4IN3B

Crystal structure of the chs5-bch1 exomer cargo adaptor complex
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
721
structure length
589
Chain Sequence
LSQTSIPEVKEDVIGYALHQRRARVGQFQDLGPPDLITFFYCMGIDTSDPTSITIFAKKITDLFISISSWNAFRKYDVNIIVVQTYIINSDGEQSQLPLNVNMIWAETFMSGIVRDIMIMKDNRADGESQNLVETLIFNPFTSGELEDVANNFIKLFPLVYEKGVYLDAPTHVLNPSLTNNYLVETLVEIVRLTKSLEACRKMLKKLIEIHPEAVIILIRVYFACDLEIDAVDLINEQLNSPSSFLADDSKTSHIQLIFKSELLSIQSEFLLDVKRDYKLAKEVAMEAVNCAPNEFKTWYLLTRIYIKLNDMSNALLSLNACPMSQVKEKYVLRRIAPINLHLPLPLDNPMDVQLEQKSADPNLVNLSASSLKSTFQLAYKLLTEIVQITGWEQLLKYRSKIFVSKRLCERWLDNLFMLLYEDLKTYTDWQSEQLYFDAQHKLTVEWELFGLCAKRLGHLPEAAKAFQIGLSQRFSPVCAKNLLQFYIDEHKRIRRDSVSSELTSSQILSSINDIDSSIIDLVVKICCWNHRWYIEFSIILIDALSVAVQDMGITKVHNEIASRFSDPVAQLIDDNILNFLKNFTNDTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitin biosynthesis protein CHS5
publication title The exomer cargo adaptor features a flexible hinge domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 183
structure length 589
sequence length 721
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09295 ChAPs ChAPs (Chs5p-Arf1p-binding proteins)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4in3B00
2WPVA 1KT1A 2FBNA 5LCWJ 1QZ2A 4HOSA 2VYIA 1KLXA 4AY5A 1XNFA 2XPIA 4GCNA 4I9CA 2Q7FA 3QWPA 2FF4A 1OUVA 2Y4TA 4JHRA 3EDTB 3TG4A 2JLBA 5CCMA 4GA1A 3U4TA 2KCVA 1YA0A 4B94A 4GYOA 1ZU2A 2IF4A 2XGMA 3LY8A 4GZ3A 5M72A 4APOA 5LCWC 5D0OD 3SZ7A 3IEGA 3LYAA 2UWJG 4NQ0A 2MHKA 3Q4AB 5CHEE 3VTXA 3CK9A 4WUYA 4N2QA 4RG6A 4N3BA 3Q47B 5AYWD 4UI9K 4N3CA 4IN3B 3GZ2A 4U0UA 3ZGQA 3OXGA 4KBQA 4HOQA 2YQ8A 3CVLA 4J8DA 4UQYA 4G2VA 3CEQA 2C0MA 4ME2A 2KATA 5KJLA 3U3WA 1ZBPA 3MEKA 3RO3A 4HOTA 4G25A 2PL2A 4U0SA 5C1DA 2FEZA 3MV3B 4HOUA 5HI7A 2DBAA 2LNIA 3AS5A 1KT0A 4CDRA 3HYMB 4XI0A 4N2SA 5HQ8A 2VGXB 3CVQA 3FFLA 5ARGA 2KCLA 3AS4A 3OXFA 4I2ZA 2VQ2A 3QKYA 2Y4UA 4N5CA 3ZFWA 4YVOA 5BT1A 3Q49B 3TAXA 4H7XA 3RO2A 4CGWA 1E96B 3UUXA 2HR2A 3LY7A 1NA0A 3JYSA 1ELRA 3Q15A 5JJ6A 5EX3A 4JA9A 2V5FA 4J8EA 3AS8A 4BT9A 2IFUA 1WAO1 2OOEA 1B89A 4G26A 5BNWA 3CVPA 3LY9A 3K9IA 2QFCA 2YHCA 3O48A 3CKCA 5CCLA 4O6FA 2AVPA 3ZPJA 4U04A 2WQHA 3S7DA 4UI9C 3KD7A 5DBKA 3QOUA 2XEVA 1HXIA 2PZIA 1IHGA 2I6HA 1W3BA 5KJKA 3ULQA 3VTYA 4XIFA 4A1SA 3BEEA 3UPVA 3S7BA 3GZ1A 3S7FA 2C2LA 4KYOB 3WXXA 3ASFA 5FZRA 4Y6WA 5G04J 3CV0A 1ELWA 2PQNA 4XI9A 5KJMA 4H7YA 4KXKB 3ZN3A 4GZ5A 1PC2A 3ASDA 2VSYA 3QDNA 4RG9A 2J9QA 1HH8A 4I1AA 4U0ZA 5JJTA 3MKRA 3ZHEB 4Y6CA 2XCCA 3ASGA 3MA5A 4GPKA 3CKBA 4J0UA 4WNGA 4BT8A 1A17A 4WNEA 4GCOA 5G04C 3GYZA 2HO1A 3N71A 5A7DB 3RKVA 3ZHEA 5DIZA 4UI9J 4JA7A 3MV2B 4AIFA 2NC9A 1P5QA 2FI7A 3OXLA 3KS2A 3FWVA 2VSNA 2VGXA 4YVQC 4N39A 2UY1B 4F3VA 2KC7A 2ONDA 3ASHA 5FZQA 3LCAA 3PDNA 3FP3A 3RJVA 2KCKA 4CGVA 1HZ4A 5G05J 4AY6A 1Y8MA 3ESKA 1TJCA 4BTAA 2UY1A 5EKQD 4I9EA 5BW8C 4J8FA 3LKUA 3QWWA 4I2WA 4GA0A 1NZNA 4G1TA 3SF4A 3NF1A 2E2EA 4WNFA 4EQFA 5A6CA 4JL0A 2GW1A 4G24A 4LEUA 2XGSA 5EX0A 4NRHB 2C0LA 5G05C 2HYZA 2BUGA 5KJNA 4U07A 4BWRA 2R5SA 4W9RA 1NA3A 5FJYA 4ABNA 4GZ6A 4I17A 2XGOA 3UQ3A 3URZA 1QQEA 4WNDA 2PQRA 4N3AA 1WM5A 3S7JA 4GYWA 3TG5A 3PE3A 3KAEA 3PE4A 3QWVA 3GW4A 3CVNA 5FT9A 4AM9A 2L6JA 4HORA 5ARFA 5JJ7A 5FZSA 3RIBA 3LPZA 1FCHA 4G23A 4UQZA 3CK7A 2FO7A 2P58C 4YNDA 4GA2A 5D0QD 3R9AB 4GYYA 2LSUA 2XCBA 3TGOA 3E4BA 2LSVA 1IYGA 3RU0A 3Q5MA 3CK8A 4BTBA 5FTPA 4UQXA 2VGYA
chains in the Genus database with same CATH superfamily
2IOSA 3VLDA 4CRWA 1QZ2A 3JXIA 5HKPA 1H6OA 4KMOA 5AQBA 3NOGD 2QZAA 3DSTA 4AJWA 2Y4TA 4CYMD 4JHRA 3TG4A 3UI2A 2L0IA 2KCVA 1H6KA 4FADA 2XRZA 5JMND 2JEKA 3Q78A 3CGHA 2CFZA 1ZU2A 3BQOA 3D9PA 5ANLA 3ASNE 3FUHA 4K0RA 5B3SE 4Q94A 4FC8A 1AWCB 3F6QA 4ANVA 2RG8A 2DWZA 2P9UG 2MHKA 2IU1A 3IHYA 1KZPA 5ITZF 4C0EA 4WUYA 4N2QA 3RK6A 1E90A 4Q69A 4IRUA 3IV0A 3EJNA 4IN3B 3GZ2A 3SQVA 3PEUB 3OXGA 1N4RA 3D3MA 5EN5D 5BXUA 2GRMA 1X81A 3ISMC 1WY6A 4UQYA 4I1MA 3SGHA 3FUEA 5J90A 4OVUA 4B8AA 4HOTA 3E37A 2ETAA 1OWNA 3DSUA 1BI8B 4HLEA 4QFVA 5C1DA 3ZKJA 3MV3B 5KBAA 1DC2A 1KT0A 4BEPA 4B93B 3SBTB 3DEOA 4J8SA 2X6JA 3EHQA 2VGXB 3FFLA 2X3MA 1YMPA 5ARGA 3JQ0A 3L16A 5A23A 5LOZA 3HXFA 3EIJA 2Y4UA 4N5CA 3FULA 2L0TB 4DX2A 2XPYA 3TAXA 5ENTD 1H2TC 3B7UX 3V2XA 2HR2A 2I9CA 2DYRE 3LY7A 4ACLA 1NA0A 3Q15A 2FULA 5JJ6A 1S70B 2XS1A 2V5FA 3PVLA 2IFUA 4BT9A 5LP0A 4YDOA 2OOEA 3PNTB 3K9IA 2YHCA 4LNUD 3CHQA 2MRIA 1OXJA 3FH5A 3I5PA 4U63A 3QARA 2AVPA 4DX7D 1INZA 4UI9C 3KD7A 1YYHA 5AARA 5CMYA 4A1GA 1W3BA 5KJKA 3ULQA 3V30A 3C3OA 5IY5E 3Q75A 4UWGA 4GAAA 3S7BA 3NAWA 4UWKA 4F7AA 3SNXA 1RW2A 3CVVA 1MX6A 1A5EA 2WXNA 4KYOB 3LXUX 3CHMA 4XZ4A 4BERA 5J08A 3HDXA 3WXXA 2PM6A 5G04J 4MLPA 1MX2A 2A5UA 1LTXA 1NP7A 3ZYMA 3Q79A 5KJMA 2WVIA 4O1PA 3ASDA 1OCZE 4BSZB 4U0ZA 3ZHEB 4Y6CA 5LX8A 3ASGA 3MA5A 2XZDG 2L9BA 2XEEA 1U3CA 3CKBA 2GRNB 4HI8A 4BT8A 4WNEA 2H6IA 2HO1A 2YHEA 3BG1B 3N71A 2XHEA 4HQDA 3RKVA 3IHVA 4AVXA 5EDSA 4DX1A 4UI9J 1DVPA 3PRZA 4JA7A 4FU3A 2NC9A 2WXIA 1JCQA 3OTNA 3D9HA 2VSXE 3Q7FA 3D9NA 3FHEA 3FWVA 4PH4B 5FIOA 3AG2E 1EDUA 1G3NB 2KC7A 2ONDA 4CEMA 4I43A 5FZQA 1IHBA 3LCAA 1AP7A 4Q96A 4FLBA 2J08A 2WM9A 3ESKA 3LJNA 3B7BA 3CSFA 2UY1A 3PNLB 1TR4A 4YDYA 3LKUA 3C3RA 4HXIA 3SF4A 5KNGA 4GMRA 3DXMG 4AP2A 3HIZA 4FHJA 3DEPA 1V55E 1H0AA 2WQ7A 3CR3A 3B7TA 1TNYA 3NQPA 3J5PA 2C0LA 2X6FA 1TN8A 3PUKA 3FUMA 3L6AA 3B95A 3UQ3A 2R02A 1QQEA 3SHFA 2VTBB 4N3AA 5CMWA 3TG5A 2R2LA 3CVNA 4C0MA 5FT9A 4RLYA 4AM9A 5ARFA 1X5BA 3SD5A 3ABLE 4ANXA 2CHXA 2V0PA 3I4RB 4UQZA 3CK7A 2P58C 1BI7B 3BU8A 3QC1A 4DPRA 4WWOA 2KZTB 3CQGB 4CCAA 4U7EB 3FUJA 3EU5A 1D8EA 1MX4A 4GYYA 2XCBA 1N4QA 1TYQG 4JEHA 3CK8A 4UQXA 2VGYA 4TXRA 1UN8A 3FTXA 4ZHBA 2FBNA 2XS8A 1JWFA 1YCSB 3ABKE 4AY5A 3TWWA 4TXQA 2WXRA 4I1OB 4GZDA 2WXPA 1OUVA 3EDTB 3S2AA 3U9WA 2WXLA 3HVEB 3CIAA 4HRLA 4WWNA 4EHMA 1UW4B 3DRAA 4GYOA 3QJZA 2WXMA 2DZOA 4HLLA 3R9MA 2XGMA 3LY8A 1FT2A 4APOA 5EIDA 3CVUA 3AG3E 5D0OD 3SZ7A 3IEGA 1TNOA 4HNAD 1JCRA 1UJKA 3ABME 5B1BE 3Q4AB 5CHEE 2WXGA 3SFXA 2DYSE 4RG6A 4N3BA 5AYWD 3SO8A 3ML8A 4TUMA 2WQ6A 4U0UA 3ZGQA 2LUHA 2YQ8A 3UX4A 3OAWA 1MYOA 3TWQA 1RZ4A 2AXZA 2VGEA 2CHZA 1PAQA 2LXMA 4GTRA 4EPZA 5CERB 2CG2A 4GTPA 4ME2A 4AEZC 3U3WA 5KJLA 2KM4A 1ZBPA 2R05A 3EUVA 5FQ6A 2J49A 3JQ1A 4U0SA 4NACA 3UM3A 3AJIA 4LG6A 4ILGA 4EBAA 2VJ8A 4LRZA 4LSZE 2ZISA 3AS5A 4RSYA 4XEIG 1D9SA 4UWLA 2Y69E 4HFGA 4XI0A 4TXPA 4QQIA 2ZGGA 3CVQA 1N94A 5JA4D 4AOFA 1K8KG 2KCLA 2AJAA 3AS4A 2EQXA 3ESLA 3QKYA 3FEYA 3ZFWA 3V31A 5T3RA 1WG0A 4Z68A 4H7XA 3HXBA 3APFA 1E96B 2F0YA 3EU9A 1UN9A 2LAIA 2DZNA 3JYSA 3UT7A 1ELRA 4UUCA 4EZKA 3AS8A 5FINA 1B89A 2H6GA 1OCCE 3CVPA 4IULA 5CECB 2QFCA 1GW6A 1UG3A 4PS8A 1S63A 4FHKA 5CCLA 4O6FA 1NFIE 1MQSA 2R59A 3P1UA 2WQHA 3S7DA 1H6PA 5ENRD 4BY6A 4U8HA 5AAOA 5DBKA 1OWPA 3ULYA 4CZ2D 3PZ3A 4KT6B 3MGBA 3UXGA 2ILRA 1JPLA 3MKQB 3ZYQA 2C2LA 1H2UA 4NURA 3FY4A 3T5VA 1BLXB 3FUKA 3B13A 4Y6WA 3CV0A 1TEZA 1Z6TA 4MBGA 2DCPA 4ANWA 3DSWA 2F8YA 4XI9A 3I3NA 4J7WA 2AW6A 1JWGA 4APFA 4JXTA 3VLFA 5C2YA 4GZCA 4RG9A 4C48B 3DPYA 3FUDA 2XCCA 2I1JA 1IKND 4GPKA 3B7SA 2IJGX 1MHQA 5CBNA 5G04C 2IY0C 2VSOE 3GYZA 4X8QA 5A7DB 2RFMA 4KVOA 2EIME 3ZHEA 3MZLB 3PH0C 4GTOA 2IO3C 2P9KG 3HG0D 3MV2B 1E7UA 1N0QA 3T8MA 2FI7A 3OXLA 3R7RA 3APDA 3ZUVB 3KS2A 3NOCD 4TUUA 1BU9A 3D9OA 3NZUA 4K5CA 3ASHA 3QAQA 3RRNB 1UOHA 2H6HA 4CGVA 3UKRG 4GTSA 2I2OA 5KCMA 2BF0X 1K1AA 2GRPB 3E30A 1Y8MA 2EILE 3FTWA 3KEZA 4BX8A 3FH7A 2DIWA 3DSSA 4K5AB 2WXJA 4J8FA 1L5JA 2XZTG 3CVXA 1NZNA 3ONLA 3NF1A 3FTUA 1E8ZA 1N52A 3RAUA 1HG2A 1SZ9A 4OVVA 4F1PA 3L08A 3ZIMA 4HI9A 1SA5A 4EQFA 4LUNU 4PS7A 2QC9A 4JL0A 2GW1A 2ZXWE 2EINE 2QYJA 4LEUA 2V4LA 2XGSA 1TNBA 2HYZA 5BPPA 4URKA 4DJAA 2OV8A 5KJNA 3FU6A 2BTDA 2R5SA 1NA3A 5FJYA 4BETA 3V2OA 1Z5SC 3ZVVA 3G2WA 3UT8A 1TNUA 4F6RD 4DK5A 5JJ7A 4G8KA 1N11A 1N4PA 2BKGA 4JZYA 1Z3YA 1HU3A 4N5QA 3L9TA 2VTBA 5HRYA 4GA2A 5ENSD 1U2VG 2HM8A 4DLQA 1N4SA 4JHKA 3JUIA 3TGOA 4L2YA 3E4BA 4L9PA 4ANUA 3AG4E 2ZGDA 3ZW3A 5FTPA 3AU5A 2KZTA 1KT1A 5LCWJ 4LNGA 2VYIA 1QYMA 3DWLG 4GCNA 5B1AE 2Q7FA 3QWPA 2FO1E 2WB2A 1V54E 5CBOA 1FVFA 2JLBA 5CCMA 4NIKA 2GRLA 3UINC 1JCSA 4KZ0A 3TXMA 2QY7A 4PDXA 3U4TA 3CHRA 1YA0A 3UKUG 2LAHA 2WXKA 3DPDA 4J6IA 1EPUA 4HB5A 3D9KA 4DUIA 2IF4A 4GZ3A 3UM2A 4WAFA 4ATGA 3W9GA 3HXCA 4I6GA 2P9LG 4LCTA 2I1KA 3G2UA 3LYAA 2UWJG 3Q73A 3VTXA 3CK9A 3Q47B 1LD7A 4UI9K 4GPMA 4N3CA 4FJYA 4HS2A 3MYVA 3BG0B 4J8DA 5AENA 3TJPA 3KSQA 2J8SD 2WXQA 3MJWA 2P9SG 2XRYA 2J4BA 4G2VA 2AXUA 2A4ZA 1H2VC 2KATA 3MEKA 4GTQA 3U64A 4DRXE 2EIKE 4ILIA 1S64A 2DVWA 2R03A 2PL2A 3L54A 1E8XA 4JEUA 5T8IA 2HE0A 1Q2ZA 5HI7A 2MOWA 1FVHA 5ENNA 3TWVA 5EYLA 4CDRA 3HYMB 3R7QA 2P2CP 5ANRA 5BV1A 4F1SA 4G11A 5HQ8A 3QK0A 2MYOA 3FU3A 4CDNA 3LDZA 3FUIA 3FTVA 3UIPC 2YNQA 4U8YD 4DI4A 2VQ2A 1MZCA 5EIBE 3EHMA 1TNZA 4YVOA 5BT1A 5EILA 3Q49B 3RO2A 4O1OA 3ZRHA 2OVFA 3L17A 4U95D 4J8YA 4BESA 4XE0A 1SQMA 5EX3A 5EYPF 4R7LA 3ENEA 3ULEG 4G26A 5BNWA 3LY9A 2R17C 3PZ4A 1BPOA 2ZIRA 2IEJA 3FDHA 4CDMA 2F8XK 5KNHD 2OEWA 2YINA 2XEVA 1HXIA 4E6HA 1WDYA 2PZIA 1IHGA 1KZOA 2V8SE 3RSEG 3ZYKA 3VTYA 4A1SA 3UPVA 3Q9NC 3CHPA 4GB9A 3LEWA 2Y0BG 1E8WA 5AN8A 1HG5A 4LNBA 2WXHA 3FUNA 1HFAA 1Y6IA 3MCXA 3ASFA 5FZRA 2WMNA 5FQ4A 4K03A 1ELWA 3FTYA 2X6HA 3RRMB 2NSZA 1N9AA 3C98A 3MKQA 3ZN3A 3EHNA 4HRMB 3L82A 2GGFA 1HH8A 2LXLA 4I1AA 3C3QA 1HE8A 5JJTA 3MKRA 3FU5A 3LS8A 4A55A 1PY1A 3SFYA 2WXFA 3Q9UC 3TWUA 4DX6D 2CFUA 4J0UA 3ONKA 3FH8A 4WNGA 3LVRE 3SI5A 1A17A 4GCOA 1HF8A 1HS6A 3CSTA 3X2QE 4GTTA 2V5QC 3QB2A 4YDWA 4OYSA 5E75A 1OY3D 4JB8P 1OT8A 4FJZA 4BSXA 3AAAC 1P5QA 2EIJE 2OEVA 4A63B 2VSNA 2VGXA 4TV3A 4N39A 1E7VA 4L2LA 1Z3XA 2A5EA 3PDNA 1O1SA 3RJVA 5ENPD 4CT4A 1HZ4A 3ML9A 5G05J 4FP7A 2WXOA 1MJ0A 1N0RA 5EKQD 2JABA 4I9EA 3DXKG 4ACKA 1O1TA 4G1TA 5AQ7A 1IQRA 3HXEA 2E2EA 3I4GA 3DSXA 3CQCB 3G2TA 2KXPC 5A6CA 4G24A 4I6EA 3UMVA 1OWMA 5G55A 5BUZA 2BUGA 4V3IA 3FU0A 4KVMA 4U07A 4A3VA 1BD8A 4UWHA 4W9RA 2RD0A 4ABNA 4GZ6A 3APCA 4WNDA 1WM5A 3QWVA 3GW4A 2L6JA 3IBEA 4MKTA 3TWXA 3PEVB 4M7CA 2J4DA 1TN6A 4EZJA 2WMOA 4GMLA 3HHMA 4YNDA 3D9IA 4XKBA 3ZYLA 2PNNA 3FEXA 1NI1A 1SA4A 5D0QD 4JW1A 1DCEA 1SW6A 5CRVA 4OAVB 3W9FA 3RU0A 1LD8A 4AV7A 3E33A 3EIQC 3Q5MA 3T5XA 4K5BA 3UM0A 2IOLA 2ETCA 4M3OA 3UTMA 1IXVA 2WPVA 1KPSB 2IQCA 4HOSA 3U66A 1KLXA 1XNFA 2XPIA 4I9CA 4JHJA 2J09A 2FF4A 3JCKC 3KSLA 4PUCA 3CVYA 4GA1A 3B7RL 4B0ZA 4B8CB 4B94A 3NBNB 4CT0A 4XX5A 5BV0A 4TRQA 1QNFA 5M72A 3UIOC 2NXPA 1N95A 2KBXA 1FT1A 5LCWC 4D10C 1S0PA 2P9NG 4NQ0A 4UWFA 2XEHA 3CHSA 2B6CA 4GU5A 4GTVA 1QBQA 1EF1C 3CVWA 2OVBA 4PS3A 1HO8A 3TWTA 4KBQA 4HOQA 3CLJA 3CVLA 2PM7A 4ZFHA 4EZLA 1XGWA 1TJFA 1ELKA 3TXNA 3Q7AA 3CEQA 1JUQA 2C0MA 4JD2G 3T9KA 4ATZD 3AU4A 2LO6A 3IXEA 5BXOA 3UM1A 5H7PA 3RO3A 4FA6A 4G25A 3HRAA 3E32A 2M63A 3ZXSA 4KZCA 3AG1E 3NZSA 2FEZA 4HOUA 2DBAA 2E0IA 2LNIA 4FULA 5FQ8A 2X6IA 4N2SA 3KEAA 1OCOE 1K1BA 1OWLA 2J07A 3L22A 5JHBA 2CHWA 3ZEFA 3C72A 3DBSA 3LJ3A 3PZ1A 3OXFA 4I2ZA 2QYUA 1LF8A 3FTZA 3L13A 3P2BA 5T4YA 4O60A 4G8LA 4CGWA 3JUEA 3UUXA 5AQAA 3WG7E 3C5RA 3TWRA 3JXJA 3EHRA 4GMJA 1IQUA 4JA9A 4J8EA 1WAO1 2P9IG 3GZSA 5ENQD 1OWOA 1FPPA 3O48A 3CKCA 2OCCE 3FUFA 3ZPJA 1DCQA 4U04A 4ILHB 3HVEA 4DI3A 4GTMA 4FLHA 3QOUA 3VLEA 2I6HA 2RKKA 1O1RA 2XPZA 5KWDA 1ZB1A 5AQ9A 2H6FA 3D9MA 4XIFA 2AXVA 3BEEA 2ETBA 3PZDA 3DSVA 4RQIA 3GZ1A 3S7FA 5CEDB 4MS6A 1NL4A 3ZNGA 4B89A 2IO2C 1SVXA 2Y3AA 1SZAA 2PQNA 1EYHA 1K3ZD 4H7YA 4KXKB 4GZ5A 3ZXPA 1PC2A 2VSYA 3SBSA 5CEAA 3QDNA 2J9QA 2BKKB 4L23A 4I6JA 5AJDA 5HS0A 1N54A 3QNKA 1TN7A 5JHAA 3SY2A 2RFAA 2V4HC 4EECA 4OAUC 5AJLA 5DIZA 4U96D 4L7TA 4JPSA 4HVBA 4U8VD 4AIFA 4HRNA 1HX8A 2X6KA 1U3DA 3NB2A 3PREA 2GRQB 4DX5D 2IONA 4YVQC 4F3VA 2UY1B 1UJJA 5ENOD 3G2VA 3PS6A 3FP3A 2KCKA 5FWQA 4JC8A 2L6BA 4AY6A 3D9LA 1TJCA 4BTAA 2P9PG 1D8DA 3TL5A 3UT4A 3V79K 3PUJA 5D66A 2F37A 1OCRE 3SFZA 5BW8C 3QWWA 4I2WA 4JVSA 4GA0A 3ZU7B 2ZU6B 4L1BA 4RVBA 3BUAA 5CRUA 4WWPA 5FQ7A 3HXDA 3MX3A 2GROB 1E8YA 4WNFA 2NYJA 2B0OE 2GRRB 1VDYA 2X38A 3FTSA 3T8KA 4MRUA 4E85A 5EX0A 3LVQE 4XKCA 4NRHB 4P29A 5G05C 2XQ0A 2BEDA 3TWSA 3RRUA 5E76A 3ASOE 4IYPA 4BWRA 2XENA 3E34A 4A3TA 5D2MC 3J5QB 2XGOA 4I17A 5G2NA 1DNPA 3URZA 2PQRA 3O4ZA 3S7JA 4GYWA 3PE3A 3KAEA 3PE4A 4F53A 4HORA 5FZSA 4YDEA 4EBAG 3RIBA 2Y1LE 3LPZA 2CG3A 1FCHA 4HBDA 4G23A 3G2SA 4BFRA 5AIJA 2FO7A 3IKOB 4LERA 4AXHA 3D9JA 3PZ2A 4C9BB 3R9AB 1H19A 2LSUA 4DLOA 2LSVA 4BX9A 2AWIA 5LFAA 1IYGA 1O5MA 3CHOA 4BTBA
chains in the Genus database with same CATH topology
1UN8A 3FTXA 4M3OA 2WPVA 2IOSA 2KZTA 3VLDA 4CRWA 1KT1A 2FBNA 5LCWJ 1QZ2A 2IQCA 4HOSA 1JWFA 2VYIA 3U66A 1KLXA 4AY5A 4KMOA 1XNFA 2XPIA 4GCNA 4I9CA 4JHJA 2Q7FA 2J09A 3QWPA 2FF4A 2WB2A 2WXRA 4I1OB 4GZDA 3JCKC 4PUCA 3CVYA 2WXPA 4AJWA 1OUVA 2Y4TA 4JHRA 3EDTB 3S2AA 3TG4A 1FVFA 2JLBA 3U9WA 3ZW3A 5CCMA 4GA1A 2GRLA 2WXLA 3B7RL 3HVEB 4KZ0A 3TXMA 4B0ZA 2L0IA 2QY7A 4PDXA 4B8CB 3U4TA 2KCVA 3CHRA 1YA0A 1H6KA 4B94A 3CIAA 4FADA 4WWNA 4CT0A 2XRZA 1UW4B 2LAHA 2WXKA 3QJZA 4GYOA 3DPDA 2WXMA 4XX5A 4J6IA 1EPUA 2JEKA 3CGHA 2CFZA 1ZU2A 3D9KA 5BV0A 2IF4A 2XGMA 3LY8A 4TRQA 4GZ3A 3D9PA 1QNFA 5M72A 5ANLA 4WAFA 4APOA 4ATGA 3CVUA 4I6GA 2NXPA 3FUHA 4K0RA 4Q94A 5LCWC 4LCTA 5D0OD 3SZ7A 3IEGA 2I1KA 4FC8A 3G2UA 4D10C 4ANVA 1S0PA 2UWJG 2RG8A 3LYAA 3IHYA 4NQ0A 2MHKA 2IU1A 4UWFA 1UJKA 3CHSA 3Q4AB 5CHEE 2WXGA 4GU5A 3VTXA 3CK9A 4C0EA 4WUYA 4N2QA 4RG6A 4N3BA 3Q47B 1E90A 5AYWD 3RK6A 4Q69A 4IRUA 4UI9K 3IV0A 1EF1C 3CVWA 2OVBA 4N3CA 3ML8A 3EJNA 4PS3A 4IN3B 3GZ2A 4FJYA 2WQ6A 1HO8A 4U0UA 3PEUB 3ZGQA 3OXGA 4KBQA 4HOQA 2YQ8A 4HS2A 3CLJA 3UX4A 3CVLA 3D3MA 3MYVA 3BG0B 4J8DA 5AENA 3OAWA 3TJPA 2GRMA 2PM7A 2WXQA 4EZLA 2AXZA 1XGWA 1TJFA 1ELKA 3MJWA 3TXNA 2CHZA 1PAQA 2XRYA 4EPZA 2J4BA 1WY6A 4UQYA 4G2VA 2CG2A 3CEQA 4I1MA 1JUQA 2AXUA 2C0MA 2A4ZA 1H2VC 3AU4A 4ME2A 4AEZC 2KATA 5KJLA 3U3WA 2KM4A 2LO6A 1ZBPA 3MEKA 3SGHA 3FUEA 3U64A 5J90A 4OVUA 3RO3A 4FA6A 4B8AA 4HOTA 4G25A 4ILIA 1OWNA 5FQ6A 2PL2A 3L54A 1E8XA 2J49A 3JQ1A 4HLEA 4JEUA 2M63A 4U0SA 3ZXSA 5T8IA 4NACA 4QFVA 4KZCA 3NZSA 5C1DA 2FEZA 4ILGA 4EBAA 3MV3B 2VJ8A 4HOUA 5HI7A 4LRZA 2DBAA 2MOWA 1FVHA 2E0IA 2LNIA 5ENNA 3AS5A 4FULA 4RSYA 1KT0A 5FQ8A 3SBTB 4CDRA 3HYMB 3R7QA 4J8SA 4UWLA 4HFGA 5ANRA 4XI0A 5BV1A 2X6IA 4N2SA 2X6JA 4F1SA 4G11A 5HQ8A 3QK0A 2VGXB 1OWLA 2J07A 3CVQA 3L22A 3FU3A 3FFLA 5JHBA 2CHWA 2X3MA 3LDZA 3FUIA 5ARGA 3JQ0A 3FTVA 3L16A 3ZEFA 2KCLA 4AOFA 5LOZA 5A23A 3DBSA 2YNQA 3AS4A 3LJ3A 2EQXA 3ESLA 4DI4A 3OXFA 4I2ZA 2VQ2A 3EIJA 3FEYA 2Y4UA 3QKYA 4N5CA 3ZFWA 3EHMA 3FULA 1LF8A 3FTZA 2L0TB 3L13A 4YVOA 5T3RA 5BT1A 3Q49B 2XPYA 3P2BA 3TAXA 4H7XA 5T4YA 3RO2A 4CGWA 1H2TC 3APFA 3B7UX 1E96B 3UUXA 3ZRHA 2HR2A 2I9CA 2OVFA 1UN9A 3L17A 3LY7A 4ACLA 2LAIA 1NA0A 3JYSA 3UT7A 1ELRA 1SQMA 4GMJA 3Q15A 2FULA 4XE0A 5JJ6A 1IQUA 5EX3A 4JA9A 2V5FA 3PVLA 4J8EA 4EZKA 3AS8A 2IFUA 4R7LA 4BT9A 5LP0A 1WAO1 3GZSA 2OOEA 3ENEA 1B89A 3PNTB 4G26A 5BNWA 3CVPA 4IULA 3LY9A 3K9IA 2R17C 2QFCA 1GW6A 2YHCA 1UG3A 4PS8A 3CHQA 2MRIA 1OWOA 3FH5A 3I5PA 3O48A 3CKCA 1BPOA 4FHKA 4U63A 5CCLA 3FUFA 3QARA 4O6FA 2AVPA 3FDHA 3ZPJA 1MQSA 2R59A 3P1UA 4U04A 2WQHA 4ILHB 4CDMA 3HVEA 3S7DA 4BY6A 4DI3A 4U8HA 4UI9C 1INZA 3KD7A 5DBKA 2YINA 4FLHA 3QOUA 2XEVA 1HXIA 3VLEA 4E6HA 1OWPA 2PZIA 1IHGA 5CMYA 2I6HA 4A1GA 2V8SE 2XPZA 1W3BA 3ZYKA 5KJKA 3ULQA 3VTYA 3D9MA 4XIFA 2AXVA 4A1SA 3BEEA 3UPVA 3CHPA 4GB9A 3PZDA 3LEWA 4UWGA 4GAAA 3S7BA 3GZ1A 4KT6B 3MGBA 2ILRA 1JPLA 3MKQB 4UWKA 1E8WA 3S7FA 3ZYQA 4F7AA 1HG5A 3SNXA 2WXHA 3FUNA 1HFAA 2C2LA 4MS6A 1H2UA 4NURA 3FY4A 3T5VA 1Y6IA 3CVVA 2WXNA 3MCXA 4KYOB 3LXUX 3CHMA 4XZ4A 4B89A 5J08A 3HDXA 3WXXA 3ASFA 2PM6A 2WMNA 3B13A 3FUKA 4K03A 3CV0A 4Y6WA 5FQ4A 2Y3AA 5FZRA 5G04J 1Z6TA 1TEZA 4MLPA 1SZAA 1ELWA 2DCPA 2PQNA 3FTYA 4ANWA 1EYHA 2X6HA 2A5UA 1NP7A 3ZYMA 4CDNA 4XI9A 3I3NA 3RRMB 5KJMA 2NSZA 4H7YA 2WVIA 4KXKB 3C98A 2AW6A 3MKQA 3ZN3A 4GZ5A 1JWGA 3EHNA 4APFA 4JXTA 3VLFA 1PC2A 3ASDA 5C2YA 2GGFA 2VSYA 3SBSA 4GZCA 3QDNA 4RG9A 2J9QA 1HH8A 4I1AA 4U0ZA 1HE8A 5JJTA 3MKRA 4L23A 3FU5A 3ZHEB 3FUDA 4Y6CA 3LS8A 4A55A 1PY1A 5LX8A 2XCCA 2WXFA 3ASGA 2I1JA 4I6JA 3MA5A 5AJDA 4GPKA 3B7SA 1N54A 2L9BA 3QNKA 2CFUA 1U3CA 3CKBA 2IJGX 1MHQA 4J0UA 3ONKA 3FH8A 4WNGA 3LVRE 3SI5A 4BT8A 1A17A 4WNEA 4GCOA 5G04C 5JHAA 2VSOE 3GYZA 1HF8A 1HS6A 2HO1A 2YHEA 3BG1B 3CSTA 4EECA 3N71A 2XHEA 5A7DB 5AJLA 3RKVA 4KVOA 3IHVA 4AVXA 5EDSA 3ZHEA 3QB2A 3MZLB 3PH0C 4OYSA 5DIZA 4UI9J 1DVPA 3PRZA 5E75A 4L7TA 4JPSA 4JA7A 4HVBA 4FU3A 3MV2B 1E7UA 4FJZA 4AIFA 2NC9A 4BSXA 2WXIA 1P5QA 3T8MA 3OTNA 1HX8A 2X6KA 2FI7A 3OXLA 1U3DA 3R7RA 2VSXE 3APDA 3D9NA 3KS2A 3PREA 3FHEA 3FWVA 2VSNA 4PH4B 2VGXA 1EDUA 2IONA 4YVQC 4TV3A 4N39A 2UY1B 4TUUA 1E7VA 2KC7A 4F3VA 3D9OA 2ONDA 3NZUA 4L2LA 1UJJA 4I43A 4CEMA 3ASHA 5FZQA 3QAQA 3RRNB 1Z3XA 3LCAA 3G2VA 3PS6A 3PDNA 3FP3A 4FLBA 4Q96A 2KCKA 3RJVA 5FWQA 4CGVA 2I2OA 4JC8A 4CT4A 1HZ4A 3ML9A 5KCMA 2BF0X 2J08A 5G05J 2WM9A 4FP7A 4AY6A 2WXOA 3D9LA 1Y8MA 3ESKA 1TJCA 4BTAA 3FTWA 3TL5A 3UT4A 3KEZA 4BX8A 3FH7A 3CSFA 2DIWA 2UY1A 3PNLB 3PUJA 5EKQD 4I9EA 3SFZA 2WXJA 5BW8C 4J8FA 1L5JA 4ACKA 3LKUA 3QWWA 4I2WA 3CVXA 4JVSA 4GA0A 1NZNA 4G1TA 3ONLA 4HXIA 1IQRA 3SF4A 2ZU6B 3FTUA 3NF1A 4L1BA 4RVBA 2E2EA 1E8ZA 1N52A 3I4GA 4WWPA 5FQ7A 1HG2A 1SZ9A 3MX3A 4AP2A 1E8YA 4OVVA 4WNFA 3CQCB 3HIZA 4FHJA 3G2TA 1H0AA 1VDYA 3L08A 3ZIMA 3CR3A 2WQ7A 4EQFA 4LUNU 5A6CA 4PS7A 3B7TA 2GW1A 2X38A 4JL0A 3FTSA 4G24A 4MRUA 4I6EA 3NQPA 4E85A 3UMVA 4LEUA 2V4LA 2XGSA 3LVQE 4XKCA 5EX0A 4NRHB 4P29A 2C0LA 2X6FA 1OWMA 5G55A 5G05C 2HYZA 2XQ0A 5BUZA 2BUGA 5BPPA 4URKA 4V3IA 3RRUA 4DJAA 3FU0A 2OV8A 3PUKA 5KJNA 4KVMA 5E76A 4U07A 3FU6A 4IYPA 3FUMA 4BWRA 2BTDA 2R5SA 4A3VA 4UWHA 4W9RA 2RD0A 1NA3A 5FJYA 3L6AA 4ABNA 4GZ6A 4A3TA 3APCA 4I17A 2XGOA 5G2NA 1DNPA 3UQ3A 3URZA 1QQEA 3SHFA 2VTBB 4WNDA 2PQRA 3O4ZA 4N3AA 5CMWA 1WM5A 3S7JA 4GYWA 3TG5A 3ZVVA 3PE3A 3KAEA 3PE4A 4F53A 3QWVA 3G2WA 3GW4A 3CVNA 4C0MA 5FT9A 4AM9A 2L6JA 3IBEA 4MKTA 3UT8A 4HORA 5ARFA 4DK5A 5JJ7A 1X5BA 5FZSA 4EBAG 3PEVB 3RIBA 3SD5A 3LPZA 4ANXA 4JZYA 2CG3A 2CHXA 2V0PA 2J4DA 1FCHA 3I4RB 1Z3YA 1HU3A 4G23A 3G2SA 4EZJA 4UQZA 4BFRA 2WMOA 3CK7A 2VTBA 4GMLA 2FO7A 2P58C 5AIJA 3HHMA 3QC1A 4YNDA 4DPRA 3D9IA 4XKBA 4WWOA 3ZYLA 3IKOB 3FEXA 4LERA 4GA2A 4AXHA 2KZTB 3CQGB 5D0QD 2HM8A 3D9JA 4CCAA 3FUJA 4C9BB 4JW1A 4DLQA 3R9AB 4JHKA 4GYYA 1H19A 3JUIA 2LSUA 2XCBA 3TGOA 4L2YA 4DLOA 3E4BA 2LSVA 4BX9A 2AWIA 5LFAA 1IYGA 3RU0A 4AV7A 4ANUA 3EIQC 3Q5MA 3T5XA 4JEHA 3CHOA 3CK8A 4BTBA 2IOLA 5FTPA 4UQXA 2VGYA 3AU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WPV A;  1KT1 A;  2FBN A;  5LCW J;  1QZ2 A;  4HOS A;  2VYI A;  1KLX A;  4AY5 A;  1XNF A;  2XPI A;  4GCN A;  4I9C A;  2Q7F A;  3QWP A;  2FF4 A;  1OUV A;  2Y4T A;  4JHR A;  3EDT B;  3TG4 A;  2JLB A;  5CCM A;  4GA1 A;  3U4T A;  2KCV A;  1YA0 A;  4B94 A;  4GYO A;  1ZU2 A;  2IF4 A;  2XGM A;  3LY8 A;  4GZ3 A;  5M72 A;  4APO A;  5LCW C;  5D0O D;  3SZ7 A;  3IEG A;  3LYA A;  2UWJ G;  4NQ0 A;  2MHK A;  3Q4A B;  5CHE E;  3VTX A;  3CK9 A;  4WUY A;  4N2Q A;  4RG6 A;  4N3B A;  3Q47 B;  5AYW D;  4UI9 K;  4N3C A;  4IN3 B;  3GZ2 A;  4U0U A;  3ZGQ A;  3OXG A;  4KBQ A;  4HOQ A;  2YQ8 A;  3CVL A;  4J8D A;  4UQY A;  4G2V A;  3CEQ A;  2C0M A;  4ME2 A;  2KAT A;  5KJL A;  3U3W A;  1ZBP A;  3MEK A;  3RO3 A;  4HOT A;  4G25 A;  2PL2 A;  4U0S A;  5C1D A;  2FEZ A;  3MV3 B;  4HOU A;  5HI7 A;  2DBA A;  2LNI A;  3AS5 A;  1KT0 A;  4CDR A;  3HYM B;  4XI0 A;  4N2S A;  5HQ8 A;  2VGX B;  3CVQ A;  3FFL A;  5ARG A;  2KCL A;  3AS4 A;  3OXF A;  4I2Z A;  2VQ2 A;  3QKY A;  2Y4U A;  4N5C A;  3ZFW A;  4YVO A;  5BT1 A;  3Q49 B;  3TAX A;  4H7X A;  3RO2 A;  4CGW A;  1E96 B;  3UUX A;  2HR2 A;  3LY7 A;  1NA0 A;  3JYS A;  1ELR A;  3Q15 A;  5JJ6 A;  5EX3 A;  4JA9 A;  2V5F A;  4J8E A;  3AS8 A;  4BT9 A;  2IFU A;  1WAO 1;  2OOE A;  1B89 A;  4G26 A;  5BNW A;  3CVP A;  3LY9 A;  3K9I A;  2QFC A;  2YHC A;  3O48 A;  3CKC A;  5CCL A;  4O6F A;  2AVP A;  3ZPJ A;  4U04 A;  2WQH A;  3S7D A;  4UI9 C;  3KD7 A;  5DBK A;  3QOU A;  2XEV A;  1HXI A;  2PZI A;  1IHG A;  2I6H A;  1W3B A;  5KJK A;  3ULQ A;  3VTY A;  4XIF A;  4A1S A;  3BEE A;  3UPV A;  3S7B A;  3GZ1 A;  3S7F A;  2C2L A;  4KYO B;  3WXX A;  3ASF A;  5FZR A;  4Y6W A;  5G04 J;  3CV0 A;  1ELW A;  2PQN A;  4XI9 A;  5KJM A;  4H7Y A;  4KXK B;  3ZN3 A;  4GZ5 A;  1PC2 A;  3ASD A;  2VSY A;  3QDN A;  4RG9 A;  2J9Q A;  1HH8 A;  4I1A A;  4U0Z A;  5JJT A;  3MKR A;  3ZHE B;  4Y6C A;  2XCC A;  3ASG A;  3MA5 A;  4GPK A;  3CKB A;  4J0U A;  4WNG A;  4BT8 A;  1A17 A;  4WNE A;  4GCO A;  5G04 C;  3GYZ A;  2HO1 A;  3N71 A;  5A7D B;  3RKV A;  3ZHE A;  5DIZ A;  4UI9 J;  4JA7 A;  3MV2 B;  4AIF A;  2NC9 A;  1P5Q A;  2FI7 A;  3OXL A;  3KS2 A;  3FWV A;  2VSN A;  2VGX A;  4YVQ C;  4N39 A;  2UY1 B;  4F3V A;  2KC7 A;  2OND A;  3ASH A;  5FZQ A;  3LCA A;  3PDN A;  3FP3 A;  3RJV A;  2KCK A;  4CGV A;  1HZ4 A;  5G05 J;  4AY6 A;  1Y8M A;  3ESK A;  1TJC A;  4BTA A;  2UY1 A;  5EKQ D;  4I9E A;  5BW8 C;  4J8F A;  3LKU A;  3QWW A;  4I2W A;  4GA0 A;  1NZN A;  4G1T A;  3SF4 A;  3NF1 A;  2E2E A;  4WNF A;  4EQF A;  5A6C A;  4JL0 A;  2GW1 A;  4G24 A;  4LEU A;  2XGS A;  5EX0 A;  4NRH B;  2C0L A;  5G05 C;  2HYZ A;  2BUG A;  5KJN A;  4U07 A;  4BWR A;  2R5S A;  4W9R A;  1NA3 A;  5FJY A;  4ABN A;  4GZ6 A;  4I17 A;  2XGO A;  3UQ3 A;  3URZ A;  1QQE A;  4WND A;  2PQR A;  4N3A A;  1WM5 A;  3S7J A;  4GYW A;  3TG5 A;  3PE3 A;  3KAE A;  3PE4 A;  3QWV A;  3GW4 A;  3CVN A;  5FT9 A;  4AM9 A;  2L6J A;  4HOR A;  5ARF A;  5JJ7 A;  5FZS A;  3RIB A;  3LPZ A;  1FCH A;  4G23 A;  4UQZ A;  3CK7 A;  2FO7 A;  2P58 C;  4YND A;  4GA2 A;  5D0Q D;  3R9A B;  4GYY A;  2LSU A;  2XCB A;  3TGO A;  3E4B A;  2LSV A;  1IYG A;  3RU0 A;  3Q5M A;  3CK8 A;  4BTB A;  5FTP A;  4UQX A;  2VGY A; 
#chains in the Genus database with same CATH topology
 2IOS A;  3VLD A;  4CRW A;  1QZ2 A;  3JXI A;  5HKP A;  1H6O A;  4KMO A;  5AQB A;  3NOG D;  2QZA A;  3DST A;  4AJW A;  2Y4T A;  4CYM D;  4JHR A;  3TG4 A;  3UI2 A;  2L0I A;  2KCV A;  1H6K A;  4FAD A;  2XRZ A;  5JMN D;  2JEK A;  3Q78 A;  3CGH A;  2CFZ A;  1ZU2 A;  3BQO A;  3D9P A;  5ANL A;  3ASN E;  3FUH A;  4K0R A;  5B3S E;  4Q94 A;  4FC8 A;  1AWC B;  3F6Q A;  4ANV A;  2RG8 A;  2DWZ A;  2P9U G;  2MHK A;  2IU1 A;  3IHY A;  1KZP A;  5ITZ F;  4C0E A;  4WUY A;  4N2Q A;  3RK6 A;  1E90 A;  4Q69 A;  4IRU A;  3IV0 A;  3EJN A;  4IN3 B;  3GZ2 A;  3SQV A;  3PEU B;  3OXG A;  1N4R A;  3D3M A;  5EN5 D;  5BXU A;  2GRM A;  1X81 A;  3ISM C;  1WY6 A;  4UQY A;  4I1M A;  3SGH A;  3FUE A;  5J90 A;  4OVU A;  4B8A A;  4HOT A;  3E37 A;  2ETA A;  1OWN A;  3DSU A;  1BI8 B;  4HLE A;  4QFV A;  5C1D A;  3ZKJ A;  3MV3 B;  5KBA A;  1DC2 A;  1KT0 A;  4BEP A;  4B93 B;  3SBT B;  3DEO A;  4J8S A;  2X6J A;  3EHQ A;  2VGX B;  3FFL A;  2X3M A;  1YMP A;  5ARG A;  3JQ0 A;  3L16 A;  5A23 A;  5LOZ A;  3HXF A;  3EIJ A;  2Y4U A;  4N5C A;  3FUL A;  2L0T B;  4DX2 A;  2XPY A;  3TAX A;  5ENT D;  1H2T C;  3B7U X;  3V2X A;  2HR2 A;  2I9C A;  2DYR E;  3LY7 A;  4ACL A;  1NA0 A;  3Q15 A;  2FUL A;  5JJ6 A;  1S70 B;  2XS1 A;  2V5F A;  3PVL A;  2IFU A;  4BT9 A;  5LP0 A;  4YDO A;  2OOE A;  3PNT B;  3K9I A;  2YHC A;  4LNU D;  3CHQ A;  2MRI A;  1OXJ A;  3FH5 A;  3I5P A;  4U63 A;  3QAR A;  2AVP A;  4DX7 D;  1INZ A;  4UI9 C;  3KD7 A;  1YYH A;  5AAR A;  5CMY A;  4A1G A;  1W3B A;  5KJK A;  3ULQ A;  3V30 A;  3C3O A;  5IY5 E;  3Q75 A;  4UWG A;  4GAA A;  3S7B A;  3NAW A;  4UWK A;  4F7A A;  3SNX A;  1RW2 A;  3CVV A;  1MX6 A;  1A5E A;  2WXN A;  4KYO B;  3LXU X;  3CHM A;  4XZ4 A;  4BER A;  5J08 A;  3HDX A;  3WXX A;  2PM6 A;  5G04 J;  4MLP A;  1MX2 A;  2A5U A;  1LTX A;  1NP7 A;  3ZYM A;  3Q79 A;  5KJM A;  2WVI A;  4O1P A;  3ASD A;  1OCZ E;  4BSZ B;  4U0Z A;  3ZHE B;  4Y6C A;  5LX8 A;  3ASG A;  3MA5 A;  2XZD G;  2L9B A;  2XEE A;  1U3C A;  3CKB A;  2GRN B;  4HI8 A;  4BT8 A;  4WNE A;  2H6I A;  2HO1 A;  2YHE A;  3BG1 B;  3N71 A;  2XHE A;  4HQD A;  3RKV A;  3IHV A;  4AVX A;  5EDS A;  4DX1 A;  4UI9 J;  1DVP A;  3PRZ A;  4JA7 A;  4FU3 A;  2NC9 A;  2WXI A;  1JCQ A;  3OTN A;  3D9H A;  2VSX E;  3Q7F A;  3D9N A;  3FHE A;  3FWV A;  4PH4 B;  5FIO A;  3AG2 E;  1EDU A;  1G3N B;  2KC7 A;  2OND A;  4CEM A;  4I43 A;  5FZQ A;  1IHB A;  3LCA A;  1AP7 A;  4Q96 A;  4FLB A;  2J08 A;  2WM9 A;  3ESK A;  3LJN A;  3B7B A;  3CSF A;  2UY1 A;  3PNL B;  1TR4 A;  4YDY A;  3LKU A;  3C3R A;  4HXI A;  3SF4 A;  5KNG A;  4GMR A;  3DXM G;  4AP2 A;  3HIZ A;  4FHJ A;  3DEP A;  1V55 E;  1H0A A;  2WQ7 A;  3CR3 A;  3B7T A;  1TNY A;  3NQP A;  3J5P A;  2C0L A;  2X6F A;  1TN8 A;  3PUK A;  3FUM A;  3L6A A;  3B95 A;  3UQ3 A;  2R02 A;  1QQE A;  3SHF A;  2VTB B;  4N3A A;  5CMW A;  3TG5 A;  2R2L A;  3CVN A;  4C0M A;  5FT9 A;  4RLY A;  4AM9 A;  5ARF A;  1X5B A;  3SD5 A;  3ABL E;  4ANX A;  2CHX A;  2V0P A;  3I4R B;  4UQZ A;  3CK7 A;  2P58 C;  1BI7 B;  3BU8 A;  3QC1 A;  4DPR A;  4WWO A;  2KZT B;  3CQG B;  4CCA A;  4U7E B;  3FUJ A;  3EU5 A;  1D8E A;  1MX4 A;  4GYY A;  2XCB A;  1N4Q A;  1TYQ G;  4JEH A;  3CK8 A;  4UQX A;  2VGY A;  4TXR A;  1UN8 A;  3FTX A;  4ZHB A;  2FBN A;  2XS8 A;  1JWF A;  1YCS B;  3ABK E;  4AY5 A;  3TWW A;  4TXQ A;  2WXR A;  4I1O B;  4GZD A;  2WXP A;  1OUV A;  3EDT B;  3S2A A;  3U9W A;  2WXL A;  3HVE B;  3CIA A;  4HRL A;  4WWN A;  4EHM A;  1UW4 B;  3DRA A;  4GYO A;  3QJZ A;  2WXM A;  2DZO A;  4HLL A;  3R9M A;  2XGM A;  3LY8 A;  1FT2 A;  4APO A;  5EID A;  3CVU A;  3AG3 E;  5D0O D;  3SZ7 A;  3IEG A;  1TNO A;  4HNA D;  1JCR A;  1UJK A;  3ABM E;  5B1B E;  3Q4A B;  5CHE E;  2WXG A;  3SFX A;  2DYS E;  4RG6 A;  4N3B A;  5AYW D;  3SO8 A;  3ML8 A;  4TUM A;  2WQ6 A;  4U0U A;  3ZGQ A;  2LUH A;  2YQ8 A;  3UX4 A;  3OAW A;  1MYO A;  3TWQ A;  1RZ4 A;  2AXZ A;  2VGE A;  2CHZ A;  1PAQ A;  2LXM A;  4GTR A;  4EPZ A;  5CER B;  2CG2 A;  4GTP A;  4ME2 A;  4AEZ C;  3U3W A;  5KJL A;  2KM4 A;  1ZBP A;  2R05 A;  3EUV A;  5FQ6 A;  2J49 A;  3JQ1 A;  4U0S A;  4NAC A;  3UM3 A;  3AJI A;  4LG6 A;  4ILG A;  4EBA A;  2VJ8 A;  4LRZ A;  4LSZ E;  2ZIS A;  3AS5 A;  4RSY A;  4XEI G;  1D9S A;  4UWL A;  2Y69 E;  4HFG A;  4XI0 A;  4TXP A;  4QQI A;  2ZGG A;  3CVQ A;  1N94 A;  5JA4 D;  4AOF A;  1K8K G;  2KCL A;  2AJA A;  3AS4 A;  2EQX A;  3ESL A;  3QKY A;  3FEY A;  3ZFW A;  3V31 A;  5T3R A;  1WG0 A;  4Z68 A;  4H7X A;  3HXB A;  3APF A;  1E96 B;  2F0Y A;  3EU9 A;  1UN9 A;  2LAI A;  2DZN A;  3JYS A;  3UT7 A;  1ELR A;  4UUC A;  4EZK A;  3AS8 A;  5FIN A;  1B89 A;  2H6G A;  1OCC E;  3CVP A;  4IUL A;  5CEC B;  2QFC A;  1GW6 A;  1UG3 A;  4PS8 A;  1S63 A;  4FHK A;  5CCL A;  4O6F A;  1NFI E;  1MQS A;  2R59 A;  3P1U A;  2WQH A;  3S7D A;  1H6P A;  5ENR D;  4BY6 A;  4U8H A;  5AAO A;  5DBK A;  1OWP A;  3ULY A;  4CZ2 D;  3PZ3 A;  4KT6 B;  3MGB A;  3UXG A;  2ILR A;  1JPL A;  3MKQ B;  3ZYQ A;  2C2L A;  1H2U A;  4NUR A;  3FY4 A;  3T5V A;  1BLX B;  3FUK A;  3B13 A;  4Y6W A;  3CV0 A;  1TEZ A;  1Z6T A;  4MBG A;  2DCP A;  4ANW A;  3DSW A;  2F8Y A;  4XI9 A;  3I3N A;  4J7W A;  2AW6 A;  1JWG A;  4APF A;  4JXT A;  3VLF A;  5C2Y A;  4GZC A;  4RG9 A;  4C48 B;  3DPY A;  3FUD A;  2XCC A;  2I1J A;  1IKN D;  4GPK A;  3B7S A;  2IJG X;  1MHQ A;  5CBN A;  5G04 C;  2IY0 C;  2VSO E;  3GYZ A;  4X8Q A;  5A7D B;  2RFM A;  4KVO A;  2EIM E;  3ZHE A;  3MZL B;  3PH0 C;  4GTO A;  2IO3 C;  2P9K G;  3HG0 D;  3MV2 B;  1E7U A;  1N0Q A;  3T8M A;  2FI7 A;  3OXL A;  3R7R A;  3APD A;  3ZUV B;  3KS2 A;  3NOC D;  4TUU A;  1BU9 A;  3D9O A;  3NZU A;  4K5C A;  3ASH A;  3QAQ A;  3RRN B;  1UOH A;  2H6H A;  4CGV A;  3UKR G;  4GTS A;  2I2O A;  5KCM A;  2BF0 X;  1K1A A;  2GRP B;  3E30 A;  1Y8M A;  2EIL E;  3FTW A;  3KEZ A;  4BX8 A;  3FH7 A;  2DIW A;  3DSS A;  4K5A B;  2WXJ A;  4J8F A;  1L5J A;  2XZT G;  3CVX A;  1NZN A;  3ONL A;  3NF1 A;  3FTU A;  1E8Z A;  1N52 A;  3RAU A;  1HG2 A;  1SZ9 A;  4OVV A;  4F1P A;  3L08 A;  3ZIM A;  4HI9 A;  1SA5 A;  4EQF A;  4LUN U;  4PS7 A;  2QC9 A;  4JL0 A;  2GW1 A;  2ZXW E;  2EIN E;  2QYJ A;  4LEU A;  2V4L A;  2XGS A;  1TNB A;  2HYZ A;  5BPP A;  4URK A;  4DJA A;  2OV8 A;  5KJN A;  3FU6 A;  2BTD A;  2R5S A;  1NA3 A;  5FJY A;  4BET A;  3V2O A;  1Z5S C;  3ZVV A;  3G2W A;  3UT8 A;  1TNU A;  4F6R D;  4DK5 A;  5JJ7 A;  4G8K A;  1N11 A;  1N4P A;  2BKG A;  4JZY A;  1Z3Y A;  1HU3 A;  4N5Q A;  3L9T A;  2VTB A;  5HRY A;  4GA2 A;  5ENS D;  1U2V G;  2HM8 A;  4DLQ A;  1N4S A;  4JHK A;  3JUI A;  3TGO A;  4L2Y A;  3E4B A;  4L9P A;  4ANU A;  3AG4 E;  2ZGD A;  3ZW3 A;  5FTP A;  3AU5 A;  2KZT A;  1KT1 A;  5LCW J;  4LNG A;  2VYI A;  1QYM A;  3DWL G;  4GCN A;  5B1A E;  2Q7F A;  3QWP A;  2FO1 E;  2WB2 A;  1V54 E;  5CBO A;  1FVF A;  2JLB A;  5CCM A;  4NIK A;  2GRL A;  3UIN C;  1JCS A;  4KZ0 A;  3TXM A;  2QY7 A;  4PDX A;  3U4T A;  3CHR A;  1YA0 A;  3UKU G;  2LAH A;  2WXK A;  3DPD A;  4J6I A;  1EPU A;  4HB5 A;  3D9K A;  4DUI A;  2IF4 A;  4GZ3 A;  3UM2 A;  4WAF A;  4ATG A;  3W9G A;  3HXC A;  4I6G A;  2P9L G;  4LCT A;  2I1K A;  3G2U A;  3LYA A;  2UWJ G;  3Q73 A;  3VTX A;  3CK9 A;  3Q47 B;  1LD7 A;  4UI9 K;  4GPM A;  4N3C A;  4FJY A;  4HS2 A;  3MYV A;  3BG0 B;  4J8D A;  5AEN A;  3TJP A;  3KSQ A;  2J8S D;  2WXQ A;  3MJW A;  2P9S G;  2XRY A;  2J4B A;  4G2V A;  2AXU A;  2A4Z A;  1H2V C;  2KAT A;  3MEK A;  4GTQ A;  3U64 A;  4DRX E;  2EIK E;  4ILI A;  1S64 A;  2DVW A;  2R03 A;  2PL2 A;  3L54 A;  1E8X A;  4JEU A;  5T8I A;  2HE0 A;  1Q2Z A;  5HI7 A;  2MOW A;  1FVH A;  5ENN A;  3TWV A;  5EYL A;  4CDR A;  3HYM B;  3R7Q A;  2P2C P;  5ANR A;  5BV1 A;  4F1S A;  4G11 A;  5HQ8 A;  3QK0 A;  2MYO A;  3FU3 A;  4CDN A;  3LDZ A;  3FUI A;  3FTV A;  3UIP C;  2YNQ A;  4U8Y D;  4DI4 A;  2VQ2 A;  1MZC A;  5EIB E;  3EHM A;  1TNZ A;  4YVO A;  5BT1 A;  5EIL A;  3Q49 B;  3RO2 A;  4O1O A;  3ZRH A;  2OVF A;  3L17 A;  4U95 D;  4J8Y A;  4BES A;  4XE0 A;  1SQM A;  5EX3 A;  5EYP F;  4R7L A;  3ENE A;  3ULE G;  4G26 A;  5BNW A;  3LY9 A;  2R17 C;  3PZ4 A;  1BPO A;  2ZIR A;  2IEJ A;  3FDH A;  4CDM A;  2F8X K;  5KNH D;  2OEW A;  2YIN A;  2XEV A;  1HXI A;  4E6H A;  1WDY A;  2PZI A;  1IHG A;  1KZO A;  2V8S E;  3RSE G;  3ZYK A;  3VTY A;  4A1S A;  3UPV A;  3Q9N C;  3CHP A;  4GB9 A;  3LEW A;  2Y0B G;  1E8W A;  5AN8 A;  1HG5 A;  4LNB A;  2WXH A;  3FUN A;  1HFA A;  1Y6I A;  3MCX A;  3ASF A;  5FZR A;  2WMN A;  5FQ4 A;  4K03 A;  1ELW A;  3FTY A;  2X6H A;  3RRM B;  2NSZ A;  1N9A A;  3C98 A;  3MKQ A;  3ZN3 A;  3EHN A;  4HRM B;  3L82 A;  2GGF A;  1HH8 A;  2LXL A;  4I1A A;  3C3Q A;  1HE8 A;  5JJT A;  3MKR A;  3FU5 A;  3LS8 A;  4A55 A;  1PY1 A;  3SFY A;  2WXF A;  3Q9U C;  3TWU A;  4DX6 D;  2CFU A;  4J0U A;  3ONK A;  3FH8 A;  4WNG A;  3LVR E;  3SI5 A;  1A17 A;  4GCO A;  1HF8 A;  1HS6 A;  3CST A;  3X2Q E;  4GTT A;  2V5Q C;  3QB2 A;  4YDW A;  4OYS A;  5E75 A;  1OY3 D;  4JB8 P;  1OT8 A;  4FJZ A;  4BSX A;  3AAA C;  1P5Q A;  2EIJ E;  2OEV A;  4A63 B;  2VSN A;  2VGX A;  4TV3 A;  4N39 A;  1E7V A;  4L2L A;  1Z3X A;  2A5E A;  3PDN A;  1O1S A;  3RJV A;  5ENP D;  4CT4 A;  1HZ4 A;  3ML9 A;  5G05 J;  4FP7 A;  2WXO A;  1MJ0 A;  1N0R A;  5EKQ D;  2JAB A;  4I9E A;  3DXK G;  4ACK A;  1O1T A;  4G1T A;  5AQ7 A;  1IQR A;  3HXE A;  2E2E A;  3I4G A;  3DSX A;  3CQC B;  3G2T A;  2KXP C;  5A6C A;  4G24 A;  4I6E A;  3UMV A;  1OWM A;  5G55 A;  5BUZ A;  2BUG A;  4V3I A;  3FU0 A;  4KVM A;  4U07 A;  4A3V A;  1BD8 A;  4UWH A;  4W9R A;  2RD0 A;  4ABN A;  4GZ6 A;  3APC A;  4WND A;  1WM5 A;  3QWV A;  3GW4 A;  2L6J A;  3IBE A;  4MKT A;  3TWX A;  3PEV B;  4M7C A;  2J4D A;  1TN6 A;  4EZJ A;  2WMO A;  4GML A;  3HHM A;  4YND A;  3D9I A;  4XKB A;  3ZYL A;  2PNN A;  3FEX A;  1NI1 A;  1SA4 A;  5D0Q D;  4JW1 A;  1DCE A;  1SW6 A;  5CRV A;  4OAV B;  3W9F A;  3RU0 A;  1LD8 A;  4AV7 A;  3E33 A;  3EIQ C;  3Q5M A;  3T5X A;  4K5B A;  3UM0 A;  2IOL A;  2ETC A;  4M3O A;  3UTM A;  1IXV A;  2WPV A;  1KPS B;  2IQC A;  4HOS A;  3U66 A;  1KLX A;  1XNF A;  2XPI A;  4I9C A;  4JHJ A;  2J09 A;  2FF4 A;  3JCK C;  3KSL A;  4PUC A;  3CVY A;  4GA1 A;  3B7R L;  4B0Z A;  4B8C B;  4B94 A;  3NBN B;  4CT0 A;  4XX5 A;  5BV0 A;  4TRQ A;  1QNF A;  5M72 A;  3UIO C;  2NXP A;  1N95 A;  2KBX A;  1FT1 A;  5LCW C;  4D10 C;  1S0P A;  2P9N G;  4NQ0 A;  4UWF A;  2XEH A;  3CHS A;  2B6C A;  4GU5 A;  4GTV A;  1QBQ A;  1EF1 C;  3CVW A;  2OVB A;  4PS3 A;  1HO8 A;  3TWT A;  4KBQ A;  4HOQ A;  3CLJ A;  3CVL A;  2PM7 A;  4ZFH A;  4EZL A;  1XGW A;  1TJF A;  1ELK A;  3TXN A;  3Q7A A;  3CEQ A;  1JUQ A;  2C0M A;  4JD2 G;  3T9K A;  4ATZ D;  3AU4 A;  2LO6 A;  3IXE A;  5BXO A;  3UM1 A;  5H7P A;  3RO3 A;  4FA6 A;  4G25 A;  3HRA A;  3E32 A;  2M63 A;  3ZXS A;  4KZC A;  3AG1 E;  3NZS A;  2FEZ A;  4HOU A;  2DBA A;  2E0I A;  2LNI A;  4FUL A;  5FQ8 A;  2X6I A;  4N2S A;  3KEA A;  1OCO E;  1K1B A;  1OWL A;  2J07 A;  3L22 A;  5JHB A;  2CHW A;  3ZEF A;  3C72 A;  3DBS A;  3LJ3 A;  3PZ1 A;  3OXF A;  4I2Z A;  2QYU A;  1LF8 A;  3FTZ A;  3L13 A;  3P2B A;  5T4Y A;  4O60 A;  4G8L A;  4CGW A;  3JUE A;  3UUX A;  5AQA A;  3WG7 E;  3C5R A;  3TWR A;  3JXJ A;  3EHR A;  4GMJ A;  1IQU A;  4JA9 A;  4J8E A;  1WAO 1;  2P9I G;  3GZS A;  5ENQ D;  1OWO A;  1FPP A;  3O48 A;  3CKC A;  2OCC E;  3FUF A;  3ZPJ A;  1DCQ A;  4U04 A;  4ILH B;  3HVE A;  4DI3 A;  4GTM A;  4FLH A;  3QOU A;  3VLE A;  2I6H A;  2RKK A;  1O1R A;  2XPZ A;  5KWD A;  1ZB1 A;  5AQ9 A;  2H6F A;  3D9M A;  4XIF A;  2AXV A;  3BEE A;  2ETB A;  3PZD A;  3DSV A;  4RQI A;  3GZ1 A;  3S7F A;  5CED B;  4MS6 A;  1NL4 A;  3ZNG A;  4B89 A;  2IO2 C;  1SVX A;  2Y3A A;  1SZA A;  2PQN A;  1EYH A;  1K3Z D;  4H7Y A;  4KXK B;  4GZ5 A;  3ZXP A;  1PC2 A;  2VSY A;  3SBS A;  5CEA A;  3QDN A;  2J9Q A;  2BKK B;  4L23 A;  4I6J A;  5AJD A;  5HS0 A;  1N54 A;  3QNK A;  1TN7 A;  5JHA A;  3SY2 A;  2RFA A;  2V4H C;  4EEC A;  4OAU C;  5AJL A;  5DIZ A;  4U96 D;  4L7T A;  4JPS A;  4HVB A;  4U8V D;  4AIF A;  4HRN A;  1HX8 A;  2X6K A;  1U3D A;  3NB2 A;  3PRE A;  2GRQ B;  4DX5 D;  2ION A;  4YVQ C;  4F3V A;  2UY1 B;  1UJJ A;  5ENO D;  3G2V A;  3PS6 A;  3FP3 A;  2KCK A;  5FWQ A;  4JC8 A;  2L6B A;  4AY6 A;  3D9L A;  1TJC A;  4BTA A;  2P9P G;  1D8D A;  3TL5 A;  3UT4 A;  3V79 K;  3PUJ A;  5D66 A;  2F37 A;  1OCR E;  3SFZ A;  5BW8 C;  3QWW A;  4I2W A;  4JVS A;  4GA0 A;  3ZU7 B;  2ZU6 B;  4L1B A;  4RVB A;  3BUA A;  5CRU A;  4WWP A;  5FQ7 A;  3HXD A;  3MX3 A;  2GRO B;  1E8Y A;  4WNF A;  2NYJ A;  2B0O E;  2GRR B;  1VDY A;  2X38 A;  3FTS A;  3T8K A;  4MRU A;  4E85 A;  5EX0 A;  3LVQ E;  4XKC A;  4NRH B;  4P29 A;  5G05 C;  2XQ0 A;  2BED A;  3TWS A;  3RRU A;  5E76 A;  3ASO E;  4IYP A;  4BWR A;  2XEN A;  3E34 A;  4A3T A;  5D2M C;  3J5Q B;  2XGO A;  4I17 A;  5G2N A;  1DNP A;  3URZ A;  2PQR A;  3O4Z A;  3S7J A;  4GYW A;  3PE3 A;  3KAE A;  3PE4 A;  4F53 A;  4HOR A;  5FZS A;  4YDE A;  4EBA G;  3RIB A;  2Y1L E;  3LPZ A;  2CG3 A;  1FCH A;  4HBD A;  4G23 A;  3G2S A;  4BFR A;  5AIJ A;  2FO7 A;  3IKO B;  4LER A;  4AXH A;  3D9J A;  3PZ2 A;  4C9B B;  3R9A B;  1H19 A;  2LSU A;  4DLO A;  2LSV A;  4BX9 A;  2AWI A;  5LFA A;  1IYG A;  1O5M A;  3CHO A;  4BTB A; 
#chains in the Genus database with same CATH homology
 1UN8 A;  3FTX A;  4M3O A;  2WPV A;  2IOS A;  2KZT A;  3VLD A;  4CRW A;  1KT1 A;  2FBN A;  5LCW J;  1QZ2 A;  2IQC A;  4HOS A;  1JWF A;  2VYI A;  3U66 A;  1KLX A;  4AY5 A;  4KMO A;  1XNF A;  2XPI A;  4GCN A;  4I9C A;  4JHJ A;  2Q7F A;  2J09 A;  3QWP A;  2FF4 A;  2WB2 A;  2WXR A;  4I1O B;  4GZD A;  3JCK C;  4PUC A;  3CVY A;  2WXP A;  4AJW A;  1OUV A;  2Y4T A;  4JHR A;  3EDT B;  3S2A A;  3TG4 A;  1FVF A;  2JLB A;  3U9W A;  3ZW3 A;  5CCM A;  4GA1 A;  2GRL A;  2WXL A;  3B7R L;  3HVE B;  4KZ0 A;  3TXM A;  4B0Z A;  2L0I A;  2QY7 A;  4PDX A;  4B8C B;  3U4T A;  2KCV A;  3CHR A;  1YA0 A;  1H6K A;  4B94 A;  3CIA A;  4FAD A;  4WWN A;  4CT0 A;  2XRZ A;  1UW4 B;  2LAH A;  2WXK A;  3QJZ A;  4GYO A;  3DPD A;  2WXM A;  4XX5 A;  4J6I A;  1EPU A;  2JEK A;  3CGH A;  2CFZ A;  1ZU2 A;  3D9K A;  5BV0 A;  2IF4 A;  2XGM A;  3LY8 A;  4TRQ A;  4GZ3 A;  3D9P A;  1QNF A;  5M72 A;  5ANL A;  4WAF A;  4APO A;  4ATG A;  3CVU A;  4I6G A;  2NXP A;  3FUH A;  4K0R A;  4Q94 A;  5LCW C;  4LCT A;  5D0O D;  3SZ7 A;  3IEG A;  2I1K A;  4FC8 A;  3G2U A;  4D10 C;  4ANV A;  1S0P A;  2UWJ G;  2RG8 A;  3LYA A;  3IHY A;  4NQ0 A;  2MHK A;  2IU1 A;  4UWF A;  1UJK A;  3CHS A;  3Q4A B;  5CHE E;  2WXG A;  4GU5 A;  3VTX A;  3CK9 A;  4C0E A;  4WUY A;  4N2Q A;  4RG6 A;  4N3B A;  3Q47 B;  1E90 A;  5AYW D;  3RK6 A;  4Q69 A;  4IRU A;  4UI9 K;  3IV0 A;  1EF1 C;  3CVW A;  2OVB A;  4N3C A;  3ML8 A;  3EJN A;  4PS3 A;  4IN3 B;  3GZ2 A;  4FJY A;  2WQ6 A;  1HO8 A;  4U0U A;  3PEU B;  3ZGQ A;  3OXG A;  4KBQ A;  4HOQ A;  2YQ8 A;  4HS2 A;  3CLJ A;  3UX4 A;  3CVL A;  3D3M A;  3MYV A;  3BG0 B;  4J8D A;  5AEN A;  3OAW A;  3TJP A;  2GRM A;  2PM7 A;  2WXQ A;  4EZL A;  2AXZ A;  1XGW A;  1TJF A;  1ELK A;  3MJW A;  3TXN A;  2CHZ A;  1PAQ A;  2XRY A;  4EPZ A;  2J4B A;  1WY6 A;  4UQY A;  4G2V A;  2CG2 A;  3CEQ A;  4I1M A;  1JUQ A;  2AXU A;  2C0M A;  2A4Z A;  1H2V C;  3AU4 A;  4ME2 A;  4AEZ C;  2KAT A;  5KJL A;  3U3W A;  2KM4 A;  2LO6 A;  1ZBP A;  3MEK A;  3SGH A;  3FUE A;  3U64 A;  5J90 A;  4OVU A;  3RO3 A;  4FA6 A;  4B8A A;  4HOT A;  4G25 A;  4ILI A;  1OWN A;  5FQ6 A;  2PL2 A;  3L54 A;  1E8X A;  2J49 A;  3JQ1 A;  4HLE A;  4JEU A;  2M63 A;  4U0S A;  3ZXS A;  5T8I A;  4NAC A;  4QFV A;  4KZC A;  3NZS A;  5C1D A;  2FEZ A;  4ILG A;  4EBA A;  3MV3 B;  2VJ8 A;  4HOU A;  5HI7 A;  4LRZ A;  2DBA A;  2MOW A;  1FVH A;  2E0I A;  2LNI A;  5ENN A;  3AS5 A;  4FUL A;  4RSY A;  1KT0 A;  5FQ8 A;  3SBT B;  4CDR A;  3HYM B;  3R7Q A;  4J8S A;  4UWL A;  4HFG A;  5ANR A;  4XI0 A;  5BV1 A;  2X6I A;  4N2S A;  2X6J A;  4F1S A;  4G11 A;  5HQ8 A;  3QK0 A;  2VGX B;  1OWL A;  2J07 A;  3CVQ A;  3L22 A;  3FU3 A;  3FFL A;  5JHB A;  2CHW A;  2X3M A;  3LDZ A;  3FUI A;  5ARG A;  3JQ0 A;  3FTV A;  3L16 A;  3ZEF A;  2KCL A;  4AOF A;  5LOZ A;  5A23 A;  3DBS A;  2YNQ A;  3AS4 A;  3LJ3 A;  2EQX A;  3ESL A;  4DI4 A;  3OXF A;  4I2Z A;  2VQ2 A;  3EIJ A;  3FEY A;  2Y4U A;  3QKY A;  4N5C A;  3ZFW A;  3EHM A;  3FUL A;  1LF8 A;  3FTZ A;  2L0T B;  3L13 A;  4YVO A;  5T3R A;  5BT1 A;  3Q49 B;  2XPY A;  3P2B A;  3TAX A;  4H7X A;  5T4Y A;  3RO2 A;  4CGW A;  1H2T C;  3APF A;  3B7U X;  1E96 B;  3UUX A;  3ZRH A;  2HR2 A;  2I9C A;  2OVF A;  1UN9 A;  3L17 A;  3LY7 A;  4ACL A;  2LAI A;  1NA0 A;  3JYS A;  3UT7 A;  1ELR A;  1SQM A;  4GMJ A;  3Q15 A;  2FUL A;  4XE0 A;  5JJ6 A;  1IQU A;  5EX3 A;  4JA9 A;  2V5F A;  3PVL A;  4J8E A;  4EZK A;  3AS8 A;  2IFU A;  4R7L A;  4BT9 A;  5LP0 A;  1WAO 1;  3GZS A;  2OOE A;  3ENE A;  1B89 A;  3PNT B;  4G26 A;  5BNW A;  3CVP A;  4IUL A;  3LY9 A;  3K9I A;  2R17 C;  2QFC A;  1GW6 A;  2YHC A;  1UG3 A;  4PS8 A;  3CHQ A;  2MRI A;  1OWO A;  3FH5 A;  3I5P A;  3O48 A;  3CKC A;  1BPO A;  4FHK A;  4U63 A;  5CCL A;  3FUF A;  3QAR A;  4O6F A;  2AVP A;  3FDH A;  3ZPJ A;  1MQS A;  2R59 A;  3P1U A;  4U04 A;  2WQH A;  4ILH B;  4CDM A;  3HVE A;  3S7D A;  4BY6 A;  4DI3 A;  4U8H A;  4UI9 C;  1INZ A;  3KD7 A;  5DBK A;  2YIN A;  4FLH A;  3QOU A;  2XEV A;  1HXI A;  3VLE A;  4E6H A;  1OWP A;  2PZI A;  1IHG A;  5CMY A;  2I6H A;  4A1G A;  2V8S E;  2XPZ A;  1W3B A;  3ZYK A;  5KJK A;  3ULQ A;  3VTY A;  3D9M A;  4XIF A;  2AXV A;  4A1S A;  3BEE A;  3UPV A;  3CHP A;  4GB9 A;  3PZD A;  3LEW A;  4UWG A;  4GAA A;  3S7B A;  3GZ1 A;  4KT6 B;  3MGB A;  2ILR A;  1JPL A;  3MKQ B;  4UWK A;  1E8W A;  3S7F A;  3ZYQ A;  4F7A A;  1HG5 A;  3SNX A;  2WXH A;  3FUN A;  1HFA A;  2C2L A;  4MS6 A;  1H2U A;  4NUR A;  3FY4 A;  3T5V A;  1Y6I A;  3CVV A;  2WXN A;  3MCX A;  4KYO B;  3LXU X;  3CHM A;  4XZ4 A;  4B89 A;  5J08 A;  3HDX A;  3WXX A;  3ASF A;  2PM6 A;  2WMN A;  3B13 A;  3FUK A;  4K03 A;  3CV0 A;  4Y6W A;  5FQ4 A;  2Y3A A;  5FZR A;  5G04 J;  1Z6T A;  1TEZ A;  4MLP A;  1SZA A;  1ELW A;  2DCP A;  2PQN A;  3FTY A;  4ANW A;  1EYH A;  2X6H A;  2A5U A;  1NP7 A;  3ZYM A;  4CDN A;  4XI9 A;  3I3N A;  3RRM B;  5KJM A;  2NSZ A;  4H7Y A;  2WVI A;  4KXK B;  3C98 A;  2AW6 A;  3MKQ A;  3ZN3 A;  4GZ5 A;  1JWG A;  3EHN A;  4APF A;  4JXT A;  3VLF A;  1PC2 A;  3ASD A;  5C2Y A;  2GGF A;  2VSY A;  3SBS A;  4GZC A;  3QDN A;  4RG9 A;  2J9Q A;  1HH8 A;  4I1A A;  4U0Z A;  1HE8 A;  5JJT A;  3MKR A;  4L23 A;  3FU5 A;  3ZHE B;  3FUD A;  4Y6C A;  3LS8 A;  4A55 A;  1PY1 A;  5LX8 A;  2XCC A;  2WXF A;  3ASG A;  2I1J A;  4I6J A;  3MA5 A;  5AJD A;  4GPK A;  3B7S A;  1N54 A;  2L9B A;  3QNK A;  2CFU A;  1U3C A;  3CKB A;  2IJG X;  1MHQ A;  4J0U A;  3ONK A;  3FH8 A;  4WNG A;  3LVR E;  3SI5 A;  4BT8 A;  1A17 A;  4WNE A;  4GCO A;  5G04 C;  5JHA A;  2VSO E;  3GYZ A;  1HF8 A;  1HS6 A;  2HO1 A;  2YHE A;  3BG1 B;  3CST A;  4EEC A;  3N71 A;  2XHE A;  5A7D B;  5AJL A;  3RKV A;  4KVO A;  3IHV A;  4AVX A;  5EDS A;  3ZHE A;  3QB2 A;  3MZL B;  3PH0 C;  4OYS A;  5DIZ A;  4UI9 J;  1DVP A;  3PRZ A;  5E75 A;  4L7T A;  4JPS A;  4JA7 A;  4HVB A;  4FU3 A;  3MV2 B;  1E7U A;  4FJZ A;  4AIF A;  2NC9 A;  4BSX A;  2WXI A;  1P5Q A;  3T8M A;  3OTN A;  1HX8 A;  2X6K A;  2FI7 A;  3OXL A;  1U3D A;  3R7R A;  2VSX E;  3APD A;  3D9N A;  3KS2 A;  3PRE A;  3FHE A;  3FWV A;  2VSN A;  4PH4 B;  2VGX A;  1EDU A;  2ION A;  4YVQ C;  4TV3 A;  4N39 A;  2UY1 B;  4TUU A;  1E7V A;  2KC7 A;  4F3V A;  3D9O A;  2OND A;  3NZU A;  4L2L A;  1UJJ A;  4I43 A;  4CEM A;  3ASH A;  5FZQ A;  3QAQ A;  3RRN B;  1Z3X A;  3LCA A;  3G2V A;  3PS6 A;  3PDN A;  3FP3 A;  4FLB A;  4Q96 A;  2KCK A;  3RJV A;  5FWQ A;  4CGV A;  2I2O A;  4JC8 A;  4CT4 A;  1HZ4 A;  3ML9 A;  5KCM A;  2BF0 X;  2J08 A;  5G05 J;  2WM9 A;  4FP7 A;  4AY6 A;  2WXO A;  3D9L A;  1Y8M A;  3ESK A;  1TJC A;  4BTA A;  3FTW A;  3TL5 A;  3UT4 A;  3KEZ A;  4BX8 A;  3FH7 A;  3CSF A;  2DIW A;  2UY1 A;  3PNL B;  3PUJ A;  5EKQ D;  4I9E A;  3SFZ A;  2WXJ A;  5BW8 C;  4J8F A;  1L5J A;  4ACK A;  3LKU A;  3QWW A;  4I2W A;  3CVX A;  4JVS A;  4GA0 A;  1NZN A;  4G1T A;  3ONL A;  4HXI A;  1IQR A;  3SF4 A;  2ZU6 B;  3FTU A;  3NF1 A;  4L1B A;  4RVB A;  2E2E A;  1E8Z A;  1N52 A;  3I4G A;  4WWP A;  5FQ7 A;  1HG2 A;  1SZ9 A;  3MX3 A;  4AP2 A;  1E8Y A;  4OVV A;  4WNF A;  3CQC B;  3HIZ A;  4FHJ A;  3G2T A;  1H0A A;  1VDY A;  3L08 A;  3ZIM A;  3CR3 A;  2WQ7 A;  4EQF A;  4LUN U;  5A6C A;  4PS7 A;  3B7T A;  2GW1 A;  2X38 A;  4JL0 A;  3FTS A;  4G24 A;  4MRU A;  4I6E A;  3NQP A;  4E85 A;  3UMV A;  4LEU A;  2V4L A;  2XGS A;  3LVQ E;  4XKC A;  5EX0 A;  4NRH B;  4P29 A;  2C0L A;  2X6F A;  1OWM A;  5G55 A;  5G05 C;  2HYZ A;  2XQ0 A;  5BUZ A;  2BUG A;  5BPP A;  4URK A;  4V3I A;  3RRU A;  4DJA A;  3FU0 A;  2OV8 A;  3PUK A;  5KJN A;  4KVM A;  5E76 A;  4U07 A;  3FU6 A;  4IYP A;  3FUM A;  4BWR A;  2BTD A;  2R5S A;  4A3V A;  4UWH A;  4W9R A;  2RD0 A;  1NA3 A;  5FJY A;  3L6A A;  4ABN A;  4GZ6 A;  4A3T A;  3APC A;  4I17 A;  2XGO A;  5G2N A;  1DNP A;  3UQ3 A;  3URZ A;  1QQE A;  3SHF A;  2VTB B;  4WND A;  2PQR A;  3O4Z A;  4N3A A;  5CMW A;  1WM5 A;  3S7J A;  4GYW A;  3TG5 A;  3ZVV A;  3PE3 A;  3KAE A;  3PE4 A;  4F53 A;  3QWV A;  3G2W A;  3GW4 A;  3CVN A;  4C0M A;  5FT9 A;  4AM9 A;  2L6J A;  3IBE A;  4MKT A;  3UT8 A;  4HOR A;  5ARF A;  4DK5 A;  5JJ7 A;  1X5B A;  5FZS A;  4EBA G;  3PEV B;  3RIB A;  3SD5 A;  3LPZ A;  4ANX A;  4JZY A;  2CG3 A;  2CHX A;  2V0P A;  2J4D A;  1FCH A;  3I4R B;  1Z3Y A;  1HU3 A;  4G23 A;  3G2S A;  4EZJ A;  4UQZ A;  4BFR A;  2WMO A;  3CK7 A;  2VTB A;  4GML A;  2FO7 A;  2P58 C;  5AIJ A;  3HHM A;  3QC1 A;  4YND A;  4DPR A;  3D9I A;  4XKB A;  4WWO A;  3ZYL A;  3IKO B;  3FEX A;  4LER A;  4GA2 A;  4AXH A;  2KZT B;  3CQG B;  5D0Q D;  2HM8 A;  3D9J A;  4CCA A;  3FUJ A;  4C9B B;  4JW1 A;  4DLQ A;  3R9A B;  4JHK A;  4GYY A;  1H19 A;  3JUI A;  2LSU A;  2XCB A;  3TGO A;  4L2Y A;  4DLO A;  3E4B A;  2LSV A;  4BX9 A;  2AWI A;  5LFA A;  1IYG A;  3RU0 A;  4AV7 A;  4ANU A;  3EIQ C;  3Q5M A;  3T5X A;  4JEH A;  3CHO A;  3CK8 A;  4BTB A;  2IOL A;  5FTP A;  4UQX A;  2VGY A;  3AU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...