4BSZB

Crystal structure of the yeast ribosomal protein rps3 in complex with its chaperone yar1
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
150
structure length
150
Chain Sequence
PLDQEDQDTIILDARAGDLDSLKDIFTTLVSPELLSTCKESESDSTALHMAAANGHIETVRYILETVSRANSAEDLKAFVNEVNKTGNTALHWASLNGKLDVVKLLCDEYEADPFIRNKFGHDAIFEAENSGKEEVETYFLKKYDVEPED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 40S RIBOSOMAL PROTEIN S3
publication title Crystal Structure of the Yeast Ribosomal Protein Rps3 in Complex with its Chaperone Yar1
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 54
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4bszB00
4GPMA 5AQBA 3T8KA 4NIKA 2ETCA 3JXJA 5KBAA 2XZTG 4C48B 2Y0BG 2RFMA 3UTMA 4BETA 1AP7A 2MYOA 3C5RA 3NOGD 3LJNA 4OAVB 2BKKB 2QC9A 1BI8B 5HRYA 5EYLA 5JA4D 2XZDG 1MX4A 3IXEA 3J5PA 4LNUD 5EILA 3UI2A 4OAUC 1D9SA 3AJIA 1YCSB 3TWSA 1SVXA 4UUCA 2P2CP 5AN8A 3ZNGA 2XENA 3ZU7B 4G8LA 2J8SD 1SW6A 2NYJA 4K5BA 4YDWA 1OY3D 3HG0D 2F8XK 4N5QA 4DX7D 3DEPA 4DX2A 5CEAA 3ZUVB 2XEEA 2F8YA 3UXGA 4O1OA 5KWDA 5EN5D 2A5EA 3TWTA 3EU9A 3Q9UC 4ATZD 4J8YA 5ENPD 1K1BA 4HBDA 1DCQA 4HI8A 4DX5D 3TWXA 4HRNA 2ETBA 3DEOA 5AQ7A 2DVWA 4CZ2D 1S70B 1DC2A 3TWVA 4BERA 4HRMB 1UOHA 4HRLA 1K1AA 1YYHA 4O1PA 1IKND 4DX6D 2HE0A 5CBOA 5EIDA 3AAAC 3V2OA 4LG6A 1BLXB 4CYMD 1MX6A 4YDYA 3T9KA 2F37A 3B7BA 2QYJA 4LSZE 4HNAD 2AJAA 3EHRA 4O60A 5EYPF 3F6QA 1MJ0A 1K3ZD 5HS0A 5FIOA 5AAOA 2ZGGA 3V31A 5FINA 5ENQD 3HRAA 3J5QB 1G3NB 3D9HA 4K5CA 4RLYA 1BU9A 2BKGA 3Q9NC 2PNNA 4JB8P 4ZHBA 1OT8A 5HKPA 4A63B 5CERB 5ENTD 3V79K 2FO1E 1N0QA 1NFIE 1TR4A 1MX2A 2DZOA 4J7WA 5ENRD 3V30A 3V2XA 4BEPA 5ITZF 2B0OE 2DZNA 4U95D 1IHBA 4U8YD 1QYMA 3NBNB 3W9FA 1MYOA 5AARA 4DRXE 1A5EA 4G8KA 1BI7B 5JMND 2L6BA 3B95A 4DUIA 2ZGDA 1YMPA 4HB5A 4TUMA 4F1PA 4Z68A 1N0RA 1WG0A 2ETAA 4BSZB 1N11A 5CEDB 4QQIA 4U96D 4U8VD 5D66A 2JABA 5ENOD 5KNHD 4QFVA 3W9GA 2KXPC 4HI9A 2VGEA 3ZKJA 4HQDA 3TWQA 1BD8A 4HLLA 5AQ9A 3EHQA 5CBNA 5EIBE 1IXVA 3NOCD 2V4HC 5ENSD 2XEHA 3TWRA 4F6RD 4BESA 1AWCB 2KBXA 2DWZA 4DX1A 2V5QC 5BXUA 5CECB 4B93B 4ZFHA 3KEAA 4GMRA 3TWUA 5KNGA 5AQAA 1WDYA 3JXIA 3SO8A 3TWWA 2Y1LE 2RFAA 3JUEA 5BXOA 4K5AB
chains in the Genus database with same CATH superfamily
3DXMG 3ASNE 5C1DA 1KT1A 2HYZA 1NI1A 2OEVA 2FO7A 2BF0X 3DSUA 1D8EA 2WPVA 2QC9A 2BEDA 1Z6TA 1N54A 2IOLA 4CDRA 3PH0C 3TAXA 4ATGA 1BPOA 3HG0D 3VLFA 3FUJA 4AJWA 4DX2A 3ZUVB 2F8YA 4M3OA 4PS3A 1OWMA 4WWOA 3E30A 4GYYA 1A17A 1VDYA 2DVWA 3LS8A 2WXOA 5T4YA 3QWPA 3V2OA 2M63A 4HNAD 3ZRHA 3EHRA 3T8MA 4B0ZA 4LEUA 3ABLE 3V31A 1H2UA 2XGMA 4E85A 2P9SG 4P29A 2FO1E 1PC2A 3RRMB 1QYMA 1HG5A 3SZ7A 4F7AA 1MYOA 3PZ3A 3IEGA 5FQ7A 1E8YA 4UWFA 1IQRA 1BI7B 2I6HA 2ZGDA 5FTPA 3FULA 4HB5A 3B7RL 3HDXA 2IO2C 3CQGB 1IHGA 5G05C 3U3WA 1NA0A 1BD8A 3FTWA 2HR2A 2X6JA 4HLLA 2E2EA 2XEHA 4JA9A 3RIBA 3D9MA 4FU3A 5AQAA 2H6HA 4ME2A 3ASDA 3AG3E 4RG6A 1HX8A 4GMLA 4GPMA 4GTSA 1FT2A 2YHCA 4KXKB 1ZU2A 2RFMA 2MYOA 2PQNA 3EUVA 4I1MA 4FADA 3E37A 5AN8A 3ZYQA 2NXPA 2IEJA 3E32A 4EBAA 2YNQA 1HXIA 3KSQA 4WAFA 5DIZA 3GYZA 3Q7FA 3NQPA 5KJLA 4HOTA 1K8KG 3Q5MA 3EIJA 3HVEA 3U66A 4JB8P 4NRHB 3P1UA 5ENTD 3Q7AA 1AP7A 3ASGA 4Q96A 3PE4A 4O6FA 4DRXE 4EZLA 4GU5A 2WXPA 3ZEFA 2LNIA 3FEXA 2DCPA 3NF1A 4OYSA 1U3DA 2RD0A 2R02A 2IOSA 4H7XA 2VYIA 4MLPA 4C0EA 3CK9A 5HQ8A 3CHSA 1OWOA 4Q94A 3JXIA 3SO8A 1FPPA 3ESKA 4DPRA 2VTBB 2VSOE 4GTMA 4U0UA 2FULA 2X6IA 2CFZA 2P9NG 4DK5A 2J07A 4UQYA 3FHEA 3ZHEA 1D9SA 4TXPA 5LFAA 3MV2B 4G11A 4N5QA 4C9BB 2R03A 2IJGX 3ESLA 3RRNB 5ENPD 3SD5A 3ZPJA 3NB2A 4XEIG 2KCKA 4KBQA 1K1AA 1N4RA 4JHRA 4BY6A 4IULA 3AAAC 3HIZA 2R05A 3T9KA 3UIPC 3MGBA 1TNZA 4GZDA 3PZDA 3ISMC 4FHKA 5HS0A 3T5XA 3FFLA 1GW6A 3HRAA 4JHJA 2WXNA 2DZOA 2GRLA 3SBSA 4H7YA 2P9UG 3BUAA 3CVPA 3TXNA 2IQCA 3ASFA 3BG0B 1U3CA 4BWRA 5JJ7A 5LOZA 1DNPA 3UKUG 1OCZE 1OCOE 4OVVA 2VGXA 3APDA 2JABA 4GA0A 3UKRG 2AW6A 4U7EB 4CCAA 2CFUA 2WXFA 2Y1LE 2EQXA 3ABKE 3R9MA 5FWQA 2KATA 2XZTG 5A6CA 1BI8B 2LSVA 4B8AA 2BUGA 3CVQA 3ZNGA 3TWSA 3E34A 3ULEG 4I9EA 4GZ6A 3DEPA 1IQUA 2VSNA 3BEEA 2X38A 4BERA 4HVBA 1TN6A 5CBOA 4L2YA 5CRVA 1E96B 2XEVA 2IF4A 4TUUA 3FUHA 4I2ZA 1JCSA 1HG2A 3AU5A 4UQZA 5G55A 1K3ZD 4JEHA 2ZGGA 2GRNB 1D8DA 4LRZA 3FUMA 4K5CA 2I9CA 3LKUA 3BU8A 5AJDA 2Q7FA 2AXVA 4U8YD 3RKVA 1A5EA 4N2QA 5HI7A 4R7LA 1XGWA 3D9JA 2WXJA 5G04C 4TUMA 4BSZB 4E6HA 3PDNA 4U96D 2DBAA 2JEKA 4HI9A 3RSEG 4N3AA 4U07A 4F6RD 3DPDA 5BXUA 4GTTA 3DSXA 3D9KA 4UI9K 4BT9A 2P9LG 1E90A 4L2LA 3LJNA 4JXTA 2BKKB 3DPYA 4NACA 5EILA 4A3TA 4BX9A 4XKCA 5H7PA 5BV0A 1SZ9A 2NYJA 2YHEA 2A5EA 3G2SA 1UJJA 3L16A 3FUKA 3MJWA 3ZYMA 1Y6IA 2CHWA 4IN3B 4LCTA 3ENEA 4EZKA 3LY8A 4BT8A 3CK7A 4AV7A 3KAEA 1MJ0A 2WXIA 3MKRA 3UX4A 3E4BA 2KZTA 5LP0A 3MYVA 2QYUA 3V79K 3B7UX 4APFA 4BEPA 3TJPA 4RVBA 3NAWA 3TL5A 4CGWA 4LNBA 3ONKA 2EIME 4I6JA 2C0MA 3DBSA 3Q73A 3L82A 4GTQA 4Z68A 3D9PA 4EBAG 3UM1A 5EX0A 2VGEA 2BTDA 1EF1C 5CCLA 1LD8A 4BSXA 3JYSA 3HVEB 4K5AB 4TXRA 4B8CB 2KCLA 3MKQA 5JJ6A 3D9IA 2DIWA 4OAVB 2GRQB 3ML8A 3ML9A 4UWLA 4YNDA 1QBQA 3ZU7B 1E7VA 2J8SD 4UI9C 4K5BA 3G2TA 3C3OA 2XS8A 2PM7A 3UXGA 4GMJA 3RAUA 5EN5D 1S63A 4F3VA 1H19A 1O5MA 4DX6D 1UN8A 3EJNA 1ELRA 4DI3A 3CVLA 3FTSA 2X3MA 1HZ4A 5D0QD 2AJAA 4K0RA 3ONLA 4U8HA 3J5QB 3OXLA 2X6HA 1NZNA 2XPYA 3SY2A 3LY7A 5JHBA 3S7JA 3HXEA 3V2XA 1MQSA 1H6KA 3R7RA 5JMND 4DLQA 4DUIA 2C0LA 1MHQA 1YMPA 2VQ2A 3FTUA 4G26A 1LF8A 2QZAA 3MX3A 3ULQA 3CQCB 1RZ4A 5AQ9A 2WXGA 2LSUA 5T8IA 1AWCB 2L0TB 3ZVVA 4BFRA 2AXZA 4AIFA 3JXJA 5B3SE 1L5JA 3QC1A 5A23A 3AG1E 2J09A 4MRUA 2A4ZA 3VTXA 2VGYA 3Q47B 3TWTA 3Q9UC 1K1BA 3B7SA 3L17A 4HBDA 3TWXA 3DEOA 1N52A 4JHKA 1TJCA 1H2VC 1DC2A 1YYHA 1MX6A 3GZ2A 3VTYA 1PAQA 3BG1B 1TNOA 3FUNA 2WXLA 3Q9NC 1NFIE 1MX2A 1P5QA 3D3MA 4EZJA 3N71A 4I2WA 5BPPA 3NBNB 1Q2ZA 4WWNA 3CGHA 4CDNA 4G8KA 2L6BA 4PDXA 3QJZA 4WWPA 5LX8A 4QFVA 3DSSA 5LCWJ 3L9TA 4HQDA 4JC8A 4B89A 2V4HC 1H0AA 1HFAA 5CECB 1NL4A 5EX3A 3C3RA 3CKBA 4MS6A 2WB2A 4UI9J 1MZCA 3UTMA 3C5RA 4FJYA 1V55E 2IY0C 5EYLA 3B13A 3CVNA 1U2VG 4GZCA 4PH4B 2R59A 3R7QA 4YDWA 3X2QE 4XKBA 2A5UA 2XEEA 2R17C 2ZIRA 3RRUA 4G25A 4XIFA 3OAWA 4A1GA 1NA3A 4TRQA 4DJAA 3CLJA 4I17A 4LSZE 2UY1B 2HM8A 3CVUA 2WVIA 4AY5A 1HF8A 4KMOA 2CG2A 3PVLA 1KT0A 2X6KA 4ILGA 2MOWA 3U4TA 4ZHBA 5HKPA 3SHFA 4ACLA 3S7FA 1TR4A 4HOQA 3GZ1A 4GZ5A 1KZOA 4I6GA 1IHBA 3CHMA 3CSTA 4ANWA 3S2AA 1OWLA 1WG0A 3FDHA 2R2LA 4QQIA 4N2SA 3EHQA 5CCMA 4K03A 3OTNA 2DYRE 4WNFA 1Z3XA 4L7TA 4B93B 4WNEA 3PNLB 3C72A 5G05J 3PREA 3AS4A 3JUEA 1WM5A 3RJVA 3LXUX 4FP7A 5BUZA 3FH5A 3U9WA 5M72A 2I2OA 4FC8A 1MX4A 4OAUC 4G8LA 5ANRA 3MEKA 3FU5A 3VLEA 2OCCE 3JQ0A 4ANXA 1OXJA 3CHOA 3AU4A 1DVPA 3TWVA 3MV3B 5FZSA 2CHXA 1BLXB 2H6GA 4J8EA 2QYJA 2NC9A 3FH7A 1UW4B 4JZYA 4I1OB 3MKQB 3VLDA 3DXKG 5A7DB 2AWIA 2Y4TA 4Y6CA 3UT4A 1G3NB 4CEMA 2EIKE 4GA1A 4J7WA 4KVMA 4C0MA 3S7BA 3CVYA 4XI0A 1JWFA 4I6EA 3LCAA 2FF4A 4LUNU 2EINE 3CHPA 3D9LA 1OCCE 1TNUA 2CG3A 3MCXA 3FUEA 4U8VD 4ILHB 3GZSA 1INZA 3GW4A 2KBXA 4PS8A 4FA6A 3I3NA 3LDZA 4X8QA 4AY6A 3QNKA 1Y8MA 4CRWA 1OWNA 3T8KA 2XCCA 1SA5A 4NQ0A 1O1SA 4UWKA 1EDUA 2J4DA 2J08A 2XZDG 3UI2A 3AJIA 4UUCA 2PM6A 1SW6A 2EILE 3CV0A 4BX8A 1TJFA 4RG9A 2ETBA 3FH8A 3PZ4A 3URZA 1E8ZA 3ZW3A 4AVXA 4JL0A 2DYSE 3TG4A 3ZYLA 4N3BA 3FTVA 3OXFA 5ARFA 3B7BA 2QFCA 3FTZA 2PQRA 3CIAA 3QAQA 3U64A 3F6QA 4M7CA 2KC7A 2XGOA 3PZ1A 1H2TC 3ABME 2BKGA 2XCBA 2PNNA 4L1BA 4EQFA 5ITZF 2P9IG 2DZNA 3SFZA 4AEZC 1LTXA 2WM9A 3FU0A 1X81A 1N0RA 2MHKA 3JCKC 1UN9A 3KEZA 5CBNA 4GA2A 4A3VA 5ENSD 4CDMA 4GMRA 4KZ0A 2WXQA 4NURA 5AQBA 5ARGA 1RW2A 2WXHA 5FQ6A 2LAHA 4TXQA 3OXGA 4N3CA 1N4QA 3CR3A 4EHMA 1QNFA 2I1JA 2OEWA 3CHRA 3T5VA 3PRZA 1DCEA 1ELWA 5B1BE 4L9PA 5HRYA 2WQ7A 3KSLA 4LNUD 4YDOA 1QZ2A 3UT7A 2PZIA 5KCMA 1E7UA 4J0UA 4Y6WA 2WQHA 5G2NA 4GTVA 4GAAA 4HRLA 1UOHA 4J8SA 2IU1A 2F37A 3PUJA 5D2MC 3AG4E 3AG2E 2FBNA 4Q69A 4D10C 4TV3A 1TNYA 4HORA 3V30A 5CHEE 2P9PG 2B0OE 4U95D 4G23A 5KJKA 2GGFA 3DSVA 5BT1A 3FEYA 1B89A 2ILRA 1N11A 1KLXA 2IONA 3SQVA 3ZHEB 2KXPC 3HHMA 3TWQA 3LVRE 4DLOA 5G04J 5EIBE 3TWRA 4CT0A 4AP2A 4DX1A 2V5FA 3MA5A 4UWHA 1JWGA 4GB9A 4G2VA 4J8FA 5ENNA 1SQMA 2XQ0A 3LVQE 1HE8A 5CRUA 5FQ8A 4NIKA 5T3RA 3UM3A 2ONDA 5DBKA 5J90A 5IY5E 3IXEA 4FLBA 3O48A 2XENA 5ANLA 2VSYA 5BW8C 4FJZA 5KJNA 3QARA 5JJTA 4FULA 2RKKA 1ZBPA 3I4RB 3SNXA 4DX5D 1S70B 4YDEA 4FLHA 3S7DA 1IKND 4XI9A 5AENA 1TNBA 4MKTA 2FI7A 4JEUA 3TGOA 1TN8A 4CYMD 2LXMA 3RK6A 4W9RA 4BTAA 4GPKA 3NZSA 2VGXB 3SFXA 3QKYA 1XNFA 4U0SA 1V54E 2NSZA 2OVBA 2B6CA 2H6FA 2GRRB 4ANVA 3C98A 3CEQA 3SI5A 3HXDA 2AVPA 4HOSA 3L08A 4GCOA 5CEDB 2Y4UA 3EHMA 3QDNA 2WMOA 3AS8A 4WNDA 2J4BA 3E33A 1Z5SC 3RO3A 3DWLG 1HH8A 1TYQG 2DWZA 5KJMA 4FHJA 5KNGA 2XS1A 1WDYA 5EKQD 3UT8A 4J6IA 2RFAA 5BXOA 4GTOA 3PZ2A 1JCQA 2GW1A 3G2UA 5KBAA 2H6IA 3FTXA 1ZB1A 4ANUA 5FZQA 4I43A 5JA4D 3G2VA 3J5PA 2GRMA 3WXXA 2P2CP 2CHZA 4JW1A 1WY6A 2F8XK 4DX7D 4KZCA 5CEAA 4JPSA 4LNGA 4ATZD 2XHEA 4HI8A 5AQ7A 4KT6B 3K9IA 3DSTA 3IKOB 4O1PA 1NP7A 1WAO1 2OOEA 3IBEA 3LJ3A 4YDYA 4URKA 3O4ZA 4F1SA 1O1RA 3FTYA 1HS6A 2WMNA 4RSYA 2L0IA 2VSXE 5FINA 1YA0A 3Q49B 4A63B 3UM2A 1TN7A 1N0QA 5ENRD 3LY9A 2WXRA 3W9FA 3JUIA 2L6JA 4F53A 1OUVA 3Q79A 5AJLA 3ZXSA 3CK8A 2OV8A 2LUHA 3SF4A 2J49A 4UQXA 1O1TA 3PEUB 2ETAA 2P58C 5D66A 3QOUA 2R5SA 4JVSA 3UMVA 4I9CA 4CT4A 1IXVA 1PY1A 3NOCD 3CVWA 4BESA 4LERA 4YVOA 4ZFHA 3I5PA 3KEAA 3TWUA 2XPZA 4HXIA 2FEZA 3CSFA 3UM0A 4GYWA 2IO3C 3TXMA 2YQ8A 3PE3A 1KPSB 4C48B 2Y0BG 5FZRA 2V8SE 3NOGD 4GTPA 1QQEA 5C2YA 3UUXA 4ACKA 2I1KA 2JLBA 2QY7A 1OWPA 3CVVA 3C3QA 1H6PA 4U0ZA 2KM4A 5E75A 3P2BA 2LAIA 3KD7A 3CHQA 2KZTB 3AS5A 5KWDA 2P9KG 1SZAA 2EIJE 2LXLA 4A55A 3CVXA 1Z3YA 3ULYA 2HE0A 4JD2G 5EIDA 3ZIMA 2GROB 4N39A 1N4SA 3MZLB 3APFA 1UJKA 1E8WA 4YVQC 3RU0A 4EECA 4O60A 4U63A 1LD7A 4V3IA 3L54A 4IYPA 5FIOA 4HS2A 3L13A 3D9HA 4RLYA 2V0PA 2AXUA 1OT8A 3HYMB 2XPIA 2L9BA 2E0IA 2XRYA 1FVFA 4CGVA 5EDSA 4KYOB 2GRPB 3D9OA 1KZPA 3Q15A 4A1SA 3FUDA 4HLEA 5CMWA 5ENOD 3IHVA 3ZKJA 3G2WA 3HXBA 4ABNA 2ZU6B 4B94A 1N9AA 2Y69E 2YINA 1EPUA 5J08A 3L6AA 2RG8A 2MRIA 1EYHA 3ZFWA 3R9AB 4AXHA 1OCRE 1IYGA 3ZXPA 2XGSA 2KCVA 5AYWD 3EDTB 3FWVA 4PS7A 2WQ6A 5CMYA 3SGHA 3ZN3A 3BQOA 3FUFA 1YCSB 1SVXA 3UPVA 3EHNA 4GTRA 2C2LA 1OY3D 2ZXWE 4ILIA 3WG7E 4I1AA 5D0OD 2OVFA 3FY4A 4O1OA 2IFUA 3EU9A 1S64A 1S0PA 1DCQA 4HRNA 4HFGA 3FUIA 3UIOC 1JPLA 4HRMB 3IHYA 4LG6A 4IRUA 1FCHA 1E8XA 3SBTB 3DSWA 4G24A 1H6OA 4U04A 5EYPF 1BU9A 4APOA 4DI4A 2UWJG 5AIJA 5CERB 2VTBA 3D9NA 5AARA 3TG5A 5JHAA 3APCA 4XE0A 4L23A 3LPZA 2UY1A 5KNHD 3W9GA 1TEZA 3EU5A 4JA7A 3NZUA 5FT9A 3HXCA 2XRZA 4GYOA 3FU3A 3LYAA 2V5QC 3B7TA 4GCNA 2WXMA 3PS6A 3DRAA 3ASOE 3L22A 3ASHA 2PL2A 3HXFA 1JCRA 4HOUA 1N95A 2LO6A 3QB2A 4XZ4A 1FVHA 2ETCA 2X6FA 3Q78A 3RO2A 5FQ4A 4BETA 3JQ1A 4UWGA 4F1PA 4N5CA 3QK0A 4BTBA 1N4PA 5E76A 4J8DA 4G1TA 2V4LA 4J8YA 1ELKA 5B1AE 4CZ2D 3CKCA 3UINC 1N94A 4EPZA 5FJYA 2F0YA 4WUYA 2Y3AA 5BV1A 1FT1A 1HO8A 1W3BA 4KVOA 3KS2A 4PUCA 3EIQC 5ENQD 5BNWA 3PNTB 3FP3A 3LEWA 3Q75A 5AAOA 3ZYKA 3ZGQA 4MBGA 4AM9A 2HO1A 3PEVB 5LCWC 1HU3A 3B95A 3UQ3A 2ZISA 4XX5A 1JUQA 4WNGA 2J9QA 3IV0A 3Q4AB 4AOFA 3QWWA 3FU6A 1X5BA 3I4GA 4RQIA 4OVUA 2WXKA 1UG3A 4GZ3A 3PUKA 3TWWA 1SA4A 2VJ8A 3QWVA 3SFYA
chains in the Genus database with same CATH topology
4GPMA 5AQBA 3T8KA 4NIKA 2ETCA 3JXJA 5KBAA 2XZTG 4C48B 2Y0BG 2RFMA 3UTMA 4BETA 1AP7A 2MYOA 3C5RA 3NOGD 3LJNA 4OAVB 2BKKB 2QC9A 1BI8B 5HRYA 5EYLA 5JA4D 2XZDG 1MX4A 3IXEA 3J5PA 4LNUD 5EILA 3UI2A 4OAUC 1D9SA 3AJIA 1YCSB 3TWSA 1SVXA 4UUCA 2P2CP 5AN8A 3ZNGA 2XENA 3ZU7B 4G8LA 2J8SD 1SW6A 2NYJA 4K5BA 4YDWA 1OY3D 3HG0D 2F8XK 4N5QA 4DX7D 3DEPA 4DX2A 5CEAA 3ZUVB 2XEEA 2F8YA 3UXGA 4O1OA 5KWDA 5EN5D 2A5EA 3TWTA 3EU9A 3Q9UC 4ATZD 4J8YA 5ENPD 1K1BA 4HBDA 1DCQA 4HI8A 4DX5D 3TWXA 4HRNA 2ETBA 3DEOA 5AQ7A 2DVWA 4CZ2D 1S70B 1DC2A 3TWVA 4BERA 4HRMB 1UOHA 4HRLA 1K1AA 1YYHA 4O1PA 1IKND 4DX6D 2HE0A 5CBOA 5EIDA 3AAAC 3V2OA 4LG6A 1BLXB 4CYMD 1MX6A 4YDYA 3T9KA 2F37A 3B7BA 2QYJA 4LSZE 4HNAD 2AJAA 3EHRA 4O60A 5EYPF 3F6QA 1MJ0A 1K3ZD 5HS0A 5FIOA 5AAOA 2ZGGA 3V31A 5FINA 5ENQD 3HRAA 3J5QB 1G3NB 3D9HA 4K5CA 4RLYA 1BU9A 2BKGA 3Q9NC 2PNNA 4JB8P 4ZHBA 1OT8A 5HKPA 4A63B 5CERB 5ENTD 3V79K 2FO1E 1N0QA 1NFIE 1TR4A 1MX2A 2DZOA 4J7WA 5ENRD 3V30A 3V2XA 4BEPA 5ITZF 2B0OE 2DZNA 4U95D 1IHBA 4U8YD 1QYMA 3NBNB 3W9FA 1MYOA 5AARA 4DRXE 1A5EA 4G8KA 1BI7B 5JMND 2L6BA 3B95A 4DUIA 2ZGDA 1YMPA 4HB5A 4TUMA 4F1PA 4Z68A 1N0RA 1WG0A 2ETAA 4BSZB 1N11A 5CEDB 4QQIA 4U96D 4U8VD 5D66A 2JABA 5ENOD 5KNHD 4QFVA 3W9GA 2KXPC 4HI9A 2VGEA 3ZKJA 4HQDA 3TWQA 1BD8A 4HLLA 5AQ9A 3EHQA 5CBNA 5EIBE 1IXVA 3NOCD 2V4HC 5ENSD 2XEHA 3TWRA 4F6RD 4BESA 1AWCB 2KBXA 2DWZA 4DX1A 2V5QC 5BXUA 5CECB 4B93B 4ZFHA 3KEAA 4GMRA 3TWUA 5KNGA 5AQAA 1WDYA 3JXIA 3SO8A 3TWWA 2Y1LE 2RFAA 3JUEA 5BXOA 4K5AB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GPM A;  5AQB A;  3T8K A;  4NIK A;  2ETC A;  3JXJ A;  5KBA A;  2XZT G;  4C48 B;  2Y0B G;  2RFM A;  3UTM A;  4BET A;  1AP7 A;  2MYO A;  3C5R A;  3NOG D;  3LJN A;  4OAV B;  2BKK B;  2QC9 A;  1BI8 B;  5HRY A;  5EYL A;  5JA4 D;  2XZD G;  1MX4 A;  3IXE A;  3J5P A;  4LNU D;  5EIL A;  3UI2 A;  4OAU C;  1D9S A;  3AJI A;  1YCS B;  3TWS A;  1SVX A;  4UUC A;  2P2C P;  5AN8 A;  3ZNG A;  2XEN A;  3ZU7 B;  4G8L A;  2J8S D;  1SW6 A;  2NYJ A;  4K5B A;  4YDW A;  1OY3 D;  3HG0 D;  2F8X K;  4N5Q A;  4DX7 D;  3DEP A;  4DX2 A;  5CEA A;  3ZUV B;  2XEE A;  2F8Y A;  3UXG A;  4O1O A;  5KWD A;  5EN5 D;  2A5E A;  3TWT A;  3EU9 A;  3Q9U C;  4ATZ D;  4J8Y A;  5ENP D;  1K1B A;  4HBD A;  1DCQ A;  4HI8 A;  4DX5 D;  3TWX A;  4HRN A;  2ETB A;  3DEO A;  5AQ7 A;  2DVW A;  4CZ2 D;  1S70 B;  1DC2 A;  3TWV A;  4BER A;  4HRM B;  1UOH A;  4HRL A;  1K1A A;  1YYH A;  4O1P A;  1IKN D;  4DX6 D;  2HE0 A;  5CBO A;  5EID A;  3AAA C;  3V2O A;  4LG6 A;  1BLX B;  4CYM D;  1MX6 A;  4YDY A;  3T9K A;  2F37 A;  3B7B A;  2QYJ A;  4LSZ E;  4HNA D;  2AJA A;  3EHR A;  4O60 A;  5EYP F;  3F6Q A;  1MJ0 A;  1K3Z D;  5HS0 A;  5FIO A;  5AAO A;  2ZGG A;  3V31 A;  5FIN A;  5ENQ D;  3HRA A;  3J5Q B;  1G3N B;  3D9H A;  4K5C A;  4RLY A;  1BU9 A;  2BKG A;  3Q9N C;  2PNN A;  4JB8 P;  4ZHB A;  1OT8 A;  5HKP A;  4A63 B;  5CER B;  5ENT D;  3V79 K;  2FO1 E;  1N0Q A;  1NFI E;  1TR4 A;  1MX2 A;  2DZO A;  4J7W A;  5ENR D;  3V30 A;  3V2X A;  4BEP A;  5ITZ F;  2B0O E;  2DZN A;  4U95 D;  1IHB A;  4U8Y D;  1QYM A;  3NBN B;  3W9F A;  1MYO A;  5AAR A;  4DRX E;  1A5E A;  4G8K A;  1BI7 B;  5JMN D;  2L6B A;  3B95 A;  4DUI A;  2ZGD A;  1YMP A;  4HB5 A;  4TUM A;  4F1P A;  4Z68 A;  1N0R A;  1WG0 A;  2ETA A;  4BSZ B;  1N11 A;  5CED B;  4QQI A;  4U96 D;  4U8V D;  5D66 A;  2JAB A;  5ENO D;  5KNH D;  4QFV A;  3W9G A;  2KXP C;  4HI9 A;  2VGE A;  3ZKJ A;  4HQD A;  3TWQ A;  1BD8 A;  4HLL A;  5AQ9 A;  3EHQ A;  5CBN A;  5EIB E;  1IXV A;  3NOC D;  2V4H C;  5ENS D;  2XEH A;  3TWR A;  4F6R D;  4BES A;  1AWC B;  2KBX A;  2DWZ A;  4DX1 A;  2V5Q C;  5BXU A;  5CEC B;  4B93 B;  4ZFH A;  3KEA A;  4GMR A;  3TWU A;  5KNG A;  5AQA A;  1WDY A;  3JXI A;  3SO8 A;  3TWW A;  2Y1L E;  2RFA A;  3JUE A;  5BXO A;  4K5A B; 
#chains in the Genus database with same CATH topology
 3DXM G;  3ASN E;  5C1D A;  1KT1 A;  2HYZ A;  1NI1 A;  2OEV A;  2FO7 A;  2BF0 X;  3DSU A;  1D8E A;  2WPV A;  2QC9 A;  2BED A;  1Z6T A;  1N54 A;  2IOL A;  4CDR A;  3PH0 C;  3TAX A;  4ATG A;  1BPO A;  3HG0 D;  3VLF A;  3FUJ A;  4AJW A;  4DX2 A;  3ZUV B;  2F8Y A;  4M3O A;  4PS3 A;  1OWM A;  4WWO A;  3E30 A;  4GYY A;  1A17 A;  1VDY A;  2DVW A;  3LS8 A;  2WXO A;  5T4Y A;  3QWP A;  3V2O A;  2M63 A;  4HNA D;  3ZRH A;  3EHR A;  3T8M A;  4B0Z A;  4LEU A;  3ABL E;  3V31 A;  1H2U A;  2XGM A;  4E85 A;  2P9S G;  4P29 A;  2FO1 E;  1PC2 A;  3RRM B;  1QYM A;  1HG5 A;  3SZ7 A;  4F7A A;  1MYO A;  3PZ3 A;  3IEG A;  5FQ7 A;  1E8Y A;  4UWF A;  1IQR A;  1BI7 B;  2I6H A;  2ZGD A;  5FTP A;  3FUL A;  4HB5 A;  3B7R L;  3HDX A;  2IO2 C;  3CQG B;  1IHG A;  5G05 C;  3U3W A;  1NA0 A;  1BD8 A;  3FTW A;  2HR2 A;  2X6J A;  4HLL A;  2E2E A;  2XEH A;  4JA9 A;  3RIB A;  3D9M A;  4FU3 A;  5AQA A;  2H6H A;  4ME2 A;  3ASD A;  3AG3 E;  4RG6 A;  1HX8 A;  4GML A;  4GPM A;  4GTS A;  1FT2 A;  2YHC A;  4KXK B;  1ZU2 A;  2RFM A;  2MYO A;  2PQN A;  3EUV A;  4I1M A;  4FAD A;  3E37 A;  5AN8 A;  3ZYQ A;  2NXP A;  2IEJ A;  3E32 A;  4EBA A;  2YNQ A;  1HXI A;  3KSQ A;  4WAF A;  5DIZ A;  3GYZ A;  3Q7F A;  3NQP A;  5KJL A;  4HOT A;  1K8K G;  3Q5M A;  3EIJ A;  3HVE A;  3U66 A;  4JB8 P;  4NRH B;  3P1U A;  5ENT D;  3Q7A A;  1AP7 A;  3ASG A;  4Q96 A;  3PE4 A;  4O6F A;  4DRX E;  4EZL A;  4GU5 A;  2WXP A;  3ZEF A;  2LNI A;  3FEX A;  2DCP A;  3NF1 A;  4OYS A;  1U3D A;  2RD0 A;  2R02 A;  2IOS A;  4H7X A;  2VYI A;  4MLP A;  4C0E A;  3CK9 A;  5HQ8 A;  3CHS A;  1OWO A;  4Q94 A;  3JXI A;  3SO8 A;  1FPP A;  3ESK A;  4DPR A;  2VTB B;  2VSO E;  4GTM A;  4U0U A;  2FUL A;  2X6I A;  2CFZ A;  2P9N G;  4DK5 A;  2J07 A;  4UQY A;  3FHE A;  3ZHE A;  1D9S A;  4TXP A;  5LFA A;  3MV2 B;  4G11 A;  4N5Q A;  4C9B B;  2R03 A;  2IJG X;  3ESL A;  3RRN B;  5ENP D;  3SD5 A;  3ZPJ A;  3NB2 A;  4XEI G;  2KCK A;  4KBQ A;  1K1A A;  1N4R A;  4JHR A;  4BY6 A;  4IUL A;  3AAA C;  3HIZ A;  2R05 A;  3T9K A;  3UIP C;  3MGB A;  1TNZ A;  4GZD A;  3PZD A;  3ISM C;  4FHK A;  5HS0 A;  3T5X A;  3FFL A;  1GW6 A;  3HRA A;  4JHJ A;  2WXN A;  2DZO A;  2GRL A;  3SBS A;  4H7Y A;  2P9U G;  3BUA A;  3CVP A;  3TXN A;  2IQC A;  3ASF A;  3BG0 B;  1U3C A;  4BWR A;  5JJ7 A;  5LOZ A;  1DNP A;  3UKU G;  1OCZ E;  1OCO E;  4OVV A;  2VGX A;  3APD A;  2JAB A;  4GA0 A;  3UKR G;  2AW6 A;  4U7E B;  4CCA A;  2CFU A;  2WXF A;  2Y1L E;  2EQX A;  3ABK E;  3R9M A;  5FWQ A;  2KAT A;  2XZT G;  5A6C A;  1BI8 B;  2LSV A;  4B8A A;  2BUG A;  3CVQ A;  3ZNG A;  3TWS A;  3E34 A;  3ULE G;  4I9E A;  4GZ6 A;  3DEP A;  1IQU A;  2VSN A;  3BEE A;  2X38 A;  4BER A;  4HVB A;  1TN6 A;  5CBO A;  4L2Y A;  5CRV A;  1E96 B;  2XEV A;  2IF4 A;  4TUU A;  3FUH A;  4I2Z A;  1JCS A;  1HG2 A;  3AU5 A;  4UQZ A;  5G55 A;  1K3Z D;  4JEH A;  2ZGG A;  2GRN B;  1D8D A;  4LRZ A;  3FUM A;  4K5C A;  2I9C A;  3LKU A;  3BU8 A;  5AJD A;  2Q7F A;  2AXV A;  4U8Y D;  3RKV A;  1A5E A;  4N2Q A;  5HI7 A;  4R7L A;  1XGW A;  3D9J A;  2WXJ A;  5G04 C;  4TUM A;  4BSZ B;  4E6H A;  3PDN A;  4U96 D;  2DBA A;  2JEK A;  4HI9 A;  3RSE G;  4N3A A;  4U07 A;  4F6R D;  3DPD A;  5BXU A;  4GTT A;  3DSX A;  3D9K A;  4UI9 K;  4BT9 A;  2P9L G;  1E90 A;  4L2L A;  3LJN A;  4JXT A;  2BKK B;  3DPY A;  4NAC A;  5EIL A;  4A3T A;  4BX9 A;  4XKC A;  5H7P A;  5BV0 A;  1SZ9 A;  2NYJ A;  2YHE A;  2A5E A;  3G2S A;  1UJJ A;  3L16 A;  3FUK A;  3MJW A;  3ZYM A;  1Y6I A;  2CHW A;  4IN3 B;  4LCT A;  3ENE A;  4EZK A;  3LY8 A;  4BT8 A;  3CK7 A;  4AV7 A;  3KAE A;  1MJ0 A;  2WXI A;  3MKR A;  3UX4 A;  3E4B A;  2KZT A;  5LP0 A;  3MYV A;  2QYU A;  3V79 K;  3B7U X;  4APF A;  4BEP A;  3TJP A;  4RVB A;  3NAW A;  3TL5 A;  4CGW A;  4LNB A;  3ONK A;  2EIM E;  4I6J A;  2C0M A;  3DBS A;  3Q73 A;  3L82 A;  4GTQ A;  4Z68 A;  3D9P A;  4EBA G;  3UM1 A;  5EX0 A;  2VGE A;  2BTD A;  1EF1 C;  5CCL A;  1LD8 A;  4BSX A;  3JYS A;  3HVE B;  4K5A B;  4TXR A;  4B8C B;  2KCL A;  3MKQ A;  5JJ6 A;  3D9I A;  2DIW A;  4OAV B;  2GRQ B;  3ML8 A;  3ML9 A;  4UWL A;  4YND A;  1QBQ A;  3ZU7 B;  1E7V A;  2J8S D;  4UI9 C;  4K5B A;  3G2T A;  3C3O A;  2XS8 A;  2PM7 A;  3UXG A;  4GMJ A;  3RAU A;  5EN5 D;  1S63 A;  4F3V A;  1H19 A;  1O5M A;  4DX6 D;  1UN8 A;  3EJN A;  1ELR A;  4DI3 A;  3CVL A;  3FTS A;  2X3M A;  1HZ4 A;  5D0Q D;  2AJA A;  4K0R A;  3ONL A;  4U8H A;  3J5Q B;  3OXL A;  2X6H A;  1NZN A;  2XPY A;  3SY2 A;  3LY7 A;  5JHB A;  3S7J A;  3HXE A;  3V2X A;  1MQS A;  1H6K A;  3R7R A;  5JMN D;  4DLQ A;  4DUI A;  2C0L A;  1MHQ A;  1YMP A;  2VQ2 A;  3FTU A;  4G26 A;  1LF8 A;  2QZA A;  3MX3 A;  3ULQ A;  3CQC B;  1RZ4 A;  5AQ9 A;  2WXG A;  2LSU A;  5T8I A;  1AWC B;  2L0T B;  3ZVV A;  4BFR A;  2AXZ A;  4AIF A;  3JXJ A;  5B3S E;  1L5J A;  3QC1 A;  5A23 A;  3AG1 E;  2J09 A;  4MRU A;  2A4Z A;  3VTX A;  2VGY A;  3Q47 B;  3TWT A;  3Q9U C;  1K1B A;  3B7S A;  3L17 A;  4HBD A;  3TWX A;  3DEO A;  1N52 A;  4JHK A;  1TJC A;  1H2V C;  1DC2 A;  1YYH A;  1MX6 A;  3GZ2 A;  3VTY A;  1PAQ A;  3BG1 B;  1TNO A;  3FUN A;  2WXL A;  3Q9N C;  1NFI E;  1MX2 A;  1P5Q A;  3D3M A;  4EZJ A;  3N71 A;  4I2W A;  5BPP A;  3NBN B;  1Q2Z A;  4WWN A;  3CGH A;  4CDN A;  4G8K A;  2L6B A;  4PDX A;  3QJZ A;  4WWP A;  5LX8 A;  4QFV A;  3DSS A;  5LCW J;  3L9T A;  4HQD A;  4JC8 A;  4B89 A;  2V4H C;  1H0A A;  1HFA A;  5CEC B;  1NL4 A;  5EX3 A;  3C3R A;  3CKB A;  4MS6 A;  2WB2 A;  4UI9 J;  1MZC A;  3UTM A;  3C5R A;  4FJY A;  1V55 E;  2IY0 C;  5EYL A;  3B13 A;  3CVN A;  1U2V G;  4GZC A;  4PH4 B;  2R59 A;  3R7Q A;  4YDW A;  3X2Q E;  4XKB A;  2A5U A;  2XEE A;  2R17 C;  2ZIR A;  3RRU A;  4G25 A;  4XIF A;  3OAW A;  4A1G A;  1NA3 A;  4TRQ A;  4DJA A;  3CLJ A;  4I17 A;  4LSZ E;  2UY1 B;  2HM8 A;  3CVU A;  2WVI A;  4AY5 A;  1HF8 A;  4KMO A;  2CG2 A;  3PVL A;  1KT0 A;  2X6K A;  4ILG A;  2MOW A;  3U4T A;  4ZHB A;  5HKP A;  3SHF A;  4ACL A;  3S7F A;  1TR4 A;  4HOQ A;  3GZ1 A;  4GZ5 A;  1KZO A;  4I6G A;  1IHB A;  3CHM A;  3CST A;  4ANW A;  3S2A A;  1OWL A;  1WG0 A;  3FDH A;  2R2L A;  4QQI A;  4N2S A;  3EHQ A;  5CCM A;  4K03 A;  3OTN A;  2DYR E;  4WNF A;  1Z3X A;  4L7T A;  4B93 B;  4WNE A;  3PNL B;  3C72 A;  5G05 J;  3PRE A;  3AS4 A;  3JUE A;  1WM5 A;  3RJV A;  3LXU X;  4FP7 A;  5BUZ A;  3FH5 A;  3U9W A;  5M72 A;  2I2O A;  4FC8 A;  1MX4 A;  4OAU C;  4G8L A;  5ANR A;  3MEK A;  3FU5 A;  3VLE A;  2OCC E;  3JQ0 A;  4ANX A;  1OXJ A;  3CHO A;  3AU4 A;  1DVP A;  3TWV A;  3MV3 B;  5FZS A;  2CHX A;  1BLX B;  2H6G A;  4J8E A;  2QYJ A;  2NC9 A;  3FH7 A;  1UW4 B;  4JZY A;  4I1O B;  3MKQ B;  3VLD A;  3DXK G;  5A7D B;  2AWI A;  2Y4T A;  4Y6C A;  3UT4 A;  1G3N B;  4CEM A;  2EIK E;  4GA1 A;  4J7W A;  4KVM A;  4C0M A;  3S7B A;  3CVY A;  4XI0 A;  1JWF A;  4I6E A;  3LCA A;  2FF4 A;  4LUN U;  2EIN E;  3CHP A;  3D9L A;  1OCC E;  1TNU A;  2CG3 A;  3MCX A;  3FUE A;  4U8V D;  4ILH B;  3GZS A;  1INZ A;  3GW4 A;  2KBX A;  4PS8 A;  4FA6 A;  3I3N A;  3LDZ A;  4X8Q A;  4AY6 A;  3QNK A;  1Y8M A;  4CRW A;  1OWN A;  3T8K A;  2XCC A;  1SA5 A;  4NQ0 A;  1O1S A;  4UWK A;  1EDU A;  2J4D A;  2J08 A;  2XZD G;  3UI2 A;  3AJI A;  4UUC A;  2PM6 A;  1SW6 A;  2EIL E;  3CV0 A;  4BX8 A;  1TJF A;  4RG9 A;  2ETB A;  3FH8 A;  3PZ4 A;  3URZ A;  1E8Z A;  3ZW3 A;  4AVX A;  4JL0 A;  2DYS E;  3TG4 A;  3ZYL A;  4N3B A;  3FTV A;  3OXF A;  5ARF A;  3B7B A;  2QFC A;  3FTZ A;  2PQR A;  3CIA A;  3QAQ A;  3U64 A;  3F6Q A;  4M7C A;  2KC7 A;  2XGO A;  3PZ1 A;  1H2T C;  3ABM E;  2BKG A;  2XCB A;  2PNN A;  4L1B A;  4EQF A;  5ITZ F;  2P9I G;  2DZN A;  3SFZ A;  4AEZ C;  1LTX A;  2WM9 A;  3FU0 A;  1X81 A;  1N0R A;  2MHK A;  3JCK C;  1UN9 A;  3KEZ A;  5CBN A;  4GA2 A;  4A3V A;  5ENS D;  4CDM A;  4GMR A;  4KZ0 A;  2WXQ A;  4NUR A;  5AQB A;  5ARG A;  1RW2 A;  2WXH A;  5FQ6 A;  2LAH A;  4TXQ A;  3OXG A;  4N3C A;  1N4Q A;  3CR3 A;  4EHM A;  1QNF A;  2I1J A;  2OEW A;  3CHR A;  3T5V A;  3PRZ A;  1DCE A;  1ELW A;  5B1B E;  4L9P A;  5HRY A;  2WQ7 A;  3KSL A;  4LNU D;  4YDO A;  1QZ2 A;  3UT7 A;  2PZI A;  5KCM A;  1E7U A;  4J0U A;  4Y6W A;  2WQH A;  5G2N A;  4GTV A;  4GAA A;  4HRL A;  1UOH A;  4J8S A;  2IU1 A;  2F37 A;  3PUJ A;  5D2M C;  3AG4 E;  3AG2 E;  2FBN A;  4Q69 A;  4D10 C;  4TV3 A;  1TNY A;  4HOR A;  3V30 A;  5CHE E;  2P9P G;  2B0O E;  4U95 D;  4G23 A;  5KJK A;  2GGF A;  3DSV A;  5BT1 A;  3FEY A;  1B89 A;  2ILR A;  1N11 A;  1KLX A;  2ION A;  3SQV A;  3ZHE B;  2KXP C;  3HHM A;  3TWQ A;  3LVR E;  4DLO A;  5G04 J;  5EIB E;  3TWR A;  4CT0 A;  4AP2 A;  4DX1 A;  2V5F A;  3MA5 A;  4UWH A;  1JWG A;  4GB9 A;  4G2V A;  4J8F A;  5ENN A;  1SQM A;  2XQ0 A;  3LVQ E;  1HE8 A;  5CRU A;  5FQ8 A;  4NIK A;  5T3R A;  3UM3 A;  2OND A;  5DBK A;  5J90 A;  5IY5 E;  3IXE A;  4FLB A;  3O48 A;  2XEN A;  5ANL A;  2VSY A;  5BW8 C;  4FJZ A;  5KJN A;  3QAR A;  5JJT A;  4FUL A;  2RKK A;  1ZBP A;  3I4R B;  3SNX A;  4DX5 D;  1S70 B;  4YDE A;  4FLH A;  3S7D A;  1IKN D;  4XI9 A;  5AEN A;  1TNB A;  4MKT A;  2FI7 A;  4JEU A;  3TGO A;  1TN8 A;  4CYM D;  2LXM A;  3RK6 A;  4W9R A;  4BTA A;  4GPK A;  3NZS A;  2VGX B;  3SFX A;  3QKY A;  1XNF A;  4U0S A;  1V54 E;  2NSZ A;  2OVB A;  2B6C A;  2H6F A;  2GRR B;  4ANV A;  3C98 A;  3CEQ A;  3SI5 A;  3HXD A;  2AVP A;  4HOS A;  3L08 A;  4GCO A;  5CED B;  2Y4U A;  3EHM A;  3QDN A;  2WMO A;  3AS8 A;  4WND A;  2J4B A;  3E33 A;  1Z5S C;  3RO3 A;  3DWL G;  1HH8 A;  1TYQ G;  2DWZ A;  5KJM A;  4FHJ A;  5KNG A;  2XS1 A;  1WDY A;  5EKQ D;  3UT8 A;  4J6I A;  2RFA A;  5BXO A;  4GTO A;  3PZ2 A;  1JCQ A;  2GW1 A;  3G2U A;  5KBA A;  2H6I A;  3FTX A;  1ZB1 A;  4ANU A;  5FZQ A;  4I43 A;  5JA4 D;  3G2V A;  3J5P A;  2GRM A;  3WXX A;  2P2C P;  2CHZ A;  4JW1 A;  1WY6 A;  2F8X K;  4DX7 D;  4KZC A;  5CEA A;  4JPS A;  4LNG A;  4ATZ D;  2XHE A;  4HI8 A;  5AQ7 A;  4KT6 B;  3K9I A;  3DST A;  3IKO B;  4O1P A;  1NP7 A;  1WAO 1;  2OOE A;  3IBE A;  3LJ3 A;  4YDY A;  4URK A;  3O4Z A;  4F1S A;  1O1R A;  3FTY A;  1HS6 A;  2WMN A;  4RSY A;  2L0I A;  2VSX E;  5FIN A;  1YA0 A;  3Q49 B;  4A63 B;  3UM2 A;  1TN7 A;  1N0Q A;  5ENR D;  3LY9 A;  2WXR A;  3W9F A;  3JUI A;  2L6J A;  4F53 A;  1OUV A;  3Q79 A;  5AJL A;  3ZXS A;  3CK8 A;  2OV8 A;  2LUH A;  3SF4 A;  2J49 A;  4UQX A;  1O1T A;  3PEU B;  2ETA A;  2P58 C;  5D66 A;  3QOU A;  2R5S A;  4JVS A;  3UMV A;  4I9C A;  4CT4 A;  1IXV A;  1PY1 A;  3NOC D;  3CVW A;  4BES A;  4LER A;  4YVO A;  4ZFH A;  3I5P A;  3KEA A;  3TWU A;  2XPZ A;  4HXI A;  2FEZ A;  3CSF A;  3UM0 A;  4GYW A;  2IO3 C;  3TXM A;  2YQ8 A;  3PE3 A;  1KPS B;  4C48 B;  2Y0B G;  5FZR A;  2V8S E;  3NOG D;  4GTP A;  1QQE A;  5C2Y A;  3UUX A;  4ACK A;  2I1K A;  2JLB A;  2QY7 A;  1OWP A;  3CVV A;  3C3Q A;  1H6P A;  4U0Z A;  2KM4 A;  5E75 A;  3P2B A;  2LAI A;  3KD7 A;  3CHQ A;  2KZT B;  3AS5 A;  5KWD A;  2P9K G;  1SZA A;  2EIJ E;  2LXL A;  4A55 A;  3CVX A;  1Z3Y A;  3ULY A;  2HE0 A;  4JD2 G;  5EID A;  3ZIM A;  2GRO B;  4N39 A;  1N4S A;  3MZL B;  3APF A;  1UJK A;  1E8W A;  4YVQ C;  3RU0 A;  4EEC A;  4O60 A;  4U63 A;  1LD7 A;  4V3I A;  3L54 A;  4IYP A;  5FIO A;  4HS2 A;  3L13 A;  3D9H A;  4RLY A;  2V0P A;  2AXU A;  1OT8 A;  3HYM B;  2XPI A;  2L9B A;  2E0I A;  2XRY A;  1FVF A;  4CGV A;  5EDS A;  4KYO B;  2GRP B;  3D9O A;  1KZP A;  3Q15 A;  4A1S A;  3FUD A;  4HLE A;  5CMW A;  5ENO D;  3IHV A;  3ZKJ A;  3G2W A;  3HXB A;  4ABN A;  2ZU6 B;  4B94 A;  1N9A A;  2Y69 E;  2YIN A;  1EPU A;  5J08 A;  3L6A A;  2RG8 A;  2MRI A;  1EYH A;  3ZFW A;  3R9A B;  4AXH A;  1OCR E;  1IYG A;  3ZXP A;  2XGS A;  2KCV A;  5AYW D;  3EDT B;  3FWV A;  4PS7 A;  2WQ6 A;  5CMY A;  3SGH A;  3ZN3 A;  3BQO A;  3FUF A;  1YCS B;  1SVX A;  3UPV A;  3EHN A;  4GTR A;  2C2L A;  1OY3 D;  2ZXW E;  4ILI A;  3WG7 E;  4I1A A;  5D0O D;  2OVF A;  3FY4 A;  4O1O A;  2IFU A;  3EU9 A;  1S64 A;  1S0P A;  1DCQ A;  4HRN A;  4HFG A;  3FUI A;  3UIO C;  1JPL A;  4HRM B;  3IHY A;  4LG6 A;  4IRU A;  1FCH A;  1E8X A;  3SBT B;  3DSW A;  4G24 A;  1H6O A;  4U04 A;  5EYP F;  1BU9 A;  4APO A;  4DI4 A;  2UWJ G;  5AIJ A;  5CER B;  2VTB A;  3D9N A;  5AAR A;  3TG5 A;  5JHA A;  3APC A;  4XE0 A;  4L23 A;  3LPZ A;  2UY1 A;  5KNH D;  3W9G A;  1TEZ A;  3EU5 A;  4JA7 A;  3NZU A;  5FT9 A;  3HXC A;  2XRZ A;  4GYO A;  3FU3 A;  3LYA A;  2V5Q C;  3B7T A;  4GCN A;  2WXM A;  3PS6 A;  3DRA A;  3ASO E;  3L22 A;  3ASH A;  2PL2 A;  3HXF A;  1JCR A;  4HOU A;  1N95 A;  2LO6 A;  3QB2 A;  4XZ4 A;  1FVH A;  2ETC A;  2X6F A;  3Q78 A;  3RO2 A;  5FQ4 A;  4BET A;  3JQ1 A;  4UWG A;  4F1P A;  4N5C A;  3QK0 A;  4BTB A;  1N4P A;  5E76 A;  4J8D A;  4G1T A;  2V4L A;  4J8Y A;  1ELK A;  5B1A E;  4CZ2 D;  3CKC A;  3UIN C;  1N94 A;  4EPZ A;  5FJY A;  2F0Y A;  4WUY A;  2Y3A A;  5BV1 A;  1FT1 A;  1HO8 A;  1W3B A;  4KVO A;  3KS2 A;  4PUC A;  3EIQ C;  5ENQ D;  5BNW A;  3PNT B;  3FP3 A;  3LEW A;  3Q75 A;  5AAO A;  3ZYK A;  3ZGQ A;  4MBG A;  4AM9 A;  2HO1 A;  3PEV B;  5LCW C;  1HU3 A;  3B95 A;  3UQ3 A;  2ZIS A;  4XX5 A;  1JUQ A;  4WNG A;  2J9Q A;  3IV0 A;  3Q4A B;  4AOF A;  3QWW A;  3FU6 A;  1X5B A;  3I4G A;  4RQI A;  4OVU A;  2WXK A;  1UG3 A;  4GZ3 A;  3PUK A;  3TWW A;  1SA4 A;  2VJ8 A;  3QWV A;  3SFY A; 
#chains in the Genus database with same CATH homology
 4GPM A;  5AQB A;  3T8K A;  4NIK A;  2ETC A;  3JXJ A;  5KBA A;  2XZT G;  4C48 B;  2Y0B G;  2RFM A;  3UTM A;  4BET A;  1AP7 A;  2MYO A;  3C5R A;  3NOG D;  3LJN A;  4OAV B;  2BKK B;  2QC9 A;  1BI8 B;  5HRY A;  5EYL A;  5JA4 D;  2XZD G;  1MX4 A;  3IXE A;  3J5P A;  4LNU D;  5EIL A;  3UI2 A;  4OAU C;  1D9S A;  3AJI A;  1YCS B;  3TWS A;  1SVX A;  4UUC A;  2P2C P;  5AN8 A;  3ZNG A;  2XEN A;  3ZU7 B;  4G8L A;  2J8S D;  1SW6 A;  2NYJ A;  4K5B A;  4YDW A;  1OY3 D;  3HG0 D;  2F8X K;  4N5Q A;  4DX7 D;  3DEP A;  4DX2 A;  5CEA A;  3ZUV B;  2XEE A;  2F8Y A;  3UXG A;  4O1O A;  5KWD A;  5EN5 D;  2A5E A;  3TWT A;  3EU9 A;  3Q9U C;  4ATZ D;  4J8Y A;  5ENP D;  1K1B A;  4HBD A;  1DCQ A;  4HI8 A;  4DX5 D;  3TWX A;  4HRN A;  2ETB A;  3DEO A;  5AQ7 A;  2DVW A;  4CZ2 D;  1S70 B;  1DC2 A;  3TWV A;  4BER A;  4HRM B;  1UOH A;  4HRL A;  1K1A A;  1YYH A;  4O1P A;  1IKN D;  4DX6 D;  2HE0 A;  5CBO A;  5EID A;  3AAA C;  3V2O A;  4LG6 A;  1BLX B;  4CYM D;  1MX6 A;  4YDY A;  3T9K A;  2F37 A;  3B7B A;  2QYJ A;  4LSZ E;  4HNA D;  2AJA A;  3EHR A;  4O60 A;  5EYP F;  3F6Q A;  1MJ0 A;  1K3Z D;  5HS0 A;  5FIO A;  5AAO A;  2ZGG A;  3V31 A;  5FIN A;  5ENQ D;  3HRA A;  3J5Q B;  1G3N B;  3D9H A;  4K5C A;  4RLY A;  1BU9 A;  2BKG A;  3Q9N C;  2PNN A;  4JB8 P;  4ZHB A;  1OT8 A;  5HKP A;  4A63 B;  5CER B;  5ENT D;  3V79 K;  2FO1 E;  1N0Q A;  1NFI E;  1TR4 A;  1MX2 A;  2DZO A;  4J7W A;  5ENR D;  3V30 A;  3V2X A;  4BEP A;  5ITZ F;  2B0O E;  2DZN A;  4U95 D;  1IHB A;  4U8Y D;  1QYM A;  3NBN B;  3W9F A;  1MYO A;  5AAR A;  4DRX E;  1A5E A;  4G8K A;  1BI7 B;  5JMN D;  2L6B A;  3B95 A;  4DUI A;  2ZGD A;  1YMP A;  4HB5 A;  4TUM A;  4F1P A;  4Z68 A;  1N0R A;  1WG0 A;  2ETA A;  4BSZ B;  1N11 A;  5CED B;  4QQI A;  4U96 D;  4U8V D;  5D66 A;  2JAB A;  5ENO D;  5KNH D;  4QFV A;  3W9G A;  2KXP C;  4HI9 A;  2VGE A;  3ZKJ A;  4HQD A;  3TWQ A;  1BD8 A;  4HLL A;  5AQ9 A;  3EHQ A;  5CBN A;  5EIB E;  1IXV A;  3NOC D;  2V4H C;  5ENS D;  2XEH A;  3TWR A;  4F6R D;  4BES A;  1AWC B;  2KBX A;  2DWZ A;  4DX1 A;  2V5Q C;  5BXU A;  5CEC B;  4B93 B;  4ZFH A;  3KEA A;  4GMR A;  3TWU A;  5KNG A;  5AQA A;  1WDY A;  3JXI A;  3SO8 A;  3TWW A;  2Y1L E;  2RFA A;  3JUE A;  5BXO A;  4K5A B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...