4IN3B

Crystal structure of the chs5-bch1 exomer cargo adaptor complex
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
721
structure length
589
Chain Sequence
LSQTSIPEVKEDVIGYALHQRRARVGQFQDLGPPDLITFFYCMGIDTSDPTSITIFAKKITDLFISISSWNAFRKYDVNIIVVQTYIINSDGEQSQLPLNVNMIWAETFMSGIVRDIMIMKDNRADGESQNLVETLIFNPFTSGELEDVANNFIKLFPLVYEKGVYLDAPTHVLNPSLTNNYLVETLVEIVRLTKSLEACRKMLKKLIEIHPEAVIILIRVYFACDLEIDAVDLINEQLNSPSSFLADDSKTSHIQLIFKSELLSIQSEFLLDVKRDYKLAKEVAMEAVNCAPNEFKTWYLLTRIYIKLNDMSNALLSLNACPMSQVKEKYVLRRIAPINLHLPLPLDNPMDVQLEQKSADPNLVNLSASSLKSTFQLAYKLLTEIVQITGWEQLLKYRSKIFVSKRLCERWLDNLFMLLYEDLKTYTDWQSEQLYFDAQHKLTVEWELFGLCAKRLGHLPEAAKAFQIGLSQRFSPVCAKNLLQFYIDEHKRIRRDSVSSELTSSQILSSINDIDSSIIDLVVKICCWNHRWYIEFSIILIDALSVAVQDMGITKVHNEIASRFSDPVAQLIDDNILNFLKNFTNDTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The exomer cargo adaptor features a flexible hinge domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords Chitin biosynthesis protein CHS5
total genus 183
structure length 589
sequence length 721
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09295 ChAPs ChAPs (Chs5p-Arf1p-binding proteins)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4in3B00
2L6JA 2VSYA 4WUYA 4GA1A 4GA0A 4JHRA 1ZBPA 5HI7A 3S7DA 2Q7FA 5FZRA 3U3WA 4AY6A 2XEVA 4UI9J 5FZQA 3K9IA 1OUVA 4GPKA 4Y6WA 3TGOA 1A17A 1KLXA 4UI9C 4HOUA 5G04J 3URZA 3OXGA 4ME2A 2XCCA 4I2WA 5G05J 5LCWC 3MA5A 2XCBA 3LYAA 1WAO1 3GZ2A 3PDNA 4J8DA 5KJKA 4G1TA 3CVLA 2C0LA 4XI0A 3QDNA 1HZ4A 5LCWJ 3Q47B 2PZIA 5DBKA 4J0UA 1W3BA 2PL2A 4U0SA 4GZ6A 2VGXB 4O6FA 3U4TA 3IEGA 4CGVA 4I9EA 2LNIA 3VTXA 5M72A 4WNEA 5AYWD 3CV0A 2Y4UA 2QFCA 3KD7A 2XGMA 5EX0A 2HO1A 4ABNA 2PQNA 2KC7A 3CKBA 4GZ3A 3HYMB 2IFUA 3Q4AB 4NQ0A 4U0UA 4WNFA 3ESKA 3GZ1A 3N71A 4JA9A 1IHGA 4XIFA 1IYGA 3ZPJA 4N2SA 3CVNA 3ULQA 3RKVA 3KAEA 2HR2A 2WQHA 2AVPA 2LSVA 5FT9A 2VGYA 3RIBA 3ASFA 3S7FA 1QQEA 3ZGQA 5D0QD 5FTPA 4AIFA 4HOSA 3PE4A 4G25A 4UQYA 5FZSA 4N2QA 4N39A 2KATA 3ASHA 2XPIA 4XI9A 4IN3B 2FI7A 4Y6CA 3RO3A 3UPVA 1ZU2A 2DBAA 4APOA 1NZNA 5HQ8A 4H7XA 2E2EA 3CK7A 4BWRA 3GYZA 4BT8A 2XGOA 4HOQA 2OOEA 1NA0A 4W9RA 3AS5A 3JYSA 1E96B 3UUXA 3CK8A 2VGXA 3ASDA 3ZHEB 1HXIA 4G26A 4RG6A 3QOUA 2C0MA 3S7BA 4HORA 3AS8A 3NF1A 4JA7A 4YVOA 2JLBA 3MEKA 4KBQA 4I2ZA 2ONDA 2Y4TA 4N3CA 4U04A 3SZ7A 3WXXA 3ZFWA 1TJCA 5G04C 4GYYA 4U0ZA 3R9AB 3Q15A 3LCAA 5JJ6A 3TG5A 2WPVA 3LY8A 3CKCA 3QWVA 5JJTA 4UI9K 2HYZA 2UY1B 2VQ2A 2VYIA 3FWVA 3OXFA 3MKRA 4G24A 3CEQA 4I1AA 4JL0A 2KCLA 4N5CA 3BEEA 4J8FA 5BW8C 2LSUA 4HOTA 5CCMA 3O48A 2YQ8A 2KCVA 4GZ5A 2FF4A 4KXKB 3EDTB 4H7YA 1PC2A 5C1DA 1FCHA 3RO2A 4LEUA 4WNDA 3E4BA 4UQZA 1YA0A 3PE3A 4BTBA 3ZHEA 4B94A 5A6CA 4YVQC 2UY1A 4BTAA 3Q5MA 1ELRA 2VSNA 4GA2A 5G05C 3CK9A 2R5SA 3VTYA 1B89A 1ELWA 2FBNA 2IF4A 5DIZA 3TG4A 5EKQD 4GCNA 2I6HA 5ARFA 5KJLA 2J9QA 4NRHB 4N3BA 1KT1A 1P5QA 2XGSA 3LY7A 4CGWA 4N3AA 5FJYA 4G23A 3MV2B 2KCKA 3OXLA 5A7DB 5CHEE 3RJVA 3QWWA 5KJNA 4RG9A 3ZN3A 3MV3B 4AM9A 4BT9A 4WNGA 4I9CA 1XNFA 5D0OD 2C2LA 1HH8A 2FEZA 3QKYA 3LPZA 4YNDA 2FO7A 3FP3A 3ASGA 3RU0A 4UQXA 4A1SA 5KJMA 1KT0A 3LKUA 4G2VA 4U07A 3TAXA 4AY5A 2GW1A 2YHCA 3Q49B 4J8EA 4CDRA 1WM5A 2MHKA 3FFLA 5JJ7A 3AS4A 2NC9A 3CVQA 4GYWA 4EQFA 2PQRA 3GW4A 5EX3A 3S7JA 4KYOB 5BT1A 5ARGA 1NA3A 5BNWA 3LY9A 4GCOA 1QZ2A 4GYOA 2P58C 4F3VA 3QWPA 3KS2A 5CCLA 2BUGA 2V5FA 1Y8MA 2UWJG 4I17A 3CVPA 3SF4A 3UQ3A
chains in the Genus database with same CATH superfamily
3S7DA 5FZRA 4Y6WA 4J8DA 2DVWA 3DWLG 3HXEA 2KXPC 2AXVA 5AJLA 2LNIA 4HXIA 2QFCA 4KT6B 4GAAA 3ABKE 3V79K 3CKBA 4GZ3A 4U0UA 1N0QA 4MKTA 5CERB 2R05A 3DEPA 4ACLA 3SGHA 4BWRA 1FVFA 2NYJA 1NA0A 2VGXA 1NP7A 3QOUA 1N9AA 4JA7A 2V0PA 5ENQD 1N95A 3E37A 2H6HA 2IU1A 3CKCA 4RSYA 2KCLA 2DCPA 2DZOA 3UT8A 4H7YA 2WQ6A 4UWLA 3ZYKA 3I5PA 3D9PA 3CK9A 4LNUD 2IJGX 4N3BA 4AVXA 2XS8A 2FULA 3LY7A 4CGWA 1H0AA 4M3OA 3PZ4A 3T9KA 4A1SA 3ESLA 3FUIA 3AG1E 4A1GA 2HE0A 4CDMA 4I17A 2CG3A 2FO1E 1LD8A 1TNBA 3ZYLA 3Q9UC 1DC2A 4UI9J 3HHMA 4L7TA 4KZCA 1IQRA 2XZTG 4GTSA 3Q7FA 3L6AA 3U64A 4A63B 2PZIA 4I1MA 4BESA 5ENPD 5AYWD 4V3IA 2KC7A 3CSFA 2VTBA 3JQ0A 1IHGA 1N11A 3ZPJA 1OCRE 3ULQA 4X8QA 2F37A 3ZGQA 2XRZA 2DYRE 3FH8A 3L22A 3RO3A 4APOA 3CHMA 4HI9A 4GZDA 4BT8A 2XGOA 1HU3A 3I4GA 4FA6A 1FPPA 3FUJA 5CMWA 2XRYA 1DVPA 3ZEFA 2CHWA 1FT1A 3R7QA 3ZFWA 4BFRA 5G04C 3DPYA 4PUCA 4A3VA 4UI9K 5BW8C 2NXPA 3R7RA 2KCVA 4E85A 4BTAA 3VTYA 4EBAA 1E8ZA 2J9QA 1MJ0A 1H6OA 5A23A 3CVYA 4BSXA 3ML9A 4AP2A 3RJVA 1XNFA 2C2LA 4IULA 3DSXA 5EYPF 4UWHA 3FTWA 2WXJA 3LDZA 5HKPA 3CVWA 3UQ3A 4GA1A 4AY6A 3Q73A 1OUVA 2WQ7A 1MX6A 3IKOB 5G05J 3MA5A 2CHZA 5LCWJ 5DBKA 5C2YA 4CYMD 4HNAD 4LSZE 3UT4A 5CBNA 2GRNB 2J09A 2X3MA 2PQNA 3D9LA 3RIBA 4JVSA 5LOZA 3B13A 3CVNA 2LSVA 4F1SA 3ABME 4N2QA 1YCSB 3D9HA 4YDYA 3UPVA 1NZNA 2E2EA 4KMOA 3DXMG 3ASDA 4HORA 2A5EA 5HRYA 3NF1A 3ZW3A 4I2ZA 4N3CA 3LY8A 2HYZA 2WVIA 3Q9NC 4C0EA 1SVXA 5C1DA 4RLYA 4I6JA 2IONA 3D9OA 3F6QA 4B94A 2Y69E 2EIME 3TL5A 4HI8A 2R5SA 3IXEA 4MS6A 2IF4A 5T4YA 1RZ4A 1PAQA 4L2YA 3I4RB 3EHNA 4F53A 3FEXA 4HRLA 2QYJA 4TUMA 3AAAC 3ZXSA 2GW1A 4CDRA 1O1SA 3CHSA 4Q69A 2WB2A 4KYOB 4A55A 2CG2A 2QYUA 3QWPA 3HVEA 1E8WA 1MX4A 4WAFA 1OXJA 3FTZA 4NIKA 4LG6A 3BUAA 3OXGA 2AJAA 5G2NA 2WXFA 1BD8A 3QDNA 2V4LA 3EHMA 3CV0A 3ASNE 3ULYA 4J7WA 1N4QA 2KZTB 3RK6A 3HYMB 3JXJA 3UTMA 4JEUA 4GZCA 2OV8A 2HR2A 2R59A 3S7FA 3ZVVA 4HOSA 3PE4A 4YDWA 1D9SA 4GTOA 3CK7A 3TXNA 4TXQA 5ENRD 2CHXA 2PM6A 4HB5A 1HFAA 3IBEA 2ONDA 3SZ7A 1MYOA 1Z3XA 4TXPA 3QWVA 5CECB 2VQ2A 1OWMA 3L17A 3DSWA 3BEEA 4LRZA 2V4HC 4WNDA 2PNNA 2Y0BG 4PDXA 3WG7E 4GMLA 1Y6IA 2CFZA 4CT0A 2IEJA 3EUVA 3MV2B 3L82A 3MV3B 3RSEG 5BPPA 5FQ4A 1KT0A 3QARA 3MGBA 4WWOA 2DZNA 2I1JA 4L1BA 3TJPA 2LAHA 2BUGA 2V5FA 3JXIA 3AG3E 2A5UA 2GRQB 1TNOA 4ZFHA 1UN8A 2DWZA 3AG2E 2J49A 3LYAA 4HFGA 4I1OB 4ANXA 3ENEA 4XKCA 1N52A 2C0LA 2V8SE 4I43A 1WDYA 1Z6TA 1JWFA 1TNZA 2Y4UA 4OVUA 5JMND 3GZ1A 5ENTD 2WQHA 2AVPA 3ZXPA 2P9IG 3PREA 2WM9A 2X6HA 3ASHA 2IY0C 4BERA 2R02A 4Y6CA 2DBAA 2BKKB 5HQ8A 1O1TA 1V54E 3ONLA 2IOSA 1JCSA 2H6IA 5EIBE 3MJWA 2LXMA 1UJKA 4GTQA 3FEYA 3TWRA 3D9JA 4GMRA 2XPZA 4G24A 3CEQA 5AQ9A 4UWKA 4GTTA 2YQ8A 4GZ5A 4O1PA 2F8XK 4FJYA 4B93B 1FCHA 2F8YA 1OY3D 3E4BA 2EINE 4IRUA 1X5BA 4ILIA 3HRAA 1KPSB 4ATZD 3TWQA 1O5MA 4JHKA 3EHQA 4C9BB 1K8KG 2GRPB 3FUEA 5BV0A 1HO8A 5B1BE 3D9MA 4EBAG 2KBXA 2PM7A 3ULEG 5B3SE 4DK5A 2FEZA 3LPZA 3L54A 4U07A 3FTUA 3LS8A 3HG0D 3CVQA 5BT1A 4ATGA 4GYOA 2ETCA 3CVVA 3UX4A 2L6JA 4XE0A 4GA0A 3ML8A 3NQPA 4DUIA 3PDNA 2J08A 4I6GA 2WXPA 3Q47B 4JPSA 5ITZF 4K5CA 4CGVA 3NBNB 5ENOD 3VTXA 2IO3C 2IFUA 1O1RA 1SZAA 3N71A 5CBOA 5FT9A 1UJJA 3SO8A 1LF8A 4UQYA 1UG3A 3UKRG 4F7AA 3P2BA 2ILRA 4TUUA 4H7XA 3SBSA 3TWUA 3KEAA 3AS5A 3JYSA 3PEVB 2C0MA 4B8CB 5EIDA 3AJIA 1Z3YA 3HXFA 3S2AA 2P9LG 4DLOA 1OWNA 2ETAA 3IHYA 1BI8B 1PC2A 4UQZA 5AIJA 4O1OA 5E76A 4GB9A 3RAUA 2MOWA 4K5BA 1N4PA 4CRWA 2P9KG 5T8IA 5KJNA 3FUKA 1H6KA 2R03A 4I6EA 3RRUA 4HVBA 3D9KA 5ARGA 2L0IA 3APDA 4O60A 4AOFA 5LFAA 5AN8A 3L16A 4ANWA 2XEHA 5AQAA 4C48B 1L5JA 4DX2A 4UUCA 3LEWA 1SA5A 4Q94A 1Z5SC 2VGXB 3IEGA 3EJNA 3KD7A 4DX1A 2OEWA 4ANVA 4WNFA 4EHMA 4XIFA 4JA9A 4JW1A 2R17C 3HIZA 4AIFA 3SFZA 4N39A 1ZU2A 2QY7A 5BXOA 4JB8P 2OOEA 2WMOA 1E96B 2JEKA 2XENA 3B7UX 5FIOA 3ZKJA 2J8SD 3LCAA 3CLJA 2UY1B 1BU9A 3ZUVB 4BSZB 4U96D 1S63A 4JD2G 1LD7A 1JPLA 1UOHA 3PE3A 4K0RA 3R9MA 3EIQC 5A6CA 3PUKA 2UY1A 2AWIA 1E90A 3MX3A 3TWTA 1ELKA 1U2VG 5KJLA 2I6HA 3UKUG 1P5QA 3E33A 3G2WA 2EQXA 5CRUA 4AM9A 1TNUA 3UT7A 1Q2ZA 4YNDA 2CFUA 3D9NA 5BXUA 4IYPA 4EZKA 1QYMA 4EECA 2P58C 3KS2A 2WXLA 3FUMA 1ZBPA 1AWCB 4ME2A 4I2WA 5KJKA 5ANRA 4CZ2D 3ZYQA 5LP0A 4FP7A 1OWPA 2RFAA 2LAIA 2KM4A 3JQ1A 2P9UG 4J0UA 4MRUA 4DX7D 1K1AA 3SFYA 3D9IA 1WG0A 3DSVA 1SW6A 1VDYA 2HO1A 3PVLA 4ABNA 2MRIA 4AJWA 2VSXE 3CHOA 3JCKC 4UWFA 4DI4A 1QQEA 1LTXA 3PZ2A 5FTPA 4F6RD 3VLFA 2KATA 1FVHA 2XPIA 1D8EA 3CVUA 2IO2C 5T3RA 1HXIA 3PNTB 4KVOA 4U04A 5LX8A 3Q75A 5JJTA 2WXGA 3VLDA 3E30A 4I1AA 4N5CA 4J8FA 5KBAA 3FUHA 1ZB1A 1DCQA 2RFMA 3CSTA 3QAQA 3BU8A 5AAOA 3FTSA 5DIZA 4ZHBA 2IQCA 1NI1A 4RG9A 2I1KA 2A4ZA 2X6KA 5D0OD 3PZ1A 2V5QC 4HRMB 4MLPA 2JABA 5J08A 5CRVA 3NAWA 4DI3A 2EIJE 3ZRHA 4LCTA 4GPKA 1KLXA 5EN5D 3ZYMA 1E7VA 4O6FA 3OTNA 4DLQA 2XGMA 3ZU7B 4EQFA 4NQ0A 4PS8A 3CHQA 1X81A 3LXUX 3RKVA 3ASFA 1H19A 4IN3B 2FI7A 2L9BA 5KCMA 2X6JA 3FU5A 3KSLA 3HXDA 5D66A 1TN6A 3MEKA 4FJZA 4EZJA 5JJ6A 2DIWA 3MKRA 3FHEA 3UINC 3QC1A 1HG2A 1YA0A 2WXRA 4G11A 3HVEB 4F1PA 1BI7B 2XGSA 1E8XA 4ANUA 5FJYA 2LXLA 2X6FA 4G23A 2QC9A 3B7RL 4OVVA 3HXBA 5KJMA 4OAUC 2ZGGA 2GROB 2J4BA 2OCCE 3ASOE 3DSUA 3B95A 2BTDA 3JUEA 3QNKA 3KSQA 2UWJG 3C3RA 4RVBA 4WUYA 4Q96A 1OWOA 5E75A 4PH4B 4UI9C 2AXUA 3FU6A 3CVLA 1HZ4A 4U8VD 2MYOA 3HXCA 4WNEA 3J5PA 2NSZA 1N4SA 3EIJA 3EHRA 4G25A 3CQCB 2P9SG 4GTRA 4QFVA 4XI9A 3IHVA 3LJ3A 5AJDA 4FC8A 3B7SA 4FHJA 4JXTA 4GPMA 4BEPA 3Q78A 2B0OE 1MQSA 2R2LA 1PY1A 1HG5A 3ISMC 4KXKB 1JCRA 2LUHA 1MHQA 3O4ZA 3Q5MA 3TWSA 3MCXA 2FBNA 3T8KA 5EKQD 2F0YA 2I2OA 3OXLA 4WWPA 4AEZC 2M63A 4AXHA 4ILHB 1H2VC 3PH0C 2XPYA 2EIKE 3T8MA 4B0ZA 3TAXA 4BY6A 2MHKA 4C0MA 4DRXE 5JJ7A 4FLBA 1NA3A 3AU4A 4F3VA 2OVFA 5EYLA 3UI2A 3BG1B 3P1UA 3U3WA 4MBGA 2P9NG 3NOCD 3CIAA 1S70B 1H6PA 3PZDA 4XI0A 4G8KA 3E34A 4GZ6A 3PZ3A 4UWGA 4I9EA 3SD5A 3DBSA 1TNYA 3DPDA 3G2VA 3ESKA 1IYGA 3OAWA 4FLHA 3VLEA 1SZ9A 2GRRB 1OWLA 3FU3A 3G2UA 3PNLB 2ZISA 5ENNA 4XX5A 3AS8A 4YVOA 2XEEA 3CHRA 2VTBB 3C72A 3WXXA 3R9AB 2EILE 3FH5A 4CDNA 1SQMA 4HOTA 2WXIA 3SY2A 3EDTB 4XZ4A 3MZLB 2L0TB 2XS1A 3ZHEA 3QB2A 5G05C 4OYSA 1TYQG 1IHBA 3NZUA 1OCZE 4DX6D 3QWWA 4ILGA 3SQVA 4I9CA 2X38A 3SNXA 3ASGA 4UQXA 4GU5A 4G2VA 4AY5A 1WM5A 3FFLA 3AS4A 3D3MA 3CQGB 1V55E 3LY9A 3NB2A 4U63A 5CCLA 2ZXWE 5ENSD 4U7EB 1A17A 4HOUA 3UXGA 2WXHA 5LCWC 5AQ7A 1WAO1 3UMVA 4LERA 2QZAA 2J4DA 1S64A 2LO6A 1A5EA 3UM1A 3DSTA 3APFA 3BQOA 4QQIA 5EX0A 4J6IA 1NL4A 1N54A 4N2SA 2P9PG 4N5QA 3UM2A 3UIOC 5BV1A 4B8AA 3BG0B 2ETBA 3TWXA 2H6FA 3FTXA 4LUNU 4YDEA 3G2TA 1DNPA 1S0PA 1TR4A 2X6IA 3FTYA 4RG6A 4G26A 3TWVA 2KZTA 1EF1C 5FWQA 1TJCA 3TG5A 2YHEA 3QK0A 5CCMA 1KZPA 1E7UA 3IV0A 1H2TC 1FT2A 4BTBA 4YVQC 3ONKA 3HDXA 3V2XA 3CVXA 4NURA 1JWGA 3C3QA 1ELWA 4KZ0A 3UIPC 3W9FA 5CEAA 3ZNGA 2YHCA 3PRZA 2BKGA 4FU3A 3S7JA 2VJ8A 5KWDA 4LNBA 4PS7A 5G55A 1UN9A 1H2UA 1Y8MA 3DSSA 3SF4A 4JEHA 5HI7A 4JHRA 2Q7FA 5JA4D 5J90A 5FZQA 5CMYA 4YDOA 3TGOA 3AG4E 4DJAA 1TN8A 4AV7A 5AARA 2OVBA 4FADA 2GGFA 1W3BA 4URKA 3LVRE 1UW4B 1GW6A 2VGEA 2GRMA 3U9WA 2VSOE 5FQ6A 3Q7AA 1N0RA 2XQ0A 5KNGA 4HOQA 3SI5A 3EU5A 4W9RA 1BPOA 3FULA 3PUJA 3S7BA 2JLBA 5ANLA 3RRNB 3B7BA 2LSUA 3O48A 3I3NA 4E6HA 4LEUA 3V31A 5KNHD 4J8YA 1XGWA 3GZSA 3T5VA 1NFIE 4Z68A 1JCQA 1ELRA 3FU0A 4EZLA 1B89A 4L2LA 4GTPA 4D10C 5A7DB 1INZA 3FY4A 1HH8A 2IOLA 3FP3A 1E8YA 4J8EA 4GYWA 2PQRA 3GW4A 2BF0X 2ZIRA 1QZ2A 3SHFA 2AXZA 4A3TA 4J8SA 3K9IA 3URZA 3T5XA 3L9TA 2H6GA 3DRAA 5AENA 4U0SA 2PL2A 3FDHA 3V2OA 3J5QB 4GTVA 3C98A 4B89A 2Y1LE 5JHAA 4DX5D 1TN7A 3L08A 3C3OA 4CT4A 1AP7A 4BX9A 3L13A 1IQUA 4RQIA 3GYZA 2RG8A 3FUDA 4LNGA 1QNFA 3ZHEB 4TXRA 1N94A 3APCA 1MX2A 1HF8A 2Y4TA 1EDUA 3B7TA 4GYYA 4U0ZA 3FWVA 4HBDA 2L6BA 1U3CA 2RD0A 3X2QE 4KVMA 3RO2A 4TV3A 2OEVA 4HQDA 4HS2A 3ZIMA 4JHJA 4GA2A 4NACA 4GCNA 3QJZA 2KCKA 5CHEE 4BT9A 4WNGA 4FULA 1D8DA 3ABLE 5JHBA 5BNWA 4CCAA 3FTVA 4GCOA 2I9CA 3CVPA 4TRQA 2VSYA 3G2SA 2XEVA 3DXKG 2RKKA 3JUIA 2XCCA 2XCBA 1EPUA 4P29A 2B6CA 5IY5E 5CEDB 4HRNA 2GRLA 1MZCA 5EDSA 1SA4A 5H7PA 2WMNA 4M7CA 3KAEA 4XEIG 2AW6A 2VGYA 4U8YD 5D0QD 5FZSA 3LJNA 2YNQA 4R7LA 4L9PA 4CEMA 1JUQA 4BX8A 3UUXA 3CK8A 2WXNA 4K5AB 3FUFA 1TJFA 4APFA 2E0IA 3Q15A 3TWWA 2ZU6B 4DPRA 3W9GA 3TG4A 4JL0A 3SFXA 3EU9A 1RW2A 3CHPA 3AU5A 4K03A 2WXQA 4L23A 4HLLA 2VSNA 1YMPA 5HS0A 3RRMB 5ARFA 1K1BA 1WY6A 3PS6A 4NRHB 1KT1A 5FQ7A 5EILA 3ZN3A 3KEZA 2Y3AA 3QKYA 2P2CP 3LKUA 5FQ8A 3U66A 1TEZA 2NC9A 3MKQA 1N4RA 4BETA 5BUZA 5G04J 1G3NB 1HE8A 3E32A 3GZ2A 4G1TA 1OCOE 4HLEA 3U4TA 5M72A 4U95D 4PS3A 4JZYA 3Q4AB 4G8LA 4GMJA 1OCCE 3Q79A 5AQBA 2DYSE 1IXVA 2WXKA 3SBTB 1K3ZD 4WWNA 3MYVA 1IKND 3C5RA 3NZSA 1OT8A 4XKBA 4KBQA 4FHKA 2XZDG 1EYHA 2WPVA 2VYIA 3OXFA 1U3DA 2WXMA 2YINA 1KZOA 3V30A 2FF4A 5FINA 2XHEA 1HX8A 3FH7A 2HM8A 3FUNA 3NOGD 1YYHA 4U8HA 5D2MC 2WXOA 3TXMA 3CGHA 4GTMA 3UM0A 4N3AA 3MKQB 1BLXB 2BEDA 4JC8A 2J07A 3CR3A 3LVQE 3PEUB 3RU0A 3UM3A 2FO7A 3Q49B 1HS6A 2ZGDA 5EX3A 4OAVB 1DCEA 4ACKA 3DEOA 1QBQA 4EPZA 5B1AE
chains in the Genus database with same CATH topology
5HI7A 4JHRA 3S7DA 2Q7FA 5FZRA 5J90A 5FZQA 5CMYA 1UN8A 4LCTA 4Y6WA 3TGOA 4GPKA 1KLXA 4DJAA 2J49A 3LYAA 4HFGA 3ZYMA 4I1OB 4J8DA 4ANXA 3ENEA 4XKCA 1E7VA 1N52A 4AV7A 2C0LA 2V8SE 2OVBA 4I43A 4FADA 1Z6TA 2GGFA 1JWFA 1W3BA 4URKA 4O6FA 3LVRE 3OTNA 2AXVA 4DLQA 5AJLA 1UW4B 2LNIA 1GW6A 2Y4UA 4HXIA 4OVUA 2QFCA 2XGMA 2GRMA 4KT6B 4GAAA 4EQFA 4NQ0A 3CKBA 4GZ3A 4U0UA 4PS8A 3U9WA 2VSOE 3CHQA 3GZ1A 5FQ6A 3LXUX 3RKVA 2WQHA 2AVPA 3ASFA 3PREA 4MKTA 2WM9A 2X6HA 3ASHA 1H19A 4IN3B 2FI7A 2L9BA 4Y6CA 2DBAA 4ACLA 2XQ0A 3SGHA 5HQ8A 5KCMA 2X6JA 4BWRA 1FVFA 4HOQA 3ONLA 3FU5A 3SI5A 1NA0A 2IOSA 4W9RA 1BPOA 3FULA 2VGXA 3PUJA 3MJWA 1NP7A 3S7BA 3QOUA 4JA7A 2V0PA 2JLBA 3MEKA 5ANLA 1UJKA 2IU1A 4FJZA 3FEYA 4EZJA 3CKCA 3RRNB 5JJ6A 3D9JA 2DIWA 4RSYA 2XPZA 3MKRA 3CEQA 3FHEA 4G24A 2KCLA 4UWKA 2LSUA 3QC1A 3O48A 2DCPA 1HG2A 2YQ8A 3I3NA 4GZ5A 3UT8A 4H7YA 4E6HA 2WQ6A 4FJYA 1FCHA 4UWLA 3ZYKA 4LEUA 3E4BA 4IRUA 1X5BA 1YA0A 4ILIA 1XGWA 3GZSA 3T5VA 2WXRA 3I5PA 1ELRA 3D9PA 3FU0A 4JHKA 3CK9A 4G11A 4EZLA 4C9BB 1B89A 2IJGX 3HVEB 4L2LA 3FUEA 4N3BA 5BV0A 4AVXA 1HO8A 2XGSA 1E8XA 2FULA 3D9MA 3LY7A 4ANUA 5FJYA 4D10C 2X6FA 4EBAG 4G23A 4CGWA 3B7RL 2PM7A 4OVVA 5A7DB 1H0AA 1INZA 3FY4A 4M3OA 4DK5A 1HH8A 2FEZA 2IOLA 3LPZA 3FP3A 3L54A 4A1SA 5KJMA 1E8YA 4U07A 3FTUA 3ESLA 4J8EA 3LS8A 3FUIA 2J4BA 4GYWA 3CVQA 2PQRA 3GW4A 2BF0X 2BTDA 5BT1A 4ATGA 4A1GA 4GYOA 1QZ2A 3QNKA 3SHFA 3CVVA 2AXZA 4CDMA 2UWJG 4I17A 4RVBA 2CG3A 3UX4A 2L6JA 4WUYA 4XE0A 4GA0A 4Q96A 3ZYLA 3ML8A 3NQPA 4A3TA 4J8SA 4UI9J 3K9IA 3HHMA 1OWOA 5E75A 4PH4B 4UI9C 4L7TA 4KZCA 3URZA 3T5XA 1IQRA 2AXUA 4AP2A 3PDNA 2J08A 3FU6A 3L6AA 3CVLA 4I6GA 2WXPA 3U64A 5AENA 1HZ4A 3Q47B 4JPSA 2PZIA 4U0SA 2PL2A 4CGVA 4I1MA 3FDHA 3VTXA 4WNEA 5AYWD 4V3IA 2KC7A 2NSZA 3C98A 2IFUA 3CSFA 2VTBA 4B89A 1SZAA 3JQ0A 3N71A 3EIJA 1IHGA 3ZPJA 5JHAA 3ULQA 5FT9A 3L08A 1UJJA 3ZGQA 4CT4A 1LF8A 4G25A 1UG3A 4UQYA 3CQCB 4F7AA 2XRZA 3FH8A 4BX9A 3L13A 3L22A 4QFVA 4XI9A 3IHVA 3RO3A 3P2BA 2ILRA 4TUUA 1IQUA 4APOA 3CHMA 4H7XA 3SBSA 3GYZA 4GZDA 4BT8A 2XGOA 2RG8A 3FUDA 1HU3A 3I4GA 3LJ3A 5AJDA 4FA6A 4FC8A 3AS5A 3FUJA 3JYSA 1QNFA 5CMWA 3ZHEB 3B7SA 2XRYA 1DVPA 2C0MA 3PEVB 4FHJA 3ZEFA 4B8CB 4EPZA 2CHWA 3APCA 4JXTA 1HF8A 1Z3YA 3R7QA 2Y4TA 3S2AA 3ZFWA 4BFRA 1EDUA 3B7TA 5G04C 4GYYA 4U0ZA 4DLOA 1OWNA 1MQSA 4PUCA 4A3VA 4UI9K 3FWVA 1PY1A 1U3CA 2RD0A 1HG5A 5BW8C 2NXPA 3R7RA 4KVMA 2KCVA 3IHYA 4KXKB 1PC2A 4E85A 3RO2A 4TV3A 4UQZA 5AIJA 1MHQA 5E76A 4HS2A 4GB9A 3ZIMA 4JHJA 3O4ZA 4BTAA 3Q5MA 4GA2A 3VTYA 4EBAA 2MOWA 3MCXA 2FBNA 4NACA 5EKQD 4GCNA 1E8ZA 2J9QA 3QJZA 4CRWA 5A23A 3CVYA 2I2OA 2KCKA 4BSXA 3ML9A 3OXLA 4WWPA 5T8IA 5CHEE 3RJVA 3FUKA 1H6KA 2M63A 4AEZC 4I6EA 4AXHA 5KJNA 4ILHB 4BT9A 1H2VC 4WNGA 1XNFA 3RRUA 2C2LA 3PH0C 4FULA 2XPYA 4IULA 3T8MA 4B0ZA 3TAXA 4HVBA 4UWHA 4BY6A 2MHKA 4C0MA 5JHBA 3D9KA 5JJ7A 3FTWA 4FLBA 2WXJA 5BNWA 4CCAA 5ARGA 1NA3A 3FTVA 3LDZA 4GCOA 3CVWA 2L0IA 3AU4A 4F3VA 2OVFA 3APDA 4AOFA 5LFAA 2I9CA 3CVPA 3L16A 3BG1B 4TRQA 3UQ3A 4ANWA 3P1UA 2VSYA 3G2SA 4GA1A 3U3WA 4AY6A 2XEVA 1OUVA 2WQ7A 3IKOB 3CIAA 3JUIA 5G05J 2XCCA 3MA5A 2XCBA 3PZDA 1EPUA 1L5JA 4P29A 3LEWA 4XI0A 2CHZA 4Q94A 2GRLA 5LCWJ 5DBKA 5C2YA 4GZ6A 2VGXB 3IEGA 4UWGA 5EDSA 4I9EA 3UT4A 3EJNA 2J09A 2X3MA 3KD7A 3SD5A 2PQNA 2WMNA 3D9LA 4ANVA 3DBSA 3DPDA 3G2VA 4WNFA 3RIBA 3ESKA 4JVSA 4JA9A 4XIFA 4JW1A 5LOZA 1IYGA 2R17C 3B13A 3CVNA 3KAEA 3OAWA 3HIZA 2LSVA 4FLHA 2AW6A 2VGYA 4F1SA 4AIFA 5D0QD 3SFZA 3VLEA 4N2QA 5FZSA 4N39A 1SZ9A 2YNQA 3UPVA 1ZU2A 1OWLA 3FU3A 3G2UA 1NZNA 3PNLB 4R7LA 2E2EA 4CEMA 2QY7A 2OOEA 4KMOA 2WMOA 1JUQA 4BX8A 1E96B 2JEKA 3CK8A 5ENNA 3ASDA 3UUXA 2WXNA 4XX5A 4HORA 3FUFA 3AS8A 3NF1A 4YVOA 3ZW3A 3B7UX 3CHRA 4I2ZA 2VTBB 1TJFA 4N3CA 4APFA 3WXXA 3R9AB 2E0IA 3Q15A 3LCAA 2ZU6B 3CLJA 3LY8A 3FH5A 4DPRA 4CDNA 2HYZA 2UY1B 3TG4A 4JL0A 1SQMA 4HOTA 3CHPA 3AU5A 2WVIA 2WXIA 4K03A 3EDTB 4C0EA 2WXQA 1JPLA 4L23A 5C1DA 4I6JA 4XZ4A 2IONA 3MZLB 2L0TB 3D9OA 3PE3A 4K0RA 3EIQC 5A6CA 3ZHEA 4B94A 3PUKA 2UY1A 2AWIA 2VSNA 3TL5A 3QB2A 5G05C 1E90A 3MX3A 4OYSA 2R5SA 4MS6A 1ELKA 2IF4A 3RRMB 5T4YA 5ARFA 2I6HA 5KJLA 1PAQA 3PS6A 1WY6A 4L2YA 3I4RB 4NRHB 1KT1A 3NZUA 1P5QA 5FQ7A 3EHNA 4F53A 3G2WA 3FEXA 3QWWA 4ILGA 3ZN3A 2EQXA 4AM9A 4I9CA 2X38A 3KEZA 3UT7A 2Y3AA 3ZXSA 3QKYA 4YNDA 3SNXA 2CFUA 3ASGA 4UQXA 3D9NA 3LKUA 4GU5A 4G2VA 5FQ8A 4AY5A 2GW1A 4CDRA 3CHSA 1WM5A 4Q69A 3U66A 2WB2A 1TEZA 3FFLA 3AS4A 2NC9A 3D3MA 4IYPA 4EZKA 3MKQA 3CQGB 4KYOB 4EECA 3LY9A 4U63A 4A55A 2CG2A 2P58C 3QWPA 3KS2A 5CCLA 2WXLA 3FUMA 3HVEA 1ZBPA 1E8WA 4WAFA 1A17A 3FTZA 4HOUA 5BUZA 5G04J 2WXHA 3OXGA 1HE8A 4I2WA 4ME2A 5LCWC 1WAO1 3GZ2A 5KJKA 3UMVA 5G2NA 5ANRA 4G1TA 2WXFA 4LERA 3ZYQA 5LP0A 4FP7A 1OWPA 2J4DA 3QDNA 4HLEA 2LAIA 2KM4A 3JQ1A 2LO6A 4J0UA 4MRUA 2V4LA 3U4TA 3EHMA 3D9IA 5M72A 3APFA 3CV0A 1VDYA 4PS3A 5EX0A 2HO1A 3PVLA 4ABNA 2KZTB 4JZYA 3RK6A 2MRIA 3HYMB 3Q4AB 4J6IA 4GMJA 1N54A 4JEUA 4AJWA 4N2SA 4GZCA 2OV8A 2VSXE 3CHOA 3JCKC 2HR2A 2R59A 4UWFA 3S7FA 4DI4A 3ZVVA 1QQEA 5FTPA 4HOSA 3VLFA 3PE4A 2WXKA 3SBTB 2KATA 1FVHA 5BV1A 2XPIA 4WWNA 4B8AA 3BG0B 3CK7A 3FTXA 4LUNU 3CVUA 3G2TA 3MYVA 1DNPA 1S0PA 5T3RA 3NZSA 3TXNA 2X6IA 3FTYA 1HXIA 4G26A 2CHXA 3PNTB 4RG6A 4XKBA 2PM6A 1HFAA 3IBEA 4KBQA 4KVOA 2ONDA 2KZTA 1EF1C 4U04A 5FWQA 4FHKA 3SZ7A 1Z3XA 5LX8A 1TJCA 1EYHA 3TG5A 2WPVA 3QWVA 5JJTA 2YHEA 2VQ2A 2VYIA 3OXFA 2WXGA 1U3DA 1OWMA 3L17A 2WXMA 3VLDA 4I1AA 3QK0A 4N5CA 3BEEA 4J8FA 2YINA 5CCMA 3FUHA 2FF4A 4LRZA 2XHEA 1E7UA 3IV0A 1H2TC 4WNDA 3CSTA 1HX8A 3FH7A 3QAQA 4BTBA 2HM8A 3FUNA 4YVQC 3FTSA 3ONKA 3HDXA 4PDXA 3CVXA 4NURA 1JWGA 4U8HA 4GMLA 1ELWA 2WXOA 5DIZA 3TXMA 4KZ0A 3CGHA 1Y6IA 2CFZA 4CT0A 2IQCA 4N3AA 3MV2B 3MKQB 4RG9A 3MV3B 4JC8A 2I1KA 2J07A 2A4ZA 2X6KA 5D0OD 5BPPA 3CR3A 3LVQE 3PEUB 5FQ4A 3RU0A 2FO7A 1KT0A 2YHCA 3Q49B 3PRZA 1HS6A 3QARA 3MGBA 4WWOA 4MLPA 4FU3A 3S7JA 2VJ8A 5EX3A 5J08A 4PS7A 2I1JA 4L1BA 2LAHA 2BUGA 2V5FA 1UN9A 1H2UA 1Y8MA 2A5UA 5G55A 3TJPA 4ACKA 3SF4A 4DI3A 3ZRHA 4JEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6J A;  2VSY A;  4WUY A;  4GA1 A;  4GA0 A;  4JHR A;  1ZBP A;  5HI7 A;  3S7D A;  2Q7F A;  5FZR A;  3U3W A;  4AY6 A;  2XEV A;  4UI9 J;  5FZQ A;  3K9I A;  1OUV A;  4GPK A;  4Y6W A;  3TGO A;  1A17 A;  1KLX A;  4UI9 C;  4HOU A;  5G04 J;  3URZ A;  3OXG A;  4ME2 A;  2XCC A;  4I2W A;  5G05 J;  5LCW C;  3MA5 A;  2XCB A;  3LYA A;  1WAO 1;  3GZ2 A;  3PDN A;  4J8D A;  5KJK A;  4G1T A;  3CVL A;  2C0L A;  4XI0 A;  3QDN A;  1HZ4 A;  5LCW J;  3Q47 B;  2PZI A;  5DBK A;  4J0U A;  1W3B A;  2PL2 A;  4U0S A;  4GZ6 A;  2VGX B;  4O6F A;  3U4T A;  3IEG A;  4CGV A;  4I9E A;  2LNI A;  3VTX A;  5M72 A;  4WNE A;  5AYW D;  3CV0 A;  2Y4U A;  2QFC A;  3KD7 A;  2XGM A;  5EX0 A;  2HO1 A;  4ABN A;  2PQN A;  2KC7 A;  3CKB A;  4GZ3 A;  3HYM B;  2IFU A;  3Q4A B;  4NQ0 A;  4U0U A;  4WNF A;  3ESK A;  3GZ1 A;  3N71 A;  4JA9 A;  1IHG A;  4XIF A;  1IYG A;  3ZPJ A;  4N2S A;  3CVN A;  3ULQ A;  3RKV A;  3KAE A;  2HR2 A;  2WQH A;  2AVP A;  2LSV A;  5FT9 A;  2VGY A;  3RIB A;  3ASF A;  3S7F A;  1QQE A;  3ZGQ A;  5D0Q D;  5FTP A;  4AIF A;  4HOS A;  3PE4 A;  4G25 A;  4UQY A;  5FZS A;  4N2Q A;  4N39 A;  2KAT A;  3ASH A;  2XPI A;  4XI9 A;  4IN3 B;  2FI7 A;  4Y6C A;  3RO3 A;  3UPV A;  1ZU2 A;  2DBA A;  4APO A;  1NZN A;  5HQ8 A;  4H7X A;  2E2E A;  3CK7 A;  4BWR A;  3GYZ A;  4BT8 A;  2XGO A;  4HOQ A;  2OOE A;  1NA0 A;  4W9R A;  3AS5 A;  3JYS A;  1E96 B;  3UUX A;  3CK8 A;  2VGX A;  3ASD A;  3ZHE B;  1HXI A;  4G26 A;  4RG6 A;  3QOU A;  2C0M A;  3S7B A;  4HOR A;  3AS8 A;  3NF1 A;  4JA7 A;  4YVO A;  2JLB A;  3MEK A;  4KBQ A;  4I2Z A;  2OND A;  2Y4T A;  4N3C A;  4U04 A;  3SZ7 A;  3WXX A;  3ZFW A;  1TJC A;  5G04 C;  4GYY A;  4U0Z A;  3R9A B;  3Q15 A;  3LCA A;  5JJ6 A;  3TG5 A;  2WPV A;  3LY8 A;  3CKC A;  3QWV A;  5JJT A;  4UI9 K;  2HYZ A;  2UY1 B;  2VQ2 A;  2VYI A;  3FWV A;  3OXF A;  3MKR A;  4G24 A;  3CEQ A;  4I1A A;  4JL0 A;  2KCL A;  4N5C A;  3BEE A;  4J8F A;  5BW8 C;  2LSU A;  4HOT A;  5CCM A;  3O48 A;  2YQ8 A;  2KCV A;  4GZ5 A;  2FF4 A;  4KXK B;  3EDT B;  4H7Y A;  1PC2 A;  5C1D A;  1FCH A;  3RO2 A;  4LEU A;  4WND A;  3E4B A;  4UQZ A;  1YA0 A;  3PE3 A;  4BTB A;  3ZHE A;  4B94 A;  5A6C A;  4YVQ C;  2UY1 A;  4BTA A;  3Q5M A;  1ELR A;  2VSN A;  4GA2 A;  5G05 C;  3CK9 A;  2R5S A;  3VTY A;  1B89 A;  1ELW A;  2FBN A;  2IF4 A;  5DIZ A;  3TG4 A;  5EKQ D;  4GCN A;  2I6H A;  5ARF A;  5KJL A;  2J9Q A;  4NRH B;  4N3B A;  1KT1 A;  1P5Q A;  2XGS A;  3LY7 A;  4CGW A;  4N3A A;  5FJY A;  4G23 A;  3MV2 B;  2KCK A;  3OXL A;  5A7D B;  5CHE E;  3RJV A;  3QWW A;  5KJN A;  4RG9 A;  3ZN3 A;  3MV3 B;  4AM9 A;  4BT9 A;  4WNG A;  4I9C A;  1XNF A;  5D0O D;  2C2L A;  1HH8 A;  2FEZ A;  3QKY A;  3LPZ A;  4YND A;  2FO7 A;  3FP3 A;  3ASG A;  3RU0 A;  4UQX A;  4A1S A;  5KJM A;  1KT0 A;  3LKU A;  4G2V A;  4U07 A;  3TAX A;  4AY5 A;  2GW1 A;  2YHC A;  3Q49 B;  4J8E A;  4CDR A;  1WM5 A;  2MHK A;  3FFL A;  5JJ7 A;  3AS4 A;  2NC9 A;  3CVQ A;  4GYW A;  4EQF A;  2PQR A;  3GW4 A;  5EX3 A;  3S7J A;  4KYO B;  5BT1 A;  5ARG A;  1NA3 A;  5BNW A;  3LY9 A;  4GCO A;  1QZ2 A;  4GYO A;  2P58 C;  4F3V A;  3QWP A;  3KS2 A;  5CCL A;  2BUG A;  2V5F A;  1Y8M A;  2UWJ G;  4I17 A;  3CVP A;  3SF4 A;  3UQ3 A; 
#chains in the Genus database with same CATH topology
 3S7D A;  5FZR A;  4Y6W A;  4J8D A;  2DVW A;  3DWL G;  3HXE A;  2KXP C;  2AXV A;  5AJL A;  2LNI A;  4HXI A;  2QFC A;  4KT6 B;  4GAA A;  3ABK E;  3V79 K;  3CKB A;  4GZ3 A;  4U0U A;  1N0Q A;  4MKT A;  5CER B;  2R05 A;  3DEP A;  4ACL A;  3SGH A;  4BWR A;  1FVF A;  2NYJ A;  1NA0 A;  2VGX A;  1NP7 A;  3QOU A;  1N9A A;  4JA7 A;  2V0P A;  5ENQ D;  1N95 A;  3E37 A;  2H6H A;  2IU1 A;  3CKC A;  4RSY A;  2KCL A;  2DCP A;  2DZO A;  3UT8 A;  4H7Y A;  2WQ6 A;  4UWL A;  3ZYK A;  3I5P A;  3D9P A;  3CK9 A;  4LNU D;  2IJG X;  4N3B A;  4AVX A;  2XS8 A;  2FUL A;  3LY7 A;  4CGW A;  1H0A A;  4M3O A;  3PZ4 A;  3T9K A;  4A1S A;  3ESL A;  3FUI A;  3AG1 E;  4A1G A;  2HE0 A;  4CDM A;  4I17 A;  2CG3 A;  2FO1 E;  1LD8 A;  1TNB A;  3ZYL A;  3Q9U C;  1DC2 A;  4UI9 J;  3HHM A;  4L7T A;  4KZC A;  1IQR A;  2XZT G;  4GTS A;  3Q7F A;  3L6A A;  3U64 A;  4A63 B;  2PZI A;  4I1M A;  4BES A;  5ENP D;  5AYW D;  4V3I A;  2KC7 A;  3CSF A;  2VTB A;  3JQ0 A;  1IHG A;  1N11 A;  3ZPJ A;  1OCR E;  3ULQ A;  4X8Q A;  2F37 A;  3ZGQ A;  2XRZ A;  2DYR E;  3FH8 A;  3L22 A;  3RO3 A;  4APO A;  3CHM A;  4HI9 A;  4GZD A;  4BT8 A;  2XGO A;  1HU3 A;  3I4G A;  4FA6 A;  1FPP A;  3FUJ A;  5CMW A;  2XRY A;  1DVP A;  3ZEF A;  2CHW A;  1FT1 A;  3R7Q A;  3ZFW A;  4BFR A;  5G04 C;  3DPY A;  4PUC A;  4A3V A;  4UI9 K;  5BW8 C;  2NXP A;  3R7R A;  2KCV A;  4E85 A;  4BTA A;  3VTY A;  4EBA A;  1E8Z A;  2J9Q A;  1MJ0 A;  1H6O A;  5A23 A;  3CVY A;  4BSX A;  3ML9 A;  4AP2 A;  3RJV A;  1XNF A;  2C2L A;  4IUL A;  3DSX A;  5EYP F;  4UWH A;  3FTW A;  2WXJ A;  3LDZ A;  5HKP A;  3CVW A;  3UQ3 A;  4GA1 A;  4AY6 A;  3Q73 A;  1OUV A;  2WQ7 A;  1MX6 A;  3IKO B;  5G05 J;  3MA5 A;  2CHZ A;  5LCW J;  5DBK A;  5C2Y A;  4CYM D;  4HNA D;  4LSZ E;  3UT4 A;  5CBN A;  2GRN B;  2J09 A;  2X3M A;  2PQN A;  3D9L A;  3RIB A;  4JVS A;  5LOZ A;  3B13 A;  3CVN A;  2LSV A;  4F1S A;  3ABM E;  4N2Q A;  1YCS B;  3D9H A;  4YDY A;  3UPV A;  1NZN A;  2E2E A;  4KMO A;  3DXM G;  3ASD A;  4HOR A;  2A5E A;  5HRY A;  3NF1 A;  3ZW3 A;  4I2Z A;  4N3C A;  3LY8 A;  2HYZ A;  2WVI A;  3Q9N C;  4C0E A;  1SVX A;  5C1D A;  4RLY A;  4I6J A;  2ION A;  3D9O A;  3F6Q A;  4B94 A;  2Y69 E;  2EIM E;  3TL5 A;  4HI8 A;  2R5S A;  3IXE A;  4MS6 A;  2IF4 A;  5T4Y A;  1RZ4 A;  1PAQ A;  4L2Y A;  3I4R B;  3EHN A;  4F53 A;  3FEX A;  4HRL A;  2QYJ A;  4TUM A;  3AAA C;  3ZXS A;  2GW1 A;  4CDR A;  1O1S A;  3CHS A;  4Q69 A;  2WB2 A;  4KYO B;  4A55 A;  2CG2 A;  2QYU A;  3QWP A;  3HVE A;  1E8W A;  1MX4 A;  4WAF A;  1OXJ A;  3FTZ A;  4NIK A;  4LG6 A;  3BUA A;  3OXG A;  2AJA A;  5G2N A;  2WXF A;  1BD8 A;  3QDN A;  2V4L A;  3EHM A;  3CV0 A;  3ASN E;  3ULY A;  4J7W A;  1N4Q A;  2KZT B;  3RK6 A;  3HYM B;  3JXJ A;  3UTM A;  4JEU A;  4GZC A;  2OV8 A;  2HR2 A;  2R59 A;  3S7F A;  3ZVV A;  4HOS A;  3PE4 A;  4YDW A;  1D9S A;  4GTO A;  3CK7 A;  3TXN A;  4TXQ A;  5ENR D;  2CHX A;  2PM6 A;  4HB5 A;  1HFA A;  3IBE A;  2OND A;  3SZ7 A;  1MYO A;  1Z3X A;  4TXP A;  3QWV A;  5CEC B;  2VQ2 A;  1OWM A;  3L17 A;  3DSW A;  3BEE A;  4LRZ A;  2V4H C;  4WND A;  2PNN A;  2Y0B G;  4PDX A;  3WG7 E;  4GML A;  1Y6I A;  2CFZ A;  4CT0 A;  2IEJ A;  3EUV A;  3MV2 B;  3L82 A;  3MV3 B;  3RSE G;  5BPP A;  5FQ4 A;  1KT0 A;  3QAR A;  3MGB A;  4WWO A;  2DZN A;  2I1J A;  4L1B A;  3TJP A;  2LAH A;  2BUG A;  2V5F A;  3JXI A;  3AG3 E;  2A5U A;  2GRQ B;  1TNO A;  4ZFH A;  1UN8 A;  2DWZ A;  3AG2 E;  2J49 A;  3LYA A;  4HFG A;  4I1O B;  4ANX A;  3ENE A;  4XKC A;  1N52 A;  2C0L A;  2V8S E;  4I43 A;  1WDY A;  1Z6T A;  1JWF A;  1TNZ A;  2Y4U A;  4OVU A;  5JMN D;  3GZ1 A;  5ENT D;  2WQH A;  2AVP A;  3ZXP A;  2P9I G;  3PRE A;  2WM9 A;  2X6H A;  3ASH A;  2IY0 C;  4BER A;  2R02 A;  4Y6C A;  2DBA A;  2BKK B;  5HQ8 A;  1O1T A;  1V54 E;  3ONL A;  2IOS A;  1JCS A;  2H6I A;  5EIB E;  3MJW A;  2LXM A;  1UJK A;  4GTQ A;  3FEY A;  3TWR A;  3D9J A;  4GMR A;  2XPZ A;  4G24 A;  3CEQ A;  5AQ9 A;  4UWK A;  4GTT A;  2YQ8 A;  4GZ5 A;  4O1P A;  2F8X K;  4FJY A;  4B93 B;  1FCH A;  2F8Y A;  1OY3 D;  3E4B A;  2EIN E;  4IRU A;  1X5B A;  4ILI A;  3HRA A;  1KPS B;  4ATZ D;  3TWQ A;  1O5M A;  4JHK A;  3EHQ A;  4C9B B;  1K8K G;  2GRP B;  3FUE A;  5BV0 A;  1HO8 A;  5B1B E;  3D9M A;  4EBA G;  2KBX A;  2PM7 A;  3ULE G;  5B3S E;  4DK5 A;  2FEZ A;  3LPZ A;  3L54 A;  4U07 A;  3FTU A;  3LS8 A;  3HG0 D;  3CVQ A;  5BT1 A;  4ATG A;  4GYO A;  2ETC A;  3CVV A;  3UX4 A;  2L6J A;  4XE0 A;  4GA0 A;  3ML8 A;  3NQP A;  4DUI A;  3PDN A;  2J08 A;  4I6G A;  2WXP A;  3Q47 B;  4JPS A;  5ITZ F;  4K5C A;  4CGV A;  3NBN B;  5ENO D;  3VTX A;  2IO3 C;  2IFU A;  1O1R A;  1SZA A;  3N71 A;  5CBO A;  5FT9 A;  1UJJ A;  3SO8 A;  1LF8 A;  4UQY A;  1UG3 A;  3UKR G;  4F7A A;  3P2B A;  2ILR A;  4TUU A;  4H7X A;  3SBS A;  3TWU A;  3KEA A;  3AS5 A;  3JYS A;  3PEV B;  2C0M A;  4B8C B;  5EID A;  3AJI A;  1Z3Y A;  3HXF A;  3S2A A;  2P9L G;  4DLO A;  1OWN A;  2ETA A;  3IHY A;  1BI8 B;  1PC2 A;  4UQZ A;  5AIJ A;  4O1O A;  5E76 A;  4GB9 A;  3RAU A;  2MOW A;  4K5B A;  1N4P A;  4CRW A;  2P9K G;  5T8I A;  5KJN A;  3FUK A;  1H6K A;  2R03 A;  4I6E A;  3RRU A;  4HVB A;  3D9K A;  5ARG A;  2L0I A;  3APD A;  4O60 A;  4AOF A;  5LFA A;  5AN8 A;  3L16 A;  4ANW A;  2XEH A;  5AQA A;  4C48 B;  1L5J A;  4DX2 A;  4UUC A;  3LEW A;  1SA5 A;  4Q94 A;  1Z5S C;  2VGX B;  3IEG A;  3EJN A;  3KD7 A;  4DX1 A;  2OEW A;  4ANV A;  4WNF A;  4EHM A;  4XIF A;  4JA9 A;  4JW1 A;  2R17 C;  3HIZ A;  4AIF A;  3SFZ A;  4N39 A;  1ZU2 A;  2QY7 A;  5BXO A;  4JB8 P;  2OOE A;  2WMO A;  1E96 B;  2JEK A;  2XEN A;  3B7U X;  5FIO A;  3ZKJ A;  2J8S D;  3LCA A;  3CLJ A;  2UY1 B;  1BU9 A;  3ZUV B;  4BSZ B;  4U96 D;  1S63 A;  4JD2 G;  1LD7 A;  1JPL A;  1UOH A;  3PE3 A;  4K0R A;  3R9M A;  3EIQ C;  5A6C A;  3PUK A;  2UY1 A;  2AWI A;  1E90 A;  3MX3 A;  3TWT A;  1ELK A;  1U2V G;  5KJL A;  2I6H A;  3UKU G;  1P5Q A;  3E33 A;  3G2W A;  2EQX A;  5CRU A;  4AM9 A;  1TNU A;  3UT7 A;  1Q2Z A;  4YND A;  2CFU A;  3D9N A;  5BXU A;  4IYP A;  4EZK A;  1QYM A;  4EEC A;  2P58 C;  3KS2 A;  2WXL A;  3FUM A;  1ZBP A;  1AWC B;  4ME2 A;  4I2W A;  5KJK A;  5ANR A;  4CZ2 D;  3ZYQ A;  5LP0 A;  4FP7 A;  1OWP A;  2RFA A;  2LAI A;  2KM4 A;  3JQ1 A;  2P9U G;  4J0U A;  4MRU A;  4DX7 D;  1K1A A;  3SFY A;  3D9I A;  1WG0 A;  3DSV A;  1SW6 A;  1VDY A;  2HO1 A;  3PVL A;  4ABN A;  2MRI A;  4AJW A;  2VSX E;  3CHO A;  3JCK C;  4UWF A;  4DI4 A;  1QQE A;  1LTX A;  3PZ2 A;  5FTP A;  4F6R D;  3VLF A;  2KAT A;  1FVH A;  2XPI A;  1D8E A;  3CVU A;  2IO2 C;  5T3R A;  1HXI A;  3PNT B;  4KVO A;  4U04 A;  5LX8 A;  3Q75 A;  5JJT A;  2WXG A;  3VLD A;  3E30 A;  4I1A A;  4N5C A;  4J8F A;  5KBA A;  3FUH A;  1ZB1 A;  1DCQ A;  2RFM A;  3CST A;  3QAQ A;  3BU8 A;  5AAO A;  3FTS A;  5DIZ A;  4ZHB A;  2IQC A;  1NI1 A;  4RG9 A;  2I1K A;  2A4Z A;  2X6K A;  5D0O D;  3PZ1 A;  2V5Q C;  4HRM B;  4MLP A;  2JAB A;  5J08 A;  5CRV A;  3NAW A;  4DI3 A;  2EIJ E;  3ZRH A;  4LCT A;  4GPK A;  1KLX A;  5EN5 D;  3ZYM A;  1E7V A;  4O6F A;  3OTN A;  4DLQ A;  2XGM A;  3ZU7 B;  4EQF A;  4NQ0 A;  4PS8 A;  3CHQ A;  1X81 A;  3LXU X;  3RKV A;  3ASF A;  1H19 A;  4IN3 B;  2FI7 A;  2L9B A;  5KCM A;  2X6J A;  3FU5 A;  3KSL A;  3HXD A;  5D66 A;  1TN6 A;  3MEK A;  4FJZ A;  4EZJ A;  5JJ6 A;  2DIW A;  3MKR A;  3FHE A;  3UIN C;  3QC1 A;  1HG2 A;  1YA0 A;  2WXR A;  4G11 A;  3HVE B;  4F1P A;  1BI7 B;  2XGS A;  1E8X A;  4ANU A;  5FJY A;  2LXL A;  2X6F A;  4G23 A;  2QC9 A;  3B7R L;  4OVV A;  3HXB A;  5KJM A;  4OAU C;  2ZGG A;  2GRO B;  2J4B A;  2OCC E;  3ASO E;  3DSU A;  3B95 A;  2BTD A;  3JUE A;  3QNK A;  3KSQ A;  2UWJ G;  3C3R A;  4RVB A;  4WUY A;  4Q96 A;  1OWO A;  5E75 A;  4PH4 B;  4UI9 C;  2AXU A;  3FU6 A;  3CVL A;  1HZ4 A;  4U8V D;  2MYO A;  3HXC A;  4WNE A;  3J5P A;  2NSZ A;  1N4S A;  3EIJ A;  3EHR A;  4G25 A;  3CQC B;  2P9S G;  4GTR A;  4QFV A;  4XI9 A;  3IHV A;  3LJ3 A;  5AJD A;  4FC8 A;  3B7S A;  4FHJ A;  4JXT A;  4GPM A;  4BEP A;  3Q78 A;  2B0O E;  1MQS A;  2R2L A;  1PY1 A;  1HG5 A;  3ISM C;  4KXK B;  1JCR A;  2LUH A;  1MHQ A;  3O4Z A;  3Q5M A;  3TWS A;  3MCX A;  2FBN A;  3T8K A;  5EKQ D;  2F0Y A;  2I2O A;  3OXL A;  4WWP A;  4AEZ C;  2M63 A;  4AXH A;  4ILH B;  1H2V C;  3PH0 C;  2XPY A;  2EIK E;  3T8M A;  4B0Z A;  3TAX A;  4BY6 A;  2MHK A;  4C0M A;  4DRX E;  5JJ7 A;  4FLB A;  1NA3 A;  3AU4 A;  4F3V A;  2OVF A;  5EYL A;  3UI2 A;  3BG1 B;  3P1U A;  3U3W A;  4MBG A;  2P9N G;  3NOC D;  3CIA A;  1S70 B;  1H6P A;  3PZD A;  4XI0 A;  4G8K A;  3E34 A;  4GZ6 A;  3PZ3 A;  4UWG A;  4I9E A;  3SD5 A;  3DBS A;  1TNY A;  3DPD A;  3G2V A;  3ESK A;  1IYG A;  3OAW A;  4FLH A;  3VLE A;  1SZ9 A;  2GRR B;  1OWL A;  3FU3 A;  3G2U A;  3PNL B;  2ZIS A;  5ENN A;  4XX5 A;  3AS8 A;  4YVO A;  2XEE A;  3CHR A;  2VTB B;  3C72 A;  3WXX A;  3R9A B;  2EIL E;  3FH5 A;  4CDN A;  1SQM A;  4HOT A;  2WXI A;  3SY2 A;  3EDT B;  4XZ4 A;  3MZL B;  2L0T B;  2XS1 A;  3ZHE A;  3QB2 A;  5G05 C;  4OYS A;  1TYQ G;  1IHB A;  3NZU A;  1OCZ E;  4DX6 D;  3QWW A;  4ILG A;  3SQV A;  4I9C A;  2X38 A;  3SNX A;  3ASG A;  4UQX A;  4GU5 A;  4G2V A;  4AY5 A;  1WM5 A;  3FFL A;  3AS4 A;  3D3M A;  3CQG B;  1V55 E;  3LY9 A;  3NB2 A;  4U63 A;  5CCL A;  2ZXW E;  5ENS D;  4U7E B;  1A17 A;  4HOU A;  3UXG A;  2WXH A;  5LCW C;  5AQ7 A;  1WAO 1;  3UMV A;  4LER A;  2QZA A;  2J4D A;  1S64 A;  2LO6 A;  1A5E A;  3UM1 A;  3DST A;  3APF A;  3BQO A;  4QQI A;  5EX0 A;  4J6I A;  1NL4 A;  1N54 A;  4N2S A;  2P9P G;  4N5Q A;  3UM2 A;  3UIO C;  5BV1 A;  4B8A A;  3BG0 B;  2ETB A;  3TWX A;  2H6F A;  3FTX A;  4LUN U;  4YDE A;  3G2T A;  1DNP A;  1S0P A;  1TR4 A;  2X6I A;  3FTY A;  4RG6 A;  4G26 A;  3TWV A;  2KZT A;  1EF1 C;  5FWQ A;  1TJC A;  3TG5 A;  2YHE A;  3QK0 A;  5CCM A;  1KZP A;  1E7U A;  3IV0 A;  1H2T C;  1FT2 A;  4BTB A;  4YVQ C;  3ONK A;  3HDX A;  3V2X A;  3CVX A;  4NUR A;  1JWG A;  3C3Q A;  1ELW A;  4KZ0 A;  3UIP C;  3W9F A;  5CEA A;  3ZNG A;  2YHC A;  3PRZ A;  2BKG A;  4FU3 A;  3S7J A;  2VJ8 A;  5KWD A;  4LNB A;  4PS7 A;  5G55 A;  1UN9 A;  1H2U A;  1Y8M A;  3DSS A;  3SF4 A;  4JEH A;  5HI7 A;  4JHR A;  2Q7F A;  5JA4 D;  5J90 A;  5FZQ A;  5CMY A;  4YDO A;  3TGO A;  3AG4 E;  4DJA A;  1TN8 A;  4AV7 A;  5AAR A;  2OVB A;  4FAD A;  2GGF A;  1W3B A;  4URK A;  3LVR E;  1UW4 B;  1GW6 A;  2VGE A;  2GRM A;  3U9W A;  2VSO E;  5FQ6 A;  3Q7A A;  1N0R A;  2XQ0 A;  5KNG A;  4HOQ A;  3SI5 A;  3EU5 A;  4W9R A;  1BPO A;  3FUL A;  3PUJ A;  3S7B A;  2JLB A;  5ANL A;  3RRN B;  3B7B A;  2LSU A;  3O48 A;  3I3N A;  4E6H A;  4LEU A;  3V31 A;  5KNH D;  4J8Y A;  1XGW A;  3GZS A;  3T5V A;  1NFI E;  4Z68 A;  1JCQ A;  1ELR A;  3FU0 A;  4EZL A;  1B89 A;  4L2L A;  4GTP A;  4D10 C;  5A7D B;  1INZ A;  3FY4 A;  1HH8 A;  2IOL A;  3FP3 A;  1E8Y A;  4J8E A;  4GYW A;  2PQR A;  3GW4 A;  2BF0 X;  2ZIR A;  1QZ2 A;  3SHF A;  2AXZ A;  4A3T A;  4J8S A;  3K9I A;  3URZ A;  3T5X A;  3L9T A;  2H6G A;  3DRA A;  5AEN A;  4U0S A;  2PL2 A;  3FDH A;  3V2O A;  3J5Q B;  4GTV A;  3C98 A;  4B89 A;  2Y1L E;  5JHA A;  4DX5 D;  1TN7 A;  3L08 A;  3C3O A;  4CT4 A;  1AP7 A;  4BX9 A;  3L13 A;  1IQU A;  4RQI A;  3GYZ A;  2RG8 A;  3FUD A;  4LNG A;  1QNF A;  3ZHE B;  4TXR A;  1N94 A;  3APC A;  1MX2 A;  1HF8 A;  2Y4T A;  1EDU A;  3B7T A;  4GYY A;  4U0Z A;  3FWV A;  4HBD A;  2L6B A;  1U3C A;  2RD0 A;  3X2Q E;  4KVM A;  3RO2 A;  4TV3 A;  2OEV A;  4HQD A;  4HS2 A;  3ZIM A;  4JHJ A;  4GA2 A;  4NAC A;  4GCN A;  3QJZ A;  2KCK A;  5CHE E;  4BT9 A;  4WNG A;  4FUL A;  1D8D A;  3ABL E;  5JHB A;  5BNW A;  4CCA A;  3FTV A;  4GCO A;  2I9C A;  3CVP A;  4TRQ A;  2VSY A;  3G2S A;  2XEV A;  3DXK G;  2RKK A;  3JUI A;  2XCC A;  2XCB A;  1EPU A;  4P29 A;  2B6C A;  5IY5 E;  5CED B;  4HRN A;  2GRL A;  1MZC A;  5EDS A;  1SA4 A;  5H7P A;  2WMN A;  4M7C A;  3KAE A;  4XEI G;  2AW6 A;  2VGY A;  4U8Y D;  5D0Q D;  5FZS A;  3LJN A;  2YNQ A;  4R7L A;  4L9P A;  4CEM A;  1JUQ A;  4BX8 A;  3UUX A;  3CK8 A;  2WXN A;  4K5A B;  3FUF A;  1TJF A;  4APF A;  2E0I A;  3Q15 A;  3TWW A;  2ZU6 B;  4DPR A;  3W9G A;  3TG4 A;  4JL0 A;  3SFX A;  3EU9 A;  1RW2 A;  3CHP A;  3AU5 A;  4K03 A;  2WXQ A;  4L23 A;  4HLL A;  2VSN A;  1YMP A;  5HS0 A;  3RRM B;  5ARF A;  1K1B A;  1WY6 A;  3PS6 A;  4NRH B;  1KT1 A;  5FQ7 A;  5EIL A;  3ZN3 A;  3KEZ A;  2Y3A A;  3QKY A;  2P2C P;  3LKU A;  5FQ8 A;  3U66 A;  1TEZ A;  2NC9 A;  3MKQ A;  1N4R A;  4BET A;  5BUZ A;  5G04 J;  1G3N B;  1HE8 A;  3E32 A;  3GZ2 A;  4G1T A;  1OCO E;  4HLE A;  3U4T A;  5M72 A;  4U95 D;  4PS3 A;  4JZY A;  3Q4A B;  4G8L A;  4GMJ A;  1OCC E;  3Q79 A;  5AQB A;  2DYS E;  1IXV A;  2WXK A;  3SBT B;  1K3Z D;  4WWN A;  3MYV A;  1IKN D;  3C5R A;  3NZS A;  1OT8 A;  4XKB A;  4KBQ A;  4FHK A;  2XZD G;  1EYH A;  2WPV A;  2VYI A;  3OXF A;  1U3D A;  2WXM A;  2YIN A;  1KZO A;  3V30 A;  2FF4 A;  5FIN A;  2XHE A;  1HX8 A;  3FH7 A;  2HM8 A;  3FUN A;  3NOG D;  1YYH A;  4U8H A;  5D2M C;  2WXO A;  3TXM A;  3CGH A;  4GTM A;  3UM0 A;  4N3A A;  3MKQ B;  1BLX B;  2BED A;  4JC8 A;  2J07 A;  3CR3 A;  3LVQ E;  3PEU B;  3RU0 A;  3UM3 A;  2FO7 A;  3Q49 B;  1HS6 A;  2ZGD A;  5EX3 A;  4OAV B;  1DCE A;  4ACK A;  3DEO A;  1QBQ A;  4EPZ A;  5B1A E; 
#chains in the Genus database with same CATH homology
 5HI7 A;  4JHR A;  3S7D A;  2Q7F A;  5FZR A;  5J90 A;  5FZQ A;  5CMY A;  1UN8 A;  4LCT A;  4Y6W A;  3TGO A;  4GPK A;  1KLX A;  4DJA A;  2J49 A;  3LYA A;  4HFG A;  3ZYM A;  4I1O B;  4J8D A;  4ANX A;  3ENE A;  4XKC A;  1E7V A;  1N52 A;  4AV7 A;  2C0L A;  2V8S E;  2OVB A;  4I43 A;  4FAD A;  1Z6T A;  2GGF A;  1JWF A;  1W3B A;  4URK A;  4O6F A;  3LVR E;  3OTN A;  2AXV A;  4DLQ A;  5AJL A;  1UW4 B;  2LNI A;  1GW6 A;  2Y4U A;  4HXI A;  4OVU A;  2QFC A;  2XGM A;  2GRM A;  4KT6 B;  4GAA A;  4EQF A;  4NQ0 A;  3CKB A;  4GZ3 A;  4U0U A;  4PS8 A;  3U9W A;  2VSO E;  3CHQ A;  3GZ1 A;  5FQ6 A;  3LXU X;  3RKV A;  2WQH A;  2AVP A;  3ASF A;  3PRE A;  4MKT A;  2WM9 A;  2X6H A;  3ASH A;  1H19 A;  4IN3 B;  2FI7 A;  2L9B A;  4Y6C A;  2DBA A;  4ACL A;  2XQ0 A;  3SGH A;  5HQ8 A;  5KCM A;  2X6J A;  4BWR A;  1FVF A;  4HOQ A;  3ONL A;  3FU5 A;  3SI5 A;  1NA0 A;  2IOS A;  4W9R A;  1BPO A;  3FUL A;  2VGX A;  3PUJ A;  3MJW A;  1NP7 A;  3S7B A;  3QOU A;  4JA7 A;  2V0P A;  2JLB A;  3MEK A;  5ANL A;  1UJK A;  2IU1 A;  4FJZ A;  3FEY A;  4EZJ A;  3CKC A;  3RRN B;  5JJ6 A;  3D9J A;  2DIW A;  4RSY A;  2XPZ A;  3MKR A;  3CEQ A;  3FHE A;  4G24 A;  2KCL A;  4UWK A;  2LSU A;  3QC1 A;  3O48 A;  2DCP A;  1HG2 A;  2YQ8 A;  3I3N A;  4GZ5 A;  3UT8 A;  4H7Y A;  4E6H A;  2WQ6 A;  4FJY A;  1FCH A;  4UWL A;  3ZYK A;  4LEU A;  3E4B A;  4IRU A;  1X5B A;  1YA0 A;  4ILI A;  1XGW A;  3GZS A;  3T5V A;  2WXR A;  3I5P A;  1ELR A;  3D9P A;  3FU0 A;  4JHK A;  3CK9 A;  4G11 A;  4EZL A;  4C9B B;  1B89 A;  2IJG X;  3HVE B;  4L2L A;  3FUE A;  4N3B A;  5BV0 A;  4AVX A;  1HO8 A;  2XGS A;  1E8X A;  2FUL A;  3D9M A;  3LY7 A;  4ANU A;  5FJY A;  4D10 C;  2X6F A;  4EBA G;  4G23 A;  4CGW A;  3B7R L;  2PM7 A;  4OVV A;  5A7D B;  1H0A A;  1INZ A;  3FY4 A;  4M3O A;  4DK5 A;  1HH8 A;  2FEZ A;  2IOL A;  3LPZ A;  3FP3 A;  3L54 A;  4A1S A;  5KJM A;  1E8Y A;  4U07 A;  3FTU A;  3ESL A;  4J8E A;  3LS8 A;  3FUI A;  2J4B A;  4GYW A;  3CVQ A;  2PQR A;  3GW4 A;  2BF0 X;  2BTD A;  5BT1 A;  4ATG A;  4A1G A;  4GYO A;  1QZ2 A;  3QNK A;  3SHF A;  3CVV A;  2AXZ A;  4CDM A;  2UWJ G;  4I17 A;  4RVB A;  2CG3 A;  3UX4 A;  2L6J A;  4WUY A;  4XE0 A;  4GA0 A;  4Q96 A;  3ZYL A;  3ML8 A;  3NQP A;  4A3T A;  4J8S A;  4UI9 J;  3K9I A;  3HHM A;  1OWO A;  5E75 A;  4PH4 B;  4UI9 C;  4L7T A;  4KZC A;  3URZ A;  3T5X A;  1IQR A;  2AXU A;  4AP2 A;  3PDN A;  2J08 A;  3FU6 A;  3L6A A;  3CVL A;  4I6G A;  2WXP A;  3U64 A;  5AEN A;  1HZ4 A;  3Q47 B;  4JPS A;  2PZI A;  4U0S A;  2PL2 A;  4CGV A;  4I1M A;  3FDH A;  3VTX A;  4WNE A;  5AYW D;  4V3I A;  2KC7 A;  2NSZ A;  3C98 A;  2IFU A;  3CSF A;  2VTB A;  4B89 A;  1SZA A;  3JQ0 A;  3N71 A;  3EIJ A;  1IHG A;  3ZPJ A;  5JHA A;  3ULQ A;  5FT9 A;  3L08 A;  1UJJ A;  3ZGQ A;  4CT4 A;  1LF8 A;  4G25 A;  1UG3 A;  4UQY A;  3CQC B;  4F7A A;  2XRZ A;  3FH8 A;  4BX9 A;  3L13 A;  3L22 A;  4QFV A;  4XI9 A;  3IHV A;  3RO3 A;  3P2B A;  2ILR A;  4TUU A;  1IQU A;  4APO A;  3CHM A;  4H7X A;  3SBS A;  3GYZ A;  4GZD A;  4BT8 A;  2XGO A;  2RG8 A;  3FUD A;  1HU3 A;  3I4G A;  3LJ3 A;  5AJD A;  4FA6 A;  4FC8 A;  3AS5 A;  3FUJ A;  3JYS A;  1QNF A;  5CMW A;  3ZHE B;  3B7S A;  2XRY A;  1DVP A;  2C0M A;  3PEV B;  4FHJ A;  3ZEF A;  4B8C B;  4EPZ A;  2CHW A;  3APC A;  4JXT A;  1HF8 A;  1Z3Y A;  3R7Q A;  2Y4T A;  3S2A A;  3ZFW A;  4BFR A;  1EDU A;  3B7T A;  5G04 C;  4GYY A;  4U0Z A;  4DLO A;  1OWN A;  1MQS A;  4PUC A;  4A3V A;  4UI9 K;  3FWV A;  1PY1 A;  1U3C A;  2RD0 A;  1HG5 A;  5BW8 C;  2NXP A;  3R7R A;  4KVM A;  2KCV A;  3IHY A;  4KXK B;  1PC2 A;  4E85 A;  3RO2 A;  4TV3 A;  4UQZ A;  5AIJ A;  1MHQ A;  5E76 A;  4HS2 A;  4GB9 A;  3ZIM A;  4JHJ A;  3O4Z A;  4BTA A;  3Q5M A;  4GA2 A;  3VTY A;  4EBA A;  2MOW A;  3MCX A;  2FBN A;  4NAC A;  5EKQ D;  4GCN A;  1E8Z A;  2J9Q A;  3QJZ A;  4CRW A;  5A23 A;  3CVY A;  2I2O A;  2KCK A;  4BSX A;  3ML9 A;  3OXL A;  4WWP A;  5T8I A;  5CHE E;  3RJV A;  3FUK A;  1H6K A;  2M63 A;  4AEZ C;  4I6E A;  4AXH A;  5KJN A;  4ILH B;  4BT9 A;  1H2V C;  4WNG A;  1XNF A;  3RRU A;  2C2L A;  3PH0 C;  4FUL A;  2XPY A;  4IUL A;  3T8M A;  4B0Z A;  3TAX A;  4HVB A;  4UWH A;  4BY6 A;  2MHK A;  4C0M A;  5JHB A;  3D9K A;  5JJ7 A;  3FTW A;  4FLB A;  2WXJ A;  5BNW A;  4CCA A;  5ARG A;  1NA3 A;  3FTV A;  3LDZ A;  4GCO A;  3CVW A;  2L0I A;  3AU4 A;  4F3V A;  2OVF A;  3APD A;  4AOF A;  5LFA A;  2I9C A;  3CVP A;  3L16 A;  3BG1 B;  4TRQ A;  3UQ3 A;  4ANW A;  3P1U A;  2VSY A;  3G2S A;  4GA1 A;  3U3W A;  4AY6 A;  2XEV A;  1OUV A;  2WQ7 A;  3IKO B;  3CIA A;  3JUI A;  5G05 J;  2XCC A;  3MA5 A;  2XCB A;  3PZD A;  1EPU A;  1L5J A;  4P29 A;  3LEW A;  4XI0 A;  2CHZ A;  4Q94 A;  2GRL A;  5LCW J;  5DBK A;  5C2Y A;  4GZ6 A;  2VGX B;  3IEG A;  4UWG A;  5EDS A;  4I9E A;  3UT4 A;  3EJN A;  2J09 A;  2X3M A;  3KD7 A;  3SD5 A;  2PQN A;  2WMN A;  3D9L A;  4ANV A;  3DBS A;  3DPD A;  3G2V A;  4WNF A;  3RIB A;  3ESK A;  4JVS A;  4JA9 A;  4XIF A;  4JW1 A;  5LOZ A;  1IYG A;  2R17 C;  3B13 A;  3CVN A;  3KAE A;  3OAW A;  3HIZ A;  2LSV A;  4FLH A;  2AW6 A;  2VGY A;  4F1S A;  4AIF A;  5D0Q D;  3SFZ A;  3VLE A;  4N2Q A;  5FZS A;  4N39 A;  1SZ9 A;  2YNQ A;  3UPV A;  1ZU2 A;  1OWL A;  3FU3 A;  3G2U A;  1NZN A;  3PNL B;  4R7L A;  2E2E A;  4CEM A;  2QY7 A;  2OOE A;  4KMO A;  2WMO A;  1JUQ A;  4BX8 A;  1E96 B;  2JEK A;  3CK8 A;  5ENN A;  3ASD A;  3UUX A;  2WXN A;  4XX5 A;  4HOR A;  3FUF A;  3AS8 A;  3NF1 A;  4YVO A;  3ZW3 A;  3B7U X;  3CHR A;  4I2Z A;  2VTB B;  1TJF A;  4N3C A;  4APF A;  3WXX A;  3R9A B;  2E0I A;  3Q15 A;  3LCA A;  2ZU6 B;  3CLJ A;  3LY8 A;  3FH5 A;  4DPR A;  4CDN A;  2HYZ A;  2UY1 B;  3TG4 A;  4JL0 A;  1SQM A;  4HOT A;  3CHP A;  3AU5 A;  2WVI A;  2WXI A;  4K03 A;  3EDT B;  4C0E A;  2WXQ A;  1JPL A;  4L23 A;  5C1D A;  4I6J A;  4XZ4 A;  2ION A;  3MZL B;  2L0T B;  3D9O A;  3PE3 A;  4K0R A;  3EIQ C;  5A6C A;  3ZHE A;  4B94 A;  3PUK A;  2UY1 A;  2AWI A;  2VSN A;  3TL5 A;  3QB2 A;  5G05 C;  1E90 A;  3MX3 A;  4OYS A;  2R5S A;  4MS6 A;  1ELK A;  2IF4 A;  3RRM B;  5T4Y A;  5ARF A;  2I6H A;  5KJL A;  1PAQ A;  3PS6 A;  1WY6 A;  4L2Y A;  3I4R B;  4NRH B;  1KT1 A;  3NZU A;  1P5Q A;  5FQ7 A;  3EHN A;  4F53 A;  3G2W A;  3FEX A;  3QWW A;  4ILG A;  3ZN3 A;  2EQX A;  4AM9 A;  4I9C A;  2X38 A;  3KEZ A;  3UT7 A;  2Y3A A;  3ZXS A;  3QKY A;  4YND A;  3SNX A;  2CFU A;  3ASG A;  4UQX A;  3D9N A;  3LKU A;  4GU5 A;  4G2V A;  5FQ8 A;  4AY5 A;  2GW1 A;  4CDR A;  3CHS A;  1WM5 A;  4Q69 A;  3U66 A;  2WB2 A;  1TEZ A;  3FFL A;  3AS4 A;  2NC9 A;  3D3M A;  4IYP A;  4EZK A;  3MKQ A;  3CQG B;  4KYO B;  4EEC A;  3LY9 A;  4U63 A;  4A55 A;  2CG2 A;  2P58 C;  3QWP A;  3KS2 A;  5CCL A;  2WXL A;  3FUM A;  3HVE A;  1ZBP A;  1E8W A;  4WAF A;  1A17 A;  3FTZ A;  4HOU A;  5BUZ A;  5G04 J;  2WXH A;  3OXG A;  1HE8 A;  4I2W A;  4ME2 A;  5LCW C;  1WAO 1;  3GZ2 A;  5KJK A;  3UMV A;  5G2N A;  5ANR A;  4G1T A;  2WXF A;  4LER A;  3ZYQ A;  5LP0 A;  4FP7 A;  1OWP A;  2J4D A;  3QDN A;  4HLE A;  2LAI A;  2KM4 A;  3JQ1 A;  2LO6 A;  4J0U A;  4MRU A;  2V4L A;  3U4T A;  3EHM A;  3D9I A;  5M72 A;  3APF A;  3CV0 A;  1VDY A;  4PS3 A;  5EX0 A;  2HO1 A;  3PVL A;  4ABN A;  2KZT B;  4JZY A;  3RK6 A;  2MRI A;  3HYM B;  3Q4A B;  4J6I A;  4GMJ A;  1N54 A;  4JEU A;  4AJW A;  4N2S A;  4GZC A;  2OV8 A;  2VSX E;  3CHO A;  3JCK C;  2HR2 A;  2R59 A;  4UWF A;  3S7F A;  4DI4 A;  3ZVV A;  1QQE A;  5FTP A;  4HOS A;  3VLF A;  3PE4 A;  2WXK A;  3SBT B;  2KAT A;  1FVH A;  5BV1 A;  2XPI A;  4WWN A;  4B8A A;  3BG0 B;  3CK7 A;  3FTX A;  4LUN U;  3CVU A;  3G2T A;  3MYV A;  1DNP A;  1S0P A;  5T3R A;  3NZS A;  3TXN A;  2X6I A;  3FTY A;  1HXI A;  4G26 A;  2CHX A;  3PNT B;  4RG6 A;  4XKB A;  2PM6 A;  1HFA A;  3IBE A;  4KBQ A;  4KVO A;  2OND A;  2KZT A;  1EF1 C;  4U04 A;  5FWQ A;  4FHK A;  3SZ7 A;  1Z3X A;  5LX8 A;  1TJC A;  1EYH A;  3TG5 A;  2WPV A;  3QWV A;  5JJT A;  2YHE A;  2VQ2 A;  2VYI A;  3OXF A;  2WXG A;  1U3D A;  1OWM A;  3L17 A;  2WXM A;  3VLD A;  4I1A A;  3QK0 A;  4N5C A;  3BEE A;  4J8F A;  2YIN A;  5CCM A;  3FUH A;  2FF4 A;  4LRZ A;  2XHE A;  1E7U A;  3IV0 A;  1H2T C;  4WND A;  3CST A;  1HX8 A;  3FH7 A;  3QAQ A;  4BTB A;  2HM8 A;  3FUN A;  4YVQ C;  3FTS A;  3ONK A;  3HDX A;  4PDX A;  3CVX A;  4NUR A;  1JWG A;  4U8H A;  4GML A;  1ELW A;  2WXO A;  5DIZ A;  3TXM A;  4KZ0 A;  3CGH A;  1Y6I A;  2CFZ A;  4CT0 A;  2IQC A;  4N3A A;  3MV2 B;  3MKQ B;  4RG9 A;  3MV3 B;  4JC8 A;  2I1K A;  2J07 A;  2A4Z A;  2X6K A;  5D0O D;  5BPP A;  3CR3 A;  3LVQ E;  3PEU B;  5FQ4 A;  3RU0 A;  2FO7 A;  1KT0 A;  2YHC A;  3Q49 B;  3PRZ A;  1HS6 A;  3QAR A;  3MGB A;  4WWO A;  4MLP A;  4FU3 A;  3S7J A;  2VJ8 A;  5EX3 A;  5J08 A;  4PS7 A;  2I1J A;  4L1B A;  2LAH A;  2BUG A;  2V5F A;  1UN9 A;  1H2U A;  1Y8M A;  2A5U A;  5G55 A;  3TJP A;  4ACK A;  3SF4 A;  4DI3 A;  3ZRH A;  4JEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...