4BSZB

Crystal structure of the yeast ribosomal protein rps3 in complex with its chaperone yar1
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
150
structure length
150
Chain Sequence
PLDQEDQDTIILDARAGDLDSLKDIFTTLVSPELLSTCKESESDSTALHMAAANGHIETVRYILETVSRANSAEDLKAFVNEVNKTGNTALHWASLNGKLDVVKLLCDEYEADPFIRNKFGHDAIFEAENSGKEEVETYFLKKYDVEPED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords 40S RIBOSOMAL PROTEIN S3
publication title Crystal Structure of the Yeast Ribosomal Protein Rps3 in Complex with its Chaperone Yar1
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 54
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4bszB00
2NYJA 1DCQA 2XEEA 4K5BA 3EHRA 1AP7A 5ENSD 4ATZD 4DUIA 5CBNA 2F37A 2ETBA 1YCSB 1S70B 2VGEA 5KBAA 4G8LA 4UUCA 3TWVA 5FINA 2RFMA 5ENTD 3NBNB 2PNNA 1WG0A 4HB5A 5BXUA 3EHQA 3AAAC 3D9HA 4A63B 3W9FA 4DX6D 3TWXA 5JA4D 3JUEA 3KEAA 4G8KA 3TWQA 4CZ2D 1IKND 3DEOA 4TUMA 3C5RA 1N11A 1D9SA 5KNGA 4BSZB 2DZOA 3SO8A 4HLLA 5D66A 5EN5D 3F6QA 2HE0A 3UI2A 3UXGA 4Z68A 4OAUC 4O60A 2V4HC 4B93B 3AJIA 1IHBA 4LG6A 1DC2A 4LSZE 1QYMA 2JABA 4HNAD 1YYHA 1BD8A 4F1PA 5EIBE 2Y0BG 1K1AA 4OAVB 5AARA 5CERB 3NOCD 4HI8A 4HRMB 1BU9A 4O1OA 5ITZF 1K3ZD 1YMPA 4J7WA 3V79K 4HRLA 5EYLA 2A5EA 4U96D 3JXIA 5AN8A 4DX7D 3IXEA 5HKPA 3LJNA 4J8YA 4U8VD 4DX1A 1A5EA 4N5QA 1SVXA 5BXOA 1OY3D 1MX6A 4HI9A 5ENRD 3TWWA 2L6BA 3V31A 4GPMA 1N0QA 1BI8B 1K1BA 5ENPD 3HRAA 3DEPA 5HS0A 3V30A 3J5QB 4LNUD 4CYMD 2KBXA 2ZGGA 3T9KA 4C48B 4YDWA 1WDYA 1TR4A 1UOHA 2B0OE 4BESA 3EU9A 5ENQD 2V5QC 4ZFHA 3ZUVB 4K5AB 5HRYA 3UTMA 2XENA 5KWDA 2Y1LE 5AAOA 5AQAA 5EIDA 5EILA 2XZTG 3HG0D 4BETA 2ZGDA 4GMRA 2P2CP 2FO1E 2XEHA 4ZHBA 4QFVA 1N0RA 5EYPF 2DVWA 3B95A 5KNHD 3J5PA 3T8KA 4K5CA 5AQ7A 3NOGD 1MX2A 2MYOA 3Q9UC 5FIOA 2ETAA 2AJAA 2DWZA 3Q9NC 5ENOD 5JMND 3W9GA 4F6RD 5CBOA 2ETCA 2J8SD 4RLYA 2BKKB 4U8YD 4NIKA 4DX5D 2F8YA 3TWSA 3B7BA 5CEAA 4DX2A 5AQBA 1IXVA 4QQIA 2KXPC 4O1PA 4BEPA 1BLXB 2BKGA 4YDYA 3ZNGA 2QC9A 1MX4A 1MYOA 2XZDG 4JB8P 3ZU7B 4BERA 1MJ0A 3TWUA 2DZNA 4U95D 1G3NB 3ZKJA 2QYJA 3JXJA 1NFIE 2RFAA 5CEDB 2F8XK 5AQ9A 5CECB 3V2XA 4HBDA 4DRXE 3TWRA 1BI7B 1AWCB 1SW6A 1OT8A 3TWTA 4HQDA 4HRNA 3V2OA
chains in the Genus database with same CATH superfamily
2MHKA 4H7YA 1TNOA 5CBNA 2XS1A 3TWVA 3DRAA 5G55A 1H2TC 1IQRA 4A63B 3P1UA 3LY9A 3TWQA 4FP7A 4TUMA 1WM5A 3C5RA 5KNGA 3SD5A 4OAUC 5E76A 4URKA 3VTXA 4JD2G 3QAQA 4I2ZA 1OWLA 2XGMA 4GYOA 3WXXA 1BPOA 3CR3A 3MA5A 2XRZA 3D9MA 1JCQA 2LO6A 3DSXA 4N5QA 1FVHA 3TWWA 3AS4A 2QYUA 4V3IA 4ATGA 3C3QA 3T9KA 4PDXA 3IV0A 4AV7A 3EIQC 4YDOA 2X6JA 4U8HA 4JHKA 4OYSA 2WB2A 4IN3B 4MLPA 3DXMG 2WXMA 5JMND 3FUIA 2HR2A 2XQ0A 2ILRA 2VTBB 3FH7A 4I9EA 2KXPC 1XNFA 3BG0B 4EPZA 3UX4A 5B3SE 2DZNA 1XGWA 2MRIA 2RKKA 3FY4A 3QDNA 3V2XA 5CECB 1JWGA 4FLBA 1OT8A 3HXDA 3V2OA 1HH8A 3TXMA 3QWVA 2IONA 3ZHEB 1HG5A 3FWVA 1V55E 3UIPC 3ZYMA 3SY2A 1N95A 3LDZA 3E33A 1TJCA 3KEAA 3CKBA 3Q47B 4EBAA 2IO3C 3IKOB 1TN8A 4HLLA 3LY8A 3HDXA 3T8MA 5CCMA 3TG5A 4F1PA 4JA7A 2X3MA 3NOCD 2UY1A 3PVLA 4HRLA 3JXIA 5T3RA 3T5XA 3PEVB 3PZDA 1N9AA 4KVMA 4JHJA 3DEPA 1D8DA 1OXJA 2CHXA 4L9PA 1Z5SC 4JW1A 4YDWA 1U3DA 3ZUVB 3AS8A 3T5VA 4NACA 2IY0C 3EIJA 3VLFA 3NOGD 5BUZA 4F6RD 2NC9A 4M7CA 3RRNB 5A7DB 2QY7A 4HOQA 3L13A 5AQBA 3ZGQA 4QQIA 4AXHA 2OVBA 2E2EA 2QC9A 3ASHA 1D8EA 4G2VA 3GYZA 1TN7A 3CHSA 4GZ3A 1H2UA 4CGVA 5LX8A 1ZU2A 3ZYKA 5JHAA 4ACLA 4XZ4A 2PZIA 2YINA 1IQUA 2YNQA 3KAEA 1YCSB 4WUYA 2KATA 3CK9A 2B6CA 4FULA 2IJGX 2KM4A 4EBAG 4A3TA 3C98A 4CZ2D 1JPLA 4I6GA 3Q5MA 3F6QA 3Q7AA 5H7PA 3L17A 3UPVA 4K03A 3Q75A 4Q94A 4LNBA 1BU9A 2L6JA 4HI8A 4HRMB 3UM1A 3FUMA 1YMPA 2I6HA 1TNUA 2Y4UA 3CKCA 4U8VD 2RD0A 1SVXA 4PH4B 5ENRD 3SFXA 1INZA 1PAQA 3CVPA 4N2QA 2WXFA 2X6FA 5FWQA 2Y3AA 1FT1A 3ZRHA 4U0UA 4ZFHA 3UINC 2WXJA 4FU3A 3JQ0A 4Y6CA 2DVWA 3J5PA 5FIOA 1O1SA 1HS6A 5ARFA 2J8SD 2VJ8A 2GRRB 4F1SA 2XPYA 5G04J 4BX8A 5BT1A 3MJWA 4GB9A 2H6FA 4GPKA 2EIJE 3FUEA 3PRZA 5FQ6A 3D9KA 3NZSA 3ABME 3C72A 2GRMA 3SGHA 2IF4A 3D9LA 2AWIA 4EECA 1Z3XA 1TNZA 1AP7A 1DVPA 1S70B 2I1JA 5ARGA 4E85A 1U2VG 4LCTA 5BXUA 3OTNA 5JA4D 3JUEA 3PZ2A 5G04C 3DSWA 3U3WA 5CMYA 5D66A 4ME2A 3BG1B 3PUJA 2V4HC 1DC2A 5KJKA 2PM6A 4HS2A 2LSUA 5ANLA 4DLQA 3V79K 1OUVA 1KPSB 1HZ4A 1A5EA 5BXOA 4WNDA 4GTVA 4OVUA 3QARA 3HIZA 3V31A 1N0QA 5BW8C 3TJPA 3JCKC 4HOUA 2H6GA 3QOUA 3ONKA 4ANUA 3G2VA 2XENA 5FQ7A 2J4DA 3LCAA 4GA1A 4BETA 4TXRA 3T8KA 1ZB1A 2M63A 3Q9UC 4DX5D 4KZ0A 4UWGA 4BWRA 3TWSA 4OVVA 3MKRA 1N4RA 3CVLA 4N39A 4PS8A 4DJAA 3OAWA 3PNLB 4JEUA 1NP7A 5D0QD 2WXRA 4A1GA 5JHBA 4K5BA 2C0MA 2X6KA 2I9CA 1L5JA 5E75A 5LCWJ 2GROB 3QKYA 2OEWA 4FHJA 4GAAA 5KBAA 1EDUA 4UUCA 4BTBA 4HB5A 3D9HA 4G24A 1H6OA 1RZ4A 1K8KG 3MYVA 2ZXWE 3RO2A 3DSVA 2DZOA 2HE0A 2WXGA 5FZSA 3UM2A 3DBSA 3LVRE 3AJIA 4KZCA 4CT0A 2KCKA 2XCCA 4AOFA 3PS6A 1ELKA 3OXFA 4BX9A 4KT6B 3RRMB 5DIZA 4XE0A 3MV2B 4F7AA 4JZYA 4MBGA 4PS7A 3ML8A 1HE8A 1TR4A 3CVVA 2LNIA 2DYSE 4F53A 3QC1A 5EIDA 2XZTG 2OVFA 4YDEA 3L9TA 3FU5A 3HVEA 2QZAA 5EYPF 4K5CA 3SF4A 2DWZA 3FTSA 5CBOA 1UN8A 2CFUA 3B7BA 2H6HA 4BEPA 3TGOA 1UJJA 1MJ0A 2XEVA 5FZQA 4A1SA 3SNXA 3ULQA 4G23A 3LS8A 3TWTA 1DCQA 2XEEA 3Q79A 3ML9A 3PUKA 2GGFA 4HFGA 4YNDA 1FCHA 5FZRA 3NBNB 2PNNA 4R7LA 3DWLG 3TWXA 1PY1A 4ILGA 3RAUA 4GTOA 3QB2A 4B93B 1QYMA 4HNAD 4JXTA 5EIBE 1E96B 3ASGA 5A23A 4JVSA 1K3ZD 4CDNA 2A5EA 1HFAA 4U0SA 2FI7A 4L1BA 1E8XA 3E34A 2L6BA 4UWHA 2BUGA 5HS0A 3G2TA 4WAFA 2VSNA 3HXFA 3K9IA 3CSTA 5EX3A 2V5QC 4XI0A 3ZXSA 4ACKA 2C2LA 1TN6A 2FO1E 4L2LA 2XEHA 4QFVA 4FJZA 4FA6A 5ENOD 3EU5A 4GTTA 2P9IG 3S7FA 5A6CA 5D2MC 4GU5A 1JCSA 3NF1A 3RKVA 4JB8P 1G3NB 1X81A 1V54E 4CGWA 5AQ9A 3FFLA 1AWCB 3U66A 2VSOE 3CHRA 4HORA 3WG7E 3G2SA 1PC2A 4GTPA 1EPUA 3MGBA 2FEZA 3B13A 4AIFA 2R03A 3CVWA 1OWNA 3B7SA 5EDSA 2EILE 4I6EA 3BQOA 3ZFWA 4B94A 5G05J 2AXZA 2V8SE 1OCZE 4O6FA 5HI7A 5LP0A 4HOSA 2LAHA 3APDA 3MKQB 3BU8A 4FHKA 5EX0A 2LAIA 2Y4TA 3DPYA 4CDRA 1H2VC 4BT8A 1OY3D 4J8EA 2KCLA 3P2BA 1BI8B 3I4GA 1P5QA 1E8YA 2V0PA 5G05C 3UKUG 4WNFA 4K5AB 4EHMA 4I6JA 2WXHA 4N2SA 3Q7FA 2VTBA 3QK0A 3FTUA 3FDHA 2ETCA 2BKKB 1LF8A 1TNYA 4GMJA 4BY6A 4UWLA 5IY5E 3DSUA 2XPZA 2GRNB 2QYJA 3ZHEA 3FU3A 3EUVA 4I43A 3TWRA 1TYQG 3ZIMA 5KJNA 4G11A 1N52A 3JQ1A 2VGEA 3QWWA 1OCOE 4Q96A 2H6IA 5CMWA 5BV1A 3OXLA 3UM0A 3C3RA 4BSZB 1S63A 4GA2A 2DCPA 3TG4A 1NZNA 1W3BA 1YYHA 1BD8A 3CVNA 2WQ7A 4UI9K 4JHRA 3U4TA 2IQCA 4U96D 4DX7D 3AG2E 5LFAA 2X6HA 3RO3A 5KJLA 3LKUA 4LEUA 4LERA 3V30A 2WXQA 3AG3E 1WDYA 4AP2A 3UTMA 3SBTB 2DIWA 4ANWA 5CCLA 3LVQE 5AJLA 4B0ZA 3SI5A 2CG2A 2KCVA 4AY6A 5BV0A 2F8YA 4L2YA 3IEGA 4RSYA 4XEIG 3PZ1A 4U07A 1KZOA 4YDYA 2XZDG 3ZU7B 3FUNA 1O5MA 4C0EA 3CVQA 2VGXB 3L22A 4DK5A 3MZLB 1TEZA 2OCCE 3CHPA 1OCCE 3E4BA 4ILIA 2RFMA 4ANXA 3CHQA 2GRLA 3FTXA 3IHVA 4LUNU 1Y6IA 4G8KA 4I1MA 4Y6WA 3PNTB 3EHNA 2ZISA 2FO7A 3BEEA 3AG4E 2DYRE 4B8AA 5ENNA 3FULA 3KEZA 3R9MA 1K1AA 3E37A 5B1AE 3AU5A 2WXLA 3D9JA 4CDMA 3U64A 1FVFA 2V5FA 5EYLA 3JYSA 1H6PA 4CEMA 3HXEA 2WMOA 3PE3A 3FU6A 3SFYA 1K1BA 3HRAA 1SA4A 3D9OA 3CIAA 4HVBA 2ZGGA 4D10C 3UT8A 2VGXA 3B7RL 1TNBA 4APOA 4BESA 5AIJA 5AQAA 5EILA 2MOWA 3O4ZA 5AQ7A 1OWOA 1KZPA 4DLOA 3W9GA 2AJAA 2IFUA 3MX3A 4RLYA 4NIKA 3UIOC 2RG8A 2AVPA 2P9NG 4LNGA 3NZUA 1QZ2A 3ZNGA 5AENA 1ZBPA 2VYIA 3FUKA 3MEKA 3R9AB 3ABLE 1SW6A 2PQRA 5FQ4A 2PM7A 2XCBA 4JL0A 1EF1C 3CVUA 3SQVA 3QNKA 4KXKB 3UT4A 4N3AA 1N4SA 4GA0A 1D9SA 2LSVA 3CVYA 4EQFA 5AYWD 3UI2A 4U63A 4GTMA 4Q69A 1A17A 4NQ0A 1N4QA 1NA3A 4GTRA 4L7TA 2IU1A 3D9PA 4NRHB 4UWKA 3UKRG 5AN8A 3IXEA 3UT7A 3KD7A 1NL4A 1MX6A 3GZSA 4XIFA 1HO8A 2LXLA 5FT9A 4LNUD 4CRWA 1SQMA 3ASNE 2WXIA 5JJ6A 5KWDA 4J8FA 5AAOA 2WM9A 5C2YA 5LCWC 2JLBA 4WWOA 3UUXA 4EZJA 3Q9NC 4U8YD 4B89A 3PZ3A 3S2AA 4TUUA 3VLEA 4DI3A 4GTSA 1MX4A 3TWUA 4U95D 3RIBA 5CEDB 1TJFA 3AG1E 3G2WA 3ASFA 2J49A 4XX5A 4GCOA 1E8ZA 1WAO1 4EZKA 4ATZD 2GRPB 2J07A 1HF8A 3CLJA 3E30A 4L23A 3TL5A 3UM3A 4C9BB 3AAAC 1Z6TA 3W9FA 3MCXA 1KLXA 4YVOA 3OXGA 3JUIA 2IEJA 4GMLA 4XKBA 3S7JA 3S7BA 3FUFA 3B7TA 3FTVA 1H19A 3ESLA 2QFCA 3ASDA 4ILHB 3LJNA 1X5BA 1JWFA 3LJ3A 3QJZA 5JJTA 3ZPJA 5M72A 4CYMD 1IYGA 4EZLA 3ZYQA 1UOHA 1NA0A 2FULA 1N4PA 4UWFA 4IYPA 4GMRA 3LXUX 2Y69E 4GZDA 4BTAA 4BFRA 3ULEG 3FHEA 2KZTB 1HX8A 2BF0X 2V4LA 2P9SG 3RRUA 4JEHA 4J6IA 2PL2A 3CVXA 4RG9A 4DUIA 1DNPA 2F37A 2ETBA 3ASOE 2AXVA 3I3NA 4N3CA 3ISMC 3TAXA 1WG0A 2WQ6A 2JEKA 2CHZA 2GRQB 4GYYA 4Z68A 2VGYA 4GZCA 2E0IA 4WNEA 4WWNA 1ELWA 3SFZA 2Y0BG 4J7WA 4XI9A 4TXQA 3SHFA 3CQGB 3RK6A 4MRUA 4HI9A 2HO1A 2IO2C 2KZTA 3CGHA 4GPMA 2X6IA 2UY1B 1SZAA 2L0TB 2KBXA 4C48B 2XGOA 2OV8A 3E32A 1N54A 3EU9A 4B8CB 2OEVA 3SBSA 3ABKE 3L16A 3FUJA 1IHGA 3HG0D 3S7DA 2ZGDA 2NXPA 5CRVA 2BTDA 3D9NA 3B95A 3URZA 3PREA 3PDNA 2MYOA 4MKTA 5D0OD 3FUHA 4XKCA 4GYWA 4J8DA 3CV0A 1ELRA 4KYOB 3GZ1A 1OWPA 1IXVA 3RU0A 1MZCA 2XRYA 4H7XA 1O1RA 3NB2A 2F8XK 3DPDA 4NURA 4DRXE 3FH5A 3C3OA 5J90A 4AEZC 4GZ6A 4FJYA 4U7EB 4G8LA 1LTXA 3Q4AB 4UQYA 2EIKE 5ENTD 4DX6D 3GZ2A 4TV3A 3DEOA 3APFA 2P9PG 3ENEA 1H6KA 2F0YA 4HXIA 3MKQA 3UXGA 4O60A 2CFZA 1YA0A 4W9RA 2JABA 3FEXA 4O1OA 4KMOA 4DI4A 3ZVVA 5T4YA 1UN9A 3ZEFA 3KS2A 3DSTA 1MHQA 2P9LG 3PEUB 3CK8A 1HXIA 3Q15A 5CHEE 3PZ4A 3KSQA 4G1TA 2LUHA 3HHMA 2WVIA 3ZXPA 5KJMA 3B7UX 2Y1LE 3DSSA 5JJ7A 4IULA 2C0LA 2P2CP 2AXUA 5KNHD 1JCRA 3G2UA 2GW1A 2WXOA 4BT9A 2WPVA 2WXNA 1EYHA 3AU4A 4DX2A 3HYMB 3LY7A 2BKGA 3DXKG 4J0UA 2X38A 2DBAA 1OCRE 1QNFA 2WXPA 2XGSA 3PH0C 4HBDA 1UW4B 2NYJA 3UQ3A 4I9CA 2VSXE 3AS5A 4C0MA 3BUAA 1E7VA 1MQSA 3EHQA 2YHCA 4N3BA 5CRUA 2HYZA 4ABNA 4FADA 2R59A 3NAWA 3EDTB 4TXPA 1DCEA 4N5CA 3SO8A 5FQ8A 5EN5D 3I5PA 3NQPA 5HQ8A 2P9KG 3CHMA 1IHBA 4HOTA 4PS3A 4WWPA 2HM8A 1E90A 2J09A 2R05A 4AJWA 2LXMA 4I1AA 3X2QE 3APCA 4I17A 1E8WA 4U0ZA 4APFA 2BEDA 4UI9J 4TRQA 2L9BA 5G2NA 5T8IA 2J08A 1WY6A 3MV3B 5BPPA 4J8SA 1JUQA 1FT2A 5FTPA 4U04A 1SZ9A 2CHWA 5HRYA 2WXKA 4RQIA 4ZHBA 5J08A 3SZ7A 1QQEA 1MX2A 2J4BA 1O1TA 3PE4A 3FH8A 4FLHA 3VLDA 4KBQA 3L6AA 2UWJG 2FBNA 1BLXB 3L82A 4UI9C 4BERA 3QWPA 3U9WA 3ZKJA 4RVBA 3FTYA 2YHEA 2KC7A 3FEYA 4HQDA 2FF4A 5ENSD 1SA5A 1B89A 2VSYA 5FINA 2PQNA 4CT4A 2I1KA 1U3CA 4GCNA 4K0RA 2XPIA 1VDYA 4FC8A 2ZIRA 1IKND 2CG3A 1Z3YA 1N11A 2ONDA 3Q78A 3LYAA 1S64A 4LSZE 2OOEA 2R02A 3CQCB 1S0PA 3CK7A 5CERB 5ITZF 4AVXA 3L54A 4AY5A 1HG2A 4BSXA 5KCMA 1H0AA 5HKPA 2ZU6B 3HXCA 3Q73A 3ONLA 3LPZA 1UJKA 3HXBA 1GW6A 4LRZA 2XS8A 2P9UG 1QBQA 5ENQD 3TXNA 3EHMA 2EINE 2IOLA 4G26A 2R5SA 3N71A 4I1OB 3FP3A 2EIME 4G25A 4UQZA 3FTWA 3ESKA 4I2WA 3CHOA 5LOZA 3RSEG 3HVEB 3Q49B 3L08A 5BNWA 4HLEA 4O1PA 2R2LA 2WMNA 2Q7FA 4JPSA 3FTZA 2J9QA 2RFAA 1KT1A 4MS6A 1LD8A 1UG3A 3RJVA 3IHYA 4A55A 3EHRA 2EQXA 2WQHA 4JC8A 1NI1A 4WNGA 5C1DA 4PUCA 1FPPA 3FU0A 5FJYA 3CEQA 4M3OA 5B1BE 1HU3A 2XHEA 3UMVA 2R17C 4IRUA 4A3VA 1LD7A 3ZYLA 4LG6A 1OWMA 4OAVB 3VTYA 5AARA 4ANVA 3CSFA 2NSZA 2P58C 3IBEA 4P29A 4J8YA 4E6HA 4DX1A 3KSLA 3D3MA 3ZN3A 1E7UA 3ZW3A 5ENPD 3J5QB 1Y8MA 4YVQC 2I2OA 3FUDA 3EJNA 2AW6A 3O48A 3GW4A 2B0OE 4UQXA 1RW2A 5ANRA 5EKQD 1KT0A 1N0RA 3R7QA 3ULYA 4GTQA 2IOSA 2YQ8A 3D9IA 4JA9A 4F3VA 2ETAA 5DBKA 2A5UA 2A4ZA 4X8QA 2VQ2A 1N94A 5CEAA 3I4RB 5AJDA 1MYOA 1Q2ZA 4KVOA 4RG6A 4AM9A 4CCAA 3JXJA 1NFIE 4GZ5A 4DPRA 1BI7B 3R7RA 4HRNA 3LEWA 2L0IA
chains in the Genus database with same CATH topology
2NYJA 1DCQA 2XEEA 4K5BA 3EHRA 1AP7A 5ENSD 4ATZD 4DUIA 5CBNA 2F37A 2ETBA 1YCSB 1S70B 2VGEA 5KBAA 4G8LA 4UUCA 3TWVA 5FINA 2RFMA 5ENTD 3NBNB 2PNNA 1WG0A 4HB5A 5BXUA 3EHQA 3AAAC 3D9HA 4A63B 3W9FA 4DX6D 3TWXA 5JA4D 3JUEA 3KEAA 4G8KA 3TWQA 4CZ2D 1IKND 3DEOA 4TUMA 3C5RA 1N11A 1D9SA 5KNGA 4BSZB 2DZOA 3SO8A 4HLLA 5D66A 5EN5D 3F6QA 2HE0A 3UI2A 3UXGA 4Z68A 4OAUC 4O60A 2V4HC 4B93B 3AJIA 1IHBA 4LG6A 1DC2A 4LSZE 1QYMA 2JABA 4HNAD 1YYHA 1BD8A 4F1PA 5EIBE 2Y0BG 1K1AA 4OAVB 5AARA 5CERB 3NOCD 4HI8A 4HRMB 1BU9A 4O1OA 5ITZF 1K3ZD 1YMPA 4J7WA 3V79K 4HRLA 5EYLA 2A5EA 4U96D 3JXIA 5AN8A 4DX7D 3IXEA 5HKPA 3LJNA 4J8YA 4U8VD 4DX1A 1A5EA 4N5QA 1SVXA 5BXOA 1OY3D 1MX6A 4HI9A 5ENRD 3TWWA 2L6BA 3V31A 4GPMA 1N0QA 1BI8B 1K1BA 5ENPD 3HRAA 3DEPA 5HS0A 3V30A 3J5QB 4LNUD 4CYMD 2KBXA 2ZGGA 3T9KA 4C48B 4YDWA 1WDYA 1TR4A 1UOHA 2B0OE 4BESA 3EU9A 5ENQD 2V5QC 4ZFHA 3ZUVB 4K5AB 5HRYA 3UTMA 2XENA 5KWDA 2Y1LE 5AAOA 5AQAA 5EIDA 5EILA 2XZTG 3HG0D 4BETA 2ZGDA 4GMRA 2P2CP 2FO1E 2XEHA 4ZHBA 4QFVA 1N0RA 5EYPF 2DVWA 3B95A 5KNHD 3J5PA 3T8KA 4K5CA 5AQ7A 3NOGD 1MX2A 2MYOA 3Q9UC 5FIOA 2ETAA 2AJAA 2DWZA 3Q9NC 5ENOD 5JMND 3W9GA 4F6RD 5CBOA 2ETCA 2J8SD 4RLYA 2BKKB 4U8YD 4NIKA 4DX5D 2F8YA 3TWSA 3B7BA 5CEAA 4DX2A 5AQBA 1IXVA 4QQIA 2KXPC 4O1PA 4BEPA 1BLXB 2BKGA 4YDYA 3ZNGA 2QC9A 1MX4A 1MYOA 2XZDG 4JB8P 3ZU7B 4BERA 1MJ0A 3TWUA 2DZNA 4U95D 1G3NB 3ZKJA 2QYJA 3JXJA 1NFIE 2RFAA 5CEDB 2F8XK 5AQ9A 5CECB 3V2XA 4HBDA 4DRXE 3TWRA 1BI7B 1AWCB 1SW6A 1OT8A 3TWTA 4HQDA 4HRNA 3V2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NYJ A;  1DCQ A;  2XEE A;  4K5B A;  3EHR A;  1AP7 A;  5ENS D;  4ATZ D;  4DUI A;  5CBN A;  2F37 A;  2ETB A;  1YCS B;  1S70 B;  2VGE A;  5KBA A;  4G8L A;  4UUC A;  3TWV A;  5FIN A;  2RFM A;  5ENT D;  3NBN B;  2PNN A;  1WG0 A;  4HB5 A;  5BXU A;  3EHQ A;  3AAA C;  3D9H A;  4A63 B;  3W9F A;  4DX6 D;  3TWX A;  5JA4 D;  3JUE A;  3KEA A;  4G8K A;  3TWQ A;  4CZ2 D;  1IKN D;  3DEO A;  4TUM A;  3C5R A;  1N11 A;  1D9S A;  5KNG A;  4BSZ B;  2DZO A;  3SO8 A;  4HLL A;  5D66 A;  5EN5 D;  3F6Q A;  2HE0 A;  3UI2 A;  3UXG A;  4Z68 A;  4OAU C;  4O60 A;  2V4H C;  4B93 B;  3AJI A;  1IHB A;  4LG6 A;  1DC2 A;  4LSZ E;  1QYM A;  2JAB A;  4HNA D;  1YYH A;  1BD8 A;  4F1P A;  5EIB E;  2Y0B G;  1K1A A;  4OAV B;  5AAR A;  5CER B;  3NOC D;  4HI8 A;  4HRM B;  1BU9 A;  4O1O A;  5ITZ F;  1K3Z D;  1YMP A;  4J7W A;  3V79 K;  4HRL A;  5EYL A;  2A5E A;  4U96 D;  3JXI A;  5AN8 A;  4DX7 D;  3IXE A;  5HKP A;  3LJN A;  4J8Y A;  4U8V D;  4DX1 A;  1A5E A;  4N5Q A;  1SVX A;  5BXO A;  1OY3 D;  1MX6 A;  4HI9 A;  5ENR D;  3TWW A;  2L6B A;  3V31 A;  4GPM A;  1N0Q A;  1BI8 B;  1K1B A;  5ENP D;  3HRA A;  3DEP A;  5HS0 A;  3V30 A;  3J5Q B;  4LNU D;  4CYM D;  2KBX A;  2ZGG A;  3T9K A;  4C48 B;  4YDW A;  1WDY A;  1TR4 A;  1UOH A;  2B0O E;  4BES A;  3EU9 A;  5ENQ D;  2V5Q C;  4ZFH A;  3ZUV B;  4K5A B;  5HRY A;  3UTM A;  2XEN A;  5KWD A;  2Y1L E;  5AAO A;  5AQA A;  5EID A;  5EIL A;  2XZT G;  3HG0 D;  4BET A;  2ZGD A;  4GMR A;  2P2C P;  2FO1 E;  2XEH A;  4ZHB A;  4QFV A;  1N0R A;  5EYP F;  2DVW A;  3B95 A;  5KNH D;  3J5P A;  3T8K A;  4K5C A;  5AQ7 A;  3NOG D;  1MX2 A;  2MYO A;  3Q9U C;  5FIO A;  2ETA A;  2AJA A;  2DWZ A;  3Q9N C;  5ENO D;  5JMN D;  3W9G A;  4F6R D;  5CBO A;  2ETC A;  2J8S D;  4RLY A;  2BKK B;  4U8Y D;  4NIK A;  4DX5 D;  2F8Y A;  3TWS A;  3B7B A;  5CEA A;  4DX2 A;  5AQB A;  1IXV A;  4QQI A;  2KXP C;  4O1P A;  4BEP A;  1BLX B;  2BKG A;  4YDY A;  3ZNG A;  2QC9 A;  1MX4 A;  1MYO A;  2XZD G;  4JB8 P;  3ZU7 B;  4BER A;  1MJ0 A;  3TWU A;  2DZN A;  4U95 D;  1G3N B;  3ZKJ A;  2QYJ A;  3JXJ A;  1NFI E;  2RFA A;  5CED B;  2F8X K;  5AQ9 A;  5CEC B;  3V2X A;  4HBD A;  4DRX E;  3TWR A;  1BI7 B;  1AWC B;  1SW6 A;  1OT8 A;  3TWT A;  4HQD A;  4HRN A;  3V2O A; 
#chains in the Genus database with same CATH topology
 2MHK A;  4H7Y A;  1TNO A;  5CBN A;  2XS1 A;  3TWV A;  3DRA A;  5G55 A;  1H2T C;  1IQR A;  4A63 B;  3P1U A;  3LY9 A;  3TWQ A;  4FP7 A;  4TUM A;  1WM5 A;  3C5R A;  5KNG A;  3SD5 A;  4OAU C;  5E76 A;  4URK A;  3VTX A;  4JD2 G;  3QAQ A;  4I2Z A;  1OWL A;  2XGM A;  4GYO A;  3WXX A;  1BPO A;  3CR3 A;  3MA5 A;  2XRZ A;  3D9M A;  1JCQ A;  2LO6 A;  3DSX A;  4N5Q A;  1FVH A;  3TWW A;  3AS4 A;  2QYU A;  4V3I A;  4ATG A;  3C3Q A;  3T9K A;  4PDX A;  3IV0 A;  4AV7 A;  3EIQ C;  4YDO A;  2X6J A;  4U8H A;  4JHK A;  4OYS A;  2WB2 A;  4IN3 B;  4MLP A;  3DXM G;  2WXM A;  5JMN D;  3FUI A;  2HR2 A;  2XQ0 A;  2ILR A;  2VTB B;  3FH7 A;  4I9E A;  2KXP C;  1XNF A;  3BG0 B;  4EPZ A;  3UX4 A;  5B3S E;  2DZN A;  1XGW A;  2MRI A;  2RKK A;  3FY4 A;  3QDN A;  3V2X A;  5CEC B;  1JWG A;  4FLB A;  1OT8 A;  3HXD A;  3V2O A;  1HH8 A;  3TXM A;  3QWV A;  2ION A;  3ZHE B;  1HG5 A;  3FWV A;  1V55 E;  3UIP C;  3ZYM A;  3SY2 A;  1N95 A;  3LDZ A;  3E33 A;  1TJC A;  3KEA A;  3CKB A;  3Q47 B;  4EBA A;  2IO3 C;  3IKO B;  1TN8 A;  4HLL A;  3LY8 A;  3HDX A;  3T8M A;  5CCM A;  3TG5 A;  4F1P A;  4JA7 A;  2X3M A;  3NOC D;  2UY1 A;  3PVL A;  4HRL A;  3JXI A;  5T3R A;  3T5X A;  3PEV B;  3PZD A;  1N9A A;  4KVM A;  4JHJ A;  3DEP A;  1D8D A;  1OXJ A;  2CHX A;  4L9P A;  1Z5S C;  4JW1 A;  4YDW A;  1U3D A;  3ZUV B;  3AS8 A;  3T5V A;  4NAC A;  2IY0 C;  3EIJ A;  3VLF A;  3NOG D;  5BUZ A;  4F6R D;  2NC9 A;  4M7C A;  3RRN B;  5A7D B;  2QY7 A;  4HOQ A;  3L13 A;  5AQB A;  3ZGQ A;  4QQI A;  4AXH A;  2OVB A;  2E2E A;  2QC9 A;  3ASH A;  1D8E A;  4G2V A;  3GYZ A;  1TN7 A;  3CHS A;  4GZ3 A;  1H2U A;  4CGV A;  5LX8 A;  1ZU2 A;  3ZYK A;  5JHA A;  4ACL A;  4XZ4 A;  2PZI A;  2YIN A;  1IQU A;  2YNQ A;  3KAE A;  1YCS B;  4WUY A;  2KAT A;  3CK9 A;  2B6C A;  4FUL A;  2IJG X;  2KM4 A;  4EBA G;  4A3T A;  3C98 A;  4CZ2 D;  1JPL A;  4I6G A;  3Q5M A;  3F6Q A;  3Q7A A;  5H7P A;  3L17 A;  3UPV A;  4K03 A;  3Q75 A;  4Q94 A;  4LNB A;  1BU9 A;  2L6J A;  4HI8 A;  4HRM B;  3UM1 A;  3FUM A;  1YMP A;  2I6H A;  1TNU A;  2Y4U A;  3CKC A;  4U8V D;  2RD0 A;  1SVX A;  4PH4 B;  5ENR D;  3SFX A;  1INZ A;  1PAQ A;  3CVP A;  4N2Q A;  2WXF A;  2X6F A;  5FWQ A;  2Y3A A;  1FT1 A;  3ZRH A;  4U0U A;  4ZFH A;  3UIN C;  2WXJ A;  4FU3 A;  3JQ0 A;  4Y6C A;  2DVW A;  3J5P A;  5FIO A;  1O1S A;  1HS6 A;  5ARF A;  2J8S D;  2VJ8 A;  2GRR B;  4F1S A;  2XPY A;  5G04 J;  4BX8 A;  5BT1 A;  3MJW A;  4GB9 A;  2H6F A;  4GPK A;  2EIJ E;  3FUE A;  3PRZ A;  5FQ6 A;  3D9K A;  3NZS A;  3ABM E;  3C72 A;  2GRM A;  3SGH A;  2IF4 A;  3D9L A;  2AWI A;  4EEC A;  1Z3X A;  1TNZ A;  1AP7 A;  1DVP A;  1S70 B;  2I1J A;  5ARG A;  4E85 A;  1U2V G;  4LCT A;  5BXU A;  3OTN A;  5JA4 D;  3JUE A;  3PZ2 A;  5G04 C;  3DSW A;  3U3W A;  5CMY A;  5D66 A;  4ME2 A;  3BG1 B;  3PUJ A;  2V4H C;  1DC2 A;  5KJK A;  2PM6 A;  4HS2 A;  2LSU A;  5ANL A;  4DLQ A;  3V79 K;  1OUV A;  1KPS B;  1HZ4 A;  1A5E A;  5BXO A;  4WND A;  4GTV A;  4OVU A;  3QAR A;  3HIZ A;  3V31 A;  1N0Q A;  5BW8 C;  3TJP A;  3JCK C;  4HOU A;  2H6G A;  3QOU A;  3ONK A;  4ANU A;  3G2V A;  2XEN A;  5FQ7 A;  2J4D A;  3LCA A;  4GA1 A;  4BET A;  4TXR A;  3T8K A;  1ZB1 A;  2M63 A;  3Q9U C;  4DX5 D;  4KZ0 A;  4UWG A;  4BWR A;  3TWS A;  4OVV A;  3MKR A;  1N4R A;  3CVL A;  4N39 A;  4PS8 A;  4DJA A;  3OAW A;  3PNL B;  4JEU A;  1NP7 A;  5D0Q D;  2WXR A;  4A1G A;  5JHB A;  4K5B A;  2C0M A;  2X6K A;  2I9C A;  1L5J A;  5E75 A;  5LCW J;  2GRO B;  3QKY A;  2OEW A;  4FHJ A;  4GAA A;  5KBA A;  1EDU A;  4UUC A;  4BTB A;  4HB5 A;  3D9H A;  4G24 A;  1H6O A;  1RZ4 A;  1K8K G;  3MYV A;  2ZXW E;  3RO2 A;  3DSV A;  2DZO A;  2HE0 A;  2WXG A;  5FZS A;  3UM2 A;  3DBS A;  3LVR E;  3AJI A;  4KZC A;  4CT0 A;  2KCK A;  2XCC A;  4AOF A;  3PS6 A;  1ELK A;  3OXF A;  4BX9 A;  4KT6 B;  3RRM B;  5DIZ A;  4XE0 A;  3MV2 B;  4F7A A;  4JZY A;  4MBG A;  4PS7 A;  3ML8 A;  1HE8 A;  1TR4 A;  3CVV A;  2LNI A;  2DYS E;  4F53 A;  3QC1 A;  5EID A;  2XZT G;  2OVF A;  4YDE A;  3L9T A;  3FU5 A;  3HVE A;  2QZA A;  5EYP F;  4K5C A;  3SF4 A;  2DWZ A;  3FTS A;  5CBO A;  1UN8 A;  2CFU A;  3B7B A;  2H6H A;  4BEP A;  3TGO A;  1UJJ A;  1MJ0 A;  2XEV A;  5FZQ A;  4A1S A;  3SNX A;  3ULQ A;  4G23 A;  3LS8 A;  3TWT A;  1DCQ A;  2XEE A;  3Q79 A;  3ML9 A;  3PUK A;  2GGF A;  4HFG A;  4YND A;  1FCH A;  5FZR A;  3NBN B;  2PNN A;  4R7L A;  3DWL G;  3TWX A;  1PY1 A;  4ILG A;  3RAU A;  4GTO A;  3QB2 A;  4B93 B;  1QYM A;  4HNA D;  4JXT A;  5EIB E;  1E96 B;  3ASG A;  5A23 A;  4JVS A;  1K3Z D;  4CDN A;  2A5E A;  1HFA A;  4U0S A;  2FI7 A;  4L1B A;  1E8X A;  3E34 A;  2L6B A;  4UWH A;  2BUG A;  5HS0 A;  3G2T A;  4WAF A;  2VSN A;  3HXF A;  3K9I A;  3CST A;  5EX3 A;  2V5Q C;  4XI0 A;  3ZXS A;  4ACK A;  2C2L A;  1TN6 A;  2FO1 E;  4L2L A;  2XEH A;  4QFV A;  4FJZ A;  4FA6 A;  5ENO D;  3EU5 A;  4GTT A;  2P9I G;  3S7F A;  5A6C A;  5D2M C;  4GU5 A;  1JCS A;  3NF1 A;  3RKV A;  4JB8 P;  1G3N B;  1X81 A;  1V54 E;  4CGW A;  5AQ9 A;  3FFL A;  1AWC B;  3U66 A;  2VSO E;  3CHR A;  4HOR A;  3WG7 E;  3G2S A;  1PC2 A;  4GTP A;  1EPU A;  3MGB A;  2FEZ A;  3B13 A;  4AIF A;  2R03 A;  3CVW A;  1OWN A;  3B7S A;  5EDS A;  2EIL E;  4I6E A;  3BQO A;  3ZFW A;  4B94 A;  5G05 J;  2AXZ A;  2V8S E;  1OCZ E;  4O6F A;  5HI7 A;  5LP0 A;  4HOS A;  2LAH A;  3APD A;  3MKQ B;  3BU8 A;  4FHK A;  5EX0 A;  2LAI A;  2Y4T A;  3DPY A;  4CDR A;  1H2V C;  4BT8 A;  1OY3 D;  4J8E A;  2KCL A;  3P2B A;  1BI8 B;  3I4G A;  1P5Q A;  1E8Y A;  2V0P A;  5G05 C;  3UKU G;  4WNF A;  4K5A B;  4EHM A;  4I6J A;  2WXH A;  4N2S A;  3Q7F A;  2VTB A;  3QK0 A;  3FTU A;  3FDH A;  2ETC A;  2BKK B;  1LF8 A;  1TNY A;  4GMJ A;  4BY6 A;  4UWL A;  5IY5 E;  3DSU A;  2XPZ A;  2GRN B;  2QYJ A;  3ZHE A;  3FU3 A;  3EUV A;  4I43 A;  3TWR A;  1TYQ G;  3ZIM A;  5KJN A;  4G11 A;  1N52 A;  3JQ1 A;  2VGE A;  3QWW A;  1OCO E;  4Q96 A;  2H6I A;  5CMW A;  5BV1 A;  3OXL A;  3UM0 A;  3C3R A;  4BSZ B;  1S63 A;  4GA2 A;  2DCP A;  3TG4 A;  1NZN A;  1W3B A;  1YYH A;  1BD8 A;  3CVN A;  2WQ7 A;  4UI9 K;  4JHR A;  3U4T A;  2IQC A;  4U96 D;  4DX7 D;  3AG2 E;  5LFA A;  2X6H A;  3RO3 A;  5KJL A;  3LKU A;  4LEU A;  4LER A;  3V30 A;  2WXQ A;  3AG3 E;  1WDY A;  4AP2 A;  3UTM A;  3SBT B;  2DIW A;  4ANW A;  5CCL A;  3LVQ E;  5AJL A;  4B0Z A;  3SI5 A;  2CG2 A;  2KCV A;  4AY6 A;  5BV0 A;  2F8Y A;  4L2Y A;  3IEG A;  4RSY A;  4XEI G;  3PZ1 A;  4U07 A;  1KZO A;  4YDY A;  2XZD G;  3ZU7 B;  3FUN A;  1O5M A;  4C0E A;  3CVQ A;  2VGX B;  3L22 A;  4DK5 A;  3MZL B;  1TEZ A;  2OCC E;  3CHP A;  1OCC E;  3E4B A;  4ILI A;  2RFM A;  4ANX A;  3CHQ A;  2GRL A;  3FTX A;  3IHV A;  4LUN U;  1Y6I A;  4G8K A;  4I1M A;  4Y6W A;  3PNT B;  3EHN A;  2ZIS A;  2FO7 A;  3BEE A;  3AG4 E;  2DYR E;  4B8A A;  5ENN A;  3FUL A;  3KEZ A;  3R9M A;  1K1A A;  3E37 A;  5B1A E;  3AU5 A;  2WXL A;  3D9J A;  4CDM A;  3U64 A;  1FVF A;  2V5F A;  5EYL A;  3JYS A;  1H6P A;  4CEM A;  3HXE A;  2WMO A;  3PE3 A;  3FU6 A;  3SFY A;  1K1B A;  3HRA A;  1SA4 A;  3D9O A;  3CIA A;  4HVB A;  2ZGG A;  4D10 C;  3UT8 A;  2VGX A;  3B7R L;  1TNB A;  4APO A;  4BES A;  5AIJ A;  5AQA A;  5EIL A;  2MOW A;  3O4Z A;  5AQ7 A;  1OWO A;  1KZP A;  4DLO A;  3W9G A;  2AJA A;  2IFU A;  3MX3 A;  4RLY A;  4NIK A;  3UIO C;  2RG8 A;  2AVP A;  2P9N G;  4LNG A;  3NZU A;  1QZ2 A;  3ZNG A;  5AEN A;  1ZBP A;  2VYI A;  3FUK A;  3MEK A;  3R9A B;  3ABL E;  1SW6 A;  2PQR A;  5FQ4 A;  2PM7 A;  2XCB A;  4JL0 A;  1EF1 C;  3CVU A;  3SQV A;  3QNK A;  4KXK B;  3UT4 A;  4N3A A;  1N4S A;  4GA0 A;  1D9S A;  2LSV A;  3CVY A;  4EQF A;  5AYW D;  3UI2 A;  4U63 A;  4GTM A;  4Q69 A;  1A17 A;  4NQ0 A;  1N4Q A;  1NA3 A;  4GTR A;  4L7T A;  2IU1 A;  3D9P A;  4NRH B;  4UWK A;  3UKR G;  5AN8 A;  3IXE A;  3UT7 A;  3KD7 A;  1NL4 A;  1MX6 A;  3GZS A;  4XIF A;  1HO8 A;  2LXL A;  5FT9 A;  4LNU D;  4CRW A;  1SQM A;  3ASN E;  2WXI A;  5JJ6 A;  5KWD A;  4J8F A;  5AAO A;  2WM9 A;  5C2Y A;  5LCW C;  2JLB A;  4WWO A;  3UUX A;  4EZJ A;  3Q9N C;  4U8Y D;  4B89 A;  3PZ3 A;  3S2A A;  4TUU A;  3VLE A;  4DI3 A;  4GTS A;  1MX4 A;  3TWU A;  4U95 D;  3RIB A;  5CED B;  1TJF A;  3AG1 E;  3G2W A;  3ASF A;  2J49 A;  4XX5 A;  4GCO A;  1E8Z A;  1WAO 1;  4EZK A;  4ATZ D;  2GRP B;  2J07 A;  1HF8 A;  3CLJ A;  3E30 A;  4L23 A;  3TL5 A;  3UM3 A;  4C9B B;  3AAA C;  1Z6T A;  3W9F A;  3MCX A;  1KLX A;  4YVO A;  3OXG A;  3JUI A;  2IEJ A;  4GML A;  4XKB A;  3S7J A;  3S7B A;  3FUF A;  3B7T A;  3FTV A;  1H19 A;  3ESL A;  2QFC A;  3ASD A;  4ILH B;  3LJN A;  1X5B A;  1JWF A;  3LJ3 A;  3QJZ A;  5JJT A;  3ZPJ A;  5M72 A;  4CYM D;  1IYG A;  4EZL A;  3ZYQ A;  1UOH A;  1NA0 A;  2FUL A;  1N4P A;  4UWF A;  4IYP A;  4GMR A;  3LXU X;  2Y69 E;  4GZD A;  4BTA A;  4BFR A;  3ULE G;  3FHE A;  2KZT B;  1HX8 A;  2BF0 X;  2V4L A;  2P9S G;  3RRU A;  4JEH A;  4J6I A;  2PL2 A;  3CVX A;  4RG9 A;  4DUI A;  1DNP A;  2F37 A;  2ETB A;  3ASO E;  2AXV A;  3I3N A;  4N3C A;  3ISM C;  3TAX A;  1WG0 A;  2WQ6 A;  2JEK A;  2CHZ A;  2GRQ B;  4GYY A;  4Z68 A;  2VGY A;  4GZC A;  2E0I A;  4WNE A;  4WWN A;  1ELW A;  3SFZ A;  2Y0B G;  4J7W A;  4XI9 A;  4TXQ A;  3SHF A;  3CQG B;  3RK6 A;  4MRU A;  4HI9 A;  2HO1 A;  2IO2 C;  2KZT A;  3CGH A;  4GPM A;  2X6I A;  2UY1 B;  1SZA A;  2L0T B;  2KBX A;  4C48 B;  2XGO A;  2OV8 A;  3E32 A;  1N54 A;  3EU9 A;  4B8C B;  2OEV A;  3SBS A;  3ABK E;  3L16 A;  3FUJ A;  1IHG A;  3HG0 D;  3S7D A;  2ZGD A;  2NXP A;  5CRV A;  2BTD A;  3D9N A;  3B95 A;  3URZ A;  3PRE A;  3PDN A;  2MYO A;  4MKT A;  5D0O D;  3FUH A;  4XKC A;  4GYW A;  4J8D A;  3CV0 A;  1ELR A;  4KYO B;  3GZ1 A;  1OWP A;  1IXV A;  3RU0 A;  1MZC A;  2XRY A;  4H7X A;  1O1R A;  3NB2 A;  2F8X K;  3DPD A;  4NUR A;  4DRX E;  3FH5 A;  3C3O A;  5J90 A;  4AEZ C;  4GZ6 A;  4FJY A;  4U7E B;  4G8L A;  1LTX A;  3Q4A B;  4UQY A;  2EIK E;  5ENT D;  4DX6 D;  3GZ2 A;  4TV3 A;  3DEO A;  3APF A;  2P9P G;  3ENE A;  1H6K A;  2F0Y A;  4HXI A;  3MKQ A;  3UXG A;  4O60 A;  2CFZ A;  1YA0 A;  4W9R A;  2JAB A;  3FEX A;  4O1O A;  4KMO A;  4DI4 A;  3ZVV A;  5T4Y A;  1UN9 A;  3ZEF A;  3KS2 A;  3DST A;  1MHQ A;  2P9L G;  3PEU B;  3CK8 A;  1HXI A;  3Q15 A;  5CHE E;  3PZ4 A;  3KSQ A;  4G1T A;  2LUH A;  3HHM A;  2WVI A;  3ZXP A;  5KJM A;  3B7U X;  2Y1L E;  3DSS A;  5JJ7 A;  4IUL A;  2C0L A;  2P2C P;  2AXU A;  5KNH D;  1JCR A;  3G2U A;  2GW1 A;  2WXO A;  4BT9 A;  2WPV A;  2WXN A;  1EYH A;  3AU4 A;  4DX2 A;  3HYM B;  3LY7 A;  2BKG A;  3DXK G;  4J0U A;  2X38 A;  2DBA A;  1OCR E;  1QNF A;  2WXP A;  2XGS A;  3PH0 C;  4HBD A;  1UW4 B;  2NYJ A;  3UQ3 A;  4I9C A;  2VSX E;  3AS5 A;  4C0M A;  3BUA A;  1E7V A;  1MQS A;  3EHQ A;  2YHC A;  4N3B A;  5CRU A;  2HYZ A;  4ABN A;  4FAD A;  2R59 A;  3NAW A;  3EDT B;  4TXP A;  1DCE A;  4N5C A;  3SO8 A;  5FQ8 A;  5EN5 D;  3I5P A;  3NQP A;  5HQ8 A;  2P9K G;  3CHM A;  1IHB A;  4HOT A;  4PS3 A;  4WWP A;  2HM8 A;  1E90 A;  2J09 A;  2R05 A;  4AJW A;  2LXM A;  4I1A A;  3X2Q E;  3APC A;  4I17 A;  1E8W A;  4U0Z A;  4APF A;  2BED A;  4UI9 J;  4TRQ A;  2L9B A;  5G2N A;  5T8I A;  2J08 A;  1WY6 A;  3MV3 B;  5BPP A;  4J8S A;  1JUQ A;  1FT2 A;  5FTP A;  4U04 A;  1SZ9 A;  2CHW A;  5HRY A;  2WXK A;  4RQI A;  4ZHB A;  5J08 A;  3SZ7 A;  1QQE A;  1MX2 A;  2J4B A;  1O1T A;  3PE4 A;  3FH8 A;  4FLH A;  3VLD A;  4KBQ A;  3L6A A;  2UWJ G;  2FBN A;  1BLX B;  3L82 A;  4UI9 C;  4BER A;  3QWP A;  3U9W A;  3ZKJ A;  4RVB A;  3FTY A;  2YHE A;  2KC7 A;  3FEY A;  4HQD A;  2FF4 A;  5ENS D;  1SA5 A;  1B89 A;  2VSY A;  5FIN A;  2PQN A;  4CT4 A;  2I1K A;  1U3C A;  4GCN A;  4K0R A;  2XPI A;  1VDY A;  4FC8 A;  2ZIR A;  1IKN D;  2CG3 A;  1Z3Y A;  1N11 A;  2OND A;  3Q78 A;  3LYA A;  1S64 A;  4LSZ E;  2OOE A;  2R02 A;  3CQC B;  1S0P A;  3CK7 A;  5CER B;  5ITZ F;  4AVX A;  3L54 A;  4AY5 A;  1HG2 A;  4BSX A;  5KCM A;  1H0A A;  5HKP A;  2ZU6 B;  3HXC A;  3Q73 A;  3ONL A;  3LPZ A;  1UJK A;  3HXB A;  1GW6 A;  4LRZ A;  2XS8 A;  2P9U G;  1QBQ A;  5ENQ D;  3TXN A;  3EHM A;  2EIN E;  2IOL A;  4G26 A;  2R5S A;  3N71 A;  4I1O B;  3FP3 A;  2EIM E;  4G25 A;  4UQZ A;  3FTW A;  3ESK A;  4I2W A;  3CHO A;  5LOZ A;  3RSE G;  3HVE B;  3Q49 B;  3L08 A;  5BNW A;  4HLE A;  4O1P A;  2R2L A;  2WMN A;  2Q7F A;  4JPS A;  3FTZ A;  2J9Q A;  2RFA A;  1KT1 A;  4MS6 A;  1LD8 A;  1UG3 A;  3RJV A;  3IHY A;  4A55 A;  3EHR A;  2EQX A;  2WQH A;  4JC8 A;  1NI1 A;  4WNG A;  5C1D A;  4PUC A;  1FPP A;  3FU0 A;  5FJY A;  3CEQ A;  4M3O A;  5B1B E;  1HU3 A;  2XHE A;  3UMV A;  2R17 C;  4IRU A;  4A3V A;  1LD7 A;  3ZYL A;  4LG6 A;  1OWM A;  4OAV B;  3VTY A;  5AAR A;  4ANV A;  3CSF A;  2NSZ A;  2P58 C;  3IBE A;  4P29 A;  4J8Y A;  4E6H A;  4DX1 A;  3KSL A;  3D3M A;  3ZN3 A;  1E7U A;  3ZW3 A;  5ENP D;  3J5Q B;  1Y8M A;  4YVQ C;  2I2O A;  3FUD A;  3EJN A;  2AW6 A;  3O48 A;  3GW4 A;  2B0O E;  4UQX A;  1RW2 A;  5ANR A;  5EKQ D;  1KT0 A;  1N0R A;  3R7Q A;  3ULY A;  4GTQ A;  2IOS A;  2YQ8 A;  3D9I A;  4JA9 A;  4F3V A;  2ETA A;  5DBK A;  2A5U A;  2A4Z A;  4X8Q A;  2VQ2 A;  1N94 A;  5CEA A;  3I4R B;  5AJD A;  1MYO A;  1Q2Z A;  4KVO A;  4RG6 A;  4AM9 A;  4CCA A;  3JXJ A;  1NFI E;  4GZ5 A;  4DPR A;  1BI7 B;  3R7R A;  4HRN A;  3LEW A;  2L0I A; 
#chains in the Genus database with same CATH homology
 2NYJ A;  1DCQ A;  2XEE A;  4K5B A;  3EHR A;  1AP7 A;  5ENS D;  4ATZ D;  4DUI A;  5CBN A;  2F37 A;  2ETB A;  1YCS B;  1S70 B;  2VGE A;  5KBA A;  4G8L A;  4UUC A;  3TWV A;  5FIN A;  2RFM A;  5ENT D;  3NBN B;  2PNN A;  1WG0 A;  4HB5 A;  5BXU A;  3EHQ A;  3AAA C;  3D9H A;  4A63 B;  3W9F A;  4DX6 D;  3TWX A;  5JA4 D;  3JUE A;  3KEA A;  4G8K A;  3TWQ A;  4CZ2 D;  1IKN D;  3DEO A;  4TUM A;  3C5R A;  1N11 A;  1D9S A;  5KNG A;  4BSZ B;  2DZO A;  3SO8 A;  4HLL A;  5D66 A;  5EN5 D;  3F6Q A;  2HE0 A;  3UI2 A;  3UXG A;  4Z68 A;  4OAU C;  4O60 A;  2V4H C;  4B93 B;  3AJI A;  1IHB A;  4LG6 A;  1DC2 A;  4LSZ E;  1QYM A;  2JAB A;  4HNA D;  1YYH A;  1BD8 A;  4F1P A;  5EIB E;  2Y0B G;  1K1A A;  4OAV B;  5AAR A;  5CER B;  3NOC D;  4HI8 A;  4HRM B;  1BU9 A;  4O1O A;  5ITZ F;  1K3Z D;  1YMP A;  4J7W A;  3V79 K;  4HRL A;  5EYL A;  2A5E A;  4U96 D;  3JXI A;  5AN8 A;  4DX7 D;  3IXE A;  5HKP A;  3LJN A;  4J8Y A;  4U8V D;  4DX1 A;  1A5E A;  4N5Q A;  1SVX A;  5BXO A;  1OY3 D;  1MX6 A;  4HI9 A;  5ENR D;  3TWW A;  2L6B A;  3V31 A;  4GPM A;  1N0Q A;  1BI8 B;  1K1B A;  5ENP D;  3HRA A;  3DEP A;  5HS0 A;  3V30 A;  3J5Q B;  4LNU D;  4CYM D;  2KBX A;  2ZGG A;  3T9K A;  4C48 B;  4YDW A;  1WDY A;  1TR4 A;  1UOH A;  2B0O E;  4BES A;  3EU9 A;  5ENQ D;  2V5Q C;  4ZFH A;  3ZUV B;  4K5A B;  5HRY A;  3UTM A;  2XEN A;  5KWD A;  2Y1L E;  5AAO A;  5AQA A;  5EID A;  5EIL A;  2XZT G;  3HG0 D;  4BET A;  2ZGD A;  4GMR A;  2P2C P;  2FO1 E;  2XEH A;  4ZHB A;  4QFV A;  1N0R A;  5EYP F;  2DVW A;  3B95 A;  5KNH D;  3J5P A;  3T8K A;  4K5C A;  5AQ7 A;  3NOG D;  1MX2 A;  2MYO A;  3Q9U C;  5FIO A;  2ETA A;  2AJA A;  2DWZ A;  3Q9N C;  5ENO D;  5JMN D;  3W9G A;  4F6R D;  5CBO A;  2ETC A;  2J8S D;  4RLY A;  2BKK B;  4U8Y D;  4NIK A;  4DX5 D;  2F8Y A;  3TWS A;  3B7B A;  5CEA A;  4DX2 A;  5AQB A;  1IXV A;  4QQI A;  2KXP C;  4O1P A;  4BEP A;  1BLX B;  2BKG A;  4YDY A;  3ZNG A;  2QC9 A;  1MX4 A;  1MYO A;  2XZD G;  4JB8 P;  3ZU7 B;  4BER A;  1MJ0 A;  3TWU A;  2DZN A;  4U95 D;  1G3N B;  3ZKJ A;  2QYJ A;  3JXJ A;  1NFI E;  2RFA A;  5CED B;  2F8X K;  5AQ9 A;  5CEC B;  3V2X A;  4HBD A;  4DRX E;  3TWR A;  1BI7 B;  1AWC B;  1SW6 A;  1OT8 A;  3TWT A;  4HQD A;  4HRN A;  3V2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...