4IN3B

Crystal structure of the chs5-bch1 exomer cargo adaptor complex
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
721
structure length
589
Chain Sequence
LSQTSIPEVKEDVIGYALHQRRARVGQFQDLGPPDLITFFYCMGIDTSDPTSITIFAKKITDLFISISSWNAFRKYDVNIIVVQTYIINSDGEQSQLPLNVNMIWAETFMSGIVRDIMIMKDNRADGESQNLVETLIFNPFTSGELEDVANNFIKLFPLVYEKGVYLDAPTHVLNPSLTNNYLVETLVEIVRLTKSLEACRKMLKKLIEIHPEAVIILIRVYFACDLEIDAVDLINEQLNSPSSFLADDSKTSHIQLIFKSELLSIQSEFLLDVKRDYKLAKEVAMEAVNCAPNEFKTWYLLTRIYIKLNDMSNALLSLNACPMSQVKEKYVLRRIAPINLHLPLPLDNPMDVQLEQKSADPNLVNLSASSLKSTFQLAYKLLTEIVQITGWEQLLKYRSKIFVSKRLCERWLDNLFMLLYEDLKTYTDWQSEQLYFDAQHKLTVEWELFGLCAKRLGHLPEAAKAFQIGLSQRFSPVCAKNLLQFYIDEHKRIRRDSVSSELTSSQILSSINDIDSSIIDLVVKICCWNHRWYIEFSIILIDALSVAVQDMGITKVHNEIASRFSDPVAQLIDDNILNFLKNFTNDTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The exomer cargo adaptor features a flexible hinge domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords Chitin biosynthesis protein CHS5
total genus 183
structure length 589
sequence length 721
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09295 ChAPs ChAPs (Chs5p-Arf1p-binding proteins)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4in3B00
4WNFA 4Y6CA 2KATA 3TGOA 5A7DB 4GPKA 3N71A 3VTXA 4U07A 2LNIA 2UY1B 3S7DA 3GZ1A 4GZ5A 4UQZA 2IFUA 3U4TA 2WPVA 4W9RA 4N3AA 2J9QA 4GYYA 5DBKA 5EKQD 3TAXA 1FCHA 3LPZA 4I9EA 3ZN3A 5FZQA 3ASFA 5G04J 2KCLA 4H7YA 3ZHEA 3LY8A 2L6JA 3Q5MA 4I2WA 1HZ4A 2E2EA 3KAEA 4G26A 4GZ3A 4WUYA 4YNDA 4B94A 3S7BA 1KLXA 4G1TA 4I17A 3S7JA 3ASHA 2IF4A 3PE4A 2PQRA 3WXXA 2FEZA 4BT8A 4O6FA 3MA5A 4JHRA 5ARGA 4ABNA 4GA2A 1P5QA 4WNEA 2ONDA 3BEEA 3GZ2A 3HYMB 3CK9A 5BNWA 3AS8A 4UI9C 2HYZA 3CV0A 4IN3B 5LCWC 4ME2A 3RIBA 4JL0A 3ZPJA 3FFLA 4J8EA 3MEKA 2C0LA 1XNFA 4UQXA 4GCOA 2WQHA 2KCVA 3Q49B 4J0UA 1IHGA 4KBQA 2JLBA 2I6HA 5G05J 5HI7A 4NQ0A 2DBAA 4N5CA 3RKVA 5CCLA 2AVPA 4UQYA 4I9CA 3R9AB 3OXLA 1ELRA 4G2VA 2OOEA 3TG4A 3GYZA 4AM9A 4G23A 1KT1A 5KJMA 1ZU2A 2FO7A 1QQEA 2MHKA 3CVNA 4J8DA 4UI9J 3RU0A 4AIFA 3ZGQA 3CKBA 3LY9A 4YVOA 5BW8C 4BT9A 3PE3A 2XGSA 4APOA 3CVLA 1NA3A 3LYAA 4HOTA 4U0UA 5EX0A 1ELWA 4BTBA 5D0OD 3E4BA 3FWVA 1NZNA 2XCBA 3URZA 2FF4A 1B89A 3ASGA 4I2ZA 3CK7A 4CDRA 5KJKA 3ULQA 2C2LA 2YQ8A 4GYOA 2R5SA 3UUXA 3LY7A 1W3BA 3QWVA 5CHEE 4N2SA 1IYGA 4J8FA 2VGXB 2NC9A 3KS2A 5M72A 4U0ZA 3NF1A 4H7XA 4HOQA 5D0QD 5AYWD 4HORA 3QDNA 3CEQA 1TJCA 2HO1A 3CVPA 5A6CA 3ESKA 3JYSA 5FTPA 2P58C 3CVQA 4RG9A 5G04C 3S7FA 3VTYA 4AY6A 4GCNA 4Y6WA 2XPIA 2Y4TA 3ZFWA 4HOUA 4XIFA 2UWJG 3FP3A 3LKUA 2YHCA 3KD7A 3MV3B 3ZHEB 2VYIA 5FT9A 5KJLA 1QZ2A 4I1AA 2KC7A 4RG6A 3TG5A 1Y8MA 3SZ7A 5BT1A 1WAO1 3MV2B 4KXKB 2FBNA 2BUGA 2HR2A 2UY1A 3LCAA 3OXFA 4G24A 5JJ6A 1E96B 3QOUA 4YVQC 4BTAA 5C1DA 3UPVA 5CCMA 3K9IA 2Q7FA 1HXIA 5JJTA 2GW1A 3GW4A 4N3BA 4HOSA 4EQFA 2QFCA 4JA7A 2VQ2A 3IEGA 4GZ6A 1WM5A 4U04A 2PQNA 2VSYA 3AS4A 3OXGA 4WNGA 4XI9A 3EDTB 5ARFA 2Y4UA 5LCWJ 1YA0A 3SF4A 5KJNA 3MKRA 4GA0A 5DIZA 3UQ3A 2C0MA 3CK8A 3Q15A 2PZIA 2VSNA 3AS5A 2XEVA 1PC2A 5EX3A 3RO2A 4XI0A 3PDNA 2FI7A 5FZRA 4N2QA 4F3VA 1NA0A 2V5FA 4GA1A 5JJ7A 1ZBPA 1HH8A 4AY5A 4BWRA 1A17A 4A1SA 2PL2A 4N3CA 5G05C 3U3WA 4UI9K 4LEUA 2LSUA 4GYWA 4U0SA 2KCKA 4WNDA 2LSVA 1OUVA 3CKCA 5FJYA 2XGMA 3QKYA 3RJVA 2VGYA 3ASDA 3Q4AB 4JA9A 4NRHB 4N39A 5FZSA 3RO3A 4CGWA 2XCCA 5HQ8A 3QWPA 2VGXA 3QWWA 4CGVA 4KYOB 1KT0A 2XGOA 3O48A 3Q47B 4G25A
chains in the Genus database with same CATH superfamily
5EYLA 3VTXA 3ML9A 5LOZA 5AQAA 3AU5A 2KCLA 4H7YA 3LY8A 3ABLE 4B94A 3IKOB 1H6PA 2ZXWE 1XGWA 4GTQA 5KNGA 1H6KA 4DJAA 3QJZA 1X5BA 3G2UA 2QZAA 3B7UX 3DSXA 3JUEA 4NQ0A 2L0IA 3TWXA 3EU9A 4X8QA 3ZGQA 5ENRD 1TN6A 3PNLB 1IYGA 1H2UA 3NF1A 4YDWA 2V4LA 4GTSA 5A6CA 1UN8A 1WDYA 1EYHA 1UJKA 3CR3A 5JJ6A 2RD0A 3UPVA 3ZXPA 5CCMA 1OXJA 4EQFA 4WNGA 3SY2A 4KMOA 4O60A 1EF1C 1MYOA 1Z5SC 4U8VD 3E33A 1HH8A 5G05C 4BX8A 3HXCA 4APFA 1N54A 2WXOA 3Q4AB 4N39A 1QBQA 3EIJA 4U95D 3SFZA 3R7QA 3Q78A 5EN5D 4HI8A 1G3NB 4OYSA 5CECB 5EKQD 4DI4A 4HLEA 1FCHA 3CHSA 3ASFA 2A5UA 3PS6A 2PQRA 3FU6A 4JHRA 5ARGA 3O4ZA 4ANUA 1NP7A 3CSFA 4RVBA 1TNUA 3FU3A 2VTBB 3CSTA 3BG0B 3KSLA 3NBNB 1TNZA 2GRLA 1ZU2A 4J8DA 2RFAA 3T8MA 4WAFA 2WMNA 3PRZA 5EX0A 5EIBE 1ELWA 3DSSA 3ULQA 1O1RA 2IU1A 4H7XA 3P1UA 5D0QD 2GRMA 2CHWA 3JYSA 3CVQA 1OWPA 4GTTA 1SQMA 3ZYKA 4PDXA 2MOWA 4UWHA 4PUCA 2X6JA 4Q96A 1E8YA 3FEYA 2XZTG 4FLBA 2HM8A 1N94A 3EHMA 2VSOE 5CBNA 3CK8A 3I4RB 5E76A 2XEVA 3RO2A 3PZ3A 4BERA 4GTPA 1FT1A 2P9SG 4C48B 3ZNGA 4PS3A 3CGHA 3FUKA 1KT0A 4J8FA 2X3MA 4J7WA 1N52A 4GZ5A 2RKKA 4OVUA 2WB2A 4CDNA 3G2VA 2BKKB 4G11A 4YNDA 5EILA 3L22A 3ASHA 1O5MA 2KZTB 2BEDA 1HE8A 3ZKJA 1P5QA 3IV0A 3BQOA 3D9HA 4BESA 3NZSA 4LSZE 3CVNA 5KCMA 3T9KA 2GGFA 3LYAA 4HOTA 4HRMB 1H2VC 2OV8A 2NC9A 5M72A 5AJDA 3PZDA 3MZLB 4JW1A 3LKUA 2P9PG 5KWDA 2XS1A 4V3IA 2KZTA 2VGEA 4UWKA 3CVYA 3CHPA 4GTRA 4GA0A 5DIZA 3CQGB 3AS5A 4U96D 2QYJA 4GTVA 4XI0A 3S2AA 4ATGA 5C2YA 4AY5A 1V54E 3JUIA 2PL2A 2X6KA 1KPSB 2KCKA 3IXEA 3RJVA 3TWSA 3I4GA 1E8WA 1MHQA 4GPKA 4OAUC 4NURA 2WXQA 5ENPD 4K5AB 3PEVB 1O1SA 3U9WA 1IHBA 3JXIA 2B0OE 3CVVA 1NL4A 2VSXE 2ONDA 2OVFA 5A23A 2QYUA 4IN3B 3MYVA 4Z68A 5CRUA 3ZPJA 1VDYA 4HRNA 4KVMA 2JLBA 5HI7A 5HKPA 3RKVA 2LO6A 4UQYA 2OOEA 3ABME 5CRVA 2HE0A 3HDXA 3RU0A 3SD5A 1N0QA 3D9PA 2L9BA 3FULA 5ENSD 4URKA 4PS7A 3UX4A 2XHEA 4R7LA 1JCQA 2GRQB 2YQ8A 2R5SA 3UT8A 1D9SA 3PZ4A 3D9LA 3HVEA 2J49A 5AYWD 3CEQA 1TJCA 2Y4TA 5AIJA 1JCRA 1Z3YA 3L16A 1FPPA 2AXZA 4RG6A 3VLDA 1V55E 4G24A 1Q2ZA 4GU5A 2NSZA 3SGHA 4FHJA 3K9IA 1HXIA 3FH7A 4N3BA 4B93B 3Q15A 2PZIA 4XKBA 3PNTB 3SBTB 3HG0D 4F3VA 4AEZC 2EQXA 1S64A 3W9GA 4GAAA 1RZ4A 4UI9K 4DRXE 2LSUA 4Q94A 2LSVA 2F8XK 3QWPA 3DEPA 3JCKC 3NQPA 4HI9A 3GZ1A 5A7DB 5G55A 2DYSE 4I1MA 2WXIA 2KM4A 1N4PA 2IQCA 1MQSA 4G26A 4WUYA 1S0PA 3LDZA 3D9IA 3V2XA 3I5PA 3BEEA 4IRUA 4N5QA 5LCWC 3QK0A 4JL0A 5ENOD 5J08A 4CYMD 4G2VA 1UW4B 1KZPA 1NFIE 4HQDA 4TUMA 4BTBA 4BSXA 5ANLA 2WXHA 2FF4A 3ASGA 3UUXA 1W3BA 2HO1A 2WXLA 3L82A 3S7FA 4RG9A 2I9CA 3TWVA 4GZDA 2WXGA 4CDMA 3QOUA 1KZOA 2Q7FA 2P9NG 2J08A 3FY4A 4RQIA 1DNPA 3T5XA 4DX7D 2IOLA 3HXDA 3PDNA 4IYPA 3FUEA 3UXGA 3C3OA 1UN9A 4N2QA 3EHQA 5T4YA 4C0EA 4TUUA 3IHYA 3BU8A 3G2WA 3AAAC 3I3NA 3QWWA 3LEWA 1UOHA 3Q9NC 1INZA 2KATA 1MX6A 4WWNA 1YMPA 3ZRHA 3SBSA 1OWOA 1PAQA 2AW6A 4TV3A 4FJYA 1KLXA 4I17A 2IF4A 3WXXA 4EBAA 4GA2A 4CZ2D 2P9LG 2IOSA 1H0AA 3D3MA 3RIBA 1OCZE 4FU3A 1N4RA 4KBQA 4JZYA 2R03A 3DWLG 4F6RD 3V2OA 1HX8A 1K1BA 3GZSA 3SFXA 4J8YA 5BV1A 4ZFHA 2NYJA 4UI9J 3LVQE 2XPZA 2XGSA 1JPLA 2EIKE 2PM6A 3G2SA 2EINE 3T8KA 4ZHBA 2E0IA 3FUNA 4GZCA 5BPPA 2CHZA 3DXKG 3FTVA 3Q7AA 4B89A 2DYRE 4TXRA 1K1AA 4HXIA 3AG1E 4A1GA 4EPZA 4XKCA 1TNYA 3D9KA 2VSYA 2Y4UA 1TYQG 1YA0A 1IQUA 3UQ3A 3D9OA 3APCA 3ONKA 3TJPA 3IHVA 2IO3C 2V5FA 5D66A 2YINA 1ZBPA 4XX5A 1OWLA 2J8SD 1X81A 2JABA 4M3OA 1OUVA 5FJYA 2XGMA 1DCEA 2V8SE 3EHRA 5BUZA 3RO3A 4YDEA 2DZOA 1YCSB 4MS6A 2Y1LE 2LAIA 4ILHB 3C3QA 2ETCA 5AQBA 2ETAA 1TN8A 3CIAA 3ABKE 3FUHA 2R05A 4BSZB 1E8ZA 3CV0A 3DBSA 2C0LA 2DBAA 4I9CA 3TG4A 4L9PA 3PE3A 3E37A 3VLFA 4GTMA 3UM1A 2WQ6A 5LP0A 2WVIA 1B89A 2KBXA 2P9IG 3KS2A 3L6AA 4M7CA 3E32A 1MX4A 4MRUA 5G04C 4AY6A 2XPIA 4KZCA 1FT2A 3MV3B 5BXUA 5FT9A 4TXQA 3TWRA 2KC7A 1N4QA 4JXTA 4EZJA 1E7UA 3IBEA 2GW1A 3TXNA 4BY6A 4UWLA 1L5JA 2QFCA 2VQ2A 1WM5A 3QB2A 2IONA 3SF4A 4LUNU 2C0MA 2IO2C 3ASNE 4JHJA 4BWRA 4DX1A 4CT4A 5HS0A 4JA9A 4NRHB 5JHBA 5FQ6A 3N71A 2UY1B 2LXLA 5FQ4A 5JMND 3JQ1A 3TAXA 2OEVA 2GRPB 3ZHEA 2L6JA 4GZ3A 3FU5A 5B1AE 2AXUA 4EBAG 1BU9A 3CVUA 2DZNA 2P9KG 3PREA 3CVWA 3LJNA 4OAVB 2KCVA 1IHGA 4FHKA 4F1PA 3R9AB 3APFA 4FA6A 5AQ7A 3UINC 1MX2A 1HS6A 1N4SA 3LY9A 4FP7A 4KZ0A 3FTUA 3ZVVA 1SW6A 1JWFA 3HXFA 2IY0C 3DSWA 4JD2G 2VGXB 3E34A 3L08A 3ESKA 2F0YA 2V4HC 3L9TA 4EZLA 4NIKA 3NOCD 3LJ3A 5T3RA 1QZ2A 4TRQA 4G8LA 3TG5A 3SFYA 3MV2B 5AQ9A 3TXMA 3BUAA 3G2TA 3KEZA 3AS4A 3WG7E 4P29A 3ZYLA 1E8XA 4PH4B 4UWGA 2WMOA 4L7TA 1BI7B 2WXKA 1NA0A 3DPDA 1U3DA 4FLHA 3UI2A 4DX2A 4BFRA 5KNHD 4JPSA 4K0RA 5HQ8A 3NB2A 3X2QE 4AXHA 3CHOA 4E85A 4CGVA 4G25A 3FUIA 4WNFA 1D8EA 2LNIA 1HG2A 4A3VA 4K5BA 5EDSA 3ZN3A 5FZQA 5G04J 2OVBA 4XZ4A 3U3WA 1A5EA 1SZ9A 1AP7A 4I1OB 3S7JA 3FHEA 4QQIA 4AVXA 3GZ2A 5CCLA 2HYZA 2NXPA 1HO8A 2GROB 3ASOE 4ACLA 5CEDB 5G05J 1OCRE 2AVPA 2H6GA 3ZW3A 2LXMA 3DEOA 4CT0A 2CFUA 3CVLA 1NA3A 4U0UA 1LTXA 3EIQC 1H6OA 4B0ZA 4GYOA 3J5PA 3LY7A 4IULA 3QDNA 5CMWA 2X6IA 2YHCA 3ZHEB 3CHQA 4I1AA 1Y8MA 3EUVA 2HR2A 3FTXA 5HRYA 4B8AA 2XEHA 5E75A 3PZ2A 4U04A 4HFGA 5FQ8A 4DK5A 3OXGA 3R9MA 4L2YA 4C9BB 4GTOA 2MYOA 5BXOA 3ZUVB 2V5QC 4F53A 2CHXA 4XE0A 2EIJE 3B95A 3TGOA 3MCXA 4N3AA 2PM7A 4MLPA 2WXNA 1HG5A 1TR4A 5JA4D 3S7BA 3QNKA 1BI8B 3UM0A 3PE4A 4BT8A 3MA5A 3AS8A 4FJZA 1OWMA 4ME2A 2RFMA 3DXMG 5H7PA 4RLYA 5FWQA 2BKGA 3JXJA 3FEXA 4G23A 3PEUB 3UKUG 2EIME 1SZAA 1HFAA 2A4ZA 1BD8A 3ULYA 2H6HA 4ACKA 3Q73A 1TJFA 1TNOA 2WXMA 3MKQA 1QNFA 3C72A 4HB5A 4Q69A 4O1OA 1K8KG 4LNGA 4Y6WA 2J07A 4XIFA 2YNQA 3B7RL 5BT1A 4EHMA 4OVVA 3LCAA 3R7RA 4YVQC 4BTAA 3L17A 5FINA 2Y3AA 4HOSA 3L13A 3HIZA 3CHMA 4DLQA 3EDTB 1OWNA 4UWFA 1E90A 5EX3A 3TWQA 1YYHA 2V0PA 3FUFA 3ZYQA 3SHFA 3D9MA 4KT6B 2XGOA 2XRYA 2I1JA 4RSYA 2WPVA 2J9QA 3E30A 3LPZA 1BLXB 4JVSA 1FVFA 3UM2A 2ILRA 4HVBA 3OAWA 3W9FA 4UI9C 2YHEA 1MZCA 2IEJA 3MEKA 4AV7A 2FO7A 1QQEA 3CKBA 4KVOA 4NACA 5J90A 4N2SA 3UT7A 2QC9A 4HORA 3P2BA 3ZXSA 3TWTA 3SI5A 2Y69E 3V30A 3FP3A 5AAOA 1WY6A 1PY1A 1SA5A 3OXFA 5C1DA 3MGBA 4HBDA 3GW4A 3IEGA 2PQNA 5ARFA 5LCWJ 2DCPA 1D8DA 2CG2A 4F1SA 3DSTA 3HXBA 2FI7A 5FZRA 1TEZA 2Y0BG 2J4BA 3CKCA 2XENA 2XCCA 4DI3A 1HU3A 3UIPC 3LVRE 5LX8A 3MJWA 1UJJA 3DPYA 1TN7A 3UMVA 2P9UG 3Q5MA 1HZ4A 5G2NA 4G1TA 2JEKA 1JUQA 3Q75A 2FEZA 2AWIA 3AG2E 2XS8A 3HYMB 1UG3A 5ENTD 3AG3E 3FFLA 4QFVA 3FTYA 3B13A 4ANVA 1ELRA 3KSQA 3F6QA 3V79K 2BF0X 2LUHA 2L6BA 3QC1A 3SO8A 2WXPA 2WXJA 3RAUA 4I2ZA 3CK7A 3Q9UC 3B7BA 3UIOC 4GMJA 5CHEE 3RRUA 2AJAA 2FULA 2I2OA 3AG4E 4F7AA 4BEPA 3U66A 4DLOA 2J09A 2KXPC 2MRIA 4HOUA 3FH8A 2UWJG 3HHMA 3L54A 4I43A 3ZU7B 2ZU6B 4LERA 5T8IA 5EIDA 5JJTA 2R2LA 1HF8A 3FUDA 4CEMA 3MX3A 3MKRA 4A63B 2VSNA 1N0RA 4G8KA 1OY3D 1E7VA 5BV0A 1LD7A 3ULEG 4YDYA 5JJ7A 4XEIG 4J6IA 4U0SA 3V31A 3QKYA 4JB8P 5FQ7A 4LCTA 5FZSA 4CGWA 3TWWA 4LG6A 3O48A 4Y6CA 5FIOA 3U4TA 4PS8A 3J5QB 4D10C 1Y6IA 2BTDA 1RW2A 4EZKA 1K3ZD 2IJGX 2WXRA 4AOFA 3DSVA 4O6FA 2ETBA 2XQ0A 5IY5E 3CQCB 4UQXA 4GCOA 5EYPF 3QARA 2VJ8A 2F8YA 4ANWA 1KT1A 2MHKA 4AIFA 1OCOE 4BT9A 4APOA 3DRAA 1H19A 1Z3XA 3NAWA 3EU5A 4DX5D 5D0OD 4CDRA 3PVLA 4U0ZA 2F37A 3TL5A 1SA4A 2P58C 4UUCA 2X6FA 2GRRB 3EHNA 2ZISA 3KD7A 5KJLA 1U3CA 2ZGGA 1BPOA 1N9AA 2R02A 4ANXA 3UT4A 1GW6A 1DCQA 4FULA 4DX6D 1EDUA 4GZ6A 1NI1A 1FVHA 5KJNA 2CG3A 3FDHA 4L23A 2L0TB 2EILE 3QAQA 4HNAD 3OTNA 3RK6A 3PUKA 3UTMA 3HVEB 2XRZA 4LEUA 4GYWA 2X6HA 3T5VA 4CRWA 2VGYA 4A3TA 1N11A 1TNBA 4DPRA 1DVPA 5LFAA 2VGXA 3OXLA 4GA1A 4W9RA 3CVXA 4GYYA 2B6CA 3KAEA 4HLLA 3ZYMA 3UKRG 4B8CB 4L1BA 4ABNA 5ITZF 3SNXA 4WNEA 1MJ0A 3CK9A 5ENQD 2P2CP 4FC8A 2XZDG 4O1PA 4J8EA 2WQHA 3Q49B 5KJMA 2I6HA 5CERB 4K03A 2X38A 3GYZA 5JHAA 4LNUD 4JEHA 1Z6TA 1IKND 3HXEA 3APDA 4JC8A 3ISMC 4BETA 5CEAA 3SQVA 2R17C 2M63A 4U8HA 4WWOA 3Q7FA 2FO1E 1OCCE 3CVPA 5FTPA 1H2TC 4MBGA 3ZFWA 3AJIA 4TXPA 3FTZA 2UY1A 4JA7A 4JHKA 4XI9A 5AARA 1PC2A 4GMLA 4A1SA 4U63A 3B7TA 3RRMB 4WNDA 2WM9A 2WQ7A 3C5RA 4KYOB 4C0MA 3VLEA 2H6FA 4I6JA 1SVXA 2QY7A 3FUJA 3S7DA 2IFUA 5DBKA 5D2MC 4I6EA 1WG0A 4I9EA 3BG1B 4I2WA 3LS8A 1IXVA 2CFZA 2XPYA 2OEWA 1EPUA 2DWZA 5BNWA 3AU4A 2AXVA 3EJNA 4J0UA 3UM3A 2XEEA 3ZEFA 4AM9A 1JCSA 5BW8C 4YVOA 2DVWA 1LD8A 1JWGA 1ELKA 4K5CA 4FADA 3Q79A 4DUIA 4ATZD 2R59A 3FWVA 3PUJA 3URZA 2RG8A 1IQRA 3B7SA 3ONLA 4AP2A 3C98A 4GCNA 1AWCB 3KEAA 4LNBA 5AENA 3PH0C 4EECA 2FBNA 2BUGA 3FTSA 1E96B 3LXUX 4J8SA 2GRNB 3ESLA 4U7EB 1U2VG 5ANRA 5AN8A 4GPMA 4AJWA 2PNNA 4LRZA 1N95A 2H6IA 5CBOA 3D9JA 3MKQB 3Q47B 3FUMA 5KBAA 2OCCE 1LF8A 3C3RA 4U07A 4UQZA 5CMYA 2DIWA 3CHRA 4U8YD 2E2EA 4JEUA 4L2LA 1DC2A 3NOGD 4MKTA 4HS2A 4GB9A 3RSEG 2I1KA 1OT8A 3PZ1A 1XNFA 2ZGDA 5ENNA 3FH5A 2A5EA 4N5CA 1QYMA 2ZIRA 3RRNB 4GMRA 4BX9A 4HRLA 3E4BA 1NZNA 2XCBA 5KJKA 3FU0A 3CLJA 3FTWA 2C2LA 3QWVA 3U64A 4CCAA 3DSUA 2WXFA 4HOQA 1S63A 5B1BE 3ML8A 4A55A 3VTYA 3HRAA 1S70B 3ENEA 4ILIA 5B3SE 2VYIA 5AJLA 3SZ7A 1WAO1 4KXKB 2VTBA 1O1TA 4ILGA 4I6GA 4WWPA 3D9NA 3NZUA 4YDOA 3JQ0A 1A17A 2LAHA 4N3CA 2J4DA 4E6HA 3ASDA 3ZIMA 3TWUA 1ZB1A
chains in the Genus database with same CATH topology
4WNFA 4Y6CA 5A7DB 3VTXA 5G55A 2LNIA 3ML9A 1HG2A 4I1MA 5LOZA 4A3VA 5EDSA 3U4TA 2WXIA 2KM4A 4PS8A 3AU5A 3ZN3A 1Y6IA 5FZQA 5G04J 2KCLA 4D10C 2BTDA 4H7YA 3LY8A 2OVBA 4XZ4A 2IQCA 1MQSA 4EZKA 3U3WA 4G26A 1SZ9A 4B94A 3IKOB 4WUYA 1S0PA 2IJGX 4I1OB 3S7JA 3LDZA 2WXRA 3D9IA 4AOFA 3FHEA 4O6FA 4AVXA 3I5PA 3BEEA 3GZ2A 5CCLA 1XGWA 4IRUA 3CVYA 2HYZA 2NXPA 2XQ0A 5LCWC 1H6KA 1HO8A 3QK0A 4JL0A 3CQCB 3QJZA 4ACLA 1X5BA 4DJAA 5J08A 4UQXA 3G2UA 4GCOA 5G05J 3B7UX 4NQ0A 3QARA 2L0IA 2AVPA 2VJ8A 3ZW3A 4ANWA 4G2VA 1UW4B 1KT1A 4BY6A 2MHKA 4AIFA 3ZGQA 4BT9A 4APOA 4CT0A 2CFUA 3CVLA 1H19A 1NA3A 1Z3XA 4U0UA 3EIQC 4BTBA 5D0OD 4BSXA 5ANLA 2WXHA 2FF4A 3ASGA 4CDRA 4B0ZA 4GYOA 3UUXA 3LY7A 1W3BA 3PNLB 3PVLA 1IYGA 4IULA 1H2UA 4U0ZA 3NF1A 3TL5A 2V4LA 3QDNA 2HO1A 5A6CA 2WXLA 3S7FA 2P58C 2X6FA 4RG9A 5CMWA 1UN8A 2X6IA 3EHNA 2YHCA 3KD7A 3ZHEB 3CHQA 5KJLA 1U3CA 1BPOA 1EYHA 2I9CA 4I1AA 4GZDA 1Y8MA 2WXGA 1UJKA 4CDMA 4ANXA 2HR2A 1GW6A 3FTXA 3UT4A 3CR3A 5JJ6A 2RD0A 3QOUA 4B8AA 3UPVA 4FULA 5CCMA 2Q7FA 5E75A 1EDUA 4EQFA 4U04A 4GZ6A 4HFGA 5FQ8A 4DK5A 4WNGA 3OXGA 1FVHA 4L2YA 5KJNA 4KMOA 4C9BB 2CG3A 2J08A 3FY4A 3FDHA 1DNPA 4L23A 3T5XA 2L0TB 3QAQA 1EF1C 3OTNA 2IOLA 4IYPA 3PDNA 3RK6A 3FUEA 4N2QA 1UN9A 3PUKA 5T4YA 1HH8A 3HVEB 4C0EA 5G05C 2XRZA 4TUUA 4F53A 4LEUA 4BX8A 4GYWA 2X6HA 3T5VA 4APFA 1N54A 3IHYA 4CRWA 3G2WA 2CHXA 2WXOA 2VGYA 3Q4AB 4XE0A 4A3TA 4N39A 3I3NA 3EIJA 4DPRA 1DVPA 5LFAA 2VGXA 3LEWA 3QWWA 3OXLA 4GA1A 3SFZA 3R7QA 1INZA 2KATA 3TGOA 4WWNA 3MCXA 3ZRHA 3SBSA 4OYSA 1OWOA 1PAQA 2AW6A 4N3AA 4GYYA 4W9RA 5EKQD 3CVXA 4TV3A 4DI4A 1FCHA 2PM7A 4HLEA 3CHSA 3ASFA 2A5UA 4MLPA 2WXNA 4FJYA 1HG5A 3KAEA 3ZYMA 3PS6A 3S7BA 1KLXA 3QNKA 4I17A 4B8CB 2IF4A 3PE4A 2PQRA 4L1BA 3FU6A 3WXXA 4EBAA 4BT8A 3MA5A 4JHRA 5ARGA 4ABNA 4GA2A 3SNXA 4WNEA 3CK9A 3AS8A 2IOSA 1H0AA 3O4ZA 4FC8A 4FJZA 4ANUA 3D3MA 1NP7A 1OWMA 3CSFA 4ME2A 4RVBA 3RIBA 4FU3A 4J8EA 3FU3A 4KBQA 2WQHA 3Q49B 4JZYA 3CSTA 5KJMA 2VTBB 2I6HA 3BG0B 5FWQA 1HX8A 3GZSA 5BV1A 4K03A 2X38A 3FEXA 2GRLA 3GYZA 3PEUB 4G23A 1ZU2A 5JHAA 1SZAA 4UI9J 4J8DA 1HFAA 4JEHA 3LVQE 1Z6TA 2XPZA 2A4ZA 3T8MA 2XGSA 1JPLA 3APDA 4JC8A 4WAFA 2WMNA 2PM6A 3PRZA 3G2SA 5EX0A 4ACKA 1ELWA 1TJFA 2R17C 3ULQA 2M63A 2WXMA 4U8HA 3MKQA 2IU1A 2E0IA 3FUNA 1QNFA 4GZCA 5BPPA 4H7XA 3P1UA 4WWOA 5D0QD 2GRMA 2CHZA 3CVPA 2CHWA 3JYSA 1H2TC 5FTPA 3CVQA 1OWPA 4Q69A 4Y6WA 2J07A 1SQMA 3ZFWA 4XIFA 2YNQA 3ZYKA 3B7RL 4PDXA 3FTVA 2MOWA 4UWHA 4PUCA 4B89A 5BT1A 3FTZA 4HXIA 4OVVA 2UY1A 2X6JA 3LCAA 1E8YA 4Q96A 3R7RA 3FEYA 4YVQC 4A1GA 4BTAA 3L17A 4EPZA 4XKCA 2Y3AA 4FLBA 4HOSA 3L13A 3HIZA 2HM8A 4JA7A 3CHMA 3D9KA 4DLQA 3EHMA 2VSYA 4JHKA 4XI9A 3EDTB 2VSOE 2Y4UA 1YA0A 1OWNA 1IQUA 3UQ3A 3D9OA 3APCA 3CK8A 3I4RB 5E76A 3ONKA 4UWFA 1E90A 1PC2A 2XEVA 5EX3A 3RO2A 3TJPA 3IHVA 4GMLA 2V5FA 2YINA 1ZBPA 4XX5A 1OWLA 4U63A 4A1SA 2V0PA 3FUFA 3B7TA 3RRMB 4WNDA 4M3OA 3ZYQA 1OUVA 5FJYA 2WM9A 2XGMA 2V8SE 3SHFA 3D9MA 5BUZA 3RO3A 2WQ7A 4PS3A 3CGHA 3FUKA 4KYOB 1KT0A 4KT6B 2XGOA 4J8FA 4C0MA 2XRYA 2I1JA 2X3MA 4RSYA 3VLEA 4I6JA 4MS6A 2QY7A 1N52A 3FUJA 3S7DA 4GZ5A 2LAIA 2IFUA 2WPVA 5DBKA 2J9QA 4ILHB 4I6EA 4OVUA 3LPZA 4I9EA 2WB2A 4CDNA 3BG1B 3G2VA 4G11A 3CIAA 4I2WA 3LS8A 4JVSA 4YNDA 1FVFA 2CFZA 2XPYA 3L22A 3ASHA 2ILRA 2KZTB 3FUHA 1EPUA 1HE8A 4HVBA 1P5QA 3OAWA 5BNWA 1E8ZA 3IV0A 4UI9C 3CV0A 3AU4A 2YHEA 3DBSA 2AXVA 3EJNA 3MEKA 2C0LA 4AV7A 4J0UA 3NZSA 2DBAA 3ZEFA 4I9CA 3TG4A 4AM9A 2FO7A 1QQEA 3CVNA 3CKBA 5KCMA 4YVOA 5BW8C 2GGFA 3PE3A 3VLFA 1JWGA 4KVOA 1ELKA 3LYAA 4HOTA 4NACA 2WQ6A 4FADA 5LP0A 2R59A 1H2VC 3FWVA 3PUJA 3URZA 2OV8A 2WVIA 1B89A 5J90A 2RG8A 1IQRA 4N2SA 3KS2A 2NC9A 3UT7A 5AJDA 3PZDA 3L6AA 5M72A 3B7SA 3ONLA 4HORA 3P2BA 3ZXSA 4AP2A 3SI5A 3C98A 3MZLB 4MRUA 5G04C 4AY6A 4GCNA 2XPIA 4KZCA 4JW1A 3FP3A 3LKUA 3MV3B 1WY6A 5FT9A 5AENA 2KC7A 3PH0C 1PY1A 4EECA 2FBNA 2BUGA 3OXFA 4JXTA 4V3IA 4EZJA 3FTSA 5C1DA 1E96B 3MGBA 2KZTA 3LXUX 1E7UA 3IBEA 2GW1A 3GW4A 4UWKA 4UWLA 3CHPA 1L5JA 2QFCA 4J8SA 2VQ2A 3IEGA 3TXNA 1WM5A 2PQNA 5ARFA 5LCWJ 3QB2A 2IONA 2DCPA 3ESLA 4LUNU 3SF4A 4GA0A 5DIZA 2C0MA 3CQGB 2CG2A 3AS5A 4F1SA 4XI0A 3S2AA 2FI7A 5ANRA 5FZRA 4AJWA 1TEZA 4JHJA 4ATGA 4BWRA 5C2YA 4LRZA 4AY5A 3JUIA 2PL2A 2X6KA 2J4BA 2KCKA 3CKCA 4CT4A 3RJVA 4JA9A 4NRHB 3D9JA 2XCCA 5JHBA 3MKQB 3I4GA 4DI3A 1HU3A 5FQ6A 1E8WA 1MHQA 3Q47B 3FUMA 3LVRE 4GPKA 1LF8A 3N71A 4U07A 2UY1B 4UQZA 5LX8A 5FQ4A 3JQ1A 5CMYA 3TAXA 3MJWA 1UJJA 2DIWA 4NURA 2WXQA 3UMVA 3ZHEA 2L6JA 3CHRA 3PEVB 3Q5MA 1HZ4A 2E2EA 4GZ3A 3U9WA 5G2NA 4G1TA 3FU5A 2JEKA 1JUQA 3CVVA 4JEUA 2FEZA 2AWIA 2AXUA 2VSXE 4L2LA 4EBAG 2ONDA 2OVFA 3HYMB 4HS2A 4MKTA 1UG3A 4G25A 4GB9A 4IN3B 5A23A 2I1KA 3CVUA 3MYVA 3ZPJA 3FFLA 1VDYA 4QFVA 1XNFA 3FTYA 3PREA 3CVWA 4KVMA 2KCVA 5ENNA 3FH5A 1IHGA 2JLBA 3B13A 4FHKA 4N5CA 5HI7A 3RKVA 4ANVA 2LO6A 4UQYA 3R9AB 1ELRA 2OOEA 3APFA 3RRNB 4FA6A 2BF0X 3HDXA 3RU0A 3SD5A 3QC1A 1HS6A 3LY9A 4BX9A 4FP7A 3D9PA 2WXPA 2WXJA 4KZ0A 3FTUA 2L9BA 3FULA 4URKA 4PS7A 3ZVVA 3UX4A 3E4BA 1NZNA 1JWFA 2XCBA 2XHEA 4I2ZA 3CK7A 4R7LA 5KJKA 3FU0A 3CLJA 3FTWA 4GMJA 2C2LA 2YQ8A 2R5SA 3UT8A 5CHEE 3RRUA 3QWVA 3U64A 2VGXB 4CCAA 3D9LA 3HVEA 2WXFA 3L08A 2FULA 2J49A 2I2OA 4HOQA 5AYWD 3CEQA 4F7AA 1TJCA 3ML8A 3U66A 4A55A 3ESKA 4DLOA 2J09A 3VTYA 4EZLA 2Y4TA 2MRIA 4HOUA 3FH8A 5AIJA 1Z3YA 2UWJG 3ENEA 3HHMA 3L16A 3LJ3A 4ILIA 3L54A 2VYIA 5T3RA 1QZ2A 2AXZA 4TRQA 4RG6A 3TG5A 5AJLA 3SZ7A 3VLDA 1WAO1 3MV2B 4I43A 4G24A 4KXKB 4GU5A 2VTBA 2NSZA 3SGHA 4FHJA 4ILGA 3TXMA 2ZU6B 4I6GA 3K9IA 4LERA 5T8IA 1HXIA 5JJTA 3G2TA 3FH7A 4N3BA 3KEZA 4WWPA 1HF8A 3D9NA 3AS4A 3FUDA 4CEMA 4P29A 3NZUA 3MX3A 3ZYLA 3MKRA 1E8XA 3Q15A 2PZIA 2VSNA 4PH4B 4XKBA 3PNTB 4UWGA 1E7VA 2WMOA 4L7TA 3SBTB 5BV0A 2WXKA 4F3VA 1NA0A 4AEZC 2EQXA 3DPDA 5JJ7A 3JQ0A 1U3DA 1A17A 4FLHA 2LAHA 4GAAA 4J6IA 4N3CA 4BFRA 2J4DA 4UI9K 4U0SA 2LSUA 4Q94A 2LSVA 4JPSA 4K0RA 3QKYA 4E6HA 3ASDA 4LCTA 5FQ7A 5FZSA 4CGWA 5HQ8A 3ZIMA 4AXHA 3QWPA 3CHOA 3JCKC 3NQPA 4E85A 4CGVA 3GZ1A 3O48A 3FUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WNF A;  4Y6C A;  2KAT A;  3TGO A;  5A7D B;  4GPK A;  3N71 A;  3VTX A;  4U07 A;  2LNI A;  2UY1 B;  3S7D A;  3GZ1 A;  4GZ5 A;  4UQZ A;  2IFU A;  3U4T A;  2WPV A;  4W9R A;  4N3A A;  2J9Q A;  4GYY A;  5DBK A;  5EKQ D;  3TAX A;  1FCH A;  3LPZ A;  4I9E A;  3ZN3 A;  5FZQ A;  3ASF A;  5G04 J;  2KCL A;  4H7Y A;  3ZHE A;  3LY8 A;  2L6J A;  3Q5M A;  4I2W A;  1HZ4 A;  2E2E A;  3KAE A;  4G26 A;  4GZ3 A;  4WUY A;  4YND A;  4B94 A;  3S7B A;  1KLX A;  4G1T A;  4I17 A;  3S7J A;  3ASH A;  2IF4 A;  3PE4 A;  2PQR A;  3WXX A;  2FEZ A;  4BT8 A;  4O6F A;  3MA5 A;  4JHR A;  5ARG A;  4ABN A;  4GA2 A;  1P5Q A;  4WNE A;  2OND A;  3BEE A;  3GZ2 A;  3HYM B;  3CK9 A;  5BNW A;  3AS8 A;  4UI9 C;  2HYZ A;  3CV0 A;  4IN3 B;  5LCW C;  4ME2 A;  3RIB A;  4JL0 A;  3ZPJ A;  3FFL A;  4J8E A;  3MEK A;  2C0L A;  1XNF A;  4UQX A;  4GCO A;  2WQH A;  2KCV A;  3Q49 B;  4J0U A;  1IHG A;  4KBQ A;  2JLB A;  2I6H A;  5G05 J;  5HI7 A;  4NQ0 A;  2DBA A;  4N5C A;  3RKV A;  5CCL A;  2AVP A;  4UQY A;  4I9C A;  3R9A B;  3OXL A;  1ELR A;  4G2V A;  2OOE A;  3TG4 A;  3GYZ A;  4AM9 A;  4G23 A;  1KT1 A;  5KJM A;  1ZU2 A;  2FO7 A;  1QQE A;  2MHK A;  3CVN A;  4J8D A;  4UI9 J;  3RU0 A;  4AIF A;  3ZGQ A;  3CKB A;  3LY9 A;  4YVO A;  5BW8 C;  4BT9 A;  3PE3 A;  2XGS A;  4APO A;  3CVL A;  1NA3 A;  3LYA A;  4HOT A;  4U0U A;  5EX0 A;  1ELW A;  4BTB A;  5D0O D;  3E4B A;  3FWV A;  1NZN A;  2XCB A;  3URZ A;  2FF4 A;  1B89 A;  3ASG A;  4I2Z A;  3CK7 A;  4CDR A;  5KJK A;  3ULQ A;  2C2L A;  2YQ8 A;  4GYO A;  2R5S A;  3UUX A;  3LY7 A;  1W3B A;  3QWV A;  5CHE E;  4N2S A;  1IYG A;  4J8F A;  2VGX B;  2NC9 A;  3KS2 A;  5M72 A;  4U0Z A;  3NF1 A;  4H7X A;  4HOQ A;  5D0Q D;  5AYW D;  4HOR A;  3QDN A;  3CEQ A;  1TJC A;  2HO1 A;  3CVP A;  5A6C A;  3ESK A;  3JYS A;  5FTP A;  2P58 C;  3CVQ A;  4RG9 A;  5G04 C;  3S7F A;  3VTY A;  4AY6 A;  4GCN A;  4Y6W A;  2XPI A;  2Y4T A;  3ZFW A;  4HOU A;  4XIF A;  2UWJ G;  3FP3 A;  3LKU A;  2YHC A;  3KD7 A;  3MV3 B;  3ZHE B;  2VYI A;  5FT9 A;  5KJL A;  1QZ2 A;  4I1A A;  2KC7 A;  4RG6 A;  3TG5 A;  1Y8M A;  3SZ7 A;  5BT1 A;  1WAO 1;  3MV2 B;  4KXK B;  2FBN A;  2BUG A;  2HR2 A;  2UY1 A;  3LCA A;  3OXF A;  4G24 A;  5JJ6 A;  1E96 B;  3QOU A;  4YVQ C;  4BTA A;  5C1D A;  3UPV A;  5CCM A;  3K9I A;  2Q7F A;  1HXI A;  5JJT A;  2GW1 A;  3GW4 A;  4N3B A;  4HOS A;  4EQF A;  2QFC A;  4JA7 A;  2VQ2 A;  3IEG A;  4GZ6 A;  1WM5 A;  4U04 A;  2PQN A;  2VSY A;  3AS4 A;  3OXG A;  4WNG A;  4XI9 A;  3EDT B;  5ARF A;  2Y4U A;  5LCW J;  1YA0 A;  3SF4 A;  5KJN A;  3MKR A;  4GA0 A;  5DIZ A;  3UQ3 A;  2C0M A;  3CK8 A;  3Q15 A;  2PZI A;  2VSN A;  3AS5 A;  2XEV A;  1PC2 A;  5EX3 A;  3RO2 A;  4XI0 A;  3PDN A;  2FI7 A;  5FZR A;  4N2Q A;  4F3V A;  1NA0 A;  2V5F A;  4GA1 A;  5JJ7 A;  1ZBP A;  1HH8 A;  4AY5 A;  4BWR A;  1A17 A;  4A1S A;  2PL2 A;  4N3C A;  5G05 C;  3U3W A;  4UI9 K;  4LEU A;  2LSU A;  4GYW A;  4U0S A;  2KCK A;  4WND A;  2LSV A;  1OUV A;  3CKC A;  5FJY A;  2XGM A;  3QKY A;  3RJV A;  2VGY A;  3ASD A;  3Q4A B;  4JA9 A;  4NRH B;  4N39 A;  5FZS A;  3RO3 A;  4CGW A;  2XCC A;  5HQ8 A;  3QWP A;  2VGX A;  3QWW A;  4CGV A;  4KYO B;  1KT0 A;  2XGO A;  3O48 A;  3Q47 B;  4G25 A; 
#chains in the Genus database with same CATH topology
 5EYL A;  3VTX A;  3ML9 A;  5LOZ A;  5AQA A;  3AU5 A;  2KCL A;  4H7Y A;  3LY8 A;  3ABL E;  4B94 A;  3IKO B;  1H6P A;  2ZXW E;  1XGW A;  4GTQ A;  5KNG A;  1H6K A;  4DJA A;  3QJZ A;  1X5B A;  3G2U A;  2QZA A;  3B7U X;  3DSX A;  3JUE A;  4NQ0 A;  2L0I A;  3TWX A;  3EU9 A;  4X8Q A;  3ZGQ A;  5ENR D;  1TN6 A;  3PNL B;  1IYG A;  1H2U A;  3NF1 A;  4YDW A;  2V4L A;  4GTS A;  5A6C A;  1UN8 A;  1WDY A;  1EYH A;  1UJK A;  3CR3 A;  5JJ6 A;  2RD0 A;  3UPV A;  3ZXP A;  5CCM A;  1OXJ A;  4EQF A;  4WNG A;  3SY2 A;  4KMO A;  4O60 A;  1EF1 C;  1MYO A;  1Z5S C;  4U8V D;  3E33 A;  1HH8 A;  5G05 C;  4BX8 A;  3HXC A;  4APF A;  1N54 A;  2WXO A;  3Q4A B;  4N39 A;  1QBQ A;  3EIJ A;  4U95 D;  3SFZ A;  3R7Q A;  3Q78 A;  5EN5 D;  4HI8 A;  1G3N B;  4OYS A;  5CEC B;  5EKQ D;  4DI4 A;  4HLE A;  1FCH A;  3CHS A;  3ASF A;  2A5U A;  3PS6 A;  2PQR A;  3FU6 A;  4JHR A;  5ARG A;  3O4Z A;  4ANU A;  1NP7 A;  3CSF A;  4RVB A;  1TNU A;  3FU3 A;  2VTB B;  3CST A;  3BG0 B;  3KSL A;  3NBN B;  1TNZ A;  2GRL A;  1ZU2 A;  4J8D A;  2RFA A;  3T8M A;  4WAF A;  2WMN A;  3PRZ A;  5EX0 A;  5EIB E;  1ELW A;  3DSS A;  3ULQ A;  1O1R A;  2IU1 A;  4H7X A;  3P1U A;  5D0Q D;  2GRM A;  2CHW A;  3JYS A;  3CVQ A;  1OWP A;  4GTT A;  1SQM A;  3ZYK A;  4PDX A;  2MOW A;  4UWH A;  4PUC A;  2X6J A;  4Q96 A;  1E8Y A;  3FEY A;  2XZT G;  4FLB A;  2HM8 A;  1N94 A;  3EHM A;  2VSO E;  5CBN A;  3CK8 A;  3I4R B;  5E76 A;  2XEV A;  3RO2 A;  3PZ3 A;  4BER A;  4GTP A;  1FT1 A;  2P9S G;  4C48 B;  3ZNG A;  4PS3 A;  3CGH A;  3FUK A;  1KT0 A;  4J8F A;  2X3M A;  4J7W A;  1N52 A;  4GZ5 A;  2RKK A;  4OVU A;  2WB2 A;  4CDN A;  3G2V A;  2BKK B;  4G11 A;  4YND A;  5EIL A;  3L22 A;  3ASH A;  1O5M A;  2KZT B;  2BED A;  1HE8 A;  3ZKJ A;  1P5Q A;  3IV0 A;  3BQO A;  3D9H A;  4BES A;  3NZS A;  4LSZ E;  3CVN A;  5KCM A;  3T9K A;  2GGF A;  3LYA A;  4HOT A;  4HRM B;  1H2V C;  2OV8 A;  2NC9 A;  5M72 A;  5AJD A;  3PZD A;  3MZL B;  4JW1 A;  3LKU A;  2P9P G;  5KWD A;  2XS1 A;  4V3I A;  2KZT A;  2VGE A;  4UWK A;  3CVY A;  3CHP A;  4GTR A;  4GA0 A;  5DIZ A;  3CQG B;  3AS5 A;  4U96 D;  2QYJ A;  4GTV A;  4XI0 A;  3S2A A;  4ATG A;  5C2Y A;  4AY5 A;  1V54 E;  3JUI A;  2PL2 A;  2X6K A;  1KPS B;  2KCK A;  3IXE A;  3RJV A;  3TWS A;  3I4G A;  1E8W A;  1MHQ A;  4GPK A;  4OAU C;  4NUR A;  2WXQ A;  5ENP D;  4K5A B;  3PEV B;  1O1S A;  3U9W A;  1IHB A;  3JXI A;  2B0O E;  3CVV A;  1NL4 A;  2VSX E;  2OND A;  2OVF A;  5A23 A;  2QYU A;  4IN3 B;  3MYV A;  4Z68 A;  5CRU A;  3ZPJ A;  1VDY A;  4HRN A;  4KVM A;  2JLB A;  5HI7 A;  5HKP A;  3RKV A;  2LO6 A;  4UQY A;  2OOE A;  3ABM E;  5CRV A;  2HE0 A;  3HDX A;  3RU0 A;  3SD5 A;  1N0Q A;  3D9P A;  2L9B A;  3FUL A;  5ENS D;  4URK A;  4PS7 A;  3UX4 A;  2XHE A;  4R7L A;  1JCQ A;  2GRQ B;  2YQ8 A;  2R5S A;  3UT8 A;  1D9S A;  3PZ4 A;  3D9L A;  3HVE A;  2J49 A;  5AYW D;  3CEQ A;  1TJC A;  2Y4T A;  5AIJ A;  1JCR A;  1Z3Y A;  3L16 A;  1FPP A;  2AXZ A;  4RG6 A;  3VLD A;  1V55 E;  4G24 A;  1Q2Z A;  4GU5 A;  2NSZ A;  3SGH A;  4FHJ A;  3K9I A;  1HXI A;  3FH7 A;  4N3B A;  4B93 B;  3Q15 A;  2PZI A;  4XKB A;  3PNT B;  3SBT B;  3HG0 D;  4F3V A;  4AEZ C;  2EQX A;  1S64 A;  3W9G A;  4GAA A;  1RZ4 A;  4UI9 K;  4DRX E;  2LSU A;  4Q94 A;  2LSV A;  2F8X K;  3QWP A;  3DEP A;  3JCK C;  3NQP A;  4HI9 A;  3GZ1 A;  5A7D B;  5G55 A;  2DYS E;  4I1M A;  2WXI A;  2KM4 A;  1N4P A;  2IQC A;  1MQS A;  4G26 A;  4WUY A;  1S0P A;  3LDZ A;  3D9I A;  3V2X A;  3I5P A;  3BEE A;  4IRU A;  4N5Q A;  5LCW C;  3QK0 A;  4JL0 A;  5ENO D;  5J08 A;  4CYM D;  4G2V A;  1UW4 B;  1KZP A;  1NFI E;  4HQD A;  4TUM A;  4BTB A;  4BSX A;  5ANL A;  2WXH A;  2FF4 A;  3ASG A;  3UUX A;  1W3B A;  2HO1 A;  2WXL A;  3L82 A;  3S7F A;  4RG9 A;  2I9C A;  3TWV A;  4GZD A;  2WXG A;  4CDM A;  3QOU A;  1KZO A;  2Q7F A;  2P9N G;  2J08 A;  3FY4 A;  4RQI A;  1DNP A;  3T5X A;  4DX7 D;  2IOL A;  3HXD A;  3PDN A;  4IYP A;  3FUE A;  3UXG A;  3C3O A;  1UN9 A;  4N2Q A;  3EHQ A;  5T4Y A;  4C0E A;  4TUU A;  3IHY A;  3BU8 A;  3G2W A;  3AAA C;  3I3N A;  3QWW A;  3LEW A;  1UOH A;  3Q9N C;  1INZ A;  2KAT A;  1MX6 A;  4WWN A;  1YMP A;  3ZRH A;  3SBS A;  1OWO A;  1PAQ A;  2AW6 A;  4TV3 A;  4FJY A;  1KLX A;  4I17 A;  2IF4 A;  3WXX A;  4EBA A;  4GA2 A;  4CZ2 D;  2P9L G;  2IOS A;  1H0A A;  3D3M A;  3RIB A;  1OCZ E;  4FU3 A;  1N4R A;  4KBQ A;  4JZY A;  2R03 A;  3DWL G;  4F6R D;  3V2O A;  1HX8 A;  1K1B A;  3GZS A;  3SFX A;  4J8Y A;  5BV1 A;  4ZFH A;  2NYJ A;  4UI9 J;  3LVQ E;  2XPZ A;  2XGS A;  1JPL A;  2EIK E;  2PM6 A;  3G2S A;  2EIN E;  3T8K A;  4ZHB A;  2E0I A;  3FUN A;  4GZC A;  5BPP A;  2CHZ A;  3DXK G;  3FTV A;  3Q7A A;  4B89 A;  2DYR E;  4TXR A;  1K1A A;  4HXI A;  3AG1 E;  4A1G A;  4EPZ A;  4XKC A;  1TNY A;  3D9K A;  2VSY A;  2Y4U A;  1TYQ G;  1YA0 A;  1IQU A;  3UQ3 A;  3D9O A;  3APC A;  3ONK A;  3TJP A;  3IHV A;  2IO3 C;  2V5F A;  5D66 A;  2YIN A;  1ZBP A;  4XX5 A;  1OWL A;  2J8S D;  1X81 A;  2JAB A;  4M3O A;  1OUV A;  5FJY A;  2XGM A;  1DCE A;  2V8S E;  3EHR A;  5BUZ A;  3RO3 A;  4YDE A;  2DZO A;  1YCS B;  4MS6 A;  2Y1L E;  2LAI A;  4ILH B;  3C3Q A;  2ETC A;  5AQB A;  2ETA A;  1TN8 A;  3CIA A;  3ABK E;  3FUH A;  2R05 A;  4BSZ B;  1E8Z A;  3CV0 A;  3DBS A;  2C0L A;  2DBA A;  4I9C A;  3TG4 A;  4L9P A;  3PE3 A;  3E37 A;  3VLF A;  4GTM A;  3UM1 A;  2WQ6 A;  5LP0 A;  2WVI A;  1B89 A;  2KBX A;  2P9I G;  3KS2 A;  3L6A A;  4M7C A;  3E32 A;  1MX4 A;  4MRU A;  5G04 C;  4AY6 A;  2XPI A;  4KZC A;  1FT2 A;  3MV3 B;  5BXU A;  5FT9 A;  4TXQ A;  3TWR A;  2KC7 A;  1N4Q A;  4JXT A;  4EZJ A;  1E7U A;  3IBE A;  2GW1 A;  3TXN A;  4BY6 A;  4UWL A;  1L5J A;  2QFC A;  2VQ2 A;  1WM5 A;  3QB2 A;  2ION A;  3SF4 A;  4LUN U;  2C0M A;  2IO2 C;  3ASN E;  4JHJ A;  4BWR A;  4DX1 A;  4CT4 A;  5HS0 A;  4JA9 A;  4NRH B;  5JHB A;  5FQ6 A;  3N71 A;  2UY1 B;  2LXL A;  5FQ4 A;  5JMN D;  3JQ1 A;  3TAX A;  2OEV A;  2GRP B;  3ZHE A;  2L6J A;  4GZ3 A;  3FU5 A;  5B1A E;  2AXU A;  4EBA G;  1BU9 A;  3CVU A;  2DZN A;  2P9K G;  3PRE A;  3CVW A;  3LJN A;  4OAV B;  2KCV A;  1IHG A;  4FHK A;  4F1P A;  3R9A B;  3APF A;  4FA6 A;  5AQ7 A;  3UIN C;  1MX2 A;  1HS6 A;  1N4S A;  3LY9 A;  4FP7 A;  4KZ0 A;  3FTU A;  3ZVV A;  1SW6 A;  1JWF A;  3HXF A;  2IY0 C;  3DSW A;  4JD2 G;  2VGX B;  3E34 A;  3L08 A;  3ESK A;  2F0Y A;  2V4H C;  3L9T A;  4EZL A;  4NIK A;  3NOC D;  3LJ3 A;  5T3R A;  1QZ2 A;  4TRQ A;  4G8L A;  3TG5 A;  3SFY A;  3MV2 B;  5AQ9 A;  3TXM A;  3BUA A;  3G2T A;  3KEZ A;  3AS4 A;  3WG7 E;  4P29 A;  3ZYL A;  1E8X A;  4PH4 B;  4UWG A;  2WMO A;  4L7T A;  1BI7 B;  2WXK A;  1NA0 A;  3DPD A;  1U3D A;  4FLH A;  3UI2 A;  4DX2 A;  4BFR A;  5KNH D;  4JPS A;  4K0R A;  5HQ8 A;  3NB2 A;  3X2Q E;  4AXH A;  3CHO A;  4E85 A;  4CGV A;  4G25 A;  3FUI A;  4WNF A;  1D8E A;  2LNI A;  1HG2 A;  4A3V A;  4K5B A;  5EDS A;  3ZN3 A;  5FZQ A;  5G04 J;  2OVB A;  4XZ4 A;  3U3W A;  1A5E A;  1SZ9 A;  1AP7 A;  4I1O B;  3S7J A;  3FHE A;  4QQI A;  4AVX A;  3GZ2 A;  5CCL A;  2HYZ A;  2NXP A;  1HO8 A;  2GRO B;  3ASO E;  4ACL A;  5CED B;  5G05 J;  1OCR E;  2AVP A;  2H6G A;  3ZW3 A;  2LXM A;  3DEO A;  4CT0 A;  2CFU A;  3CVL A;  1NA3 A;  4U0U A;  1LTX A;  3EIQ C;  1H6O A;  4B0Z A;  4GYO A;  3J5P A;  3LY7 A;  4IUL A;  3QDN A;  5CMW A;  2X6I A;  2YHC A;  3ZHE B;  3CHQ A;  4I1A A;  1Y8M A;  3EUV A;  2HR2 A;  3FTX A;  5HRY A;  4B8A A;  2XEH A;  5E75 A;  3PZ2 A;  4U04 A;  4HFG A;  5FQ8 A;  4DK5 A;  3OXG A;  3R9M A;  4L2Y A;  4C9B B;  4GTO A;  2MYO A;  5BXO A;  3ZUV B;  2V5Q C;  4F53 A;  2CHX A;  4XE0 A;  2EIJ E;  3B95 A;  3TGO A;  3MCX A;  4N3A A;  2PM7 A;  4MLP A;  2WXN A;  1HG5 A;  1TR4 A;  5JA4 D;  3S7B A;  3QNK A;  1BI8 B;  3UM0 A;  3PE4 A;  4BT8 A;  3MA5 A;  3AS8 A;  4FJZ A;  1OWM A;  4ME2 A;  2RFM A;  3DXM G;  5H7P A;  4RLY A;  5FWQ A;  2BKG A;  3JXJ A;  3FEX A;  4G23 A;  3PEU B;  3UKU G;  2EIM E;  1SZA A;  1HFA A;  2A4Z A;  1BD8 A;  3ULY A;  2H6H A;  4ACK A;  3Q73 A;  1TJF A;  1TNO A;  2WXM A;  3MKQ A;  1QNF A;  3C72 A;  4HB5 A;  4Q69 A;  4O1O A;  1K8K G;  4LNG A;  4Y6W A;  2J07 A;  4XIF A;  2YNQ A;  3B7R L;  5BT1 A;  4EHM A;  4OVV A;  3LCA A;  3R7R A;  4YVQ C;  4BTA A;  3L17 A;  5FIN A;  2Y3A A;  4HOS A;  3L13 A;  3HIZ A;  3CHM A;  4DLQ A;  3EDT B;  1OWN A;  4UWF A;  1E90 A;  5EX3 A;  3TWQ A;  1YYH A;  2V0P A;  3FUF A;  3ZYQ A;  3SHF A;  3D9M A;  4KT6 B;  2XGO A;  2XRY A;  2I1J A;  4RSY A;  2WPV A;  2J9Q A;  3E30 A;  3LPZ A;  1BLX B;  4JVS A;  1FVF A;  3UM2 A;  2ILR A;  4HVB A;  3OAW A;  3W9F A;  4UI9 C;  2YHE A;  1MZC A;  2IEJ A;  3MEK A;  4AV7 A;  2FO7 A;  1QQE A;  3CKB A;  4KVO A;  4NAC A;  5J90 A;  4N2S A;  3UT7 A;  2QC9 A;  4HOR A;  3P2B A;  3ZXS A;  3TWT A;  3SI5 A;  2Y69 E;  3V30 A;  3FP3 A;  5AAO A;  1WY6 A;  1PY1 A;  1SA5 A;  3OXF A;  5C1D A;  3MGB A;  4HBD A;  3GW4 A;  3IEG A;  2PQN A;  5ARF A;  5LCW J;  2DCP A;  1D8D A;  2CG2 A;  4F1S A;  3DST A;  3HXB A;  2FI7 A;  5FZR A;  1TEZ A;  2Y0B G;  2J4B A;  3CKC A;  2XEN A;  2XCC A;  4DI3 A;  1HU3 A;  3UIP C;  3LVR E;  5LX8 A;  3MJW A;  1UJJ A;  3DPY A;  1TN7 A;  3UMV A;  2P9U G;  3Q5M A;  1HZ4 A;  5G2N A;  4G1T A;  2JEK A;  1JUQ A;  3Q75 A;  2FEZ A;  2AWI A;  3AG2 E;  2XS8 A;  3HYM B;  1UG3 A;  5ENT D;  3AG3 E;  3FFL A;  4QFV A;  3FTY A;  3B13 A;  4ANV A;  1ELR A;  3KSQ A;  3F6Q A;  3V79 K;  2BF0 X;  2LUH A;  2L6B A;  3QC1 A;  3SO8 A;  2WXP A;  2WXJ A;  3RAU A;  4I2Z A;  3CK7 A;  3Q9U C;  3B7B A;  3UIO C;  4GMJ A;  5CHE E;  3RRU A;  2AJA A;  2FUL A;  2I2O A;  3AG4 E;  4F7A A;  4BEP A;  3U66 A;  4DLO A;  2J09 A;  2KXP C;  2MRI A;  4HOU A;  3FH8 A;  2UWJ G;  3HHM A;  3L54 A;  4I43 A;  3ZU7 B;  2ZU6 B;  4LER A;  5T8I A;  5EID A;  5JJT A;  2R2L A;  1HF8 A;  3FUD A;  4CEM A;  3MX3 A;  3MKR A;  4A63 B;  2VSN A;  1N0R A;  4G8K A;  1OY3 D;  1E7V A;  5BV0 A;  1LD7 A;  3ULE G;  4YDY A;  5JJ7 A;  4XEI G;  4J6I A;  4U0S A;  3V31 A;  3QKY A;  4JB8 P;  5FQ7 A;  4LCT A;  5FZS A;  4CGW A;  3TWW A;  4LG6 A;  3O48 A;  4Y6C A;  5FIO A;  3U4T A;  4PS8 A;  3J5Q B;  4D10 C;  1Y6I A;  2BTD A;  1RW2 A;  4EZK A;  1K3Z D;  2IJG X;  2WXR A;  4AOF A;  3DSV A;  4O6F A;  2ETB A;  2XQ0 A;  5IY5 E;  3CQC B;  4UQX A;  4GCO A;  5EYP F;  3QAR A;  2VJ8 A;  2F8Y A;  4ANW A;  1KT1 A;  2MHK A;  4AIF A;  1OCO E;  4BT9 A;  4APO A;  3DRA A;  1H19 A;  1Z3X A;  3NAW A;  3EU5 A;  4DX5 D;  5D0O D;  4CDR A;  3PVL A;  4U0Z A;  2F37 A;  3TL5 A;  1SA4 A;  2P58 C;  4UUC A;  2X6F A;  2GRR B;  3EHN A;  2ZIS A;  3KD7 A;  5KJL A;  1U3C A;  2ZGG A;  1BPO A;  1N9A A;  2R02 A;  4ANX A;  3UT4 A;  1GW6 A;  1DCQ A;  4FUL A;  4DX6 D;  1EDU A;  4GZ6 A;  1NI1 A;  1FVH A;  5KJN A;  2CG3 A;  3FDH A;  4L23 A;  2L0T B;  2EIL E;  3QAQ A;  4HNA D;  3OTN A;  3RK6 A;  3PUK A;  3UTM A;  3HVE B;  2XRZ A;  4LEU A;  4GYW A;  2X6H A;  3T5V A;  4CRW A;  2VGY A;  4A3T A;  1N11 A;  1TNB A;  4DPR A;  1DVP A;  5LFA A;  2VGX A;  3OXL A;  4GA1 A;  4W9R A;  3CVX A;  4GYY A;  2B6C A;  3KAE A;  4HLL A;  3ZYM A;  3UKR G;  4B8C B;  4L1B A;  4ABN A;  5ITZ F;  3SNX A;  4WNE A;  1MJ0 A;  3CK9 A;  5ENQ D;  2P2C P;  4FC8 A;  2XZD G;  4O1P A;  4J8E A;  2WQH A;  3Q49 B;  5KJM A;  2I6H A;  5CER B;  4K03 A;  2X38 A;  3GYZ A;  5JHA A;  4LNU D;  4JEH A;  1Z6T A;  1IKN D;  3HXE A;  3APD A;  4JC8 A;  3ISM C;  4BET A;  5CEA A;  3SQV A;  2R17 C;  2M63 A;  4U8H A;  4WWO A;  3Q7F A;  2FO1 E;  1OCC E;  3CVP A;  5FTP A;  1H2T C;  4MBG A;  3ZFW A;  3AJI A;  4TXP A;  3FTZ A;  2UY1 A;  4JA7 A;  4JHK A;  4XI9 A;  5AAR A;  1PC2 A;  4GML A;  4A1S A;  4U63 A;  3B7T A;  3RRM B;  4WND A;  2WM9 A;  2WQ7 A;  3C5R A;  4KYO B;  4C0M A;  3VLE A;  2H6F A;  4I6J A;  1SVX A;  2QY7 A;  3FUJ A;  3S7D A;  2IFU A;  5DBK A;  5D2M C;  4I6E A;  1WG0 A;  4I9E A;  3BG1 B;  4I2W A;  3LS8 A;  1IXV A;  2CFZ A;  2XPY A;  2OEW A;  1EPU A;  2DWZ A;  5BNW A;  3AU4 A;  2AXV A;  3EJN A;  4J0U A;  3UM3 A;  2XEE A;  3ZEF A;  4AM9 A;  1JCS A;  5BW8 C;  4YVO A;  2DVW A;  1LD8 A;  1JWG A;  1ELK A;  4K5C A;  4FAD A;  3Q79 A;  4DUI A;  4ATZ D;  2R59 A;  3FWV A;  3PUJ A;  3URZ A;  2RG8 A;  1IQR A;  3B7S A;  3ONL A;  4AP2 A;  3C98 A;  4GCN A;  1AWC B;  3KEA A;  4LNB A;  5AEN A;  3PH0 C;  4EEC A;  2FBN A;  2BUG A;  3FTS A;  1E96 B;  3LXU X;  4J8S A;  2GRN B;  3ESL A;  4U7E B;  1U2V G;  5ANR A;  5AN8 A;  4GPM A;  4AJW A;  2PNN A;  4LRZ A;  1N95 A;  2H6I A;  5CBO A;  3D9J A;  3MKQ B;  3Q47 B;  3FUM A;  5KBA A;  2OCC E;  1LF8 A;  3C3R A;  4U07 A;  4UQZ A;  5CMY A;  2DIW A;  3CHR A;  4U8Y D;  2E2E A;  4JEU A;  4L2L A;  1DC2 A;  3NOG D;  4MKT A;  4HS2 A;  4GB9 A;  3RSE G;  2I1K A;  1OT8 A;  3PZ1 A;  1XNF A;  2ZGD A;  5ENN A;  3FH5 A;  2A5E A;  4N5C A;  1QYM A;  2ZIR A;  3RRN B;  4GMR A;  4BX9 A;  4HRL A;  3E4B A;  1NZN A;  2XCB A;  5KJK A;  3FU0 A;  3CLJ A;  3FTW A;  2C2L A;  3QWV A;  3U64 A;  4CCA A;  3DSU A;  2WXF A;  4HOQ A;  1S63 A;  5B1B E;  3ML8 A;  4A55 A;  3VTY A;  3HRA A;  1S70 B;  3ENE A;  4ILI A;  5B3S E;  2VYI A;  5AJL A;  3SZ7 A;  1WAO 1;  4KXK B;  2VTB A;  1O1T A;  4ILG A;  4I6G A;  4WWP A;  3D9N A;  3NZU A;  4YDO A;  3JQ0 A;  1A17 A;  2LAH A;  4N3C A;  2J4D A;  4E6H A;  3ASD A;  3ZIM A;  3TWU A;  1ZB1 A; 
#chains in the Genus database with same CATH homology
 4WNF A;  4Y6C A;  5A7D B;  3VTX A;  5G55 A;  2LNI A;  3ML9 A;  1HG2 A;  4I1M A;  5LOZ A;  4A3V A;  5EDS A;  3U4T A;  2WXI A;  2KM4 A;  4PS8 A;  3AU5 A;  3ZN3 A;  1Y6I A;  5FZQ A;  5G04 J;  2KCL A;  4D10 C;  2BTD A;  4H7Y A;  3LY8 A;  2OVB A;  4XZ4 A;  2IQC A;  1MQS A;  4EZK A;  3U3W A;  4G26 A;  1SZ9 A;  4B94 A;  3IKO B;  4WUY A;  1S0P A;  2IJG X;  4I1O B;  3S7J A;  3LDZ A;  2WXR A;  3D9I A;  4AOF A;  3FHE A;  4O6F A;  4AVX A;  3I5P A;  3BEE A;  3GZ2 A;  5CCL A;  1XGW A;  4IRU A;  3CVY A;  2HYZ A;  2NXP A;  2XQ0 A;  5LCW C;  1H6K A;  1HO8 A;  3QK0 A;  4JL0 A;  3CQC B;  3QJZ A;  4ACL A;  1X5B A;  4DJA A;  5J08 A;  4UQX A;  3G2U A;  4GCO A;  5G05 J;  3B7U X;  4NQ0 A;  3QAR A;  2L0I A;  2AVP A;  2VJ8 A;  3ZW3 A;  4ANW A;  4G2V A;  1UW4 B;  1KT1 A;  4BY6 A;  2MHK A;  4AIF A;  3ZGQ A;  4BT9 A;  4APO A;  4CT0 A;  2CFU A;  3CVL A;  1H19 A;  1NA3 A;  1Z3X A;  4U0U A;  3EIQ C;  4BTB A;  5D0O D;  4BSX A;  5ANL A;  2WXH A;  2FF4 A;  3ASG A;  4CDR A;  4B0Z A;  4GYO A;  3UUX A;  3LY7 A;  1W3B A;  3PNL B;  3PVL A;  1IYG A;  4IUL A;  1H2U A;  4U0Z A;  3NF1 A;  3TL5 A;  2V4L A;  3QDN A;  2HO1 A;  5A6C A;  2WXL A;  3S7F A;  2P58 C;  2X6F A;  4RG9 A;  5CMW A;  1UN8 A;  2X6I A;  3EHN A;  2YHC A;  3KD7 A;  3ZHE B;  3CHQ A;  5KJL A;  1U3C A;  1BPO A;  1EYH A;  2I9C A;  4I1A A;  4GZD A;  1Y8M A;  2WXG A;  1UJK A;  4CDM A;  4ANX A;  2HR2 A;  1GW6 A;  3FTX A;  3UT4 A;  3CR3 A;  5JJ6 A;  2RD0 A;  3QOU A;  4B8A A;  3UPV A;  4FUL A;  5CCM A;  2Q7F A;  5E75 A;  1EDU A;  4EQF A;  4U04 A;  4GZ6 A;  4HFG A;  5FQ8 A;  4DK5 A;  4WNG A;  3OXG A;  1FVH A;  4L2Y A;  5KJN A;  4KMO A;  4C9B B;  2CG3 A;  2J08 A;  3FY4 A;  3FDH A;  1DNP A;  4L23 A;  3T5X A;  2L0T B;  3QAQ A;  1EF1 C;  3OTN A;  2IOL A;  4IYP A;  3PDN A;  3RK6 A;  3FUE A;  4N2Q A;  1UN9 A;  3PUK A;  5T4Y A;  1HH8 A;  3HVE B;  4C0E A;  5G05 C;  2XRZ A;  4TUU A;  4F53 A;  4LEU A;  4BX8 A;  4GYW A;  2X6H A;  3T5V A;  4APF A;  1N54 A;  3IHY A;  4CRW A;  3G2W A;  2CHX A;  2WXO A;  2VGY A;  3Q4A B;  4XE0 A;  4A3T A;  4N39 A;  3I3N A;  3EIJ A;  4DPR A;  1DVP A;  5LFA A;  2VGX A;  3LEW A;  3QWW A;  3OXL A;  4GA1 A;  3SFZ A;  3R7Q A;  1INZ A;  2KAT A;  3TGO A;  4WWN A;  3MCX A;  3ZRH A;  3SBS A;  4OYS A;  1OWO A;  1PAQ A;  2AW6 A;  4N3A A;  4GYY A;  4W9R A;  5EKQ D;  3CVX A;  4TV3 A;  4DI4 A;  1FCH A;  2PM7 A;  4HLE A;  3CHS A;  3ASF A;  2A5U A;  4MLP A;  2WXN A;  4FJY A;  1HG5 A;  3KAE A;  3ZYM A;  3PS6 A;  3S7B A;  1KLX A;  3QNK A;  4I17 A;  4B8C B;  2IF4 A;  3PE4 A;  2PQR A;  4L1B A;  3FU6 A;  3WXX A;  4EBA A;  4BT8 A;  3MA5 A;  4JHR A;  5ARG A;  4ABN A;  4GA2 A;  3SNX A;  4WNE A;  3CK9 A;  3AS8 A;  2IOS A;  1H0A A;  3O4Z A;  4FC8 A;  4FJZ A;  4ANU A;  3D3M A;  1NP7 A;  1OWM A;  3CSF A;  4ME2 A;  4RVB A;  3RIB A;  4FU3 A;  4J8E A;  3FU3 A;  4KBQ A;  2WQH A;  3Q49 B;  4JZY A;  3CST A;  5KJM A;  2VTB B;  2I6H A;  3BG0 B;  5FWQ A;  1HX8 A;  3GZS A;  5BV1 A;  4K03 A;  2X38 A;  3FEX A;  2GRL A;  3GYZ A;  3PEU B;  4G23 A;  1ZU2 A;  5JHA A;  1SZA A;  4UI9 J;  4J8D A;  1HFA A;  4JEH A;  3LVQ E;  1Z6T A;  2XPZ A;  2A4Z A;  3T8M A;  2XGS A;  1JPL A;  3APD A;  4JC8 A;  4WAF A;  2WMN A;  2PM6 A;  3PRZ A;  3G2S A;  5EX0 A;  4ACK A;  1ELW A;  1TJF A;  2R17 C;  3ULQ A;  2M63 A;  2WXM A;  4U8H A;  3MKQ A;  2IU1 A;  2E0I A;  3FUN A;  1QNF A;  4GZC A;  5BPP A;  4H7X A;  3P1U A;  4WWO A;  5D0Q D;  2GRM A;  2CHZ A;  3CVP A;  2CHW A;  3JYS A;  1H2T C;  5FTP A;  3CVQ A;  1OWP A;  4Q69 A;  4Y6W A;  2J07 A;  1SQM A;  3ZFW A;  4XIF A;  2YNQ A;  3ZYK A;  3B7R L;  4PDX A;  3FTV A;  2MOW A;  4UWH A;  4PUC A;  4B89 A;  5BT1 A;  3FTZ A;  4HXI A;  4OVV A;  2UY1 A;  2X6J A;  3LCA A;  1E8Y A;  4Q96 A;  3R7R A;  3FEY A;  4YVQ C;  4A1G A;  4BTA A;  3L17 A;  4EPZ A;  4XKC A;  2Y3A A;  4FLB A;  4HOS A;  3L13 A;  3HIZ A;  2HM8 A;  4JA7 A;  3CHM A;  3D9K A;  4DLQ A;  3EHM A;  2VSY A;  4JHK A;  4XI9 A;  3EDT B;  2VSO E;  2Y4U A;  1YA0 A;  1OWN A;  1IQU A;  3UQ3 A;  3D9O A;  3APC A;  3CK8 A;  3I4R B;  5E76 A;  3ONK A;  4UWF A;  1E90 A;  1PC2 A;  2XEV A;  5EX3 A;  3RO2 A;  3TJP A;  3IHV A;  4GML A;  2V5F A;  2YIN A;  1ZBP A;  4XX5 A;  1OWL A;  4U63 A;  4A1S A;  2V0P A;  3FUF A;  3B7T A;  3RRM B;  4WND A;  4M3O A;  3ZYQ A;  1OUV A;  5FJY A;  2WM9 A;  2XGM A;  2V8S E;  3SHF A;  3D9M A;  5BUZ A;  3RO3 A;  2WQ7 A;  4PS3 A;  3CGH A;  3FUK A;  4KYO B;  1KT0 A;  4KT6 B;  2XGO A;  4J8F A;  4C0M A;  2XRY A;  2I1J A;  2X3M A;  4RSY A;  3VLE A;  4I6J A;  4MS6 A;  2QY7 A;  1N52 A;  3FUJ A;  3S7D A;  4GZ5 A;  2LAI A;  2IFU A;  2WPV A;  5DBK A;  2J9Q A;  4ILH B;  4I6E A;  4OVU A;  3LPZ A;  4I9E A;  2WB2 A;  4CDN A;  3BG1 B;  3G2V A;  4G11 A;  3CIA A;  4I2W A;  3LS8 A;  4JVS A;  4YND A;  1FVF A;  2CFZ A;  2XPY A;  3L22 A;  3ASH A;  2ILR A;  2KZT B;  3FUH A;  1EPU A;  1HE8 A;  4HVB A;  1P5Q A;  3OAW A;  5BNW A;  1E8Z A;  3IV0 A;  4UI9 C;  3CV0 A;  3AU4 A;  2YHE A;  3DBS A;  2AXV A;  3EJN A;  3MEK A;  2C0L A;  4AV7 A;  4J0U A;  3NZS A;  2DBA A;  3ZEF A;  4I9C A;  3TG4 A;  4AM9 A;  2FO7 A;  1QQE A;  3CVN A;  3CKB A;  5KCM A;  4YVO A;  5BW8 C;  2GGF A;  3PE3 A;  3VLF A;  1JWG A;  4KVO A;  1ELK A;  3LYA A;  4HOT A;  4NAC A;  2WQ6 A;  4FAD A;  5LP0 A;  2R59 A;  1H2V C;  3FWV A;  3PUJ A;  3URZ A;  2OV8 A;  2WVI A;  1B89 A;  5J90 A;  2RG8 A;  1IQR A;  4N2S A;  3KS2 A;  2NC9 A;  3UT7 A;  5AJD A;  3PZD A;  3L6A A;  5M72 A;  3B7S A;  3ONL A;  4HOR A;  3P2B A;  3ZXS A;  4AP2 A;  3SI5 A;  3C98 A;  3MZL B;  4MRU A;  5G04 C;  4AY6 A;  4GCN A;  2XPI A;  4KZC A;  4JW1 A;  3FP3 A;  3LKU A;  3MV3 B;  1WY6 A;  5FT9 A;  5AEN A;  2KC7 A;  3PH0 C;  1PY1 A;  4EEC A;  2FBN A;  2BUG A;  3OXF A;  4JXT A;  4V3I A;  4EZJ A;  3FTS A;  5C1D A;  1E96 B;  3MGB A;  2KZT A;  3LXU X;  1E7U A;  3IBE A;  2GW1 A;  3GW4 A;  4UWK A;  4UWL A;  3CHP A;  1L5J A;  2QFC A;  4J8S A;  2VQ2 A;  3IEG A;  3TXN A;  1WM5 A;  2PQN A;  5ARF A;  5LCW J;  3QB2 A;  2ION A;  2DCP A;  3ESL A;  4LUN U;  3SF4 A;  4GA0 A;  5DIZ A;  2C0M A;  3CQG B;  2CG2 A;  3AS5 A;  4F1S A;  4XI0 A;  3S2A A;  2FI7 A;  5ANR A;  5FZR A;  4AJW A;  1TEZ A;  4JHJ A;  4ATG A;  4BWR A;  5C2Y A;  4LRZ A;  4AY5 A;  3JUI A;  2PL2 A;  2X6K A;  2J4B A;  2KCK A;  3CKC A;  4CT4 A;  3RJV A;  4JA9 A;  4NRH B;  3D9J A;  2XCC A;  5JHB A;  3MKQ B;  3I4G A;  4DI3 A;  1HU3 A;  5FQ6 A;  1E8W A;  1MHQ A;  3Q47 B;  3FUM A;  3LVR E;  4GPK A;  1LF8 A;  3N71 A;  4U07 A;  2UY1 B;  4UQZ A;  5LX8 A;  5FQ4 A;  3JQ1 A;  5CMY A;  3TAX A;  3MJW A;  1UJJ A;  2DIW A;  4NUR A;  2WXQ A;  3UMV A;  3ZHE A;  2L6J A;  3CHR A;  3PEV B;  3Q5M A;  1HZ4 A;  2E2E A;  4GZ3 A;  3U9W A;  5G2N A;  4G1T A;  3FU5 A;  2JEK A;  1JUQ A;  3CVV A;  4JEU A;  2FEZ A;  2AWI A;  2AXU A;  2VSX E;  4L2L A;  4EBA G;  2OND A;  2OVF A;  3HYM B;  4HS2 A;  4MKT A;  1UG3 A;  4G25 A;  4GB9 A;  4IN3 B;  5A23 A;  2I1K A;  3CVU A;  3MYV A;  3ZPJ A;  3FFL A;  1VDY A;  4QFV A;  1XNF A;  3FTY A;  3PRE A;  3CVW A;  4KVM A;  2KCV A;  5ENN A;  3FH5 A;  1IHG A;  2JLB A;  3B13 A;  4FHK A;  4N5C A;  5HI7 A;  3RKV A;  4ANV A;  2LO6 A;  4UQY A;  3R9A B;  1ELR A;  2OOE A;  3APF A;  3RRN B;  4FA6 A;  2BF0 X;  3HDX A;  3RU0 A;  3SD5 A;  3QC1 A;  1HS6 A;  3LY9 A;  4BX9 A;  4FP7 A;  3D9P A;  2WXP A;  2WXJ A;  4KZ0 A;  3FTU A;  2L9B A;  3FUL A;  4URK A;  4PS7 A;  3ZVV A;  3UX4 A;  3E4B A;  1NZN A;  1JWF A;  2XCB A;  2XHE A;  4I2Z A;  3CK7 A;  4R7L A;  5KJK A;  3FU0 A;  3CLJ A;  3FTW A;  4GMJ A;  2C2L A;  2YQ8 A;  2R5S A;  3UT8 A;  5CHE E;  3RRU A;  3QWV A;  3U64 A;  2VGX B;  4CCA A;  3D9L A;  3HVE A;  2WXF A;  3L08 A;  2FUL A;  2J49 A;  2I2O A;  4HOQ A;  5AYW D;  3CEQ A;  4F7A A;  1TJC A;  3ML8 A;  3U66 A;  4A55 A;  3ESK A;  4DLO A;  2J09 A;  3VTY A;  4EZL A;  2Y4T A;  2MRI A;  4HOU A;  3FH8 A;  5AIJ A;  1Z3Y A;  2UWJ G;  3ENE A;  3HHM A;  3L16 A;  3LJ3 A;  4ILI A;  3L54 A;  2VYI A;  5T3R A;  1QZ2 A;  2AXZ A;  4TRQ A;  4RG6 A;  3TG5 A;  5AJL A;  3SZ7 A;  3VLD A;  1WAO 1;  3MV2 B;  4I43 A;  4G24 A;  4KXK B;  4GU5 A;  2VTB A;  2NSZ A;  3SGH A;  4FHJ A;  4ILG A;  3TXM A;  2ZU6 B;  4I6G A;  3K9I A;  4LER A;  5T8I A;  1HXI A;  5JJT A;  3G2T A;  3FH7 A;  4N3B A;  3KEZ A;  4WWP A;  1HF8 A;  3D9N A;  3AS4 A;  3FUD A;  4CEM A;  4P29 A;  3NZU A;  3MX3 A;  3ZYL A;  3MKR A;  1E8X A;  3Q15 A;  2PZI A;  2VSN A;  4PH4 B;  4XKB A;  3PNT B;  4UWG A;  1E7V A;  2WMO A;  4L7T A;  3SBT B;  5BV0 A;  2WXK A;  4F3V A;  1NA0 A;  4AEZ C;  2EQX A;  3DPD A;  5JJ7 A;  3JQ0 A;  1U3D A;  1A17 A;  4FLH A;  2LAH A;  4GAA A;  4J6I A;  4N3C A;  4BFR A;  2J4D A;  4UI9 K;  4U0S A;  2LSU A;  4Q94 A;  2LSV A;  4JPS A;  4K0R A;  3QKY A;  4E6H A;  3ASD A;  4LCT A;  5FQ7 A;  5FZS A;  4CGW A;  5HQ8 A;  3ZIM A;  4AXH A;  3QWP A;  3CHO A;  3JCK C;  3NQP A;  4E85 A;  4CGV A;  3GZ1 A;  3O48 A;  3FUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...