 A;  2OOE A;  3DSX A;  3JYS A;  4I6E A;  4TXR A;  3GZS A;  3MZL B;  3PEU B;  3SO8 A;  2V8S E;  3X2Q E;  2P2C P;  4B8C B;  4ME2 A;  3HRA A;  2HO1 A;  4CCA A;  4LNU D;  4GZD A;  5ANL A;  2XHE A;  5FQ8 A;  5H7P A;  3CHO A;  1JCQ A;  2XPI A;  3KAE A;  2BF0 X;  3FH5 A;  4Z68 A;  3UM1 A;  4EPZ A;  2R5S A;  3RIB A;  5BUZ A;  4UI9 C;  3G2V A;  1TN6 A;  2PQN A;  2L6J A;  3CSF A;  4JB8 P;  4PS7 A;  2R02 A;  2KZT A;  1K1B A;  4YDE A;  2EIJ E;  3T5X A;  5CCM A;  2R59 A;  1DCQ A;  2YHE A;  4HNA D;  2AVP A;  1JWF A;  3TG5 A;  3ASG A;  4J8S A;  2RKK A;  3ZYL A;  3S7B A;  3AU5 A;  2ZIR A;  3ESK A;  4KVM A;  3ZRH A;  3PRE A;  3ZUV B;  3PUJ A;  5ENT D;  3TWW A;  3ABK E;  4WWP A;  2F8Y A;  3FUL A;  2J07 A;  4GMR A;  3NZS A;  1TEZ A;  4JPS A;  4TUM A;  2J08 A;  2H6F A;  2VTB B;  2J8S D;  2XPZ A;  1KZO A;  3HDX A;  4MKT A;  3D9L A;  3EDT B;  2A5U A;  3QWW A;  3AAA C;  4FC8 A;  3LJN A;  4DPR A;  3UXG A;  3PS6 A;  1IYG A;  2WXQ A;  1Q2Z A;  5AQB A;  3FP3 A;  1V54 E;  4BTA A;  5JJ7 A;  1PC2 A;  1WAO 1;  4G26 A;  2LXL A;  3SD5 A;  1KPS B;  5AQ7 A;  2IQC A;  1VDY A;  3PH0 C;  2J49 A;  4LG6 A;  4G23 A;  3HXB A;  3FFL A;  2FUL A;  1UJJ A;  4I6G A;  3CHP A;  2KXP C;  3NOC D;  4MBG A;  2AXZ A;  2B6C A;  3CVP A;  1D9S A;  3DBS A;  3SGH A;  2XGS A;  1OCZ E;  3G2U A;  4GPK A;  2ZIS A;  1UG3 A;  2Y0B G;  3FUJ A;  2FF4 A;  2P9I G;  2MHK A;  3SZ7 A;  2PNN A;  3PUK A;  3U9W A;  1XNF A;  4BT9 A;  4U8H A;  4OVU A;  2L9B A;  5B1B E;  3Q49 B;  1LF8 A;  4UWG A;  3ASD A;  1X5B A;  2P9S G;  3Q47 B;  3SY2 A;  4U0S A;  2X6K A;  3C72 A;  3OTN A;  3QNK A;  1N4Q A;  5ENQ D;  2J4D A;  1KT1 A;  4Q94 A;  4GCN A;  4GAA A;  3FH8 A;  4B93 B;  2DZN A;  4A1G A;  3CHQ A;  2UY1 A;  3HYM B;  3KEZ A;  4YVO A;  4GTP A;  2XQ0 A;  3WG7 E;  2VGY A;  4U07 A;  3ENE A;  3S7D A;  5BW8 C;  1IHG A;  3IXE A;  5C1D A;  3BU8 A;  3VLD A;  3CVW A;  1NP7 A;  5FIO A;  5T3R A;  5CED B;  2EIM E;  3ZXP A;  3B7S A;  3LYA A;  3ASF A;  2XPY A;  4HOT A;  5CCL A;  2XEN A;  3ULE G;  4GCO A;  3V2X A;  5ARF A;  1RZ4 A;  1DCE A;  3LY8 A;  3FUN A;  4NUR A;  4N2S A;  3UPV A;  3CGH A;  3PVL A;  2XEH A;  2R03 A;  5CMW A;  5AAO A;  4GTM A;  2XS1 A;  1NI1 A;  3J5Q B;  2JLB A;  3C98 A;  4G11 A;  2RD0 A;  4GA0 A;  3B7B A;  3TG4 A;  4UWF A;  2RFA A;  3ISM C;  3IV0 A;  4FLB A;  3ZHE A;  2XEV A;  4I1M A;  2YIN A;  1E7V A;  1TNY A;  3UIN C;  2EQX A;  2AXU A;  3ML9 A;  4FHJ A;  5B3S E;  2LSV A;  4F7A A;  3DXM G;  4EBA G;  3J5P A;  3ULY A;  1YMP A;  3EIJ A;  4A3T A;  4N2Q A;  2LUH A;  2CHW A;  5HRY A;  1UW4 B;  2PL2 A;  3ZNG A;  1E8X A;  1ZB1 A;  4XKC A;  1OCR E;  4BTB A;  3CVU A;  4BT8 A;  2E2E A;  4N3C A;  3SNX A;  1N94 A;  3ZIM A;  3ASH A;  1SZA A;  3QJZ A;  2RFM A;  2X6H A;  3Q15 A;  4KZC A;  1TNU A;  2KCK A;  4C9B B;  4WND A;  1HX8 A;  3FUF A;  1NA3 A;  4N3A A;  3SQV A;  2I1J A;  5ITZ F;  1SQM A;  2BTD A;  1JCR A;  3MV2 B;  1LD7 A;  2C0L A;  2DBA A;  4U7E B;  4YND A;  3E4B A;  2XGM A;  3E34 A;  3L17 A;  2ETB A;  3ZXS A;  3B7T A;  4ATG A;  1DC2 A;  2HYZ A;  4CRW A;  3VTY A;  5G05 J;  3NB2 A;  1OT8 A;  1NZN A;  3IEG A;  4DX7 D;  4KYO B;  3DRA A;  1H6P A;  1MZC A;  5ANR A;  3PZ4 A;  5JHB A;  3MCX A;  2OEV A;  3ONK A;  3MKQ B;  1BI7 B;  3TWT A;  4GTS A;  3EIQ C;  2VSX E;  2DVW A;  3FHE A;  4NQ0 A;  5BV0 A;  5AEN A;  2UWJ G;  1UN9 A;  1HG5 A;  3B95 A;  3GZ1 A;  3NOG D;  2AXV A;  2XCC A;  3AG4 E;  1JPL A;  5FJY A;  3UM2 A;  2GRQ B;  4BSX A;  4HOU A;  1IXV A;  3U64 A;  3UIP C;  5LFA A;  3L13 A;  3DPD A;  3T8M A;  2OEW A;  2CHX A;  4GTT A;  4XKB A;  4G2V A;  3BG0 B;  3GYZ A;  1MQS A;  1E8W A;  4PH4 B;  2H6G A;  4ILI A;  1BI8 B;  3B7R L;  3BQO A;  3CK9 A;  1HS6 A;  2XZD G;  3QWV A;  1FT1 A;  4YDO A;  1HG2 A;  3LDZ A;  1MX6 A;  3CR3 A;  4BEP A;  1FVF A;  4RVB A;  4O6F A;  4AY5 A;  4URK A;  3QDN A;  4HB5 A;  5JMN D;  2VGX A;  4GYO A;  2GRN B;  1H2T C;  1YA0 A;  3KS2 A;  3APC A;  4AVX A;  4DI3 A;  3EHM A;  1NA0 A;  2XS8 A;  4KXK B;  3AS5 A;  3LVR E;  4L23 A;  5CBN A;  1SW6 A;  3E33 A;  2V4H C;  3UTM A;  1BLX B;  4IN3 B;  3IHY A;  5KNH D;  3SFY A;  4CZ2 D;  1H19 A;  4A55 A;  5JHA A;  3VTX A;  3GW4 A;  5AYW D;  3QC1 A;  3APD A;  5DBK A;  2VSO E;  4HI8 A;  3ASN E;  4HI9 A;  4AJW A;  3RKV A;  3EU5 A;  4ACL A;  4LEU A;  5EID A;  3CK8 A;  4DX5 D;  2CG3 A;  1A5E A;  4EQF A;  4K5B A;  3SI5 A;  4PUC A;  4GYW A;  2CFU A;  4TUU A;  1N9A A;  4JEU A;  3JXI A;  4M3O A;  3UT4 A;  4BET A;  2HM8 A;  3V2O A;  2I1K A;  4AXH A;  4I1A A;  2YNQ A;  3PNT B;  4HFG A;  1O1T A;  3S7F A;  2KCL A;  3MYV A;  1SZ9 A;  4APF A;  1AP7 A;  4PS3 A;  3L08 A;  3D3M A;  2MOW A;  4C48 B;  4CDN A;  3S7J A;  4H7Y A;  5ARG A;  1UJK A;  4I9E A;  4I9C A;  4NRH B;  5KJM A;  2OVF A;  4BES A;  2X38 A;  3UKR G;  5AIJ A;  1PY1 A;  2MYO A;  2IOS A;  5C2Y A;  4EBA A;  4P29 A;  1JCS A;  5ENO D;  2V5F A;  3LY7 A;  2KAT A;  3QK0 A;  3B7U X;  3DSU A;  1H6O A;  3CVV A;  4F3V A;  3KSL A;  2OND A;  1N0Q A;  2WMN A;  3D9J A;  4J7W A;  2AJA A;  4NAC A;  5JA4 D;  3URZ A;  5T4Y A;  3HXF A;  3CQG B;  4APO A;  4WNG A;  1PAQ A;  1OUV A;  1HZ4 A;  4XEI G;  3OAW A;  4ANU A;  1KT0 A;  2DYS E;  3UM0 A;  4XE0 A;  2Y4T A;  5FZQ A;  3Q75 A;  4JA7 A;  5LCW J;  4A3V A;  1L5J A;  2FEZ A;  2AWI A;  1TNZ A;  3BUA A;  3DXK G;  3I4G A;  3R7Q A;  3RAU A;  3DSV A;  4HRM B;  4GTO A;  4I2Z A;  2PM6 A;  3SBT B;  5BPP A;  1ELW A;  1E8Z A;  1N11 A;  4HRN A;  1N0R A;  1P5Q A;  4ACK A;  4FA6 A;  2XCB A;  4I2W A;  5FQ4 A;  3FUI A;  2FO7 A;  4JEH A;  5B1A E;  3ZFW A;  3P1U A;  2VSY A;  4GZ5 A;  4J8Y A;  2GRR B;  1GW6 A;  2Y3A A;  3ABM E;  2EIK E;  4E6H A;  3JXJ A;  2R17 C;  3MEK A;  4ZFH A;  1H0A A;  1QYM A;  4JVS A;  3AJI A;  5A23 A;  3CVY A;  3D9N A;  5G04 J;  2IU1 A;  2XZT G;  4O60 A;  1YCS B;  2UY1 B;  2P9L G;  3HXE A;  4GTQ A;  4N3B A;  2CG2 A;  4WNF A;  2WXI A;  3C3R A;  3T8K A;  1MX4 A;  4UI9 K;  2XGO A;  2J09 A;  1Z3Y A;  2Q7F A;  3TWR A;  4CEM A;  3D9H A;  4FU3 A;  2VTB A;  3Q79 A;  2X6I A;  1QQE A;  5M72 A;  1NL4 A;  2KCV A;  1U3D A;  2M63 A;  2LO6 A;  4R7L A;  2A4Z A;  4D10 C;  3ZGQ A;  5ENR D;  3ZEF A;  4I43 A;  4FLH A;  4PDX A;  4DX2 A;  1K3Z D;  4B8A A;  3TWQ A;  3HHM A;  3L54 A;  2X6J A;  4Q96 A;  5CMY A;  3BEE A;  1ELR A;  1Z5S C;  3IKO B;  2LXM A;  4UQZ A;  4UUC A;  2IOL A;  3FTY A;  4L1B A;  4EZK A;  3CK7 A;  1IQU A;  1MHQ A;  2YQ8 A;  3NBN B;  1EF1 C;  1MX2 A;  4DX6 D;  4WWO A;  4TXQ A;  4N5Q A;  1JUQ A;  4ATZ D;  3V31 A;  3FU5 A;  3ZHE B;  3MV3 B;  3ZPJ A;  2R05 A;  4O1P A;  1IKN D;  1DNP A;  4TXP A;  2JAB A;  3DPY A;  3CKB A;  3TL5 A;  4I17 A;  4EHM A;  4L7T A;  4AOF A;  1KZP A;  1XGW A;  2GGF A;  1SA5 A;  3L6A A;  3EHN A;  4ANV A;  5BT1 A;  2V5Q C;  1NFI E;  2P9U G;  2IJG X;  3ZVV A;  2KC7 A;  3G2T A;  5BXO A;  2ETA A;  3ZN3 A;  3JUI A;  3TGO A;  3D9M A;  4CDM A;  2J9Q A;  5ENS D;  3T9K A;  1KLX A;  2I6H A;  5D0Q D;  4A63 B;  2ZXW E;  3TWX A;  3PNL B;  3UMV A;  3D9P A;  3JUE A;  3UUX A;  3CVX A;  4W9R A;  3PE4 A;  5EX3 A;  4U63 A;  3EJN A;  1WY6 A;  3LJ3 A;  5CHE E;  3SBS A;  4BSZ B;  4FUL A;  2C0M A;  3JCK C;  1E96 B;  3PZD A;  1Y6I A;  4RQI A;  3ZYM A;  4LNB A;  4QFV A;  3OXG A;  3NF1 A;  2JEK A;  3V30 A;  4HLE A;  3L9T A;  3FU0 A;  3D9I A;  5T8I A;  5FQ7 A;  4ANX A;  4U95 D;  1Z6T A;  4WNE A;  1SA4 A;  1WG0 A;  3W9G A;  4GU5 A;  3D9K A;  2WXF A;  4GB9 A;  3D9O A;  1TNB A;  2B0O E;  2YHC A;  3E37 A;  5KNG A;  3QKY A;  3AG3 E;  2VJ8 A;  3HVE B;  1S63 A;  2GRL A;  2WXP A;  3FUH A;  1IQR A;  1LTX A;  2DCP A;  1TYQ G;  4KZ0 A;  3E30 A;  2F8X K;  3Q5M A;  1ZBP A;  3CST A;  2Y69 E;  4IRU A;  1TJF A;  2WPV A;  4GML A;  4CDR A;  4Y6C A;  1QBQ A;  1JWG A;  2HE0 A;  3Q7A A;  1QNF A;  5AAR A;  5G05 C;  4Q69 A;  2DYR E;  2LAH A;  1IHB A;  3L22 A;  2WVI A;  4GPM A;  1QZ2 A;  5EYP F;  1ZU2 A;  4HLL A;  1SVX A;  1BD8 A;  4B89 A;  2VQ2 A;  3AU4 A;  3CQC B;  4B94 A;  4HOR A;  3PDN A;  2VGX B;  1U3C A;  4OAU C;  2WXK A;  3AG2 E;  1EYH A;  3LS8 A;  5G2N A;  4GYY A;  5KJK A;  1INZ A;  3MJW A;  5CER B;  5KCM A; 
#chains in the Genus database with same CATH homology
 2MYO A;  1WG0 A;  3W9G A;  2A5E A;  3J5Q B;  4HB5 A;  2ETB A;  5CEC B;  5JMN D;  5EIB E;  2FO1 E;  5KWD A;  1OY3 D;  4RLY A;  2BKK B;  2JAB A;  1K1A A;  5ENT D;  3ZKJ A;  3T8K A;  3TWW A;  3ZUV B;  5ENP D;  2F8Y A;  1MX4 A;  3UI2 A;  4U96 D;  5ENO D;  1DC2 A;  3EHR A;  3B7B A;  4GMR A;  3HG0 D;  5ENQ D;  4OAV B;  2B0O E;  1OT8 A;  3ZU7 B;  4TUM A;  3EU9 A;  4DX7 D;  3C5R A;  4NIK A;  1N0Q A;  4K5A B;  2J8S D;  4J7W A;  2RFA A;  1SW6 A;  2AJA A;  5KNG A;  3D9H A;  3TWR A;  4CYM D;  5BXU A;  4BER A;  5AQA A;  2QYJ A;  2V4H C;  5D66 A;  2DZN A;  3UTM A;  4B93 B;  2V5Q C;  1NFI E;  4DRX E;  1BLX B;  5AQ9 A;  3AAA C;  5BXO A;  5CBN A;  5JA4 D;  3LJN A;  5AN8 A;  3Q9N C;  3TWV A;  3UXG A;  4DX1 A;  2ETA A;  2F37 A;  4U8Y D;  5KNH D;  4CZ2 D;  1BI7 B;  4U8V D;  3TWT A;  5HKP A;  4G8K A;  5AQB A;  5FIN A;  3TWS A;  3DEP A;  2DVW A;  2BKG A;  5ENS D;  3W9F A;  3KEA A;  4ZHB A;  2F8X K;  3SO8 A;  3IXE A;  4HI8 A;  4HI9 A;  3T9K A;  2P2C P;  5ENR D;  3F6Q A;  3HRA A;  4A63 B;  3TWX A;  1UOH A;  5FIO A;  3DEO A;  3JUE A;  1AWC B;  1G3N B;  5CED B;  5EID A;  2KBX A;  3B95 A;  4LNU D;  1TR4 A;  4YDY A;  3NOG D;  1YYH A;  3EHQ A;  4DX2 A;  4DX5 D;  3J5P A;  4HRL A;  1YMP A;  1MJ0 A;  1K3Z D;  1A5E A;  3TWQ A;  2HE0 A;  4K5B A;  5HRY A;  5AQ7 A;  5AAR A;  4HRM B;  4O1O A;  3ZNG A;  4F6R D;  4LG6 A;  1IHB A;  4BSZ B;  4Z68 A;  1IXV A;  4GPM A;  3V79 K;  5CBO A;  3JXI A;  1N11 A;  5EYP F;  2L6B A;  4LSZ E;  4YDW A;  4HRN A;  1N0R A;  4HLL A;  2XEN A;  4BET A;  2RFM A;  5EYL A;  5HS0 A;  3V2X A;  1SVX A;  4F1P A;  2KXP C;  3V2O A;  1BD8 A;  4JB8 P;  5KBA A;  2QC9 A;  3NOC D;  4UUC A;  2XEE A;  1K1B A;  4QFV A;  5CEA A;  4J8Y A;  1BU9 A;  2VGE A;  5EN5 D;  5EIL A;  4HBD A;  1D9S A;  3TWU A;  1AP7 A;  3NBN B;  3JXJ A;  4OAU C;  1BI8 B;  1DCQ A;  2NYJ A;  3V30 A;  1WDY A;  5ITZ F;  4QQI A;  4C48 B;  4HNA D;  1MYO A;  2Y1L E;  4ZFH A;  2DWZ A;  2XZD G;  2ZGD A;  1MX2 A;  1QYM A;  4HQD A;  4DX6 D;  2Y0B G;  3AJI A;  4N5Q A;  1MX6 A;  2DZO A;  1S70 B;  4U95 D;  4BES A;  4ATZ D;  4BEP A;  4G8L A;  2ZGG A;  2ETC A;  4K5C A;  3V31 A;  2XZT G;  4O60 A;  5CER B;  2PNN A;  2XEH A;  5AAO A;  1YCS B;  4O1P A;  4DUI A;  1IKN D;  3Q9U C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...