4C48B

Crystal structure of acrb-acrz complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
152
structure length
152
Chain Sequence
GKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the AcrAB-TolC multidrug efflux pump.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transport protein
molecule keywords ACRIFLAVINE RESISTANCE PROTEIN B
total genus 35
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2013-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4c48B00
4Z68A 4ZFHA 2RFAA 4YDWA 4HBDA 4N5QA 1BI8B 1BU9A 5AQAA 5CECB 5HKPA 1NFIE 1MX4A 2HE0A 4BETA 2ETBA 3LJNA 1SVXA 1UOHA 2DZOA 3B95A 5ENOD 2RFMA 1AP7A 5AN8A 3DEOA 2KXPC 4HRLA 5AQ7A 3ZUVB 3V79K 5EN5D 4OAUC 2A5EA 2NYJA 1WG0A 2XZTG 5ITZF 1YYHA 3TWRA 2ZGDA 1N11A 4J8YA 4ATZD 2DVWA 5HRYA 1IXVA 4BSZB 4HRMB 1IKND 2V4HC 1DCQA 3V30A 5KWDA 3T8KA 3NBNB 3EU9A 4U95D 4F1PA 3J5PA 4HQDA 4K5AB 5BXUA 2DWZA 3IXEA 4DUIA 3B7BA 5JA4D 4UUCA 5AARA 5CERB 4DRXE 4BESA 4QQIA 2AJAA 3D9HA 1MJ0A 2P2CP 4HLLA 1QYMA 3V31A 1IHBA 1K1BA 3C5RA 1MYOA 4TUMA 3Q9UC 1S70B 2JABA 4U96D 5CEAA 4GPMA 1WDYA 3ZNGA 4F6RD 2F8YA 4HNAD 5EYLA 1MX6A 5D66A 4ZHBA 4K5BA 3T9KA 1YCSB 1G3NB 4DX6D 3HRAA 3V2XA 3NOCD 2VGEA 1K1AA 2XZDG 4LG6A 2PNNA 5CBOA 1BLXB 2DZNA 4O60A 1BD8A 4O1OA 2J8SD 5CEDB 4HI8A 1MX2A 2KBXA 3TWWA 3SO8A 4HB5A 3TWSA 3TWUA 4RLYA 3JXJA 4A63B 2Y1LE 4G8LA 5ENSD 4DX7D 1K3ZD 3DEPA 5KNGA 1D9SA 4HRNA 3JUEA 3ZU7B 5KBAA 3NOGD 5AAOA 4O1PA 5ENQD 2QYJA 3UTMA 2XEHA 4BERA 2FO1E 5ENTD 5AQBA 3J5QB 3UI2A 3Q9NC 2MYOA 2B0OE 4LSZE 5KNHD 3V2OA 2XEEA 4J7WA 2ZGGA 3TWQA 5FIOA 4LNUD 3TWVA 4HI9A 2ETCA 5BXOA 1DC2A 3JXIA 4JB8P 4DX2A 2BKKB 3KEAA 1OT8A 2V5QC 5ENPD 5EIBE 1OY3D 5AQ9A 2F37A 2L6BA 1SW6A 4U8YD 1YMPA 3TWXA 4B93B 3W9FA 3ZKJA 3UXGA 4QFVA 4OAVB 1A5EA 3F6QA 5EYPF 1TR4A 3TWTA 3W9GA 4CZ2D 5JMND 5HS0A 1N0RA 3AAAC 3EHRA 4BEPA 2QC9A 4CYMD 4G8KA 1BI7B 4GMRA 2XENA 4U8VD 3HG0D 4C48B 5CBNA 2Y0BG 4YDYA 4NIKA 4K5CA 2ETAA 4DX5D 5ENRD 4DX1A 3EHQA 1AWCB 2F8XK 1N0QA 2BKGA 5FINA 5EILA 3AJIA 5EIDA
chains in the Genus database with same CATH superfamily
2EIME 3ASHA 4RG6A 2ETBA 4PUCA 2GRMA 4OAUC 5AJDA 5D2MC 5LP0A 3CK8A 4GYOA 4GPKA 1OWPA 4XKBA 2FBNA 2CHWA 1JPLA 3HXDA 4HQDA 4GTMA 4UUCA 1OWOA 4QQIA 1UG3A 3E32A 3C5RA 2JABA 3ZYMA 2JEKA 2EILE 2WXMA 4C9BB 4IRUA 1EF1C 3R9AB 4A3VA 4U7EB 2GRPB 2VTBB 2Y4TA 4DI4A 4RLYA 4N2SA 3ENEA 3VLEA 4DX7D 5BT1A 4I1MA 4HOQA 2VSOE 2WMNA 3ESLA 4L23A 4URKA 1U3DA 3EJNA 2VGYA 4WNDA 2OVBA 4J7WA 5KJLA 2V4LA 4U0UA 4M7CA 3UM1A 4X8QA 1INZA 2HO1A 3UM3A 4BX8A 3TG5A 3DSTA 3U64A 3HXBA 5EYPF 2IQCA 5JMND 3FTVA 1RW2A 4DJAA 2QC9A 4I1OB 2J9QA 3LVQE 1Z5SC 4P29A 3PH0C 3FTZA 3L9TA 3Q15A 5E76A 4DLOA 4K5CA 4DX5D 4OYSA 4HOSA 5EKQD 1IYGA 5HKPA 1OXJA 1NFIE 3EHMA 4OVVA 1EDUA 3ZUVB 2NYJA 2XHEA 3ZFWA 3T5VA 3ZYQA 2WM9A 3PZ4A 5CMYA 4JZYA 4ANVA 3IXEA 4Y6WA 2XS8A 4U07A 4BESA 4WNFA 3MCXA 2MHKA 1GW6A 3PZ3A 1NA0A 3LS8A 4BY6A 3PUJA 4CT0A 3ABME 4K5BA 4DX6D 4U04A 3OXFA 3ZGQA 2PNNA 3ML9A 3PNLB 2IF4A 4ACLA 4G8LA 2WXNA 4HRNA 3ZU7B 2H6GA 4GCNA 1SA5A 4L9PA 2LAIA 1HS6A 3L6AA 3MGBA 2HM8A 3DSVA 3FP3A 4J8EA 3IBEA 5EDSA 1N0RA 4GCOA 2GW1A 4TUUA 2L6JA 4XI9A 1MHQA 4C48B 3FY4A 4DX1A 3KSLA 3LXUX 3AJIA 5KJNA 4N5QA 3ZHEA 1H2UA 5ARGA 4E6HA 3PE4A 3FULA 3UM0A 1HG2A 3MZLB 3SQVA 3APCA 4B8CB 3CGHA 3DEOA 1DVPA 2X3MA 4ME2A 5B3SE 1YA0A 2WXIA 3U66A 2VSNA 5KWDA 1ZB1A 4K5AB 2P58C 3PDNA 3FUIA 4J8FA 4V3IA 3HVEA 4EBAG 4GPMA 3ULYA 1W3BA 2H6HA 1NI1A 3HRAA 1LD8A 2KC7A 3UQ3A 1BLXB 5H7PA 4XKCA 2J8SD 3QK0A 4JA7A 2IFUA 4EZLA 3P1UA 4N2QA 3QWWA 2XPIA 4AY6A 3SI5A 1TJFA 4UI9J 4FHKA 4CDMA 1IHGA 3VTYA 3HVEB 3N71A 5IY5E 2ETCA 2BKKB 1OT8A 2IO2C 3E37A 5ENPD 2NXPA 1OY3D 1SW6A 5G05J 5A23A 3ZKJA 5BNWA 3DXMG 4AOFA 5HS0A 3QNKA 1KLXA 4GMJA 4L1BA 3Q79A 4H7YA 3TXNA 3UPVA 2WPVA 4XX5A 3RRUA 1AWCB 4JW1A 1U3CA 3DRAA 4YDWA 3QKYA 3AS4A 4YVQC 3NQPA 4I1AA 1HE8A 1NA3A 2MOWA 3LJNA 2PM7A 5ARFA 2DZOA 1L5JA 5AN8A 3D9OA 4J0UA 2F0YA 3K9IA 3CVVA 4G11A 5D0OD 4AIFA 3DXKG 3IV0A 3FUHA 1DCQA 3QJZA 3D3MA 4KZCA 1JWFA 5AYWD 4DRXE 2YQ8A 3FTYA 4W9RA 1IHBA 4JXTA 3CEQA 4YVOA 4FLBA 1S63A 3R7RA 4ZHBA 2DZNA 3ASDA 3PEUB 4WWOA 1D8EA 5LCWC 2Y1LE 2P9UG 3AU4A 5FT9A 2PM6A 3PEVB 2GRQB 4ABNA 5BPPA 3CVUA 2DCPA 4PS8A 4IULA 3TWVA 2HYZA 1TNOA 3UINC 2WXPA 3D9NA 1TR4A 4IYPA 3QAQA 3AAAC 3KD7A 4FJZA 2OV8A 5CMWA 4PS7A 1N4QA 2AXUA 4NIKA 5JJTA 4UQZA 3R9MA 3KEZA 1D8DA 3PZDA 1UOHA 2KZTA 3SZ7A 3V79K 5EN5D 2EIJE 3URZA 3KSQA 5ITZF 3BQOA 1PC2A 5B1BE 1WAO1 2P9PG 4GZ5A 4GTTA 4BX9A 2P9KG 1KPSB 1KT1A 3CHRA 2I2OA 1PAQA 4EZJA 3CSTA 3FWVA 4GYWA 3VLDA 3D9HA 3E34A 4I2WA 2P2CP 5FWQA 4Y6CA 4F6RD 1JCQA 1YCSB 1H6KA 3UM2A 1OCCE 2J08A 3PUKA 4LG6A 3T8MA 1TYQG 3FTSA 4O6FA 3TWUA 3JXJA 3DEPA 4JHJA 5AAOA 2LXMA 1TNBA 4BERA 2FO1E 3UI2A 2VQ2A 1FVHA 1DC2A 1Z3XA 3I4RB 3JUIA 3T5XA 4XZ4A 2F37A 2VYIA 4B93B 3I4GA 3W9FA 1JCSA 2P9NG 3ZHEB 3AG1E 1OWLA 3RIBA 4CYMD 1WM5A 3IHYA 2BTDA 3HG0D 5CCMA 3MX3A 5ANLA 2R59A 2RFAA 3FU6A 3RKVA 4HS2A 2R2LA 2KXPC 3CVXA 2WXHA 4CDNA 4LUNU 4FP7A 3DSUA 2DVWA 1U2VG 3EUVA 4RSYA 3T8KA 4G25A 5JJ6A 1N54A 1TN7A 3RO3A 1KT0A 3L17A 3D9LA 3ESKA 3CIAA 1HZ4A 1X5BA 4NACA 3HDXA 1MX6A 2LUHA 1QQEA 1QZ2A 4WNEA 3NOCD 4ACKA 4RQIA 3CVYA 4O60A 4G24A 4XIFA 2KBXA 3TWWA 4JEUA 2J09A 4E85A 3JUEA 2OOEA 3RSEG 2Q7FA 1NP7A 3ULQA 4A3TA 2IU1A 3IHVA 4M3OA 3NB2A 4LNUD 2LSVA 1H0AA 4TXPA 3B13A 4RVBA 3FUNA 4L2YA 4GMRA 3ZEFA 4YDYA 5DBKA 2OVFA 3EHQA 1N0QA 3QOUA 2PL2A 5EX0A 3FUFA 3HHMA 3UMVA 3ASNE 3FUEA 5G05C 2PQNA 3FUDA 5ENNA 3L13A 5EX3A 4FA6A 4N3AA 2OCCE 3VTXA 4A1GA 1E8YA 2QFCA 3IKOB 3D9MA 3TWRA 2ZGDA 2XPZA 1KZOA 3BEEA 3QDNA 3NBNB 3V30A 1NZNA 2NSZA 4F7AA 4U95D 4TV3A 4JHKA 5FZQA 2DWZA 4DUIA 2C0MA 4PH4B 2VGXB 4I6GA 5CRVA 2MRIA 1E90A 3LY8A 3RAUA 3V31A 3Q9UC 4U96D 4D10C 5EYLA 3BU8A 3V2XA 2VGEA 3FDHA 5HQ8A 5T4YA 4A63B 3B7UX 2FULA 4CCAA 2CFUA 4PS3A 5T8IA 4F1SA 2QYJA 3UIPC 2VGXA 2B0OE 1Y8MA 3TWQA 2IONA 2X6IA 4J8DA 3B7TA 4J6IA 3MV2B 1UN8A 4CDRA 2L0TB 3W9GA 3TGOA 3S7JA 3O4ZA 3CKBA 3D9JA 3DSXA 4I9EA 3CHPA 4G8KA 2I6HA 3Q78A 3DPYA 2VSYA 2FF4A 1X81A 4JD2G 1O1RA 3WG7E 5E75A 1H2VC 3EDTB 3CHQA 4MRUA 3E30A 4J8YA 4GAAA 2V4HC 1HO8A 1XGWA 2ZISA 1A17A 3CKCA 5ANRA 1FCHA 2P9IG 5D66A 5FQ7A 3BG0B 3PE3A 2XZDG 4G1TA 2R05A 5AENA 3OAWA 4G26A 3L54A 3UKRG 2RD0A 5KBAA 3FH7A 4GB9A 3S2AA 5ENTD 5AQBA 2I1KA 4LSZE 2PZIA 4B0ZA 5FIOA 3UIOC 3AG2E 4JA9A 3CVNA 3APDA 2EQXA 1E7VA 2WMOA 3GZ2A 3TWXA 1E96B 2WXGA 3MKRA 2I9CA 3HIZA 1RZ4A 1TNZA 2ZIRA 2WQ6A 3FTXA 4XI0A 4UWLA 4GA0A 3Q47B 3MKQA 2Y0BG 2WXJA 5DIZA 2F8XK 3OTNA 4N3BA 4KBQA 3UX4A 1TN8A 4WWNA 1LF8A 2FO7A 4Z68A 4LNBA 4KVMA 1UN9A 4K0RA 1SVXA 4ANXA 3C3RA 4HRLA 2A5EA 4GYYA 2OEWA 3C98A 2VTBA 4AVXA 2YHCA 4G23A 4GA1A 4FULA 4CRWA 4DI3A 3EIQC 2WXKA 3PNTB 3TAXA 5A7DB 2UWJG 2P9SG 1E8WA 4ILGA 3SFYA 2XCCA 2GRRB 4I43A 4HNAD 3ZN3A 3LDZA 3SBSA 3CVQA 3ONKA 1N52A 4K03A 5BV0A 5AJLA 4HI8A 4WAFA 4EPZA 1OCOE 4LCTA 3HXEA 5FQ6A 5CRUA 1K8KG 2MYOA 3V2OA 1N95A 3TL5A 3KEAA 3CHMA 5FQ8A 4GTSA 4NURA 4I6EA 4JHRA 3OXGA 3ZXPA 1E8XA 1FVFA 4WUYA 3SNXA 2E2EA 2ZXWE 3Q73A 3RJVA 3IEGA 1TNUA 2Y4UA 2WB2A 3DBSA 2WXQA 1HFAA 5G2NA 2GRNB 1AP7A 4FC8A 3E4BA 2JLBA 3U3WA 4OVUA 4R7LA 3L82A 4CGVA 4MS6A 2IOSA 4XEIG 2A4ZA 1Z6TA 2E0IA 3SD5A 4JC8A 3LY7A 3S7DA 1N94A 4GZ6A 2I1JA 2OEVA 1MJ0A 4C0MA 5KCMA 3L22A 1S70B 5G55A 1H6PA 3DWLG 2PQRA 1HF8A 2IY0C 4KXKB 4BTBA 3FTWA 4BWRA 4O1OA 4HB5A 3R7QA 1Y6IA 2DBAA 3ZVVA 4GMLA 1B89A 5LX8A 4ANUA 1E7UA 2XEHA 1IQUA 2EIKE 4GA2A 4EZKA 2ONDA 3LEWA 4TRQA 5BXOA 3UT4A 1HG5A 2H6FA 2L6BA 4A1SA 3I3NA 1N4RA 4JPSA 5C1DA 4QFVA 2LSUA 1MQSA 3CVPA 2C2LA 4WNGA 1O5MA 3CK9A 3LYAA 3FH5A 4HLEA 4LNGA 2LXLA 2Y3AA 1A5EA 2AXZA 4HBDA 2CHXA 5BV1A 3MJWA 3Q75A 3JCKC 2AXVA 5ENOD 5KJKA 2M63A 4MBGA 4GU5A 4DK5A 4KZ0A 2NC9A 4N39A 2R02A 3FU3A 4F1PA 4LEUA 4UQYA 5CERB 2AJAA 4XE0A 1WY6A 4RG9A 3CVLA 5CEAA 1N4SA 1PY1A 2KCKA 4FADA 2J4DA 3FUKA 1S64A 3HXFA 3EIJA 3EU5A 3AS8A 5G04J 2R03A 1K1AA 5CBOA 1BD8A 2UY1A 3MEKA 4I2ZA 3RK6A 2WXOA 4AXHA 2V5FA 2XQ0A 4EBAA 3GYZA 2J07A 2L9BA 2L0IA 2CHZA 3SF4A 4GTOA 3ONLA 4GZDA 5B1AE 3U4TA 4I9CA 2ZGGA 3EHNA 2YNQA 1FT2A 5JJ7A 1JUQA 4HXIA 4Q94A 5EIBE 1JCRA 1HXIA 5AQ9A 2KCVA 2WVIA 3LPZA 2XS1A 3PREA 3CV0A 3QARA 4AY5A 3LVRE 4BT9A 4HOUA 3FHEA 5FINA 4Q69A 3GZSA 2XCBA 5EIDA 4EHMA 2IJGX 5C2YA 4UI9C 5CECB 4HORA 4WWPA 5FQ4A 2RFMA 4UQXA 3CK7A 4KYOB 3I5PA 3SFZA 2H6IA 4BSZB 3L16A 3FUMA 5BXUA 3KS2A 3C3QA 5AARA 2WXLA 3G2UA 3B7SA 1VDYA 3LCAA 3ZIMA 3E33A 3ZXSA 1BPOA 3SGHA 4YDOA 1G3NB 2FEZA 1S0PA 4G2VA 3Q7AA 2DIWA 4NQ0A 4YNDA 1H19A 2QY7A 1UJKA 2X6FA 4O1PA 1FT1A 5ENQD 4JL0A 3Q9NC 2X6HA 2XEEA 3QB2A 3RU0A 4KVOA 3DPDA 4CT4A 4UWHA 5D0QD 1OCZE 1LD7A 4OAVB 3FEYA 3CQGB 3PVLA 3TWTA 2YINA 1DNPA 2C0LA 5KJMA 3EHRA 1JWGA 3SHFA 1KZPA 2XENA 2DYRE 4IN3B 2ETAA 3CSFA 3LKUA 1HX8A 4ILHB 2BEDA 2YHEA 1BU9A 2WXRA 1MX4A 2P9LG 3CQCB 1ELRA 3GZ1A 5AQ7A 4GZCA 1WG0A 4GTRA 4U8HA 1LTXA 1TN6A 5BUZA 3C3OA 3O48A 3SFXA 1N11A 5BW8C 5HRYA 3QWVA 3JYSA 1OWMA 4HRMB 1Z3YA 3EU9A 3NZSA 3BG1B 3QWPA 4DLQA 4KMOA 3Q5MA 3G2VA 1N9AA 4N3CA 3FH8A 3CVWA 3ZRHA 5HI7A 2AWIA 2XGOA 1UJJA 2F8YA 4L2LA 2XRYA 5J08A 3JQ0A 3ZYKA 3AS5A 5CEDB 3TWSA 4HOTA 4MLPA 5FZSA 4A55A 5ENSD 1IQRA 4MKTA 2A5UA 3NOGD 3ULEG 1ZBPA 2FI7A 3HYMB 4HFGA 3JXIA 4GTPA 3NAWA 4YDEA 3KAEA 2RKKA 3NZUA 1YMPA 3X2QE 1QNFA 4BFRA 2AVPA 3CLJA 1O1SA 2B6CA 4Q96A 4ANWA 2J49A 3ABKE 1ZU2A 3FFLA 3FEXA 2X6JA 3BUAA 4ZFHA 3G2TA 1BI8B 2XRZA 2R17C 4CEMA 4AEZC 1SA4A 1NL4A 4I17A 2XZTG 5T3RA 4EECA 3ZYLA 4C0EA 3PS6A 4BSXA 1IXVA 3J5PA 3U9WA 2WQ7A 5JA4D 2QYUA 1H6OA 1K1BA 1Q2ZA 1MYOA 3QC1A 2KCLA 3G2WA 4GTQA 3FU0A 4FLHA 4FJYA 1MX2A 3SO8A 1SZAA 2R5SA 3CHOA 1ELWA 5JHAA 2RG8A 2WXFA 3UKUG 4UI9K 5KNGA 1D9SA 3ZPJA 1E8ZA 3Q7FA 3UTMA 1TNYA 4AV7A 1OCRE 5FTPA 4BTAA 3PRZA 3SY2A 4J8SA 4JEHA 4B89A 5G04C 5LFAA 4DX2A 2V5QC 3JQ1A 1V54E 3VLFA 4LERA 3FUJA 3P2BA 1EPUA 4CZ2D 4FHJA 3GW4A 4U0SA 2LAHA 2XGMA 3LJ3A 4EQFA 1EYHA 1BI7B 2AW6A 4U8VD 4HVBA 4U63A 3ASGA 2J4BA 4B8AA 1TJCA 3DSWA 5AQAA 4BETA 2BUGA 4AM9A 1H2TC 3AU5A 3HXCA 1FPPA 3DSSA 4U0ZA 4KT6B 5AIJA 1YYHA 1HU3A 4UWKA 4ATZD 2X6KA 3RRNB 3PZ1A 2IEJA 4I6JA 3CHSA 4TXQA 3OXLA 1HH8A 2LO6A 3B7BA 5CCLA 3AG4E 1SQMA 3UT7A 4HLLA 4F3VA 1ELKA 4TUMA 1QBQA 2DYSE 4JVSA 5J90A 5LOZA 3T9KA 5FZRA 4AP2A 1TEZA 4F53A 3AG3E 4ATGA 4BT8A 3ASFA 3D9KA 3S7BA 2CG2A 4FU3A 2WQHA 2EINE 4N5CA 3MYVA 2V0PA 4B94A 3J5QB 5KNHD 3ASOE 2X38A 2KATA 3MA5A 1MZCA 3C72A 4HI9A 2ILRA 3TXMA 4APFA 2KM4A 4L7TA 3ABLE 3UXGA 3F6QA 2V8SE 2KZTB 3TJPA 1DCEA 3MV3B 4BEPA 3RRMB 3D9IA 2UY1B 3G2SA 2XGSA 2BF0X 3CR3A 3RO2A 4TXRA 2LNIA 4APOA 2IO3C 3WXXA 4DPRA 2HE0A 3B95A 5LCWJ 5M72A 2XEVA 1SZ9A 4GTVA 1N4PA 4CGWA 2XPYA 3APFA 3Q4AB 1IKND 5A6CA 3NF1A 5FJYA 1QYMA 4LRZA 5JHBA 3UUXA 3ZNGA 1WDYA 3L08A 2Y69E 3FU5A 3TG4A 4NRHB 4GZ3A 3UT8A 3ISMC 3ML8A 4ILIA 2CG3A 3LY9A 5CHEE 1K3ZD 1V55E 2HR2A 2ZU6B 4AJWA 3Q49B 3MKQB 2IOLA 2VJ8A 2QZAA 1OUVA 2GRLA 2GGFA 2CFZA 1XNFA 3SBTB 4JB8P 3ZW3A 3S7FA 3B7RL 4U8YD 1P5QA 4H7XA 4UWFA 1UW4B 2GROB 3FTUA 3D9PA 4PDXA 1O1TA 3PZ2A 5CBNA 5ENRD 1OWNA 2BKGA 5EILA 2VSXE 4UWGA
chains in the Genus database with same CATH topology
4Z68A 4ZFHA 2RFAA 4YDWA 4HBDA 4N5QA 1BI8B 1BU9A 5AQAA 5CECB 5HKPA 1NFIE 1MX4A 2HE0A 4BETA 2ETBA 3LJNA 1SVXA 1UOHA 2DZOA 3B95A 5ENOD 2RFMA 1AP7A 5AN8A 3DEOA 2KXPC 4HRLA 5AQ7A 3ZUVB 3V79K 5EN5D 4OAUC 2A5EA 2NYJA 1WG0A 2XZTG 5ITZF 1YYHA 3TWRA 2ZGDA 1N11A 4J8YA 4ATZD 2DVWA 5HRYA 1IXVA 4BSZB 4HRMB 1IKND 2V4HC 1DCQA 3V30A 5KWDA 3T8KA 3NBNB 3EU9A 4U95D 4F1PA 3J5PA 4HQDA 4K5AB 5BXUA 2DWZA 3IXEA 4DUIA 3B7BA 5JA4D 4UUCA 5AARA 5CERB 4DRXE 4BESA 4QQIA 2AJAA 3D9HA 1MJ0A 2P2CP 4HLLA 1QYMA 3V31A 1IHBA 1K1BA 3C5RA 1MYOA 4TUMA 3Q9UC 1S70B 2JABA 4U96D 5CEAA 4GPMA 1WDYA 3ZNGA 4F6RD 2F8YA 4HNAD 5EYLA 1MX6A 5D66A 4ZHBA 4K5BA 3T9KA 1YCSB 1G3NB 4DX6D 3HRAA 3V2XA 3NOCD 2VGEA 1K1AA 2XZDG 4LG6A 2PNNA 5CBOA 1BLXB 2DZNA 4O60A 1BD8A 4O1OA 2J8SD 5CEDB 4HI8A 1MX2A 2KBXA 3TWWA 3SO8A 4HB5A 3TWSA 3TWUA 4RLYA 3JXJA 4A63B 2Y1LE 4G8LA 5ENSD 4DX7D 1K3ZD 3DEPA 5KNGA 1D9SA 4HRNA 3JUEA 3ZU7B 5KBAA 3NOGD 5AAOA 4O1PA 5ENQD 2QYJA 3UTMA 2XEHA 4BERA 2FO1E 5ENTD 5AQBA 3J5QB 3UI2A 3Q9NC 2MYOA 2B0OE 4LSZE 5KNHD 3V2OA 2XEEA 4J7WA 2ZGGA 3TWQA 5FIOA 4LNUD 3TWVA 4HI9A 2ETCA 5BXOA 1DC2A 3JXIA 4JB8P 4DX2A 2BKKB 3KEAA 1OT8A 2V5QC 5ENPD 5EIBE 1OY3D 5AQ9A 2F37A 2L6BA 1SW6A 4U8YD 1YMPA 3TWXA 4B93B 3W9FA 3ZKJA 3UXGA 4QFVA 4OAVB 1A5EA 3F6QA 5EYPF 1TR4A 3TWTA 3W9GA 4CZ2D 5JMND 5HS0A 1N0RA 3AAAC 3EHRA 4BEPA 2QC9A 4CYMD 4G8KA 1BI7B 4GMRA 2XENA 4U8VD 3HG0D 4C48B 5CBNA 2Y0BG 4YDYA 4NIKA 4K5CA 2ETAA 4DX5D 5ENRD 4DX1A 3EHQA 1AWCB 2F8XK 1N0QA 2BKGA 5FINA 5EILA 3AJIA 5EIDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z68 A;  4ZFH A;  2RFA A;  4YDW A;  4HBD A;  4N5Q A;  1BI8 B;  1BU9 A;  5AQA A;  5CEC B;  5HKP A;  1NFI E;  1MX4 A;  2HE0 A;  4BET A;  2ETB A;  3LJN A;  1SVX A;  1UOH A;  2DZO A;  3B95 A;  5ENO D;  2RFM A;  1AP7 A;  5AN8 A;  3DEO A;  2KXP C;  4HRL A;  5AQ7 A;  3ZUV B;  3V79 K;  5EN5 D;  4OAU C;  2A5E A;  2NYJ A;  1WG0 A;  2XZT G;  5ITZ F;  1YYH A;  3TWR A;  2ZGD A;  1N11 A;  4J8Y A;  4ATZ D;  2DVW A;  5HRY A;  1IXV A;  4BSZ B;  4HRM B;  1IKN D;  2V4H C;  1DCQ A;  3V30 A;  5KWD A;  3T8K A;  3NBN B;  3EU9 A;  4U95 D;  4F1P A;  3J5P A;  4HQD A;  4K5A B;  5BXU A;  2DWZ A;  3IXE A;  4DUI A;  3B7B A;  5JA4 D;  4UUC A;  5AAR A;  5CER B;  4DRX E;  4BES A;  4QQI A;  2AJA A;  3D9H A;  1MJ0 A;  2P2C P;  4HLL A;  1QYM A;  3V31 A;  1IHB A;  1K1B A;  3C5R A;  1MYO A;  4TUM A;  3Q9U C;  1S70 B;  2JAB A;  4U96 D;  5CEA A;  4GPM A;  1WDY A;  3ZNG A;  4F6R D;  2F8Y A;  4HNA D;  5EYL A;  1MX6 A;  5D66 A;  4ZHB A;  4K5B A;  3T9K A;  1YCS B;  1G3N B;  4DX6 D;  3HRA A;  3V2X A;  3NOC D;  2VGE A;  1K1A A;  2XZD G;  4LG6 A;  2PNN A;  5CBO A;  1BLX B;  2DZN A;  4O60 A;  1BD8 A;  4O1O A;  2J8S D;  5CED B;  4HI8 A;  1MX2 A;  2KBX A;  3TWW A;  3SO8 A;  4HB5 A;  3TWS A;  3TWU A;  4RLY A;  3JXJ A;  4A63 B;  2Y1L E;  4G8L A;  5ENS D;  4DX7 D;  1K3Z D;  3DEP A;  5KNG A;  1D9S A;  4HRN A;  3JUE A;  3ZU7 B;  5KBA A;  3NOG D;  5AAO A;  4O1P A;  5ENQ D;  2QYJ A;  3UTM A;  2XEH A;  4BER A;  2FO1 E;  5ENT D;  5AQB A;  3J5Q B;  3UI2 A;  3Q9N C;  2MYO A;  2B0O E;  4LSZ E;  5KNH D;  3V2O A;  2XEE A;  4J7W A;  2ZGG A;  3TWQ A;  5FIO A;  4LNU D;  3TWV A;  4HI9 A;  2ETC A;  5BXO A;  1DC2 A;  3JXI A;  4JB8 P;  4DX2 A;  2BKK B;  3KEA A;  1OT8 A;  2V5Q C;  5ENP D;  5EIB E;  1OY3 D;  5AQ9 A;  2F37 A;  2L6B A;  1SW6 A;  4U8Y D;  1YMP A;  3TWX A;  4B93 B;  3W9F A;  3ZKJ A;  3UXG A;  4QFV A;  4OAV B;  1A5E A;  3F6Q A;  5EYP F;  1TR4 A;  3TWT A;  3W9G A;  4CZ2 D;  5JMN D;  5HS0 A;  1N0R A;  3AAA C;  3EHR A;  4BEP A;  2QC9 A;  4CYM D;  4G8K A;  1BI7 B;  4GMR A;  2XEN A;  4U8V D;  3HG0 D;  4C48 B;  5CBN A;  2Y0B G;  4YDY A;  4NIK A;  4K5C A;  2ETA A;  4DX5 D;  5ENR D;  4DX1 A;  3EHQ A;  1AWC B;  2F8X K;  1N0Q A;  2BKG A;  5FIN A;  5EIL A;  3AJI A;  5EID A; 
#chains in the Genus database with same CATH topology
 2EIM E;  3ASH A;  4RG6 A;  2ETB A;  4PUC A;  2GRM A;  4OAU C;  5AJD A;  5D2M C;  5LP0 A;  3CK8 A;  4GYO A;  4GPK A;  1OWP A;  4XKB A;  2FBN A;  2CHW A;  1JPL A;  3HXD A;  4HQD A;  4GTM A;  4UUC A;  1OWO A;  4QQI A;  1UG3 A;  3E32 A;  3C5R A;  2JAB A;  3ZYM A;  2JEK A;  2EIL E;  2WXM A;  4C9B B;  4IRU A;  1EF1 C;  3R9A B;  4A3V A;  4U7E B;  2GRP B;  2VTB B;  2Y4T A;  4DI4 A;  4RLY A;  4N2S A;  3ENE A;  3VLE A;  4DX7 D;  5BT1 A;  4I1M A;  4HOQ A;  2VSO E;  2WMN A;  3ESL A;  4L23 A;  4URK A;  1U3D A;  3EJN A;  2VGY A;  4WND A;  2OVB A;  4J7W A;  5KJL A;  2V4L A;  4U0U A;  4M7C A;  3UM1 A;  4X8Q A;  1INZ A;  2HO1 A;  3UM3 A;  4BX8 A;  3TG5 A;  3DST A;  3U64 A;  3HXB A;  5EYP F;  2IQC A;  5JMN D;  3FTV A;  1RW2 A;  4DJA A;  2QC9 A;  4I1O B;  2J9Q A;  3LVQ E;  1Z5S C;  4P29 A;  3PH0 C;  3FTZ A;  3L9T A;  3Q15 A;  5E76 A;  4DLO A;  4K5C A;  4DX5 D;  4OYS A;  4HOS A;  5EKQ D;  1IYG A;  5HKP A;  1OXJ A;  1NFI E;  3EHM A;  4OVV A;  1EDU A;  3ZUV B;  2NYJ A;  2XHE A;  3ZFW A;  3T5V A;  3ZYQ A;  2WM9 A;  3PZ4 A;  5CMY A;  4JZY A;  4ANV A;  3IXE A;  4Y6W A;  2XS8 A;  4U07 A;  4BES A;  4WNF A;  3MCX A;  2MHK A;  1GW6 A;  3PZ3 A;  1NA0 A;  3LS8 A;  4BY6 A;  3PUJ A;  4CT0 A;  3ABM E;  4K5B A;  4DX6 D;  4U04 A;  3OXF A;  3ZGQ A;  2PNN A;  3ML9 A;  3PNL B;  2IF4 A;  4ACL A;  4G8L A;  2WXN A;  4HRN A;  3ZU7 B;  2H6G A;  4GCN A;  1SA5 A;  4L9P A;  2LAI A;  1HS6 A;  3L6A A;  3MGB A;  2HM8 A;  3DSV A;  3FP3 A;  4J8E A;  3IBE A;  5EDS A;  1N0R A;  4GCO A;  2GW1 A;  4TUU A;  2L6J A;  4XI9 A;  1MHQ A;  4C48 B;  3FY4 A;  4DX1 A;  3KSL A;  3LXU X;  3AJI A;  5KJN A;  4N5Q A;  3ZHE A;  1H2U A;  5ARG A;  4E6H A;  3PE4 A;  3FUL A;  3UM0 A;  1HG2 A;  3MZL B;  3SQV A;  3APC A;  4B8C B;  3CGH A;  3DEO A;  1DVP A;  2X3M A;  4ME2 A;  5B3S E;  1YA0 A;  2WXI A;  3U66 A;  2VSN A;  5KWD A;  1ZB1 A;  4K5A B;  2P58 C;  3PDN A;  3FUI A;  4J8F A;  4V3I A;  3HVE A;  4EBA G;  4GPM A;  3ULY A;  1W3B A;  2H6H A;  1NI1 A;  3HRA A;  1LD8 A;  2KC7 A;  3UQ3 A;  1BLX B;  5H7P A;  4XKC A;  2J8S D;  3QK0 A;  4JA7 A;  2IFU A;  4EZL A;  3P1U A;  4N2Q A;  3QWW A;  2XPI A;  4AY6 A;  3SI5 A;  1TJF A;  4UI9 J;  4FHK A;  4CDM A;  1IHG A;  3VTY A;  3HVE B;  3N71 A;  5IY5 E;  2ETC A;  2BKK B;  1OT8 A;  2IO2 C;  3E37 A;  5ENP D;  2NXP A;  1OY3 D;  1SW6 A;  5G05 J;  5A23 A;  3ZKJ A;  5BNW A;  3DXM G;  4AOF A;  5HS0 A;  3QNK A;  1KLX A;  4GMJ A;  4L1B A;  3Q79 A;  4H7Y A;  3TXN A;  3UPV A;  2WPV A;  4XX5 A;  3RRU A;  1AWC B;  4JW1 A;  1U3C A;  3DRA A;  4YDW A;  3QKY A;  3AS4 A;  4YVQ C;  3NQP A;  4I1A A;  1HE8 A;  1NA3 A;  2MOW A;  3LJN A;  2PM7 A;  5ARF A;  2DZO A;  1L5J A;  5AN8 A;  3D9O A;  4J0U A;  2F0Y A;  3K9I A;  3CVV A;  4G11 A;  5D0O D;  4AIF A;  3DXK G;  3IV0 A;  3FUH A;  1DCQ A;  3QJZ A;  3D3M A;  4KZC A;  1JWF A;  5AYW D;  4DRX E;  2YQ8 A;  3FTY A;  4W9R A;  1IHB A;  4JXT A;  3CEQ A;  4YVO A;  4FLB A;  1S63 A;  3R7R A;  4ZHB A;  2DZN A;  3ASD A;  3PEU B;  4WWO A;  1D8E A;  5LCW C;  2Y1L E;  2P9U G;  3AU4 A;  5FT9 A;  2PM6 A;  3PEV B;  2GRQ B;  4ABN A;  5BPP A;  3CVU A;  2DCP A;  4PS8 A;  4IUL A;  3TWV A;  2HYZ A;  1TNO A;  3UIN C;  2WXP A;  3D9N A;  1TR4 A;  4IYP A;  3QAQ A;  3AAA C;  3KD7 A;  4FJZ A;  2OV8 A;  5CMW A;  4PS7 A;  1N4Q A;  2AXU A;  4NIK A;  5JJT A;  4UQZ A;  3R9M A;  3KEZ A;  1D8D A;  3PZD A;  1UOH A;  2KZT A;  3SZ7 A;  3V79 K;  5EN5 D;  2EIJ E;  3URZ A;  3KSQ A;  5ITZ F;  3BQO A;  1PC2 A;  5B1B E;  1WAO 1;  2P9P G;  4GZ5 A;  4GTT A;  4BX9 A;  2P9K G;  1KPS B;  1KT1 A;  3CHR A;  2I2O A;  1PAQ A;  4EZJ A;  3CST A;  3FWV A;  4GYW A;  3VLD A;  3D9H A;  3E34 A;  4I2W A;  2P2C P;  5FWQ A;  4Y6C A;  4F6R D;  1JCQ A;  1YCS B;  1H6K A;  3UM2 A;  1OCC E;  2J08 A;  3PUK A;  4LG6 A;  3T8M A;  1TYQ G;  3FTS A;  4O6F A;  3TWU A;  3JXJ A;  3DEP A;  4JHJ A;  5AAO A;  2LXM A;  1TNB A;  4BER A;  2FO1 E;  3UI2 A;  2VQ2 A;  1FVH A;  1DC2 A;  1Z3X A;  3I4R B;  3JUI A;  3T5X A;  4XZ4 A;  2F37 A;  2VYI A;  4B93 B;  3I4G A;  3W9F A;  1JCS A;  2P9N G;  3ZHE B;  3AG1 E;  1OWL A;  3RIB A;  4CYM D;  1WM5 A;  3IHY A;  2BTD A;  3HG0 D;  5CCM A;  3MX3 A;  5ANL A;  2R59 A;  2RFA A;  3FU6 A;  3RKV A;  4HS2 A;  2R2L A;  2KXP C;  3CVX A;  2WXH A;  4CDN A;  4LUN U;  4FP7 A;  3DSU A;  2DVW A;  1U2V G;  3EUV A;  4RSY A;  3T8K A;  4G25 A;  5JJ6 A;  1N54 A;  1TN7 A;  3RO3 A;  1KT0 A;  3L17 A;  3D9L A;  3ESK A;  3CIA A;  1HZ4 A;  1X5B A;  4NAC A;  3HDX A;  1MX6 A;  2LUH A;  1QQE A;  1QZ2 A;  4WNE A;  3NOC D;  4ACK A;  4RQI A;  3CVY A;  4O60 A;  4G24 A;  4XIF A;  2KBX A;  3TWW A;  4JEU A;  2J09 A;  4E85 A;  3JUE A;  2OOE A;  3RSE G;  2Q7F A;  1NP7 A;  3ULQ A;  4A3T A;  2IU1 A;  3IHV A;  4M3O A;  3NB2 A;  4LNU D;  2LSV A;  1H0A A;  4TXP A;  3B13 A;  4RVB A;  3FUN A;  4L2Y A;  4GMR A;  3ZEF A;  4YDY A;  5DBK A;  2OVF A;  3EHQ A;  1N0Q A;  3QOU A;  2PL2 A;  5EX0 A;  3FUF A;  3HHM A;  3UMV A;  3ASN E;  3FUE A;  5G05 C;  2PQN A;  3FUD A;  5ENN A;  3L13 A;  5EX3 A;  4FA6 A;  4N3A A;  2OCC E;  3VTX A;  4A1G A;  1E8Y A;  2QFC A;  3IKO B;  3D9M A;  3TWR A;  2ZGD A;  2XPZ A;  1KZO A;  3BEE A;  3QDN A;  3NBN B;  3V30 A;  1NZN A;  2NSZ A;  4F7A A;  4U95 D;  4TV3 A;  4JHK A;  5FZQ A;  2DWZ A;  4DUI A;  2C0M A;  4PH4 B;  2VGX B;  4I6G A;  5CRV A;  2MRI A;  1E90 A;  3LY8 A;  3RAU A;  3V31 A;  3Q9U C;  4U96 D;  4D10 C;  5EYL A;  3BU8 A;  3V2X A;  2VGE A;  3FDH A;  5HQ8 A;  5T4Y A;  4A63 B;  3B7U X;  2FUL A;  4CCA A;  2CFU A;  4PS3 A;  5T8I A;  4F1S A;  2QYJ A;  3UIP C;  2VGX A;  2B0O E;  1Y8M A;  3TWQ A;  2ION A;  2X6I A;  4J8D A;  3B7T A;  4J6I A;  3MV2 B;  1UN8 A;  4CDR A;  2L0T B;  3W9G A;  3TGO A;  3S7J A;  3O4Z A;  3CKB A;  3D9J A;  3DSX A;  4I9E A;  3CHP A;  4G8K A;  2I6H A;  3Q78 A;  3DPY A;  2VSY A;  2FF4 A;  1X81 A;  4JD2 G;  1O1R A;  3WG7 E;  5E75 A;  1H2V C;  3EDT B;  3CHQ A;  4MRU A;  3E30 A;  4J8Y A;  4GAA A;  2V4H C;  1HO8 A;  1XGW A;  2ZIS A;  1A17 A;  3CKC A;  5ANR A;  1FCH A;  2P9I G;  5D66 A;  5FQ7 A;  3BG0 B;  3PE3 A;  2XZD G;  4G1T A;  2R05 A;  5AEN A;  3OAW A;  4G26 A;  3L54 A;  3UKR G;  2RD0 A;  5KBA A;  3FH7 A;  4GB9 A;  3S2A A;  5ENT D;  5AQB A;  2I1K A;  4LSZ E;  2PZI A;  4B0Z A;  5FIO A;  3UIO C;  3AG2 E;  4JA9 A;  3CVN A;  3APD A;  2EQX A;  1E7V A;  2WMO A;  3GZ2 A;  3TWX A;  1E96 B;  2WXG A;  3MKR A;  2I9C A;  3HIZ A;  1RZ4 A;  1TNZ A;  2ZIR A;  2WQ6 A;  3FTX A;  4XI0 A;  4UWL A;  4GA0 A;  3Q47 B;  3MKQ A;  2Y0B G;  2WXJ A;  5DIZ A;  2F8X K;  3OTN A;  4N3B A;  4KBQ A;  3UX4 A;  1TN8 A;  4WWN A;  1LF8 A;  2FO7 A;  4Z68 A;  4LNB A;  4KVM A;  1UN9 A;  4K0R A;  1SVX A;  4ANX A;  3C3R A;  4HRL A;  2A5E A;  4GYY A;  2OEW A;  3C98 A;  2VTB A;  4AVX A;  2YHC A;  4G23 A;  4GA1 A;  4FUL A;  4CRW A;  4DI3 A;  3EIQ C;  2WXK A;  3PNT B;  3TAX A;  5A7D B;  2UWJ G;  2P9S G;  1E8W A;  4ILG A;  3SFY A;  2XCC A;  2GRR B;  4I43 A;  4HNA D;  3ZN3 A;  3LDZ A;  3SBS A;  3CVQ A;  3ONK A;  1N52 A;  4K03 A;  5BV0 A;  5AJL A;  4HI8 A;  4WAF A;  4EPZ A;  1OCO E;  4LCT A;  3HXE A;  5FQ6 A;  5CRU A;  1K8K G;  2MYO A;  3V2O A;  1N95 A;  3TL5 A;  3KEA A;  3CHM A;  5FQ8 A;  4GTS A;  4NUR A;  4I6E A;  4JHR A;  3OXG A;  3ZXP A;  1E8X A;  1FVF A;  4WUY A;  3SNX A;  2E2E A;  2ZXW E;  3Q73 A;  3RJV A;  3IEG A;  1TNU A;  2Y4U A;  2WB2 A;  3DBS A;  2WXQ A;  1HFA A;  5G2N A;  2GRN B;  1AP7 A;  4FC8 A;  3E4B A;  2JLB A;  3U3W A;  4OVU A;  4R7L A;  3L82 A;  4CGV A;  4MS6 A;  2IOS A;  4XEI G;  2A4Z A;  1Z6T A;  2E0I A;  3SD5 A;  4JC8 A;  3LY7 A;  3S7D A;  1N94 A;  4GZ6 A;  2I1J A;  2OEV A;  1MJ0 A;  4C0M A;  5KCM A;  3L22 A;  1S70 B;  5G55 A;  1H6P A;  3DWL G;  2PQR A;  1HF8 A;  2IY0 C;  4KXK B;  4BTB A;  3FTW A;  4BWR A;  4O1O A;  4HB5 A;  3R7Q A;  1Y6I A;  2DBA A;  3ZVV A;  4GML A;  1B89 A;  5LX8 A;  4ANU A;  1E7U A;  2XEH A;  1IQU A;  2EIK E;  4GA2 A;  4EZK A;  2OND A;  3LEW A;  4TRQ A;  5BXO A;  3UT4 A;  1HG5 A;  2H6F A;  2L6B A;  4A1S A;  3I3N A;  1N4R A;  4JPS A;  5C1D A;  4QFV A;  2LSU A;  1MQS A;  3CVP A;  2C2L A;  4WNG A;  1O5M A;  3CK9 A;  3LYA A;  3FH5 A;  4HLE A;  4LNG A;  2LXL A;  2Y3A A;  1A5E A;  2AXZ A;  4HBD A;  2CHX A;  5BV1 A;  3MJW A;  3Q75 A;  3JCK C;  2AXV A;  5ENO D;  5KJK A;  2M63 A;  4MBG A;  4GU5 A;  4DK5 A;  4KZ0 A;  2NC9 A;  4N39 A;  2R02 A;  3FU3 A;  4F1P A;  4LEU A;  4UQY A;  5CER B;  2AJA A;  4XE0 A;  1WY6 A;  4RG9 A;  3CVL A;  5CEA A;  1N4S A;  1PY1 A;  2KCK A;  4FAD A;  2J4D A;  3FUK A;  1S64 A;  3HXF A;  3EIJ A;  3EU5 A;  3AS8 A;  5G04 J;  2R03 A;  1K1A A;  5CBO A;  1BD8 A;  2UY1 A;  3MEK A;  4I2Z A;  3RK6 A;  2WXO A;  4AXH A;  2V5F A;  2XQ0 A;  4EBA A;  3GYZ A;  2J07 A;  2L9B A;  2L0I A;  2CHZ A;  3SF4 A;  4GTO A;  3ONL A;  4GZD A;  5B1A E;  3U4T A;  4I9C A;  2ZGG A;  3EHN A;  2YNQ A;  1FT2 A;  5JJ7 A;  1JUQ A;  4HXI A;  4Q94 A;  5EIB E;  1JCR A;  1HXI A;  5AQ9 A;  2KCV A;  2WVI A;  3LPZ A;  2XS1 A;  3PRE A;  3CV0 A;  3QAR A;  4AY5 A;  3LVR E;  4BT9 A;  4HOU A;  3FHE A;  5FIN A;  4Q69 A;  3GZS A;  2XCB A;  5EID A;  4EHM A;  2IJG X;  5C2Y A;  4UI9 C;  5CEC B;  4HOR A;  4WWP A;  5FQ4 A;  2RFM A;  4UQX A;  3CK7 A;  4KYO B;  3I5P A;  3SFZ A;  2H6I A;  4BSZ B;  3L16 A;  3FUM A;  5BXU A;  3KS2 A;  3C3Q A;  5AAR A;  2WXL A;  3G2U A;  3B7S A;  1VDY A;  3LCA A;  3ZIM A;  3E33 A;  3ZXS A;  1BPO A;  3SGH A;  4YDO A;  1G3N B;  2FEZ A;  1S0P A;  4G2V A;  3Q7A A;  2DIW A;  4NQ0 A;  4YND A;  1H19 A;  2QY7 A;  1UJK A;  2X6F A;  4O1P A;  1FT1 A;  5ENQ D;  4JL0 A;  3Q9N C;  2X6H A;  2XEE A;  3QB2 A;  3RU0 A;  4KVO A;  3DPD A;  4CT4 A;  4UWH A;  5D0Q D;  1OCZ E;  1LD7 A;  4OAV B;  3FEY A;  3CQG B;  3PVL A;  3TWT A;  2YIN A;  1DNP A;  2C0L A;  5KJM A;  3EHR A;  1JWG A;  3SHF A;  1KZP A;  2XEN A;  2DYR E;  4IN3 B;  2ETA A;  3CSF A;  3LKU A;  1HX8 A;  4ILH B;  2BED A;  2YHE A;  1BU9 A;  2WXR A;  1MX4 A;  2P9L G;  3CQC B;  1ELR A;  3GZ1 A;  5AQ7 A;  4GZC A;  1WG0 A;  4GTR A;  4U8H A;  1LTX A;  1TN6 A;  5BUZ A;  3C3O A;  3O48 A;  3SFX A;  1N11 A;  5BW8 C;  5HRY A;  3QWV A;  3JYS A;  1OWM A;  4HRM B;  1Z3Y A;  3EU9 A;  3NZS A;  3BG1 B;  3QWP A;  4DLQ A;  4KMO A;  3Q5M A;  3G2V A;  1N9A A;  4N3C A;  3FH8 A;  3CVW A;  3ZRH A;  5HI7 A;  2AWI A;  2XGO A;  1UJJ A;  2F8Y A;  4L2L A;  2XRY A;  5J08 A;  3JQ0 A;  3ZYK A;  3AS5 A;  5CED B;  3TWS A;  4HOT A;  4MLP A;  5FZS A;  4A55 A;  5ENS D;  1IQR A;  4MKT A;  2A5U A;  3NOG D;  3ULE G;  1ZBP A;  2FI7 A;  3HYM B;  4HFG A;  3JXI A;  4GTP A;  3NAW A;  4YDE A;  3KAE A;  2RKK A;  3NZU A;  1YMP A;  3X2Q E;  1QNF A;  4BFR A;  2AVP A;  3CLJ A;  1O1S A;  2B6C A;  4Q96 A;  4ANW A;  2J49 A;  3ABK E;  1ZU2 A;  3FFL A;  3FEX A;  2X6J A;  3BUA A;  4ZFH A;  3G2T A;  1BI8 B;  2XRZ A;  2R17 C;  4CEM A;  4AEZ C;  1SA4 A;  1NL4 A;  4I17 A;  2XZT G;  5T3R A;  4EEC A;  3ZYL A;  4C0E A;  3PS6 A;  4BSX A;  1IXV A;  3J5P A;  3U9W A;  2WQ7 A;  5JA4 D;  2QYU A;  1H6O A;  1K1B A;  1Q2Z A;  1MYO A;  3QC1 A;  2KCL A;  3G2W A;  4GTQ A;  3FU0 A;  4FLH A;  4FJY A;  1MX2 A;  3SO8 A;  1SZA A;  2R5S A;  3CHO A;  1ELW A;  5JHA A;  2RG8 A;  2WXF A;  3UKU G;  4UI9 K;  5KNG A;  1D9S A;  3ZPJ A;  1E8Z A;  3Q7F A;  3UTM A;  1TNY A;  4AV7 A;  1OCR E;  5FTP A;  4BTA A;  3PRZ A;  3SY2 A;  4J8S A;  4JEH A;  4B89 A;  5G04 C;  5LFA A;  4DX2 A;  2V5Q C;  3JQ1 A;  1V54 E;  3VLF A;  4LER A;  3FUJ A;  3P2B A;  1EPU A;  4CZ2 D;  4FHJ A;  3GW4 A;  4U0S A;  2LAH A;  2XGM A;  3LJ3 A;  4EQF A;  1EYH A;  1BI7 B;  2AW6 A;  4U8V D;  4HVB A;  4U63 A;  3ASG A;  2J4B A;  4B8A A;  1TJC A;  3DSW A;  5AQA A;  4BET A;  2BUG A;  4AM9 A;  1H2T C;  3AU5 A;  3HXC A;  1FPP A;  3DSS A;  4U0Z A;  4KT6 B;  5AIJ A;  1YYH A;  1HU3 A;  4UWK A;  4ATZ D;  2X6K A;  3RRN B;  3PZ1 A;  2IEJ A;  4I6J A;  3CHS A;  4TXQ A;  3OXL A;  1HH8 A;  2LO6 A;  3B7B A;  5CCL A;  3AG4 E;  1SQM A;  3UT7 A;  4HLL A;  4F3V A;  1ELK A;  4TUM A;  1QBQ A;  2DYS E;  4JVS A;  5J90 A;  5LOZ A;  3T9K A;  5FZR A;  4AP2 A;  1TEZ A;  4F53 A;  3AG3 E;  4ATG A;  4BT8 A;  3ASF A;  3D9K A;  3S7B A;  2CG2 A;  4FU3 A;  2WQH A;  2EIN E;  4N5C A;  3MYV A;  2V0P A;  4B94 A;  3J5Q B;  5KNH D;  3ASO E;  2X38 A;  2KAT A;  3MA5 A;  1MZC A;  3C72 A;  4HI9 A;  2ILR A;  3TXM A;  4APF A;  2KM4 A;  4L7T A;  3ABL E;  3UXG A;  3F6Q A;  2V8S E;  2KZT B;  3TJP A;  1DCE A;  3MV3 B;  4BEP A;  3RRM B;  3D9I A;  2UY1 B;  3G2S A;  2XGS A;  2BF0 X;  3CR3 A;  3RO2 A;  4TXR A;  2LNI A;  4APO A;  2IO3 C;  3WXX A;  4DPR A;  2HE0 A;  3B95 A;  5LCW J;  5M72 A;  2XEV A;  1SZ9 A;  4GTV A;  1N4P A;  4CGW A;  2XPY A;  3APF A;  3Q4A B;  1IKN D;  5A6C A;  3NF1 A;  5FJY A;  1QYM A;  4LRZ A;  5JHB A;  3UUX A;  3ZNG A;  1WDY A;  3L08 A;  2Y69 E;  3FU5 A;  3TG4 A;  4NRH B;  4GZ3 A;  3UT8 A;  3ISM C;  3ML8 A;  4ILI A;  2CG3 A;  3LY9 A;  5CHE E;  1K3Z D;  1V55 E;  2HR2 A;  2ZU6 B;  4AJW A;  3Q49 B;  3MKQ B;  2IOL A;  2VJ8 A;  2QZA A;  1OUV A;  2GRL A;  2GGF A;  2CFZ A;  1XNF A;  3SBT B;  4JB8 P;  3ZW3 A;  3S7F A;  3B7R L;  4U8Y D;  1P5Q A;  4H7X A;  4UWF A;  1UW4 B;  2GRO B;  3FTU A;  3D9P A;  4PDX A;  1O1T A;  3PZ2 A;  5CBN A;  5ENR D;  1OWN A;  2BKG A;  5EIL A;  2VSX E;  4UWG A; 
#chains in the Genus database with same CATH homology
 4Z68 A;  4ZFH A;  2RFA A;  4YDW A;  4HBD A;  4N5Q A;  1BI8 B;  1BU9 A;  5AQA A;  5CEC B;  5HKP A;  1NFI E;  1MX4 A;  2HE0 A;  4BET A;  2ETB A;  3LJN A;  1SVX A;  1UOH A;  2DZO A;  3B95 A;  5ENO D;  2RFM A;  1AP7 A;  5AN8 A;  3DEO A;  2KXP C;  4HRL A;  5AQ7 A;  3ZUV B;  3V79 K;  5EN5 D;  4OAU C;  2A5E A;  2NYJ A;  1WG0 A;  2XZT G;  5ITZ F;  1YYH A;  3TWR A;  2ZGD A;  1N11 A;  4J8Y A;  4ATZ D;  2DVW A;  5HRY A;  1IXV A;  4BSZ B;  4HRM B;  1IKN D;  2V4H C;  1DCQ A;  3V30 A;  5KWD A;  3T8K A;  3NBN B;  3EU9 A;  4U95 D;  4F1P A;  3J5P A;  4HQD A;  4K5A B;  5BXU A;  2DWZ A;  3IXE A;  4DUI A;  3B7B A;  5JA4 D;  4UUC A;  5AAR A;  5CER B;  4DRX E;  4BES A;  4QQI A;  2AJA A;  3D9H A;  1MJ0 A;  2P2C P;  4HLL A;  1QYM A;  3V31 A;  1IHB A;  1K1B A;  3C5R A;  1MYO A;  4TUM A;  3Q9U C;  1S70 B;  2JAB A;  4U96 D;  5CEA A;  4GPM A;  1WDY A;  3ZNG A;  4F6R D;  2F8Y A;  4HNA D;  5EYL A;  1MX6 A;  5D66 A;  4ZHB A;  4K5B A;  3T9K A;  1YCS B;  1G3N B;  4DX6 D;  3HRA A;  3V2X A;  3NOC D;  2VGE A;  1K1A A;  2XZD G;  4LG6 A;  2PNN A;  5CBO A;  1BLX B;  2DZN A;  4O60 A;  1BD8 A;  4O1O A;  2J8S D;  5CED B;  4HI8 A;  1MX2 A;  2KBX A;  3TWW A;  3SO8 A;  4HB5 A;  3TWS A;  3TWU A;  4RLY A;  3JXJ A;  4A63 B;  2Y1L E;  4G8L A;  5ENS D;  4DX7 D;  1K3Z D;  3DEP A;  5KNG A;  1D9S A;  4HRN A;  3JUE A;  3ZU7 B;  5KBA A;  3NOG D;  5AAO A;  4O1P A;  5ENQ D;  2QYJ A;  3UTM A;  2XEH A;  4BER A;  2FO1 E;  5ENT D;  5AQB A;  3J5Q B;  3UI2 A;  3Q9N C;  2MYO A;  2B0O E;  4LSZ E;  5KNH D;  3V2O A;  2XEE A;  4J7W A;  2ZGG A;  3TWQ A;  5FIO A;  4LNU D;  3TWV A;  4HI9 A;  2ETC A;  5BXO A;  1DC2 A;  3JXI A;  4JB8 P;  4DX2 A;  2BKK B;  3KEA A;  1OT8 A;  2V5Q C;  5ENP D;  5EIB E;  1OY3 D;  5AQ9 A;  2F37 A;  2L6B A;  1SW6 A;  4U8Y D;  1YMP A;  3TWX A;  4B93 B;  3W9F A;  3ZKJ A;  3UXG A;  4QFV A;  4OAV B;  1A5E A;  3F6Q A;  5EYP F;  1TR4 A;  3TWT A;  3W9G A;  4CZ2 D;  5JMN D;  5HS0 A;  1N0R A;  3AAA C;  3EHR A;  4BEP A;  2QC9 A;  4CYM D;  4G8K A;  1BI7 B;  4GMR A;  2XEN A;  4U8V D;  3HG0 D;  4C48 B;  5CBN A;  2Y0B G;  4YDY A;  4NIK A;  4K5C A;  2ETA A;  4DX5 D;  5ENR D;  4DX1 A;  3EHQ A;  1AWC B;  2F8X K;  1N0Q A;  2BKG A;  5FIN A;  5EIL A;  3AJI A;  5EID A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...