4BSZB

Crystal structure of the yeast ribosomal protein rps3 in complex with its chaperone yar1
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
150
structure length
150
Chain Sequence
PLDQEDQDTIILDARAGDLDSLKDIFTTLVSPELLSTCKESESDSTALHMAAANGHIETVRYILETVSRANSAEDLKAFVNEVNKTGNTALHWASLNGKLDVVKLLCDEYEADPFIRNKFGHDAIFEAENSGKEEVETYFLKKYDVEPED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Yeast Ribosomal Protein Rps3 in Complex with its Chaperone Yar1
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords 40S RIBOSOMAL PROTEIN S3
total genus 54
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4bszB00
3B7BA 1YYHA 3TWXA 3UI2A 2RFMA 2V4HC 3UXGA 1DC2A 5AQ7A 5CBOA 3EU9A 2P2CP 4K5BA 3Q9UC 4DX6D 4YDYA 1WDYA 3C5RA 2F8XK 4U95D 2XENA 2A5EA 4OAVB 3TWTA 4NIKA 3KEAA 2QYJA 3ZU7B 4OAUC 2AJAA 2ZGDA 2MYOA 2Y1LE 5ENOD 3TWUA 1NFIE 3V2XA 3EHQA 4DUIA 4B93B 3IXEA 4ATZD 4F1PA 3HRAA 2PNNA 5EIDA 3JUEA 4HRMB 5AQAA 4HI9A 1D9SA 1MX4A 4BESA 4U8VD 5AQBA 1N11A 2Y0BG 3DEOA 4HRLA 2ETCA 2V5QC 1MX2A 1OY3D 5BXUA 5EIBE 2F8YA 3JXJA 2DZNA 2XZTG 4UUCA 4DX5D 1AWCB 2XEHA 4J7WA 4F6RD 4Z68A 3T9KA 5EYLA 3TWQA 2JABA 2BKKB 5ENTD 5ENRD 2HE0A 1N0RA 4ZFHA 1IXVA 2DVWA 5CBNA 5CERB 2L6BA 4U96D 2ETBA 2ETAA 2F37A 2DZOA 4LSZE 2KBXA 2XEEA 4N5QA 2DWZA 4K5AB 5FIOA 5KWDA 5EILA 5HRYA 3NOCD 4HB5A 4HQDA 4HI8A 3TWSA 2KXPC 4G8LA 3UTMA 5CEAA 4CYMD 4GMRA 5HS0A 3T8KA 2NYJA 1YMPA 4JB8P 2RFAA 3J5PA 2B0OE 2QC9A 3SO8A 3ZUVB 4DX7D 3NBNB 5CECB 3JXIA 1UOHA 4CZ2D 4QQIA 4G8KA 4RLYA 3ZKJA 5JA4D 3V79K 1N0QA 5ENSD 5CEDB 1BI8B 3B95A 1IKND 4LG6A 4O1PA 1SVXA 1BD8A 4O1OA 1K1BA 3EHRA 4O60A 4A63B 1MYOA 3HG0D 4DX2A 1MX6A 4HNAD 1WG0A 2VGEA 5EN5D 5BXOA 3ZNGA 3V30A 1OT8A 1TR4A 1BI7B 1G3NB 1MJ0A 5ENPD 3TWWA 1SW6A 3D9HA 1AP7A 4DRXE 5ITZF 5KNHD 5HKPA 5AARA 3LJNA 1K1AA 4U8YD 3AJIA 5D66A 4HLLA 3AAAC 4GPMA 5AQ9A 4ZHBA 1DCQA 5AN8A 5KBAA 4YDWA 5EYPF 4C48B 2ZGGA 1BLXB 5JMND 3NOGD 1IHBA 1QYMA 3F6QA 4LNUD 3DEPA 4QFVA 1YCSB 4J8YA 4BSZB 2BKGA 3TWRA 4BETA 1S70B 5AAOA 1BU9A 5KNGA 3TWVA 2XZDG 3V31A 3J5QB 5ENQD 4TUMA 1K3ZD 4BEPA 4DX1A 1A5EA 3Q9NC 2J8SD 4HRNA 3V2OA 3W9FA 4K5CA 3W9GA 4HBDA 2FO1E 5FINA 4BERA
chains in the Genus database with same CATH superfamily
2WVIA 3ENEA 1UJJA 3CVQA 4KBQA 4CDMA 5AJLA 5D2MC 1NA3A 4MS6A 3RRNB 3CKBA 1NFIE 2JEKA 4F1SA 4F1PA 3HRAA 2PNNA 1FT1A 1HG5A 1D9SA 3ZFWA 4J8DA 4BTAA 4DX5D 3UIOC 2AXUA 3LJ3A 4CGWA 2J49A 5ENTD 1N0RA 4GTTA 4G25A 5CERB 5J90A 5EILA 1KZOA 2YHCA 3ZHEA 4HQDA 3UTMA 1JWGA 3T5XA 4KVMA 3LY7A 3AU5A 2H6HA 3DSWA 4ACLA 3L16A 3DSTA 3EHMA 4BT8A 2XQ0A 2V8SE 3WG7E 4L7TA 2OCCE 1TN7A 2CHWA 1X81A 1OWOA 5HKPA 1TNOA 4TUUA 4Q96A 5CHEE 2XGMA 3DXMG 2ZXWE 3FTVA 1Y8MA 4YVOA 4WWOA 5KJMA 4BETA 3PNLB 5T4YA 2XZDG 2AW6A 5ENQD 3UQ3A 1ZBPA 1V55E 3AS8A 3FEYA 4UQYA 4BERA 3B7UX 5JJTA 3TG5A 2QY7A 2WXMA 1KT0A 2CG3A 2QYJA 3FHEA 2ZU6B 1TNUA 2UY1B 2DCPA 3CLJA 1HXIA 4GYYA 4BESA 3CR3A 5KCMA 2KCKA 3FH5A 2ETCA 2F8YA 4N3BA 4ACKA 1LF8A 4GYWA 3UUXA 4I2WA 1Z5SC 1X5BA 1HG2A 3IKOB 2J09A 5FIOA 1TNYA 2DBAA 4FP7A 4FHJA 4CYMD 3ML8A 2NYJA 3SY2A 2QC9A 4A1GA 4CRWA 1UOHA 3Q47B 3RO3A 5BUZA 4YNDA 4EHMA 3CKCA 4LG6A 4O1OA 3G2WA 4O60A 1O1TA 4A63B 1JCRA 5B1BE 3SGHA 1QNFA 3LJNA 2FBNA 4I1AA 3ULEG 3I3NA 2R02A 2LSUA 2P9PG 3UINC 2VGXB 2OEVA 4I1OB 5G04C 1OXJA 3L08A 4J8YA 2AXZA 4TXRA 2IJGX 1OCCE 1A17A 2HO1A 3V2OA 3LVQE 3SNXA 4HBDA 2L9BA 4L1BA 3PZ2A 2X6FA 2P2CP 4MBGA 4AXHA 4XI9A 2P9SG 2ZGDA 3TXNA 2OVFA 3V2XA 4UWKA 3EDTB 3C98A 1S64A 2CFUA 2DZNA 4DK5A 1H2VC 1FVHA 3TAXA 3APFA 3IHVA 2DVWA 2XGSA 3P1UA 3CSFA 3FWVA 5CRUA 3PEVB 2V4LA 3I4GA 1TNBA 2Y4TA 4DX7D 4GPKA 3NBNB 2EIKE 4G8KA 4RLYA 5CEDB 2Y69E 1H2TC 2GGFA 5FZRA 2Y3AA 3CSTA 5B3SE 3KAEA 3UT8A 3UMVA 4URKA 4HS2A 2BF0X 5ENPD 2EILE 3FULA 2WXJA 4TXQA 4FJZA 4ILHB 4GTMA 4C48B 2AXVA 1Z3XA 1MHQA 3KD7A 3UPVA 3FUFA 3GZ2A 5ANLA 3C3RA 1UJKA 5KJKA 3CK8A 1O5MA 4KZ0A 3C3QA 2IEJA 3DWLG 1PY1A 3QDNA 1UN8A 4G2VA 4DLOA 4HFGA 3ZRHA 2KZTA 1SQMA 3I5PA 3SQVA 2FO7A 4O6FA 4M7CA 3FUDA 4OAUC 4ATZD 4ILGA 5AQAA 3CHOA 1N11A 4B8CB 5LOZA 4DLQA 3JXJA 3BUAA 2WXKA 1OCRE 1E7VA 4ZFHA 1IXVA 2I9CA 5KWDA 4GMRA 3ZUVB 1OWPA 4CZ2D 2X6HA 4FLBA 5T8IA 3NAWA 2E0IA 3EHRA 5CRVA 1MX6A 3R9MA 4GAAA 4EPZA 4F7AA 1S63A 1E7UA 3Q49B 4N2SA 3FTXA 5FQ7A 3CVPA 2AVPA 3ZYLA 4N2QA 4WUYA 3TWRA 1BU9A 4WNDA 5DIZA 1N54A 4IYPA 1KT1A 2MOWA 2VTBB 5FQ6A 3B7BA 5IY5E 4AP2A 2I1KA 2CFZA 3Q4AB 3KS2A 5EDSA 3GZ1A 3AS4A 4WWNA 2ONDA 4U8VD 2IF4A 3CHSA 3NF1A 1UG3A 4Z68A 3UM0A 2FO1E 5BPPA 2L6BA 2ETBA 5C2YA 3LXUX 4GCOA 5HRYA 2WQ6A 4Q69A 4HI8A 1N95A 3JUIA 2RG8A 4J0UA 4ME2A 1YMPA 2A5UA 2LAHA 2B0OE 4ANUA 2FEZA 3SHFA 4JHJA 3OTNA 3S7DA 4G1TA 4TV3A 4DX2A 4WWPA 1E8XA 4EQFA 4B8AA 2C0LA 4HVBA 5AARA 3Q7FA 5FZQA 4YDWA 2IONA 4KYOB 2ZGGA 3QJZA 3F6QA 3HXDA 2WXLA 3PREA 4D10C 4BSZB 3G2UA 3TWVA 3FH8A 1PAQA 3E30A 2WXIA 4I9EA 3FUKA 3ZYKA 2EQXA 2CHZA 1EF1C 3ASDA 3VLDA 2V4HC 1DC2A 4N39A 3AU4A 4B0ZA 1WDYA 4I1MA 1E96B 3TWTA 4NIKA 4I9CA 3D9NA 1Z6TA 3SFYA 3R7QA 4ATGA 2PQRA 5KJLA 4N3CA 4I6GA 2UWJG 4AEZC 3LY9A 1MX2A 4I6EA 4BT9A 2A4ZA 1Y6IA 3EIQC 2LAIA 3ZW3A 4EZJA 2HE0A 3TL5A 1H2UA 3GZSA 4GA1A 4LSZE 4HXIA 4LRZA 3G2TA 1IHGA 5CEAA 3L13A 2KCLA 4FC8A 4UWFA 4GTSA 4EBAG 1QQEA 3ZEFA 3JQ0A 4XZ4A 2J08A 4R7LA 4WNEA 5AQ9A 4ZHBA 4N3AA 4K0RA 2PQNA 1E8ZA 2KATA 3AG4E 3MCXA 1SA4A 2Y4UA 4NRHB 3CHPA 4U0ZA 3FUEA 3BG1B 2BKGA 1S70B 1W3BA 3V31A 3J5QB 3HIZA 2DYSE 4OYSA 4FADA 3B7RL 1O1SA 3W9FA 4L23A 4LEUA 1JCSA 3TWXA 4HORA 2RFMA 3EU9A 4DJAA 3NB2A 3S2AA 3D9LA 4AVXA 1H6KA 3FUIA 3ZU7B 2WMOA 3S7FA 3C72A 1HS6A 2VSYA 4GZ6A 2X38A 4E85A 1ELRA 2YNQA 3HXEA 1BPOA 3LYAA 4HRLA 3DEOA 2R5SA 2XGOA 3D9MA 4RSYA 2GRRB 2JABA 3AG1E 1NI1A 2VYIA 2E2EA 5ANRA 2GRLA 5HS0A 4JB8P 2MRIA 3URZA 3IBEA 5LCWC 3MZLB 3L82A 1KPSB 3BEEA 3OXGA 5EN5D 4JA9A 1UN9A 5E75A 1BI7B 4ANXA 1N4PA 1H19A 1DCQA 3ONLA 1WAO1 1OCOE 4JVSA 4UWLA 1BLXB 3CVXA 1LTXA 3ZPJA 3MEKA 3C3OA 4BWRA 2XRYA 3MJWA 4J8EA 3BG0B 1A5EA 5H7PA 4IULA 3PE4A 4DPRA 2R03A 1YYHA 2L6JA 3MA5A 4FU3A 4GU5A 3UM2A 2VSOE 3CHRA 3CV0A 1JPLA 2EIJE 3ZXPA 5ENNA 3ASNE 4AY6A 4J8FA 4U7EB 3FUMA 5FQ4A 4XKBA 1HX8A 4JXTA 4KT6B 3TXMA 3ABLE 3CK9A 2FULA 1TJFA 5ENRD 3Q15A 4JL0A 5G05J 3KSQA 4ABNA 3D9PA 1TYQG 2P9LG 4YDOA 3J5PA 3LS8A 3OXFA 2XPZA 4AY5A 2OV8A 2XPYA 5ENSD 3B95A 2IU1A 3NZUA 5DBKA 3FH7A 1K1BA 3ONKA 1MYOA 3HG0D 4NACA 1OCZE 4JW1A 4LUNU 3CVUA 1N9AA 2LO6A 3L6AA 5LX8A 5G05C 2WB2A 4BX8A 3N71A 5AN8A 3RK6A 3EU5A 4JD2G 4L2YA 1SZ9A 3X2QE 3FDHA 4X8QA 1YCSB 4CCAA 1PC2A 4CDRA 2IOSA 3SF4A 4AM9A 3ZN3A 4HOSA 3W9GA 4A3VA 2WQHA 3MKRA 3LPZA 2KM4A 5ARGA 5JJ7A 3S7JA 2I6HA 1EYHA 3Q9UC 2XENA 4MRUA 4FHKA 2IO3C 3LDZA 3EHQA 5BNWA 3AG3E 2I2OA 3RAUA 2LSVA 4HRMB 2NSZA 2XPIA 4XKCA 4UI9K 4CDNA 5EIBE 3LKUA 2V5FA 4OVVA 4F53A 5E76A 1NL4A 3UT7A 2R17C 3QARA 5FWQA 3DSUA 1FVFA 4LNGA 3TWSA 4U07A 2KXPC 4H7YA 4F3VA 1TEZA 3SO8A 1OWMA 4PS3A 1U2VG 4I17A 2PL2A 3V79K 3SD5A 1N0QA 1RW2A 1B89A 4BTBA 1IKND 2NXPA 5AJDA 3E33A 4W9RA 2LUHA 4Q94A 1JUQA 4XE0A 4A55A 3D9KA 4GTRA 4JHRA 4HLLA 1U3CA 4B94A 1N4QA 3QK0A 4PH4B 3EHNA 3DSXA 1N94A 2X6JA 3RRMB 3Q73A 2P58C 2VGYA 2WXOA 3AS5A 3ZYMA 3RIBA 4N5CA 2J07A 5A7DB 4K03A 4GMLA 1FT2A 4U8HA 4U0UA 3PZ4A 2RD0A 1N52A 3SBSA 4K5BA 3ABKE 2VSXE 3C5RA 2WXRA 1WM5A 5AENA 5D0QD 2AJAA 4HOQA 3RJVA 1ZU2A 1ELKA 4CT0A 3CVLA 3WXXA 2BTDA 4XIFA 1S0PA 3ESKA 1OY3D 1ELWA 3T5VA 1INZA 2XCBA 5BV1A 5G04J 3KSLA 3RO2A 1HF8A 3FUJA 2F37A 4HOTA 2C0MA 2DZOA 4N5QA 2XEEA 3B13A 4AIFA 1LD7A 3UIPC 3QNKA 4KMOA 2LXLA 3DPDA 3BQOA 4DI3A 3CIAA 3R9AB 3FFLA 5CECB 3VTYA 3JXIA 4E6HA 2F8XK 3BU8A 5JA4D 1OUVA 4KVOA 3PRZA 1FCHA 3L22A 3APCA 4YVQC 1IYGA 2XRZA 1GW6A 1FPPA 2LXMA 3B7SA 1MJ0A 3TWWA 3U4TA 3D9HA 3AJIA 4RG6A 3CVYA 4WNGA 2GRQB 2VQ2A 2WQ7A 5LCWJ 2X6KA 5FZSA 4AV7A 4UI9J 3E4BA 4BEPA 2J8SD 2PM6A 4G11A 4XI0A 3IEGA 2X6IA 3QKYA 4ANVA 5B1AE 5BT1A 3ZXSA 3B7TA 2OOEA 3UM1A 2IQCA 3ASFA 3IV0A 2KC7A 5ENOD 2MYOA 4UWGA 4DUIA 4ILIA 3E32A 3IXEA 1QBQA 2R59A 2WXHA 4JPSA 3LEWA 2XZTG 1AWCB 3G2VA 5A6CA 4I2ZA 5EYLA 2BKKB 2EIME 1LD8A 4WNFA 4CT4A 2DWZA 2WXGA 3LVRE 4K5AB 2XHEA 4G26A 2P9UG 2P9KG 3GYZA 3D3MA 5AYWD 1MQSA 3MKQA 2FI7A 5FTPA 4C0EA 2C2LA 4EZKA 3PUJA 1E8WA 4WAFA 3Q78A 4O1PA 1SVXA 2YINA 3LY8A 1JWFA 4JC8A 2HYZA 1H6OA 3EUVA 2L0TB 4FULA 3FTUA 3ML9A 2L0IA 5KNHD 1NA0A 2YQ8A 3RSEG 5KBAA 3TGOA 1HZ4A 3HVEA 2IO2C 3PH0C 3NOGD 3QWWA 4JA7A 1XNFA 2I1JA 3FUHA 3UM3A 5KJNA 4GTPA 3HVEB 1K3ZD 3FU0A 3ULYA 5FJYA 4HRNA 4J8SA 3UI2A 3UXGA 1HO8A 4DX6D 2QYUA 5FT9A 4OAVB 2P9NG 2Y1LE 3SZ7A 1D8DA 3U64A 2DIWA 3Q75A 5CCMA 2MHKA 2H6IA 4JEHA 3PZ3A 2V5QC 4GTQA 2PM7A 4F6RD 3L17A 5EX0A 3FU5A 2OVBA 2WXQA 4U96D 3CQGB 4GMJA 3L9TA 3NOCD 1EDUA 4G8LA 4Y6WA 3FTZA 3PVLA 3GW4A 3FUNA 5LP0A 2WXFA 4GB9A 3ZKJA 1BD8A 4PUCA 5D0OD 4TXPA 2J4BA 3QOUA 4GTOA 3O4ZA 3V30A 4EBAA 1G3NB 1TN6A 4U8YD 4UQXA 1JCQA 5M72A 1N4SA 3ASOE 2KCVA 1QYMA 1QZ2A 5J08A 5JHBA 1DCEA 3K9IA 4FLHA 1HH8A 3U3WA 3L54A 1HE8A 3Q9NC 3U9WA 4OVUA 2ZIRA 5HI7A 3PZDA 4EECA 3HDXA 5AQ7A 5CMYA 3QB2A 2A5EA 4BY6A 3KEAA 3CHQA 4BFRA 4CEMA 3TWUA 2GROB 1L5JA 3PZ1A 4PS8A 4NQ0A 1OWLA 4Y6CA 4JEUA 3D9IA 4FA6A 4BX9A 5JJ6A 3FTWA 4J7WA 2V0PA 2X3MA 2WXPA 2BEDA 2ETAA 4PDXA 4L9PA 2KBXA 2IFUA 2B6CA 3DXKG 3NQPA 3P2BA 3QWPA 4IN3B 4U04A 3T8KA 2CG2A 3MKQB 5BV0A 4GZCA 2OEWA 3SI5A 4LNBA 1BI8B 3QWVA 1E8YA 5ARFA 1NP7A 2IY0C 3UKUG 4H7XA 1WG0A 2VGEA 3O48A 4RQIA 3ZGQA 3D9OA 5BXOA 3PUKA 1OT8A 1TR4A 1K8KG 1O1RA 4GCNA 1YA0A 4GZ5A 4DRXE 3RKVA 1K1AA 1ZB1A 4XEIG 2KZTB 3ZYQA 3Q5MA 3FEXA 5EYPF 1IQUA 3IHYA 1RZ4A 3ISMC 4TRQA 5FQ8A 3JQ1A 2R05A 1OWNA 4TUMA 4XX5A 3RRUA 3ZVVA 3HXCA 4DX1A 4RVBA 3CHMA 3CVVA 3HXFA 1XGWA 3CQCB 5JHAA 2EINE 4ANWA 5CBOA 3HHMA 3DRAA 4YDYA 4U95D 5AIJA 2J4DA 5BW8C 2GW1A 4AJWA 2XS8A 2R2LA 5G55A 4B93B 2JLBA 5EIDA 3JUEA 3SFZA 4JHKA 1UW4B 2VJ8A 5BXUA 3Q7AA 1WY6A 1SZAA 4UUCA 4CGVA 3FTSA 2XEHA 4I43A 2WM9A 4MLPA 3TWQA 2RKKA 3MX3A 4A3TA 3I4RB 1HFAA 2PZIA 5A23A 3HYMB 3JYSA 3OXLA 5EKQD 3ZIMA 1DVPA 3VLFA 3MV3B 3E37A 4QQIA 2P9IG 1TN8A 3S7BA 3FP3A 4GYOA 4U0SA 1U3DA 4HNAD 1H6PA 1N4RA 3ZNGA 4AOFA 3EIJA 1SA5A 5D66A 2WMNA 2J9QA 3TG4A 4IRUA 5JMND 4P29A 1IHBA 5HQ8A 5EX3A 1IQRA 3E34A 2F0YA 2XEVA 3SBTB 3DEPA 3FY4A 3ABME 3ZHEB 2FF4A 3DSVA 3MV2B 2XS1A 3EJNA 4G24A 1E90A 4HOUA 4BSXA 2DYRE 3VTXA 4GTVA 2H6FA 3DBSA 2YHEA 4NURA 4UQZA 3TJPA 4GZDA 1H0AA 2HR2A 3T8MA 2IOLA 2CHXA 4PS7A 3JCKC 2HM8A 5LFAA 4U63A 3T9KA 5CCLA 3PNTB 3CK7A 4JZYA 5CBNA 2VSNA 4B89A 2NC9A 4J6IA 1VDYA 5G2NA 1V54E 3SFXA 2UY1A 1Z3YA 2AWIA 4C0MA 4MKTA 1TNZA 3ASGA 2GRPB 1AP7A 1SW6A 5ITZF 3AAAC 2QFCA 3MYVA 3APDA 3HXBA 4APOA 1KZPA 2WPVA 1HU3A 3CGHA 3MGBA 4LNUD 4QFVA 5AAOA 5KNGA 4L2LA 3FU6A 2XCCA 4LERA 4LCTA 4YDEA 4G23A 3ASHA 3QC1A 4GA0A 2QZAA 3FU3A 4V3IA 1D8EA 3QAQA 2VGXA 3DSSA 4C9BB 3U66A 4I6JA 3OAWA 3ESLA 4GA2A 3UT4A 3KEZA 2GRMA 3NZSA 4HI9A 1MX4A 3DPYA 5AQBA 2Y0BG 2WXNA 5T3RA 4FJYA 3PS6A 4GZ3A 3RU0A 3PE3A 2ZISA 3VLEA 4EZLA 3CVWA 1EPUA 3ULQA 2ILRA 4M3OA 4KZCA 4HB5A 3UX4A 2GRNB 3CEQA 3FTYA 2RFAA 5CMWA 4RG9A 3G2SA 3PEUB 1NZNA 4HLEA 1TJCA 1KLXA 2Q7FA 4APFA 4UWHA 2BUGA 3UKRG 4GPMA 4DI4A 2H6GA 3Q79A 4A1SA 2VTBA 1P5QA 1MZCA 5C1DA 4KXKB 1Q2ZA 2LNIA 3CVNA 2M63A 3R7RA 3PDNA 3D9JA 1DNPA 3LCAA 3AG2E 4UI9C 4K5CA 5FINA
chains in the Genus database with same CATH topology
3B7BA 1YYHA 3TWXA 3UI2A 2RFMA 2V4HC 3UXGA 1DC2A 5AQ7A 5CBOA 3EU9A 2P2CP 4K5BA 3Q9UC 4DX6D 4YDYA 1WDYA 3C5RA 2F8XK 4U95D 2XENA 2A5EA 4OAVB 3TWTA 4NIKA 3KEAA 2QYJA 3ZU7B 4OAUC 2AJAA 2ZGDA 2MYOA 2Y1LE 5ENOD 3TWUA 1NFIE 3V2XA 3EHQA 4DUIA 4B93B 3IXEA 4ATZD 4F1PA 3HRAA 2PNNA 5EIDA 3JUEA 4HRMB 5AQAA 4HI9A 1D9SA 1MX4A 4BESA 4U8VD 5AQBA 1N11A 2Y0BG 3DEOA 4HRLA 2ETCA 2V5QC 1MX2A 1OY3D 5BXUA 5EIBE 2F8YA 3JXJA 2DZNA 2XZTG 4UUCA 4DX5D 1AWCB 2XEHA 4J7WA 4F6RD 4Z68A 3T9KA 5EYLA 3TWQA 2JABA 2BKKB 5ENTD 5ENRD 2HE0A 1N0RA 4ZFHA 1IXVA 2DVWA 5CBNA 5CERB 2L6BA 4U96D 2ETBA 2ETAA 2F37A 2DZOA 4LSZE 2KBXA 2XEEA 4N5QA 2DWZA 4K5AB 5FIOA 5KWDA 5EILA 5HRYA 3NOCD 4HB5A 4HQDA 4HI8A 3TWSA 2KXPC 4G8LA 3UTMA 5CEAA 4CYMD 4GMRA 5HS0A 3T8KA 2NYJA 1YMPA 4JB8P 2RFAA 3J5PA 2B0OE 2QC9A 3SO8A 3ZUVB 4DX7D 3NBNB 5CECB 3JXIA 1UOHA 4CZ2D 4QQIA 4G8KA 4RLYA 3ZKJA 5JA4D 3V79K 1N0QA 5ENSD 5CEDB 1BI8B 3B95A 1IKND 4LG6A 4O1PA 1SVXA 1BD8A 4O1OA 1K1BA 3EHRA 4O60A 4A63B 1MYOA 3HG0D 4DX2A 1MX6A 4HNAD 1WG0A 2VGEA 5EN5D 5BXOA 3ZNGA 3V30A 1OT8A 1TR4A 1BI7B 1G3NB 1MJ0A 5ENPD 3TWWA 1SW6A 3D9HA 1AP7A 4DRXE 5ITZF 5KNHD 5HKPA 5AARA 3LJNA 1K1AA 4U8YD 3AJIA 5D66A 4HLLA 3AAAC 4GPMA 5AQ9A 4ZHBA 1DCQA 5AN8A 5KBAA 4YDWA 5EYPF 4C48B 2ZGGA 1BLXB 5JMND 3NOGD 1IHBA 1QYMA 3F6QA 4LNUD 3DEPA 4QFVA 1YCSB 4J8YA 4BSZB 2BKGA 3TWRA 4BETA 1S70B 5AAOA 1BU9A 5KNGA 3TWVA 2XZDG 3V31A 3J5QB 5ENQD 4TUMA 1K3ZD 4BEPA 4DX1A 1A5EA 3Q9NC 2J8SD 4HRNA 3V2OA 3W9FA 4K5CA 3W9GA 4HBDA 2FO1E 5FINA 4BERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B7B A;  1YYH A;  3TWX A;  3UI2 A;  2RFM A;  2V4H C;  3UXG A;  1DC2 A;  5AQ7 A;  5CBO A;  3EU9 A;  2P2C P;  4K5B A;  3Q9U C;  4DX6 D;  4YDY A;  1WDY A;  3C5R A;  2F8X K;  4U95 D;  2XEN A;  2A5E A;  4OAV B;  3TWT A;  4NIK A;  3KEA A;  2QYJ A;  3ZU7 B;  4OAU C;  2AJA A;  2ZGD A;  2MYO A;  2Y1L E;  5ENO D;  3TWU A;  1NFI E;  3V2X A;  3EHQ A;  4DUI A;  4B93 B;  3IXE A;  4ATZ D;  4F1P A;  3HRA A;  2PNN A;  5EID A;  3JUE A;  4HRM B;  5AQA A;  4HI9 A;  1D9S A;  1MX4 A;  4BES A;  4U8V D;  5AQB A;  1N11 A;  2Y0B G;  3DEO A;  4HRL A;  2ETC A;  2V5Q C;  1MX2 A;  1OY3 D;  5BXU A;  5EIB E;  2F8Y A;  3JXJ A;  2DZN A;  2XZT G;  4UUC A;  4DX5 D;  1AWC B;  2XEH A;  4J7W A;  4F6R D;  4Z68 A;  3T9K A;  5EYL A;  3TWQ A;  2JAB A;  2BKK B;  5ENT D;  5ENR D;  2HE0 A;  1N0R A;  4ZFH A;  1IXV A;  2DVW A;  5CBN A;  5CER B;  2L6B A;  4U96 D;  2ETB A;  2ETA A;  2F37 A;  2DZO A;  4LSZ E;  2KBX A;  2XEE A;  4N5Q A;  2DWZ A;  4K5A B;  5FIO A;  5KWD A;  5EIL A;  5HRY A;  3NOC D;  4HB5 A;  4HQD A;  4HI8 A;  3TWS A;  2KXP C;  4G8L A;  3UTM A;  5CEA A;  4CYM D;  4GMR A;  5HS0 A;  3T8K A;  2NYJ A;  1YMP A;  4JB8 P;  2RFA A;  3J5P A;  2B0O E;  2QC9 A;  3SO8 A;  3ZUV B;  4DX7 D;  3NBN B;  5CEC B;  3JXI A;  1UOH A;  4CZ2 D;  4QQI A;  4G8K A;  4RLY A;  3ZKJ A;  5JA4 D;  3V79 K;  1N0Q A;  5ENS D;  5CED B;  1BI8 B;  3B95 A;  1IKN D;  4LG6 A;  4O1P A;  1SVX A;  1BD8 A;  4O1O A;  1K1B A;  3EHR A;  4O60 A;  4A63 B;  1MYO A;  3HG0 D;  4DX2 A;  1MX6 A;  4HNA D;  1WG0 A;  2VGE A;  5EN5 D;  5BXO A;  3ZNG A;  3V30 A;  1OT8 A;  1TR4 A;  1BI7 B;  1G3N B;  1MJ0 A;  5ENP D;  3TWW A;  1SW6 A;  3D9H A;  1AP7 A;  4DRX E;  5ITZ F;  5KNH D;  5HKP A;  5AAR A;  3LJN A;  1K1A A;  4U8Y D;  3AJI A;  5D66 A;  4HLL A;  3AAA C;  4GPM A;  5AQ9 A;  4ZHB A;  1DCQ A;  5AN8 A;  5KBA A;  4YDW A;  5EYP F;  4C48 B;  2ZGG A;  1BLX B;  5JMN D;  3NOG D;  1IHB A;  1QYM A;  3F6Q A;  4LNU D;  3DEP A;  4QFV A;  1YCS B;  4J8Y A;  4BSZ B;  2BKG A;  3TWR A;  4BET A;  1S70 B;  5AAO A;  1BU9 A;  5KNG A;  3TWV A;  2XZD G;  3V31 A;  3J5Q B;  5ENQ D;  4TUM A;  1K3Z D;  4BEP A;  4DX1 A;  1A5E A;  3Q9N C;  2J8S D;  4HRN A;  3V2O A;  3W9F A;  4K5C A;  3W9G A;  4HBD A;  2FO1 E;  5FIN A;  4BER A; 
#chains in the Genus database with same CATH topology
 2WVI A;  3ENE A;  1UJJ A;  3CVQ A;  4KBQ A;  4CDM A;  5AJL A;  5D2M C;  1NA3 A;  4MS6 A;  3RRN B;  3CKB A;  1NFI E;  2JEK A;  4F1S A;  4F1P A;  3HRA A;  2PNN A;  1FT1 A;  1HG5 A;  1D9S A;  3ZFW A;  4J8D A;  4BTA A;  4DX5 D;  3UIO C;  2AXU A;  3LJ3 A;  4CGW A;  2J49 A;  5ENT D;  1N0R A;  4GTT A;  4G25 A;  5CER B;  5J90 A;  5EIL A;  1KZO A;  2YHC A;  3ZHE A;  4HQD A;  3UTM A;  1JWG A;  3T5X A;  4KVM A;  3LY7 A;  3AU5 A;  2H6H A;  3DSW A;  4ACL A;  3L16 A;  3DST A;  3EHM A;  4BT8 A;  2XQ0 A;  2V8S E;  3WG7 E;  4L7T A;  2OCC E;  1TN7 A;  2CHW A;  1X81 A;  1OWO A;  5HKP A;  1TNO A;  4TUU A;  4Q96 A;  5CHE E;  2XGM A;  3DXM G;  2ZXW E;  3FTV A;  1Y8M A;  4YVO A;  4WWO A;  5KJM A;  4BET A;  3PNL B;  5T4Y A;  2XZD G;  2AW6 A;  5ENQ D;  3UQ3 A;  1ZBP A;  1V55 E;  3AS8 A;  3FEY A;  4UQY A;  4BER A;  3B7U X;  5JJT A;  3TG5 A;  2QY7 A;  2WXM A;  1KT0 A;  2CG3 A;  2QYJ A;  3FHE A;  2ZU6 B;  1TNU A;  2UY1 B;  2DCP A;  3CLJ A;  1HXI A;  4GYY A;  4BES A;  3CR3 A;  5KCM A;  2KCK A;  3FH5 A;  2ETC A;  2F8Y A;  4N3B A;  4ACK A;  1LF8 A;  4GYW A;  3UUX A;  4I2W A;  1Z5S C;  1X5B A;  1HG2 A;  3IKO B;  2J09 A;  5FIO A;  1TNY A;  2DBA A;  4FP7 A;  4FHJ A;  4CYM D;  3ML8 A;  2NYJ A;  3SY2 A;  2QC9 A;  4A1G A;  4CRW A;  1UOH A;  3Q47 B;  3RO3 A;  5BUZ A;  4YND A;  4EHM A;  3CKC A;  4LG6 A;  4O1O A;  3G2W A;  4O60 A;  1O1T A;  4A63 B;  1JCR A;  5B1B E;  3SGH A;  1QNF A;  3LJN A;  2FBN A;  4I1A A;  3ULE G;  3I3N A;  2R02 A;  2LSU A;  2P9P G;  3UIN C;  2VGX B;  2OEV A;  4I1O B;  5G04 C;  1OXJ A;  3L08 A;  4J8Y A;  2AXZ A;  4TXR A;  2IJG X;  1OCC E;  1A17 A;  2HO1 A;  3V2O A;  3LVQ E;  3SNX A;  4HBD A;  2L9B A;  4L1B A;  3PZ2 A;  2X6F A;  2P2C P;  4MBG A;  4AXH A;  4XI9 A;  2P9S G;  2ZGD A;  3TXN A;  2OVF A;  3V2X A;  4UWK A;  3EDT B;  3C98 A;  1S64 A;  2CFU A;  2DZN A;  4DK5 A;  1H2V C;  1FVH A;  3TAX A;  3APF A;  3IHV A;  2DVW A;  2XGS A;  3P1U A;  3CSF A;  3FWV A;  5CRU A;  3PEV B;  2V4L A;  3I4G A;  1TNB A;  2Y4T A;  4DX7 D;  4GPK A;  3NBN B;  2EIK E;  4G8K A;  4RLY A;  5CED B;  2Y69 E;  1H2T C;  2GGF A;  5FZR A;  2Y3A A;  3CST A;  5B3S E;  3KAE A;  3UT8 A;  3UMV A;  4URK A;  4HS2 A;  2BF0 X;  5ENP D;  2EIL E;  3FUL A;  2WXJ A;  4TXQ A;  4FJZ A;  4ILH B;  4GTM A;  4C48 B;  2AXV A;  1Z3X A;  1MHQ A;  3KD7 A;  3UPV A;  3FUF A;  3GZ2 A;  5ANL A;  3C3R A;  1UJK A;  5KJK A;  3CK8 A;  1O5M A;  4KZ0 A;  3C3Q A;  2IEJ A;  3DWL G;  1PY1 A;  3QDN A;  1UN8 A;  4G2V A;  4DLO A;  4HFG A;  3ZRH A;  2KZT A;  1SQM A;  3I5P A;  3SQV A;  2FO7 A;  4O6F A;  4M7C A;  3FUD A;  4OAU C;  4ATZ D;  4ILG A;  5AQA A;  3CHO A;  1N11 A;  4B8C B;  5LOZ A;  4DLQ A;  3JXJ A;  3BUA A;  2WXK A;  1OCR E;  1E7V A;  4ZFH A;  1IXV A;  2I9C A;  5KWD A;  4GMR A;  3ZUV B;  1OWP A;  4CZ2 D;  2X6H A;  4FLB A;  5T8I A;  3NAW A;  2E0I A;  3EHR A;  5CRV A;  1MX6 A;  3R9M A;  4GAA A;  4EPZ A;  4F7A A;  1S63 A;  1E7U A;  3Q49 B;  4N2S A;  3FTX A;  5FQ7 A;  3CVP A;  2AVP A;  3ZYL A;  4N2Q A;  4WUY A;  3TWR A;  1BU9 A;  4WND A;  5DIZ A;  1N54 A;  4IYP A;  1KT1 A;  2MOW A;  2VTB B;  5FQ6 A;  3B7B A;  5IY5 E;  4AP2 A;  2I1K A;  2CFZ A;  3Q4A B;  3KS2 A;  5EDS A;  3GZ1 A;  3AS4 A;  4WWN A;  2OND A;  4U8V D;  2IF4 A;  3CHS A;  3NF1 A;  1UG3 A;  4Z68 A;  3UM0 A;  2FO1 E;  5BPP A;  2L6B A;  2ETB A;  5C2Y A;  3LXU X;  4GCO A;  5HRY A;  2WQ6 A;  4Q69 A;  4HI8 A;  1N95 A;  3JUI A;  2RG8 A;  4J0U A;  4ME2 A;  1YMP A;  2A5U A;  2LAH A;  2B0O E;  4ANU A;  2FEZ A;  3SHF A;  4JHJ A;  3OTN A;  3S7D A;  4G1T A;  4TV3 A;  4DX2 A;  4WWP A;  1E8X A;  4EQF A;  4B8A A;  2C0L A;  4HVB A;  5AAR A;  3Q7F A;  5FZQ A;  4YDW A;  2ION A;  4KYO B;  2ZGG A;  3QJZ A;  3F6Q A;  3HXD A;  2WXL A;  3PRE A;  4D10 C;  4BSZ B;  3G2U A;  3TWV A;  3FH8 A;  1PAQ A;  3E30 A;  2WXI A;  4I9E A;  3FUK A;  3ZYK A;  2EQX A;  2CHZ A;  1EF1 C;  3ASD A;  3VLD A;  2V4H C;  1DC2 A;  4N39 A;  3AU4 A;  4B0Z A;  1WDY A;  4I1M A;  1E96 B;  3TWT A;  4NIK A;  4I9C A;  3D9N A;  1Z6T A;  3SFY A;  3R7Q A;  4ATG A;  2PQR A;  5KJL A;  4N3C A;  4I6G A;  2UWJ G;  4AEZ C;  3LY9 A;  1MX2 A;  4I6E A;  4BT9 A;  2A4Z A;  1Y6I A;  3EIQ C;  2LAI A;  3ZW3 A;  4EZJ A;  2HE0 A;  3TL5 A;  1H2U A;  3GZS A;  4GA1 A;  4LSZ E;  4HXI A;  4LRZ A;  3G2T A;  1IHG A;  5CEA A;  3L13 A;  2KCL A;  4FC8 A;  4UWF A;  4GTS A;  4EBA G;  1QQE A;  3ZEF A;  3JQ0 A;  4XZ4 A;  2J08 A;  4R7L A;  4WNE A;  5AQ9 A;  4ZHB A;  4N3A A;  4K0R A;  2PQN A;  1E8Z A;  2KAT A;  3AG4 E;  3MCX A;  1SA4 A;  2Y4U A;  4NRH B;  3CHP A;  4U0Z A;  3FUE A;  3BG1 B;  2BKG A;  1S70 B;  1W3B A;  3V31 A;  3J5Q B;  3HIZ A;  2DYS E;  4OYS A;  4FAD A;  3B7R L;  1O1S A;  3W9F A;  4L23 A;  4LEU A;  1JCS A;  3TWX A;  4HOR A;  2RFM A;  3EU9 A;  4DJA A;  3NB2 A;  3S2A A;  3D9L A;  4AVX A;  1H6K A;  3FUI A;  3ZU7 B;  2WMO A;  3S7F A;  3C72 A;  1HS6 A;  2VSY A;  4GZ6 A;  2X38 A;  4E85 A;  1ELR A;  2YNQ A;  3HXE A;  1BPO A;  3LYA A;  4HRL A;  3DEO A;  2R5S A;  2XGO A;  3D9M A;  4RSY A;  2GRR B;  2JAB A;  3AG1 E;  1NI1 A;  2VYI A;  2E2E A;  5ANR A;  2GRL A;  5HS0 A;  4JB8 P;  2MRI A;  3URZ A;  3IBE A;  5LCW C;  3MZL B;  3L82 A;  1KPS B;  3BEE A;  3OXG A;  5EN5 D;  4JA9 A;  1UN9 A;  5E75 A;  1BI7 B;  4ANX A;  1N4P A;  1H19 A;  1DCQ A;  3ONL A;  1WAO 1;  1OCO E;  4JVS A;  4UWL A;  1BLX B;  3CVX A;  1LTX A;  3ZPJ A;  3MEK A;  3C3O A;  4BWR A;  2XRY A;  3MJW A;  4J8E A;  3BG0 B;  1A5E A;  5H7P A;  4IUL A;  3PE4 A;  4DPR A;  2R03 A;  1YYH A;  2L6J A;  3MA5 A;  4FU3 A;  4GU5 A;  3UM2 A;  2VSO E;  3CHR A;  3CV0 A;  1JPL A;  2EIJ E;  3ZXP A;  5ENN A;  3ASN E;  4AY6 A;  4J8F A;  4U7E B;  3FUM A;  5FQ4 A;  4XKB A;  1HX8 A;  4JXT A;  4KT6 B;  3TXM A;  3ABL E;  3CK9 A;  2FUL A;  1TJF A;  5ENR D;  3Q15 A;  4JL0 A;  5G05 J;  3KSQ A;  4ABN A;  3D9P A;  1TYQ G;  2P9L G;  4YDO A;  3J5P A;  3LS8 A;  3OXF A;  2XPZ A;  4AY5 A;  2OV8 A;  2XPY A;  5ENS D;  3B95 A;  2IU1 A;  3NZU A;  5DBK A;  3FH7 A;  1K1B A;  3ONK A;  1MYO A;  3HG0 D;  4NAC A;  1OCZ E;  4JW1 A;  4LUN U;  3CVU A;  1N9A A;  2LO6 A;  3L6A A;  5LX8 A;  5G05 C;  2WB2 A;  4BX8 A;  3N71 A;  5AN8 A;  3RK6 A;  3EU5 A;  4JD2 G;  4L2Y A;  1SZ9 A;  3X2Q E;  3FDH A;  4X8Q A;  1YCS B;  4CCA A;  1PC2 A;  4CDR A;  2IOS A;  3SF4 A;  4AM9 A;  3ZN3 A;  4HOS A;  3W9G A;  4A3V A;  2WQH A;  3MKR A;  3LPZ A;  2KM4 A;  5ARG A;  5JJ7 A;  3S7J A;  2I6H A;  1EYH A;  3Q9U C;  2XEN A;  4MRU A;  4FHK A;  2IO3 C;  3LDZ A;  3EHQ A;  5BNW A;  3AG3 E;  2I2O A;  3RAU A;  2LSV A;  4HRM B;  2NSZ A;  2XPI A;  4XKC A;  4UI9 K;  4CDN A;  5EIB E;  3LKU A;  2V5F A;  4OVV A;  4F53 A;  5E76 A;  1NL4 A;  3UT7 A;  2R17 C;  3QAR A;  5FWQ A;  3DSU A;  1FVF A;  4LNG A;  3TWS A;  4U07 A;  2KXP C;  4H7Y A;  4F3V A;  1TEZ A;  3SO8 A;  1OWM A;  4PS3 A;  1U2V G;  4I17 A;  2PL2 A;  3V79 K;  3SD5 A;  1N0Q A;  1RW2 A;  1B89 A;  4BTB A;  1IKN D;  2NXP A;  5AJD A;  3E33 A;  4W9R A;  2LUH A;  4Q94 A;  1JUQ A;  4XE0 A;  4A55 A;  3D9K A;  4GTR A;  4JHR A;  4HLL A;  1U3C A;  4B94 A;  1N4Q A;  3QK0 A;  4PH4 B;  3EHN A;  3DSX A;  1N94 A;  2X6J A;  3RRM B;  3Q73 A;  2P58 C;  2VGY A;  2WXO A;  3AS5 A;  3ZYM A;  3RIB A;  4N5C A;  2J07 A;  5A7D B;  4K03 A;  4GML A;  1FT2 A;  4U8H A;  4U0U A;  3PZ4 A;  2RD0 A;  1N52 A;  3SBS A;  4K5B A;  3ABK E;  2VSX E;  3C5R A;  2WXR A;  1WM5 A;  5AEN A;  5D0Q D;  2AJA A;  4HOQ A;  3RJV A;  1ZU2 A;  1ELK A;  4CT0 A;  3CVL A;  3WXX A;  2BTD A;  4XIF A;  1S0P A;  3ESK A;  1OY3 D;  1ELW A;  3T5V A;  1INZ A;  2XCB A;  5BV1 A;  5G04 J;  3KSL A;  3RO2 A;  1HF8 A;  3FUJ A;  2F37 A;  4HOT A;  2C0M A;  2DZO A;  4N5Q A;  2XEE A;  3B13 A;  4AIF A;  1LD7 A;  3UIP C;  3QNK A;  4KMO A;  2LXL A;  3DPD A;  3BQO A;  4DI3 A;  3CIA A;  3R9A B;  3FFL A;  5CEC B;  3VTY A;  3JXI A;  4E6H A;  2F8X K;  3BU8 A;  5JA4 D;  1OUV A;  4KVO A;  3PRZ A;  1FCH A;  3L22 A;  3APC A;  4YVQ C;  1IYG A;  2XRZ A;  1GW6 A;  1FPP A;  2LXM A;  3B7S A;  1MJ0 A;  3TWW A;  3U4T A;  3D9H A;  3AJI A;  4RG6 A;  3CVY A;  4WNG A;  2GRQ B;  2VQ2 A;  2WQ7 A;  5LCW J;  2X6K A;  5FZS A;  4AV7 A;  4UI9 J;  3E4B A;  4BEP A;  2J8S D;  2PM6 A;  4G11 A;  4XI0 A;  3IEG A;  2X6I A;  3QKY A;  4ANV A;  5B1A E;  5BT1 A;  3ZXS A;  3B7T A;  2OOE A;  3UM1 A;  2IQC A;  3ASF A;  3IV0 A;  2KC7 A;  5ENO D;  2MYO A;  4UWG A;  4DUI A;  4ILI A;  3E32 A;  3IXE A;  1QBQ A;  2R59 A;  2WXH A;  4JPS A;  3LEW A;  2XZT G;  1AWC B;  3G2V A;  5A6C A;  4I2Z A;  5EYL A;  2BKK B;  2EIM E;  1LD8 A;  4WNF A;  4CT4 A;  2DWZ A;  2WXG A;  3LVR E;  4K5A B;  2XHE A;  4G26 A;  2P9U G;  2P9K G;  3GYZ A;  3D3M A;  5AYW D;  1MQS A;  3MKQ A;  2FI7 A;  5FTP A;  4C0E A;  2C2L A;  4EZK A;  3PUJ A;  1E8W A;  4WAF A;  3Q78 A;  4O1P A;  1SVX A;  2YIN A;  3LY8 A;  1JWF A;  4JC8 A;  2HYZ A;  1H6O A;  3EUV A;  2L0T B;  4FUL A;  3FTU A;  3ML9 A;  2L0I A;  5KNH D;  1NA0 A;  2YQ8 A;  3RSE G;  5KBA A;  3TGO A;  1HZ4 A;  3HVE A;  2IO2 C;  3PH0 C;  3NOG D;  3QWW A;  4JA7 A;  1XNF A;  2I1J A;  3FUH A;  3UM3 A;  5KJN A;  4GTP A;  3HVE B;  1K3Z D;  3FU0 A;  3ULY A;  5FJY A;  4HRN A;  4J8S A;  3UI2 A;  3UXG A;  1HO8 A;  4DX6 D;  2QYU A;  5FT9 A;  4OAV B;  2P9N G;  2Y1L E;  3SZ7 A;  1D8D A;  3U64 A;  2DIW A;  3Q75 A;  5CCM A;  2MHK A;  2H6I A;  4JEH A;  3PZ3 A;  2V5Q C;  4GTQ A;  2PM7 A;  4F6R D;  3L17 A;  5EX0 A;  3FU5 A;  2OVB A;  2WXQ A;  4U96 D;  3CQG B;  4GMJ A;  3L9T A;  3NOC D;  1EDU A;  4G8L A;  4Y6W A;  3FTZ A;  3PVL A;  3GW4 A;  3FUN A;  5LP0 A;  2WXF A;  4GB9 A;  3ZKJ A;  1BD8 A;  4PUC A;  5D0O D;  4TXP A;  2J4B A;  3QOU A;  4GTO A;  3O4Z A;  3V30 A;  4EBA A;  1G3N B;  1TN6 A;  4U8Y D;  4UQX A;  1JCQ A;  5M72 A;  1N4S A;  3ASO E;  2KCV A;  1QYM A;  1QZ2 A;  5J08 A;  5JHB A;  1DCE A;  3K9I A;  4FLH A;  1HH8 A;  3U3W A;  3L54 A;  1HE8 A;  3Q9N C;  3U9W A;  4OVU A;  2ZIR A;  5HI7 A;  3PZD A;  4EEC A;  3HDX A;  5AQ7 A;  5CMY A;  3QB2 A;  2A5E A;  4BY6 A;  3KEA A;  3CHQ A;  4BFR A;  4CEM A;  3TWU A;  2GRO B;  1L5J A;  3PZ1 A;  4PS8 A;  4NQ0 A;  1OWL A;  4Y6C A;  4JEU A;  3D9I A;  4FA6 A;  4BX9 A;  5JJ6 A;  3FTW A;  4J7W A;  2V0P A;  2X3M A;  2WXP A;  2BED A;  2ETA A;  4PDX A;  4L9P A;  2KBX A;  2IFU A;  2B6C A;  3DXK G;  3NQP A;  3P2B A;  3QWP A;  4IN3 B;  4U04 A;  3T8K A;  2CG2 A;  3MKQ B;  5BV0 A;  4GZC A;  2OEW A;  3SI5 A;  4LNB A;  1BI8 B;  3QWV A;  1E8Y A;  5ARF A;  1NP7 A;  2IY0 C;  3UKU G;  4H7X A;  1WG0 A;  2VGE A;  3O48 A;  4RQI A;  3ZGQ A;  3D9O A;  5BXO A;  3PUK A;  1OT8 A;  1TR4 A;  1K8K G;  1O1R A;  4GCN A;  1YA0 A;  4GZ5 A;  4DRX E;  3RKV A;  1K1A A;  1ZB1 A;  4XEI G;  2KZT B;  3ZYQ A;  3Q5M A;  3FEX A;  5EYP F;  1IQU A;  3IHY A;  1RZ4 A;  3ISM C;  4TRQ A;  5FQ8 A;  3JQ1 A;  2R05 A;  1OWN A;  4TUM A;  4XX5 A;  3RRU A;  3ZVV A;  3HXC A;  4DX1 A;  4RVB A;  3CHM A;  3CVV A;  3HXF A;  1XGW A;  3CQC B;  5JHA A;  2EIN E;  4ANW A;  5CBO A;  3HHM A;  3DRA A;  4YDY A;  4U95 D;  5AIJ A;  2J4D A;  5BW8 C;  2GW1 A;  4AJW A;  2XS8 A;  2R2L A;  5G55 A;  4B93 B;  2JLB A;  5EID A;  3JUE A;  3SFZ A;  4JHK A;  1UW4 B;  2VJ8 A;  5BXU A;  3Q7A A;  1WY6 A;  1SZA A;  4UUC A;  4CGV A;  3FTS A;  2XEH A;  4I43 A;  2WM9 A;  4MLP A;  3TWQ A;  2RKK A;  3MX3 A;  4A3T A;  3I4R B;  1HFA A;  2PZI A;  5A23 A;  3HYM B;  3JYS A;  3OXL A;  5EKQ D;  3ZIM A;  1DVP A;  3VLF A;  3MV3 B;  3E37 A;  4QQI A;  2P9I G;  1TN8 A;  3S7B A;  3FP3 A;  4GYO A;  4U0S A;  1U3D A;  4HNA D;  1H6P A;  1N4R A;  3ZNG A;  4AOF A;  3EIJ A;  1SA5 A;  5D66 A;  2WMN A;  2J9Q A;  3TG4 A;  4IRU A;  5JMN D;  4P29 A;  1IHB A;  5HQ8 A;  5EX3 A;  1IQR A;  3E34 A;  2F0Y A;  2XEV A;  3SBT B;  3DEP A;  3FY4 A;  3ABM E;  3ZHE B;  2FF4 A;  3DSV A;  3MV2 B;  2XS1 A;  3EJN A;  4G24 A;  1E90 A;  4HOU A;  4BSX A;  2DYR E;  3VTX A;  4GTV A;  2H6F A;  3DBS A;  2YHE A;  4NUR A;  4UQZ A;  3TJP A;  4GZD A;  1H0A A;  2HR2 A;  3T8M A;  2IOL A;  2CHX A;  4PS7 A;  3JCK C;  2HM8 A;  5LFA A;  4U63 A;  3T9K A;  5CCL A;  3PNT B;  3CK7 A;  4JZY A;  5CBN A;  2VSN A;  4B89 A;  2NC9 A;  4J6I A;  1VDY A;  5G2N A;  1V54 E;  3SFX A;  2UY1 A;  1Z3Y A;  2AWI A;  4C0M A;  4MKT A;  1TNZ A;  3ASG A;  2GRP B;  1AP7 A;  1SW6 A;  5ITZ F;  3AAA C;  2QFC A;  3MYV A;  3APD A;  3HXB A;  4APO A;  1KZP A;  2WPV A;  1HU3 A;  3CGH A;  3MGB A;  4LNU D;  4QFV A;  5AAO A;  5KNG A;  4L2L A;  3FU6 A;  2XCC A;  4LER A;  4LCT A;  4YDE A;  4G23 A;  3ASH A;  3QC1 A;  4GA0 A;  2QZA A;  3FU3 A;  4V3I A;  1D8E A;  3QAQ A;  2VGX A;  3DSS A;  4C9B B;  3U66 A;  4I6J A;  3OAW A;  3ESL A;  4GA2 A;  3UT4 A;  3KEZ A;  2GRM A;  3NZS A;  4HI9 A;  1MX4 A;  3DPY A;  5AQB A;  2Y0B G;  2WXN A;  5T3R A;  4FJY A;  3PS6 A;  4GZ3 A;  3RU0 A;  3PE3 A;  2ZIS A;  3VLE A;  4EZL A;  3CVW A;  1EPU A;  3ULQ A;  2ILR A;  4M3O A;  4KZC A;  4HB5 A;  3UX4 A;  2GRN B;  3CEQ A;  3FTY A;  2RFA A;  5CMW A;  4RG9 A;  3G2S A;  3PEU B;  1NZN A;  4HLE A;  1TJC A;  1KLX A;  2Q7F A;  4APF A;  4UWH A;  2BUG A;  3UKR G;  4GPM A;  4DI4 A;  2H6G A;  3Q79 A;  4A1S A;  2VTB A;  1P5Q A;  1MZC A;  5C1D A;  4KXK B;  1Q2Z A;  2LNI A;  3CVN A;  2M63 A;  3R7R A;  3PDN A;  3D9J A;  1DNP A;  3LCA A;  3AG2 E;  4UI9 C;  4K5C A;  5FIN A; 
#chains in the Genus database with same CATH homology
 3B7B A;  1YYH A;  3TWX A;  3UI2 A;  2RFM A;  2V4H C;  3UXG A;  1DC2 A;  5AQ7 A;  5CBO A;  3EU9 A;  2P2C P;  4K5B A;  3Q9U C;  4DX6 D;  4YDY A;  1WDY A;  3C5R A;  2F8X K;  4U95 D;  2XEN A;  2A5E A;  4OAV B;  3TWT A;  4NIK A;  3KEA A;  2QYJ A;  3ZU7 B;  4OAU C;  2AJA A;  2ZGD A;  2MYO A;  2Y1L E;  5ENO D;  3TWU A;  1NFI E;  3V2X A;  3EHQ A;  4DUI A;  4B93 B;  3IXE A;  4ATZ D;  4F1P A;  3HRA A;  2PNN A;  5EID A;  3JUE A;  4HRM B;  5AQA A;  4HI9 A;  1D9S A;  1MX4 A;  4BES A;  4U8V D;  5AQB A;  1N11 A;  2Y0B G;  3DEO A;  4HRL A;  2ETC A;  2V5Q C;  1MX2 A;  1OY3 D;  5BXU A;  5EIB E;  2F8Y A;  3JXJ A;  2DZN A;  2XZT G;  4UUC A;  4DX5 D;  1AWC B;  2XEH A;  4J7W A;  4F6R D;  4Z68 A;  3T9K A;  5EYL A;  3TWQ A;  2JAB A;  2BKK B;  5ENT D;  5ENR D;  2HE0 A;  1N0R A;  4ZFH A;  1IXV A;  2DVW A;  5CBN A;  5CER B;  2L6B A;  4U96 D;  2ETB A;  2ETA A;  2F37 A;  2DZO A;  4LSZ E;  2KBX A;  2XEE A;  4N5Q A;  2DWZ A;  4K5A B;  5FIO A;  5KWD A;  5EIL A;  5HRY A;  3NOC D;  4HB5 A;  4HQD A;  4HI8 A;  3TWS A;  2KXP C;  4G8L A;  3UTM A;  5CEA A;  4CYM D;  4GMR A;  5HS0 A;  3T8K A;  2NYJ A;  1YMP A;  4JB8 P;  2RFA A;  3J5P A;  2B0O E;  2QC9 A;  3SO8 A;  3ZUV B;  4DX7 D;  3NBN B;  5CEC B;  3JXI A;  1UOH A;  4CZ2 D;  4QQI A;  4G8K A;  4RLY A;  3ZKJ A;  5JA4 D;  3V79 K;  1N0Q A;  5ENS D;  5CED B;  1BI8 B;  3B95 A;  1IKN D;  4LG6 A;  4O1P A;  1SVX A;  1BD8 A;  4O1O A;  1K1B A;  3EHR A;  4O60 A;  4A63 B;  1MYO A;  3HG0 D;  4DX2 A;  1MX6 A;  4HNA D;  1WG0 A;  2VGE A;  5EN5 D;  5BXO A;  3ZNG A;  3V30 A;  1OT8 A;  1TR4 A;  1BI7 B;  1G3N B;  1MJ0 A;  5ENP D;  3TWW A;  1SW6 A;  3D9H A;  1AP7 A;  4DRX E;  5ITZ F;  5KNH D;  5HKP A;  5AAR A;  3LJN A;  1K1A A;  4U8Y D;  3AJI A;  5D66 A;  4HLL A;  3AAA C;  4GPM A;  5AQ9 A;  4ZHB A;  1DCQ A;  5AN8 A;  5KBA A;  4YDW A;  5EYP F;  4C48 B;  2ZGG A;  1BLX B;  5JMN D;  3NOG D;  1IHB A;  1QYM A;  3F6Q A;  4LNU D;  3DEP A;  4QFV A;  1YCS B;  4J8Y A;  4BSZ B;  2BKG A;  3TWR A;  4BET A;  1S70 B;  5AAO A;  1BU9 A;  5KNG A;  3TWV A;  2XZD G;  3V31 A;  3J5Q B;  5ENQ D;  4TUM A;  1K3Z D;  4BEP A;  4DX1 A;  1A5E A;  3Q9N C;  2J8S D;  4HRN A;  3V2O A;  3W9F A;  4K5C A;  3W9G A;  4HBD A;  2FO1 E;  5FIN A;  4BER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...