4IN3B

Crystal structure of the chs5-bch1 exomer cargo adaptor complex
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
721
structure length
589
Chain Sequence
LSQTSIPEVKEDVIGYALHQRRARVGQFQDLGPPDLITFFYCMGIDTSDPTSITIFAKKITDLFISISSWNAFRKYDVNIIVVQTYIINSDGEQSQLPLNVNMIWAETFMSGIVRDIMIMKDNRADGESQNLVETLIFNPFTSGELEDVANNFIKLFPLVYEKGVYLDAPTHVLNPSLTNNYLVETLVEIVRLTKSLEACRKMLKKLIEIHPEAVIILIRVYFACDLEIDAVDLINEQLNSPSSFLADDSKTSHIQLIFKSELLSIQSEFLLDVKRDYKLAKEVAMEAVNCAPNEFKTWYLLTRIYIKLNDMSNALLSLNACPMSQVKEKYVLRRIAPINLHLPLPLDNPMDVQLEQKSADPNLVNLSASSLKSTFQLAYKLLTEIVQITGWEQLLKYRSKIFVSKRLCERWLDNLFMLLYEDLKTYTDWQSEQLYFDAQHKLTVEWELFGLCAKRLGHLPEAAKAFQIGLSQRFSPVCAKNLLQFYIDEHKRIRRDSVSSELTSSQILSSINDIDSSIIDLVVKICCWNHRWYIEFSIILIDALSVAVQDMGITKVHNEIASRFSDPVAQLIDDNILNFLKNFTNDTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Chitin biosynthesis protein CHS5
publication title The exomer cargo adaptor features a flexible hinge domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 183
structure length 589
sequence length 721
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09295 ChAPs ChAPs (Chs5p-Arf1p-binding proteins)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4in3B00
5KJLA 2YQ8A 4G1TA 1IYGA 3KAEA 2UY1B 3PE4A 5G05C 1ELRA 3CVLA 1HH8A 4N2QA 4AY6A 4H7XA 5FT9A 3LCAA 3S7DA 3FFLA 2ONDA 4G26A 2VGXA 3UQ3A 3LY9A 3ZHEA 4A1SA 3S7BA 3S7FA 3GYZA 3KS2A 4W9RA 5G04C 5D0OD 3AS5A 3MV2B 2VSYA 2FBNA 3ZPJA 1P5QA 4XIFA 3MEKA 4JA7A 5KJKA 2FO7A 5CHEE 1KT1A 3OXLA 3SF4A 4F3VA 4GPKA 4N3CA 1E96B 5FZQA 2LNIA 4NQ0A 2XGMA 3K9IA 3NF1A 3CKCA 1YA0A 3BEEA 3FP3A 3MA5A 4GYYA 4RG6A 2J9QA 4B94A 4UQYA 4BTAA 2C0LA 3ESKA 5ARGA 2OOEA 4XI0A 2VGYA 4O6FA 1NZNA 4Y6WA 3CKBA 2HYZA 5FZSA 4GYWA 5FTPA 4GYOA 2WQHA 3URZA 2UY1A 1NA0A 2QFCA 4I1AA 2Y4TA 3GW4A 3TG4A 3RIBA 4KBQA 2BUGA 3EDTB 5LCWJ 5KJMA 3U3WA 3ZGQA 3UPVA 1QZ2A 4G23A 3Q49B 4UI9J 3AS8A 2FF4A 5HQ8A 4J8EA 2XEVA 1ZBPA 4I9EA 2PQRA 2KCVA 4GZ6A 4AIFA 2L6JA 2VYIA 1XNFA 3LY7A 5A7DB 2V5FA 4WNDA 1NA3A 4N5CA 5KJNA 4RG9A 2P58C 4KXKB 3PE3A 2LSUA 3KD7A 1W3BA 2JLBA 2C2LA 2IF4A 1HZ4A 4BWRA 3ASDA 4HORA 5EX0A 3E4BA 3CVQA 2XCBA 5JJ6A 2KCLA 3Q5MA 2E2EA 5LCWC 1WAO1 3CK9A 2Y4UA 2VQ2A 4UI9K 2I6HA 3VTYA 2VGXB 4UI9C 3RO2A 2HO1A 4J0UA 3Q4AB 4GCOA 1KLXA 4CDRA 4GCNA 2KC7A 4GA2A 2XPIA 3LYAA 1B89A 4GA0A 5HI7A 3RU0A 1Y8MA 3ASHA 5CCMA 4XI9A 5EX3A 5EKQD 2PQNA 3VTXA 4CGVA 4WNFA 1OUVA 3ZFWA 3S7JA 3TAXA 3CV0A 3PDNA 3QDNA 2KATA 1KT0A 2PL2A 4ABNA 3TGOA 3QKYA 3GZ1A 2VSNA 5BW8C 5M72A 4NRHB 4I9CA 3ASGA 4G24A 4UQZA 2UWJG 3AS4A 4APOA 2DBAA 5FZRA 4YVQC 3QWWA 4N3AA 2C0MA 1QQEA 3UUXA 4IN3B 3MV3B 4HOQA 3MKRA 4EQFA 4I17A 3HYMB 4BTBA 2Q7FA 3OXGA 4U0UA 4GA1A 4WUYA 3JYSA 4AM9A 3RKVA 4HOSA 2MHKA 3ZN3A 2WPVA 5FJYA 3IEGA 1TJCA 2PZIA 5D0QD 2GW1A 5AYWD 4WNGA 4U07A 3SZ7A 3FWVA 2YHCA 5DIZA 2LSVA 3LPZA 1ZU2A 4ME2A 3WXXA 4JA9A 4J8FA 3LY8A 3QWVA 4N39A 4N2SA 5BNWA 3TG5A 3CK8A 3ZHEB 3CEQA 4JHRA 2AVPA 5CCLA 3CK7A 3OXFA 3RO3A 3CVNA 4BT9A 3U4TA 3CVPA 1FCHA 3ASFA 4H7YA 4Y6CA 5G05J 4UQXA 5ARFA 1A17A 3QWPA 1PC2A 2HR2A 2XGOA 4U0ZA 4YNDA 3O48A 4GZ3A 2FEZA 4N3BA 4WNEA 4U04A 4HOTA 2NC9A 3QOUA 4G2VA 1HXIA 4BT8A 2XGSA 5G04J 5A6CA 5BT1A 2R5SA 5C1DA 3Q47B 2FI7A 4J8DA 5JJ7A 4AY5A 1IHGA 2KCKA 3LKUA 4HOUA 4JL0A 3ULQA 5DBKA 4CGWA 2XCCA 4G25A 1WM5A 4I2WA 4YVOA 4I2ZA 2IFUA 4LEUA 1ELWA 4KYOB 3GZ2A 4U0SA 3Q15A 4GZ5A 3R9AB 5JJTA 3RJVA 3N71A
chains in the Genus database with same CATH superfamily
1X5BA 2YQ8A 3SFZA 3AJIA 4Q69A 5G05C 1N4RA 4AOFA 3CGHA 4FP7A 3CVLA 3E32A 2ZGDA 4N2QA 2X6JA 3IBEA 4H7XA 3TWVA 4Q94A 2DYRE 1X81A 3FUMA 3PS6A 3UQ3A 3S7BA 1TYQG 3KS2A 3ONLA 3UMVA 1RZ4A 4BSXA 5AIJA 2P2CP 3HIZA 3BU8A 4NIKA 2FBNA 3ZPJA 3MEKA 3DSSA 4MBGA 3CHQA 2IEJA 5B1AE 2WXIA 1YYHA 1GW6A 5D2MC 5CMWA 1O1TA 3KSLA 3ZYQA 2WXQA 3L08A 2BF0X 4A3TA 3SF4A 4GPKA 3BQOA 3ISMC 4I6EA 4N3CA 1E8XA 3CSFA 4KVOA 2WXKA 4ILHB 3K9IA 3CKCA 1YA0A 3FP3A 3G2SA 4TXPA 3FUHA 4RG6A 2J9QA 3D9PA 3DSVA 2OEWA 3DBSA 1IKND 2C0LA 1JPLA 2VGYA 4O6FA 2V4LA 4ANUA 2RFMA 4BY6A 4B0ZA 4BFRA 3IHVA 4F53A 5EYPF 1OT8A 2J07A 4AEZC 1NA0A 4CT0A 1OWNA 3VLFA 3ZXPA 2Y4TA 1H19A 4FLBA 5JMND 3ZVVA 1FT2A 2CHZA 3L82A 3TG4A 2KXPC 2MYOA 3NOCD 3I4GA 3EDTB 1NL4A 2LO6A 2ILRA 2J09A 5LCWJ 5KJMA 4ILIA 3ZGQA 3FU6A 1Z3XA 4UI9J 2XEVA 4JPSA 3LDZA 4GZ6A 4AIFA 2B0OE 3UM1A 3RRUA 2GRQB 3LY7A 4I6GA 1DCEA 3ZYKA 5A7DB 4DX6D 2EINE 5A23A 3I4RB 3PH0C 4RG9A 2ZU6B 4OVUA 3J5QB 3DSTA 3L54A 4KZCA 4FJZA 2IF4A 1HZ4A 2BKKB 1TJFA 3W9FA 5EX0A 3NBNB 3LVQE 2Y1LE 3E4BA 2IO3C 2DCPA 4HQDA 2DWZA 4HFGA 2XZDG 2E2EA 2L0TB 1ZB1A 1WAO1 3PUJA 3FTVA 2Y4UA 2VQ2A 4UI9K 2I6HA 2H6GA 4JHJA 2HO1A 1LD7A 3DEPA 1UJJA 2WB2A 1U2VG 3UM3A 4LERA 2XPIA 3UX4A 3LYAA 4HI9A 3APCA 4J7WA 4PH4B 5HI7A 3T8KA 3FU0A 3FU3A 3O4ZA 5AQBA 2PQNA 4WNFA 3FUEA 3G2UA 3ZFWA 3CV0A 2F37A 3QDNA 3U64A 3RRMB 4FULA 4RQIA 5CEDB 3SQVA 3FULA 5FQ6A 5BW8C 3V79K 4A63B 4I9CA 3UT7A 3ASGA 4J8SA 4UQZA 5J08A 2X6KA 4APOA 2R03A 1PAQA 2BKGA 5ENSD 5FQ8A 4HOQA 3KEAA 4D10C 1SQMA 4I17A 4UUCA 3RAUA 3OXGA 3Q78A 3NZSA 4HLLA 3QB2A 3X2QE 4DUIA 2M63A 3R9MA 2Y0BG 1K1AA 4JW1A 1N4PA 5AENA 1TR4A 1TJCA 2GW1A 3DRAA 2KZTA 4RSYA 5HKPA 2RFAA 3E33A 3JXIA 1N54A 3ULYA 2J49A 3ML8A 3KEZA 2XENA 3SGHA 2WXHA 5DIZA 5HRYA 4L7TA 3QNKA 3DXMG 3CHPA 4HI8A 4CCAA 4WWPA 4G11A 1S0PA 1H2TC 4N39A 4I1OB 4UWKA 3TG5A 3ABKE 4FU3A 5FQ7A 1SZAA 1HG5A 3I3NA 3RRNB 4I6JA 5T4YA 5BXOA 4LG6A 4HBDA 3RO3A 4OAVB 3ASFA 3HVEB 1OCCE 4UQXA 3QWPA 1FVFA 4GTQA 3W9GA 5AJDA 2P9LG 1H2UA 4GZ3A 1Z6TA 2FEZA 3HHMA 5CMYA 4U04A 5AN8A 2NC9A 2EILE 1N4QA 1N11A 5BT1A 1PY1A 4APFA 3CVXA 4J8DA 3PEVB 1IHGA 2KCKA 4PUCA 4HOUA 2QYUA 2EIJE 5BV0A 3D9LA 4YVOA 3CVVA 2IFUA 4ZFHA 3PNLB 3GZ2A 4DPRA 5E76A 3QAQA 4GZ5A 4UWGA 3HXFA 3R9AB 5LP0A 4ANXA 5KJLA 3RSEG 4WWOA 5CECB 1IYGA 4CZ2D 1ELRA 4A1GA 3OAWA 4QFVA 5B3SE 2R2LA 3FFLA 4B8AA 3MGBA 2ETAA 3ZHEA 4C9BB 3S7FA 3GYZA 3PZ1A 4GPMA 3D9OA 3B95A 2XZTG 1G3NB 2A4ZA 4W9RA 4EZKA 1EF1C 1OWLA 3AS5A 2VSYA 3MKQB 3V31A 4WAFA 1Z3YA 3FDHA 3DEOA 4JA7A 3DSWA 4DI3A 1UN9A 2I1KA 2WXGA 4L23A 4CYMD 4G8KA 4TXQA 3SBSA 4BETA 1SA4A 3FTWA 4UWHA 1OWMA 1N0QA 3AG1E 1H0AA 4MS6A 4LNBA 3NF1A 4HVBA 4UWFA 1AWCB 3FUJA 4B94A 4UQYA 1BD8A 4DRXE 3P1UA 1EDUA 2GROB 3LJ3A 1NZNA 2X38A 4CRWA 4GYWA 2R02A 4XX5A 4JVSA 3LJNA 1DCQA 1TN8A 4PS3A 3DPYA 3EHNA 5FTPA 4MRUA 2UY1A 3U9WA 2QFCA 3LVRE 4LUNU 2I9CA 2ZISA 4ZHBA 3QARA 4GZCA 3GW4A 4F7AA 3S2AA 3PRZA 4PDXA 2BUGA 2J4BA 4F6RD 2J8SD 4BSZB 1INZA 2I1JA 3P2BA 3D9HA 4R7LA 3SO8A 2AWIA 5HQ8A 1ZBPA 4I9EA 4OVVA 4U7EB 2WQ6A 3R7QA 2WXMA 2AXVA 2VYIA 4YDEA 5ENTD 1N95A 3UI2A 1LF8A 2X6FA 4K03A 4L2LA 4N5CA 3IV0A 2P58C 3UIPC 3PE3A 1W3BA 3TXMA 3ASDA 5LOZA 3AG4E 1JWGA 3EU5A 2XCBA 2DYSE 4BEPA 1E7VA 2KCLA 3Q5MA 5LCWC 1RW2A 3HXCA 3VTYA 3UM2A 1IXVA 5EIDA 3CIAA 2R59A 4UI9C 4XKBA 1EYHA 4J0UA 2MOWA 2V8SE 2FO1E 1WDYA 4GCNA 2QZAA 4LSZE 2KC7A 4GTVA 4GTOA 1B89A 1TN6A 3AU4A 4IULA 4FHKA 4XI9A 1JWFA 4YDOA 5EX3A 5EKQD 4HLEA 1HF8A 1TNUA 2GGFA 3ZXSA 4E85A 4CGVA 1OUVA 3S7JA 3FUFA 3PDNA 4K0RA 3EJNA 1E8YA 2KATA 1KT0A 2PL2A 2L9BA 4ATGA 3TGOA 2WXOA 1TNBA 4N5QA 3MYVA 3TXNA 4NRHB 2V4HC 5AQ7A 5ENRD 5CBOA 2UWJG 3AS4A 3L16A 4PS8A 1IHBA 3UIOC 4GMRA 4N3AA 3CHRA 1YCSB 2C0MA 5EYLA 1QQEA 3MV3B 1BI7B 3HXBA 2WXRA 1K8KG 2LXMA 3HYMB 2Q7FA 1QBQA 4EHMA 1OWPA 4GA1A 5ENNA 1S63A 3ASOE 2NSZA 4I1MA 4LNGA 2P9NG 3RKVA 4G8LA 2VSXE 3B7BA 1E90A 3IEGA 2IO2C 3I5PA 1UJKA 1D8DA 4C0MA 2IJGX 2PZIA 5KBAA 5D0QD 5AYWD 1HX8A 4HXIA 3UXGA 4GMJA 3V2OA 1OCRE 3FWVA 3NB2A 3ASNE 2YHCA 3SHFA 3LPZA 3ML9A 5BXUA 1ZU2A 3PUKA 3SI5A 3WXXA 2BEDA 1S70B 3QWVA 4GTSA 5BNWA 3L22A 2RG8A 3APFA 4FA6A 4TXRA 3CEQA 3C3QA 3C3OA 1TNOA 2ETCA 5CCLA 3CK7A 4FLHA 3OXFA 3C98A 4A3VA 3CVNA 3CVPA 4GU5A 3C3RA 5ARFA 1H2VC 4LRZA 4U8HA 2XGOA 5FINA 2VTBA 1KZPA 3D9JA 3QOUA 1E8ZA 2NYJA 4BT8A 3CHOA 5G04J 5A6CA 3SBTB 1E8WA 2R5SA 3EIJA 4PS7A 3RK6A 1UOHA 3L17A 4GTTA 3IKOB 2OVFA 1D9SA 2GRMA 4ILGA 2AXUA 4AV7A 4XEIG 1HFAA 5KNGA 4CDMA 4I2ZA 1TNZA 4CDNA 4LEUA 4KYOB 3BG0B 1SZ9A 4ATZD 3N71A 3HXEA 4G1TA 3CVYA 3MJWA 1H6OA 2KM4A 3KAEA 2YINA 4DX7D 2EQXA 3PE4A 3TWUA 2XS1A 1DVPA 5ITZF 3TL5A 1OWOA 1HH8A 3E34A 5FT9A 4L9PA 3UT8A 5CBNA 2VGXA 1JCSA 2EIME 1HO8A 4J8YA 5D0OD 3MV2B 4HRLA 1JUQA 1P5QA 4XIFA 5JHBA 2PM7A 3JUIA 3ABLE 5KJKA 2F0YA 4NURA 2FO7A 3E37A 2I2OA 4K5CA 2IU1A 3IXEA 4C48B 3ZW3A 4TRQA 3NQPA 3VLDA 3TWWA 5AAOA 1HS6A 3FU5A 2LNIA 1VDYA 4NQ0A 2XGMA 2E0IA 5ENPD 5CRVA 3D9IA 1MZCA 1WY6A 2GRPB 3BEEA 1V55E 1K1BA 3MA5A 4GYYA 4BTAA 3TWSA 5ARGA 3UKRG 5BUZA 4XI0A 3APDA 3B13A 3CKBA 5FZSA 2YHEA 3D9MA 1FT1A 3TWTA 1H6KA 1L5JA 2WXJA 4IYPA 3CVWA 4GYOA 2QYJA 2WQHA 4ACKA 3ESLA 4I43A 5IY5E 3NAWA 3FH8A 2EIKE 2F8YA 4KBQA 2H6HA 4M3OA 2X3MA 1MHQA 1UN8A 3SFYA 2AW6A 2P9IG 1SW6A 3PEUB 5FQ4A 3ABME 3NZUA 2LAHA 1QZ2A 5EILA 4G23A 5AQAA 3V30A 2RD0A 1E7UA 4J6IA 3FY4A 2KCVA 2L6JA 3JQ1A 2B6CA 2AXZA 1XNFA 1QNFA 4EBAG 2V5FA 5KCMA 1NA3A 4DLQA 3L13A 4CEMA 1O5MA 4KXKB 1FVHA 4KMOA 2LSUA 3KD7A 3R7RA 2DZOA 3PZ2A 2JLBA 2QC9A 4TV3A 4BWRA 2GRLA 4HORA 4HNAD 2WXLA 3EU9A 3CVQA 1IQRA 3MZLB 4FC8A 4RVBA 1QYMA 1Y6IA 4NACA 4LNUD 3ZIMA 2KZTB 3CK9A 2VGXB 4EBAA 2CG3A 4JEHA 4V3IA 3RO2A 3Q4AB 4GCOA 3Q7FA 2VJ8A 2WMNA 1N94A 3ZUVB 4RLYA 3E30A 4C0EA 5BV1A 4GA2A 2H6IA 3FTYA 4GA0A 1Y8MA 3ASHA 5CCMA 4JZYA 4HRNA 3DSXA 1U3CA 2P9KG 5AQ9A 2A5UA 4GMLA 3FTSA 3ZRHA 2KBXA 1DC2A 1SA5A 3LEWA 4L1BA 4BERA 2ETBA 2VSNA 3TWQA 5T8IA 2XS8A 5ENQD 4MKTA 4AVXA 4OAUC 3FH5A 1HE8A 1TNYA 5FZRA 4YVQC 2OV8A 3G2VA 3QWWA 2GRRB 1A5EA 2WQ7A 3UT4A 3ZNGA 2CG2A 3ONKA 2XPZA 3SNXA 3FUNA 1FPPA 4JC8A 5FIOA 4BTBA 4U0UA 4CT4A 2NXPA 1O1RA 3UTMA 5FWQA 3UM0A 4WUYA 4F1PA 4ANVA 2MHKA 3PREA 3TWXA 2P9PG 1D8EA 4TUMA 3DXKG 1K3ZD 3B7UX 4AXHA 2ZXWE 4U07A 4XE0A 3SZ7A 2CHWA 5G55A 1ELKA 2LSVA 3FEYA 2IQCA 2RKKA 4J8FA 1NP7A 3LY8A 3FTUA 3IHYA 3TJPA 3JCKC 3Q79A 4M7CA 4N2SA 3ZHEB 3ENEA 4JHRA 1KPSB 1BLXB 3JQ0A 4JHKA 4WWNA 3T5XA 2R17C 3G2WA 4OYSA 1FCHA 2J4DA 1U3DA 4H7YA 5G05J 5EN5D 2A5EA 1PC2A 1MX2A 1MJ0A 2PM6A 3DWLG 4WNEA 1MYOA 3C5RA 4HOTA 4G2VA 4O60A 5E75A 2AJAA 2OCCE 2XGSA 2FULA 2XQ0A 5C1DA 2R05A 5JJ7A 2OEVA 4B89A 5BPPA 4GAAA 4B93B 4TUUA 3Q7AA 2XEHA 3FHEA 4JB8P 2XCCA 1O1SA 4KT6B 4G25A 4QQIA 5ENOD 1WM5A 4I2WA 1AP7A 2WM9A 3PZDA 1OXJA 4FHJA 3L6AA 1ELWA 3CHSA 3Q15A 1H6PA 3HRAA 1BPOA 3CQGB 5JJTA 4JD2G 3RJVA 5AJLA 5H7PA 1NFIE 2UY1B 4KZ0A 4AY6A 3DPDA 3AG3E 3LCAA 3S7DA 3FUIA 5HS0A 2ONDA 4G26A 3LY9A 4A1SA 3GZSA 1BU9A 1YMPA 2LAIA 5G04C 2L6BA 4BX9A 5LX8A 2LXLA 4IRUA 4LCTA 4YDWA 2XRZA 3FUKA 2Y3AA 3HVEA 2CHXA 4K5AB 5CHEE 1KT1A 3OXLA 3B7TA 4BESA 4Z68A 1WG0A 4F3VA 1UW4B 1JCQA 3JUEA 1E96B 5FZQA 2XEEA 1JCRA 5EDSA 1OCZE 4UWLA 2QY7A 3FTZA 4MLPA 4B8CB 3U66A 3CHMA 4U8VD 3NOGD 2VGEA 4DI4A 1HU3A 3LS8A 3PVLA 3C72A 3ESKA 2OOEA 1OY3D 4Y6WA 2HYZA 2OVBA 2WVIA 4ACLA 2IOLA 2XPYA 2WXNA 3CSTA 4U63A 3V2XA 3SFXA 4HS2A 3URZA 4JXTA 3FH7A 5KNHD 1MQSA 3D3MA 4I1AA 3D9NA 3QC1A 3RIBA 5C2YA 1Z5SC 3EHMA 1N9AA 3MCXA 3Q73A 1HG2A 4GZDA 2DZNA 3L9TA 5B1BE 4O1PA 3U3WA 5G2NA 3BG1B 3B7SA 2DVWA 3UPVA 2BTDA 3ZKJA 3MKQA 3Q49B 2LUHA 3AS8A 2FF4A 4J8EA 2P9SG 2IOSA 3JXJA 4ANWA 2PQRA 4WNDA 2ZIRA 1EPUA 5AARA 5KJNA 4EPZA 1MX6A 3SY2A 2C2LA 2PNNA 4DX5D 4K5BA 5CERB 1S64A 3TWRA 2CFZA 3T8MA 1NI1A 5JJ6A 4P29A 3T9KA 3SD5A 4EZLA 4XKCA 3UINC 2IONA 3FTXA 3QJZA 4L2YA 1KLXA 3AAAC 4CDRA 2P9UG 4GB9A 2JEKA 3DSUA 2Y69E 3LXUX 3RU0A 3UKUG 5EIBE 4U96D 4HB5A 1TEZA 3VTXA 4XZ4A 4EZJA 4FADA 3TAXA 3MX3A 1UG3A 3HXDA 4X8QA 5JA4D 1V54E 2YNQA 3Q75A 4ABNA 3QKYA 3GZ1A 3PZ3A 4AJWA 5M72A 2XHEA 3F6QA 4O1OA 2V5QC 3WG7E 4Q96A 4G24A 1BI8B 1N52A 2V0PA 2DBAA 4DJAA 4GTRA 2VTBB 3UUXA 3ZYLA 2DIWA 4IN3B 4U8YD 3MKRA 5LFAA 3EHQA 4GTPA 3CQCB 4EQFA 5CRUA 5CEAA 2J08A 2X6HA 4E6HA 3JYSA 1LD8A 4AM9A 3OTNA 2VSOE 4HOSA 3ZN3A 4JEUA 4GTMA 2WPVA 1N0RA 1LTXA 5FJYA 3AU5A 2WXPA 4HRMB 3FEXA 3D9KA 1OCOE 3Q9NC 4WNGA 3ZU7B 4AP2A 3FUDA 3VLEA 5KWDA 4DX2A 2HE0A 5ANLA 3HG0D 4ME2A 1DNPA 1SVXA 2WMOA 5T3RA 4A55A 2GRNB 4JA9A 3CVUA 4EECA 2IY0C 4U95D 3B7RL 3CK8A 3ZYMA 4YDYA 2JABA 5J90A 2X6IA 2AVPA 4KVMA 1KZOA 2XRYA 1N4SA 1TN7A 2ZGGA 3U4TA 4BT9A 1MX4A 3CR3A 5ANRA 4Y6CA 3QK0A 3PNTB 1A17A 2H6FA 2HR2A 4U0ZA 3T5VA 4YNDA 2HM8A 3O48A 4BX8A 1Q2ZA 1XGWA 3CLJA 2L0IA 5D66A 3ZEFA 4N3BA 3AG2E 3EIQC 3EHRA 1HXIA 4DLOA 1IQUA 2WXFA 3ULEG 3Q47B 3J5PA 2FI7A 2MRIA 4F1SA 4AY5A 4DK5A 3Q9UC 4URKA 3LKUA 4JL0A 3BUAA 3ULQA 5DBKA 4CGWA 5JHAA 3PZ4A 3G2TA 3KSQA 4FJYA 2F8XK 3EUVA 4DX1A 3HDXA 4U0SA 2CFUA
chains in the Genus database with same CATH topology
5KJLA 1X5BA 2YQ8A 4G1TA 3SFZA 3CVYA 3MJWA 4WWOA 1IYGA 2KM4A 3KAEA 2UY1B 2YINA 2EQXA 4KZ0A 3PE4A 4Q69A 5G05C 1ELRA 1DVPA 4AOFA 3CGHA 4FP7A 3TL5A 4A1GA 3CVLA 3OAWA 1OWOA 1HH8A 4QFVA 4N2QA 2X6JA 4AY6A 3IBEA 4H7XA 5FT9A 3DPDA 3LCAA 3S7DA 3FUIA 4Q94A 3FFLA 4B8AA 2ONDA 3UT8A 3FUMA 3PS6A 3MGBA 4G26A 2VGXA 3UQ3A 3LY9A 3ZHEA 4A1SA 3S7BA 3GZSA 4C9BB 3S7FA 3GYZA 3KS2A 3D9OA 4W9RA 2A4ZA 3ONLA 4EZKA 2LAIA 3UMVA 1EF1C 5G04C 1HO8A 4BSXA 4BX9A 5LX8A 5D0OD 5AIJA 3HIZA 1OWLA 3AS5A 3MV2B 2VSYA 4IRUA 4LCTA 3MKQB 4WAFA 1Z3YA 3FDHA 2FBNA 3FUKA 2XRZA 1JUQA 3ZPJA 1P5QA 2Y3AA 3HVEA 2CHXA 3MEKA 4XIFA 2PM7A 3JUIA 4JA7A 5JHBA 3CHQA 4DI3A 1UN9A 5KJKA 2I1KA 2WXGA 4NURA 4L23A 2WXIA 2FO7A 5CHEE 1GW6A 1KT1A 2I2OA 5CMWA 3OXLA 2IU1A 3ZYQA 3SBSA 2WXQA 3B7TA 3L08A 2BF0X 3ZW3A 4A3TA 4TRQA 3SF4A 4F3VA 4GPKA 3NQPA 1UW4B 4I6EA 3VLDA 4N3CA 3FTWA 4UWHA 1E96B 1OWMA 5FZQA 1E8XA 1HS6A 3CSFA 4KVOA 1H0AA 3FU5A 2LNIA 2WXKA 4MS6A 1VDYA 5EDSA 4ILHB 2XGMA 4NQ0A 2E0IA 3K9IA 3D9IA 3NF1A 4UWLA 4HVBA 3CKCA 4UWFA 1WY6A 2QY7A 1YA0A 3FTZA 4MLPA 3BEEA 4B8CB 3U66A 3CHMA 3FP3A 3MA5A 3G2SA 3FUHA 4GYYA 4RG6A 2J9QA 3FUJA 3D9PA 4B94A 3DBSA 4UQYA 4DI4A 4BTAA 1HU3A 3LS8A 3PVLA 2C0LA 3ESKA 5ARGA 2OOEA 3P1UA 5BUZA 1JPLA 4XI0A 1EDUA 2VGYA 3APDA 3LJ3A 4O6FA 3B13A 1NZNA 4Y6WA 3CKBA 2V4LA 2HYZA 5FZSA 2X38A 2OVBA 4ANUA 2YHEA 3D9MA 2WVIA 4BY6A 4CRWA 4ACLA 4B0ZA 4GYWA 4BFRA 4XX5A 3IHVA 4JVSA 4F53A 2IOLA 2XPYA 1H6KA 4PS3A 2WXNA 3EHNA 5FTPA 1L5JA 3CSTA 2WXJA 4IYPA 4U63A 2J07A 4MRUA 3CVWA 4GYOA 4AEZC 4ACKA 2WQHA 4HS2A 2UY1A 1NA0A 3URZA 4JXTA 4CT0A 3FH7A 3U9WA 3ESLA 1OWNA 1MQSA 2QFCA 3LVRE 3D3MA 4I43A 3VLFA 4I1AA 4LUNU 2I9CA 4ANXA 2Y4TA 1H19A 4FLBA 3D9NA 3ZVVA 3QC1A 3FH8A 3QARA 4GZCA 2CHZA 3GW4A 3RIBA 3TG4A 4F7AA 5C2YA 4KBQA 3S2AA 3EHMA 3MCXA 4M3OA 2X3MA 3PRZA 4PDXA 2BUGA 1MHQA 2J4BA 1HG2A 1UN8A 3EDTB 3I4GA 4GZDA 2AW6A 2LO6A 2ILRA 2J09A 5LCWJ 5KJMA 3PEUB 3U3WA 5G2NA 3BG1B 3B7SA 4ILIA 5FQ4A 3ZGQA 3UPVA 1INZA 2BTDA 2I1JA 3P2BA 3NZUA 3FU6A 4R7LA 2LAHA 3MKQA 1QZ2A 4G23A 3Q49B 2AWIA 1Z3XA 4UI9J 3AS8A 2FF4A 2RD0A 5HQ8A 4J8EA 2XEVA 1E7UA 2IOSA 1ZBPA 4J6IA 4JPSA 4I9EA 3FY4A 3LDZA 4OVVA 4ANWA 2PQRA 2KCVA 4GZ6A 2WQ6A 3R7QA 2WXMA 2L6JA 4AIFA 3JQ1A 3RRUA 2AXVA 2VYIA 2AXZA 1XNFA 1QNFA 4EBAG 3LY7A 4I6GA 3ZYKA 5A7DB 2V5FA 4WNDA 1LF8A 5KCMA 1EPUA 1NA3A 4DLQA 2X6FA 4K03A 3L13A 4L2LA 4CEMA 5A23A 3I4RB 4N5CA 3PH0C 4RG9A 3IV0A 5KJNA 2P58C 2ZU6B 4KXKB 4OVUA 3PE3A 1FVHA 4KMOA 2LSUA 4EPZA 3KD7A 3R7RA 3L54A 1W3BA 4KZCA 2JLBA 4FJZA 2C2LA 2IF4A 1HZ4A 4TV3A 3TXMA 4BWRA 3ASDA 5LOZA 2GRLA 1TJFA 4HORA 2WXLA 5EX0A 3LVQE 1JWGA 3E4BA 3CVQA 2DCPA 1IQRA 2CFZA 3MZLB 3T8MA 4FC8A 2XCBA 4RVBA 4HFGA 5JJ6A 1E7VA 2KCLA 3Q5MA 1Y6IA 2E2EA 4NACA 2L0TB 5LCWC 3ZIMA 1WAO1 3PUJA 2KZTB 3CK9A 3FTVA 2Y4UA 2VQ2A 4P29A 4UI9K 2I6HA 3VTYA 2VGXB 4EBAA 3CIAA 2R59A 4JHJA 4UI9C 3SD5A 4EZLA 2CG3A 4XKCA 4JEHA 4V3IA 2HO1A 1EYHA 2IONA 2MOWA 2V8SE 3FTXA 3Q4AB 4J0UA 3QJZA 4GCOA 4L2YA 1KLXA 2VJ8A 2WMNA 4CDRA 1UJJA 2WB2A 4GB9A 2JEKA 4C0EA 5BV1A 4GCNA 2KC7A 4LERA 4GA2A 2XPIA 3UX4A 3LYAA 3FTYA 1B89A 3LXUX 3AU4A 4GA0A 3APCA 4IULA 4PH4B 5HI7A 3RU0A 1Y8MA 3ASHA 3FU0A 3FU3A 4FHKA 5CCMA 4XI9A 1JWFA 4JZYA 5EX3A 3O4ZA 5EKQD 4HLEA 2PQNA 1TEZA 3VTXA 1HF8A 2GGFA 4XZ4A 4WNFA 3ZXSA 4E85A 4EZJA 4CGVA 1OUVA 3G2UA 3FUEA 3MX3A 1U3CA 3CV0A 3FUFA 3S7JA 3TAXA 2A5UA 3ZFWA 3PDNA 4GMLA 4K0RA 3FTSA 1UG3A 3EJNA 3QDNA 3RRMB 3U64A 4FULA 3ZRHA 4FADA 1E8YA 2KATA 1KT0A 2PL2A 2YNQA 2L9BA 4ABNA 4ATGA 3TGOA 2WXOA 3LEWA 3QKYA 4L1BA 3FULA 3GZ1A 5FQ6A 2VSNA 4AJWA 5BW8C 5M72A 2XHEA 3MYVA 3TXNA 4NRHB 5T8IA 4I9CA 3UT7A 3ASGA 4Q96A 4MKTA 4J8SA 4G24A 4UQZA 4AVXA 5J08A 3AS4A 2UWJG 2X6KA 3FH5A 4APOA 1N52A 1PAQA 1HE8A 2V0PA 2DBAA 3L16A 4PS8A 4YVQC 5FZRA 2OV8A 4DJAA 3G2VA 3QWWA 3CHRA 4N3AA 5FQ8A 2WQ7A 3UT4A 2C0MA 1QQEA 2VTBB 2CG2A 3UUXA 3ZYLA 2DIWA 4IN3B 3MV3B 4HOQA 3MKRA 5LFAA 3ONKA 2XPZA 2WXRA 3CQCB 3SNXA 3FUNA 4D10C 1SQMA 4EQFA 4I17A 3HYMB 4JC8A 2Q7FA 3OXGA 4BTBA 3NZSA 4U0UA 1OWPA 2NXPA 4GA1A 4CT4A 3QB2A 5ENNA 5FWQA 2J08A 2X6HA 4E6HA 2M63A 2NSZA 4I1MA 3JYSA 4JW1A 4WUYA 4AM9A 4ANVA 3OTNA 3RKVA 2VSOE 4HOSA 2MHKA 3ZN3A 4JEUA 3PREA 2VSXE 2WPVA 5FJYA 3AU5A 2WXPA 5AENA 1E90A 3IEGA 3I5PA 1UJKA 3B7UX 3FEXA 3D9KA 4C0MA 2IJGX 1TJCA 2PZIA 4AXHA 5D0QD 2GW1A 5AYWD 1HX8A 2KZTA 4HXIA 4RSYA 4WNGA 1N54A 4AP2A 4U07A 4GMJA 3FUDA 2J49A 3VLEA 3ML8A 3KEZA 4XE0A 3SZ7A 3FWVA 5ANLA 2CHWA 3SGHA 2YHCA 2WXHA 5G55A 5DIZA 3SHFA 1ELKA 2LSVA 3FEYA 3LPZA 3ML9A 4L7TA 1ZU2A 4ME2A 3QNKA 3PUKA 3SI5A 1DNPA 2WMOA 3WXXA 2IQCA 5T3RA 3CHPA 4A55A 4JA9A 4J8FA 4CCAA 4WWPA 1NP7A 4G11A 1S0PA 3LY8A 3CVUA 1H2TC 3FTUA 3IHYA 4EECA 3TJPA 3JCKC 3QWVA 4N39A 4N2SA 4I1OB 5BNWA 3L22A 2RG8A 3B7RL 4UWKA 3CK8A 3APFA 3TG5A 3ZYMA 4FA6A 3ZHEB 3ENEA 4FU3A 3CEQA 4JHRA 5FQ7A 5J90A 2X6IA 1SZAA 2AVPA 3JQ0A 1HG5A 3I3NA 4KVMA 4JHKA 3RRNB 5CCLA 3CK7A 4WWNA 3T5XA 4I6JA 2XRYA 4FLHA 2R17C 5T4YA 3G2WA 3C98A 3OXFA 3RO3A 4A3VA 3CVNA 4OYSA 4BT9A 3U4TA 3CVPA 1FCHA 2J4DA 1U3DA 3ASFA 4GU5A 3CR3A 4H7YA 5ANRA 3HVEB 4Y6CA 3QK0A 5G05J 4UQXA 3PNTB 5ARFA 1A17A 3QWPA 1FVFA 3RO2A 1PC2A 1H2VC 2HR2A 4LRZA 4U8HA 2XGOA 4U0ZA 5AJDA 3T5VA 1H2UA 4YNDA 2HM8A 3O48A 4BX8A 2PM6A 3CLJA 1XGWA 4GZ3A 1Z6TA 2FEZA 2L0IA 2VTBA 3ZEFA 3HHMA 4N3BA 5CMYA 4WNEA 4U04A 3D9JA 4HOTA 2NC9A 3QOUA 1E8ZA 3EIQC 4G2VA 1HXIA 5E75A 4BT8A 4DLOA 1IQUA 2WXFA 2XGSA 3CHOA 5G04J 5A6CA 3SBTB 1E8WA 2FULA 2XQ0A 5BT1A 1PY1A 2R5SA 4APFA 5C1DA 3EIJA 3Q47B 3CVXA 2FI7A 4J8DA 5JJ7A 2MRIA 3PEVB 4F1SA 4AY5A 4DK5A 4B89A 5BPPA 1IHGA 4GAAA 4PS7A 3RK6A 2KCKA 4URKA 3L17A 3IKOB 2OVFA 4PUCA 4TUUA 3LKUA 2GRMA 4HOUA 4ILGA 2AXUA 4JL0A 4AV7A 3ULQA 5DBKA 4CGWA 3FHEA 5BV0A 5JHAA 2XCCA 4KT6B 1HFAA 4G25A 4XKBA 4CDMA 3D9LA 1WM5A 4I2WA 4YVOA 2WM9A 3PZDA 3G2TA 4I2ZA 3CVVA 4FHJA 4FJYA 4CDNA 2IFUA 3L6AA 3PNLB 4LEUA 1ELWA 4KYOB 3GZ2A 3HDXA 3BG0B 4DPRA 4U0SA 3CHSA 1SZ9A 5E76A 3Q15A 3QAQA 4GZ5A 4UWGA 1BPOA 2CFUA 3CQGB 3R9AB 5LP0A 5JJTA 3RJVA 5AJLA 3N71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KJL A;  2YQ8 A;  4G1T A;  1IYG A;  3KAE A;  2UY1 B;  3PE4 A;  5G05 C;  1ELR A;  3CVL A;  1HH8 A;  4N2Q A;  4AY6 A;  4H7X A;  5FT9 A;  3LCA A;  3S7D A;  3FFL A;  2OND A;  4G26 A;  2VGX A;  3UQ3 A;  3LY9 A;  3ZHE A;  4A1S A;  3S7B A;  3S7F A;  3GYZ A;  3KS2 A;  4W9R A;  5G04 C;  5D0O D;  3AS5 A;  3MV2 B;  2VSY A;  2FBN A;  3ZPJ A;  1P5Q A;  4XIF A;  3MEK A;  4JA7 A;  5KJK A;  2FO7 A;  5CHE E;  1KT1 A;  3OXL A;  3SF4 A;  4F3V A;  4GPK A;  4N3C A;  1E96 B;  5FZQ A;  2LNI A;  4NQ0 A;  2XGM A;  3K9I A;  3NF1 A;  3CKC A;  1YA0 A;  3BEE A;  3FP3 A;  3MA5 A;  4GYY A;  4RG6 A;  2J9Q A;  4B94 A;  4UQY A;  4BTA A;  2C0L A;  3ESK A;  5ARG A;  2OOE A;  4XI0 A;  2VGY A;  4O6F A;  1NZN A;  4Y6W A;  3CKB A;  2HYZ A;  5FZS A;  4GYW A;  5FTP A;  4GYO A;  2WQH A;  3URZ A;  2UY1 A;  1NA0 A;  2QFC A;  4I1A A;  2Y4T A;  3GW4 A;  3TG4 A;  3RIB A;  4KBQ A;  2BUG A;  3EDT B;  5LCW J;  5KJM A;  3U3W A;  3ZGQ A;  3UPV A;  1QZ2 A;  4G23 A;  3Q49 B;  4UI9 J;  3AS8 A;  2FF4 A;  5HQ8 A;  4J8E A;  2XEV A;  1ZBP A;  4I9E A;  2PQR A;  2KCV A;  4GZ6 A;  4AIF A;  2L6J A;  2VYI A;  1XNF A;  3LY7 A;  5A7D B;  2V5F A;  4WND A;  1NA3 A;  4N5C A;  5KJN A;  4RG9 A;  2P58 C;  4KXK B;  3PE3 A;  2LSU A;  3KD7 A;  1W3B A;  2JLB A;  2C2L A;  2IF4 A;  1HZ4 A;  4BWR A;  3ASD A;  4HOR A;  5EX0 A;  3E4B A;  3CVQ A;  2XCB A;  5JJ6 A;  2KCL A;  3Q5M A;  2E2E A;  5LCW C;  1WAO 1;  3CK9 A;  2Y4U A;  2VQ2 A;  4UI9 K;  2I6H A;  3VTY A;  2VGX B;  4UI9 C;  3RO2 A;  2HO1 A;  4J0U A;  3Q4A B;  4GCO A;  1KLX A;  4CDR A;  4GCN A;  2KC7 A;  4GA2 A;  2XPI A;  3LYA A;  1B89 A;  4GA0 A;  5HI7 A;  3RU0 A;  1Y8M A;  3ASH A;  5CCM A;  4XI9 A;  5EX3 A;  5EKQ D;  2PQN A;  3VTX A;  4CGV A;  4WNF A;  1OUV A;  3ZFW A;  3S7J A;  3TAX A;  3CV0 A;  3PDN A;  3QDN A;  2KAT A;  1KT0 A;  2PL2 A;  4ABN A;  3TGO A;  3QKY A;  3GZ1 A;  2VSN A;  5BW8 C;  5M72 A;  4NRH B;  4I9C A;  3ASG A;  4G24 A;  4UQZ A;  2UWJ G;  3AS4 A;  4APO A;  2DBA A;  5FZR A;  4YVQ C;  3QWW A;  4N3A A;  2C0M A;  1QQE A;  3UUX A;  4IN3 B;  3MV3 B;  4HOQ A;  3MKR A;  4EQF A;  4I17 A;  3HYM B;  4BTB A;  2Q7F A;  3OXG A;  4U0U A;  4GA1 A;  4WUY A;  3JYS A;  4AM9 A;  3RKV A;  4HOS A;  2MHK A;  3ZN3 A;  2WPV A;  5FJY A;  3IEG A;  1TJC A;  2PZI A;  5D0Q D;  2GW1 A;  5AYW D;  4WNG A;  4U07 A;  3SZ7 A;  3FWV A;  2YHC A;  5DIZ A;  2LSV A;  3LPZ A;  1ZU2 A;  4ME2 A;  3WXX A;  4JA9 A;  4J8F A;  3LY8 A;  3QWV A;  4N39 A;  4N2S A;  5BNW A;  3TG5 A;  3CK8 A;  3ZHE B;  3CEQ A;  4JHR A;  2AVP A;  5CCL A;  3CK7 A;  3OXF A;  3RO3 A;  3CVN A;  4BT9 A;  3U4T A;  3CVP A;  1FCH A;  3ASF A;  4H7Y A;  4Y6C A;  5G05 J;  4UQX A;  5ARF A;  1A17 A;  3QWP A;  1PC2 A;  2HR2 A;  2XGO A;  4U0Z A;  4YND A;  3O48 A;  4GZ3 A;  2FEZ A;  4N3B A;  4WNE A;  4U04 A;  4HOT A;  2NC9 A;  3QOU A;  4G2V A;  1HXI A;  4BT8 A;  2XGS A;  5G04 J;  5A6C A;  5BT1 A;  2R5S A;  5C1D A;  3Q47 B;  2FI7 A;  4J8D A;  5JJ7 A;  4AY5 A;  1IHG A;  2KCK A;  3LKU A;  4HOU A;  4JL0 A;  3ULQ A;  5DBK A;  4CGW A;  2XCC A;  4G25 A;  1WM5 A;  4I2W A;  4YVO A;  4I2Z A;  2IFU A;  4LEU A;  1ELW A;  4KYO B;  3GZ2 A;  4U0S A;  3Q15 A;  4GZ5 A;  3R9A B;  5JJT A;  3RJV A;  3N71 A; 
#chains in the Genus database with same CATH topology
 1X5B A;  2YQ8 A;  3SFZ A;  3AJI A;  4Q69 A;  5G05 C;  1N4R A;  4AOF A;  3CGH A;  4FP7 A;  3CVL A;  3E32 A;  2ZGD A;  4N2Q A;  2X6J A;  3IBE A;  4H7X A;  3TWV A;  4Q94 A;  2DYR E;  1X81 A;  3FUM A;  3PS6 A;  3UQ3 A;  3S7B A;  1TYQ G;  3KS2 A;  3ONL A;  3UMV A;  1RZ4 A;  4BSX A;  5AIJ A;  2P2C P;  3HIZ A;  3BU8 A;  4NIK A;  2FBN A;  3ZPJ A;  3MEK A;  3DSS A;  4MBG A;  3CHQ A;  2IEJ A;  5B1A E;  2WXI A;  1YYH A;  1GW6 A;  5D2M C;  5CMW A;  1O1T A;  3KSL A;  3ZYQ A;  2WXQ A;  3L08 A;  2BF0 X;  4A3T A;  3SF4 A;  4GPK A;  3BQO A;  3ISM C;  4I6E A;  4N3C A;  1E8X A;  3CSF A;  4KVO A;  2WXK A;  4ILH B;  3K9I A;  3CKC A;  1YA0 A;  3FP3 A;  3G2S A;  4TXP A;  3FUH A;  4RG6 A;  2J9Q A;  3D9P A;  3DSV A;  2OEW A;  3DBS A;  1IKN D;  2C0L A;  1JPL A;  2VGY A;  4O6F A;  2V4L A;  4ANU A;  2RFM A;  4BY6 A;  4B0Z A;  4BFR A;  3IHV A;  4F53 A;  5EYP F;  1OT8 A;  2J07 A;  4AEZ C;  1NA0 A;  4CT0 A;  1OWN A;  3VLF A;  3ZXP A;  2Y4T A;  1H19 A;  4FLB A;  5JMN D;  3ZVV A;  1FT2 A;  2CHZ A;  3L82 A;  3TG4 A;  2KXP C;  2MYO A;  3NOC D;  3I4G A;  3EDT B;  1NL4 A;  2LO6 A;  2ILR A;  2J09 A;  5LCW J;  5KJM A;  4ILI A;  3ZGQ A;  3FU6 A;  1Z3X A;  4UI9 J;  2XEV A;  4JPS A;  3LDZ A;  4GZ6 A;  4AIF A;  2B0O E;  3UM1 A;  3RRU A;  2GRQ B;  3LY7 A;  4I6G A;  1DCE A;  3ZYK A;  5A7D B;  4DX6 D;  2EIN E;  5A23 A;  3I4R B;  3PH0 C;  4RG9 A;  2ZU6 B;  4OVU A;  3J5Q B;  3DST A;  3L54 A;  4KZC A;  4FJZ A;  2IF4 A;  1HZ4 A;  2BKK B;  1TJF A;  3W9F A;  5EX0 A;  3NBN B;  3LVQ E;  2Y1L E;  3E4B A;  2IO3 C;  2DCP A;  4HQD A;  2DWZ A;  4HFG A;  2XZD G;  2E2E A;  2L0T B;  1ZB1 A;  1WAO 1;  3PUJ A;  3FTV A;  2Y4U A;  2VQ2 A;  4UI9 K;  2I6H A;  2H6G A;  4JHJ A;  2HO1 A;  1LD7 A;  3DEP A;  1UJJ A;  2WB2 A;  1U2V G;  3UM3 A;  4LER A;  2XPI A;  3UX4 A;  3LYA A;  4HI9 A;  3APC A;  4J7W A;  4PH4 B;  5HI7 A;  3T8K A;  3FU0 A;  3FU3 A;  3O4Z A;  5AQB A;  2PQN A;  4WNF A;  3FUE A;  3G2U A;  3ZFW A;  3CV0 A;  2F37 A;  3QDN A;  3U64 A;  3RRM B;  4FUL A;  4RQI A;  5CED B;  3SQV A;  3FUL A;  5FQ6 A;  5BW8 C;  3V79 K;  4A63 B;  4I9C A;  3UT7 A;  3ASG A;  4J8S A;  4UQZ A;  5J08 A;  2X6K A;  4APO A;  2R03 A;  1PAQ A;  2BKG A;  5ENS D;  5FQ8 A;  4HOQ A;  3KEA A;  4D10 C;  1SQM A;  4I17 A;  4UUC A;  3RAU A;  3OXG A;  3Q78 A;  3NZS A;  4HLL A;  3QB2 A;  3X2Q E;  4DUI A;  2M63 A;  3R9M A;  2Y0B G;  1K1A A;  4JW1 A;  1N4P A;  5AEN A;  1TR4 A;  1TJC A;  2GW1 A;  3DRA A;  2KZT A;  4RSY A;  5HKP A;  2RFA A;  3E33 A;  3JXI A;  1N54 A;  3ULY A;  2J49 A;  3ML8 A;  3KEZ A;  2XEN A;  3SGH A;  2WXH A;  5DIZ A;  5HRY A;  4L7T A;  3QNK A;  3DXM G;  3CHP A;  4HI8 A;  4CCA A;  4WWP A;  4G11 A;  1S0P A;  1H2T C;  4N39 A;  4I1O B;  4UWK A;  3TG5 A;  3ABK E;  4FU3 A;  5FQ7 A;  1SZA A;  1HG5 A;  3I3N A;  3RRN B;  4I6J A;  5T4Y A;  5BXO A;  4LG6 A;  4HBD A;  3RO3 A;  4OAV B;  3ASF A;  3HVE B;  1OCC E;  4UQX A;  3QWP A;  1FVF A;  4GTQ A;  3W9G A;  5AJD A;  2P9L G;  1H2U A;  4GZ3 A;  1Z6T A;  2FEZ A;  3HHM A;  5CMY A;  4U04 A;  5AN8 A;  2NC9 A;  2EIL E;  1N4Q A;  1N11 A;  5BT1 A;  1PY1 A;  4APF A;  3CVX A;  4J8D A;  3PEV B;  1IHG A;  2KCK A;  4PUC A;  4HOU A;  2QYU A;  2EIJ E;  5BV0 A;  3D9L A;  4YVO A;  3CVV A;  2IFU A;  4ZFH A;  3PNL B;  3GZ2 A;  4DPR A;  5E76 A;  3QAQ A;  4GZ5 A;  4UWG A;  3HXF A;  3R9A B;  5LP0 A;  4ANX A;  5KJL A;  3RSE G;  4WWO A;  5CEC B;  1IYG A;  4CZ2 D;  1ELR A;  4A1G A;  3OAW A;  4QFV A;  5B3S E;  2R2L A;  3FFL A;  4B8A A;  3MGB A;  2ETA A;  3ZHE A;  4C9B B;  3S7F A;  3GYZ A;  3PZ1 A;  4GPM A;  3D9O A;  3B95 A;  2XZT G;  1G3N B;  2A4Z A;  4W9R A;  4EZK A;  1EF1 C;  1OWL A;  3AS5 A;  2VSY A;  3MKQ B;  3V31 A;  4WAF A;  1Z3Y A;  3FDH A;  3DEO A;  4JA7 A;  3DSW A;  4DI3 A;  1UN9 A;  2I1K A;  2WXG A;  4L23 A;  4CYM D;  4G8K A;  4TXQ A;  3SBS A;  4BET A;  1SA4 A;  3FTW A;  4UWH A;  1OWM A;  1N0Q A;  3AG1 E;  1H0A A;  4MS6 A;  4LNB A;  3NF1 A;  4HVB A;  4UWF A;  1AWC B;  3FUJ A;  4B94 A;  4UQY A;  1BD8 A;  4DRX E;  3P1U A;  1EDU A;  2GRO B;  3LJ3 A;  1NZN A;  2X38 A;  4CRW A;  4GYW A;  2R02 A;  4XX5 A;  4JVS A;  3LJN A;  1DCQ A;  1TN8 A;  4PS3 A;  3DPY A;  3EHN A;  5FTP A;  4MRU A;  2UY1 A;  3U9W A;  2QFC A;  3LVR E;  4LUN U;  2I9C A;  2ZIS A;  4ZHB A;  3QAR A;  4GZC A;  3GW4 A;  4F7A A;  3S2A A;  3PRZ A;  4PDX A;  2BUG A;  2J4B A;  4F6R D;  2J8S D;  4BSZ B;  1INZ A;  2I1J A;  3P2B A;  3D9H A;  4R7L A;  3SO8 A;  2AWI A;  5HQ8 A;  1ZBP A;  4I9E A;  4OVV A;  4U7E B;  2WQ6 A;  3R7Q A;  2WXM A;  2AXV A;  2VYI A;  4YDE A;  5ENT D;  1N95 A;  3UI2 A;  1LF8 A;  2X6F A;  4K03 A;  4L2L A;  4N5C A;  3IV0 A;  2P58 C;  3UIP C;  3PE3 A;  1W3B A;  3TXM A;  3ASD A;  5LOZ A;  3AG4 E;  1JWG A;  3EU5 A;  2XCB A;  2DYS E;  4BEP A;  1E7V A;  2KCL A;  3Q5M A;  5LCW C;  1RW2 A;  3HXC A;  3VTY A;  3UM2 A;  1IXV A;  5EID A;  3CIA A;  2R59 A;  4UI9 C;  4XKB A;  1EYH A;  4J0U A;  2MOW A;  2V8S E;  2FO1 E;  1WDY A;  4GCN A;  2QZA A;  4LSZ E;  2KC7 A;  4GTV A;  4GTO A;  1B89 A;  1TN6 A;  3AU4 A;  4IUL A;  4FHK A;  4XI9 A;  1JWF A;  4YDO A;  5EX3 A;  5EKQ D;  4HLE A;  1HF8 A;  1TNU A;  2GGF A;  3ZXS A;  4E85 A;  4CGV A;  1OUV A;  3S7J A;  3FUF A;  3PDN A;  4K0R A;  3EJN A;  1E8Y A;  2KAT A;  1KT0 A;  2PL2 A;  2L9B A;  4ATG A;  3TGO A;  2WXO A;  1TNB A;  4N5Q A;  3MYV A;  3TXN A;  4NRH B;  2V4H C;  5AQ7 A;  5ENR D;  5CBO A;  2UWJ G;  3AS4 A;  3L16 A;  4PS8 A;  1IHB A;  3UIO C;  4GMR A;  4N3A A;  3CHR A;  1YCS B;  2C0M A;  5EYL A;  1QQE A;  3MV3 B;  1BI7 B;  3HXB A;  2WXR A;  1K8K G;  2LXM A;  3HYM B;  2Q7F A;  1QBQ A;  4EHM A;  1OWP A;  4GA1 A;  5ENN A;  1S63 A;  3ASO E;  2NSZ A;  4I1M A;  4LNG A;  2P9N G;  3RKV A;  4G8L A;  2VSX E;  3B7B A;  1E90 A;  3IEG A;  2IO2 C;  3I5P A;  1UJK A;  1D8D A;  4C0M A;  2IJG X;  2PZI A;  5KBA A;  5D0Q D;  5AYW D;  1HX8 A;  4HXI A;  3UXG A;  4GMJ A;  3V2O A;  1OCR E;  3FWV A;  3NB2 A;  3ASN E;  2YHC A;  3SHF A;  3LPZ A;  3ML9 A;  5BXU A;  1ZU2 A;  3PUK A;  3SI5 A;  3WXX A;  2BED A;  1S70 B;  3QWV A;  4GTS A;  5BNW A;  3L22 A;  2RG8 A;  3APF A;  4FA6 A;  4TXR A;  3CEQ A;  3C3Q A;  3C3O A;  1TNO A;  2ETC A;  5CCL A;  3CK7 A;  4FLH A;  3OXF A;  3C98 A;  4A3V A;  3CVN A;  3CVP A;  4GU5 A;  3C3R A;  5ARF A;  1H2V C;  4LRZ A;  4U8H A;  2XGO A;  5FIN A;  2VTB A;  1KZP A;  3D9J A;  3QOU A;  1E8Z A;  2NYJ A;  4BT8 A;  3CHO A;  5G04 J;  5A6C A;  3SBT B;  1E8W A;  2R5S A;  3EIJ A;  4PS7 A;  3RK6 A;  1UOH A;  3L17 A;  4GTT A;  3IKO B;  2OVF A;  1D9S A;  2GRM A;  4ILG A;  2AXU A;  4AV7 A;  4XEI G;  1HFA A;  5KNG A;  4CDM A;  4I2Z A;  1TNZ A;  4CDN A;  4LEU A;  4KYO B;  3BG0 B;  1SZ9 A;  4ATZ D;  3N71 A;  3HXE A;  4G1T A;  3CVY A;  3MJW A;  1H6O A;  2KM4 A;  3KAE A;  2YIN A;  4DX7 D;  2EQX A;  3PE4 A;  3TWU A;  2XS1 A;  1DVP A;  5ITZ F;  3TL5 A;  1OWO A;  1HH8 A;  3E34 A;  5FT9 A;  4L9P A;  3UT8 A;  5CBN A;  2VGX A;  1JCS A;  2EIM E;  1HO8 A;  4J8Y A;  5D0O D;  3MV2 B;  4HRL A;  1JUQ A;  1P5Q A;  4XIF A;  5JHB A;  2PM7 A;  3JUI A;  3ABL E;  5KJK A;  2F0Y A;  4NUR A;  2FO7 A;  3E37 A;  2I2O A;  4K5C A;  2IU1 A;  3IXE A;  4C48 B;  3ZW3 A;  4TRQ A;  3NQP A;  3VLD A;  3TWW A;  5AAO A;  1HS6 A;  3FU5 A;  2LNI A;  1VDY A;  4NQ0 A;  2XGM A;  2E0I A;  5ENP D;  5CRV A;  3D9I A;  1MZC A;  1WY6 A;  2GRP B;  3BEE A;  1V55 E;  1K1B A;  3MA5 A;  4GYY A;  4BTA A;  3TWS A;  5ARG A;  3UKR G;  5BUZ A;  4XI0 A;  3APD A;  3B13 A;  3CKB A;  5FZS A;  2YHE A;  3D9M A;  1FT1 A;  3TWT A;  1H6K A;  1L5J A;  2WXJ A;  4IYP A;  3CVW A;  4GYO A;  2QYJ A;  2WQH A;  4ACK A;  3ESL A;  4I43 A;  5IY5 E;  3NAW A;  3FH8 A;  2EIK E;  2F8Y A;  4KBQ A;  2H6H A;  4M3O A;  2X3M A;  1MHQ A;  1UN8 A;  3SFY A;  2AW6 A;  2P9I G;  1SW6 A;  3PEU B;  5FQ4 A;  3ABM E;  3NZU A;  2LAH A;  1QZ2 A;  5EIL A;  4G23 A;  5AQA A;  3V30 A;  2RD0 A;  1E7U A;  4J6I A;  3FY4 A;  2KCV A;  2L6J A;  3JQ1 A;  2B6C A;  2AXZ A;  1XNF A;  1QNF A;  4EBA G;  2V5F A;  5KCM A;  1NA3 A;  4DLQ A;  3L13 A;  4CEM A;  1O5M A;  4KXK B;  1FVH A;  4KMO A;  2LSU A;  3KD7 A;  3R7R A;  2DZO A;  3PZ2 A;  2JLB A;  2QC9 A;  4TV3 A;  4BWR A;  2GRL A;  4HOR A;  4HNA D;  2WXL A;  3EU9 A;  3CVQ A;  1IQR A;  3MZL B;  4FC8 A;  4RVB A;  1QYM A;  1Y6I A;  4NAC A;  4LNU D;  3ZIM A;  2KZT B;  3CK9 A;  2VGX B;  4EBA A;  2CG3 A;  4JEH A;  4V3I A;  3RO2 A;  3Q4A B;  4GCO A;  3Q7F A;  2VJ8 A;  2WMN A;  1N94 A;  3ZUV B;  4RLY A;  3E30 A;  4C0E A;  5BV1 A;  4GA2 A;  2H6I A;  3FTY A;  4GA0 A;  1Y8M A;  3ASH A;  5CCM A;  4JZY A;  4HRN A;  3DSX A;  1U3C A;  2P9K G;  5AQ9 A;  2A5U A;  4GML A;  3FTS A;  3ZRH A;  2KBX A;  1DC2 A;  1SA5 A;  3LEW A;  4L1B A;  4BER A;  2ETB A;  2VSN A;  3TWQ A;  5T8I A;  2XS8 A;  5ENQ D;  4MKT A;  4AVX A;  4OAU C;  3FH5 A;  1HE8 A;  1TNY A;  5FZR A;  4YVQ C;  2OV8 A;  3G2V A;  3QWW A;  2GRR B;  1A5E A;  2WQ7 A;  3UT4 A;  3ZNG A;  2CG2 A;  3ONK A;  2XPZ A;  3SNX A;  3FUN A;  1FPP A;  4JC8 A;  5FIO A;  4BTB A;  4U0U A;  4CT4 A;  2NXP A;  1O1R A;  3UTM A;  5FWQ A;  3UM0 A;  4WUY A;  4F1P A;  4ANV A;  2MHK A;  3PRE A;  3TWX A;  2P9P G;  1D8E A;  4TUM A;  3DXK G;  1K3Z D;  3B7U X;  4AXH A;  2ZXW E;  4U07 A;  4XE0 A;  3SZ7 A;  2CHW A;  5G55 A;  1ELK A;  2LSV A;  3FEY A;  2IQC A;  2RKK A;  4J8F A;  1NP7 A;  3LY8 A;  3FTU A;  3IHY A;  3TJP A;  3JCK C;  3Q79 A;  4M7C A;  4N2S A;  3ZHE B;  3ENE A;  4JHR A;  1KPS B;  1BLX B;  3JQ0 A;  4JHK A;  4WWN A;  3T5X A;  2R17 C;  3G2W A;  4OYS A;  1FCH A;  2J4D A;  1U3D A;  4H7Y A;  5G05 J;  5EN5 D;  2A5E A;  1PC2 A;  1MX2 A;  1MJ0 A;  2PM6 A;  3DWL G;  4WNE A;  1MYO A;  3C5R A;  4HOT A;  4G2V A;  4O60 A;  5E75 A;  2AJA A;  2OCC E;  2XGS A;  2FUL A;  2XQ0 A;  5C1D A;  2R05 A;  5JJ7 A;  2OEV A;  4B89 A;  5BPP A;  4GAA A;  4B93 B;  4TUU A;  3Q7A A;  2XEH A;  3FHE A;  4JB8 P;  2XCC A;  1O1S A;  4KT6 B;  4G25 A;  4QQI A;  5ENO D;  1WM5 A;  4I2W A;  1AP7 A;  2WM9 A;  3PZD A;  1OXJ A;  4FHJ A;  3L6A A;  1ELW A;  3CHS A;  3Q15 A;  1H6P A;  3HRA A;  1BPO A;  3CQG B;  5JJT A;  4JD2 G;  3RJV A;  5AJL A;  5H7P A;  1NFI E;  2UY1 B;  4KZ0 A;  4AY6 A;  3DPD A;  3AG3 E;  3LCA A;  3S7D A;  3FUI A;  5HS0 A;  2OND A;  4G26 A;  3LY9 A;  4A1S A;  3GZS A;  1BU9 A;  1YMP A;  2LAI A;  5G04 C;  2L6B A;  4BX9 A;  5LX8 A;  2LXL A;  4IRU A;  4LCT A;  4YDW A;  2XRZ A;  3FUK A;  2Y3A A;  3HVE A;  2CHX A;  4K5A B;  5CHE E;  1KT1 A;  3OXL A;  3B7T A;  4BES A;  4Z68 A;  1WG0 A;  4F3V A;  1UW4 B;  1JCQ A;  3JUE A;  1E96 B;  5FZQ A;  2XEE A;  1JCR A;  5EDS A;  1OCZ E;  4UWL A;  2QY7 A;  3FTZ A;  4MLP A;  4B8C B;  3U66 A;  3CHM A;  4U8V D;  3NOG D;  2VGE A;  4DI4 A;  1HU3 A;  3LS8 A;  3PVL A;  3C72 A;  3ESK A;  2OOE A;  1OY3 D;  4Y6W A;  2HYZ A;  2OVB A;  2WVI A;  4ACL A;  2IOL A;  2XPY A;  2WXN A;  3CST A;  4U63 A;  3V2X A;  3SFX A;  4HS2 A;  3URZ A;  4JXT A;  3FH7 A;  5KNH D;  1MQS A;  3D3M A;  4I1A A;  3D9N A;  3QC1 A;  3RIB A;  5C2Y A;  1Z5S C;  3EHM A;  1N9A A;  3MCX A;  3Q73 A;  1HG2 A;  4GZD A;  2DZN A;  3L9T A;  5B1B E;  4O1P A;  3U3W A;  5G2N A;  3BG1 B;  3B7S A;  2DVW A;  3UPV A;  2BTD A;  3ZKJ A;  3MKQ A;  3Q49 B;  2LUH A;  3AS8 A;  2FF4 A;  4J8E A;  2P9S G;  2IOS A;  3JXJ A;  4ANW A;  2PQR A;  4WND A;  2ZIR A;  1EPU A;  5AAR A;  5KJN A;  4EPZ A;  1MX6 A;  3SY2 A;  2C2L A;  2PNN A;  4DX5 D;  4K5B A;  5CER B;  1S64 A;  3TWR A;  2CFZ A;  3T8M A;  1NI1 A;  5JJ6 A;  4P29 A;  3T9K A;  3SD5 A;  4EZL A;  4XKC A;  3UIN C;  2ION A;  3FTX A;  3QJZ A;  4L2Y A;  1KLX A;  3AAA C;  4CDR A;  2P9U G;  4GB9 A;  2JEK A;  3DSU A;  2Y69 E;  3LXU X;  3RU0 A;  3UKU G;  5EIB E;  4U96 D;  4HB5 A;  1TEZ A;  3VTX A;  4XZ4 A;  4EZJ A;  4FAD A;  3TAX A;  3MX3 A;  1UG3 A;  3HXD A;  4X8Q A;  5JA4 D;  1V54 E;  2YNQ A;  3Q75 A;  4ABN A;  3QKY A;  3GZ1 A;  3PZ3 A;  4AJW A;  5M72 A;  2XHE A;  3F6Q A;  4O1O A;  2V5Q C;  3WG7 E;  4Q96 A;  4G24 A;  1BI8 B;  1N52 A;  2V0P A;  2DBA A;  4DJA A;  4GTR A;  2VTB B;  3UUX A;  3ZYL A;  2DIW A;  4IN3 B;  4U8Y D;  3MKR A;  5LFA A;  3EHQ A;  4GTP A;  3CQC B;  4EQF A;  5CRU A;  5CEA A;  2J08 A;  2X6H A;  4E6H A;  3JYS A;  1LD8 A;  4AM9 A;  3OTN A;  2VSO E;  4HOS A;  3ZN3 A;  4JEU A;  4GTM A;  2WPV A;  1N0R A;  1LTX A;  5FJY A;  3AU5 A;  2WXP A;  4HRM B;  3FEX A;  3D9K A;  1OCO E;  3Q9N C;  4WNG A;  3ZU7 B;  4AP2 A;  3FUD A;  3VLE A;  5KWD A;  4DX2 A;  2HE0 A;  5ANL A;  3HG0 D;  4ME2 A;  1DNP A;  1SVX A;  2WMO A;  5T3R A;  4A55 A;  2GRN B;  4JA9 A;  3CVU A;  4EEC A;  2IY0 C;  4U95 D;  3B7R L;  3CK8 A;  3ZYM A;  4YDY A;  2JAB A;  5J90 A;  2X6I A;  2AVP A;  4KVM A;  1KZO A;  2XRY A;  1N4S A;  1TN7 A;  2ZGG A;  3U4T A;  4BT9 A;  1MX4 A;  3CR3 A;  5ANR A;  4Y6C A;  3QK0 A;  3PNT B;  1A17 A;  2H6F A;  2HR2 A;  4U0Z A;  3T5V A;  4YND A;  2HM8 A;  3O48 A;  4BX8 A;  1Q2Z A;  1XGW A;  3CLJ A;  2L0I A;  5D66 A;  3ZEF A;  4N3B A;  3AG2 E;  3EIQ C;  3EHR A;  1HXI A;  4DLO A;  1IQU A;  2WXF A;  3ULE G;  3Q47 B;  3J5P A;  2FI7 A;  2MRI A;  4F1S A;  4AY5 A;  4DK5 A;  3Q9U C;  4URK A;  3LKU A;  4JL0 A;  3BUA A;  3ULQ A;  5DBK A;  4CGW A;  5JHA A;  3PZ4 A;  3G2T A;  3KSQ A;  4FJY A;  2F8X K;  3EUV A;  4DX1 A;  3HDX A;  4U0S A;  2CFU A; 
#chains in the Genus database with same CATH homology
 5KJL A;  1X5B A;  2YQ8 A;  4G1T A;  3SFZ A;  3CVY A;  3MJW A;  4WWO A;  1IYG A;  2KM4 A;  3KAE A;  2UY1 B;  2YIN A;  2EQX A;  4KZ0 A;  3PE4 A;  4Q69 A;  5G05 C;  1ELR A;  1DVP A;  4AOF A;  3CGH A;  4FP7 A;  3TL5 A;  4A1G A;  3CVL A;  3OAW A;  1OWO A;  1HH8 A;  4QFV A;  4N2Q A;  2X6J A;  4AY6 A;  3IBE A;  4H7X A;  5FT9 A;  3DPD A;  3LCA A;  3S7D A;  3FUI A;  4Q94 A;  3FFL A;  4B8A A;  2OND A;  3UT8 A;  3FUM A;  3PS6 A;  3MGB A;  4G26 A;  2VGX A;  3UQ3 A;  3LY9 A;  3ZHE A;  4A1S A;  3S7B A;  3GZS A;  4C9B B;  3S7F A;  3GYZ A;  3KS2 A;  3D9O A;  4W9R A;  2A4Z A;  3ONL A;  4EZK A;  2LAI A;  3UMV A;  1EF1 C;  5G04 C;  1HO8 A;  4BSX A;  4BX9 A;  5LX8 A;  5D0O D;  5AIJ A;  3HIZ A;  1OWL A;  3AS5 A;  3MV2 B;  2VSY A;  4IRU A;  4LCT A;  3MKQ B;  4WAF A;  1Z3Y A;  3FDH A;  2FBN A;  3FUK A;  2XRZ A;  1JUQ A;  3ZPJ A;  1P5Q A;  2Y3A A;  3HVE A;  2CHX A;  3MEK A;  4XIF A;  2PM7 A;  3JUI A;  4JA7 A;  5JHB A;  3CHQ A;  4DI3 A;  1UN9 A;  5KJK A;  2I1K A;  2WXG A;  4NUR A;  4L23 A;  2WXI A;  2FO7 A;  5CHE E;  1GW6 A;  1KT1 A;  2I2O A;  5CMW A;  3OXL A;  2IU1 A;  3ZYQ A;  3SBS A;  2WXQ A;  3B7T A;  3L08 A;  2BF0 X;  3ZW3 A;  4A3T A;  4TRQ A;  3SF4 A;  4F3V A;  4GPK A;  3NQP A;  1UW4 B;  4I6E A;  3VLD A;  4N3C A;  3FTW A;  4UWH A;  1E96 B;  1OWM A;  5FZQ A;  1E8X A;  1HS6 A;  3CSF A;  4KVO A;  1H0A A;  3FU5 A;  2LNI A;  2WXK A;  4MS6 A;  1VDY A;  5EDS A;  4ILH B;  2XGM A;  4NQ0 A;  2E0I A;  3K9I A;  3D9I A;  3NF1 A;  4UWL A;  4HVB A;  3CKC A;  4UWF A;  1WY6 A;  2QY7 A;  1YA0 A;  3FTZ A;  4MLP A;  3BEE A;  4B8C B;  3U66 A;  3CHM A;  3FP3 A;  3MA5 A;  3G2S A;  3FUH A;  4GYY A;  4RG6 A;  2J9Q A;  3FUJ A;  3D9P A;  4B94 A;  3DBS A;  4UQY A;  4DI4 A;  4BTA A;  1HU3 A;  3LS8 A;  3PVL A;  2C0L A;  3ESK A;  5ARG A;  2OOE A;  3P1U A;  5BUZ A;  1JPL A;  4XI0 A;  1EDU A;  2VGY A;  3APD A;  3LJ3 A;  4O6F A;  3B13 A;  1NZN A;  4Y6W A;  3CKB A;  2V4L A;  2HYZ A;  5FZS A;  2X38 A;  2OVB A;  4ANU A;  2YHE A;  3D9M A;  2WVI A;  4BY6 A;  4CRW A;  4ACL A;  4B0Z A;  4GYW A;  4BFR A;  4XX5 A;  3IHV A;  4JVS A;  4F53 A;  2IOL A;  2XPY A;  1H6K A;  4PS3 A;  2WXN A;  3EHN A;  5FTP A;  1L5J A;  3CST A;  2WXJ A;  4IYP A;  4U63 A;  2J07 A;  4MRU A;  3CVW A;  4GYO A;  4AEZ C;  4ACK A;  2WQH A;  4HS2 A;  2UY1 A;  1NA0 A;  3URZ A;  4JXT A;  4CT0 A;  3FH7 A;  3U9W A;  3ESL A;  1OWN A;  1MQS A;  2QFC A;  3LVR E;  3D3M A;  4I43 A;  3VLF A;  4I1A A;  4LUN U;  2I9C A;  4ANX A;  2Y4T A;  1H19 A;  4FLB A;  3D9N A;  3ZVV A;  3QC1 A;  3FH8 A;  3QAR A;  4GZC A;  2CHZ A;  3GW4 A;  3RIB A;  3TG4 A;  4F7A A;  5C2Y A;  4KBQ A;  3S2A A;  3EHM A;  3MCX A;  4M3O A;  2X3M A;  3PRZ A;  4PDX A;  2BUG A;  1MHQ A;  2J4B A;  1HG2 A;  1UN8 A;  3EDT B;  3I4G A;  4GZD A;  2AW6 A;  2LO6 A;  2ILR A;  2J09 A;  5LCW J;  5KJM A;  3PEU B;  3U3W A;  5G2N A;  3BG1 B;  3B7S A;  4ILI A;  5FQ4 A;  3ZGQ A;  3UPV A;  1INZ A;  2BTD A;  2I1J A;  3P2B A;  3NZU A;  3FU6 A;  4R7L A;  2LAH A;  3MKQ A;  1QZ2 A;  4G23 A;  3Q49 B;  2AWI A;  1Z3X A;  4UI9 J;  3AS8 A;  2FF4 A;  2RD0 A;  5HQ8 A;  4J8E A;  2XEV A;  1E7U A;  2IOS A;  1ZBP A;  4J6I A;  4JPS A;  4I9E A;  3FY4 A;  3LDZ A;  4OVV A;  4ANW A;  2PQR A;  2KCV A;  4GZ6 A;  2WQ6 A;  3R7Q A;  2WXM A;  2L6J A;  4AIF A;  3JQ1 A;  3RRU A;  2AXV A;  2VYI A;  2AXZ A;  1XNF A;  1QNF A;  4EBA G;  3LY7 A;  4I6G A;  3ZYK A;  5A7D B;  2V5F A;  4WND A;  1LF8 A;  5KCM A;  1EPU A;  1NA3 A;  4DLQ A;  2X6F A;  4K03 A;  3L13 A;  4L2L A;  4CEM A;  5A23 A;  3I4R B;  4N5C A;  3PH0 C;  4RG9 A;  3IV0 A;  5KJN A;  2P58 C;  2ZU6 B;  4KXK B;  4OVU A;  3PE3 A;  1FVH A;  4KMO A;  2LSU A;  4EPZ A;  3KD7 A;  3R7R A;  3L54 A;  1W3B A;  4KZC A;  2JLB A;  4FJZ A;  2C2L A;  2IF4 A;  1HZ4 A;  4TV3 A;  3TXM A;  4BWR A;  3ASD A;  5LOZ A;  2GRL A;  1TJF A;  4HOR A;  2WXL A;  5EX0 A;  3LVQ E;  1JWG A;  3E4B A;  3CVQ A;  2DCP A;  1IQR A;  2CFZ A;  3MZL B;  3T8M A;  4FC8 A;  2XCB A;  4RVB A;  4HFG A;  5JJ6 A;  1E7V A;  2KCL A;  3Q5M A;  1Y6I A;  2E2E A;  4NAC A;  2L0T B;  5LCW C;  3ZIM A;  1WAO 1;  3PUJ A;  2KZT B;  3CK9 A;  3FTV A;  2Y4U A;  2VQ2 A;  4P29 A;  4UI9 K;  2I6H A;  3VTY A;  2VGX B;  4EBA A;  3CIA A;  2R59 A;  4JHJ A;  4UI9 C;  3SD5 A;  4EZL A;  2CG3 A;  4XKC A;  4JEH A;  4V3I A;  2HO1 A;  1EYH A;  2ION A;  2MOW A;  2V8S E;  3FTX A;  3Q4A B;  4J0U A;  3QJZ A;  4GCO A;  4L2Y A;  1KLX A;  2VJ8 A;  2WMN A;  4CDR A;  1UJJ A;  2WB2 A;  4GB9 A;  2JEK A;  4C0E A;  5BV1 A;  4GCN A;  2KC7 A;  4LER A;  4GA2 A;  2XPI A;  3UX4 A;  3LYA A;  3FTY A;  1B89 A;  3LXU X;  3AU4 A;  4GA0 A;  3APC A;  4IUL A;  4PH4 B;  5HI7 A;  3RU0 A;  1Y8M A;  3ASH A;  3FU0 A;  3FU3 A;  4FHK A;  5CCM A;  4XI9 A;  1JWF A;  4JZY A;  5EX3 A;  3O4Z A;  5EKQ D;  4HLE A;  2PQN A;  1TEZ A;  3VTX A;  1HF8 A;  2GGF A;  4XZ4 A;  4WNF A;  3ZXS A;  4E85 A;  4EZJ A;  4CGV A;  1OUV A;  3G2U A;  3FUE A;  3MX3 A;  1U3C A;  3CV0 A;  3FUF A;  3S7J A;  3TAX A;  2A5U A;  3ZFW A;  3PDN A;  4GML A;  4K0R A;  3FTS A;  1UG3 A;  3EJN A;  3QDN A;  3RRM B;  3U64 A;  4FUL A;  3ZRH A;  4FAD A;  1E8Y A;  2KAT A;  1KT0 A;  2PL2 A;  2YNQ A;  2L9B A;  4ABN A;  4ATG A;  3TGO A;  2WXO A;  3LEW A;  3QKY A;  4L1B A;  3FUL A;  3GZ1 A;  5FQ6 A;  2VSN A;  4AJW A;  5BW8 C;  5M72 A;  2XHE A;  3MYV A;  3TXN A;  4NRH B;  5T8I A;  4I9C A;  3UT7 A;  3ASG A;  4Q96 A;  4MKT A;  4J8S A;  4G24 A;  4UQZ A;  4AVX A;  5J08 A;  3AS4 A;  2UWJ G;  2X6K A;  3FH5 A;  4APO A;  1N52 A;  1PAQ A;  1HE8 A;  2V0P A;  2DBA A;  3L16 A;  4PS8 A;  4YVQ C;  5FZR A;  2OV8 A;  4DJA A;  3G2V A;  3QWW A;  3CHR A;  4N3A A;  5FQ8 A;  2WQ7 A;  3UT4 A;  2C0M A;  1QQE A;  2VTB B;  2CG2 A;  3UUX A;  3ZYL A;  2DIW A;  4IN3 B;  3MV3 B;  4HOQ A;  3MKR A;  5LFA A;  3ONK A;  2XPZ A;  2WXR A;  3CQC B;  3SNX A;  3FUN A;  4D10 C;  1SQM A;  4EQF A;  4I17 A;  3HYM B;  4JC8 A;  2Q7F A;  3OXG A;  4BTB A;  3NZS A;  4U0U A;  1OWP A;  2NXP A;  4GA1 A;  4CT4 A;  3QB2 A;  5ENN A;  5FWQ A;  2J08 A;  2X6H A;  4E6H A;  2M63 A;  2NSZ A;  4I1M A;  3JYS A;  4JW1 A;  4WUY A;  4AM9 A;  4ANV A;  3OTN A;  3RKV A;  2VSO E;  4HOS A;  2MHK A;  3ZN3 A;  4JEU A;  3PRE A;  2VSX E;  2WPV A;  5FJY A;  3AU5 A;  2WXP A;  5AEN A;  1E90 A;  3IEG A;  3I5P A;  1UJK A;  3B7U X;  3FEX A;  3D9K A;  4C0M A;  2IJG X;  1TJC A;  2PZI A;  4AXH A;  5D0Q D;  2GW1 A;  5AYW D;  1HX8 A;  2KZT A;  4HXI A;  4RSY A;  4WNG A;  1N54 A;  4AP2 A;  4U07 A;  4GMJ A;  3FUD A;  2J49 A;  3VLE A;  3ML8 A;  3KEZ A;  4XE0 A;  3SZ7 A;  3FWV A;  5ANL A;  2CHW A;  3SGH A;  2YHC A;  2WXH A;  5G55 A;  5DIZ A;  3SHF A;  1ELK A;  2LSV A;  3FEY A;  3LPZ A;  3ML9 A;  4L7T A;  1ZU2 A;  4ME2 A;  3QNK A;  3PUK A;  3SI5 A;  1DNP A;  2WMO A;  3WXX A;  2IQC A;  5T3R A;  3CHP A;  4A55 A;  4JA9 A;  4J8F A;  4CCA A;  4WWP A;  1NP7 A;  4G11 A;  1S0P A;  3LY8 A;  3CVU A;  1H2T C;  3FTU A;  3IHY A;  4EEC A;  3TJP A;  3JCK C;  3QWV A;  4N39 A;  4N2S A;  4I1O B;  5BNW A;  3L22 A;  2RG8 A;  3B7R L;  4UWK A;  3CK8 A;  3APF A;  3TG5 A;  3ZYM A;  4FA6 A;  3ZHE B;  3ENE A;  4FU3 A;  3CEQ A;  4JHR A;  5FQ7 A;  5J90 A;  2X6I A;  1SZA A;  2AVP A;  3JQ0 A;  1HG5 A;  3I3N A;  4KVM A;  4JHK A;  3RRN B;  5CCL A;  3CK7 A;  4WWN A;  3T5X A;  4I6J A;  2XRY A;  4FLH A;  2R17 C;  5T4Y A;  3G2W A;  3C98 A;  3OXF A;  3RO3 A;  4A3V A;  3CVN A;  4OYS A;  4BT9 A;  3U4T A;  3CVP A;  1FCH A;  2J4D A;  1U3D A;  3ASF A;  4GU5 A;  3CR3 A;  4H7Y A;  5ANR A;  3HVE B;  4Y6C A;  3QK0 A;  5G05 J;  4UQX A;  3PNT B;  5ARF A;  1A17 A;  3QWP A;  1FVF A;  3RO2 A;  1PC2 A;  1H2V C;  2HR2 A;  4LRZ A;  4U8H A;  2XGO A;  4U0Z A;  5AJD A;  3T5V A;  1H2U A;  4YND A;  2HM8 A;  3O48 A;  4BX8 A;  2PM6 A;  3CLJ A;  1XGW A;  4GZ3 A;  1Z6T A;  2FEZ A;  2L0I A;  2VTB A;  3ZEF A;  3HHM A;  4N3B A;  5CMY A;  4WNE A;  4U04 A;  3D9J A;  4HOT A;  2NC9 A;  3QOU A;  1E8Z A;  3EIQ C;  4G2V A;  1HXI A;  5E75 A;  4BT8 A;  4DLO A;  1IQU A;  2WXF A;  2XGS A;  3CHO A;  5G04 J;  5A6C A;  3SBT B;  1E8W A;  2FUL A;  2XQ0 A;  5BT1 A;  1PY1 A;  2R5S A;  4APF A;  5C1D A;  3EIJ A;  3Q47 B;  3CVX A;  2FI7 A;  4J8D A;  5JJ7 A;  2MRI A;  3PEV B;  4F1S A;  4AY5 A;  4DK5 A;  4B89 A;  5BPP A;  1IHG A;  4GAA A;  4PS7 A;  3RK6 A;  2KCK A;  4URK A;  3L17 A;  3IKO B;  2OVF A;  4PUC A;  4TUU A;  3LKU A;  2GRM A;  4HOU A;  4ILG A;  2AXU A;  4JL0 A;  4AV7 A;  3ULQ A;  5DBK A;  4CGW A;  3FHE A;  5BV0 A;  5JHA A;  2XCC A;  4KT6 B;  1HFA A;  4G25 A;  4XKB A;  4CDM A;  3D9L A;  1WM5 A;  4I2W A;  4YVO A;  2WM9 A;  3PZD A;  3G2T A;  4I2Z A;  3CVV A;  4FHJ A;  4FJY A;  4CDN A;  2IFU A;  3L6A A;  3PNL B;  4LEU A;  1ELW A;  4KYO B;  3GZ2 A;  3HDX A;  3BG0 B;  4DPR A;  4U0S A;  3CHS A;  1SZ9 A;  5E76 A;  3Q15 A;  3QAQ A;  4GZ5 A;  4UWG A;  1BPO A;  2CFU A;  3CQG B;  3R9A B;  5LP0 A;  5JJT A;  3RJV A;  5AJL A;  3N71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...