4BSZB

Crystal structure of the yeast ribosomal protein rps3 in complex with its chaperone yar1
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
150
structure length
150
Chain Sequence
PLDQEDQDTIILDARAGDLDSLKDIFTTLVSPELLSTCKESESDSTALHMAAANGHIETVRYILETVSRANSAEDLKAFVNEVNKTGNTALHWASLNGKLDVVKLLCDEYEADPFIRNKFGHDAIFEAENSGKEEVETYFLKKYDVEPED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Yeast Ribosomal Protein Rps3 in Complex with its Chaperone Yar1
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords 40S RIBOSOMAL PROTEIN S3
total genus 54
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4bszB00
2P2CP 4F1PA 2MYOA 2Y1LE 2ETCA 4HB5A 3C5RA 3ZUVB 3ZNGA 3AAAC 3B7BA 5BXOA 4HI8A 5KBAA 1NFIE 1G3NB 5FINA 5CERB 2ETBA 2QYJA 3TWUA 4U8YD 5JMND 3J5QB 1MJ0A 1IHBA 3IXEA 1DCQA 2QC9A 1MX6A 3TWWA 3F6QA 4QFVA 3TWVA 3V30A 4HRMB 4DX2A 5KWDA 4O1PA 3HG0D 4B93B 4DX5D 2ZGGA 4QQIA 2HE0A 5AQ9A 4YDWA 2DZNA 3DEPA 4O60A 5ENPD 3JXJA 4OAVB 4DX7D 4Z68A 1K1AA 1BLXB 1YYHA 1D9SA 5JA4D 1QYMA 1MX2A 5BXUA 2Y0BG 5AARA 5EIBE 1WDYA 3UXGA 4HI9A 2F8XK 3EU9A 5HRYA 4BEPA 2ETAA 4U8VD 5KNGA 5AAOA 2F8YA 4TUMA 2PNNA 3B95A 5ENTD 1IXVA 4G8LA 1TR4A 4HRLA 1N0QA 3Q9NC 4O1OA 4BERA 5CBNA 4OAUC 5EIDA 2ZGDA 3JUEA 5D66A 4BETA 4HRNA 1AWCB 2KXPC 4U96D 4K5BA 3V31A 3HRAA 2DZOA 4JB8P 3UTMA 4J7WA 2KBXA 2XEEA 4J8YA 3AJIA 4CYMD 4CZ2D 4DX1A 2VGEA 1OT8A 5HKPA 3TWRA 4HLLA 4BSZB 1BD8A 4LNUD 2JABA 4K5CA 4ZHBA 4DX6D 2B0OE 5AN8A 3NBNB 1AP7A 4YDYA 5KNHD 2XENA 5CEDB 5EYPF 2AJAA 5AQAA 1SVXA 4NIKA 3ZU7B 2RFAA 4U95D 3T9KA 4A63B 3V79K 4GPMA 5ENOD 3TWTA 3LJNA 4ZFHA 4N5QA 5EN5D 1BI8B 3TWXA 3W9GA 4HQDA 5AQBA 4DUIA 1A5EA 3DEOA 2F37A 4LSZE 4HBDA 1BU9A 2DVWA 3W9FA 3D9HA 4F6RD 1MYOA 5ENRD 2RFMA 2XZTG 5CEAA 1YMPA 3NOGD 1IKND 4RLYA 5CBOA 3TWSA 3EHRA 3V2OA 3KEAA 2J8SD 3J5PA 1WG0A 5FIOA 1MX4A 4G8KA 3TWQA 2XEHA 3Q9UC 2XZDG 1SW6A 3EHQA 4ATZD 4BESA 5ITZF 2L6BA 1BI7B 5EYLA 1N0RA 2DWZA 1OY3D 3JXIA 3NOCD 4GMRA 4LG6A 5EILA 2V5QC 2NYJA 5HS0A 3ZKJA 2A5EA 2V4HC 4UUCA 1K3ZD 1UOHA 4DRXE 1S70B 2BKGA 3V2XA 5ENQD 3SO8A 2BKKB 5AQ7A 4C48B 5CECB 4HNAD 2FO1E 3T8KA 1DC2A 1N11A 5ENSD 1K1BA 4K5AB 1YCSB 3UI2A
chains in the Genus database with same CATH superfamily
3MEKA 3TL5A 3ZUVB 3GW4A 4AJWA 1X5BA 3MYVA 1XNFA 3CKBA 3AG2E 4UWHA 1BPOA 1E7VA 3EIJA 4MLPA 2J09A 3I4RB 1UN9A 4ILHB 2CG2A 1TN7A 1UJJA 2BEDA 4U0UA 1NA0A 2LXLA 2YHCA 5LCWJ 2OVFA 1Y6IA 1U3CA 4GAAA 4FP7A 4TRQA 4G8LA 1DC2A 2GGFA 3ML8A 4BETA 3UMVA 4U96D 1HU3A 3HVEB 2WXJA 3FU0A 3PE4A 4GTTA 4LNUD 1N52A 4ZHBA 2VJ8A 3DSTA 3LXUX 5ENNA 4RQIA 2AVPA 2OCCE 3Q15A 3SHFA 2H6GA 3ASNE 4MS6A 4N3AA 4P29A 1Z5SC 1BI8B 3Q4AB 4YVQC 1UG3A 1KT0A 4NURA 4DUIA 1JUQA 2H6FA 4J6IA 3D9HA 3FUIA 3PNLB 2P58C 1YMPA 2MRIA 2WQ7A 2NSZA 2PL2A 1HG5A 2R03A 2P9NG 3OXGA 2Q7FA 2OVBA 4A55A 1EPUA 3NOCD 2H6IA 3LCAA 2V4HC 1K3ZD 1S70B 5AQ7A 4A3VA 1UN8A 4U0SA 4D10C 4L2YA 1K1BA 3SFXA 3ULYA 2V8SE 2P2CP 3CVNA 1IYGA 2E2EA 3MV3B 1O5MA 1G3NB 3RO2A 4U8YD 1IHGA 4X8QA 2XPZA 3JQ1A 2BTDA 2GRMA 4YVOA 2ZGGA 4WNGA 2AXUA 3FUKA 4ANWA 2I2OA 1E8XA 2DCPA 1HFAA 5DBKA 2WXQA 3DSVA 2A5UA 4PH4B 2VSXE 4FU3A 4XIFA 5ANLA 3VLFA 2FBNA 3MGBA 5FZSA 1PY1A 1KPSB 3PZ3A 4GZ6A 3TXNA 2XEEA 3D9MA 1KLXA 4CZ2D 2YHEA 3DXMG 1N4SA 2X6JA 4CT0A 3ZYLA 2XGSA 2H6HA 3DSXA 4C9BB 4CDNA 3DWLG 3PE3A 1JWFA 2F37A 3L16A 4HBDA 4GZ3A 1HO8A 5B3SE 1OCZE 2F0YA 3J5PA 1TNYA 3FWVA 4ATGA 2IOLA 3HDXA 3RRUA 4BFRA 4TXQA 4HOUA 4YDOA 3L08A 3ZKJA 2A5EA 2KCLA 3BG0B 4B8AA 4E85A 5KJMA 4FJZA 4J8SA 1V55E 2WXOA 3T8KA 3CVVA 3Q49B 4G24A 1JCQA 2LSVA 3ZYMA 2Y4UA 3E32A 5BV0A 3FY4A 5G55A 2IO3C 4I2ZA 4TV3A 3C72A 4B93B 2X6IA 3FUDA 3GZ2A 4FLHA 3SFYA 4O60A 2IFUA 5M72A 4MBGA 2XGMA 3DSWA 4O6FA 3ZW3A 3K9IA 4I9EA 3EJNA 3CR3A 2XCCA 5KNGA 3CQCB 4BX8A 1MZCA 4JA7A 1V54E 3KAEA 1KZOA 4H7XA 5EKQD 3D9OA 4I17A 5CMYA 3LJ3A 3ZVVA 3PZ4A 2R17C 2HM8A 5KNHD 4GB9A 1QNFA 4I6EA 4I6GA 2XS1A 2WXIA 4Y6WA 4OVUA 3E37A 4GTVA 1A5EA 3ZEFA 4EQFA 3ABLE 3JCKC 2IEJA 1MYOA 5FQ8A 3FUJA 4YDEA 4RLYA 2EQXA 3PEVB 3DPYA 3TWQA 1JCSA 4ATZD 1ELRA 3NF1A 3CVQA 3ZXPA 1WAO1 4BSXA 3CGHA 2NXPA 1HZ4A 1SA4A 2P9IG 3RJVA 2GRPB 1N11A 2WXMA 3RKVA 2I1JA 1NZNA 2Y3AA 4BY6A 4KZ0A 5KBAA 3CSFA 4IULA 4HRMB 2L6JA 4GMJA 4O1PA 3HG0D 3LY9A 2IONA 3EHNA 4Q69A 1WDYA 1H2UA 4HOQA 3FU3A 3QWPA 5EIDA 1QQEA 3ZXSA 3ASFA 5CHEE 2VGEA 2IY0C 3P2BA 5JJTA 4JEHA 3BEEA 1D8EA 3QJZA 4NIKA 4U95D 2RG8A 5ENOD 4JVSA 4OVVA 4J8EA 3ZYKA 3I4GA 2UWJG 3IV0A 3D9IA 4LSZE 2AW6A 2LAHA 3U4TA 2IJGX 1E8YA 1NI1A 4WWNA 4I2WA 3FH8A 4LERA 3TWSA 3V2OA 4BT8A 4FLBA 2AXZA 4DLOA 2IO2C 5HI7A 2QYUA 2OEWA 2LO6A 1RW2A 2WXHA 4GYYA 4H7YA 4UI9J 5ENSD 2WMNA 3CHRA 2HO1A 4JHRA 1WM5A 2WQ6A 1FCHA 4K0RA 2WQHA 4EBAA 1N94A 5JHAA 1OWOA 3GZSA 2CG3A 2MOWA 3FTYA 4XI9A 4WUYA 5C1DA 4GA2A 2DYRE 5ARFA 1TYQG 5T4YA 1H19A 1HG2A 4NACA 4XX5A 1D9SA 4AV7A 2DYSE 3SF4A 3RAUA 1HH8A 4WNEA 1TR4A 4BERA 3JUEA 4JB8P 4GZDA 3LKUA 3JUIA 3L54A 1OT8A 4HLLA 3APCA 3LDZA 2FEZA 1ELKA 2KATA 4XE0A 4CEMA 3FTZA 2J08A 2AWIA 3AG3E 4ACKA 1WY6A 4UQXA 2LNIA 3SY2A 2J49A 4TXPA 1SW6A 4C0MA 4A1GA 5EILA 1H6KA 1E8ZA 5G05C 3EIQC 3UM3A 4FHKA 5LX8A 2BKGA 3LPZA 4ABNA 2E0IA 3UIOC 1JWGA 2WXGA 3APFA 1S0PA 3EDTB 3SD5A 5BT1A 3UI2A 2QZAA 2YNQA 3ABME 4YNDA 3ZNGA 3ONLA 5A23A 3IXEA 3TWWA 2IQCA 2X6KA 3B13A 3FUEA 2WXFA 3C3QA 3UM1A 4HOSA 1E7UA 4MKTA 4IN3B 2FULA 3SZ7A 2ILRA 3SQVA 3E30A 5KJLA 2WXRA 3UUXA 5D66A 4J8FA 4J7WA 4CYMD 3PZ1A 1BD8A 4EZJA 1TNZA 4YDYA 3B7RL 4DPRA 3BU8A 3T9KA 3Q7AA 3TWTA 2VSYA 4GTSA 2DIWA 2L9BA 4U8HA 3QDNA 3RRMB 4GTOA 3HVEA 3CQGB 3LVQE 4JC8A 2KZTA 1IKND 1N4PA 1WG0A 1Z6TA 2LXMA 2PQNA 3AG1E 2PM7A 4UUCA 4C0EA 4KZCA 4F3VA 3OTNA 2J4BA 3N71A 4F53A 3U64A 1TN6A 4K5AB 2EINE 2L0IA 1B89A 3ZHEA 3C5RA 1NFIE 2QYJA 3J5QB 1IHBA 1L5JA 3AS4A 3O48A 3Q78A 4XKCA 1S63A 2J07A 3C98A 2CHZA 3ASOE 3I3NA 3APDA 4U7EB 4L2LA 4AP2A 1ZU2A 3CIAA 1HXIA 5ENTD 1N0QA 3KS2A 5CRUA 2C2LA 1DVPA 4HVBA 4Q96A 2Y4TA 3TJPA 1JCRA 2JABA 3MKQA 3PNTB 3OXFA 4DX6D 1U2VG 2C0LA 3FH7A 2AJAA 3C3RA 1PAQA 5FTPA 2GRLA 3LJNA 3UIPC 4DLQA 2V4LA 3QARA 3TWXA 3S7BA 4BT9A 4FJYA 4AY5A 4B0ZA 3W9FA 4EPZA 5ENRD 1H6OA 3KEAA 2WB2A 3ENEA 3I5PA 2LSUA 3LVRE 2UY1B 2NYJA 3IBEA 3V2XA 4WWPA 4URKA 4OYSA 4N39A 5EDSA 5BXOA 4J0UA 4I1MA 3O4ZA 1NA3A 4U04A 5KWDA 1SZ9A 3D9KA 3HXFA 2YINA 2HE0A 3RU0A 4YDWA 5KJNA 4RG9A 1K1AA 2X6HA 4CT4A 2I6HA 2ETAA 3PVLA 1E96B 5BV1A 1E8WA 3S7JA 1IXVA 3PUJA 2KXPC 4UWFA 3B7UX 4WAFA 1Z3YA 3FDHA 1HF8A 3TGOA 4UWLA 1H0AA 3GZ1A 3R7QA 1TJFA 3MKQB 4L9PA 1H2TC 4LNBA 3NQPA 4JEUA 3HXBA 4HQDA 3BQOA 4EECA 4K03A 4EHMA 2DVWA 1SQMA 2FI7A 2XCBA 2R2LA 3EUVA 2RFMA 5CEAA 2V5FA 3Q79A 3IHYA 1MX4A 1N4RA 2YQ8A 2VSOE 4BESA 3LEWA 1FT2A 4GA0A 5HS0A 3E34A 1MQSA 3L82A 3EU5A 3B7TA 3SO8A 3MCXA 2BKKB 5B1BE 3ASDA 2VQ2A 1YCSB 2CHXA 3UINC 1N54A 2KZTB 1INZA 1KT1A 2UY1A 1X81A 3ULQA 3RK6A 3HHMA 4JHKA 4QQIA 2X38A 3ML9A 4OAVB 3BUAA 4M7CA 5JHBA 4U63A 3SI5A 3E33A 3S7FA 3EU9A 3ZHEB 3FTUA 5AJDA 2WPVA 2ZGDA 4UI9C 4W9RA 4GA1A 3SFZA 1OWPA 3C3OA 2ZXWE 4L23A 3FU5A 2VGYA 3SBTB 3DRAA 4M3OA 2CFUA 3ZU7B 1IQRA 3TXMA 1PC2A 3FEYA 1SA5A 5BW8C 2JLBA 5T8IA 3FU6A 4V3IA 5H7PA 3NOGD 3CK7A 2IU1A 2XZDG 3CEQA 1P5QA 2L6BA 4LG6A 5BUZA 4DRXE 4C48B 5CECB 3ABKE 2LUHA 4N2SA 4KT6B 4APFA 1TJCA 2WXKA 3D9PA 2OOEA 5HQ8A 3FULA 1N9AA 3U9WA 5LP0A 3AS8A 4HFGA 4WNDA 3L9TA 4FHJA 3CHPA 2GW1A 3KEZA 4A1SA 3RIBA 4RVBA 2Y0BG 2XPIA 4HI9A 4AXHA 4UI9K 3MKRA 5G05J 3WG7E 1OCCE 2I1KA 3ONKA 4HRLA 4O1OA 3PDNA 4KVOA 4JZYA 2VYIA 1LD8A 1Y8MA 4RG6A 4ILGA 3OXLA 4BSZB 5CRVA 3T5VA 2FO7A 1OXJA 3NBNB 3BG1B 3MA5A 2RFAA 4KYOB 1OWNA 1ZB1A 3Q47B 4G25A 2L0TB 3E4BA 3IEGA 1E90A 1NP7A 3UPVA 1DCEA 3UT8A 3KD7A 3IKOB 2XZTG 5J90A 3UT4A 5AENA 3LY8A 1OWLA 3NB2A 2XEHA 3D9JA 4JD2G 4KXKB 4F7AA 4JHJA 2WXPA 4GMRA 3JXIA 3FUFA 4JA9A 2VSNA 5G04J 1SZAA 4L7TA 3CVWA 4GU5A 5KCMA 3FFLA 3CHOA 5T3RA 4ME2A 3DPDA 3PZDA 3FTWA 4E6HA 4FADA 2KCVA 4ANXA 4XEIG 1O1RA 3V30A 3P1UA 1DCQA 4I1AA 3L22A 2R59A 4DX5D 4BTAA 3CVYA 2EIKE 1OWMA 5KJKA 3R7RA 4UQYA 5C2YA 3JXJA 5BXUA 1KZPA 4U07A 2P9SG 3VTYA 4JW1A 3D3MA 3B95A 3CVPA 4GTRA 3B7SA 2QFCA 5LFAA 4HRNA 1D8DA 3G2UA 3V31A 3VLEA 1S64A 3ULEG 4DX1A 2PQRA 3CK8A 3L17A 4RSYA 3QOUA 2VGXA 4ILIA 3ZPJA 4AIFA 3Q75A 4ZFHA 4N5QA 3UKUG 2EILE 1OCOE 3W9GA 1H2VC 4LNGA 4GMLA 2WVIA 3UM0A 4G1TA 3G2TA 5ANRA 5FIOA 4Q94A 1K8KG 4AM9A 4ACLA 2ONDA 4CCAA 3ISMC 4L1BA 3FUNA 4TXRA 4GZ5A 3RSEG 5ENQD 5AIJA 3ASGA 3DSSA 3S2AA 2IF4A 2Y1LE 2ZIRA 5FQ7A 1TEZA 3AAAC 2BUGA 2CHWA 5CERB 4AEZC 1MJ0A 1IQUA 2XHEA 1MX6A 3F6QA 4LRZA 4B8CB 1OUVA 4Y6CA 4Z68A 5D0QD 1QYMA 2I9CA 1A17A 5HRYA 4G23A 2WM9A 1EDUA 2M63A 2RKKA 3UQ3A 4K5BA 3HRAA 3HXCA 3QAQA 3NZUA 1TNUA 5HKPA 3PZ2A 3RRNB 3X2QE 5JJ7A 5FZQA 3KSLA 1HE8A 3MV2B 5J08A 3V79K 4A63B 3PEUB 2LAIA 2XPYA 4G11A 4I1OB 3TAXA 2QY7A 3Q73A 1LF8A 1BU9A 3EHMA 2RD0A 3FTSA 4PS3A 2VGXB 5CBOA 4LUNU 4PS8A 3PREA 2XQ0A 2V5QC 3L6AA 3LS8A 3G2VA 3NAWA 3FTVA 1O1TA 2KC7A 4GTMA 3LYAA 5LOZA 2F8XK 1RZ4A 4N2QA 2MHKA 2XRZA 3NZSA 1Q2ZA 1TNOA 4J8DA 4JL0A 2HYZA 4DX7D 3R9MA 5AARA 2KCKA 4WWOA 2IOSA 2OEVA 2F8YA 2GRRB 3JYSA 3PH0C 4GCOA 4HOTA 3Q9NC 3CVUA 3UTMA 3R9AB 3AU5A 4N5CA 3AJIA 3OAWA 4FULA 4R7LA 4KBQA 3PUKA 3D9NA 1QBQA 3DBSA 5CCLA 4K5CA 2GROB 1TN8A 5EYPF 5AQAA 3QWVA 1FPPA 2HR2A 4GPMA 5EX3A 2R02A 1HS6A 4JXTA 4U0ZA 4BTBA 3AU4A 1EYHA 2ZISA 5FWQA 2VTBA 4BWRA 3EHRA 2J4DA 4EZLA 2ZU6B 3Q9UC 3G2WA 4CDMA 3EHQA 1MHQA 2DWZA 1OY3D 1ELWA 3MX3A 2WXNA 3L13A 1UOHA 4KMOA 3FP3A 1OCRE 3UX4A 3PS6A 4EZKA 3AS5A 4HI8A 1FT1A 4UQZA 3HIZA 1U3DA 5FINA 2EIJE 3CVLA 3TWUA 5JMND 3URZA 2QC9A 4DJAA 3U3WA 4IRUA 3CVXA 3DEPA 4NQ0A 3IHVA 1XGWA 1W3BA 3CKCA 3ZIMA 4LEUA 3ASHA 2X3MA 4EBAG 4AOFA 5EIBE 3UT7A 4HLEA 4CGWA 4HS2A 4BEPA 5CBNA 5EX0A 1AWCB 4LCTA 4J8YA 1LTXA 2DBAA 4DI3A 4PS7A 4G26A 5DIZA 2XEVA 2FF4A 1JPLA 2J9QA 4FC8A 5AN8A 4DI4A 2XRYA 3T5XA 5CEDB 4TUUA 5BPPA 2V0PA 2R5SA 3AG4E 4PDXA 3CV0A 2AXVA 3UKRG 1YA0A 5AQBA 3Q5MA 3DSUA 2BF0X 2PM6A 4GYWA 4CGVA 3ESLA 3UM2A 4CRWA 4DK5A 2Y69E 3QB2A 2P9LG 2B6CA 2C0MA 3HXDA 2P9PG 5E75A 4FA6A 2FO1E 1VDYA 3CSTA 5FQ4A 5FZRA 3Q7FA 4F1SA 4ANUA 2MYOA 2ETCA 2PZIA 3RO3A 2ETBA 3SNXA 3DXKG 5G2NA 4QFVA 3ZRHA 3JQ0A 4I9CA 1QZ2A 1UJKA 3ZFWA 2VTBB 4UWGA 1YYHA 1MX2A 4GCNA 1FVFA 3UXGA 5FJYA 1EF1C 1LD7A 4U8VD 4XZ4A 3SBSA 4OAUC 4B89A 2KBXA 3T8MA 5FQ6A 5CMWA 5AJLA 4XKBA 4CDRA 3QWWA 5A6CA 1N4QA 1SVXA 4N3CA 3CHMA 1ZBPA 5EN5D 3ESKA 2KM4A 2GRQB 5LCWC 3DEOA 3TG5A 3S7DA 3GYZA 3ZGQA 1NL4A 5B1AE 2JEKA 3QKYA 3D9LA 3PRZA 3WXXA 3FHEA 4I43A 1N0RA 1GW6A 3HXEA 3CHQA 3FTXA 3CHSA 3G2SA 3MZLB 2R05A 4HNAD 3ZN3A 4AVXA 3HYMB 4F1PA 3VTXA 4HB5A 2XS8A 4PUCA 3B7BA 2WMOA 5FT9A 4GTPA 1N95A 5D2MC 2NC9A 3TWVA 3QK0A 1H6PA 4DX2A 4JPSA 4KVMA 5JJ6A 2XGOA 1FVHA 5AQ9A 4MRUA 3QC1A 2DZNA 5ENPD 4GYOA 5D0OD 5G04C 1BLXB 5JA4D 3SGHA 5AYWD 4HORA 4GPKA 4NRHB 3KSQA 4XI0A 4GZCA 5AAOA 4TUMA 2PNNA 1UW4B 4I6JA 4B94A 5E76A 4GTQA 4WNFA 3CK9A 4UWKA 2DZOA 3FUHA 1HX8A 4APOA 4N3BA 3TG4A 3QNKA 2EIME 4AY6A 3FEXA 3TWRA 3FH5A 3CLJA 2B0OE 1AP7A 4A3TA 2XENA 4ANVA 1Z3XA 4F6RD 1O1SA 3MJWA 2X6FA 2A4ZA 3FUMA 2CFZA 4IYPA 3LY7A 2J8SD 2P9UG 2WXLA 4G8KA 3ZYQA 5ITZF 4HXIA 3VLDA 1BI7B 1DNPA 5EYLA 2P9KG 2GRNB 5ARGA 4BX9A 3U66A 5A7DB 2OV8A 5CCMA 1TNBA 5IY5E 4G2VA 5BNWA
chains in the Genus database with same CATH topology
2P2CP 4F1PA 2MYOA 2Y1LE 2ETCA 4HB5A 3C5RA 3ZUVB 3ZNGA 3AAAC 3B7BA 5BXOA 4HI8A 5KBAA 1NFIE 1G3NB 5FINA 5CERB 2ETBA 2QYJA 3TWUA 4U8YD 5JMND 3J5QB 1MJ0A 1IHBA 3IXEA 1DCQA 2QC9A 1MX6A 3TWWA 3F6QA 4QFVA 3TWVA 3V30A 4HRMB 4DX2A 5KWDA 4O1PA 3HG0D 4B93B 4DX5D 2ZGGA 4QQIA 2HE0A 5AQ9A 4YDWA 2DZNA 3DEPA 4O60A 5ENPD 3JXJA 4OAVB 4DX7D 4Z68A 1K1AA 1BLXB 1YYHA 1D9SA 5JA4D 1QYMA 1MX2A 5BXUA 2Y0BG 5AARA 5EIBE 1WDYA 3UXGA 4HI9A 2F8XK 3EU9A 5HRYA 4BEPA 2ETAA 4U8VD 5KNGA 5AAOA 2F8YA 4TUMA 2PNNA 3B95A 5ENTD 1IXVA 4G8LA 1TR4A 4HRLA 1N0QA 3Q9NC 4O1OA 4BERA 5CBNA 4OAUC 5EIDA 2ZGDA 3JUEA 5D66A 4BETA 4HRNA 1AWCB 2KXPC 4U96D 4K5BA 3V31A 3HRAA 2DZOA 4JB8P 3UTMA 4J7WA 2KBXA 2XEEA 4J8YA 3AJIA 4CYMD 4CZ2D 4DX1A 2VGEA 1OT8A 5HKPA 3TWRA 4HLLA 4BSZB 1BD8A 4LNUD 2JABA 4K5CA 4ZHBA 4DX6D 2B0OE 5AN8A 3NBNB 1AP7A 4YDYA 5KNHD 2XENA 5CEDB 5EYPF 2AJAA 5AQAA 1SVXA 4NIKA 3ZU7B 2RFAA 4U95D 3T9KA 4A63B 3V79K 4GPMA 5ENOD 3TWTA 3LJNA 4ZFHA 4N5QA 5EN5D 1BI8B 3TWXA 3W9GA 4HQDA 5AQBA 4DUIA 1A5EA 3DEOA 2F37A 4LSZE 4HBDA 1BU9A 2DVWA 3W9FA 3D9HA 4F6RD 1MYOA 5ENRD 2RFMA 2XZTG 5CEAA 1YMPA 3NOGD 1IKND 4RLYA 5CBOA 3TWSA 3EHRA 3V2OA 3KEAA 2J8SD 3J5PA 1WG0A 5FIOA 1MX4A 4G8KA 3TWQA 2XEHA 3Q9UC 2XZDG 1SW6A 3EHQA 4ATZD 4BESA 5ITZF 2L6BA 1BI7B 5EYLA 1N0RA 2DWZA 1OY3D 3JXIA 3NOCD 4GMRA 4LG6A 5EILA 2V5QC 2NYJA 5HS0A 3ZKJA 2A5EA 2V4HC 4UUCA 1K3ZD 1UOHA 4DRXE 1S70B 2BKGA 3V2XA 5ENQD 3SO8A 2BKKB 5AQ7A 4C48B 5CECB 4HNAD 2FO1E 3T8KA 1DC2A 1N11A 5ENSD 1K1BA 4K5AB 1YCSB 3UI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P2C P;  4F1P A;  2MYO A;  2Y1L E;  2ETC A;  4HB5 A;  3C5R A;  3ZUV B;  3ZNG A;  3AAA C;  3B7B A;  5BXO A;  4HI8 A;  5KBA A;  1NFI E;  1G3N B;  5FIN A;  5CER B;  2ETB A;  2QYJ A;  3TWU A;  4U8Y D;  5JMN D;  3J5Q B;  1MJ0 A;  1IHB A;  3IXE A;  1DCQ A;  2QC9 A;  1MX6 A;  3TWW A;  3F6Q A;  4QFV A;  3TWV A;  3V30 A;  4HRM B;  4DX2 A;  5KWD A;  4O1P A;  3HG0 D;  4B93 B;  4DX5 D;  2ZGG A;  4QQI A;  2HE0 A;  5AQ9 A;  4YDW A;  2DZN A;  3DEP A;  4O60 A;  5ENP D;  3JXJ A;  4OAV B;  4DX7 D;  4Z68 A;  1K1A A;  1BLX B;  1YYH A;  1D9S A;  5JA4 D;  1QYM A;  1MX2 A;  5BXU A;  2Y0B G;  5AAR A;  5EIB E;  1WDY A;  3UXG A;  4HI9 A;  2F8X K;  3EU9 A;  5HRY A;  4BEP A;  2ETA A;  4U8V D;  5KNG A;  5AAO A;  2F8Y A;  4TUM A;  2PNN A;  3B95 A;  5ENT D;  1IXV A;  4G8L A;  1TR4 A;  4HRL A;  1N0Q A;  3Q9N C;  4O1O A;  4BER A;  5CBN A;  4OAU C;  5EID A;  2ZGD A;  3JUE A;  5D66 A;  4BET A;  4HRN A;  1AWC B;  2KXP C;  4U96 D;  4K5B A;  3V31 A;  3HRA A;  2DZO A;  4JB8 P;  3UTM A;  4J7W A;  2KBX A;  2XEE A;  4J8Y A;  3AJI A;  4CYM D;  4CZ2 D;  4DX1 A;  2VGE A;  1OT8 A;  5HKP A;  3TWR A;  4HLL A;  4BSZ B;  1BD8 A;  4LNU D;  2JAB A;  4K5C A;  4ZHB A;  4DX6 D;  2B0O E;  5AN8 A;  3NBN B;  1AP7 A;  4YDY A;  5KNH D;  2XEN A;  5CED B;  5EYP F;  2AJA A;  5AQA A;  1SVX A;  4NIK A;  3ZU7 B;  2RFA A;  4U95 D;  3T9K A;  4A63 B;  3V79 K;  4GPM A;  5ENO D;  3TWT A;  3LJN A;  4ZFH A;  4N5Q A;  5EN5 D;  1BI8 B;  3TWX A;  3W9G A;  4HQD A;  5AQB A;  4DUI A;  1A5E A;  3DEO A;  2F37 A;  4LSZ E;  4HBD A;  1BU9 A;  2DVW A;  3W9F A;  3D9H A;  4F6R D;  1MYO A;  5ENR D;  2RFM A;  2XZT G;  5CEA A;  1YMP A;  3NOG D;  1IKN D;  4RLY A;  5CBO A;  3TWS A;  3EHR A;  3V2O A;  3KEA A;  2J8S D;  3J5P A;  1WG0 A;  5FIO A;  1MX4 A;  4G8K A;  3TWQ A;  2XEH A;  3Q9U C;  2XZD G;  1SW6 A;  3EHQ A;  4ATZ D;  4BES A;  5ITZ F;  2L6B A;  1BI7 B;  5EYL A;  1N0R A;  2DWZ A;  1OY3 D;  3JXI A;  3NOC D;  4GMR A;  4LG6 A;  5EIL A;  2V5Q C;  2NYJ A;  5HS0 A;  3ZKJ A;  2A5E A;  2V4H C;  4UUC A;  1K3Z D;  1UOH A;  4DRX E;  1S70 B;  2BKG A;  3V2X A;  5ENQ D;  3SO8 A;  2BKK B;  5AQ7 A;  4C48 B;  5CEC B;  4HNA D;  2FO1 E;  3T8K A;  1DC2 A;  1N11 A;  5ENS D;  1K1B A;  4K5A B;  1YCS B;  3UI2 A; 
#chains in the Genus database with same CATH topology
 3MEK A;  3TL5 A;  3ZUV B;  3GW4 A;  4AJW A;  1X5B A;  3MYV A;  1XNF A;  3CKB A;  3AG2 E;  4UWH A;  1BPO A;  1E7V A;  3EIJ A;  4MLP A;  2J09 A;  3I4R B;  1UN9 A;  4ILH B;  2CG2 A;  1TN7 A;  1UJJ A;  2BED A;  4U0U A;  1NA0 A;  2LXL A;  2YHC A;  5LCW J;  2OVF A;  1Y6I A;  1U3C A;  4GAA A;  4FP7 A;  4TRQ A;  4G8L A;  1DC2 A;  2GGF A;  3ML8 A;  4BET A;  3UMV A;  4U96 D;  1HU3 A;  3HVE B;  2WXJ A;  3FU0 A;  3PE4 A;  4GTT A;  4LNU D;  1N52 A;  4ZHB A;  2VJ8 A;  3DST A;  3LXU X;  5ENN A;  4RQI A;  2AVP A;  2OCC E;  3Q15 A;  3SHF A;  2H6G A;  3ASN E;  4MS6 A;  4N3A A;  4P29 A;  1Z5S C;  1BI8 B;  3Q4A B;  4YVQ C;  1UG3 A;  1KT0 A;  4NUR A;  4DUI A;  1JUQ A;  2H6F A;  4J6I A;  3D9H A;  3FUI A;  3PNL B;  2P58 C;  1YMP A;  2MRI A;  2WQ7 A;  2NSZ A;  2PL2 A;  1HG5 A;  2R03 A;  2P9N G;  3OXG A;  2Q7F A;  2OVB A;  4A55 A;  1EPU A;  3NOC D;  2H6I A;  3LCA A;  2V4H C;  1K3Z D;  1S70 B;  5AQ7 A;  4A3V A;  1UN8 A;  4U0S A;  4D10 C;  4L2Y A;  1K1B A;  3SFX A;  3ULY A;  2V8S E;  2P2C P;  3CVN A;  1IYG A;  2E2E A;  3MV3 B;  1O5M A;  1G3N B;  3RO2 A;  4U8Y D;  1IHG A;  4X8Q A;  2XPZ A;  3JQ1 A;  2BTD A;  2GRM A;  4YVO A;  2ZGG A;  4WNG A;  2AXU A;  3FUK A;  4ANW A;  2I2O A;  1E8X A;  2DCP A;  1HFA A;  5DBK A;  2WXQ A;  3DSV A;  2A5U A;  4PH4 B;  2VSX E;  4FU3 A;  4XIF A;  5ANL A;  3VLF A;  2FBN A;  3MGB A;  5FZS A;  1PY1 A;  1KPS B;  3PZ3 A;  4GZ6 A;  3TXN A;  2XEE A;  3D9M A;  1KLX A;  4CZ2 D;  2YHE A;  3DXM G;  1N4S A;  2X6J A;  4CT0 A;  3ZYL A;  2XGS A;  2H6H A;  3DSX A;  4C9B B;  4CDN A;  3DWL G;  3PE3 A;  1JWF A;  2F37 A;  3L16 A;  4HBD A;  4GZ3 A;  1HO8 A;  5B3S E;  1OCZ E;  2F0Y A;  3J5P A;  1TNY A;  3FWV A;  4ATG A;  2IOL A;  3HDX A;  3RRU A;  4BFR A;  4TXQ A;  4HOU A;  4YDO A;  3L08 A;  3ZKJ A;  2A5E A;  2KCL A;  3BG0 B;  4B8A A;  4E85 A;  5KJM A;  4FJZ A;  4J8S A;  1V55 E;  2WXO A;  3T8K A;  3CVV A;  3Q49 B;  4G24 A;  1JCQ A;  2LSV A;  3ZYM A;  2Y4U A;  3E32 A;  5BV0 A;  3FY4 A;  5G55 A;  2IO3 C;  4I2Z A;  4TV3 A;  3C72 A;  4B93 B;  2X6I A;  3FUD A;  3GZ2 A;  4FLH A;  3SFY A;  4O60 A;  2IFU A;  5M72 A;  4MBG A;  2XGM A;  3DSW A;  4O6F A;  3ZW3 A;  3K9I A;  4I9E A;  3EJN A;  3CR3 A;  2XCC A;  5KNG A;  3CQC B;  4BX8 A;  1MZC A;  4JA7 A;  1V54 E;  3KAE A;  1KZO A;  4H7X A;  5EKQ D;  3D9O A;  4I17 A;  5CMY A;  3LJ3 A;  3ZVV A;  3PZ4 A;  2R17 C;  2HM8 A;  5KNH D;  4GB9 A;  1QNF A;  4I6E A;  4I6G A;  2XS1 A;  2WXI A;  4Y6W A;  4OVU A;  3E37 A;  4GTV A;  1A5E A;  3ZEF A;  4EQF A;  3ABL E;  3JCK C;  2IEJ A;  1MYO A;  5FQ8 A;  3FUJ A;  4YDE A;  4RLY A;  2EQX A;  3PEV B;  3DPY A;  3TWQ A;  1JCS A;  4ATZ D;  1ELR A;  3NF1 A;  3CVQ A;  3ZXP A;  1WAO 1;  4BSX A;  3CGH A;  2NXP A;  1HZ4 A;  1SA4 A;  2P9I G;  3RJV A;  2GRP B;  1N11 A;  2WXM A;  3RKV A;  2I1J A;  1NZN A;  2Y3A A;  4BY6 A;  4KZ0 A;  5KBA A;  3CSF A;  4IUL A;  4HRM B;  2L6J A;  4GMJ A;  4O1P A;  3HG0 D;  3LY9 A;  2ION A;  3EHN A;  4Q69 A;  1WDY A;  1H2U A;  4HOQ A;  3FU3 A;  3QWP A;  5EID A;  1QQE A;  3ZXS A;  3ASF A;  5CHE E;  2VGE A;  2IY0 C;  3P2B A;  5JJT A;  4JEH A;  3BEE A;  1D8E A;  3QJZ A;  4NIK A;  4U95 D;  2RG8 A;  5ENO D;  4JVS A;  4OVV A;  4J8E A;  3ZYK A;  3I4G A;  2UWJ G;  3IV0 A;  3D9I A;  4LSZ E;  2AW6 A;  2LAH A;  3U4T A;  2IJG X;  1E8Y A;  1NI1 A;  4WWN A;  4I2W A;  3FH8 A;  4LER A;  3TWS A;  3V2O A;  4BT8 A;  4FLB A;  2AXZ A;  4DLO A;  2IO2 C;  5HI7 A;  2QYU A;  2OEW A;  2LO6 A;  1RW2 A;  2WXH A;  4GYY A;  4H7Y A;  4UI9 J;  5ENS D;  2WMN A;  3CHR A;  2HO1 A;  4JHR A;  1WM5 A;  2WQ6 A;  1FCH A;  4K0R A;  2WQH A;  4EBA A;  1N94 A;  5JHA A;  1OWO A;  3GZS A;  2CG3 A;  2MOW A;  3FTY A;  4XI9 A;  4WUY A;  5C1D A;  4GA2 A;  2DYR E;  5ARF A;  1TYQ G;  5T4Y A;  1H19 A;  1HG2 A;  4NAC A;  4XX5 A;  1D9S A;  4AV7 A;  2DYS E;  3SF4 A;  3RAU A;  1HH8 A;  4WNE A;  1TR4 A;  4BER A;  3JUE A;  4JB8 P;  4GZD A;  3LKU A;  3JUI A;  3L54 A;  1OT8 A;  4HLL A;  3APC A;  3LDZ A;  2FEZ A;  1ELK A;  2KAT A;  4XE0 A;  4CEM A;  3FTZ A;  2J08 A;  2AWI A;  3AG3 E;  4ACK A;  1WY6 A;  4UQX A;  2LNI A;  3SY2 A;  2J49 A;  4TXP A;  1SW6 A;  4C0M A;  4A1G A;  5EIL A;  1H6K A;  1E8Z A;  5G05 C;  3EIQ C;  3UM3 A;  4FHK A;  5LX8 A;  2BKG A;  3LPZ A;  4ABN A;  2E0I A;  3UIO C;  1JWG A;  2WXG A;  3APF A;  1S0P A;  3EDT B;  3SD5 A;  5BT1 A;  3UI2 A;  2QZA A;  2YNQ A;  3ABM E;  4YND A;  3ZNG A;  3ONL A;  5A23 A;  3IXE A;  3TWW A;  2IQC A;  2X6K A;  3B13 A;  3FUE A;  2WXF A;  3C3Q A;  3UM1 A;  4HOS A;  1E7U A;  4MKT A;  4IN3 B;  2FUL A;  3SZ7 A;  2ILR A;  3SQV A;  3E30 A;  5KJL A;  2WXR A;  3UUX A;  5D66 A;  4J8F A;  4J7W A;  4CYM D;  3PZ1 A;  1BD8 A;  4EZJ A;  1TNZ A;  4YDY A;  3B7R L;  4DPR A;  3BU8 A;  3T9K A;  3Q7A A;  3TWT A;  2VSY A;  4GTS A;  2DIW A;  2L9B A;  4U8H A;  3QDN A;  3RRM B;  4GTO A;  3HVE A;  3CQG B;  3LVQ E;  4JC8 A;  2KZT A;  1IKN D;  1N4P A;  1WG0 A;  1Z6T A;  2LXM A;  2PQN A;  3AG1 E;  2PM7 A;  4UUC A;  4C0E A;  4KZC A;  4F3V A;  3OTN A;  2J4B A;  3N71 A;  4F53 A;  3U64 A;  1TN6 A;  4K5A B;  2EIN E;  2L0I A;  1B89 A;  3ZHE A;  3C5R A;  1NFI E;  2QYJ A;  3J5Q B;  1IHB A;  1L5J A;  3AS4 A;  3O48 A;  3Q78 A;  4XKC A;  1S63 A;  2J07 A;  3C98 A;  2CHZ A;  3ASO E;  3I3N A;  3APD A;  4U7E B;  4L2L A;  4AP2 A;  1ZU2 A;  3CIA A;  1HXI A;  5ENT D;  1N0Q A;  3KS2 A;  5CRU A;  2C2L A;  1DVP A;  4HVB A;  4Q96 A;  2Y4T A;  3TJP A;  1JCR A;  2JAB A;  3MKQ A;  3PNT B;  3OXF A;  4DX6 D;  1U2V G;  2C0L A;  3FH7 A;  2AJA A;  3C3R A;  1PAQ A;  5FTP A;  2GRL A;  3LJN A;  3UIP C;  4DLQ A;  2V4L A;  3QAR A;  3TWX A;  3S7B A;  4BT9 A;  4FJY A;  4AY5 A;  4B0Z A;  3W9F A;  4EPZ A;  5ENR D;  1H6O A;  3KEA A;  2WB2 A;  3ENE A;  3I5P A;  2LSU A;  3LVR E;  2UY1 B;  2NYJ A;  3IBE A;  3V2X A;  4WWP A;  4URK A;  4OYS A;  4N39 A;  5EDS A;  5BXO A;  4J0U A;  4I1M A;  3O4Z A;  1NA3 A;  4U04 A;  5KWD A;  1SZ9 A;  3D9K A;  3HXF A;  2YIN A;  2HE0 A;  3RU0 A;  4YDW A;  5KJN A;  4RG9 A;  1K1A A;  2X6H A;  4CT4 A;  2I6H A;  2ETA A;  3PVL A;  1E96 B;  5BV1 A;  1E8W A;  3S7J A;  1IXV A;  3PUJ A;  2KXP C;  4UWF A;  3B7U X;  4WAF A;  1Z3Y A;  3FDH A;  1HF8 A;  3TGO A;  4UWL A;  1H0A A;  3GZ1 A;  3R7Q A;  1TJF A;  3MKQ B;  4L9P A;  1H2T C;  4LNB A;  3NQP A;  4JEU A;  3HXB A;  4HQD A;  3BQO A;  4EEC A;  4K03 A;  4EHM A;  2DVW A;  1SQM A;  2FI7 A;  2XCB A;  2R2L A;  3EUV A;  2RFM A;  5CEA A;  2V5F A;  3Q79 A;  3IHY A;  1MX4 A;  1N4R A;  2YQ8 A;  2VSO E;  4BES A;  3LEW A;  1FT2 A;  4GA0 A;  5HS0 A;  3E34 A;  1MQS A;  3L82 A;  3EU5 A;  3B7T A;  3SO8 A;  3MCX A;  2BKK B;  5B1B E;  3ASD A;  2VQ2 A;  1YCS B;  2CHX A;  3UIN C;  1N54 A;  2KZT B;  1INZ A;  1KT1 A;  2UY1 A;  1X81 A;  3ULQ A;  3RK6 A;  3HHM A;  4JHK A;  4QQI A;  2X38 A;  3ML9 A;  4OAV B;  3BUA A;  4M7C A;  5JHB A;  4U63 A;  3SI5 A;  3E33 A;  3S7F A;  3EU9 A;  3ZHE B;  3FTU A;  5AJD A;  2WPV A;  2ZGD A;  4UI9 C;  4W9R A;  4GA1 A;  3SFZ A;  1OWP A;  3C3O A;  2ZXW E;  4L23 A;  3FU5 A;  2VGY A;  3SBT B;  3DRA A;  4M3O A;  2CFU A;  3ZU7 B;  1IQR A;  3TXM A;  1PC2 A;  3FEY A;  1SA5 A;  5BW8 C;  2JLB A;  5T8I A;  3FU6 A;  4V3I A;  5H7P A;  3NOG D;  3CK7 A;  2IU1 A;  2XZD G;  3CEQ A;  1P5Q A;  2L6B A;  4LG6 A;  5BUZ A;  4DRX E;  4C48 B;  5CEC B;  3ABK E;  2LUH A;  4N2S A;  4KT6 B;  4APF A;  1TJC A;  2WXK A;  3D9P A;  2OOE A;  5HQ8 A;  3FUL A;  1N9A A;  3U9W A;  5LP0 A;  3AS8 A;  4HFG A;  4WND A;  3L9T A;  4FHJ A;  3CHP A;  2GW1 A;  3KEZ A;  4A1S A;  3RIB A;  4RVB A;  2Y0B G;  2XPI A;  4HI9 A;  4AXH A;  4UI9 K;  3MKR A;  5G05 J;  3WG7 E;  1OCC E;  2I1K A;  3ONK A;  4HRL A;  4O1O A;  3PDN A;  4KVO A;  4JZY A;  2VYI A;  1LD8 A;  1Y8M A;  4RG6 A;  4ILG A;  3OXL A;  4BSZ B;  5CRV A;  3T5V A;  2FO7 A;  1OXJ A;  3NBN B;  3BG1 B;  3MA5 A;  2RFA A;  4KYO B;  1OWN A;  1ZB1 A;  3Q47 B;  4G25 A;  2L0T B;  3E4B A;  3IEG A;  1E90 A;  1NP7 A;  3UPV A;  1DCE A;  3UT8 A;  3KD7 A;  3IKO B;  2XZT G;  5J90 A;  3UT4 A;  5AEN A;  3LY8 A;  1OWL A;  3NB2 A;  2XEH A;  3D9J A;  4JD2 G;  4KXK B;  4F7A A;  4JHJ A;  2WXP A;  4GMR A;  3JXI A;  3FUF A;  4JA9 A;  2VSN A;  5G04 J;  1SZA A;  4L7T A;  3CVW A;  4GU5 A;  5KCM A;  3FFL A;  3CHO A;  5T3R A;  4ME2 A;  3DPD A;  3PZD A;  3FTW A;  4E6H A;  4FAD A;  2KCV A;  4ANX A;  4XEI G;  1O1R A;  3V30 A;  3P1U A;  1DCQ A;  4I1A A;  3L22 A;  2R59 A;  4DX5 D;  4BTA A;  3CVY A;  2EIK E;  1OWM A;  5KJK A;  3R7R A;  4UQY A;  5C2Y A;  3JXJ A;  5BXU A;  1KZP A;  4U07 A;  2P9S G;  3VTY A;  4JW1 A;  3D3M A;  3B95 A;  3CVP A;  4GTR A;  3B7S A;  2QFC A;  5LFA A;  4HRN A;  1D8D A;  3G2U A;  3V31 A;  3VLE A;  1S64 A;  3ULE G;  4DX1 A;  2PQR A;  3CK8 A;  3L17 A;  4RSY A;  3QOU A;  2VGX A;  4ILI A;  3ZPJ A;  4AIF A;  3Q75 A;  4ZFH A;  4N5Q A;  3UKU G;  2EIL E;  1OCO E;  3W9G A;  1H2V C;  4LNG A;  4GML A;  2WVI A;  3UM0 A;  4G1T A;  3G2T A;  5ANR A;  5FIO A;  4Q94 A;  1K8K G;  4AM9 A;  4ACL A;  2OND A;  4CCA A;  3ISM C;  4L1B A;  3FUN A;  4TXR A;  4GZ5 A;  3RSE G;  5ENQ D;  5AIJ A;  3ASG A;  3DSS A;  3S2A A;  2IF4 A;  2Y1L E;  2ZIR A;  5FQ7 A;  1TEZ A;  3AAA C;  2BUG A;  2CHW A;  5CER B;  4AEZ C;  1MJ0 A;  1IQU A;  2XHE A;  1MX6 A;  3F6Q A;  4LRZ A;  4B8C B;  1OUV A;  4Y6C A;  4Z68 A;  5D0Q D;  1QYM A;  2I9C A;  1A17 A;  5HRY A;  4G23 A;  2WM9 A;  1EDU A;  2M63 A;  2RKK A;  3UQ3 A;  4K5B A;  3HRA A;  3HXC A;  3QAQ A;  3NZU A;  1TNU A;  5HKP A;  3PZ2 A;  3RRN B;  3X2Q E;  5JJ7 A;  5FZQ A;  3KSL A;  1HE8 A;  3MV2 B;  5J08 A;  3V79 K;  4A63 B;  3PEU B;  2LAI A;  2XPY A;  4G11 A;  4I1O B;  3TAX A;  2QY7 A;  3Q73 A;  1LF8 A;  1BU9 A;  3EHM A;  2RD0 A;  3FTS A;  4PS3 A;  2VGX B;  5CBO A;  4LUN U;  4PS8 A;  3PRE A;  2XQ0 A;  2V5Q C;  3L6A A;  3LS8 A;  3G2V A;  3NAW A;  3FTV A;  1O1T A;  2KC7 A;  4GTM A;  3LYA A;  5LOZ A;  2F8X K;  1RZ4 A;  4N2Q A;  2MHK A;  2XRZ A;  3NZS A;  1Q2Z A;  1TNO A;  4J8D A;  4JL0 A;  2HYZ A;  4DX7 D;  3R9M A;  5AAR A;  2KCK A;  4WWO A;  2IOS A;  2OEV A;  2F8Y A;  2GRR B;  3JYS A;  3PH0 C;  4GCO A;  4HOT A;  3Q9N C;  3CVU A;  3UTM A;  3R9A B;  3AU5 A;  4N5C A;  3AJI A;  3OAW A;  4FUL A;  4R7L A;  4KBQ A;  3PUK A;  3D9N A;  1QBQ A;  3DBS A;  5CCL A;  4K5C A;  2GRO B;  1TN8 A;  5EYP F;  5AQA A;  3QWV A;  1FPP A;  2HR2 A;  4GPM A;  5EX3 A;  2R02 A;  1HS6 A;  4JXT A;  4U0Z A;  4BTB A;  3AU4 A;  1EYH A;  2ZIS A;  5FWQ A;  2VTB A;  4BWR A;  3EHR A;  2J4D A;  4EZL A;  2ZU6 B;  3Q9U C;  3G2W A;  4CDM A;  3EHQ A;  1MHQ A;  2DWZ A;  1OY3 D;  1ELW A;  3MX3 A;  2WXN A;  3L13 A;  1UOH A;  4KMO A;  3FP3 A;  1OCR E;  3UX4 A;  3PS6 A;  4EZK A;  3AS5 A;  4HI8 A;  1FT1 A;  4UQZ A;  3HIZ A;  1U3D A;  5FIN A;  2EIJ E;  3CVL A;  3TWU A;  5JMN D;  3URZ A;  2QC9 A;  4DJA A;  3U3W A;  4IRU A;  3CVX A;  3DEP A;  4NQ0 A;  3IHV A;  1XGW A;  1W3B A;  3CKC A;  3ZIM A;  4LEU A;  3ASH A;  2X3M A;  4EBA G;  4AOF A;  5EIB E;  3UT7 A;  4HLE A;  4CGW A;  4HS2 A;  4BEP A;  5CBN A;  5EX0 A;  1AWC B;  4LCT A;  4J8Y A;  1LTX A;  2DBA A;  4DI3 A;  4PS7 A;  4G26 A;  5DIZ A;  2XEV A;  2FF4 A;  1JPL A;  2J9Q A;  4FC8 A;  5AN8 A;  4DI4 A;  2XRY A;  3T5X A;  5CED B;  4TUU A;  5BPP A;  2V0P A;  2R5S A;  3AG4 E;  4PDX A;  3CV0 A;  2AXV A;  3UKR G;  1YA0 A;  5AQB A;  3Q5M A;  3DSU A;  2BF0 X;  2PM6 A;  4GYW A;  4CGV A;  3ESL A;  3UM2 A;  4CRW A;  4DK5 A;  2Y69 E;  3QB2 A;  2P9L G;  2B6C A;  2C0M A;  3HXD A;  2P9P G;  5E75 A;  4FA6 A;  2FO1 E;  1VDY A;  3CST A;  5FQ4 A;  5FZR A;  3Q7F A;  4F1S A;  4ANU A;  2MYO A;  2ETC A;  2PZI A;  3RO3 A;  2ETB A;  3SNX A;  3DXK G;  5G2N A;  4QFV A;  3ZRH A;  3JQ0 A;  4I9C A;  1QZ2 A;  1UJK A;  3ZFW A;  2VTB B;  4UWG A;  1YYH A;  1MX2 A;  4GCN A;  1FVF A;  3UXG A;  5FJY A;  1EF1 C;  1LD7 A;  4U8V D;  4XZ4 A;  3SBS A;  4OAU C;  4B89 A;  2KBX A;  3T8M A;  5FQ6 A;  5CMW A;  5AJL A;  4XKB A;  4CDR A;  3QWW A;  5A6C A;  1N4Q A;  1SVX A;  4N3C A;  3CHM A;  1ZBP A;  5EN5 D;  3ESK A;  2KM4 A;  2GRQ B;  5LCW C;  3DEO A;  3TG5 A;  3S7D A;  3GYZ A;  3ZGQ A;  1NL4 A;  5B1A E;  2JEK A;  3QKY A;  3D9L A;  3PRZ A;  3WXX A;  3FHE A;  4I43 A;  1N0R A;  1GW6 A;  3HXE A;  3CHQ A;  3FTX A;  3CHS A;  3G2S A;  3MZL B;  2R05 A;  4HNA D;  3ZN3 A;  4AVX A;  3HYM B;  4F1P A;  3VTX A;  4HB5 A;  2XS8 A;  4PUC A;  3B7B A;  2WMO A;  5FT9 A;  4GTP A;  1N95 A;  5D2M C;  2NC9 A;  3TWV A;  3QK0 A;  1H6P A;  4DX2 A;  4JPS A;  4KVM A;  5JJ6 A;  2XGO A;  1FVH A;  5AQ9 A;  4MRU A;  3QC1 A;  2DZN A;  5ENP D;  4GYO A;  5D0O D;  5G04 C;  1BLX B;  5JA4 D;  3SGH A;  5AYW D;  4HOR A;  4GPK A;  4NRH B;  3KSQ A;  4XI0 A;  4GZC A;  5AAO A;  4TUM A;  2PNN A;  1UW4 B;  4I6J A;  4B94 A;  5E76 A;  4GTQ A;  4WNF A;  3CK9 A;  4UWK A;  2DZO A;  3FUH A;  1HX8 A;  4APO A;  4N3B A;  3TG4 A;  3QNK A;  2EIM E;  4AY6 A;  3FEX A;  3TWR A;  3FH5 A;  3CLJ A;  2B0O E;  1AP7 A;  4A3T A;  2XEN A;  4ANV A;  1Z3X A;  4F6R D;  1O1S A;  3MJW A;  2X6F A;  2A4Z A;  3FUM A;  2CFZ A;  4IYP A;  3LY7 A;  2J8S D;  2P9U G;  2WXL A;  4G8K A;  3ZYQ A;  5ITZ F;  4HXI A;  3VLD A;  1BI7 B;  1DNP A;  5EYL A;  2P9K G;  2GRN B;  5ARG A;  4BX9 A;  3U66 A;  5A7D B;  2OV8 A;  5CCM A;  1TNB A;  5IY5 E;  4G2V A;  5BNW A; 
#chains in the Genus database with same CATH homology
 2P2C P;  4F1P A;  2MYO A;  2Y1L E;  2ETC A;  4HB5 A;  3C5R A;  3ZUV B;  3ZNG A;  3AAA C;  3B7B A;  5BXO A;  4HI8 A;  5KBA A;  1NFI E;  1G3N B;  5FIN A;  5CER B;  2ETB A;  2QYJ A;  3TWU A;  4U8Y D;  5JMN D;  3J5Q B;  1MJ0 A;  1IHB A;  3IXE A;  1DCQ A;  2QC9 A;  1MX6 A;  3TWW A;  3F6Q A;  4QFV A;  3TWV A;  3V30 A;  4HRM B;  4DX2 A;  5KWD A;  4O1P A;  3HG0 D;  4B93 B;  4DX5 D;  2ZGG A;  4QQI A;  2HE0 A;  5AQ9 A;  4YDW A;  2DZN A;  3DEP A;  4O60 A;  5ENP D;  3JXJ A;  4OAV B;  4DX7 D;  4Z68 A;  1K1A A;  1BLX B;  1YYH A;  1D9S A;  5JA4 D;  1QYM A;  1MX2 A;  5BXU A;  2Y0B G;  5AAR A;  5EIB E;  1WDY A;  3UXG A;  4HI9 A;  2F8X K;  3EU9 A;  5HRY A;  4BEP A;  2ETA A;  4U8V D;  5KNG A;  5AAO A;  2F8Y A;  4TUM A;  2PNN A;  3B95 A;  5ENT D;  1IXV A;  4G8L A;  1TR4 A;  4HRL A;  1N0Q A;  3Q9N C;  4O1O A;  4BER A;  5CBN A;  4OAU C;  5EID A;  2ZGD A;  3JUE A;  5D66 A;  4BET A;  4HRN A;  1AWC B;  2KXP C;  4U96 D;  4K5B A;  3V31 A;  3HRA A;  2DZO A;  4JB8 P;  3UTM A;  4J7W A;  2KBX A;  2XEE A;  4J8Y A;  3AJI A;  4CYM D;  4CZ2 D;  4DX1 A;  2VGE A;  1OT8 A;  5HKP A;  3TWR A;  4HLL A;  4BSZ B;  1BD8 A;  4LNU D;  2JAB A;  4K5C A;  4ZHB A;  4DX6 D;  2B0O E;  5AN8 A;  3NBN B;  1AP7 A;  4YDY A;  5KNH D;  2XEN A;  5CED B;  5EYP F;  2AJA A;  5AQA A;  1SVX A;  4NIK A;  3ZU7 B;  2RFA A;  4U95 D;  3T9K A;  4A63 B;  3V79 K;  4GPM A;  5ENO D;  3TWT A;  3LJN A;  4ZFH A;  4N5Q A;  5EN5 D;  1BI8 B;  3TWX A;  3W9G A;  4HQD A;  5AQB A;  4DUI A;  1A5E A;  3DEO A;  2F37 A;  4LSZ E;  4HBD A;  1BU9 A;  2DVW A;  3W9F A;  3D9H A;  4F6R D;  1MYO A;  5ENR D;  2RFM A;  2XZT G;  5CEA A;  1YMP A;  3NOG D;  1IKN D;  4RLY A;  5CBO A;  3TWS A;  3EHR A;  3V2O A;  3KEA A;  2J8S D;  3J5P A;  1WG0 A;  5FIO A;  1MX4 A;  4G8K A;  3TWQ A;  2XEH A;  3Q9U C;  2XZD G;  1SW6 A;  3EHQ A;  4ATZ D;  4BES A;  5ITZ F;  2L6B A;  1BI7 B;  5EYL A;  1N0R A;  2DWZ A;  1OY3 D;  3JXI A;  3NOC D;  4GMR A;  4LG6 A;  5EIL A;  2V5Q C;  2NYJ A;  5HS0 A;  3ZKJ A;  2A5E A;  2V4H C;  4UUC A;  1K3Z D;  1UOH A;  4DRX E;  1S70 B;  2BKG A;  3V2X A;  5ENQ D;  3SO8 A;  2BKK B;  5AQ7 A;  4C48 B;  5CEC B;  4HNA D;  2FO1 E;  3T8K A;  1DC2 A;  1N11 A;  5ENS D;  1K1B A;  4K5A B;  1YCS B;  3UI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...