3ASOE

Bovine heart cytochrome c oxidase in the fully oxidized state measured at 0.9 angstrom wavelength
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title Distinguishing between Cl- and O2(2-) as the bridging element between Fe3+ and Cu2+ in resting-oxidized cytochrome c oxidase
pubmed doi rcsb
total genus 40
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 3asoE00
5B1BE 3X2QE 1OCCE 3AG1E 2ZXWE 1V55E 5B3SE 3AG3E 3ABLE 1OCOE 3ASOE 2DYRE 2EIKE 2EINE 2OCCE 2Y69E 2EIJE 2DYSE 3AG2E 3ABKE 2EIME 3ASNE 3AG4E 5IY5E 1V54E 3ABME 1OCRE 2EILE 1OCZE 5B1AE 3WG7E
chains in the Genus database with same CATH superfamily
2OVFA 2V5FA 2FF4A 1MHQA 4LRZA 4N5QA 4AVXA 2V0PA 3I5PA 3SI5A 4Q69A 2DVWA 4HRMB 2KM4A 4J8YA 2OOEA 3CK9A 4G11A 2XS1A 4F53A 4FU3A 4L23A 1BU9A 2LXLA 4GMJA 4N5CA 1KZPA 2QZAA 2I1KA 4CDNA 2XPZA 1QZ2A 2M63A 3ULQA 3U4TA 3ULEG 4AJWA 3DSSA 1BPOA 3HRAA 2BF0X 4WAFA 4Q96A 5BW8C 2XQ0A 4K5BA 3ZYMA 1IYGA 3SZ7A 1ELKA 3SFYA 1EDUA 3SD5A 4TXQA 3IHYA 5FQ7A 4HQDA 4H7YA 4B8CB 3CHOA 3LCAA 3NB2A 1FT1A 1Y8MA 5D0OD 2VSNA 4JHKA 3MA5A 4GTRA 1JWFA 1NL4A 4Q94A 2OEVA 3FULA 3UT7A 4ANVA 4G25A 3VLFA 3C3OA 3ASNE 3D9PA 3S7BA 4HVBA 2X6KA 2J09A 3QC1A 1WAO1 1FVFA 2J08A 3QWVA 4L7TA 3JQ0A 1A5EA 3UINC 1TNUA 3TL5A 1N0QA 2XRYA 1DNPA 4BEPA 4EPZA 4NACA 2GW1A 4B94A 1LTXA 2RD0A 4FJZA 4DLOA 4JB8P 4WWOA 2IFUA 4CDRA 4LNGA 4J8EA 4JPSA 2XCCA 2DCPA 1HXIA 2XPYA 1AWCB 2PQRA 4U8VD 2HE0A 3HXBA 3ZYKA 3JUEA 3QARA 4LEUA 1Z5SC 4CT4A 3LY8A 3AG1E 3MV2B 3PEVB 2AJAA 3HIZA 1YYHA 3T9KA 2BUGA 3S7JA 3ZHEB 3ZN3A 1K3ZD 3FUKA 4GTOA 3W9GA 5ARGA 2GRPB 4GCOA 4KMOA 3Q75A 5ENNA 3L54A 2X3MA 3QJZA 4KVMA 3GW4A 3L9TA 2X6FA 3AAAC 4PH4B 4EQFA 5ANRA 4ANXA 1XGWA 3TAXA 1MX4A 3SO8A 2XZDG 1IQRA 3ESLA 3TWQA 1W3BA 3TXNA 4I2ZA 5CRVA 2IQCA 3CVVA 4RSYA 4BTAA 4I6GA 5FZSA 4G8LA 3ZPJA 3O4ZA 3TGOA 2QC9A 1HX8A 4XI9A 1TNZA 4JW1A 5CRUA 3TXMA 3ASDA 3HG0D 3LY7A 5AQ7A 4GA2A 1Y6IA 4RG6A 3AU5A 4Y6WA 3ISMC 2P58C 1INZA 3AG4E 2PL2A 3PZ2A 4A1GA 5G04J 1N4SA 2EILE 1TN6A 3GZ1A 3MV3B 3ZRHA 5A6CA 1DVPA 3C98A 4XKBA 3GYZA 5AENA 4UI9J 3QK0A 1HO8A 5FT9A 3KAEA 3D9IA 4C0MA 4I6EA 4MS6A 1H6PA 2LUHA 3W9FA 3ABME 2HO1A 1WY6A 4AY5A 3FH5A 4GTTA 3X2QE 4WNGA 1ELWA 3EJNA 1JCQA 1HZ4A 2EINE 3EU9A 1JCSA 2OEWA 3SHFA 2DYSE 4I9EA 2J49A 4TXRA 3PNTB 3ZU7B 2VGEA 1WM5A 5B1BE 3CQCB 1MX2A 3PREA 1E8XA 3EDTB 3MKQA 3QKYA 1NA0A 2BKKB 1EF1C 3BUAA 3ZEFA 4HBDA 2F8XK 5JHBA 4HS2A 2JEKA 2VJ8A 4N3AA 4CRWA 1UJKA 1V55E 4WNDA 5T4YA 2GRNB 1LD7A 4F1SA 1N52A 2WMNA 3I3NA 1D8EA 1DC2A 5EIDA 1HFAA 4EBAG 1FVHA 5KBAA 4A63B 4HI9A 2QYJA 4HORA 2RFMA 3B7TA 5KCMA 1YMPA 2WXRA 3LYAA 2IY0C 2MYOA 2R17C 1XNFA 2X6JA 3JYSA 3HHMA 4ABNA 3JUIA 4GTQA 3HXFA 2V5QC 2E0IA 4J8FA 3IEGA 3D9LA 4CZ2D 3DPDA 3FY4A 4YNDA 5ENSD 1TN8A 3QNKA 5EDSA 4BERA 2GGFA 2C0MA 3DSVA 3Q9NC 3URZA 2I2OA 3I4GA 4J6IA 4L2YA 5BT1A 2YNQA 3E34A 4YVQC 3FU6A 5D0QD 2OV8A 3KS2A 4UQYA 3UMVA 5BV1A 3NOCD 3PZ1A 5D66A 5JMND 3P2BA 3K9IA 3CHQA 4DLQA 2FBNA 3UKUG 3QWPA 4B89A 1B89A 1HU3A 3PE3A 3ZFWA 4BX8A 3ZIMA 3L17A 4OAVB 1QBQA 1WDYA 1JUQA 4CYMD 3DWLG 2LSVA 1YCSB 2XGMA 3FUFA 5DBKA 2GRMA 4F1PA 2P9KG 3TWSA 2C0LA 3LVQE 4BFRA 4DPRA 3G2UA 3RIBA 3B7BA 4U96D 1E8YA 3D9NA 4UUCA 4IRUA 1HS6A 3LKUA 3UT8A 4HB5A 4F6RD 3Q73A 4Y6CA 5ENPD 2XEHA 1GW6A 3CK8A 3D9OA 1TYQG 5HS0A 3ZUVB 3R9AB 2PM7A 4QFVA 4GCNA 4MRUA 2P9LG 3BEEA 4R7LA 4HLLA 2RFAA 4GA1A 3TWRA 4FJYA 2Y3AA 1N94A 1OXJA 3D9JA 4TXPA 2DWZA 3EHMA 2VSYA 2L6BA 4LNUD 4N3CA 4G8KA 3OXFA 3CVNA 4U7EB 5CECB 2I6HA 4M3OA 2EIJE 3TWTA 3CVWA 4HOQA 3MGBA 5LFAA 4GPMA 2J8SD 1IHBA 3L22A 2XZTG 2WXGA 3MKRA 2CFZA 5CEAA 2ETAA 4K5CA 3UUXA 2WB2A 4AIFA 3LJ3A 2LSUA 4DX2A 2HYZA 1OWNA 4U63A 2IOLA 3JXIA 3B13A 4E6HA 2CHZA 1L5JA 1Z3XA 3IV0A 5J90A 3CVPA 4JEUA 4ZHBA 4GZ6A 2ZGDA 2L0TB 4LERA 3RAUA 1NZNA 5D2MC 2MRIA 4OVVA 4ILIA 4U04A 1PC2A 5AYWD 2PM6A 4DX7D 3L6AA 3FEYA 4UQXA 5AAOA 3ZXPA 3Q78A 4F7AA 1FT2A 3B7RL 4KYOB 2VSOE 5T8IA 3S7FA 3T5XA 4CT0A 2WXHA 3RJVA 5AQ9A 3UKRG 4V3IA 5DIZA 3QB2A 2QFCA 2KC7A 4H7XA 4B93B 4G23A 3Q15A 2VTBA 5AJDA 2EIKE 5EIBE 5FQ4A 3APFA 2LAHA 3HDXA 1D8DA 4FLHA 3CKCA 3NF1A 1E90A 2WXNA 2BEDA 3OXGA 2A4ZA 3Q9UC 1O1TA 3UIPC 3RO2A 2R03A 3R7RA 1A17A 4ME2A 5AJLA 4DUIA 5G05C 2WXPA 4UQZA 4YVOA 1IKND 5CCMA 4I2WA 4O1OA 3V79K 3C72A 4YDYA 1Q2ZA 4AP2A 1OT8A 2YQ8A 2AWIA 3G2SA 2Y4TA 1SZAA 4ANWA 4XKCA 4HI8A 2IO3C 2WXOA 3PRZA 4U8YD 1SVXA 1JCRA 4B0ZA 5G2NA 3PS6A 2UWJG 2AW6A 3GZSA 1X5BA 2ZIRA 4QQIA 2GRQB 3RO3A 3AS8A 3FTXA 3T8KA 2V8SE 4J8DA 4WNEA 2WXIA 4ZFHA 3CHRA 4TV3A 1NFIE 3NQPA 4OYSA 4WWPA 5B3SE 4IN3B 1TNBA 1E7UA 2ILRA 3EHRA 3ASFA 3TJPA 2IOSA 4FP7A 4GZCA 3DRAA 3KSLA 2IU1A 3UXGA 4YDEA 2DBAA 3GZ2A 4FLBA 1N9AA 3WG7E 4M7CA 4BSZB 4J0UA 1DCEA 3DEOA 1HE8A 2P9IG 5AIJA 2WXFA 4AOFA 2F37A 3NOGD 3PE4A 2P2CP 5LCWJ 3E30A 3N71A 3QOUA 3NBNB 2Y4UA 4APOA 3LS8A 1FPPA 4PUCA 2VQ2A 3U64A 1ZU2A 2KBXA 3FFLA 1H2VC 2UY1A 2FULA 4HOTA 4I17A 2CG2A 4JD2G 4DI4A 3OAWA 3O48A 4U07A 1OCZE 3UIOC 3KEZA 3CKBA 5C2YA 2P9UG 3U9WA 2XRZA 3SBTB 1MQSA 2IONA 3CVUA 3PH0C 1S0PA 4DK5A 4DRXE 1RZ4A 1G3NB 1OWLA 2BKGA 3FWVA 5E76A 3ML9A 1JPLA 1VDYA 4YDWA 5KJMA 4UWFA 2FI7A 3J5PA 3FUEA 5HKPA 3UM3A 3MX3A 3L82A 3LPZA 3HYMB 3NAWA 2KCKA 4GTVA 5FQ6A 4EHMA 4O6FA 3TG5A 3T8MA 3QAQA 3F6QA 1N0RA 5ENTD 4ILHB 4WUYA 3NZSA 4EECA 2XPIA 4I43A 4D10C 4ACLA 3DSXA 2WXQA 2FO7A 4DI3A 2GRRB 3PEUB 2V4HC 3FUJA 4GTMA 5BNWA 4TUMA 3AS5A 1QNFA 2AXZA 2YINA 2XGSA 2NC9A 4JA7A 4JC8A 2OCCE 2WXMA 2VTBB 1OWPA 4FHJA 5EILA 3ML8A 3PZ4A 1BI7B 2F8YA 3P1UA 1HG5A 4WWNA 4G24A 5LP0A 5A7DB 3OXLA 5G04C 1SW6A 2VGYA 3KSQA 5EN5D 1OUVA 5BXUA 4XX5A 4MKTA 4HOUA 1H6OA 3FHEA 4UI9C 4U0UA 3E33A 3E32A 1OY3D 2PZIA 4AXHA 3ZYLA 4BESA 4DX1A 2VGXA 4BT9A 5KJKA 4LNBA 3LJNA 3TWVA 4I1OB 5ENOD 2QYUA 1P5QA 1MYOA 4FC8A 3CHPA 4KVOA 1Z3YA 3FTZA 2ZISA 3C5RA 1KPSB 1TR4A 3D9HA 2WVIA 3LXUX 4CEMA 2WM9A 3BU8A 2Y1LE 4J7WA 2WXLA 4O60A 4XEIG 2KZTA 2P9NG 3PZDA 5B1AE 1AP7A 3S2AA 5T3RA 5ARFA 1OCCE 3RKVA 3B7UX 4JHRA 5FJYA 4URKA 4BTBA 4FHKA 3APCA 4UWHA 1TN7A 3SGHA 1UW4B 3Q7AA 1HF8A 4NURA 4N3BA 2RG8A 3KD7A 5E75A 3EHQA 1E8WA 5HQ8A 5CEDB 3DXKG 2AXVA 2H6HA 1S63A 1NI1A 4GMLA 3Q7FA 2C2LA 4ACKA 1SQMA 1YA0A 3KEAA 4XE0A 1UN9A 3PZ3A 1BI8B 3SF4A 3DEPA 4HFGA 4RVBA 5FZQA 2LNIA 3HXCA 5JJTA 3B7SA 3LDZA 3MYVA 1N4RA 3PVLA 4N39A 2LXMA 2UY1B 4J8SA 4RQIA 2CHXA 4FULA 4NQ0A 3RRUA 3G2VA 1UN8A 1S64A 2VSXE 2AVPA 3OTNA 4GYYA 3VLDA 3CHMA 1SZ9A 4XZ4A 3NZUA 4NIKA 2YHEA 4YDOA 4GZ3A 2KXPC 4U0SA 4PS8A 3R9MA 1OWOA 2JABA 2X6IA 4KBQA 5KNHD 3CVQA 3FH8A 1RW2A 5G05J 5C1DA 4BWRA 2H6GA 4APFA 5EYPF 3PNLB 3EIQC 1BLXB 3CIAA 5A23A 3UPVA 3Q49B 4HLEA 2FO1E 3ASGA 3MKQB 3IXEA 3LVRE 4GTPA 1S70B 4F3VA 3Q79A 1U3CA 4X8QA 4WNFA 1IXVA 4ANUA 2IEJA 4K5AB 2LO6A 1ZB1A 2WMOA 3CLJA 2XENA 4DX5D 3JCKC 2HR2A 1LF8A 2P9SG 4KZ0A 2WPVA 3FU3A 3CGHA 3VTYA 3WXXA 3D3MA 1SA5A 2CFUA 1MZCA 4W9RA 4U95D 2H6FA 1OCOE 5BPPA 2J07A 5ANLA 3HVEA 4FADA 4BY6A 3FUNA 4PDXA 3CV0A 5JJ7A 3ZW3A 3EUVA 2KATA 1QQEA 1Z6TA 1O1SA 1TNYA 2DZNA 5BV0A 2DZOA 2EQXA 3CEQA 2L9BA 3AS4A 3EIJA 5CHEE 4BX9A 3FTYA 2IJGX 5JJ6A 3RSEG 2I9CA 4A1SA 4RG9A 2EIME 2IO2C 1BD8A 4UWKA 4LCTA 4TRQA 2XEVA 5FWQA 4DJAA 4XI0A 4KT6B 4C9BB 4EZJA 1O5MA 4N2SA 2R59A 1N4PA 5LOZA 4CGWA 4BSXA 5ITZF 4EZKA 2HM8A 4P29A 5KWDA 1UG3A 4CDMA 2QY7A 1PAQA 4GZ5A 2WQ6A 4IYPA 4B8AA 2VGXB 3T5VA 2J4BA 3FTSA 3V30A 1DCQA 3ZKJA 3TWUA 2A5UA 1N95A 1U2VG 4A55A 2F0YA 4HXIA 3ENEA 1KT1A 1U3DA 4AY6A 2R05A 3ONLA 5ENQD 3CK7A 4A3VA 3CVXA 5CBOA 3JXJA 2B6CA 3MJWA 1HG2A 2E2EA 3ZNGA 2KZTB 3AJIA 4BETA 3SNXA 1X81A 4ATZD 4UI9K 2Y0BG 2MHKA 5BUZA 5J08A 4KZCA 4FA6A 4GA0A 1MJ0A 3IBEA 1UOHA 5JHAA 1H2TC 5HRYA 3APDA 1KZOA 4KXKB 3UM2A 3U3WA 3AU4A 4U8HA 1D9SA 1H0AA 2NSZA 4K0RA 3ULYA 3FUHA 4JVSA 4GTSA 4JXTA 3S7DA 3FUMA 2H6IA 3MEKA 4UWLA 4GYWA 3RU0A 3TG4A 1H6KA 3DSWA 5CERB 3RRNB 3L16A 3BQOA 2ETCA 2L0IA 3DXMG 3FU0A 1EYHA 3E4BA 1WG0A 4I6JA 5AN8A 3V2OA 5LX8A 2NYJA 2R5SA 3QWWA 4U0ZA 2R2LA 3IHVA 4PS3A 3TWWA 1ELRA 4I1AA 4BT8A 5M72A 3ONKA 1EPUA 1TJCA 4K03A 3SQVA 2YHCA 3DPYA 1NP7A 3HXDA 2XS8A 3TWXA 1TEZA 3FTWA 5FQ8A 3FU5A 4L1BA 3SY2A 4N2QA 2X6HA 2AXUA 3Q4AB 5FZRA 1N4QA 2MOWA 2ONDA 2J4DA 3FDHA 3L08A 4JHJA 2FEZA 2ETBA 3LEWA 3FEXA 3ZYQA 3UTMA 3DSTA 4DX6D 3E37A 2ZU6B 2GROB 3V31A 4IULA 1KT0A 3EHNA 3IKOB 2X38A 4GU5A 1FCHA 4GB9A 4MBGA 3HXEA 3CSTA 1N11A 4ATGA 2J9QA 4UWGA 1OWMA 5JA4D 5FINA 2XEEA 4EZLA 3EU5A 2B0OE 3B95A 3VLEA 1H19A 3LY9A 1UJJA 2XGOA 4GAAA 2ZGGA 3HVEB 4AM9A 5G55A 2WQ7A 3SBSA 4I1MA 1QYMA 3U66A 4JL0A 3C3QA 3D9MA 1MX6A 3UM1A 1K1AA 3DSUA 2WXKA 2LAIA 1SA4A 3FTUA 4ILGA 3BG0B 3Q5MA 3I4RB 3CVYA 5AQAA 3ZVVA 4RLYA 4LG6A 3FUDA 3FUIA 3UT4A 3D9KA 3FP3A 4CGVA 2XHEA 3Q47B 2DIWA 5LCWC 2ZXWE 3FTVA 4LUNU 4C48B 2OVBA 4XIFA 3ZXSA 1H2UA 4GYOA 2CHWA 3J5QB 3CR3A 3V2XA 1NA3A 1K1BA 4I9CA 3MCXA 4OVUA 3AG3E 2Q7FA 3ABLE 3SFXA 4PS7A 2DYRE 3G2WA 4L9PA 1E96B 5AQBA 3ABKE 3CHSA 2IF4A 3UQ3A 3L13A 2NXPA 3BG1B 3ASHA 5AARA 5EX3A 5ENRD 5CMYA 5KNGA 2I1JA 3G2TA 3CVLA 5FIOA 1HH8A 5CCLA 4HRLA 2P9PG 3FH7A 3CSFA 1TNOA 1PY1A 5FTPA 4AV7A 5CMWA 1LD8A 3C3RA 4HRNA 4E85A 1IHGA 4G26A 1IQUA 1TJFA 4NRHB 3ZHEA 3QDNA 4HNAD 4A3TA 3JQ1A 2XCBA 4CCAA 2WQHA 3PUJA 4G2VA 2WXJA 4JA9A 1K8KG 3ASOE 3PUKA 4GPKA 3ZGQA 4O1PA 2JLBA 3UI2A 3AG2E 1E7VA 1N54A 2KCVA 2V4LA 1OCRE 2L6JA 1ZBPA 3DBSA 5CBNA 3VTXA 3RRMB 1O1RA 2CG3A 2PQNA 1E8ZA 5H7PA 5BXOA 4MLPA 1JWGA 2Y69E 3CQGB 3R7QA 4TUUA 5IY5E 1V54E 3UX4A 4L2LA 4EBAA 3PDNA 4C0EA 3RK6A 2PNNA 4G1TA 5KJLA 4OAUC 1KLXA 4GZDA 5KJNA 2KCLA 4GMRA 3ESKA 2RKKA 2VYIA 5HI7A 3SFZA 5EX0A 2BTDA 4HOSA 2R02A 3MZLB 4JZYA 5EYLA 2A5EA 5EKQD 4JEHA 4AEZC 4LSZE 2GRLA 4Z68A 3UM0A
chains in the Genus database with same CATH topology
5B1BE 3X2QE 1OCCE 3AG1E 2ZXWE 1V55E 5B3SE 3AG3E 3ABLE 1OCOE 3ASOE 2DYRE 2EIKE 2EINE 2OCCE 2Y69E 2EIJE 2DYSE 3AG2E 3ABKE 2EIME 3ASNE 3AG4E 5IY5E 1V54E 3ABME 1OCRE 2EILE 1OCZE 5B1AE 3WG7E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B1B E;  3X2Q E;  1OCC E;  3AG1 E;  2ZXW E;  1V55 E;  5B3S E;  3AG3 E;  3ABL E;  1OCO E;  3ASO E;  2DYR E;  2EIK E;  2EIN E;  2OCC E;  2Y69 E;  2EIJ E;  2DYS E;  3AG2 E;  3ABK E;  2EIM E;  3ASN E;  3AG4 E;  5IY5 E;  1V54 E;  3ABM E;  1OCR E;  2EIL E;  1OCZ E;  5B1A E;  3WG7 E; 
#chains in the Genus database with same CATH topology
 2OVF A;  2V5F A;  2FF4 A;  1MHQ A;  4LRZ A;  4N5Q A;  4AVX A;  2V0P A;  3I5P A;  3SI5 A;  4Q69 A;  2DVW A;  4HRM B;  2KM4 A;  4J8Y A;  2OOE A;  3CK9 A;  4G11 A;  2XS1 A;  4F53 A;  4FU3 A;  4L23 A;  1BU9 A;  2LXL A;  4GMJ A;  4N5C A;  1KZP A;  2QZA A;  2I1K A;  4CDN A;  2XPZ A;  1QZ2 A;  2M63 A;  3ULQ A;  3U4T A;  3ULE G;  4AJW A;  3DSS A;  1BPO A;  3HRA A;  2BF0 X;  4WAF A;  4Q96 A;  5BW8 C;  2XQ0 A;  4K5B A;  3ZYM A;  1IYG A;  3SZ7 A;  1ELK A;  3SFY A;  1EDU A;  3SD5 A;  4TXQ A;  3IHY A;  5FQ7 A;  4HQD A;  4H7Y A;  4B8C B;  3CHO A;  3LCA A;  3NB2 A;  1FT1 A;  1Y8M A;  5D0O D;  2VSN A;  4JHK A;  3MA5 A;  4GTR A;  1JWF A;  1NL4 A;  4Q94 A;  2OEV A;  3FUL A;  3UT7 A;  4ANV A;  4G25 A;  3VLF A;  3C3O A;  3ASN E;  3D9P A;  3S7B A;  4HVB A;  2X6K A;  2J09 A;  3QC1 A;  1WAO 1;  1FVF A;  2J08 A;  3QWV A;  4L7T A;  3JQ0 A;  1A5E A;  3UIN C;  1TNU A;  3TL5 A;  1N0Q A;  2XRY A;  1DNP A;  4BEP A;  4EPZ A;  4NAC A;  2GW1 A;  4B94 A;  1LTX A;  2RD0 A;  4FJZ A;  4DLO A;  4JB8 P;  4WWO A;  2IFU A;  4CDR A;  4LNG A;  4J8E A;  4JPS A;  2XCC A;  2DCP A;  1HXI A;  2XPY A;  1AWC B;  2PQR A;  4U8V D;  2HE0 A;  3HXB A;  3ZYK A;  3JUE A;  3QAR A;  4LEU A;  1Z5S C;  4CT4 A;  3LY8 A;  3AG1 E;  3MV2 B;  3PEV B;  2AJA A;  3HIZ A;  1YYH A;  3T9K A;  2BUG A;  3S7J A;  3ZHE B;  3ZN3 A;  1K3Z D;  3FUK A;  4GTO A;  3W9G A;  5ARG A;  2GRP B;  4GCO A;  4KMO A;  3Q75 A;  5ENN A;  3L54 A;  2X3M A;  3QJZ A;  4KVM A;  3GW4 A;  3L9T A;  2X6F A;  3AAA C;  4PH4 B;  4EQF A;  5ANR A;  4ANX A;  1XGW A;  3TAX A;  1MX4 A;  3SO8 A;  2XZD G;  1IQR A;  3ESL A;  3TWQ A;  1W3B A;  3TXN A;  4I2Z A;  5CRV A;  2IQC A;  3CVV A;  4RSY A;  4BTA A;  4I6G A;  5FZS A;  4G8L A;  3ZPJ A;  3O4Z A;  3TGO A;  2QC9 A;  1HX8 A;  4XI9 A;  1TNZ A;  4JW1 A;  5CRU A;  3TXM A;  3ASD A;  3HG0 D;  3LY7 A;  5AQ7 A;  4GA2 A;  1Y6I A;  4RG6 A;  3AU5 A;  4Y6W A;  3ISM C;  2P58 C;  1INZ A;  3AG4 E;  2PL2 A;  3PZ2 A;  4A1G A;  5G04 J;  1N4S A;  2EIL E;  1TN6 A;  3GZ1 A;  3MV3 B;  3ZRH A;  5A6C A;  1DVP A;  3C98 A;  4XKB A;  3GYZ A;  5AEN A;  4UI9 J;  3QK0 A;  1HO8 A;  5FT9 A;  3KAE A;  3D9I A;  4C0M A;  4I6E A;  4MS6 A;  1H6P A;  2LUH A;  3W9F A;  3ABM E;  2HO1 A;  1WY6 A;  4AY5 A;  3FH5 A;  4GTT A;  3X2Q E;  4WNG A;  1ELW A;  3EJN A;  1JCQ A;  1HZ4 A;  2EIN E;  3EU9 A;  1JCS A;  2OEW A;  3SHF A;  2DYS E;  4I9E A;  2J49 A;  4TXR A;  3PNT B;  3ZU7 B;  2VGE A;  1WM5 A;  5B1B E;  3CQC B;  1MX2 A;  3PRE A;  1E8X A;  3EDT B;  3MKQ A;  3QKY A;  1NA0 A;  2BKK B;  1EF1 C;  3BUA A;  3ZEF A;  4HBD A;  2F8X K;  5JHB A;  4HS2 A;  2JEK A;  2VJ8 A;  4N3A A;  4CRW A;  1UJK A;  1V55 E;  4WND A;  5T4Y A;  2GRN B;  1LD7 A;  4F1S A;  1N52 A;  2WMN A;  3I3N A;  1D8E A;  1DC2 A;  5EID A;  1HFA A;  4EBA G;  1FVH A;  5KBA A;  4A63 B;  4HI9 A;  2QYJ A;  4HOR A;  2RFM A;  3B7T A;  5KCM A;  1YMP A;  2WXR A;  3LYA A;  2IY0 C;  2MYO A;  2R17 C;  1XNF A;  2X6J A;  3JYS A;  3HHM A;  4ABN A;  3JUI A;  4GTQ A;  3HXF A;  2V5Q C;  2E0I A;  4J8F A;  3IEG A;  3D9L A;  4CZ2 D;  3DPD A;  3FY4 A;  4YND A;  5ENS D;  1TN8 A;  3QNK A;  5EDS A;  4BER A;  2GGF A;  2C0M A;  3DSV A;  3Q9N C;  3URZ A;  2I2O A;  3I4G A;  4J6I A;  4L2Y A;  5BT1 A;  2YNQ A;  3E34 A;  4YVQ C;  3FU6 A;  5D0Q D;  2OV8 A;  3KS2 A;  4UQY A;  3UMV A;  5BV1 A;  3NOC D;  3PZ1 A;  5D66 A;  5JMN D;  3P2B A;  3K9I A;  3CHQ A;  4DLQ A;  2FBN A;  3UKU G;  3QWP A;  4B89 A;  1B89 A;  1HU3 A;  3PE3 A;  3ZFW A;  4BX8 A;  3ZIM A;  3L17 A;  4OAV B;  1QBQ A;  1WDY A;  1JUQ A;  4CYM D;  3DWL G;  2LSV A;  1YCS B;  2XGM A;  3FUF A;  5DBK A;  2GRM A;  4F1P A;  2P9K G;  3TWS A;  2C0L A;  3LVQ E;  4BFR A;  4DPR A;  3G2U A;  3RIB A;  3B7B A;  4U96 D;  1E8Y A;  3D9N A;  4UUC A;  4IRU A;  1HS6 A;  3LKU A;  3UT8 A;  4HB5 A;  4F6R D;  3Q73 A;  4Y6C A;  5ENP D;  2XEH A;  1GW6 A;  3CK8 A;  3D9O A;  1TYQ G;  5HS0 A;  3ZUV B;  3R9A B;  2PM7 A;  4QFV A;  4GCN A;  4MRU A;  2P9L G;  3BEE A;  4R7L A;  4HLL A;  2RFA A;  4GA1 A;  3TWR A;  4FJY A;  2Y3A A;  1N94 A;  1OXJ A;  3D9J A;  4TXP A;  2DWZ A;  3EHM A;  2VSY A;  2L6B A;  4LNU D;  4N3C A;  4G8K A;  3OXF A;  3CVN A;  4U7E B;  5CEC B;  2I6H A;  4M3O A;  2EIJ E;  3TWT A;  3CVW A;  4HOQ A;  3MGB A;  5LFA A;  4GPM A;  2J8S D;  1IHB A;  3L22 A;  2XZT G;  2WXG A;  3MKR A;  2CFZ A;  5CEA A;  2ETA A;  4K5C A;  3UUX A;  2WB2 A;  4AIF A;  3LJ3 A;  2LSU A;  4DX2 A;  2HYZ A;  1OWN A;  4U63 A;  2IOL A;  3JXI A;  3B13 A;  4E6H A;  2CHZ A;  1L5J A;  1Z3X A;  3IV0 A;  5J90 A;  3CVP A;  4JEU A;  4ZHB A;  4GZ6 A;  2ZGD A;  2L0T B;  4LER A;  3RAU A;  1NZN A;  5D2M C;  2MRI A;  4OVV A;  4ILI A;  4U04 A;  1PC2 A;  5AYW D;  2PM6 A;  4DX7 D;  3L6A A;  3FEY A;  4UQX A;  5AAO A;  3ZXP A;  3Q78 A;  4F7A A;  1FT2 A;  3B7R L;  4KYO B;  2VSO E;  5T8I A;  3S7F A;  3T5X A;  4CT0 A;  2WXH A;  3RJV A;  5AQ9 A;  3UKR G;  4V3I A;  5DIZ A;  3QB2 A;  2QFC A;  2KC7 A;  4H7X A;  4B93 B;  4G23 A;  3Q15 A;  2VTB A;  5AJD A;  2EIK E;  5EIB E;  5FQ4 A;  3APF A;  2LAH A;  3HDX A;  1D8D A;  4FLH A;  3CKC A;  3NF1 A;  1E90 A;  2WXN A;  2BED A;  3OXG A;  2A4Z A;  3Q9U C;  1O1T A;  3UIP C;  3RO2 A;  2R03 A;  3R7R A;  1A17 A;  4ME2 A;  5AJL A;  4DUI A;  5G05 C;  2WXP A;  4UQZ A;  4YVO A;  1IKN D;  5CCM A;  4I2W A;  4O1O A;  3V79 K;  3C72 A;  4YDY A;  1Q2Z A;  4AP2 A;  1OT8 A;  2YQ8 A;  2AWI A;  3G2S A;  2Y4T A;  1SZA A;  4ANW A;  4XKC A;  4HI8 A;  2IO3 C;  2WXO A;  3PRZ A;  4U8Y D;  1SVX A;  1JCR A;  4B0Z A;  5G2N A;  3PS6 A;  2UWJ G;  2AW6 A;  3GZS A;  1X5B A;  2ZIR A;  4QQI A;  2GRQ B;  3RO3 A;  3AS8 A;  3FTX A;  3T8K A;  2V8S E;  4J8D A;  4WNE A;  2WXI A;  4ZFH A;  3CHR A;  4TV3 A;  1NFI E;  3NQP A;  4OYS A;  4WWP A;  5B3S E;  4IN3 B;  1TNB A;  1E7U A;  2ILR A;  3EHR A;  3ASF A;  3TJP A;  2IOS A;  4FP7 A;  4GZC A;  3DRA A;  3KSL A;  2IU1 A;  3UXG A;  4YDE A;  2DBA A;  3GZ2 A;  4FLB A;  1N9A A;  3WG7 E;  4M7C A;  4BSZ B;  4J0U A;  1DCE A;  3DEO A;  1HE8 A;  2P9I G;  5AIJ A;  2WXF A;  4AOF A;  2F37 A;  3NOG D;  3PE4 A;  2P2C P;  5LCW J;  3E30 A;  3N71 A;  3QOU A;  3NBN B;  2Y4U A;  4APO A;  3LS8 A;  1FPP A;  4PUC A;  2VQ2 A;  3U64 A;  1ZU2 A;  2KBX A;  3FFL A;  1H2V C;  2UY1 A;  2FUL A;  4HOT A;  4I17 A;  2CG2 A;  4JD2 G;  4DI4 A;  3OAW A;  3O48 A;  4U07 A;  1OCZ E;  3UIO C;  3KEZ A;  3CKB A;  5C2Y A;  2P9U G;  3U9W A;  2XRZ A;  3SBT B;  1MQS A;  2ION A;  3CVU A;  3PH0 C;  1S0P A;  4DK5 A;  4DRX E;  1RZ4 A;  1G3N B;  1OWL A;  2BKG A;  3FWV A;  5E76 A;  3ML9 A;  1JPL A;  1VDY A;  4YDW A;  5KJM A;  4UWF A;  2FI7 A;  3J5P A;  3FUE A;  5HKP A;  3UM3 A;  3MX3 A;  3L82 A;  3LPZ A;  3HYM B;  3NAW A;  2KCK A;  4GTV A;  5FQ6 A;  4EHM A;  4O6F A;  3TG5 A;  3T8M A;  3QAQ A;  3F6Q A;  1N0R A;  5ENT D;  4ILH B;  4WUY A;  3NZS A;  4EEC A;  2XPI A;  4I43 A;  4D10 C;  4ACL A;  3DSX A;  2WXQ A;  2FO7 A;  4DI3 A;  2GRR B;  3PEU B;  2V4H C;  3FUJ A;  4GTM A;  5BNW A;  4TUM A;  3AS5 A;  1QNF A;  2AXZ A;  2YIN A;  2XGS A;  2NC9 A;  4JA7 A;  4JC8 A;  2OCC E;  2WXM A;  2VTB B;  1OWP A;  4FHJ A;  5EIL A;  3ML8 A;  3PZ4 A;  1BI7 B;  2F8Y A;  3P1U A;  1HG5 A;  4WWN A;  4G24 A;  5LP0 A;  5A7D B;  3OXL A;  5G04 C;  1SW6 A;  2VGY A;  3KSQ A;  5EN5 D;  1OUV A;  5BXU A;  4XX5 A;  4MKT A;  4HOU A;  1H6O A;  3FHE A;  4UI9 C;  4U0U A;  3E33 A;  3E32 A;  1OY3 D;  2PZI A;  4AXH A;  3ZYL A;  4BES A;  4DX1 A;  2VGX A;  4BT9 A;  5KJK A;  4LNB A;  3LJN A;  3TWV A;  4I1O B;  5ENO D;  2QYU A;  1P5Q A;  1MYO A;  4FC8 A;  3CHP A;  4KVO A;  1Z3Y A;  3FTZ A;  2ZIS A;  3C5R A;  1KPS B;  1TR4 A;  3D9H A;  2WVI A;  3LXU X;  4CEM A;  2WM9 A;  3BU8 A;  2Y1L E;  4J7W A;  2WXL A;  4O60 A;  4XEI G;  2KZT A;  2P9N G;  3PZD A;  5B1A E;  1AP7 A;  3S2A A;  5T3R A;  5ARF A;  1OCC E;  3RKV A;  3B7U X;  4JHR A;  5FJY A;  4URK A;  4BTB A;  4FHK A;  3APC A;  4UWH A;  1TN7 A;  3SGH A;  1UW4 B;  3Q7A A;  1HF8 A;  4NUR A;  4N3B A;  2RG8 A;  3KD7 A;  5E75 A;  3EHQ A;  1E8W A;  5HQ8 A;  5CED B;  3DXK G;  2AXV A;  2H6H A;  1S63 A;  1NI1 A;  4GML A;  3Q7F A;  2C2L A;  4ACK A;  1SQM A;  1YA0 A;  3KEA A;  4XE0 A;  1UN9 A;  3PZ3 A;  1BI8 B;  3SF4 A;  3DEP A;  4HFG A;  4RVB A;  5FZQ A;  2LNI A;  3HXC A;  5JJT A;  3B7S A;  3LDZ A;  3MYV A;  1N4R A;  3PVL A;  4N39 A;  2LXM A;  2UY1 B;  4J8S A;  4RQI A;  2CHX A;  4FUL A;  4NQ0 A;  3RRU A;  3G2V A;  1UN8 A;  1S64 A;  2VSX E;  2AVP A;  3OTN A;  4GYY A;  3VLD A;  3CHM A;  1SZ9 A;  4XZ4 A;  3NZU A;  4NIK A;  2YHE A;  4YDO A;  4GZ3 A;  2KXP C;  4U0S A;  4PS8 A;  3R9M A;  1OWO A;  2JAB A;  2X6I A;  4KBQ A;  5KNH D;  3CVQ A;  3FH8 A;  1RW2 A;  5G05 J;  5C1D A;  4BWR A;  2H6G A;  4APF A;  5EYP F;  3PNL B;  3EIQ C;  1BLX B;  3CIA A;  5A23 A;  3UPV A;  3Q49 B;  4HLE A;  2FO1 E;  3ASG A;  3MKQ B;  3IXE A;  3LVR E;  4GTP A;  1S70 B;  4F3V A;  3Q79 A;  1U3C A;  4X8Q A;  4WNF A;  1IXV A;  4ANU A;  2IEJ A;  4K5A B;  2LO6 A;  1ZB1 A;  2WMO A;  3CLJ A;  2XEN A;  4DX5 D;  3JCK C;  2HR2 A;  1LF8 A;  2P9S G;  4KZ0 A;  2WPV A;  3FU3 A;  3CGH A;  3VTY A;  3WXX A;  3D3M A;  1SA5 A;  2CFU A;  1MZC A;  4W9R A;  4U95 D;  2H6F A;  1OCO E;  5BPP A;  2J07 A;  5ANL A;  3HVE A;  4FAD A;  4BY6 A;  3FUN A;  4PDX A;  3CV0 A;  5JJ7 A;  3ZW3 A;  3EUV A;  2KAT A;  1QQE A;  1Z6T A;  1O1S A;  1TNY A;  2DZN A;  5BV0 A;  2DZO A;  2EQX A;  3CEQ A;  2L9B A;  3AS4 A;  3EIJ A;  5CHE E;  4BX9 A;  3FTY A;  2IJG X;  5JJ6 A;  3RSE G;  2I9C A;  4A1S A;  4RG9 A;  2EIM E;  2IO2 C;  1BD8 A;  4UWK A;  4LCT A;  4TRQ A;  2XEV A;  5FWQ A;  4DJA A;  4XI0 A;  4KT6 B;  4C9B B;  4EZJ A;  1O5M A;  4N2S A;  2R59 A;  1N4P A;  5LOZ A;  4CGW A;  4BSX A;  5ITZ F;  4EZK A;  2HM8 A;  4P29 A;  5KWD A;  1UG3 A;  4CDM A;  2QY7 A;  1PAQ A;  4GZ5 A;  2WQ6 A;  4IYP A;  4B8A A;  2VGX B;  3T5V A;  2J4B A;  3FTS A;  3V30 A;  1DCQ A;  3ZKJ A;  3TWU A;  2A5U A;  1N95 A;  1U2V G;  4A55 A;  2F0Y A;  4HXI A;  3ENE A;  1KT1 A;  1U3D A;  4AY6 A;  2R05 A;  3ONL A;  5ENQ D;  3CK7 A;  4A3V A;  3CVX A;  5CBO A;  3JXJ A;  2B6C A;  3MJW A;  1HG2 A;  2E2E A;  3ZNG A;  2KZT B;  3AJI A;  4BET A;  3SNX A;  1X81 A;  4ATZ D;  4UI9 K;  2Y0B G;  2MHK A;  5BUZ A;  5J08 A;  4KZC A;  4FA6 A;  4GA0 A;  1MJ0 A;  3IBE A;  1UOH A;  5JHA A;  1H2T C;  5HRY A;  3APD A;  1KZO A;  4KXK B;  3UM2 A;  3U3W A;  3AU4 A;  4U8H A;  1D9S A;  1H0A A;  2NSZ A;  4K0R A;  3ULY A;  3FUH A;  4JVS A;  4GTS A;  4JXT A;  3S7D A;  3FUM A;  2H6I A;  3MEK A;  4UWL A;  4GYW A;  3RU0 A;  3TG4 A;  1H6K A;  3DSW A;  5CER B;  3RRN B;  3L16 A;  3BQO A;  2ETC A;  2L0I A;  3DXM G;  3FU0 A;  1EYH A;  3E4B A;  1WG0 A;  4I6J A;  5AN8 A;  3V2O A;  5LX8 A;  2NYJ A;  2R5S A;  3QWW A;  4U0Z A;  2R2L A;  3IHV A;  4PS3 A;  3TWW A;  1ELR A;  4I1A A;  4BT8 A;  5M72 A;  3ONK A;  1EPU A;  1TJC A;  4K03 A;  3SQV A;  2YHC A;  3DPY A;  1NP7 A;  3HXD A;  2XS8 A;  3TWX A;  1TEZ A;  3FTW A;  5FQ8 A;  3FU5 A;  4L1B A;  3SY2 A;  4N2Q A;  2X6H A;  2AXU A;  3Q4A B;  5FZR A;  1N4Q A;  2MOW A;  2OND A;  2J4D A;  3FDH A;  3L08 A;  4JHJ A;  2FEZ A;  2ETB A;  3LEW A;  3FEX A;  3ZYQ A;  3UTM A;  3DST A;  4DX6 D;  3E37 A;  2ZU6 B;  2GRO B;  3V31 A;  4IUL A;  1KT0 A;  3EHN A;  3IKO B;  2X38 A;  4GU5 A;  1FCH A;  4GB9 A;  4MBG A;  3HXE A;  3CST A;  1N11 A;  4ATG A;  2J9Q A;  4UWG A;  1OWM A;  5JA4 D;  5FIN A;  2XEE A;  4EZL A;  3EU5 A;  2B0O E;  3B95 A;  3VLE A;  1H19 A;  3LY9 A;  1UJJ A;  2XGO A;  4GAA A;  2ZGG A;  3HVE B;  4AM9 A;  5G55 A;  2WQ7 A;  3SBS A;  4I1M A;  1QYM A;  3U66 A;  4JL0 A;  3C3Q A;  3D9M A;  1MX6 A;  3UM1 A;  1K1A A;  3DSU A;  2WXK A;  2LAI A;  1SA4 A;  3FTU A;  4ILG A;  3BG0 B;  3Q5M A;  3I4R B;  3CVY A;  5AQA A;  3ZVV A;  4RLY A;  4LG6 A;  3FUD A;  3FUI A;  3UT4 A;  3D9K A;  3FP3 A;  4CGV A;  2XHE A;  3Q47 B;  2DIW A;  5LCW C;  2ZXW E;  3FTV A;  4LUN U;  4C48 B;  2OVB A;  4XIF A;  3ZXS A;  1H2U A;  4GYO A;  2CHW A;  3J5Q B;  3CR3 A;  3V2X A;  1NA3 A;  1K1B A;  4I9C A;  3MCX A;  4OVU A;  3AG3 E;  2Q7F A;  3ABL E;  3SFX A;  4PS7 A;  2DYR E;  3G2W A;  4L9P A;  1E96 B;  5AQB A;  3ABK E;  3CHS A;  2IF4 A;  3UQ3 A;  3L13 A;  2NXP A;  3BG1 B;  3ASH A;  5AAR A;  5EX3 A;  5ENR D;  5CMY A;  5KNG A;  2I1J A;  3G2T A;  3CVL A;  5FIO A;  1HH8 A;  5CCL A;  4HRL A;  2P9P G;  3FH7 A;  3CSF A;  1TNO A;  1PY1 A;  5FTP A;  4AV7 A;  5CMW A;  1LD8 A;  3C3R A;  4HRN A;  4E85 A;  1IHG A;  4G26 A;  1IQU A;  1TJF A;  4NRH B;  3ZHE A;  3QDN A;  4HNA D;  4A3T A;  3JQ1 A;  2XCB A;  4CCA A;  2WQH A;  3PUJ A;  4G2V A;  2WXJ A;  4JA9 A;  1K8K G;  3ASO E;  3PUK A;  4GPK A;  3ZGQ A;  4O1P A;  2JLB A;  3UI2 A;  3AG2 E;  1E7V A;  1N54 A;  2KCV A;  2V4L A;  1OCR E;  2L6J A;  1ZBP A;  3DBS A;  5CBN A;  3VTX A;  3RRM B;  1O1R A;  2CG3 A;  2PQN A;  1E8Z A;  5H7P A;  5BXO A;  4MLP A;  1JWG A;  2Y69 E;  3CQG B;  3R7Q A;  4TUU A;  5IY5 E;  1V54 E;  3UX4 A;  4L2L A;  4EBA A;  3PDN A;  4C0E A;  3RK6 A;  2PNN A;  4G1T A;  5KJL A;  4OAU C;  1KLX A;  4GZD A;  5KJN A;  2KCL A;  4GMR A;  3ESK A;  2RKK A;  2VYI A;  5HI7 A;  3SFZ A;  5EX0 A;  2BTD A;  4HOS A;  2R02 A;  3MZL B;  4JZY A;  5EYL A;  2A5E A;  5EKQ D;  4JEH A;  4AEZ C;  4LSZ E;  2GRL A;  4Z68 A;  3UM0 A; 
#chains in the Genus database with same CATH homology
 5B1B E;  3X2Q E;  1OCC E;  3AG1 E;  2ZXW E;  1V55 E;  5B3S E;  3AG3 E;  3ABL E;  1OCO E;  3ASO E;  2DYR E;  2EIK E;  2EIN E;  2OCC E;  2Y69 E;  2EIJ E;  2DYS E;  3AG2 E;  3ABK E;  2EIM E;  3ASN E;  3AG4 E;  5IY5 E;  1V54 E;  3ABM E;  1OCR E;  2EIL E;  1OCZ E;  5B1A E;  3WG7 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...