4C48B

Crystal structure of acrb-acrz complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
152
structure length
152
Chain Sequence
GKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ACRIFLAVINE RESISTANCE PROTEIN B
publication title Structure of the AcrAB-TolC multidrug efflux pump.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 35
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2013-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4c48B00
1N0RA 5HS0A 5KBAA 1N0QA 5ENSD 1QYMA 3J5PA 4JB8P 4QFVA 4DUIA 3EU9A 2ETAA 4DX7D 2XZTG 4HI8A 2F37A 2VGEA 1MX2A 2Y0BG 1IXVA 2DZOA 3IXEA 3HG0D 3LJNA 5EN5D 4J7WA 4LSZE 5CECB 2XEHA 1IKND 4K5AB 1MX6A 2BKKB 5EYLA 5CEAA 3J5QB 5BXUA 4UUCA 1K3ZD 1DC2A 3DEOA 2F8XK 4O60A 1BLXB 4HRLA 2ZGGA 4DX6D 3KEAA 1AP7A 1SW6A 5CBNA 3V79K 1MYOA 5KNHD 3AAAC 3UI2A 4YDYA 4B93B 2DVWA 5KNGA 1TR4A 1D9SA 2HE0A 1K1BA 3TWUA 5JMND 2BKGA 2P2CP 2AJAA 2B0OE 5ENOD 5HRYA 4ZHBA 2ZGDA 3ZU7B 1N11A 4N5QA 5ENTD 4HQDA 3ZNGA 5ENPD 4OAVB 2F8YA 5D66A 5FIOA 3ZKJA 5AQAA 4LG6A 2XZDG 3D9HA 4CZ2D 3Q9UC 2A5EA 3EHQA 3HRAA 1BI7B 1S70B 1OT8A 5EIDA 4G8LA 5AN8A 3NBNB 4Z68A 3NOGD 3W9FA 2RFMA 2QYJA 3UXGA 3W9GA 4K5CA 1YMPA 3C5RA 1BI8B 3T9KA 4RLYA 4BSZB 3B7BA 2PNNA 4A63B 4C48B 1UOHA 3AJIA 4HRMB 4U8VD 5EYPF 1BU9A 2Y1LE 1NFIE 1BD8A 4DX2A 1DCQA 5JA4D 2DZNA 2RFAA 4TUMA 2J8SD 3B95A 2ETCA 1OY3D 2V4HC 5CERB 3NOCD 3V2OA 4BERA 3TWTA 2XENA 1K1AA 5ITZF 4U95D 4BEPA 3V31A 5BXOA 1YYHA 4U96D 2MYOA 4HRNA 3EHRA 4HLLA 4BESA 4DRXE 1WDYA 2KBXA 5AQ7A 3T8KA 3ZUVB 1IHBA 4F1PA 2QC9A 4NIKA 1AWCB 3Q9NC 2KXPC 3F6QA 5AAOA 4O1OA 5HKPA 5CBOA 3SO8A 3JXIA 5EILA 5FINA 1G3NB 1A5EA 3TWVA 5KWDA 4LNUD 4ATZD 4DX5D 3TWXA 1WG0A 3TWWA 1SVXA 3DEPA 4O1PA 5ENRD 3TWRA 4GMRA 4DX1A 5AARA 3UTMA 4U8YD 3V30A 4OAUC 2V5QC 2FO1E 4GPMA 5AQ9A 5ENQD 2L6BA 4HB5A 4CYMD 4ZFHA 2NYJA 4YDWA 1MX4A 4BETA 2XEEA 2ETBA 4HNAD 5CEDB 4K5BA 1MJ0A 4J8YA 3TWQA 4G8KA 4HBDA 5EIBE 2DWZA 3V2XA 3JXJA 1YCSB 3JUEA 5AQBA 4F6RD 3TWSA 2JABA 4HI9A 4QQIA
chains in the Genus database with same CATH superfamily
3FUFA 2IEJA 4EBAG 4QFVA 4ATGA 2Y0BG 2HM8A 3RRUA 5EKQD 4JEHA 2WQ7A 3EHNA 4WNFA 4KVMA 4DX6D 3V79K 5KNHD 3CHSA 2FBNA 3QDNA 4CDNA 2YINA 3ML9A 2B0OE 4PS7A 1HF8A 5FIOA 3D9HA 1S70B 3AG4E 1OT8A 2VJ8A 4U7EB 3AS4A 2MOWA 4GTOA 1HXIA 4KVOA 4U8VD 1HO8A 3D9MA 4ANUA 5T4YA 5JJ7A 1FVHA 2V4HC 3E37A 2J07A 3SFZA 2XENA 3DPYA 1W3BA 2V4LA 2MYOA 4U0ZA 3VLDA 5H7PA 1TNUA 3KEZA 3UKRG 1HG2A 4JA9A 5FJYA 3ZPJA 4LNBA 2XGMA 4GMRA 2P9NG 2XGSA 4JPSA 4W9RA 4I2ZA 4BWRA 5FTPA 3OAWA 1MJ0A 3OTNA 4GYWA 4X8QA 3KS2A 3IHYA 3JUEA 3TWSA 1UN9A 4BSZB 3OXFA 3APFA 3EU9A 1D8DA 2ETAA 3SFYA 4BTBA 1E8ZA 4I43A 5BXUA 1H0AA 4BY6A 3EU5A 2IO3C 3FUDA 4KT6B 4B8AA 3QWVA 3ZRHA 5JHAA 1Z6TA 4XE0A 3RSEG 3CIAA 4RSYA 3CHQA 3SBSA 4JXTA 1ZB1A 2DCPA 5BT1A 5EX0A 3SBTB 4IN3B 3S7JA 3Q7AA 4CZ2D 4IYPA 3IHVA 5C1DA 2L0TB 1JWGA 1X5BA 2IQCA 4Z68A 3NOGD 2RG8A 4G26A 3CHRA 2GW1A 2WXPA 1B89A 3NZUA 2WXKA 4HOUA 4C48B 3CQCB 2Y1LE 1SA4A 4NQ0A 4G25A 3PE3A 1FCHA 2L6JA 3PS6A 3V2OA 2IOSA 5BXOA 3V31A 5E75A 3MV3B 2L0IA 4DRXE 2OCCE 3ZYKA 4CT0A 1ZU2A 2C0LA 4AXHA 3FTXA 5A23A 2QFCA 3TWRA 3CVWA 3V30A 4JVSA 3JCKC 4JL0A 3UM0A 5M72A 3ZHEB 3L13A 4HBDA 1TJCA 5BPPA 2NC9A 4WNEA 3CK9A 3CVPA 4LCTA 1Z3XA 2KC7A 2QY7A 2IJGX 2GRNB 3PUKA 1OCOE 2WPVA 5EYLA 4UUCA 2AWIA 1H2UA 1KT1A 3B7TA 1H19A 1MYOA 3FUJA 2HR2A 1K1BA 3D9KA 3TG5A 4I1MA 3ZNGA 1JCQA 4EQFA 4A3TA 2R17C 4UWKA 5T8IA 4JEUA 5CCMA 2P9SG 2QYJA 3E34A 2WXJA 2WXGA 3Q47B 2XPYA 1S63A 4WAFA 1LF8A 3ZXPA 4I6EA 3B95A 4BERA 2Y69E 5ITZF 2XCCA 5T3RA 4DPRA 3Q5MA 1JCRA 3FUMA 3UMVA 3AG2E 3KAEA 1HH8A 4N5CA 3RO2A 2I2OA 3FH8A 2P58C 1E8YA 3WG7E 4GB9A 4U8YD 4GCOA 1Z3YA 3ZVVA 1H6KA 2XEEA 5CEDB 4KXKB 3GZSA 1S0PA 2HO1A 1XNFA 3EJNA 5EIBE 3U4TA 4A55A 3E33A 4GAAA 2HYZA 3QNKA 4WWNA 4MKTA 5A7DB 4ME2A 1OCCE 4A1GA 5G05C 3D3MA 3TXNA 2ZIRA 4B94A 1TJFA 3PNLB 1INZA 4GTQA 4IULA 4DJAA 4N2SA 3UT8A 1OXJA 3B7UX 3Q4AB 3DXKG 4DLQA 4C9BB 3D9PA 2GRRB 2BKGA 4WWOA 2E0IA 2P2CP 4ZHBA 2A4ZA 4RVBA 4XIFA 3P1UA 3L16A 3G2TA 3CGHA 3MX3A 1OWLA 5BNWA 3CVXA 3S7FA 2CHZA 3ZW3A 4AV7A 1OCZE 1UG3A 4TXRA 3PVLA 3T9KA 5LP0A 3CVLA 5EYPF 2V8SE 3LVRE 2IF4A 5EX3A 4F7AA 4FJZA 2WXIA 4BT9A 4GYYA 4APFA 5AIJA 4GA2A 3RIBA 3SZ7A 2QC9A 2WXQA 3TGOA 4M3OA 2XEVA 4I2WA 3TWVA 1HU3A 1WG0A 3PZ3A 4EBAA 4JA7A 1IYGA 4D10C 3PZDA 4CYMD 1O1SA 2IY0C 2NYJA 4ILIA 1Y6IA 2FEZA 2ONDA 2YHEA 4MRUA 4FC8A 3FP3A 4HI9A 2X6FA 2VTBB 2UY1A 3OXLA 2CHWA 3QKYA 4O60A 4HXIA 1OWMA 4FA6A 4U07A 3S2AA 5CBNA 2GRLA 1U3DA 3QAQA 1SQMA 4FADA 1N11A 3PH0C 1K8KG 5LFAA 1E96B 4FLHA 2WM9A 4WWPA 5KJMA 3UKUG 1TEZA 1BPOA 4URKA 4BTAA 2C2LA 5AN8A 3W9FA 2H6GA 2GRQB 2FULA 3UIPC 4EZJA 2P9PG 3EDTB 2DZNA 2J8SD 2LAHA 4EECA 1N52A 3U9WA 3U3WA 4GZ3A 3ASOE 3HXDA 4KZ0A 2LO6A 1EYHA 5B1BE 3ASHA 4WNGA 3L08A 1E8WA 3T8KA 5JJTA 2PQNA 1JUQA 2WB2A 1WAO1 4Q96A 4GMLA 1DCEA 2VGXA 1G3NB 4JHKA 4TRQA 1L5JA 4GPMA 5ENQD 2L6BA 4UWFA 3CSTA 4BETA 2LAIA 3FTYA 3CR3A 4DX7D 3BQOA 4G1TA 2ZISA 3IXEA 5JJ6A 3RK6A 4FU3A 1MZCA 2VSNA 4N2QA 4HRLA 2BTDA 4YDYA 3UPVA 5E76A 2KZTB 5J90A 4H7XA 2CG3A 4AJWA 1PAQA 2EIKE 4HQDA 2OEWA 4GPKA 3PEUB 4RG6A 4AP2A 3NBNB 3FTVA 2P9LG 3R9MA 3UINC 4L9PA 1ELWA 1H2TC 1OWNA 2IFUA 5JA4D 3ABKE 4XX5A 3SQVA 4U95D 2OEVA 3OXGA 3LEWA 1Q2ZA 2NXPA 4U8HA 3RRNB 4HLLA 2LXMA 3SHFA 3Q9NC 3FEXA 1D8EA 3FTUA 4CGVA 3L6AA 4J8DA 4I1AA 3ULYA 3ONKA 2OVFA 3DEPA 3HVEB 4DX1A 5D0QD 4TXPA 1FPPA 1MX4A 2V5FA 4HNAD 4UQYA 4HOSA 3LPZA 3HHMA 3L9TA 4LRZA 3V2XA 2Y4UA 4CRWA 3CHPA 5CMWA 2PM6A 2J4BA 4HI8A 5AJLA 5EN5D 1IXVA 5CCLA 3ASDA 3ASGA 1DC2A 2EILE 3L82A 3RU0A 4APOA 2F8XK 1E7UA 4HFGA 4TXQA 3WXXA 5JHBA 5B1AE 3ZFWA 1XGWA 2IONA 3PREA 5ENOD 1U3CA 4AY5A 2XPZA 3B7RL 4DK5A 3Q9UC 1N4PA 4G23A 4I9CA 3B7SA 2KCLA 4U63A 2AVPA 1BI8B 5G2NA 3TG4A 3ESKA 3ABLE 1NFIE 1NL4A 3UIOC 4ACLA 1EDUA 4FHKA 2RD0A 1N4RA 4BEPA 1O1RA 1KLXA 3CVYA 2WMOA 4TV3A 4GTTA 1LD8A 4F3VA 4GA0A 3GZ2A 4F1PA 3S7BA 2QZAA 5EILA 4BX8A 5FINA 4F1SA 2MRIA 4ANWA 3BEEA 4K0RA 4ACKA 2FF4A 3PDNA 4G8KA 2WQ6A 3ESLA 4RG9A 1WY6A 4OVVA 3NZSA 3HIZA 4I17A 3MKRA 3CVQA 3CV0A 3ZYQA 3HDXA 3J5QB 3UM1A 3D9JA 2DYSE 5BV1A 4AOFA 2Q7FA 3FUIA 2XPIA 1JWFA 3ASNE 5JMND 1NI1A 3APDA 3TJPA 3VTYA 4FULA 3D9IA 3LS8A 2BF0X 4YDEA 2IOLA 1PY1A 4M7CA 4PS3A 1NZNA 3D9NA 2XHEA 2A5EA 4L2LA 1WM5A 2R03A 2CHXA 5FQ8A 3HXFA 2H6FA 3MKQB 5FQ6A 3QWPA 1UOHA 1RW2A 3AJIA 3DSWA 4HRMB 5B3SE 2I9CA 4GCNA 1OY3D 2DBAA 4GMJA 3CVVA 1K1AA 1YYHA 4J8FA 2YHCA 3FTZA 4P29A 3QJZA 1WDYA 3F6QA 2P9KG 3SO8A 3JXIA 1SZAA 3CK8A 3GZ1A 1IHGA 4LNGA 3PEVB 5AARA 3SNXA 4HB5A 4CCAA 1FVFA 4N3AA 3G2WA 5G05J 4C0EA 2CFZA 2YNQA 5HS0A 4BT8A 2X38A 3PNTB 5D2MC 2KCVA 3LJNA 1MX2A 3QOUA 2E2EA 2XEHA 2PL2A 3L17A 1MX6A 2VYIA 5CEAA 4CDRA 1EPUA 3DEOA 3Q7FA 1IQRA 4XEIG 4DI3A 2DYRE 4B93B 1QNFA 1HZ4A 4UI9J 2L9BA 4E6HA 4PDXA 3CVNA 3EHMA 2IU1A 5D66A 3UX4A 2XZDG 5FQ4A 3QK0A 3EHQA 3S7DA 2A5UA 3TXMA 2XS1A 2WXLA 1YMPA 4RLYA 2C0MA 3B7BA 2XQ0A 3AG1E 3FWVA 4V3IA 4KZCA 3FU6A 4NACA 2MHKA 3AU4A 5CERB 1HE8A 4UI9C 3JQ1A 3EHRA 2EIJE 4N3BA 4KBQA 4GZDA 4GU5A 2DIWA 3CHOA 3GYZA 1O1TA 4Y6CA 3UTMA 1E8XA 1DNPA 5KJKA 5FZRA 4H7YA 4L1BA 3LKUA 3CK7A 4F6RD 2GGFA 4Q69A 3UQ3A 2J08A 3HYMB 4B0ZA 2X6KA 2Y3AA 4GTVA 3UT7A 3KD7A 3KSQA 3FHEA 1P5QA 3DSUA 1MHQA 3KEAA 4R7LA 4I1OB 3BUAA 3PZ4A 4GTMA 4N5QA 4YDOA 3FTWA 4RQIA 5IY5E 5LCWC 3PE4A 5FZQA 3VLEA 2WXOA 3EIJA 5FT9A 2AXUA 1QBQA 1BI7B 4I9EA 3I4RB 2EINE 1H6PA 4G8LA 5D0OD 2PQRA 2IO2C 3U64A 3P2BA 3K9IA 1TYQG 2FI7A 3R7RA 1DCQA 4ANXA 4TUMA 3ZGQA 3MCXA 2OOEA 2XRZA 2XRYA 5FZSA 2LNIA 1Z5SC 2R05A 3NF1A 1LD7A 5KWDA 4LNUD 4DX5D 4PUCA 4U04A 2QYUA 3ML8A 4FHJA 1TNBA 4YDWA 2ETBA 3ZIMA 1SA5A 3ZHEA 1ELRA 3JXJA 3CHMA 3FUEA 4G2VA 3SFXA 4UI9K 1N0RA 3ULEG 2AXVA 1QYMA 3SI5A 4JB8P 4EZLA 2XZTG 1IKND 2EIME 4K5AB 3BG1B 3FDHA 3QB2A 2BUGA 2X6JA 2PM7A 3D9OA 2AW6A 1SW6A 2H6HA 4MLPA 5HRYA 3ZU7B 5ENTD 4N3CA 3E32A 4OAVB 3DXMG 5AQAA 2H6IA 3ZYMA 1KZPA 3C98A 3Q79A 5EIDA 1E90A 4XKCA 4E85A 3CLJA 5AJDA 3FH5A 3T5XA 3PZ1A 3C3RA 3ZEFA 3SY2A 2RFAA 4FP7A 1N4SA 3E4BA 4AY6A 5FWQA 1HS6A 4BESA 1TNZA 3FUKA 3FH7A 4GA1A 4GYOA 3MGBA 5AYWD 4ATZD 2VSOE 4OAUC 3NQPA 3DWLG 2WQHA 4KYOB 1JPLA 3ZXSA 1KZOA 3DBSA 5ANRA 4BSXA 2I1KA 4JW1A 4DI4A 1N0QA 1IQUA 4Q94A 3AS8A 3ULQA 2DZOA 4J6IA 2R2LA 3URZA 5ANLA 3CQGB 2I1JA 4UWGA 3AS5A 2LXLA 4XKBA 5KNGA 4CGWA 4JD2G 4UQZA 3B13A 4HVBA 4BFRA 1UW4B 2GRPB 3CVUA 5LOZA 2XGOA 2WMNA 1NA3A 3T8MA 3G2SA 3ONLA 3DSSA 5KCMA 1X81A 3FUNA 5CHEE 4WUYA 2JEKA 1BU9A 3FTSA 4HS2A 3C3QA 1UJKA 4O6FA 1Y8MA 3LCAA 3ZUVB 2KBXA 5AQ7A 1A17A 2ILRA 4J8SA 4L2YA 4O1OA 3LXUX 2OVBA 3FU3A 3FUHA 4IRUA 1NP7A 3TWXA 5LX8A 1N95A 1QQEA 3T5VA 2PZIA 1HFAA 2EQXA 5FQ7A 4L7TA 1S64A 3UT4A 1UN8A 1FT1A 3QC1A 5KBAA 2VTBA 2VQ2A 2F37A 1H2VC 4YVOA 3FY4A 5CECB 2UY1B 4HORA 4GTSA 3MA5A 3DPDA 1K3ZD 1BLXB 5BV0A 2ZGGA 4F53A 3RO3A 2X6IA 3AAAC 1HG5A 1D9SA 3E30A 3TWUA 1V54E 4JC8A 1V55E 1OWPA 2J09A 4N39A 2F8YA 4NRHB 4FJYA 4LG6A 3RRMB 3MV2B 2KATA 1QZ2A 2CG2A 1O5MA 3UXGA 3EUVA 3W9GA 4UWHA 4AM9A 4GZ6A 4A63B 3ENEA 3VLFA 3I4GA 1BD8A 2XCBA 1KPSB 4UWLA 3QARA 4A3VA 4DLOA 1ZBPA 3KSLA 2WXMA 3MYVA 2FO7A 1GW6A 5CBOA 4JHRA 4ANVA 2WXNA 2KCKA 3LY7A 3FFLA 4EPZA 2J49A 2VGXB 2V0PA 4I6JA 2J4DA 4J8YA 3TWQA 4JZYA 3DSTA 1NA0A 1YA0A 3C72A 4BX9A 1HX8A 2DWZA 1YCSB 5AQBA 3O4ZA 3IEGA 3J5PA 3C3OA 2R5SA 4AVXA 3FULA 4J7WA 4LSZE 2KM4A 3Q78A 4GTPA 1N4QA 4AEZC 4B8CB 2WXFA 4EHMA 2VSXE 4HOQA 5DBKA 1E7VA 1AP7A 3TL5A 4XI0A 3RAUA 4PS8A 2DVWA 1N54A 2HE0A 3UM2A 4XZ4A 2KZTA 2P9UG 3APCA 3I3NA 2R59A 2OV8A 2UWJG 3ZKJA 5G55A 1RZ4A 3JQ0A 4MBGA 5CRUA 3HXEA 3EIQC 2I6HA 4J8EA 4CEMA 1N94A 2RFMA 4C0MA 3UM3A 4WNDA 3ZYLA 4ILGA 2PNNA 1ELKA 3VTXA 2Y4TA 3CSFA 2ZU6B 4YNDA 1SZ9A 3DSVA 4GTRA 4LUNU 2VGYA 3LY8A 3DRAA 4U96D 4Y6WA 2M63A 3LVQE 5AENA 3MEKA 3LJ3A 1AWCB 4K03A 3HVEA 4JHJA 1SVXA 3N71A 2V5QC 1KT0A 2VSYA 2FO1E 5C2YA 1PC2A 3FEYA 5AQ9A 4ZFHA 3Q49B 3NB2A 4UQXA 2WVIA 4AIFA 4OVUA 4I6GA 3NAWA 2YQ8A 3LDZA 4LERA 2AXZA 3MZLB 5ENSD 4DUIA 1FT2A 5KJNA 2VGEA 4NURA 2B6CA 4ILHB 3BG0B 1UJJA 2P9IG 5ENNA 1JCSA 4L23A 1OUVA 2JLBA 5LCWJ 2CFUA 2GROB 3UI2A 3LYAA 4G24A 4KMOA 3RJVA 2AJAA 3IBEA 4LEUA 3GW4A 3CKBA 5CRVA 2RKKA 3G2UA 3L22A 3HRAA 1VDYA 3HXBA 3Q75A 3FU0A 3ABME 4XI9A 1LTXA 3PUJA 3C5RA 4G11A 5ARFA 4A1SA 5CMYA 2R02A 2ETCA 5ARGA 3R9AB 3JYSA 5G04J 5BW8C 1TN6A 3RKVA 3D9LA 4NIKA 2KXPC 5AAOA 4OYSA 1OWOA 3DSXA 4CT4A 3TWWA 5ENRD 2LSUA 1H6OA 3LY9A 3PRZA 1DVPA 4K5BA 4HOTA 2BEDA 4MS6A 4B89A 4ABNA 4EZKA 1OCRE 3IKOB 2JABA 4QQIA 2XS8A 5G04C 1MQSA 3HG0D 2BKKB 2F0YA 3AU5A 3MJWA 3X2QE 3L54A 3G2VA 2J9QA 1TR4A 4YVQC 3R7QA 2LUHA 4U0SA 2ZGDA 2WXHA 1N9AA 5ENPD 5J08A 1U2VG 2X6HA 3Q15A 2LSVA 3PZ2A 3IV0A 3UUXA 3MKQA 4GZ5A 3ZN3A 5BUZA 3SGHA 2GRMA 4U0UA 4K5CA 4CDMA 3JUIA 4DX2A 3BU8A 3SD5A 3NOCD 4TUUA 1TNYA 2WXRA 3CEQA 3FU5A 3QWWA 3TWTA 2ZXWE 3ISMC 3CKCA 4HRNA 3SF4A 3AG3E 3O48A 2X3MA 1EF1C 5HQ8A 1IHBA 2NSZA 3I5PA 1TNOA 4J0UA 5HKPA 3HXCA 3U66A 1A5EA 5EDSA 4O1PA 5DIZA 4HLEA 1TN7A 4GZCA 3TAXA 5A6CA 4FLBA 3ASFA 4PH4B 5KJLA 3Q73A 5HI7A 1TN8A
chains in the Genus database with same CATH topology
1N0RA 5HS0A 5KBAA 1N0QA 5ENSD 1QYMA 3J5PA 4JB8P 4QFVA 4DUIA 3EU9A 2ETAA 4DX7D 2XZTG 4HI8A 2F37A 2VGEA 1MX2A 2Y0BG 1IXVA 2DZOA 3IXEA 3HG0D 3LJNA 5EN5D 4J7WA 4LSZE 5CECB 2XEHA 1IKND 4K5AB 1MX6A 2BKKB 5EYLA 5CEAA 3J5QB 5BXUA 4UUCA 1K3ZD 1DC2A 3DEOA 2F8XK 4O60A 1BLXB 4HRLA 2ZGGA 4DX6D 3KEAA 1AP7A 1SW6A 5CBNA 3V79K 1MYOA 5KNHD 3AAAC 3UI2A 4YDYA 4B93B 2DVWA 5KNGA 1TR4A 1D9SA 2HE0A 1K1BA 3TWUA 5JMND 2BKGA 2P2CP 2AJAA 2B0OE 5ENOD 5HRYA 4ZHBA 2ZGDA 3ZU7B 1N11A 4N5QA 5ENTD 4HQDA 3ZNGA 5ENPD 4OAVB 2F8YA 5D66A 5FIOA 3ZKJA 5AQAA 4LG6A 2XZDG 3D9HA 4CZ2D 3Q9UC 2A5EA 3EHQA 3HRAA 1BI7B 1S70B 1OT8A 5EIDA 4G8LA 5AN8A 3NBNB 4Z68A 3NOGD 3W9FA 2RFMA 2QYJA 3UXGA 3W9GA 4K5CA 1YMPA 3C5RA 1BI8B 3T9KA 4RLYA 4BSZB 3B7BA 2PNNA 4A63B 4C48B 1UOHA 3AJIA 4HRMB 4U8VD 5EYPF 1BU9A 2Y1LE 1NFIE 1BD8A 4DX2A 1DCQA 5JA4D 2DZNA 2RFAA 4TUMA 2J8SD 3B95A 2ETCA 1OY3D 2V4HC 5CERB 3NOCD 3V2OA 4BERA 3TWTA 2XENA 1K1AA 5ITZF 4U95D 4BEPA 3V31A 5BXOA 1YYHA 4U96D 2MYOA 4HRNA 3EHRA 4HLLA 4BESA 4DRXE 1WDYA 2KBXA 5AQ7A 3T8KA 3ZUVB 1IHBA 4F1PA 2QC9A 4NIKA 1AWCB 3Q9NC 2KXPC 3F6QA 5AAOA 4O1OA 5HKPA 5CBOA 3SO8A 3JXIA 5EILA 5FINA 1G3NB 1A5EA 3TWVA 5KWDA 4LNUD 4ATZD 4DX5D 3TWXA 1WG0A 3TWWA 1SVXA 3DEPA 4O1PA 5ENRD 3TWRA 4GMRA 4DX1A 5AARA 3UTMA 4U8YD 3V30A 4OAUC 2V5QC 2FO1E 4GPMA 5AQ9A 5ENQD 2L6BA 4HB5A 4CYMD 4ZFHA 2NYJA 4YDWA 1MX4A 4BETA 2XEEA 2ETBA 4HNAD 5CEDB 4K5BA 1MJ0A 4J8YA 3TWQA 4G8KA 4HBDA 5EIBE 2DWZA 3V2XA 3JXJA 1YCSB 3JUEA 5AQBA 4F6RD 3TWSA 2JABA 4HI9A 4QQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N0R A;  5HS0 A;  5KBA A;  1N0Q A;  5ENS D;  1QYM A;  3J5P A;  4JB8 P;  4QFV A;  4DUI A;  3EU9 A;  2ETA A;  4DX7 D;  2XZT G;  4HI8 A;  2F37 A;  2VGE A;  1MX2 A;  2Y0B G;  1IXV A;  2DZO A;  3IXE A;  3HG0 D;  3LJN A;  5EN5 D;  4J7W A;  4LSZ E;  5CEC B;  2XEH A;  1IKN D;  4K5A B;  1MX6 A;  2BKK B;  5EYL A;  5CEA A;  3J5Q B;  5BXU A;  4UUC A;  1K3Z D;  1DC2 A;  3DEO A;  2F8X K;  4O60 A;  1BLX B;  4HRL A;  2ZGG A;  4DX6 D;  3KEA A;  1AP7 A;  1SW6 A;  5CBN A;  3V79 K;  1MYO A;  5KNH D;  3AAA C;  3UI2 A;  4YDY A;  4B93 B;  2DVW A;  5KNG A;  1TR4 A;  1D9S A;  2HE0 A;  1K1B A;  3TWU A;  5JMN D;  2BKG A;  2P2C P;  2AJA A;  2B0O E;  5ENO D;  5HRY A;  4ZHB A;  2ZGD A;  3ZU7 B;  1N11 A;  4N5Q A;  5ENT D;  4HQD A;  3ZNG A;  5ENP D;  4OAV B;  2F8Y A;  5D66 A;  5FIO A;  3ZKJ A;  5AQA A;  4LG6 A;  2XZD G;  3D9H A;  4CZ2 D;  3Q9U C;  2A5E A;  3EHQ A;  3HRA A;  1BI7 B;  1S70 B;  1OT8 A;  5EID A;  4G8L A;  5AN8 A;  3NBN B;  4Z68 A;  3NOG D;  3W9F A;  2RFM A;  2QYJ A;  3UXG A;  3W9G A;  4K5C A;  1YMP A;  3C5R A;  1BI8 B;  3T9K A;  4RLY A;  4BSZ B;  3B7B A;  2PNN A;  4A63 B;  4C48 B;  1UOH A;  3AJI A;  4HRM B;  4U8V D;  5EYP F;  1BU9 A;  2Y1L E;  1NFI E;  1BD8 A;  4DX2 A;  1DCQ A;  5JA4 D;  2DZN A;  2RFA A;  4TUM A;  2J8S D;  3B95 A;  2ETC A;  1OY3 D;  2V4H C;  5CER B;  3NOC D;  3V2O A;  4BER A;  3TWT A;  2XEN A;  1K1A A;  5ITZ F;  4U95 D;  4BEP A;  3V31 A;  5BXO A;  1YYH A;  4U96 D;  2MYO A;  4HRN A;  3EHR A;  4HLL A;  4BES A;  4DRX E;  1WDY A;  2KBX A;  5AQ7 A;  3T8K A;  3ZUV B;  1IHB A;  4F1P A;  2QC9 A;  4NIK A;  1AWC B;  3Q9N C;  2KXP C;  3F6Q A;  5AAO A;  4O1O A;  5HKP A;  5CBO A;  3SO8 A;  3JXI A;  5EIL A;  5FIN A;  1G3N B;  1A5E A;  3TWV A;  5KWD A;  4LNU D;  4ATZ D;  4DX5 D;  3TWX A;  1WG0 A;  3TWW A;  1SVX A;  3DEP A;  4O1P A;  5ENR D;  3TWR A;  4GMR A;  4DX1 A;  5AAR A;  3UTM A;  4U8Y D;  3V30 A;  4OAU C;  2V5Q C;  2FO1 E;  4GPM A;  5AQ9 A;  5ENQ D;  2L6B A;  4HB5 A;  4CYM D;  4ZFH A;  2NYJ A;  4YDW A;  1MX4 A;  4BET A;  2XEE A;  2ETB A;  4HNA D;  5CED B;  4K5B A;  1MJ0 A;  4J8Y A;  3TWQ A;  4G8K A;  4HBD A;  5EIB E;  2DWZ A;  3V2X A;  3JXJ A;  1YCS B;  3JUE A;  5AQB A;  4F6R D;  3TWS A;  2JAB A;  4HI9 A;  4QQI A; 
#chains in the Genus database with same CATH topology
 3FUF A;  2IEJ A;  4EBA G;  4QFV A;  4ATG A;  2Y0B G;  2HM8 A;  3RRU A;  5EKQ D;  4JEH A;  2WQ7 A;  3EHN A;  4WNF A;  4KVM A;  4DX6 D;  3V79 K;  5KNH D;  3CHS A;  2FBN A;  3QDN A;  4CDN A;  2YIN A;  3ML9 A;  2B0O E;  4PS7 A;  1HF8 A;  5FIO A;  3D9H A;  1S70 B;  3AG4 E;  1OT8 A;  2VJ8 A;  4U7E B;  3AS4 A;  2MOW A;  4GTO A;  1HXI A;  4KVO A;  4U8V D;  1HO8 A;  3D9M A;  4ANU A;  5T4Y A;  5JJ7 A;  1FVH A;  2V4H C;  3E37 A;  2J07 A;  3SFZ A;  2XEN A;  3DPY A;  1W3B A;  2V4L A;  2MYO A;  4U0Z A;  3VLD A;  5H7P A;  1TNU A;  3KEZ A;  3UKR G;  1HG2 A;  4JA9 A;  5FJY A;  3ZPJ A;  4LNB A;  2XGM A;  4GMR A;  2P9N G;  2XGS A;  4JPS A;  4W9R A;  4I2Z A;  4BWR A;  5FTP A;  3OAW A;  1MJ0 A;  3OTN A;  4GYW A;  4X8Q A;  3KS2 A;  3IHY A;  3JUE A;  3TWS A;  1UN9 A;  4BSZ B;  3OXF A;  3APF A;  3EU9 A;  1D8D A;  2ETA A;  3SFY A;  4BTB A;  1E8Z A;  4I43 A;  5BXU A;  1H0A A;  4BY6 A;  3EU5 A;  2IO3 C;  3FUD A;  4KT6 B;  4B8A A;  3QWV A;  3ZRH A;  5JHA A;  1Z6T A;  4XE0 A;  3RSE G;  3CIA A;  4RSY A;  3CHQ A;  3SBS A;  4JXT A;  1ZB1 A;  2DCP A;  5BT1 A;  5EX0 A;  3SBT B;  4IN3 B;  3S7J A;  3Q7A A;  4CZ2 D;  4IYP A;  3IHV A;  5C1D A;  2L0T B;  1JWG A;  1X5B A;  2IQC A;  4Z68 A;  3NOG D;  2RG8 A;  4G26 A;  3CHR A;  2GW1 A;  2WXP A;  1B89 A;  3NZU A;  2WXK A;  4HOU A;  4C48 B;  3CQC B;  2Y1L E;  1SA4 A;  4NQ0 A;  4G25 A;  3PE3 A;  1FCH A;  2L6J A;  3PS6 A;  3V2O A;  2IOS A;  5BXO A;  3V31 A;  5E75 A;  3MV3 B;  2L0I A;  4DRX E;  2OCC E;  3ZYK A;  4CT0 A;  1ZU2 A;  2C0L A;  4AXH A;  3FTX A;  5A23 A;  2QFC A;  3TWR A;  3CVW A;  3V30 A;  4JVS A;  3JCK C;  4JL0 A;  3UM0 A;  5M72 A;  3ZHE B;  3L13 A;  4HBD A;  1TJC A;  5BPP A;  2NC9 A;  4WNE A;  3CK9 A;  3CVP A;  4LCT A;  1Z3X A;  2KC7 A;  2QY7 A;  2IJG X;  2GRN B;  3PUK A;  1OCO E;  2WPV A;  5EYL A;  4UUC A;  2AWI A;  1H2U A;  1KT1 A;  3B7T A;  1H19 A;  1MYO A;  3FUJ A;  2HR2 A;  1K1B A;  3D9K A;  3TG5 A;  4I1M A;  3ZNG A;  1JCQ A;  4EQF A;  4A3T A;  2R17 C;  4UWK A;  5T8I A;  4JEU A;  5CCM A;  2P9S G;  2QYJ A;  3E34 A;  2WXJ A;  2WXG A;  3Q47 B;  2XPY A;  1S63 A;  4WAF A;  1LF8 A;  3ZXP A;  4I6E A;  3B95 A;  4BER A;  2Y69 E;  5ITZ F;  2XCC A;  5T3R A;  4DPR A;  3Q5M A;  1JCR A;  3FUM A;  3UMV A;  3AG2 E;  3KAE A;  1HH8 A;  4N5C A;  3RO2 A;  2I2O A;  3FH8 A;  2P58 C;  1E8Y A;  3WG7 E;  4GB9 A;  4U8Y D;  4GCO A;  1Z3Y A;  3ZVV A;  1H6K A;  2XEE A;  5CED B;  4KXK B;  3GZS A;  1S0P A;  2HO1 A;  1XNF A;  3EJN A;  5EIB E;  3U4T A;  4A55 A;  3E33 A;  4GAA A;  2HYZ A;  3QNK A;  4WWN A;  4MKT A;  5A7D B;  4ME2 A;  1OCC E;  4A1G A;  5G05 C;  3D3M A;  3TXN A;  2ZIR A;  4B94 A;  1TJF A;  3PNL B;  1INZ A;  4GTQ A;  4IUL A;  4DJA A;  4N2S A;  3UT8 A;  1OXJ A;  3B7U X;  3Q4A B;  3DXK G;  4DLQ A;  4C9B B;  3D9P A;  2GRR B;  2BKG A;  4WWO A;  2E0I A;  2P2C P;  4ZHB A;  2A4Z A;  4RVB A;  4XIF A;  3P1U A;  3L16 A;  3G2T A;  3CGH A;  3MX3 A;  1OWL A;  5BNW A;  3CVX A;  3S7F A;  2CHZ A;  3ZW3 A;  4AV7 A;  1OCZ E;  1UG3 A;  4TXR A;  3PVL A;  3T9K A;  5LP0 A;  3CVL A;  5EYP F;  2V8S E;  3LVR E;  2IF4 A;  5EX3 A;  4F7A A;  4FJZ A;  2WXI A;  4BT9 A;  4GYY A;  4APF A;  5AIJ A;  4GA2 A;  3RIB A;  3SZ7 A;  2QC9 A;  2WXQ A;  3TGO A;  4M3O A;  2XEV A;  4I2W A;  3TWV A;  1HU3 A;  1WG0 A;  3PZ3 A;  4EBA A;  4JA7 A;  1IYG A;  4D10 C;  3PZD A;  4CYM D;  1O1S A;  2IY0 C;  2NYJ A;  4ILI A;  1Y6I A;  2FEZ A;  2OND A;  2YHE A;  4MRU A;  4FC8 A;  3FP3 A;  4HI9 A;  2X6F A;  2VTB B;  2UY1 A;  3OXL A;  2CHW A;  3QKY A;  4O60 A;  4HXI A;  1OWM A;  4FA6 A;  4U07 A;  3S2A A;  5CBN A;  2GRL A;  1U3D A;  3QAQ A;  1SQM A;  4FAD A;  1N11 A;  3PH0 C;  1K8K G;  5LFA A;  1E96 B;  4FLH A;  2WM9 A;  4WWP A;  5KJM A;  3UKU G;  1TEZ A;  1BPO A;  4URK A;  4BTA A;  2C2L A;  5AN8 A;  3W9F A;  2H6G A;  2GRQ B;  2FUL A;  3UIP C;  4EZJ A;  2P9P G;  3EDT B;  2DZN A;  2J8S D;  2LAH A;  4EEC A;  1N52 A;  3U9W A;  3U3W A;  4GZ3 A;  3ASO E;  3HXD A;  4KZ0 A;  2LO6 A;  1EYH A;  5B1B E;  3ASH A;  4WNG A;  3L08 A;  1E8W A;  3T8K A;  5JJT A;  2PQN A;  1JUQ A;  2WB2 A;  1WAO 1;  4Q96 A;  4GML A;  1DCE A;  2VGX A;  1G3N B;  4JHK A;  4TRQ A;  1L5J A;  4GPM A;  5ENQ D;  2L6B A;  4UWF A;  3CST A;  4BET A;  2LAI A;  3FTY A;  3CR3 A;  4DX7 D;  3BQO A;  4G1T A;  2ZIS A;  3IXE A;  5JJ6 A;  3RK6 A;  4FU3 A;  1MZC A;  2VSN A;  4N2Q A;  4HRL A;  2BTD A;  4YDY A;  3UPV A;  5E76 A;  2KZT B;  5J90 A;  4H7X A;  2CG3 A;  4AJW A;  1PAQ A;  2EIK E;  4HQD A;  2OEW A;  4GPK A;  3PEU B;  4RG6 A;  4AP2 A;  3NBN B;  3FTV A;  2P9L G;  3R9M A;  3UIN C;  4L9P A;  1ELW A;  1H2T C;  1OWN A;  2IFU A;  5JA4 D;  3ABK E;  4XX5 A;  3SQV A;  4U95 D;  2OEV A;  3OXG A;  3LEW A;  1Q2Z A;  2NXP A;  4U8H A;  3RRN B;  4HLL A;  2LXM A;  3SHF A;  3Q9N C;  3FEX A;  1D8E A;  3FTU A;  4CGV A;  3L6A A;  4J8D A;  4I1A A;  3ULY A;  3ONK A;  2OVF A;  3DEP A;  3HVE B;  4DX1 A;  5D0Q D;  4TXP A;  1FPP A;  1MX4 A;  2V5F A;  4HNA D;  4UQY A;  4HOS A;  3LPZ A;  3HHM A;  3L9T A;  4LRZ A;  3V2X A;  2Y4U A;  4CRW A;  3CHP A;  5CMW A;  2PM6 A;  2J4B A;  4HI8 A;  5AJL A;  5EN5 D;  1IXV A;  5CCL A;  3ASD A;  3ASG A;  1DC2 A;  2EIL E;  3L82 A;  3RU0 A;  4APO A;  2F8X K;  1E7U A;  4HFG A;  4TXQ A;  3WXX A;  5JHB A;  5B1A E;  3ZFW A;  1XGW A;  2ION A;  3PRE A;  5ENO D;  1U3C A;  4AY5 A;  2XPZ A;  3B7R L;  4DK5 A;  3Q9U C;  1N4P A;  4G23 A;  4I9C A;  3B7S A;  2KCL A;  4U63 A;  2AVP A;  1BI8 B;  5G2N A;  3TG4 A;  3ESK A;  3ABL E;  1NFI E;  1NL4 A;  3UIO C;  4ACL A;  1EDU A;  4FHK A;  2RD0 A;  1N4R A;  4BEP A;  1O1R A;  1KLX A;  3CVY A;  2WMO A;  4TV3 A;  4GTT A;  1LD8 A;  4F3V A;  4GA0 A;  3GZ2 A;  4F1P A;  3S7B A;  2QZA A;  5EIL A;  4BX8 A;  5FIN A;  4F1S A;  2MRI A;  4ANW A;  3BEE A;  4K0R A;  4ACK A;  2FF4 A;  3PDN A;  4G8K A;  2WQ6 A;  3ESL A;  4RG9 A;  1WY6 A;  4OVV A;  3NZS A;  3HIZ A;  4I17 A;  3MKR A;  3CVQ A;  3CV0 A;  3ZYQ A;  3HDX A;  3J5Q B;  3UM1 A;  3D9J A;  2DYS E;  5BV1 A;  4AOF A;  2Q7F A;  3FUI A;  2XPI A;  1JWF A;  3ASN E;  5JMN D;  1NI1 A;  3APD A;  3TJP A;  3VTY A;  4FUL A;  3D9I A;  3LS8 A;  2BF0 X;  4YDE A;  2IOL A;  1PY1 A;  4M7C A;  4PS3 A;  1NZN A;  3D9N A;  2XHE A;  2A5E A;  4L2L A;  1WM5 A;  2R03 A;  2CHX A;  5FQ8 A;  3HXF A;  2H6F A;  3MKQ B;  5FQ6 A;  3QWP A;  1UOH A;  1RW2 A;  3AJI A;  3DSW A;  4HRM B;  5B3S E;  2I9C A;  4GCN A;  1OY3 D;  2DBA A;  4GMJ A;  3CVV A;  1K1A A;  1YYH A;  4J8F A;  2YHC A;  3FTZ A;  4P29 A;  3QJZ A;  1WDY A;  3F6Q A;  2P9K G;  3SO8 A;  3JXI A;  1SZA A;  3CK8 A;  3GZ1 A;  1IHG A;  4LNG A;  3PEV B;  5AAR A;  3SNX A;  4HB5 A;  4CCA A;  1FVF A;  4N3A A;  3G2W A;  5G05 J;  4C0E A;  2CFZ A;  2YNQ A;  5HS0 A;  4BT8 A;  2X38 A;  3PNT B;  5D2M C;  2KCV A;  3LJN A;  1MX2 A;  3QOU A;  2E2E A;  2XEH A;  2PL2 A;  3L17 A;  1MX6 A;  2VYI A;  5CEA A;  4CDR A;  1EPU A;  3DEO A;  3Q7F A;  1IQR A;  4XEI G;  4DI3 A;  2DYR E;  4B93 B;  1QNF A;  1HZ4 A;  4UI9 J;  2L9B A;  4E6H A;  4PDX A;  3CVN A;  3EHM A;  2IU1 A;  5D66 A;  3UX4 A;  2XZD G;  5FQ4 A;  3QK0 A;  3EHQ A;  3S7D A;  2A5U A;  3TXM A;  2XS1 A;  2WXL A;  1YMP A;  4RLY A;  2C0M A;  3B7B A;  2XQ0 A;  3AG1 E;  3FWV A;  4V3I A;  4KZC A;  3FU6 A;  4NAC A;  2MHK A;  3AU4 A;  5CER B;  1HE8 A;  4UI9 C;  3JQ1 A;  3EHR A;  2EIJ E;  4N3B A;  4KBQ A;  4GZD A;  4GU5 A;  2DIW A;  3CHO A;  3GYZ A;  1O1T A;  4Y6C A;  3UTM A;  1E8X A;  1DNP A;  5KJK A;  5FZR A;  4H7Y A;  4L1B A;  3LKU A;  3CK7 A;  4F6R D;  2GGF A;  4Q69 A;  3UQ3 A;  2J08 A;  3HYM B;  4B0Z A;  2X6K A;  2Y3A A;  4GTV A;  3UT7 A;  3KD7 A;  3KSQ A;  3FHE A;  1P5Q A;  3DSU A;  1MHQ A;  3KEA A;  4R7L A;  4I1O B;  3BUA A;  3PZ4 A;  4GTM A;  4N5Q A;  4YDO A;  3FTW A;  4RQI A;  5IY5 E;  5LCW C;  3PE4 A;  5FZQ A;  3VLE A;  2WXO A;  3EIJ A;  5FT9 A;  2AXU A;  1QBQ A;  1BI7 B;  4I9E A;  3I4R B;  2EIN E;  1H6P A;  4G8L A;  5D0O D;  2PQR A;  2IO2 C;  3U64 A;  3P2B A;  3K9I A;  1TYQ G;  2FI7 A;  3R7R A;  1DCQ A;  4ANX A;  4TUM A;  3ZGQ A;  3MCX A;  2OOE A;  2XRZ A;  2XRY A;  5FZS A;  2LNI A;  1Z5S C;  2R05 A;  3NF1 A;  1LD7 A;  5KWD A;  4LNU D;  4DX5 D;  4PUC A;  4U04 A;  2QYU A;  3ML8 A;  4FHJ A;  1TNB A;  4YDW A;  2ETB A;  3ZIM A;  1SA5 A;  3ZHE A;  1ELR A;  3JXJ A;  3CHM A;  3FUE A;  4G2V A;  3SFX A;  4UI9 K;  1N0R A;  3ULE G;  2AXV A;  1QYM A;  3SI5 A;  4JB8 P;  4EZL A;  2XZT G;  1IKN D;  2EIM E;  4K5A B;  3BG1 B;  3FDH A;  3QB2 A;  2BUG A;  2X6J A;  2PM7 A;  3D9O A;  2AW6 A;  1SW6 A;  2H6H A;  4MLP A;  5HRY A;  3ZU7 B;  5ENT D;  4N3C A;  3E32 A;  4OAV B;  3DXM G;  5AQA A;  2H6I A;  3ZYM A;  1KZP A;  3C98 A;  3Q79 A;  5EID A;  1E90 A;  4XKC A;  4E85 A;  3CLJ A;  5AJD A;  3FH5 A;  3T5X A;  3PZ1 A;  3C3R A;  3ZEF A;  3SY2 A;  2RFA A;  4FP7 A;  1N4S A;  3E4B A;  4AY6 A;  5FWQ A;  1HS6 A;  4BES A;  1TNZ A;  3FUK A;  3FH7 A;  4GA1 A;  4GYO A;  3MGB A;  5AYW D;  4ATZ D;  2VSO E;  4OAU C;  3NQP A;  3DWL G;  2WQH A;  4KYO B;  1JPL A;  3ZXS A;  1KZO A;  3DBS A;  5ANR A;  4BSX A;  2I1K A;  4JW1 A;  4DI4 A;  1N0Q A;  1IQU A;  4Q94 A;  3AS8 A;  3ULQ A;  2DZO A;  4J6I A;  2R2L A;  3URZ A;  5ANL A;  3CQG B;  2I1J A;  4UWG A;  3AS5 A;  2LXL A;  4XKB A;  5KNG A;  4CGW A;  4JD2 G;  4UQZ A;  3B13 A;  4HVB A;  4BFR A;  1UW4 B;  2GRP B;  3CVU A;  5LOZ A;  2XGO A;  2WMN A;  1NA3 A;  3T8M A;  3G2S A;  3ONL A;  3DSS A;  5KCM A;  1X81 A;  3FUN A;  5CHE E;  4WUY A;  2JEK A;  1BU9 A;  3FTS A;  4HS2 A;  3C3Q A;  1UJK A;  4O6F A;  1Y8M A;  3LCA A;  3ZUV B;  2KBX A;  5AQ7 A;  1A17 A;  2ILR A;  4J8S A;  4L2Y A;  4O1O A;  3LXU X;  2OVB A;  3FU3 A;  3FUH A;  4IRU A;  1NP7 A;  3TWX A;  5LX8 A;  1N95 A;  1QQE A;  3T5V A;  2PZI A;  1HFA A;  2EQX A;  5FQ7 A;  4L7T A;  1S64 A;  3UT4 A;  1UN8 A;  1FT1 A;  3QC1 A;  5KBA A;  2VTB A;  2VQ2 A;  2F37 A;  1H2V C;  4YVO A;  3FY4 A;  5CEC B;  2UY1 B;  4HOR A;  4GTS A;  3MA5 A;  3DPD A;  1K3Z D;  1BLX B;  5BV0 A;  2ZGG A;  4F53 A;  3RO3 A;  2X6I A;  3AAA C;  1HG5 A;  1D9S A;  3E30 A;  3TWU A;  1V54 E;  4JC8 A;  1V55 E;  1OWP A;  2J09 A;  4N39 A;  2F8Y A;  4NRH B;  4FJY A;  4LG6 A;  3RRM B;  3MV2 B;  2KAT A;  1QZ2 A;  2CG2 A;  1O5M A;  3UXG A;  3EUV A;  3W9G A;  4UWH A;  4AM9 A;  4GZ6 A;  4A63 B;  3ENE A;  3VLF A;  3I4G A;  1BD8 A;  2XCB A;  1KPS B;  4UWL A;  3QAR A;  4A3V A;  4DLO A;  1ZBP A;  3KSL A;  2WXM A;  3MYV A;  2FO7 A;  1GW6 A;  5CBO A;  4JHR A;  4ANV A;  2WXN A;  2KCK A;  3LY7 A;  3FFL A;  4EPZ A;  2J49 A;  2VGX B;  2V0P A;  4I6J A;  2J4D A;  4J8Y A;  3TWQ A;  4JZY A;  3DST A;  1NA0 A;  1YA0 A;  3C72 A;  4BX9 A;  1HX8 A;  2DWZ A;  1YCS B;  5AQB A;  3O4Z A;  3IEG A;  3J5P A;  3C3O A;  2R5S A;  4AVX A;  3FUL A;  4J7W A;  4LSZ E;  2KM4 A;  3Q78 A;  4GTP A;  1N4Q A;  4AEZ C;  4B8C B;  2WXF A;  4EHM A;  2VSX E;  4HOQ A;  5DBK A;  1E7V A;  1AP7 A;  3TL5 A;  4XI0 A;  3RAU A;  4PS8 A;  2DVW A;  1N54 A;  2HE0 A;  3UM2 A;  4XZ4 A;  2KZT A;  2P9U G;  3APC A;  3I3N A;  2R59 A;  2OV8 A;  2UWJ G;  3ZKJ A;  5G55 A;  1RZ4 A;  3JQ0 A;  4MBG A;  5CRU A;  3HXE A;  3EIQ C;  2I6H A;  4J8E A;  4CEM A;  1N94 A;  2RFM A;  4C0M A;  3UM3 A;  4WND A;  3ZYL A;  4ILG A;  2PNN A;  1ELK A;  3VTX A;  2Y4T A;  3CSF A;  2ZU6 B;  4YND A;  1SZ9 A;  3DSV A;  4GTR A;  4LUN U;  2VGY A;  3LY8 A;  3DRA A;  4U96 D;  4Y6W A;  2M63 A;  3LVQ E;  5AEN A;  3MEK A;  3LJ3 A;  1AWC B;  4K03 A;  3HVE A;  4JHJ A;  1SVX A;  3N71 A;  2V5Q C;  1KT0 A;  2VSY A;  2FO1 E;  5C2Y A;  1PC2 A;  3FEY A;  5AQ9 A;  4ZFH A;  3Q49 B;  3NB2 A;  4UQX A;  2WVI A;  4AIF A;  4OVU A;  4I6G A;  3NAW A;  2YQ8 A;  3LDZ A;  4LER A;  2AXZ A;  3MZL B;  5ENS D;  4DUI A;  1FT2 A;  5KJN A;  2VGE A;  4NUR A;  2B6C A;  4ILH B;  3BG0 B;  1UJJ A;  2P9I G;  5ENN A;  1JCS A;  4L23 A;  1OUV A;  2JLB A;  5LCW J;  2CFU A;  2GRO B;  3UI2 A;  3LYA A;  4G24 A;  4KMO A;  3RJV A;  2AJA A;  3IBE A;  4LEU A;  3GW4 A;  3CKB A;  5CRV A;  2RKK A;  3G2U A;  3L22 A;  3HRA A;  1VDY A;  3HXB A;  3Q75 A;  3FU0 A;  3ABM E;  4XI9 A;  1LTX A;  3PUJ A;  3C5R A;  4G11 A;  5ARF A;  4A1S A;  5CMY A;  2R02 A;  2ETC A;  5ARG A;  3R9A B;  3JYS A;  5G04 J;  5BW8 C;  1TN6 A;  3RKV A;  3D9L A;  4NIK A;  2KXP C;  5AAO A;  4OYS A;  1OWO A;  3DSX A;  4CT4 A;  3TWW A;  5ENR D;  2LSU A;  1H6O A;  3LY9 A;  3PRZ A;  1DVP A;  4K5B A;  4HOT A;  2BED A;  4MS6 A;  4B89 A;  4ABN A;  4EZK A;  1OCR E;  3IKO B;  2JAB A;  4QQI A;  2XS8 A;  5G04 C;  1MQS A;  3HG0 D;  2BKK B;  2F0Y A;  3AU5 A;  3MJW A;  3X2Q E;  3L54 A;  3G2V A;  2J9Q A;  1TR4 A;  4YVQ C;  3R7Q A;  2LUH A;  4U0S A;  2ZGD A;  2WXH A;  1N9A A;  5ENP D;  5J08 A;  1U2V G;  2X6H A;  3Q15 A;  2LSV A;  3PZ2 A;  3IV0 A;  3UUX A;  3MKQ A;  4GZ5 A;  3ZN3 A;  5BUZ A;  3SGH A;  2GRM A;  4U0U A;  4K5C A;  4CDM A;  3JUI A;  4DX2 A;  3BU8 A;  3SD5 A;  3NOC D;  4TUU A;  1TNY A;  2WXR A;  3CEQ A;  3FU5 A;  3QWW A;  3TWT A;  2ZXW E;  3ISM C;  3CKC A;  4HRN A;  3SF4 A;  3AG3 E;  3O48 A;  2X3M A;  1EF1 C;  5HQ8 A;  1IHB A;  2NSZ A;  3I5P A;  1TNO A;  4J0U A;  5HKP A;  3HXC A;  3U66 A;  1A5E A;  5EDS A;  4O1P A;  5DIZ A;  4HLE A;  1TN7 A;  4GZC A;  3TAX A;  5A6C A;  4FLB A;  3ASF A;  4PH4 B;  5KJL A;  3Q73 A;  5HI7 A;  1TN8 A; 
#chains in the Genus database with same CATH homology
 1N0R A;  5HS0 A;  5KBA A;  1N0Q A;  5ENS D;  1QYM A;  3J5P A;  4JB8 P;  4QFV A;  4DUI A;  3EU9 A;  2ETA A;  4DX7 D;  2XZT G;  4HI8 A;  2F37 A;  2VGE A;  1MX2 A;  2Y0B G;  1IXV A;  2DZO A;  3IXE A;  3HG0 D;  3LJN A;  5EN5 D;  4J7W A;  4LSZ E;  5CEC B;  2XEH A;  1IKN D;  4K5A B;  1MX6 A;  2BKK B;  5EYL A;  5CEA A;  3J5Q B;  5BXU A;  4UUC A;  1K3Z D;  1DC2 A;  3DEO A;  2F8X K;  4O60 A;  1BLX B;  4HRL A;  2ZGG A;  4DX6 D;  3KEA A;  1AP7 A;  1SW6 A;  5CBN A;  3V79 K;  1MYO A;  5KNH D;  3AAA C;  3UI2 A;  4YDY A;  4B93 B;  2DVW A;  5KNG A;  1TR4 A;  1D9S A;  2HE0 A;  1K1B A;  3TWU A;  5JMN D;  2BKG A;  2P2C P;  2AJA A;  2B0O E;  5ENO D;  5HRY A;  4ZHB A;  2ZGD A;  3ZU7 B;  1N11 A;  4N5Q A;  5ENT D;  4HQD A;  3ZNG A;  5ENP D;  4OAV B;  2F8Y A;  5D66 A;  5FIO A;  3ZKJ A;  5AQA A;  4LG6 A;  2XZD G;  3D9H A;  4CZ2 D;  3Q9U C;  2A5E A;  3EHQ A;  3HRA A;  1BI7 B;  1S70 B;  1OT8 A;  5EID A;  4G8L A;  5AN8 A;  3NBN B;  4Z68 A;  3NOG D;  3W9F A;  2RFM A;  2QYJ A;  3UXG A;  3W9G A;  4K5C A;  1YMP A;  3C5R A;  1BI8 B;  3T9K A;  4RLY A;  4BSZ B;  3B7B A;  2PNN A;  4A63 B;  4C48 B;  1UOH A;  3AJI A;  4HRM B;  4U8V D;  5EYP F;  1BU9 A;  2Y1L E;  1NFI E;  1BD8 A;  4DX2 A;  1DCQ A;  5JA4 D;  2DZN A;  2RFA A;  4TUM A;  2J8S D;  3B95 A;  2ETC A;  1OY3 D;  2V4H C;  5CER B;  3NOC D;  3V2O A;  4BER A;  3TWT A;  2XEN A;  1K1A A;  5ITZ F;  4U95 D;  4BEP A;  3V31 A;  5BXO A;  1YYH A;  4U96 D;  2MYO A;  4HRN A;  3EHR A;  4HLL A;  4BES A;  4DRX E;  1WDY A;  2KBX A;  5AQ7 A;  3T8K A;  3ZUV B;  1IHB A;  4F1P A;  2QC9 A;  4NIK A;  1AWC B;  3Q9N C;  2KXP C;  3F6Q A;  5AAO A;  4O1O A;  5HKP A;  5CBO A;  3SO8 A;  3JXI A;  5EIL A;  5FIN A;  1G3N B;  1A5E A;  3TWV A;  5KWD A;  4LNU D;  4ATZ D;  4DX5 D;  3TWX A;  1WG0 A;  3TWW A;  1SVX A;  3DEP A;  4O1P A;  5ENR D;  3TWR A;  4GMR A;  4DX1 A;  5AAR A;  3UTM A;  4U8Y D;  3V30 A;  4OAU C;  2V5Q C;  2FO1 E;  4GPM A;  5AQ9 A;  5ENQ D;  2L6B A;  4HB5 A;  4CYM D;  4ZFH A;  2NYJ A;  4YDW A;  1MX4 A;  4BET A;  2XEE A;  2ETB A;  4HNA D;  5CED B;  4K5B A;  1MJ0 A;  4J8Y A;  3TWQ A;  4G8K A;  4HBD A;  5EIB E;  2DWZ A;  3V2X A;  3JXJ A;  1YCS B;  3JUE A;  5AQB A;  4F6R D;  3TWS A;  2JAB A;  4HI9 A;  4QQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...