3ASOE

Bovine heart cytochrome c oxidase in the fully oxidized state measured at 0.9 angstrom wavelength
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Distinguishing between Cl- and O2(2-) as the bridging element between Fe3+ and Cu2+ in resting-oxidized cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 40
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 3asoE00
2EINE 3ASNE 5B1BE 5B3SE 3ABME 1OCOE 3AG1E 3X2QE 1OCZE 1V54E 3ASOE 3WG7E 2DYSE 2EIME 2Y69E 3AG4E 3AG3E 3ABKE 3ABLE 1OCRE 2EIKE 2DYRE 2OCCE 5IY5E 2EILE 2EIJE 2ZXWE 1V55E 3AG2E 5B1AE 1OCCE
chains in the Genus database with same CATH superfamily
3E33A 3ASNE 2ETCA 5B1BE 4DJAA 4HB5A 4GCOA 4A1GA 3D9NA 4ANUA 3HDXA 2QZAA 3LXUX 2RFMA 1LD7A 3UQ3A 1MX2A 4DX2A 2DYRE 4L2YA 3SFZA 1TNYA 4B8AA 4IYPA 1OCCE 3EHMA 1HH8A 2CFZA 4AJWA 2WB2A 3UT7A 3I4GA 3U3WA 4N3BA 3TWTA 3FUEA 4YDOA 3R9MA 1HG5A 4HOUA 4JB8P 3E30A 3ABKE 3BU8A 1UN8A 4YDEA 4DLQA 1TNOA 3UMVA 1N0RA 1H6KA 3CK7A 4CGWA 2KATA 2VYIA 2OEWA 1JUQA 2LAIA 3KS2A 2WXPA 3SD5A 4GTSA 2IJGX 4WUYA 4K5CA 3W9FA 3ABME 3UI2A 3E4BA 4NQ0A 3SGHA 4C0EA 1EF1C 2DIWA 3C5RA 5LFAA 1U3DA 2IOLA 5ANLA 5A7DB 5EYLA 2VSYA 2I1JA 3HRAA 3L54A 4HLLA 4GZ5A 4J8FA 2IO2C 3QDNA 5CERB 4PS7A 3EUVA 2WM9A 3QWPA 3RO2A 4J8EA 5AYWD 3C3QA 4WWNA 4URKA 4GTRA 3W9GA 3Q7FA 1FPPA 3SQVA 3MGBA 3HHMA 1OWPA 1RW2A 4ATZD 4GZ3A 4NURA 5BXOA 4JHKA 3U64A 4B94A 5T4YA 4GZDA 4L2LA 5FQ8A 4I17A 4U96D 2QFCA 4FU3A 1H19A 1WG0A 4HRMB 3Q73A 3EJNA 1IQRA 4LG6A 1V54E 2AW6A 2KXPC 4U0SA 2LNIA 3BUAA 5E75A 1OWNA 3MV3B 2XENA 4BT8A 2YHCA 3Q79A 5CECB 4J6IA 1NL4A 3UM1A 4AY6A 3PH0C 4DX5D 5EN5D 1TR4A 5BT1A 2X3MA 1Y8MA 3TG5A 2CFUA 3DSTA 4O60A 4U7EB 4GMLA 1PC2A 4A1SA 2VSXE 3CVVA 1AWCB 5AQAA 1FT2A 4XZ4A 2CG3A 4AEZC 2LO6A 3IBEA 2KZTA 3S7FA 3FH5A 3ISMC 2WMNA 1S0PA 4ANVA 2VGXA 1ZU2A 3ABLE 1N11A 2FI7A 2WQHA 2LXLA 1JWFA 3MZLB 3QAQA 3CHPA 3C98A 2P9IG 3TXMA 3OAWA 4XI9A 5E76A 5AJDA 5DIZA 3U4TA 2PNNA 5AARA 3B7RL 3RRUA 1OCRE 1MX4A 2CG2A 4YVQC 2X6IA 3PUJA 5ENNA 4IN3B 1KZOA 3J5PA 4ANWA 4AIFA 2P9LG 1YYHA 2QC9A 3NB2A 3FUMA 4ZFHA 3CVQA 3VLDA 3BG1B 3CK9A 2WXIA 1KT1A 2CHXA 5EIDA 2WXOA 3NQPA 2I2OA 3CVYA 1BPOA 4LRZA 2X6KA 5JJ7A 2OVBA 4V3IA 3ESKA 3QNKA 5HQ8A 3CHSA 3DPDA 3CLJA 4TUUA 2WXQA 3FUJA 4AP2A 3SFXA 3ASOE 1SZ9A 1O1RA 4XE0A 3IV0A 4UWLA 2RFAA 1BI7B 1QBQA 1BU9A 2WXFA 2J08A 4FHJA 3TWQA 4AVXA 2R59A 3TJPA 1WAO1 2GRRB 3FULA 2LSVA 4YDWA 1SA4A 5HS0A 2HE0A 1BLXB 1Z6TA 5IY5E 4RLYA 2LXMA 4DUIA 3FUFA 2LUHA 1ELKA 4C48B 3AS8A 2R03A 3ZYQA 1E8YA 3HXCA 4JHJA 3FH8A 3R7RA 4JD2G 4FA6A 3D9HA 3JXIA 1N0QA 2XGMA 4CCAA 4GTMA 4K5BA 3PEUB 5ENRD 4D10C 1XNFA 3DRAA 4FADA 1H6PA 4A3VA 4CEMA 3T5VA 2IONA 3G2VA 2XRYA 3AG3E 4G24A 4ZHBA 5T3RA 1SVXA 3APDA 2IQCA 2KCKA 1OWOA 1K3ZD 3TWSA 3Q78A 3Q49B 2X38A 3AU5A 1Q2ZA 3RRMB 3ZN3A 4KT6B 3UKUG 5HI7A 2WXRA 1OWMA 2VTBB 4HRNA 3CKCA 4Z68A 1QYMA 4MBGA 2PM6A 3L13A 4IRUA 4I43A 4BETA 3DXKG 4HRLA 4WNDA 3RIBA 4GTQA 5AIJA 4ILHB 2WMOA 2VSOE 1SQMA 4TV3A 1LTXA 5CHEE 4PH4B 4K0RA 3FTYA 5BPPA 2IU1A 5FZSA 4L9PA 3SO8A 1MX6A 4I6EA 4JA7A 3ZEFA 2ETBA 4Y6WA 3LPZA 2XEHA 2XRZA 4L1BA 3RJVA 1D9SA 3RU0A 4NIKA 2JEKA 1K1AA 3D9PA 4JEUA 1LF8A 2F8XK 3P2BA 3LVRE 3L9TA 2P9KG 3FU3A 2RD0A 1AP7A 3V2OA 4QQIA 4PUCA 2PM7A 5AQ7A 4TUMA 1ELRA 3VTXA 4U8YD 2NYJA 4OAVB 2GRPB 4GA1A 4KMOA 4UQYA 4CDNA 3MX3A 1UJKA 2CHZA 4A63B 3JUEA 4HORA 2QYJA 3FFLA 3E37A 3B13A 3DXMG 3R7QA 2I1KA 4M7CA 2V0PA 5FINA 3DSXA 2V5FA 3ZVVA 4CT4A 2XHEA 1HE8A 5EX0A 4UI9C 1ZB1A 2KCLA 3DBSA 2DYSE 1FVFA 1NZNA 2XEEA 3ZHEB 4HVBA 1U2VG 5FQ4A 3FUHA 5KNGA 4OVUA 4I2ZA 4O1PA 1WY6A 5BNWA 4WNEA 3ZU7B 4I6JA 4OAUC 3ONKA 4U95D 3Q7AA 4X8QA 5FQ6A 2WVIA 2ZISA 4BWRA 5HKPA 5JHBA 2F0YA 2I6HA 3DSUA 2PQNA 3QC1A 2EIKE 2OCCE 1E7VA 4AV7A 3V2XA 5CEDB 4DPRA 1OT8A 4F1SA 3SY2A 4CDMA 5JJ6A 4LCTA 3Q47B 5FIOA 3DEPA 3ZXPA 5A23A 5FJYA 3CVWA 4JW1A 4EQFA 1H2VC 4O1OA 3CSTA 2IY0C 2R02A 3L16A 3RSEG 4N5CA 1QQEA 4AXHA 4DI4A 4G23A 1JWGA 3CVXA 3D9OA 3FU6A 2BUGA 3T8KA 3S2AA 4DK5A 2FF4A 5G05C 3KD7A 4B0ZA 4B89A 2J49A 3CKBA 1INZA 5G04C 2DZOA 1N94A 3EIJA 3C3RA 2H6FA 3S7JA 5AQ9A 3PS6A 3X2QE 2X6HA 3PZ3A 1TNBA 3CSFA 3ZGQA 2VQ2A 4LEUA 3TGOA 5CBNA 4GYOA 4UWFA 3HXFA 2YQ8A 2XPZA 3PE3A 5B3SE 1E96B 4M3OA 3OXLA 1E8WA 1O1SA 3KSQA 4BERA 1IKND 4LNBA 2VTBA 4N5QA 5CRUA 3UINC 4R7LA 2UY1B 5KJLA 4I1MA 1JCSA 5CMYA 2Y3AA 5D66A 1IQUA 5FT9A 3LVQE 4LUNU 3UIPC 3IEGA 4B93B 4E6HA 3E32A 4DX1A 2F8YA 3QK0A 1Z5SC 2AVPA 4HBDA 5BW8C 3LJNA 3ASGA 4CRWA 4N3CA 3ML9A 4RSYA 2AXVA 4GZ6A 2Y4UA 3FTZA 3AG1E 2KC7A 3AJIA 4HS2A 3HYMB 3NOGD 5KJNA 4I9EA 3AAAC 3T8MA 1UG3A 1L5JA 4Q94A 2R2LA 1HF8A 5KBAA 4KXKB 4GZCA 3FH7A 3UTMA 2BKGA 2P9PG 1O5MA 1H6OA 4DLOA 2ZGGA 3Q4AB 4HI9A 2GRNB 5G55A 1KZPA 3AG2E 1H2TC 2VSNA 2A5UA 2R5SA 2XCBA 4BTAA 1OCZE 5KNHD 4XKBA 2IFUA 3NAWA 3AS4A 5HRYA 5CBOA 4ILIA 4O6FA 4W9RA 5KCMA 1KLXA 4J8SA 4WAFA 3C3OA 4XI0A 4YNDA 2C0LA 2WXNA 2H6IA 5CCMA 3CR3A 3ZKJA 3ML8A 2ETAA 1Y6IA 3MKRA 4UUCA 4F6RD 1XGWA 3ZPJA 3TWXA 3TWRA 3L17A 4CT0A 1ZBPA 2GGFA 3NZUA 2OOEA 3APCA 1HX8A 1QNFA 3RK6A 3PVLA 4LERA 2LSUA 1W3BA 5M72A 3TG4A 4FP7A 2XEVA 4JPSA 2OEVA 3FTVA 2HYZA 4H7YA 4DI3A 3JQ1A 2ILRA 4AY5A 4FHKA 4UWHA 2AWIA 2E2EA 2VJ8A 3B7SA 3GZ2A 3NOCD 3TXNA 1N4RA 5FQ7A 2NSZA 4BFRA 3I5PA 3RKVA 2KCVA 3HIZA 3WXXA 4HQDA 1S70B 2OV8A 3ONLA 2DZNA 2YNQA 3CIAA 3PRZA 3J5QB 3ZNGA 3KEAA 4G11A 4ATGA 3N71A 2X6JA 5D0OD 1NA0A 3TAXA 3IHVA 2L6BA 1TN7A 1N4PA 5EIBE 4GYYA 3LY9A 4CYMD 1KT0A 1YA0A 2B6CA 3EIQC 3EDTB 5H7PA 3U66A 1PY1A 1WDYA 1DCEA 2WXJA 2BKKB 2EINE 4XKCA 2BEDA 3FTWA 3G2SA 3PUKA 1N4SA 3L22A 3PNTB 5DBKA 2V4HC 3DWLG 1UJJA 2C2LA 3FEYA 3RAUA 3CHOA 5ENPD 1DC2A 3L82A 2B0OE 3SBSA 2UY1A 4MKTA 2OVFA 2M63A 2EIJE 1PAQA 4NACA 4GA0A 5LCWJ 3RO3A 3D9LA 4MRUA 3IKOB 3TL5A 1A17A 3CK8A 4A55A 1MJ0A 2C0MA 4EECA 4GTTA 3QOUA 3RRNB 5KJMA 3HXEA 3FTUA 2LAHA 5AAOA 4GPKA 4RG9A 2R05A 4K5AB 3Q9NC 2YHEA 2IEJA 1D8EA 3TWVA 3O4ZA 2NXPA 1TJFA 3LY8A 3Q15A 2ZU6B 3HVEB 3TWUA 2P9SG 1IHGA 3UT4A 4BX8A 4YVOA 3E34A 4J8YA 1DNPA 3CVUA 3PZDA 1E90A 4RQIA 4BTBA 4H7XA 3FP3A 1GW6A 1EDUA 2AXZA 3UXGA 3AS5A 3LY7A 2JLBA 4GYWA 4AOFA 3KAEA 1H2UA 3SHFA 4EBAG 4CDRA 1HU3A 1TNUA 3SF4A 5KWDA 3GYZA 4IULA 3FEXA 5ANRA 5BUZA 4AM9A 1H0AA 2QYUA 3UM2A 2UWJG 4APFA 4I2WA 2KM4A 2V5QC 4U8VD 3SI5A 2XZTG 2P9UG 4NRHB 3JUIA 2L0IA 4FJZA 4UWKA 5EDSA 2PL2A 3FUKA 4C9BB 3ZIMA 3HXBA 2FO7A 2P9NG 4B8CB 2KZTB 4JC8A 1FVHA 1OY3D 4EHMA 2MHKA 2YINA 3TWWA 2IF4A 3PDNA 1E7UA 2XS1A 3VTYA 5D2MC 3ULYA 4U0ZA 3APFA 3B7TA 4GB9A 3MKQB 1N95A 4UQZA 5ENSD 5LOZA 1SA5A 4UQXA 4N39A 3OTNA 4DX7D 3VLFA 5CEAA 2WQ6A 1NP7A 3MV2B 5C1DA 4OYSA 3URZA 3SZ7A 3ZW3A 3JXJA 4I1AA 4G2VA 1N9AA 3D9JA 2IO3C 3ZUVB 4JVSA 2VGEA 1HS6A 4Q69A 4I1OB 3PE4A 3UUXA 4A3TA 3B95A 2A4ZA 2ONDA 2XGOA 3PNLB 2FO1E 3LCAA 3ENEA 1N54A 3AG4E 2H6GA 4G25A 4BEPA 3BEEA 3PZ1A 5FWQA 3ASDA 3UM3A 1YMPA 3I3NA 1OWLA 5ENQD 4MLPA 2BTDA 5ARGA 3ZYKA 5ENOD 2EIME 3Q75A 4GCNA 2DCPA 3D9MA 4L23A 1MYOA 1E8XA 1HO8A 2P2CP 4ACLA 1TN6A 1V55E 3F6QA 3L6AA 3KEZA 2F37A 3UKRG 3Q5MA 5JJTA 1E8ZA 4ILGA 1TNZA 4ABNA 2WQ7A 4U0UA 3FUNA 3FDHA 4JA9A 5BV0A 3CVLA 4YDYA 2DBAA 5FZQA 4U8HA 5AN8A 3CEQA 4I9CA 4N2QA 4QFVA 3FHEA 2E0IA 1D8DA 4EZLA 3FY4A 4G26A 2L9BA 2Q7FA 3U9WA 3IXEA 3D9KA 4I6GA 4KBQA 3ZFWA 4GA2A 1B89A 3B7UX 2J07A 1O1TA 5LX8A 4HXIA 3FU5A 3JQ0A 3DSWA 3OXGA 4HOTA 4Y6CA 5J08A 1EYHA 1UN9A 2GRLA 2WXHA 3CVNA 5D0QD 5FZRA 5ITZF 3HVEA 4G8KA 2PQRA 3CQGB 3SFYA 2XS8A 4FLHA 3L08A 3O48A 4GMRA 4GMJA 3K9IA 4F3VA 4BX9A 1OXJA 2WXLA 3FWVA 4FC8A 5G2NA 1TYQG 2H6HA 2Y4TA 4HOSA 3SNXA 3PZ2A 4Q96A 3BG0B 2HR2A 3IHYA 1Z3XA 3ZRHA 4J8DA 1FCHA 4JHRA 4CGVA 5LP0A 3QARA 1JCQA 1ELWA 5EILA 2AJAA 2Y0BG 5C2YA 2WXMA 4U04A 5A6CA 2XPYA 3ASHA 2V4LA 4HFGA 4GTVA 4HI8A 3ZXSA 1NA3A 2GRMA 1UOHA 3ULQA 5JHAA 1G3NB 2XCCA 5B1AE 2GW1A 2HO1A 5J90A 4KZCA 4APOA 4TXQA 1BI8B 3CQCB 1IXVA 3UM0A 4WWOA 3QWWA 2L0TB 3QJZA 3V30A 3EHQA 1DVPA 4KZ0A 3JCKC 4F7AA 4GU5A 4BY6A 5CCLA 1TJCA 3CHQA 5FTPA 2AXUA 4BSZB 1BD8A 5CMWA 3MKQA 2GRQB 2ZGDA 3ZHEA 4G1TA 1JPLA 2I9CA 3LKUA 4DRXE 5ENTD 3MEKA 2L6JA 4FJYA 5AQBA 2DWZA 4GTPA 4GTOA 1K8KG 4OVVA 3S7BA 4N2SA 4UI9K 2FEZA 3LEWA 3EHRA 4WWPA 2J4DA 4TXRA 4JL0A 1N52A 4L7TA 3EU5A 4U07A 3D9IA 2XGSA 3I4RB 2MRIA 4HNAD 2KBXA 2WXKA 3GZSA 3DEOA 3V79K 1X5BA 1YCSB 4JXTA 2Y1LE 3BQOA 3WG7E 1IHBA 4XX5A 3QB2A 1RZ4A 3AU4A 1NI1A 4LNGA 1JCRA 3PZ4A 4PDXA 2FULA 2RG8A 3ZYMA 4U63A 1LD8A 4P29A 1SW6A 4E85A 3CHMA 4F1PA 2HM8A 4ACKA 4XIFA 2MOWA 1TN8A 2X6FA 2ZXWE 1N4QA 2WXGA 4LNUD 1HG2A 3V31A 3LJ3A 4KVMA 2GROB 1A5EA 3GW4A 4BESA 3EU9A 4ME2A 4WNGA 4CZ2D 1U3CA 3ULEG 4N3AA 2J8SD 3DPYA 3LS8A 3NZSA 1SZAA 2EQXA 3VLEA 2MYOA 1OCOE 3LDZA 3GZ1A 3DSSA 3CV0A 1HXIA 1K1BA 1WM5A 3QKYA 1NFIE 4J0UA 4RVBA 4FLBA 3JYSA 2WPVA 3EHNA 5ARFA 3NBNB 4K03A 2J9QA 3P1UA 4WNFA 4JEHA 5EX3A 1Z3YA 3CHRA 4XEIG 2VGYA 2RKKA 2ZIRA 4MS6A 2J09A 3DSVA 2R17C 1HZ4A 3S7DA 5AENA 1HFAA 3UT8A 3ZYLA 1KPSB 3R9AB 4EZJA 4LSZE 5BV1A 3ESLA 4PS8A 1TEZA 5BXUA 4EBAA 2XPIA 3T9KA 1IYGA 5CRVA 4ANXA 4HLEA 1VDYA 4PS3A 2IOSA 2NC9A 4DX6D 3CVPA 4UI9J 4C0MA 3NF1A 3FUDA 3OXFA 2XQ0A 4EZKA 3B7BA 3G2TA 2JABA 3UIOC 3G2WA 1DCQA 2A5EA 5EKQD 5JA4D 3PREA 2FBNA 3G2UA 1MZCA 2CHWA 2P58C 4G8LA 3ASFA 3UPVA 1QZ2A 5AJLA 4RG6A 3FUIA 3FTXA 3Q9UC 3PEVB 4JZYA 2EILE 3HXDA 3CGHA 3FTSA 4UWGA 3D3MA 1S63A 3T5XA 4GAAA 3C72A 4BT9A 2QY7A 4HOQA 5LCWC 3QWVA 3KSLA 2BF0X 4J7WA 2V8SE 1S64A 2XZDG 1UW4B 4FULA 4F53A 1P5QA 2J4BA 4BSXA 4GPMA 3MJWA 4KVOA 2VGXB 2DVWA 5EYPF 5T8IA 1EPUA 3MCXA 2PZIA 4KYOB 3MA5A 3MYVA 3SBTB 3LYAA 1OUVA 1FT1A 5G05J 1MHQA 3FU0A 2Y69E 5KJKA 1MQSA 3UX4A 5JMND 4TXPA 3HG0D 5G04J 4TRQA 1X81A 4EPZA
chains in the Genus database with same CATH topology
2EINE 3ASNE 5B1BE 5B3SE 3ABME 1OCOE 3AG1E 3X2QE 1OCZE 1V54E 3ASOE 3WG7E 2DYSE 2EIME 2Y69E 3AG4E 3AG3E 3ABKE 3ABLE 1OCRE 2EIKE 2DYRE 2OCCE 5IY5E 2EILE 2EIJE 2ZXWE 1V55E 3AG2E 5B1AE 1OCCE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIN E;  3ASN E;  5B1B E;  5B3S E;  3ABM E;  1OCO E;  3AG1 E;  3X2Q E;  1OCZ E;  1V54 E;  3ASO E;  3WG7 E;  2DYS E;  2EIM E;  2Y69 E;  3AG4 E;  3AG3 E;  3ABK E;  3ABL E;  1OCR E;  2EIK E;  2DYR E;  2OCC E;  5IY5 E;  2EIL E;  2EIJ E;  2ZXW E;  1V55 E;  3AG2 E;  5B1A E;  1OCC E; 
#chains in the Genus database with same CATH topology
 3E33 A;  3ASN E;  2ETC A;  5B1B E;  4DJA A;  4HB5 A;  4GCO A;  4A1G A;  3D9N A;  4ANU A;  3HDX A;  2QZA A;  3LXU X;  2RFM A;  1LD7 A;  3UQ3 A;  1MX2 A;  4DX2 A;  2DYR E;  4L2Y A;  3SFZ A;  1TNY A;  4B8A A;  4IYP A;  1OCC E;  3EHM A;  1HH8 A;  2CFZ A;  4AJW A;  2WB2 A;  3UT7 A;  3I4G A;  3U3W A;  4N3B A;  3TWT A;  3FUE A;  4YDO A;  3R9M A;  1HG5 A;  4HOU A;  4JB8 P;  3E30 A;  3ABK E;  3BU8 A;  1UN8 A;  4YDE A;  4DLQ A;  1TNO A;  3UMV A;  1N0R A;  1H6K A;  3CK7 A;  4CGW A;  2KAT A;  2VYI A;  2OEW A;  1JUQ A;  2LAI A;  3KS2 A;  2WXP A;  3SD5 A;  4GTS A;  2IJG X;  4WUY A;  4K5C A;  3W9F A;  3ABM E;  3UI2 A;  3E4B A;  4NQ0 A;  3SGH A;  4C0E A;  1EF1 C;  2DIW A;  3C5R A;  5LFA A;  1U3D A;  2IOL A;  5ANL A;  5A7D B;  5EYL A;  2VSY A;  2I1J A;  3HRA A;  3L54 A;  4HLL A;  4GZ5 A;  4J8F A;  2IO2 C;  3QDN A;  5CER B;  4PS7 A;  3EUV A;  2WM9 A;  3QWP A;  3RO2 A;  4J8E A;  5AYW D;  3C3Q A;  4WWN A;  4URK A;  4GTR A;  3W9G A;  3Q7F A;  1FPP A;  3SQV A;  3MGB A;  3HHM A;  1OWP A;  1RW2 A;  4ATZ D;  4GZ3 A;  4NUR A;  5BXO A;  4JHK A;  3U64 A;  4B94 A;  5T4Y A;  4GZD A;  4L2L A;  5FQ8 A;  4I17 A;  4U96 D;  2QFC A;  4FU3 A;  1H19 A;  1WG0 A;  4HRM B;  3Q73 A;  3EJN A;  1IQR A;  4LG6 A;  1V54 E;  2AW6 A;  2KXP C;  4U0S A;  2LNI A;  3BUA A;  5E75 A;  1OWN A;  3MV3 B;  2XEN A;  4BT8 A;  2YHC A;  3Q79 A;  5CEC B;  4J6I A;  1NL4 A;  3UM1 A;  4AY6 A;  3PH0 C;  4DX5 D;  5EN5 D;  1TR4 A;  5BT1 A;  2X3M A;  1Y8M A;  3TG5 A;  2CFU A;  3DST A;  4O60 A;  4U7E B;  4GML A;  1PC2 A;  4A1S A;  2VSX E;  3CVV A;  1AWC B;  5AQA A;  1FT2 A;  4XZ4 A;  2CG3 A;  4AEZ C;  2LO6 A;  3IBE A;  2KZT A;  3S7F A;  3FH5 A;  3ISM C;  2WMN A;  1S0P A;  4ANV A;  2VGX A;  1ZU2 A;  3ABL E;  1N11 A;  2FI7 A;  2WQH A;  2LXL A;  1JWF A;  3MZL B;  3QAQ A;  3CHP A;  3C98 A;  2P9I G;  3TXM A;  3OAW A;  4XI9 A;  5E76 A;  5AJD A;  5DIZ A;  3U4T A;  2PNN A;  5AAR A;  3B7R L;  3RRU A;  1OCR E;  1MX4 A;  2CG2 A;  4YVQ C;  2X6I A;  3PUJ A;  5ENN A;  4IN3 B;  1KZO A;  3J5P A;  4ANW A;  4AIF A;  2P9L G;  1YYH A;  2QC9 A;  3NB2 A;  3FUM A;  4ZFH A;  3CVQ A;  3VLD A;  3BG1 B;  3CK9 A;  2WXI A;  1KT1 A;  2CHX A;  5EID A;  2WXO A;  3NQP A;  2I2O A;  3CVY A;  1BPO A;  4LRZ A;  2X6K A;  5JJ7 A;  2OVB A;  4V3I A;  3ESK A;  3QNK A;  5HQ8 A;  3CHS A;  3DPD A;  3CLJ A;  4TUU A;  2WXQ A;  3FUJ A;  4AP2 A;  3SFX A;  3ASO E;  1SZ9 A;  1O1R A;  4XE0 A;  3IV0 A;  4UWL A;  2RFA A;  1BI7 B;  1QBQ A;  1BU9 A;  2WXF A;  2J08 A;  4FHJ A;  3TWQ A;  4AVX A;  2R59 A;  3TJP A;  1WAO 1;  2GRR B;  3FUL A;  2LSV A;  4YDW A;  1SA4 A;  5HS0 A;  2HE0 A;  1BLX B;  1Z6T A;  5IY5 E;  4RLY A;  2LXM A;  4DUI A;  3FUF A;  2LUH A;  1ELK A;  4C48 B;  3AS8 A;  2R03 A;  3ZYQ A;  1E8Y A;  3HXC A;  4JHJ A;  3FH8 A;  3R7R A;  4JD2 G;  4FA6 A;  3D9H A;  3JXI A;  1N0Q A;  2XGM A;  4CCA A;  4GTM A;  4K5B A;  3PEU B;  5ENR D;  4D10 C;  1XNF A;  3DRA A;  4FAD A;  1H6P A;  4A3V A;  4CEM A;  3T5V A;  2ION A;  3G2V A;  2XRY A;  3AG3 E;  4G24 A;  4ZHB A;  5T3R A;  1SVX A;  3APD A;  2IQC A;  2KCK A;  1OWO A;  1K3Z D;  3TWS A;  3Q78 A;  3Q49 B;  2X38 A;  3AU5 A;  1Q2Z A;  3RRM B;  3ZN3 A;  4KT6 B;  3UKU G;  5HI7 A;  2WXR A;  1OWM A;  2VTB B;  4HRN A;  3CKC A;  4Z68 A;  1QYM A;  4MBG A;  2PM6 A;  3L13 A;  4IRU A;  4I43 A;  4BET A;  3DXK G;  4HRL A;  4WND A;  3RIB A;  4GTQ A;  5AIJ A;  4ILH B;  2WMO A;  2VSO E;  1SQM A;  4TV3 A;  1LTX A;  5CHE E;  4PH4 B;  4K0R A;  3FTY A;  5BPP A;  2IU1 A;  5FZS A;  4L9P A;  3SO8 A;  1MX6 A;  4I6E A;  4JA7 A;  3ZEF A;  2ETB A;  4Y6W A;  3LPZ A;  2XEH A;  2XRZ A;  4L1B A;  3RJV A;  1D9S A;  3RU0 A;  4NIK A;  2JEK A;  1K1A A;  3D9P A;  4JEU A;  1LF8 A;  2F8X K;  3P2B A;  3LVR E;  3L9T A;  2P9K G;  3FU3 A;  2RD0 A;  1AP7 A;  3V2O A;  4QQI A;  4PUC A;  2PM7 A;  5AQ7 A;  4TUM A;  1ELR A;  3VTX A;  4U8Y D;  2NYJ A;  4OAV B;  2GRP B;  4GA1 A;  4KMO A;  4UQY A;  4CDN A;  3MX3 A;  1UJK A;  2CHZ A;  4A63 B;  3JUE A;  4HOR A;  2QYJ A;  3FFL A;  3E37 A;  3B13 A;  3DXM G;  3R7Q A;  2I1K A;  4M7C A;  2V0P A;  5FIN A;  3DSX A;  2V5F A;  3ZVV A;  4CT4 A;  2XHE A;  1HE8 A;  5EX0 A;  4UI9 C;  1ZB1 A;  2KCL A;  3DBS A;  2DYS E;  1FVF A;  1NZN A;  2XEE A;  3ZHE B;  4HVB A;  1U2V G;  5FQ4 A;  3FUH A;  5KNG A;  4OVU A;  4I2Z A;  4O1P A;  1WY6 A;  5BNW A;  4WNE A;  3ZU7 B;  4I6J A;  4OAU C;  3ONK A;  4U95 D;  3Q7A A;  4X8Q A;  5FQ6 A;  2WVI A;  2ZIS A;  4BWR A;  5HKP A;  5JHB A;  2F0Y A;  2I6H A;  3DSU A;  2PQN A;  3QC1 A;  2EIK E;  2OCC E;  1E7V A;  4AV7 A;  3V2X A;  5CED B;  4DPR A;  1OT8 A;  4F1S A;  3SY2 A;  4CDM A;  5JJ6 A;  4LCT A;  3Q47 B;  5FIO A;  3DEP A;  3ZXP A;  5A23 A;  5FJY A;  3CVW A;  4JW1 A;  4EQF A;  1H2V C;  4O1O A;  3CST A;  2IY0 C;  2R02 A;  3L16 A;  3RSE G;  4N5C A;  1QQE A;  4AXH A;  4DI4 A;  4G23 A;  1JWG A;  3CVX A;  3D9O A;  3FU6 A;  2BUG A;  3T8K A;  3S2A A;  4DK5 A;  2FF4 A;  5G05 C;  3KD7 A;  4B0Z A;  4B89 A;  2J49 A;  3CKB A;  1INZ A;  5G04 C;  2DZO A;  1N94 A;  3EIJ A;  3C3R A;  2H6F A;  3S7J A;  5AQ9 A;  3PS6 A;  3X2Q E;  2X6H A;  3PZ3 A;  1TNB A;  3CSF A;  3ZGQ A;  2VQ2 A;  4LEU A;  3TGO A;  5CBN A;  4GYO A;  4UWF A;  3HXF A;  2YQ8 A;  2XPZ A;  3PE3 A;  5B3S E;  1E96 B;  4M3O A;  3OXL A;  1E8W A;  1O1S A;  3KSQ A;  4BER A;  1IKN D;  4LNB A;  2VTB A;  4N5Q A;  5CRU A;  3UIN C;  4R7L A;  2UY1 B;  5KJL A;  4I1M A;  1JCS A;  5CMY A;  2Y3A A;  5D66 A;  1IQU A;  5FT9 A;  3LVQ E;  4LUN U;  3UIP C;  3IEG A;  4B93 B;  4E6H A;  3E32 A;  4DX1 A;  2F8Y A;  3QK0 A;  1Z5S C;  2AVP A;  4HBD A;  5BW8 C;  3LJN A;  3ASG A;  4CRW A;  4N3C A;  3ML9 A;  4RSY A;  2AXV A;  4GZ6 A;  2Y4U A;  3FTZ A;  3AG1 E;  2KC7 A;  3AJI A;  4HS2 A;  3HYM B;  3NOG D;  5KJN A;  4I9E A;  3AAA C;  3T8M A;  1UG3 A;  1L5J A;  4Q94 A;  2R2L A;  1HF8 A;  5KBA A;  4KXK B;  4GZC A;  3FH7 A;  3UTM A;  2BKG A;  2P9P G;  1O5M A;  1H6O A;  4DLO A;  2ZGG A;  3Q4A B;  4HI9 A;  2GRN B;  5G55 A;  1KZP A;  3AG2 E;  1H2T C;  2VSN A;  2A5U A;  2R5S A;  2XCB A;  4BTA A;  1OCZ E;  5KNH D;  4XKB A;  2IFU A;  3NAW A;  3AS4 A;  5HRY A;  5CBO A;  4ILI A;  4O6F A;  4W9R A;  5KCM A;  1KLX A;  4J8S A;  4WAF A;  3C3O A;  4XI0 A;  4YND A;  2C0L A;  2WXN A;  2H6I A;  5CCM A;  3CR3 A;  3ZKJ A;  3ML8 A;  2ETA A;  1Y6I A;  3MKR A;  4UUC A;  4F6R D;  1XGW A;  3ZPJ A;  3TWX A;  3TWR A;  3L17 A;  4CT0 A;  1ZBP A;  2GGF A;  3NZU A;  2OOE A;  3APC A;  1HX8 A;  1QNF A;  3RK6 A;  3PVL A;  4LER A;  2LSU A;  1W3B A;  5M72 A;  3TG4 A;  4FP7 A;  2XEV A;  4JPS A;  2OEV A;  3FTV A;  2HYZ A;  4H7Y A;  4DI3 A;  3JQ1 A;  2ILR A;  4AY5 A;  4FHK A;  4UWH A;  2AWI A;  2E2E A;  2VJ8 A;  3B7S A;  3GZ2 A;  3NOC D;  3TXN A;  1N4R A;  5FQ7 A;  2NSZ A;  4BFR A;  3I5P A;  3RKV A;  2KCV A;  3HIZ A;  3WXX A;  4HQD A;  1S70 B;  2OV8 A;  3ONL A;  2DZN A;  2YNQ A;  3CIA A;  3PRZ A;  3J5Q B;  3ZNG A;  3KEA A;  4G11 A;  4ATG A;  3N71 A;  2X6J A;  5D0O D;  1NA0 A;  3TAX A;  3IHV A;  2L6B A;  1TN7 A;  1N4P A;  5EIB E;  4GYY A;  3LY9 A;  4CYM D;  1KT0 A;  1YA0 A;  2B6C A;  3EIQ C;  3EDT B;  5H7P A;  3U66 A;  1PY1 A;  1WDY A;  1DCE A;  2WXJ A;  2BKK B;  2EIN E;  4XKC A;  2BED A;  3FTW A;  3G2S A;  3PUK A;  1N4S A;  3L22 A;  3PNT B;  5DBK A;  2V4H C;  3DWL G;  1UJJ A;  2C2L A;  3FEY A;  3RAU A;  3CHO A;  5ENP D;  1DC2 A;  3L82 A;  2B0O E;  3SBS A;  2UY1 A;  4MKT A;  2OVF A;  2M63 A;  2EIJ E;  1PAQ A;  4NAC A;  4GA0 A;  5LCW J;  3RO3 A;  3D9L A;  4MRU A;  3IKO B;  3TL5 A;  1A17 A;  3CK8 A;  4A55 A;  1MJ0 A;  2C0M A;  4EEC A;  4GTT A;  3QOU A;  3RRN B;  5KJM A;  3HXE A;  3FTU A;  2LAH A;  5AAO A;  4GPK A;  4RG9 A;  2R05 A;  4K5A B;  3Q9N C;  2YHE A;  2IEJ A;  1D8E A;  3TWV A;  3O4Z A;  2NXP A;  1TJF A;  3LY8 A;  3Q15 A;  2ZU6 B;  3HVE B;  3TWU A;  2P9S G;  1IHG A;  3UT4 A;  4BX8 A;  4YVO A;  3E34 A;  4J8Y A;  1DNP A;  3CVU A;  3PZD A;  1E90 A;  4RQI A;  4BTB A;  4H7X A;  3FP3 A;  1GW6 A;  1EDU A;  2AXZ A;  3UXG A;  3AS5 A;  3LY7 A;  2JLB A;  4GYW A;  4AOF A;  3KAE A;  1H2U A;  3SHF A;  4EBA G;  4CDR A;  1HU3 A;  1TNU A;  3SF4 A;  5KWD A;  3GYZ A;  4IUL A;  3FEX A;  5ANR A;  5BUZ A;  4AM9 A;  1H0A A;  2QYU A;  3UM2 A;  2UWJ G;  4APF A;  4I2W A;  2KM4 A;  2V5Q C;  4U8V D;  3SI5 A;  2XZT G;  2P9U G;  4NRH B;  3JUI A;  2L0I A;  4FJZ A;  4UWK A;  5EDS A;  2PL2 A;  3FUK A;  4C9B B;  3ZIM A;  3HXB A;  2FO7 A;  2P9N G;  4B8C B;  2KZT B;  4JC8 A;  1FVH A;  1OY3 D;  4EHM A;  2MHK A;  2YIN A;  3TWW A;  2IF4 A;  3PDN A;  1E7U A;  2XS1 A;  3VTY A;  5D2M C;  3ULY A;  4U0Z A;  3APF A;  3B7T A;  4GB9 A;  3MKQ B;  1N95 A;  4UQZ A;  5ENS D;  5LOZ A;  1SA5 A;  4UQX A;  4N39 A;  3OTN A;  4DX7 D;  3VLF A;  5CEA A;  2WQ6 A;  1NP7 A;  3MV2 B;  5C1D A;  4OYS A;  3URZ A;  3SZ7 A;  3ZW3 A;  3JXJ A;  4I1A A;  4G2V A;  1N9A A;  3D9J A;  2IO3 C;  3ZUV B;  4JVS A;  2VGE A;  1HS6 A;  4Q69 A;  4I1O B;  3PE4 A;  3UUX A;  4A3T A;  3B95 A;  2A4Z A;  2OND A;  2XGO A;  3PNL B;  2FO1 E;  3LCA A;  3ENE A;  1N54 A;  3AG4 E;  2H6G A;  4G25 A;  4BEP A;  3BEE A;  3PZ1 A;  5FWQ A;  3ASD A;  3UM3 A;  1YMP A;  3I3N A;  1OWL A;  5ENQ D;  4MLP A;  2BTD A;  5ARG A;  3ZYK A;  5ENO D;  2EIM E;  3Q75 A;  4GCN A;  2DCP A;  3D9M A;  4L23 A;  1MYO A;  1E8X A;  1HO8 A;  2P2C P;  4ACL A;  1TN6 A;  1V55 E;  3F6Q A;  3L6A A;  3KEZ A;  2F37 A;  3UKR G;  3Q5M A;  5JJT A;  1E8Z A;  4ILG A;  1TNZ A;  4ABN A;  2WQ7 A;  4U0U A;  3FUN A;  3FDH A;  4JA9 A;  5BV0 A;  3CVL A;  4YDY A;  2DBA A;  5FZQ A;  4U8H A;  5AN8 A;  3CEQ A;  4I9C A;  4N2Q A;  4QFV A;  3FHE A;  2E0I A;  1D8D A;  4EZL A;  3FY4 A;  4G26 A;  2L9B A;  2Q7F A;  3U9W A;  3IXE A;  3D9K A;  4I6G A;  4KBQ A;  3ZFW A;  4GA2 A;  1B89 A;  3B7U X;  2J07 A;  1O1T A;  5LX8 A;  4HXI A;  3FU5 A;  3JQ0 A;  3DSW A;  3OXG A;  4HOT A;  4Y6C A;  5J08 A;  1EYH A;  1UN9 A;  2GRL A;  2WXH A;  3CVN A;  5D0Q D;  5FZR A;  5ITZ F;  3HVE A;  4G8K A;  2PQR A;  3CQG B;  3SFY A;  2XS8 A;  4FLH A;  3L08 A;  3O48 A;  4GMR A;  4GMJ A;  3K9I A;  4F3V A;  4BX9 A;  1OXJ A;  2WXL A;  3FWV A;  4FC8 A;  5G2N A;  1TYQ G;  2H6H A;  2Y4T A;  4HOS A;  3SNX A;  3PZ2 A;  4Q96 A;  3BG0 B;  2HR2 A;  3IHY A;  1Z3X A;  3ZRH A;  4J8D A;  1FCH A;  4JHR A;  4CGV A;  5LP0 A;  3QAR A;  1JCQ A;  1ELW A;  5EIL A;  2AJA A;  2Y0B G;  5C2Y A;  2WXM A;  4U04 A;  5A6C A;  2XPY A;  3ASH A;  2V4L A;  4HFG A;  4GTV A;  4HI8 A;  3ZXS A;  1NA3 A;  2GRM A;  1UOH A;  3ULQ A;  5JHA A;  1G3N B;  2XCC A;  5B1A E;  2GW1 A;  2HO1 A;  5J90 A;  4KZC A;  4APO A;  4TXQ A;  1BI8 B;  3CQC B;  1IXV A;  3UM0 A;  4WWO A;  3QWW A;  2L0T B;  3QJZ A;  3V30 A;  3EHQ A;  1DVP A;  4KZ0 A;  3JCK C;  4F7A A;  4GU5 A;  4BY6 A;  5CCL A;  1TJC A;  3CHQ A;  5FTP A;  2AXU A;  4BSZ B;  1BD8 A;  5CMW A;  3MKQ A;  2GRQ B;  2ZGD A;  3ZHE A;  4G1T A;  1JPL A;  2I9C A;  3LKU A;  4DRX E;  5ENT D;  3MEK A;  2L6J A;  4FJY A;  5AQB A;  2DWZ A;  4GTP A;  4GTO A;  1K8K G;  4OVV A;  3S7B A;  4N2S A;  4UI9 K;  2FEZ A;  3LEW A;  3EHR A;  4WWP A;  2J4D A;  4TXR A;  4JL0 A;  1N52 A;  4L7T A;  3EU5 A;  4U07 A;  3D9I A;  2XGS A;  3I4R B;  2MRI A;  4HNA D;  2KBX A;  2WXK A;  3GZS A;  3DEO A;  3V79 K;  1X5B A;  1YCS B;  4JXT A;  2Y1L E;  3BQO A;  3WG7 E;  1IHB A;  4XX5 A;  3QB2 A;  1RZ4 A;  3AU4 A;  1NI1 A;  4LNG A;  1JCR A;  3PZ4 A;  4PDX A;  2FUL A;  2RG8 A;  3ZYM A;  4U63 A;  1LD8 A;  4P29 A;  1SW6 A;  4E85 A;  3CHM A;  4F1P A;  2HM8 A;  4ACK A;  4XIF A;  2MOW A;  1TN8 A;  2X6F A;  2ZXW E;  1N4Q A;  2WXG A;  4LNU D;  1HG2 A;  3V31 A;  3LJ3 A;  4KVM A;  2GRO B;  1A5E A;  3GW4 A;  4BES A;  3EU9 A;  4ME2 A;  4WNG A;  4CZ2 D;  1U3C A;  3ULE G;  4N3A A;  2J8S D;  3DPY A;  3LS8 A;  3NZS A;  1SZA A;  2EQX A;  3VLE A;  2MYO A;  1OCO E;  3LDZ A;  3GZ1 A;  3DSS A;  3CV0 A;  1HXI A;  1K1B A;  1WM5 A;  3QKY A;  1NFI E;  4J0U A;  4RVB A;  4FLB A;  3JYS A;  2WPV A;  3EHN A;  5ARF A;  3NBN B;  4K03 A;  2J9Q A;  3P1U A;  4WNF A;  4JEH A;  5EX3 A;  1Z3Y A;  3CHR A;  4XEI G;  2VGY A;  2RKK A;  2ZIR A;  4MS6 A;  2J09 A;  3DSV A;  2R17 C;  1HZ4 A;  3S7D A;  5AEN A;  1HFA A;  3UT8 A;  3ZYL A;  1KPS B;  3R9A B;  4EZJ A;  4LSZ E;  5BV1 A;  3ESL A;  4PS8 A;  1TEZ A;  5BXU A;  4EBA A;  2XPI A;  3T9K A;  1IYG A;  5CRV A;  4ANX A;  4HLE A;  1VDY A;  4PS3 A;  2IOS A;  2NC9 A;  4DX6 D;  3CVP A;  4UI9 J;  4C0M A;  3NF1 A;  3FUD A;  3OXF A;  2XQ0 A;  4EZK A;  3B7B A;  3G2T A;  2JAB A;  3UIO C;  3G2W A;  1DCQ A;  2A5E A;  5EKQ D;  5JA4 D;  3PRE A;  2FBN A;  3G2U A;  1MZC A;  2CHW A;  2P58 C;  4G8L A;  3ASF A;  3UPV A;  1QZ2 A;  5AJL A;  4RG6 A;  3FUI A;  3FTX A;  3Q9U C;  3PEV B;  4JZY A;  2EIL E;  3HXD A;  3CGH A;  3FTS A;  4UWG A;  3D3M A;  1S63 A;  3T5X A;  4GAA A;  3C72 A;  4BT9 A;  2QY7 A;  4HOQ A;  5LCW C;  3QWV A;  3KSL A;  2BF0 X;  4J7W A;  2V8S E;  1S64 A;  2XZD G;  1UW4 B;  4FUL A;  4F53 A;  1P5Q A;  2J4B A;  4BSX A;  4GPM A;  3MJW A;  4KVO A;  2VGX B;  2DVW A;  5EYP F;  5T8I A;  1EPU A;  3MCX A;  2PZI A;  4KYO B;  3MA5 A;  3MYV A;  3SBT B;  3LYA A;  1OUV A;  1FT1 A;  5G05 J;  1MHQ A;  3FU0 A;  2Y69 E;  5KJK A;  1MQS A;  3UX4 A;  5JMN D;  4TXP A;  3HG0 D;  5G04 J;  4TRQ A;  1X81 A;  4EPZ A; 
#chains in the Genus database with same CATH homology
 2EIN E;  3ASN E;  5B1B E;  5B3S E;  3ABM E;  1OCO E;  3AG1 E;  3X2Q E;  1OCZ E;  1V54 E;  3ASO E;  3WG7 E;  2DYS E;  2EIM E;  2Y69 E;  3AG4 E;  3AG3 E;  3ABK E;  3ABL E;  1OCR E;  2EIK E;  2DYR E;  2OCC E;  5IY5 E;  2EIL E;  2EIJ E;  2ZXW E;  1V55 E;  3AG2 E;  5B1A E;  1OCC E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...