4C48B

Crystal structure of acrb-acrz complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
152
structure length
152
Chain Sequence
GKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACRIFLAVINE RESISTANCE PROTEIN B
publication title Structure of the AcrAB-TolC multidrug efflux pump.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transport protein
total genus 35
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2013-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4c48B00
5ITZF 3NBNB 4CZ2D 5EN5D 3EHRA 1OY3D 5KNHD 5ENRD 4DX5D 4C48B 5CERB 2F8XK 2V5QC 4HB5A 1BD8A 1IHBA 4DX1A 4GPMA 3W9FA 3ZUVB 2XZDG 3D9HA 5FINA 1MYOA 3KEAA 2ZGDA 2ZGGA 1BLXB 2HE0A 2XEHA 1G3NB 2DZNA 2QC9A 2RFMA 3DEPA 4HNAD 3J5PA 3TWUA 5ENQD 2P2CP 4U8VD 5JMND 4OAVB 1D9SA 5AAOA 1YYHA 2AJAA 2DZOA 2XEEA 3TWWA 3F6QA 5HRYA 5BXUA 4BSZB 4DUIA 1N0RA 1OT8A 4F1PA 3HRAA 3V30A 3UXGA 1N11A 4K5BA 4ATZD 5FIOA 4YDWA 4LNUD 3V2OA 2JABA 4DX6D 4DX7D 1MX6A 4TUMA 1K3ZD 1MJ0A 2J8SD 5EYPF 5AQ7A 3TWRA 2ETCA 4ZHBA 3V79K 4HQDA 4NIKA 5ENTD 4HLLA 5AQAA 4O60A 3ZKJA 4U95D 4GMRA 4HRLA 5KNGA 4BETA 4LG6A 1AP7A 5EYLA 4N5QA 4HRNA 1WG0A 3JXIA 4CYMD 4O1PA 4B93B 5HKPA 3TWVA 4Z68A 4HBDA 1K1BA 4K5CA 1S70B 2XZTG 1UOHA 3SO8A 4DRXE 2NYJA 2A5EA 4U96D 5AARA 3V31A 1TR4A 3Q9NC 3B95A 4HRMB 4QFVA 3W9GA 5CEAA 3ZU7B 1SVXA 3EU9A 4BESA 1IKND 4K5AB 4O1OA 2V4HC 3C5RA 3UTMA 3JUEA 3UI2A 4JB8P 5D66A 2B0OE 1SW6A 1YMPA 2ETBA 3IXEA 2VGEA 3AJIA 5CEDB 4A63B 5KBAA 4BEPA 4F6RD 5CBNA 3Q9UC 4G8LA 1MX4A 3B7BA 2XENA 4QQIA 2DWZA 3EHQA 3TWSA 2Y1LE 3DEOA 1DC2A 3AAAC 1K1AA 1A5EA 5ENPD 5AQ9A 5CECB 4DX2A 1IXVA 5AN8A 1WDYA 3T8KA 1BI7B 1N0QA 3JXJA 3T9KA 4BERA 2ETAA 1AWCB 3J5QB 3ZNGA 5JA4D 4RLYA 1BI8B 5AQBA 4J7WA 4U8YD 5HS0A 1YCSB 2PNNA 5KWDA 3V2XA 1BU9A 2F8YA 2L6BA 1NFIE 5ENOD 3HG0D 5ENSD 3TWXA 4UUCA 2KXPC 5EILA 4G8KA 4LSZE 2BKGA 2DVWA 1MX2A 2F37A 2QYJA 2KBXA 1QYMA 3TWTA 3TWQA 5EIBE 4J8YA 5BXOA 3NOGD 1DCQA 4OAUC 5CBOA 4HI9A 3NOCD 5EIDA 2Y0BG 4ZFHA 2MYOA 3LJNA 2FO1E 2BKKB 4HI8A 2RFAA 4YDYA
chains in the Genus database with same CATH superfamily
4MRUA 2CHZA 2WMNA 4JA7A 4ILGA 3G2WA 3O48A 3PUJA 4JXTA 5CCMA 2VJ8A 1Z5SC 1E7VA 3VLDA 3UPVA 1OCZE 4BX8A 4UI9K 2J9QA 5BUZA 4DX6D 5EYPF 1N94A 3G2SA 3TXMA 2CG2A 4K0RA 4NIKA 1TYQG 4GMRA 3LS8A 4BX9A 3MV2B 4O1PA 3PZDA 2A4ZA 4WWOA 1S70B 4DRXE 5LOZA 4WNGA 1DNPA 2V5FA 4CDRA 3EU9A 1KT1A 3Q4AB 2GRRB 5D66A 2EIME 5LFAA 1PC2A 3APFA 2VSYA 2XENA 2OEVA 5BV0A 2HYZA 1UN8A 1WAO1 2PQNA 3L08A 1FPPA 3T9KA 3RU0A 4OVVA 2NC9A 4WWNA 2F8YA 2NSZA 3FU0A 1O1RA 1MX2A 4TXPA 3NOGD 3ZVVA 1DCQA 1IHGA 2Y0BG 3B7TA 4ANXA 5E75A 4OVUA 4JD2G 5ENNA 1BD8A 4YDEA 3KEAA 4U8VD 4Q94A 4KVOA 3TL5A 1SA5A 1N0RA 4A3TA 4EZLA 2XGMA 4LCTA 2VGYA 5G55A 3MGBA 1S0PA 4F53A 4N39A 3PZ4A 4L9PA 3PZ3A 5ARFA 3SBSA 4F7AA 4HRLA 4JVSA 5EYLA 4KYOB 3OXLA 5D0QD 2M63A 4ANWA 4HOQA 1K1BA 2EILE 4C0EA 1IQUA 2XRZA 3D9KA 3Q9NC 2VTBA 3S2AA 5CMYA 3UI2A 3VTXA 3CVPA 3ASGA 4DLOA 4DI3A 2XPZA 3Q9UC 3DSSA 2DWZA 4GTQA 3JUIA 5AN8A 3Q79A 5JJ6A 2KM4A 3VLEA 2P9PG 3ASOE 3DSTA 2X6KA 2J09A 4GTSA 2WQ6A 2KXPC 2CHWA 1JPLA 3JQ0A 5AJDA 4EQFA 5B1AE 5LX8A 3UM0A 4APOA 4CT0A 2XPIA 1E8YA 2X6JA 4HB5A 5EKQD 3LYAA 1OWNA 3LVRE 2YHEA 3D9PA 3QB2A 5B1BE 4U07A 2HE0A 3PDNA 5G05C 2UWJG 2KCLA 2XCCA 5HRYA 3SY2A 3FHEA 3ZHEA 4GCOA 1NL4A 4DX7D 1FT2A 3CHPA 4U63A 3OTNA 3CSTA 4LUNU 5AIJA 3FH5A 4KVMA 5KNGA 4LG6A 5DIZA 3ZEFA 1S64A 4CYMD 3HVEA 3FULA 3ZRHA 4GTPA 2XZTG 3CVVA 1P5QA 5FZQA 2VQ2A 5FQ8A 4K5AB 4W9RA 3JUEA 2OOEA 1MZCA 3DXKG 3PNLB 4FHJA 4AVXA 2R02A 4M3OA 4F6RD 5CBNA 1MX4A 4QQIA 3RRUA 2Y1LE 3CEQA 2HO1A 2VSNA 3BG0B 3S7DA 5FT9A 4XEIG 1BI7B 3AG1E 2UY1A 3CGHA 3FUMA 3HHMA 3CVYA 2LSUA 4ILHB 4D10C 1HFAA 3D9OA 1TNBA 4N5CA 1TNOA 3UT8A 3P2BA 4NQ0A 2BUGA 4J8YA 5DBKA 3CVQA 3ZYKA 1H19A 4BTAA 3ZPJA 2WXHA 1NZNA 5ITZF 3NBNB 4UQZA 5B3SE 2FEZA 3I5PA 4FADA 4GZ3A 4YVQC 2RFMA 2QC9A 3L17A 3R7QA 3UUXA 1OWLA 4U8HA 3R9AB 4OAVB 1UW4B 3HXDA 4DUIA 3BG1B 5CRUA 3CHOA 3PEUB 2J8SD 3Q49B 4N2QA 2B6CA 5D2MC 4ZHBA 3RSEG 3JYSA 3E33A 5CCLA 3JXIA 2J4DA 4OYSA 3FUDA 3MCXA 4DK5A 2R5SA 3MKQB 4NURA 4U96D 4BWRA 3UTMA 1U2VG 3HYMB 3GZ2A 3AS5A 4GTMA 2OVBA 1IXVA 1H6PA 3C3OA 1BI8B 3X2QE 1O1TA 2AXUA 2J07A 4I6JA 4N3BA 2QZAA 2QYUA 2VGXB 3UM3A 3DSWA 5EILA 1X5BA 1OUVA 3R7RA 3CR3A 4DJAA 2XGSA 3ABLE 3ML8A 1WM5A 4YDYA 2OEWA 5A6CA 4C48B 2P9IG 1A17A 3CVWA 1H2VC 1IHBA 2XZDG 4FU3A 5BW8C 4NRHB 4HNAD 4RQIA 1FCHA 1D9SA 1OCCE 4KZ0A 3ZXSA 3LY8A 3TG4A 4WWPA 4HFGA 2LNIA 3CVLA 2OVFA 1HZ4A 4UI9C 3SQVA 4FA6A 4AOFA 4I6EA 4IULA 1WG0A 4AY5A 3G2TA 4E6HA 3SO8A 3ONLA 3Q75A 3CQGB 3B95A 5LP0A 4GYWA 2A5UA 5JJTA 4G25A 3UIPC 2WXJA 3ABME 5FTPA 2ETBA 3IXEA 4GB9A 1JWFA 2C0LA 1PY1A 2GW1A 3QOUA 3SBTB 3TG5A 5JA4D 1Z3XA 2LO6A 3FUHA 2LUHA 3NB2A 3V2XA 3LCAA 4IN3B 3FU3A 2LAIA 4WUYA 4F1SA 4U0SA 2KBXA 4UWHA 3T5VA 3Q7AA 3L22A 3HDXA 4UWKA 4RG6A 1Z3YA 2CHXA 2F8XK 4B8AA 3FWVA 3CHMA 3ZN3A 1JWGA 4MS6A 4GAAA 2ZGDA 2XEHA 2KCVA 4RSYA 4LNBA 2WQHA 4AJWA 3UXGA 1D8DA 2KZTA 5AQ7A 2I1JA 4WAFA 5J08A 3U3WA 1AP7A 3CK7A 1BPOA 4TUUA 1ELRA 3LJ3A 1Z6TA 1OWPA 4KBQA 3QNKA 3UKRG 3S7JA 3PEVB 1N9AA 1K8KG 2PZIA 1FT1A 2B0OE 2JEKA 4AIFA 3T5XA 1OCOE 2JLBA 4B0ZA 1ZB1A 1DC2A 4J8DA 4CCAA 2EIJE 2GRNB 2XS8A 3KS2A 3JXJA 2E0IA 2YHCA 4GCNA 2PNNA 2F0YA 3D9MA 3EIQC 3UMVA 2Y69E 4MKTA 1SQMA 1E90A 5JJ7A 2DVWA 2F37A 2IONA 4TXRA 3TWQA 3FUEA 4C9BB 3DSVA 2KCKA 4OAUC 4G23A 4DI4A 4KMOA 3UINC 3IEGA 3QAQA 2RFAA 2WXIA 4Y6CA 3IV0A 4GTRA 3MYVA 5EDSA 2YQ8A 3CV0A 3Q7FA 4G11A 4CDMA 4L23A 3ULYA 5IY5E 1EYHA 3CSFA 5AAOA 3D9LA 1SZ9A 3ZFWA 3D9NA 2X6FA 2IFUA 5G04C 1N11A 3HXEA 2PL2A 3ZKJA 4HLLA 3UM1A 3ASNE 2DBAA 3DXMG 4EECA 4HRNA 3B13A 3QARA 1UOHA 4LRZA 2IO2C 1HXIA 3MV3B 3U9WA 3IKOB 3OAWA 3SNXA 3L13A 3SFYA 5BV1A 3TGOA 3PREA 1E8WA 3FY4A 2I9CA 4GA0A 3AU5A 1FVHA 3E34A 4BERA 2WXQA 1UJJA 4RLYA 4JZYA 3D9JA 4JHKA 3SFZA 3UT4A 3DSUA 3LXUX 4HXIA 1QYMA 2IO3C 1D8EA 2KATA 4ZFHA 3Q78A 2FO1E 1KPSB 3EHRA 3LKUA 2V4LA 3CHRA 4JL0A 4PH4B 2GRPB 2CFUA 4CGVA 3UQ3A 1YA0A 3J5PA 5ENQD 4V3IA 1OXJA 3VTYA 5KJNA 3HRAA 5CHEE 2CG3A 4K5BA 3E30A 4PS7A 1MJ0A 4U7EB 2ETCA 4EZKA 5ENTD 1JCRA 1OWMA 4BETA 2WXLA 4XKBA 2IJGX 4N5QA 1ELKA 4GTTA 3CVXA 2FI7A 2L9BA 2Y4UA 4HBDA 3FH8A 2VSOE 2DCPA 5JHAA 4I2ZA 4M7CA 5JHBA 4LNGA 5E76A 2CFZA 4GZCA 3LY9A 1HX8A 2IF4A 5BNWA 3CVNA 5CEDB 3ZYQA 3EHQA 1NA0A 3FDHA 3NAWA 3FTVA 3UT7A 5CRVA 4EZJA 4CGWA 3EHMA 2WXRA 1U3DA 5HS0A 4U8YD 3I4GA 3EUVA 1TN7A 2L6BA 3ZYLA 2ONDA 4P29A 3ASFA 4U0UA 3L54A 1IYGA 4GTVA 2LAHA 3PE4A 1QQEA 2DYRE 1VDYA 1OY3D 4EHMA 5KNHD 5ENRD 2V5QC 1FVFA 2V0PA 4UI9J 1JUQA 3ZUVB 4GU5A 2R59A 2P9LG 3IBEA 3OXGA 3DEPA 2DZNA 3AS4A 3SGHA 4AEZC 4ANUA 2XEEA 3B7SA 3CK9A 3MX3A 3FTZA 4J6IA 2L6JA 3E32A 3ASHA 4N3AA 1XNFA 4E85A 3SI5A 1K3ZD 2X6IA 3R9MA 4JW1A 3TWRA 4BT8A 1MHQA 1TNUA 5KJKA 3KSQA 2J08A 4Z68A 1MQSA 2XHEA 5EX3A 5AYWD 1E7UA 2IU1A 2A5EA 3RRNB 3V31A 1N4RA 2QFCA 3FTXA 4GYOA 4ATGA 4YVOA 2H6GA 2X3MA 3RAUA 3HXBA 4DX2A 2P9SG 1N0QA 3MZLB 2R05A 5H7PA 3NZUA 4WNFA 3ONKA 4GTOA 4HI9A 3CHSA 4U04A 2WM9A 2R03A 2XRYA 5LCWC 2P58C 2GRLA 2PM7A 2XCBA 2WXPA 2L0IA 4CZ2D 2Y4TA 3Q15A 2VSXE 3ESLA 3QWWA 3D9HA 4EBAA 4X8QA 1DCEA 1UG3A 3CQCB 2VYIA 2P2CP 4ANVA 1TNZA 1EDUA 3KD7A 3ENEA 2WQ7A 1N4PA 5AJLA 4A1SA 4I2WA 1L5JA 3GZ1A 2X38A 4LEUA 2BTDA 2HM8A 3CKBA 2GRMA 3ZGQA 1NI1A 4XZ4A 4CEMA 5KJMA 3C72A 4QFVA 1NA3A 4J8SA 2DIWA 2Q7FA 3EDTB 4C0MA 4I6GA 4URKA 1HE8A 2QY7A 1HU3A 4GA1A 3PNTB 5T4YA 3CKCA 4UWFA 1A5EA 3SF4A 5BPPA 2E2EA 4K03A 3ABKE 2PM6A 3G2UA 2WB2A 4UWGA 3L82A 4J7WA 3MKQA 4FULA 4L1BA 4G26A 3LY7A 2WXNA 4JEUA 3DRAA 2IOLA 4GZ5A 3ESKA 2RD0A 3APCA 5BXOA 1GW6A 4HOUA 2P9UG 4JC8A 4I9CA 4I1AA 5G04J 2MYOA 4WNDA 3IHVA 5HQ8A 2Y3AA 3URZA 4HVBA 4XKCA 5FINA 1MYOA 3ASDA 3N71A 2FO7A 3FEXA 2AJAA 4BT9A 2VGXA 1LTXA 1OCRE 2DYSE 4Q96A 4PDXA 2AWIA 4GZ6A 3RIBA 3U66A 4CRWA 3OXFA 1KT0A 3O4ZA 3CHQA 3WXXA 2GROB 2MRIA 3AG3E 2NYJA 4EBAG 3W9GA 1LD8A 3RO2A 2R17C 1SVXA 3LDZA 4KT6B 3HXCA 3MEKA 4RG9A 5FQ4A 1HF8A 3BQOA 3ISMC 4XIFA 5T8IA 2I6HA 3CVUA 4I1MA 3E37A 5CECB 4IYPA 4Y6WA 2OCCE 2ETAA 3ZNGA 1O1SA 1XGWA 2BF0X 4BTBA 5ENSD 4GMLA 3TWXA 4GA2A 4MBGA 1KZPA 1N54A 3MKRA 2QYJA 3PUKA 4A3VA 3VLFA 4TV3A 3CK8A 4NACA 3TAXA 3DPYA 3LJNA 4HI8A 4HOTA 3PE3A 5A7DB 3SHFA 2YINA 3LEWA 3DPDA 3ULQA 2GGFA 2ZGGA 4TXQA 3L16A 1BLXB 3PS6A 3S7FA 4AM9A 5G05J 3DWLG 1H0AA 4JHRA 4XE0A 3TWWA 3F6QA 5G2NA 2VTBB 2EQXA 4BSZB 3FUIA 3V30A 2ZU6B 4YDWA 1UN9A 1PAQA 2WXOA 4AP2A 3I3NA 4HQDA 4G1TA 2WXKA 3C3QA 1EPUA 3T8MA 3TWVA 5HKPA 4GPKA 3HXFA 1Y8MA 3QWPA 2H6HA 3RO3A 3C98A 1TR4A 5CEAA 2BEDA 4G2VA 1U3CA 2RG8A 4I17A 4LERA 3KEZA 4A63B 3E4BA 3QJZA 4L2LA 1N4QA 2ZXWE 1INZA 4HORA 3PZ1A 5ANLA 5M72A 3T8KA 3AG4E 1O5MA 1TN8A 1AWCB 3J5QB 3ZYMA 1HO8A 5AQBA 3APDA 3RJVA 1BU9A 2OV8A 3ZHEB 2BKGA 4J8EA 4Q69A 3QK0A 2WVIA 5HI7A 2P9KG 2FULA 3CLJA 3KAEA 3AU4A 2WXMA 5CERB 4DX5D 2I2OA 3HVEB 3B7RL 3L6AA 3UKUG 5FQ6A 1H6KA 1HS6A 5T3RA 1H2TC 4FJYA 4GYYA 1HH8A 5JMND 2DZOA 3LPZA 3RKVA 2L0TB 1OT8A 2XEVA 2IOSA 3ML9A 2JABA 5J90A 5FJYA 5ARGA 4BY6A 2V8SE 1ZU2A 3FH7A 4RVBA 4N3CA 2UY1B 3BUAA 4JHJA 1E8XA 1V54E 3KSLA 1HG2A 5AARA 2WXGA 4XI9A 3Q47B 4N2SA 3FUNA 1E96B 4O1OA 4PS3A 1SA4A 1SW6A 4WNEA 4G8LA 2GRQB 2LSVA 3D3MA 5ENPD 5LCWJ 2IY0C 4CT4A 1YCSB 3G2VA 3BU8A 5KWDA 3UIOC 4G24A 3DSXA 1NFIE 1W3BA 5A23A 3JQ1A 4G8KA 5D0OD 3RRMB 3NOCD 2H6FA 2P9NG 1S63A 2XQ0A 3BEEA 4DX1A 3SFXA 4GPMA 1IQRA 4H7YA 2AW6A 2EIKE 2C2LA 3QKYA 3TWUA 3SD5A 3FU6A 3PH0C 5BXUA 1JCSA 1TNYA 3U4TA 3FEYA 4LNUD 4APFA 3NQPA 4YNDA 3Q5MA 4U95D 3FUFA 3UX4A 3ZIMA 1RW2A 4AV7A 1LF8A 1LD7A 3EHNA 4B93B 2HR2A 2C0MA 2IQCA 2NXPA 3AG2E 5KCMA 3ZU7B 4BESA 1IKND 3FTYA 1TJFA 3U64A 3EIJA 1YMPA 2WMOA 4J8FA 3B7BA 3SZ7A 2LXMA 3FFLA 2PQRA 4XI0A 3AAAC 1UJKA 4KZCA 1KLXA 2MOWA 1QZ2A 3C3RA 3GYZA 4L2YA 1RZ4A 4AY6A 3FTWA 5ENOD 4FLBA 4U0ZA 4UUCA 2J4BA 3NZSA 4O6FA 2XS1A 1TJCA 5EIBE 5KJLA 2XGOA 1V55E 4PS8A 3RK6A 3GZSA 4BFRA 2BKKB 3WG7E 1Y6IA 4GMJA 1DVPA 4R7LA 3W9FA 1HG5A 1N52A 3B7UX 3QDNA 1G3NB 3ULEG 2MHKA 1JCQA 1X81A 4ATZD 1H6OA 2RKKA 4A1GA 1MX6A 4TUMA 2FF4A 1TEZA 3HIZA 3P1UA 3V79K 4HLEA 4HOSA 5AQAA 4O60A 4I1OB 3TXNA 2FBNA 2ZISA 3QC1A 3TJPA 4K5CA 1N95A 1H2UA 4UWLA 4B94A 1QBQA 4HRMB 4FJZA 3FTSA 2X6HA 2V4HC 4JB8P 4ABNA 1SZAA 2VGEA 3AJIA 5C1DA 3ZW3A 5ANRA 2EINE 3TWSA 3PRZA 3DEOA 3I4RB 4DPRA 1K1AA 4JA9A 3NF1A 1WY6A 1WDYA 5BT1A 1QNFA 5FZRA 4GZDA 3ZXPA 4CDNA 2YNQA 2J49A 3HG0D 4DLQA 4FLHA 2WPVA 4L7TA 4I43A 3TWTA 4ACKA 4FC8A 4IRUA 2AXZA 2KZTB 3MJWA 1E8ZA 1EF1C 3DBSA 5EN5D 5EX0A 5FWQA 4ACLA 3FUJA 4UQXA 5AENA 3FU5A 1YYHA 3PVLA 3S7BA 4KXKB 4A55A 4J0UA 5FZSA 2IEJA 4B8CB 3UM2A 2AVPA 1ZBPA 4TRQA 4F1PA 4ILIA 5FIOA 3V2OA 3EJNA 4BSXA 4JPSA 1Q2ZA 3IHYA 4UQYA 4I9EA 4HS2A 4XX5A 1KZOA 3MA5A 4EPZA 2WXFA 4F3VA 3PZ2A 3AS8A 3GW4A 3Q73A 1OWOA 1B89A 2H6IA 2I1KA 4H7XA 3QWVA 5C2YA 2KC7A 1N4SA 3C5RA 3D9IA 2XPYA 1TN6A 2R2LA 5KBAA 4FHKA 4BEPA 5CMWA 2ZIRA 4MLPA 1ELWA 5AQ9A 3L9TA 3LVQE 4PUCA 5FQ7A 3FTUA 4FP7A 3FUKA 1NP7A 3K9IA 4YDOA 3FP3A 4AXHA 2LXLA 4LSZE 4JEHA 3JCKC 3CIAA 2AXVA 5CBOA 5EIDA 4B89A 4ME2A 2ILRA 3EU5A
chains in the Genus database with same CATH topology
5ITZF 3NBNB 4CZ2D 5EN5D 3EHRA 1OY3D 5KNHD 5ENRD 4DX5D 4C48B 5CERB 2F8XK 2V5QC 4HB5A 1BD8A 1IHBA 4DX1A 4GPMA 3W9FA 3ZUVB 2XZDG 3D9HA 5FINA 1MYOA 3KEAA 2ZGDA 2ZGGA 1BLXB 2HE0A 2XEHA 1G3NB 2DZNA 2QC9A 2RFMA 3DEPA 4HNAD 3J5PA 3TWUA 5ENQD 2P2CP 4U8VD 5JMND 4OAVB 1D9SA 5AAOA 1YYHA 2AJAA 2DZOA 2XEEA 3TWWA 3F6QA 5HRYA 5BXUA 4BSZB 4DUIA 1N0RA 1OT8A 4F1PA 3HRAA 3V30A 3UXGA 1N11A 4K5BA 4ATZD 5FIOA 4YDWA 4LNUD 3V2OA 2JABA 4DX6D 4DX7D 1MX6A 4TUMA 1K3ZD 1MJ0A 2J8SD 5EYPF 5AQ7A 3TWRA 2ETCA 4ZHBA 3V79K 4HQDA 4NIKA 5ENTD 4HLLA 5AQAA 4O60A 3ZKJA 4U95D 4GMRA 4HRLA 5KNGA 4BETA 4LG6A 1AP7A 5EYLA 4N5QA 4HRNA 1WG0A 3JXIA 4CYMD 4O1PA 4B93B 5HKPA 3TWVA 4Z68A 4HBDA 1K1BA 4K5CA 1S70B 2XZTG 1UOHA 3SO8A 4DRXE 2NYJA 2A5EA 4U96D 5AARA 3V31A 1TR4A 3Q9NC 3B95A 4HRMB 4QFVA 3W9GA 5CEAA 3ZU7B 1SVXA 3EU9A 4BESA 1IKND 4K5AB 4O1OA 2V4HC 3C5RA 3UTMA 3JUEA 3UI2A 4JB8P 5D66A 2B0OE 1SW6A 1YMPA 2ETBA 3IXEA 2VGEA 3AJIA 5CEDB 4A63B 5KBAA 4BEPA 4F6RD 5CBNA 3Q9UC 4G8LA 1MX4A 3B7BA 2XENA 4QQIA 2DWZA 3EHQA 3TWSA 2Y1LE 3DEOA 1DC2A 3AAAC 1K1AA 1A5EA 5ENPD 5AQ9A 5CECB 4DX2A 1IXVA 5AN8A 1WDYA 3T8KA 1BI7B 1N0QA 3JXJA 3T9KA 4BERA 2ETAA 1AWCB 3J5QB 3ZNGA 5JA4D 4RLYA 1BI8B 5AQBA 4J7WA 4U8YD 5HS0A 1YCSB 2PNNA 5KWDA 3V2XA 1BU9A 2F8YA 2L6BA 1NFIE 5ENOD 3HG0D 5ENSD 3TWXA 4UUCA 2KXPC 5EILA 4G8KA 4LSZE 2BKGA 2DVWA 1MX2A 2F37A 2QYJA 2KBXA 1QYMA 3TWTA 3TWQA 5EIBE 4J8YA 5BXOA 3NOGD 1DCQA 4OAUC 5CBOA 4HI9A 3NOCD 5EIDA 2Y0BG 4ZFHA 2MYOA 3LJNA 2FO1E 2BKKB 4HI8A 2RFAA 4YDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ITZ F;  3NBN B;  4CZ2 D;  5EN5 D;  3EHR A;  1OY3 D;  5KNH D;  5ENR D;  4DX5 D;  4C48 B;  5CER B;  2F8X K;  2V5Q C;  4HB5 A;  1BD8 A;  1IHB A;  4DX1 A;  4GPM A;  3W9F A;  3ZUV B;  2XZD G;  3D9H A;  5FIN A;  1MYO A;  3KEA A;  2ZGD A;  2ZGG A;  1BLX B;  2HE0 A;  2XEH A;  1G3N B;  2DZN A;  2QC9 A;  2RFM A;  3DEP A;  4HNA D;  3J5P A;  3TWU A;  5ENQ D;  2P2C P;  4U8V D;  5JMN D;  4OAV B;  1D9S A;  5AAO A;  1YYH A;  2AJA A;  2DZO A;  2XEE A;  3TWW A;  3F6Q A;  5HRY A;  5BXU A;  4BSZ B;  4DUI A;  1N0R A;  1OT8 A;  4F1P A;  3HRA A;  3V30 A;  3UXG A;  1N11 A;  4K5B A;  4ATZ D;  5FIO A;  4YDW A;  4LNU D;  3V2O A;  2JAB A;  4DX6 D;  4DX7 D;  1MX6 A;  4TUM A;  1K3Z D;  1MJ0 A;  2J8S D;  5EYP F;  5AQ7 A;  3TWR A;  2ETC A;  4ZHB A;  3V79 K;  4HQD A;  4NIK A;  5ENT D;  4HLL A;  5AQA A;  4O60 A;  3ZKJ A;  4U95 D;  4GMR A;  4HRL A;  5KNG A;  4BET A;  4LG6 A;  1AP7 A;  5EYL A;  4N5Q A;  4HRN A;  1WG0 A;  3JXI A;  4CYM D;  4O1P A;  4B93 B;  5HKP A;  3TWV A;  4Z68 A;  4HBD A;  1K1B A;  4K5C A;  1S70 B;  2XZT G;  1UOH A;  3SO8 A;  4DRX E;  2NYJ A;  2A5E A;  4U96 D;  5AAR A;  3V31 A;  1TR4 A;  3Q9N C;  3B95 A;  4HRM B;  4QFV A;  3W9G A;  5CEA A;  3ZU7 B;  1SVX A;  3EU9 A;  4BES A;  1IKN D;  4K5A B;  4O1O A;  2V4H C;  3C5R A;  3UTM A;  3JUE A;  3UI2 A;  4JB8 P;  5D66 A;  2B0O E;  1SW6 A;  1YMP A;  2ETB A;  3IXE A;  2VGE A;  3AJI A;  5CED B;  4A63 B;  5KBA A;  4BEP A;  4F6R D;  5CBN A;  3Q9U C;  4G8L A;  1MX4 A;  3B7B A;  2XEN A;  4QQI A;  2DWZ A;  3EHQ A;  3TWS A;  2Y1L E;  3DEO A;  1DC2 A;  3AAA C;  1K1A A;  1A5E A;  5ENP D;  5AQ9 A;  5CEC B;  4DX2 A;  1IXV A;  5AN8 A;  1WDY A;  3T8K A;  1BI7 B;  1N0Q A;  3JXJ A;  3T9K A;  4BER A;  2ETA A;  1AWC B;  3J5Q B;  3ZNG A;  5JA4 D;  4RLY A;  1BI8 B;  5AQB A;  4J7W A;  4U8Y D;  5HS0 A;  1YCS B;  2PNN A;  5KWD A;  3V2X A;  1BU9 A;  2F8Y A;  2L6B A;  1NFI E;  5ENO D;  3HG0 D;  5ENS D;  3TWX A;  4UUC A;  2KXP C;  5EIL A;  4G8K A;  4LSZ E;  2BKG A;  2DVW A;  1MX2 A;  2F37 A;  2QYJ A;  2KBX A;  1QYM A;  3TWT A;  3TWQ A;  5EIB E;  4J8Y A;  5BXO A;  3NOG D;  1DCQ A;  4OAU C;  5CBO A;  4HI9 A;  3NOC D;  5EID A;  2Y0B G;  4ZFH A;  2MYO A;  3LJN A;  2FO1 E;  2BKK B;  4HI8 A;  2RFA A;  4YDY A; 
#chains in the Genus database with same CATH topology
 4MRU A;  2CHZ A;  2WMN A;  4JA7 A;  4ILG A;  3G2W A;  3O48 A;  3PUJ A;  4JXT A;  5CCM A;  2VJ8 A;  1Z5S C;  1E7V A;  3VLD A;  3UPV A;  1OCZ E;  4BX8 A;  4UI9 K;  2J9Q A;  5BUZ A;  4DX6 D;  5EYP F;  1N94 A;  3G2S A;  3TXM A;  2CG2 A;  4K0R A;  4NIK A;  1TYQ G;  4GMR A;  3LS8 A;  4BX9 A;  3MV2 B;  4O1P A;  3PZD A;  2A4Z A;  4WWO A;  1S70 B;  4DRX E;  5LOZ A;  4WNG A;  1DNP A;  2V5F A;  4CDR A;  3EU9 A;  1KT1 A;  3Q4A B;  2GRR B;  5D66 A;  2EIM E;  5LFA A;  1PC2 A;  3APF A;  2VSY A;  2XEN A;  2OEV A;  5BV0 A;  2HYZ A;  1UN8 A;  1WAO 1;  2PQN A;  3L08 A;  1FPP A;  3T9K A;  3RU0 A;  4OVV A;  2NC9 A;  4WWN A;  2F8Y A;  2NSZ A;  3FU0 A;  1O1R A;  1MX2 A;  4TXP A;  3NOG D;  3ZVV A;  1DCQ A;  1IHG A;  2Y0B G;  3B7T A;  4ANX A;  5E75 A;  4OVU A;  4JD2 G;  5ENN A;  1BD8 A;  4YDE A;  3KEA A;  4U8V D;  4Q94 A;  4KVO A;  3TL5 A;  1SA5 A;  1N0R A;  4A3T A;  4EZL A;  2XGM A;  4LCT A;  2VGY A;  5G55 A;  3MGB A;  1S0P A;  4F53 A;  4N39 A;  3PZ4 A;  4L9P A;  3PZ3 A;  5ARF A;  3SBS A;  4F7A A;  4HRL A;  4JVS A;  5EYL A;  4KYO B;  3OXL A;  5D0Q D;  2M63 A;  4ANW A;  4HOQ A;  1K1B A;  2EIL E;  4C0E A;  1IQU A;  2XRZ A;  3D9K A;  3Q9N C;  2VTB A;  3S2A A;  5CMY A;  3UI2 A;  3VTX A;  3CVP A;  3ASG A;  4DLO A;  4DI3 A;  2XPZ A;  3Q9U C;  3DSS A;  2DWZ A;  4GTQ A;  3JUI A;  5AN8 A;  3Q79 A;  5JJ6 A;  2KM4 A;  3VLE A;  2P9P G;  3ASO E;  3DST A;  2X6K A;  2J09 A;  4GTS A;  2WQ6 A;  2KXP C;  2CHW A;  1JPL A;  3JQ0 A;  5AJD A;  4EQF A;  5B1A E;  5LX8 A;  3UM0 A;  4APO A;  4CT0 A;  2XPI A;  1E8Y A;  2X6J A;  4HB5 A;  5EKQ D;  3LYA A;  1OWN A;  3LVR E;  2YHE A;  3D9P A;  3QB2 A;  5B1B E;  4U07 A;  2HE0 A;  3PDN A;  5G05 C;  2UWJ G;  2KCL A;  2XCC A;  5HRY A;  3SY2 A;  3FHE A;  3ZHE A;  4GCO A;  1NL4 A;  4DX7 D;  1FT2 A;  3CHP A;  4U63 A;  3OTN A;  3CST A;  4LUN U;  5AIJ A;  3FH5 A;  4KVM A;  5KNG A;  4LG6 A;  5DIZ A;  3ZEF A;  1S64 A;  4CYM D;  3HVE A;  3FUL A;  3ZRH A;  4GTP A;  2XZT G;  3CVV A;  1P5Q A;  5FZQ A;  2VQ2 A;  5FQ8 A;  4K5A B;  4W9R A;  3JUE A;  2OOE A;  1MZC A;  3DXK G;  3PNL B;  4FHJ A;  4AVX A;  2R02 A;  4M3O A;  4F6R D;  5CBN A;  1MX4 A;  4QQI A;  3RRU A;  2Y1L E;  3CEQ A;  2HO1 A;  2VSN A;  3BG0 B;  3S7D A;  5FT9 A;  4XEI G;  1BI7 B;  3AG1 E;  2UY1 A;  3CGH A;  3FUM A;  3HHM A;  3CVY A;  2LSU A;  4ILH B;  4D10 C;  1HFA A;  3D9O A;  1TNB A;  4N5C A;  1TNO A;  3UT8 A;  3P2B A;  4NQ0 A;  2BUG A;  4J8Y A;  5DBK A;  3CVQ A;  3ZYK A;  1H19 A;  4BTA A;  3ZPJ A;  2WXH A;  1NZN A;  5ITZ F;  3NBN B;  4UQZ A;  5B3S E;  2FEZ A;  3I5P A;  4FAD A;  4GZ3 A;  4YVQ C;  2RFM A;  2QC9 A;  3L17 A;  3R7Q A;  3UUX A;  1OWL A;  4U8H A;  3R9A B;  4OAV B;  1UW4 B;  3HXD A;  4DUI A;  3BG1 B;  5CRU A;  3CHO A;  3PEU B;  2J8S D;  3Q49 B;  4N2Q A;  2B6C A;  5D2M C;  4ZHB A;  3RSE G;  3JYS A;  3E33 A;  5CCL A;  3JXI A;  2J4D A;  4OYS A;  3FUD A;  3MCX A;  4DK5 A;  2R5S A;  3MKQ B;  4NUR A;  4U96 D;  4BWR A;  3UTM A;  1U2V G;  3HYM B;  3GZ2 A;  3AS5 A;  4GTM A;  2OVB A;  1IXV A;  1H6P A;  3C3O A;  1BI8 B;  3X2Q E;  1O1T A;  2AXU A;  2J07 A;  4I6J A;  4N3B A;  2QZA A;  2QYU A;  2VGX B;  3UM3 A;  3DSW A;  5EIL A;  1X5B A;  1OUV A;  3R7R A;  3CR3 A;  4DJA A;  2XGS A;  3ABL E;  3ML8 A;  1WM5 A;  4YDY A;  2OEW A;  5A6C A;  4C48 B;  2P9I G;  1A17 A;  3CVW A;  1H2V C;  1IHB A;  2XZD G;  4FU3 A;  5BW8 C;  4NRH B;  4HNA D;  4RQI A;  1FCH A;  1D9S A;  1OCC E;  4KZ0 A;  3ZXS A;  3LY8 A;  3TG4 A;  4WWP A;  4HFG A;  2LNI A;  3CVL A;  2OVF A;  1HZ4 A;  4UI9 C;  3SQV A;  4FA6 A;  4AOF A;  4I6E A;  4IUL A;  1WG0 A;  4AY5 A;  3G2T A;  4E6H A;  3SO8 A;  3ONL A;  3Q75 A;  3CQG B;  3B95 A;  5LP0 A;  4GYW A;  2A5U A;  5JJT A;  4G25 A;  3UIP C;  2WXJ A;  3ABM E;  5FTP A;  2ETB A;  3IXE A;  4GB9 A;  1JWF A;  2C0L A;  1PY1 A;  2GW1 A;  3QOU A;  3SBT B;  3TG5 A;  5JA4 D;  1Z3X A;  2LO6 A;  3FUH A;  2LUH A;  3NB2 A;  3V2X A;  3LCA A;  4IN3 B;  3FU3 A;  2LAI A;  4WUY A;  4F1S A;  4U0S A;  2KBX A;  4UWH A;  3T5V A;  3Q7A A;  3L22 A;  3HDX A;  4UWK A;  4RG6 A;  1Z3Y A;  2CHX A;  2F8X K;  4B8A A;  3FWV A;  3CHM A;  3ZN3 A;  1JWG A;  4MS6 A;  4GAA A;  2ZGD A;  2XEH A;  2KCV A;  4RSY A;  4LNB A;  2WQH A;  4AJW A;  3UXG A;  1D8D A;  2KZT A;  5AQ7 A;  2I1J A;  4WAF A;  5J08 A;  3U3W A;  1AP7 A;  3CK7 A;  1BPO A;  4TUU A;  1ELR A;  3LJ3 A;  1Z6T A;  1OWP A;  4KBQ A;  3QNK A;  3UKR G;  3S7J A;  3PEV B;  1N9A A;  1K8K G;  2PZI A;  1FT1 A;  2B0O E;  2JEK A;  4AIF A;  3T5X A;  1OCO E;  2JLB A;  4B0Z A;  1ZB1 A;  1DC2 A;  4J8D A;  4CCA A;  2EIJ E;  2GRN B;  2XS8 A;  3KS2 A;  3JXJ A;  2E0I A;  2YHC A;  4GCN A;  2PNN A;  2F0Y A;  3D9M A;  3EIQ C;  3UMV A;  2Y69 E;  4MKT A;  1SQM A;  1E90 A;  5JJ7 A;  2DVW A;  2F37 A;  2ION A;  4TXR A;  3TWQ A;  3FUE A;  4C9B B;  3DSV A;  2KCK A;  4OAU C;  4G23 A;  4DI4 A;  4KMO A;  3UIN C;  3IEG A;  3QAQ A;  2RFA A;  2WXI A;  4Y6C A;  3IV0 A;  4GTR A;  3MYV A;  5EDS A;  2YQ8 A;  3CV0 A;  3Q7F A;  4G11 A;  4CDM A;  4L23 A;  3ULY A;  5IY5 E;  1EYH A;  3CSF A;  5AAO A;  3D9L A;  1SZ9 A;  3ZFW A;  3D9N A;  2X6F A;  2IFU A;  5G04 C;  1N11 A;  3HXE A;  2PL2 A;  3ZKJ A;  4HLL A;  3UM1 A;  3ASN E;  2DBA A;  3DXM G;  4EEC A;  4HRN A;  3B13 A;  3QAR A;  1UOH A;  4LRZ A;  2IO2 C;  1HXI A;  3MV3 B;  3U9W A;  3IKO B;  3OAW A;  3SNX A;  3L13 A;  3SFY A;  5BV1 A;  3TGO A;  3PRE A;  1E8W A;  3FY4 A;  2I9C A;  4GA0 A;  3AU5 A;  1FVH A;  3E34 A;  4BER A;  2WXQ A;  1UJJ A;  4RLY A;  4JZY A;  3D9J A;  4JHK A;  3SFZ A;  3UT4 A;  3DSU A;  3LXU X;  4HXI A;  1QYM A;  2IO3 C;  1D8E A;  2KAT A;  4ZFH A;  3Q78 A;  2FO1 E;  1KPS B;  3EHR A;  3LKU A;  2V4L A;  3CHR A;  4JL0 A;  4PH4 B;  2GRP B;  2CFU A;  4CGV A;  3UQ3 A;  1YA0 A;  3J5P A;  5ENQ D;  4V3I A;  1OXJ A;  3VTY A;  5KJN A;  3HRA A;  5CHE E;  2CG3 A;  4K5B A;  3E30 A;  4PS7 A;  1MJ0 A;  4U7E B;  2ETC A;  4EZK A;  5ENT D;  1JCR A;  1OWM A;  4BET A;  2WXL A;  4XKB A;  2IJG X;  4N5Q A;  1ELK A;  4GTT A;  3CVX A;  2FI7 A;  2L9B A;  2Y4U A;  4HBD A;  3FH8 A;  2VSO E;  2DCP A;  5JHA A;  4I2Z A;  4M7C A;  5JHB A;  4LNG A;  5E76 A;  2CFZ A;  4GZC A;  3LY9 A;  1HX8 A;  2IF4 A;  5BNW A;  3CVN A;  5CED B;  3ZYQ A;  3EHQ A;  1NA0 A;  3FDH A;  3NAW A;  3FTV A;  3UT7 A;  5CRV A;  4EZJ A;  4CGW A;  3EHM A;  2WXR A;  1U3D A;  5HS0 A;  4U8Y D;  3I4G A;  3EUV A;  1TN7 A;  2L6B A;  3ZYL A;  2OND A;  4P29 A;  3ASF A;  4U0U A;  3L54 A;  1IYG A;  4GTV A;  2LAH A;  3PE4 A;  1QQE A;  2DYR E;  1VDY A;  1OY3 D;  4EHM A;  5KNH D;  5ENR D;  2V5Q C;  1FVF A;  2V0P A;  4UI9 J;  1JUQ A;  3ZUV B;  4GU5 A;  2R59 A;  2P9L G;  3IBE A;  3OXG A;  3DEP A;  2DZN A;  3AS4 A;  3SGH A;  4AEZ C;  4ANU A;  2XEE A;  3B7S A;  3CK9 A;  3MX3 A;  3FTZ A;  4J6I A;  2L6J A;  3E32 A;  3ASH A;  4N3A A;  1XNF A;  4E85 A;  3SI5 A;  1K3Z D;  2X6I A;  3R9M A;  4JW1 A;  3TWR A;  4BT8 A;  1MHQ A;  1TNU A;  5KJK A;  3KSQ A;  2J08 A;  4Z68 A;  1MQS A;  2XHE A;  5EX3 A;  5AYW D;  1E7U A;  2IU1 A;  2A5E A;  3RRN B;  3V31 A;  1N4R A;  2QFC A;  3FTX A;  4GYO A;  4ATG A;  4YVO A;  2H6G A;  2X3M A;  3RAU A;  3HXB A;  4DX2 A;  2P9S G;  1N0Q A;  3MZL B;  2R05 A;  5H7P A;  3NZU A;  4WNF A;  3ONK A;  4GTO A;  4HI9 A;  3CHS A;  4U04 A;  2WM9 A;  2R03 A;  2XRY A;  5LCW C;  2P58 C;  2GRL A;  2PM7 A;  2XCB A;  2WXP A;  2L0I A;  4CZ2 D;  2Y4T A;  3Q15 A;  2VSX E;  3ESL A;  3QWW A;  3D9H A;  4EBA A;  4X8Q A;  1DCE A;  1UG3 A;  3CQC B;  2VYI A;  2P2C P;  4ANV A;  1TNZ A;  1EDU A;  3KD7 A;  3ENE A;  2WQ7 A;  1N4P A;  5AJL A;  4A1S A;  4I2W A;  1L5J A;  3GZ1 A;  2X38 A;  4LEU A;  2BTD A;  2HM8 A;  3CKB A;  2GRM A;  3ZGQ A;  1NI1 A;  4XZ4 A;  4CEM A;  5KJM A;  3C72 A;  4QFV A;  1NA3 A;  4J8S A;  2DIW A;  2Q7F A;  3EDT B;  4C0M A;  4I6G A;  4URK A;  1HE8 A;  2QY7 A;  1HU3 A;  4GA1 A;  3PNT B;  5T4Y A;  3CKC A;  4UWF A;  1A5E A;  3SF4 A;  5BPP A;  2E2E A;  4K03 A;  3ABK E;  2PM6 A;  3G2U A;  2WB2 A;  4UWG A;  3L82 A;  4J7W A;  3MKQ A;  4FUL A;  4L1B A;  4G26 A;  3LY7 A;  2WXN A;  4JEU A;  3DRA A;  2IOL A;  4GZ5 A;  3ESK A;  2RD0 A;  3APC A;  5BXO A;  1GW6 A;  4HOU A;  2P9U G;  4JC8 A;  4I9C A;  4I1A A;  5G04 J;  2MYO A;  4WND A;  3IHV A;  5HQ8 A;  2Y3A A;  3URZ A;  4HVB A;  4XKC A;  5FIN A;  1MYO A;  3ASD A;  3N71 A;  2FO7 A;  3FEX A;  2AJA A;  4BT9 A;  2VGX A;  1LTX A;  1OCR E;  2DYS E;  4Q96 A;  4PDX A;  2AWI A;  4GZ6 A;  3RIB A;  3U66 A;  4CRW A;  3OXF A;  1KT0 A;  3O4Z A;  3CHQ A;  3WXX A;  2GRO B;  2MRI A;  3AG3 E;  2NYJ A;  4EBA G;  3W9G A;  1LD8 A;  3RO2 A;  2R17 C;  1SVX A;  3LDZ A;  4KT6 B;  3HXC A;  3MEK A;  4RG9 A;  5FQ4 A;  1HF8 A;  3BQO A;  3ISM C;  4XIF A;  5T8I A;  2I6H A;  3CVU A;  4I1M A;  3E37 A;  5CEC B;  4IYP A;  4Y6W A;  2OCC E;  2ETA A;  3ZNG A;  1O1S A;  1XGW A;  2BF0 X;  4BTB A;  5ENS D;  4GML A;  3TWX A;  4GA2 A;  4MBG A;  1KZP A;  1N54 A;  3MKR A;  2QYJ A;  3PUK A;  4A3V A;  3VLF A;  4TV3 A;  3CK8 A;  4NAC A;  3TAX A;  3DPY A;  3LJN A;  4HI8 A;  4HOT A;  3PE3 A;  5A7D B;  3SHF A;  2YIN A;  3LEW A;  3DPD A;  3ULQ A;  2GGF A;  2ZGG A;  4TXQ A;  3L16 A;  1BLX B;  3PS6 A;  3S7F A;  4AM9 A;  5G05 J;  3DWL G;  1H0A A;  4JHR A;  4XE0 A;  3TWW A;  3F6Q A;  5G2N A;  2VTB B;  2EQX A;  4BSZ B;  3FUI A;  3V30 A;  2ZU6 B;  4YDW A;  1UN9 A;  1PAQ A;  2WXO A;  4AP2 A;  3I3N A;  4HQD A;  4G1T A;  2WXK A;  3C3Q A;  1EPU A;  3T8M A;  3TWV A;  5HKP A;  4GPK A;  3HXF A;  1Y8M A;  3QWP A;  2H6H A;  3RO3 A;  3C98 A;  1TR4 A;  5CEA A;  2BED A;  4G2V A;  1U3C A;  2RG8 A;  4I17 A;  4LER A;  3KEZ A;  4A63 B;  3E4B A;  3QJZ A;  4L2L A;  1N4Q A;  2ZXW E;  1INZ A;  4HOR A;  3PZ1 A;  5ANL A;  5M72 A;  3T8K A;  3AG4 E;  1O5M A;  1TN8 A;  1AWC B;  3J5Q B;  3ZYM A;  1HO8 A;  5AQB A;  3APD A;  3RJV A;  1BU9 A;  2OV8 A;  3ZHE B;  2BKG A;  4J8E A;  4Q69 A;  3QK0 A;  2WVI A;  5HI7 A;  2P9K G;  2FUL A;  3CLJ A;  3KAE A;  3AU4 A;  2WXM A;  5CER B;  4DX5 D;  2I2O A;  3HVE B;  3B7R L;  3L6A A;  3UKU G;  5FQ6 A;  1H6K A;  1HS6 A;  5T3R A;  1H2T C;  4FJY A;  4GYY A;  1HH8 A;  5JMN D;  2DZO A;  3LPZ A;  3RKV A;  2L0T B;  1OT8 A;  2XEV A;  2IOS A;  3ML9 A;  2JAB A;  5J90 A;  5FJY A;  5ARG A;  4BY6 A;  2V8S E;  1ZU2 A;  3FH7 A;  4RVB A;  4N3C A;  2UY1 B;  3BUA A;  4JHJ A;  1E8X A;  1V54 E;  3KSL A;  1HG2 A;  5AAR A;  2WXG A;  4XI9 A;  3Q47 B;  4N2S A;  3FUN A;  1E96 B;  4O1O A;  4PS3 A;  1SA4 A;  1SW6 A;  4WNE A;  4G8L A;  2GRQ B;  2LSV A;  3D3M A;  5ENP D;  5LCW J;  2IY0 C;  4CT4 A;  1YCS B;  3G2V A;  3BU8 A;  5KWD A;  3UIO C;  4G24 A;  3DSX A;  1NFI E;  1W3B A;  5A23 A;  3JQ1 A;  4G8K A;  5D0O D;  3RRM B;  3NOC D;  2H6F A;  2P9N G;  1S63 A;  2XQ0 A;  3BEE A;  4DX1 A;  3SFX A;  4GPM A;  1IQR A;  4H7Y A;  2AW6 A;  2EIK E;  2C2L A;  3QKY A;  3TWU A;  3SD5 A;  3FU6 A;  3PH0 C;  5BXU A;  1JCS A;  1TNY A;  3U4T A;  3FEY A;  4LNU D;  4APF A;  3NQP A;  4YND A;  3Q5M A;  4U95 D;  3FUF A;  3UX4 A;  3ZIM A;  1RW2 A;  4AV7 A;  1LF8 A;  1LD7 A;  3EHN A;  4B93 B;  2HR2 A;  2C0M A;  2IQC A;  2NXP A;  3AG2 E;  5KCM A;  3ZU7 B;  4BES A;  1IKN D;  3FTY A;  1TJF A;  3U64 A;  3EIJ A;  1YMP A;  2WMO A;  4J8F A;  3B7B A;  3SZ7 A;  2LXM A;  3FFL A;  2PQR A;  4XI0 A;  3AAA C;  1UJK A;  4KZC A;  1KLX A;  2MOW A;  1QZ2 A;  3C3R A;  3GYZ A;  4L2Y A;  1RZ4 A;  4AY6 A;  3FTW A;  5ENO D;  4FLB A;  4U0Z A;  4UUC A;  2J4B A;  3NZS A;  4O6F A;  2XS1 A;  1TJC A;  5EIB E;  5KJL A;  2XGO A;  1V55 E;  4PS8 A;  3RK6 A;  3GZS A;  4BFR A;  2BKK B;  3WG7 E;  1Y6I A;  4GMJ A;  1DVP A;  4R7L A;  3W9F A;  1HG5 A;  1N52 A;  3B7U X;  3QDN A;  1G3N B;  3ULE G;  2MHK A;  1JCQ A;  1X81 A;  4ATZ D;  1H6O A;  2RKK A;  4A1G A;  1MX6 A;  4TUM A;  2FF4 A;  1TEZ A;  3HIZ A;  3P1U A;  3V79 K;  4HLE A;  4HOS A;  5AQA A;  4O60 A;  4I1O B;  3TXN A;  2FBN A;  2ZIS A;  3QC1 A;  3TJP A;  4K5C A;  1N95 A;  1H2U A;  4UWL A;  4B94 A;  1QBQ A;  4HRM B;  4FJZ A;  3FTS A;  2X6H A;  2V4H C;  4JB8 P;  4ABN A;  1SZA A;  2VGE A;  3AJI A;  5C1D A;  3ZW3 A;  5ANR A;  2EIN E;  3TWS A;  3PRZ A;  3DEO A;  3I4R B;  4DPR A;  1K1A A;  4JA9 A;  3NF1 A;  1WY6 A;  1WDY A;  5BT1 A;  1QNF A;  5FZR A;  4GZD A;  3ZXP A;  4CDN A;  2YNQ A;  2J49 A;  3HG0 D;  4DLQ A;  4FLH A;  2WPV A;  4L7T A;  4I43 A;  3TWT A;  4ACK A;  4FC8 A;  4IRU A;  2AXZ A;  2KZT B;  3MJW A;  1E8Z A;  1EF1 C;  3DBS A;  5EN5 D;  5EX0 A;  5FWQ A;  4ACL A;  3FUJ A;  4UQX A;  5AEN A;  3FU5 A;  1YYH A;  3PVL A;  3S7B A;  4KXK B;  4A55 A;  4J0U A;  5FZS A;  2IEJ A;  4B8C B;  3UM2 A;  2AVP A;  1ZBP A;  4TRQ A;  4F1P A;  4ILI A;  5FIO A;  3V2O A;  3EJN A;  4BSX A;  4JPS A;  1Q2Z A;  3IHY A;  4UQY A;  4I9E A;  4HS2 A;  4XX5 A;  1KZO A;  3MA5 A;  4EPZ A;  2WXF A;  4F3V A;  3PZ2 A;  3AS8 A;  3GW4 A;  3Q73 A;  1OWO A;  1B89 A;  2H6I A;  2I1K A;  4H7X A;  3QWV A;  5C2Y A;  2KC7 A;  1N4S A;  3C5R A;  3D9I A;  2XPY A;  1TN6 A;  2R2L A;  5KBA A;  4FHK A;  4BEP A;  5CMW A;  2ZIR A;  4MLP A;  1ELW A;  5AQ9 A;  3L9T A;  3LVQ E;  4PUC A;  5FQ7 A;  3FTU A;  4FP7 A;  3FUK A;  1NP7 A;  3K9I A;  4YDO A;  3FP3 A;  4AXH A;  2LXL A;  4LSZ E;  4JEH A;  3JCK C;  3CIA A;  2AXV A;  5CBO A;  5EID A;  4B89 A;  4ME2 A;  2ILR A;  3EU5 A; 
#chains in the Genus database with same CATH homology
 5ITZ F;  3NBN B;  4CZ2 D;  5EN5 D;  3EHR A;  1OY3 D;  5KNH D;  5ENR D;  4DX5 D;  4C48 B;  5CER B;  2F8X K;  2V5Q C;  4HB5 A;  1BD8 A;  1IHB A;  4DX1 A;  4GPM A;  3W9F A;  3ZUV B;  2XZD G;  3D9H A;  5FIN A;  1MYO A;  3KEA A;  2ZGD A;  2ZGG A;  1BLX B;  2HE0 A;  2XEH A;  1G3N B;  2DZN A;  2QC9 A;  2RFM A;  3DEP A;  4HNA D;  3J5P A;  3TWU A;  5ENQ D;  2P2C P;  4U8V D;  5JMN D;  4OAV B;  1D9S A;  5AAO A;  1YYH A;  2AJA A;  2DZO A;  2XEE A;  3TWW A;  3F6Q A;  5HRY A;  5BXU A;  4BSZ B;  4DUI A;  1N0R A;  1OT8 A;  4F1P A;  3HRA A;  3V30 A;  3UXG A;  1N11 A;  4K5B A;  4ATZ D;  5FIO A;  4YDW A;  4LNU D;  3V2O A;  2JAB A;  4DX6 D;  4DX7 D;  1MX6 A;  4TUM A;  1K3Z D;  1MJ0 A;  2J8S D;  5EYP F;  5AQ7 A;  3TWR A;  2ETC A;  4ZHB A;  3V79 K;  4HQD A;  4NIK A;  5ENT D;  4HLL A;  5AQA A;  4O60 A;  3ZKJ A;  4U95 D;  4GMR A;  4HRL A;  5KNG A;  4BET A;  4LG6 A;  1AP7 A;  5EYL A;  4N5Q A;  4HRN A;  1WG0 A;  3JXI A;  4CYM D;  4O1P A;  4B93 B;  5HKP A;  3TWV A;  4Z68 A;  4HBD A;  1K1B A;  4K5C A;  1S70 B;  2XZT G;  1UOH A;  3SO8 A;  4DRX E;  2NYJ A;  2A5E A;  4U96 D;  5AAR A;  3V31 A;  1TR4 A;  3Q9N C;  3B95 A;  4HRM B;  4QFV A;  3W9G A;  5CEA A;  3ZU7 B;  1SVX A;  3EU9 A;  4BES A;  1IKN D;  4K5A B;  4O1O A;  2V4H C;  3C5R A;  3UTM A;  3JUE A;  3UI2 A;  4JB8 P;  5D66 A;  2B0O E;  1SW6 A;  1YMP A;  2ETB A;  3IXE A;  2VGE A;  3AJI A;  5CED B;  4A63 B;  5KBA A;  4BEP A;  4F6R D;  5CBN A;  3Q9U C;  4G8L A;  1MX4 A;  3B7B A;  2XEN A;  4QQI A;  2DWZ A;  3EHQ A;  3TWS A;  2Y1L E;  3DEO A;  1DC2 A;  3AAA C;  1K1A A;  1A5E A;  5ENP D;  5AQ9 A;  5CEC B;  4DX2 A;  1IXV A;  5AN8 A;  1WDY A;  3T8K A;  1BI7 B;  1N0Q A;  3JXJ A;  3T9K A;  4BER A;  2ETA A;  1AWC B;  3J5Q B;  3ZNG A;  5JA4 D;  4RLY A;  1BI8 B;  5AQB A;  4J7W A;  4U8Y D;  5HS0 A;  1YCS B;  2PNN A;  5KWD A;  3V2X A;  1BU9 A;  2F8Y A;  2L6B A;  1NFI E;  5ENO D;  3HG0 D;  5ENS D;  3TWX A;  4UUC A;  2KXP C;  5EIL A;  4G8K A;  4LSZ E;  2BKG A;  2DVW A;  1MX2 A;  2F37 A;  2QYJ A;  2KBX A;  1QYM A;  3TWT A;  3TWQ A;  5EIB E;  4J8Y A;  5BXO A;  3NOG D;  1DCQ A;  4OAU C;  5CBO A;  4HI9 A;  3NOC D;  5EID A;  2Y0B G;  4ZFH A;  2MYO A;  3LJN A;  2FO1 E;  2BKK B;  4HI8 A;  2RFA A;  4YDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...