4IN3B

Crystal structure of the chs5-bch1 exomer cargo adaptor complex
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
721
structure length
589
Chain Sequence
b'LSQTSIPEVKEDVIGYALHQRRARVGQFQDLGPPDLITFFYCMGIDTSDPTSITIFAKKITDLFISISSWNAFRKYDVNIIVVQTYIINSDGEQSQLPLNVNMIWAETFMSGIVRDIMIMKDNRADGESQNLVETLIFNPFTSGELEDVANNFIKLFPLVYEKGVYLDAPTHVLNPSLTNNYLVETLVEIVRLTKSLEACRKMLKKLIEIHPEAVIILIRVYFACDLEIDAVDLINEQLNSPSSFLADDSKTSHIQLIFKSELLSIQSEFLLDVKRDYKLAKEVAMEAVNCAPNEFKTWYLLTRIYIKLNDMSNALLSLNACPMSQVKEKYVLRRIAPINLHLPLPLDNPMDVQLEQKSADPNLVNLSASSLKSTFQLAYKLLTEIVQITGWEQLLKYRSKIFVSKRLCERWLDNLFMLLYEDLKTYTDWQSEQLYFDAQHKLTVEWELFGLCAKRLGHLPEAAKAFQIGLSQRFSPVCAKNLLQFYIDEHKRIRRDSVSSELTSSQILSSINDIDSSIIDLVVKICCWNHRWYIEFSIILIDALSVAVQDMGITKVHNEIASRFSDPVAQLIDDNILNFLKNFTNDTF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitin biosynthesis protein CHS5
publication title The exomer cargo adaptor features a flexible hinge domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 183
structure length 589
sequence length 721
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09295 ChAPs ChAPs (Chs5p-Arf1p-binding proteins)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4in3B00
4JA9A 3ASFA 5CCMA 2C0MA 4YVQC 1NA3A 3ZGQA 3CKCA 4XIFA 4JL0A 4YVOA 3WXXA 4GZ6A 4B94A 4UQYA 5G04J 3U4TA 3ZN3A 1KT1A 1QZ2A 3TG4A 1KLXA 3Q5MA 5DBKA 3LY8A 5FJYA 3Q15A 1TJCA 3ESKA 3EDTB 4KXKB 5M72A 5BNWA 3CEQA 4APOA 4WUYA 4BTBA 2FI7A 5D0QD 1ELRA 4BTAA 2LSVA 4U0SA 3QWWA 3ZHEB 4BT8A 4H7YA 4G26A 4WNEA 5AYWD 3GZ1A 1IHGA 4GA1A 4N3BA 3TG5A 3CK8A 3FWVA 4KBQA 4W9RA 1B89A 1ZU2A 3MKRA 2FO7A 1PC2A 1HZ4A 4J0UA 1OUVA 4GZ3A 2Y4TA 4J8EA 2HYZA 5D0OD 4XI0A 1ELWA 4I17A 4U0UA 2HR2A 5BW8C 2KCKA 4N2SA 4O6FA 1YA0A 4G23A 3QKYA 3CV0A 4WNGA 4N3CA 2DBAA 4I9CA 2P58C 2VGXB 3ASGA 5KJLA 3MV3B 4WNFA 2VGYA 3CVPA 2C2LA 4I9EA 3KD7A 1W3BA 3HYMB 3SF4A 5DIZA 4UQZA 4HOTA 3CVLA 4CDRA 3LKUA 4N2QA 2PL2A 4LEUA 4GZ5A 4N5CA 5KJMA 4UI9J 5G04C 5JJ7A 2PQNA 2C0LA 3QWPA 5HI7A 3R9AB 3ASHA 2BUGA 4UQXA 4G2VA 3RJVA 3RO2A 5ARGA 1E96B 2AVPA 2YQ8A 3FFLA 1Y8MA 5C1DA 5A6CA 2XGMA 4HOSA 3FP3A 3S7FA 3O48A 3TAXA 5A7DB 2PZIA 3CVNA 4G25A 4GYWA 3QDNA 4GYOA 4BWRA 2KCLA 5JJTA 3Q4AB 3MV2B 4GPKA 2YHCA 2XCBA 2UY1A 3GYZA 4EQFA 4AIFA 3CK9A 3U3WA 4JHRA 3S7JA 2UWJG 1KT0A 2KCVA 3OXGA 4N3AA 2WQHA 4AM9A 1ZBPA 4I2WA 4GA0A 3N71A 2FBNA 3IEGA 2KATA 3ULQA 3VTYA 3AS8A 5KJKA 3CKBA 3Q47B 2PQRA 4HORA 2XCCA 5BT1A 5LCWJ 2MHKA 3OXFA 5KJNA 2JLBA 4F3VA 5FZRA 2OOEA 4AY5A 2XGSA 1WAO1 4IN3B 4YNDA 1P5QA 4HOQA 4U0ZA 5CHEE 2KC7A 2IF4A 3CK7A 3LPZA 4I2ZA 4HOUA 4UI9K 3K9IA 5G05J 3SZ7A 2V5FA 3ASDA 5FT9A 3PE4A 3Q49B 4G24A 3BEEA 3LY7A 2LNIA 2FEZA 4NRHB 3S7DA 3RKVA 1NZNA 3VTXA 3MA5A 1A17A 2XGOA 3QWVA 5EX3A 3KAEA 5JJ6A 3ZFWA 2L6JA 4AY6A 5FTPA 2GW1A 3ZPJA 4BT9A 4ABNA 3PE3A 2E2EA 3URZA 4GA2A 3OXLA 4G1TA 2LSUA 4JA7A 5CCLA 2NC9A 5FZSA 4Y6WA 3GZ2A 4GCNA 3S7BA 2IFUA 3CVQA 3TGOA 2VYIA 5EKQD 2R5SA 3QOUA 2UY1B 2XEVA 4U04A 4H7XA 4J8FA 3UQ3A 2J9QA 4RG9A 5ARFA 2VSYA 3NF1A 4CGVA 4NQ0A 3ZHEA 4ME2A 3LCAA 5LCWC 1QQEA 2I6HA 2XPIA 3KS2A 3RU0A 4KYOB 5EX0A 3LY9A 2VSNA 3GW4A 3PDNA 4N39A 4CGWA 4RG6A 4XI9A 4U07A 1HH8A 3MEKA 2FF4A 3AS5A 2ONDA 1FCHA 3UPVA 4I1AA 2QFCA 4WNDA 4A1SA 5HQ8A 2HO1A 3AS4A 5G05C 3E4BA 2WPVA 2Y4UA 4GCOA 3LYAA 1XNFA 4UI9C 2Q7FA 3RIBA 1NA0A 2VGXA 3RO3A 1IYGA 4Y6CA 4GYYA 1WM5A 3UUXA 1HXIA 4J8DA 5FZQA 2VQ2A 3JYSA
chains in the Genus database with same CATH superfamily
4JA9A 1X5BA 1NP7A 4DLOA 2MYOA 4K5BA 3ZGQA 3T5VA 1O1RA 3CKCA 2ZIRA 3FTVA 3PEVB 4AP2A 1OWOA 4CEMA 4IRUA 5G04J 2B6CA 2H6FA 3ISMC 4GTQA 3ZN3A 3SO8A 3C72A 3Q5MA 4QFVA 3Q15A 4HVBA 3EHMA 3R7QA 2KZTB 3CQCB 5ANRA 4V3IA 4NURA 1OCZE 3LJ3A 3LS8A 4XKCA 4WUYA 5KWDA 2IO2C 2BKKB 3BG0B 4U8VD 5T3RA 1N4PA 3DXMG 3HHMA 2LXMA 4U0SA 1N94A 3CR3A 3LVQE 1TNYA 2BF0X 4HRLA 4CT4A 2RFAA 2EILE 3RK6A 3L17A 3SBTB 3FWVA 4UWHA 2LO6A 2V4LA 2IONA 2FO7A 5LX8A 2Y4TA 2F8XK 1A5EA 5BW8C 2KCKA 2QC9A 2J07A 1YA0A 4DX6D 3FUHA 1H0AA 3T9KA 3UKUG 4G23A 1SA5A 2R2LA 3DPYA 1OWLA 2H6HA 3UIOC 5T8IA 4I9CA 5KJLA 4WNFA 3FY4A 1DNPA 1G3NB 4C0EA 1TN8A 2R05A 1Q2ZA 1UG3A 3SFZA 3SF4A 5DIZA 1EF1C 3UKRG 4HB5A 3T8KA 4R7LA 4CDRA 4JXTA 4RQIA 3ZRHA 1WDYA 3TWRA 5KJMA 3DSVA 4UI9J 1N95A 1UOHA 4IYPA 3ASHA 2YNQA 5ANLA 2BUGA 1WG0A 4ACLA 4UQXA 4L2YA 2QY7A 3EJNA 3CHOA 4JZYA 1N9AA 4M3OA 3LDZA 5ARGA 2CFUA 4K03A 3ZW3A 1Z3YA 3V30A 4FC8A 3FHEA 1DC2A 2XZTG 3UM2A 3TAXA 3PREA 4LNUD 4DX5D 2CG3A 2EQXA 3DEPA 4GTSA 3J5QB 4URKA 3CVNA 4HI9A 4G25A 2EIME 3UM0A 4GYOA 1H19A 4BWRA 1AWCB 4EBAG 4WWNA 2XCBA 1IHBA 2DZOA 2BKGA 1K1BA 3NOGD 4L1BA 4JD2G 4KVOA 3S7JA 4KT6B 3ABME 2UWJG 4N3AA 4CDNA 4Q94A 2OEWA 4A1GA 2FBNA 5BXOA 5KJKA 4MKTA 3TJPA 1V54E 3D9KA 1TNBA 3OXFA 5CMYA 1N11A 2OOEA 5FWQA 1RW2A 2X6KA 2LAIA 2Y0BG 1UJKA 2IU1A 4YDOA 5FQ4A 1N4RA 4I2ZA 4HLLA 3ZYLA 4HOUA 2Y1LE 2P2CP 4XX5A 4BSZB 1PY1A 3HG0D 3SZ7A 3MGBA 4BX8A 3HXBA 3RAUA 4BX9A 3CHMA 2H6IA 3KEAA 4BEPA 4NRHB 3VLDA 3RKVA 2GRMA 3MA5A 1A17A 3MCXA 2I9CA 5AJLA 2WXKA 4Z68A 2L6JA 4Q69A 3ZIMA 1OY3D 4KVMA 3I5PA 1TN7A 4BT9A 4DX7D 2XEHA 3LJNA 3CGHA 3PE3A 4JC8A 3ESLA 2E2EA 3URZA 3W9GA 4G1TA 3FUFA 2LAHA 4I43A 4JA7A 3IXEA 2WXHA 3D9MA 2CHXA 4GZCA 3CVQA 2VGEA 4JW1A 1E7UA 4B8AA 3RRUA 2R5SA 3QOUA 5EIDA 4G11A 1DVPA 1N52A 2YINA 4J8FA 3L08A 4OYSA 4GTPA 3NF1A 4CGVA 3ZHEA 4ME2A 1NFIE 2JABA 5LCWC 3D9PA 1HS6A 2GRPB 1S0PA 1Y6IA 5AQAA 2P9PG 4ZFHA 4DI4A 4FHKA 3LY9A 3APFA 4N39A 4CGWA 1NL4A 3CSTA 2FF4A 3AS5A 1H2VC 2WXGA 4I1AA 4WNDA 4A1SA 1HF8A 4GMRA 2HO1A 2H6GA 4WAFA 2I1JA 4RVBA 2Y4UA 1E8XA 5AJDA 5EDSA 3UM3A 1IYGA 3Q78A 1BI8B 4GYYA 4HXIA 3SHFA 2WXIA 4DX2A 2VQ2A 3ZKJA 2J4BA 3JYSA 5JA4D 3ASNE 5CCMA 4I6EA 3GZSA 1LD7A 4ATGA 1FVHA 1BU9A 4XIFA 1JPLA 4JL0A 5BV0A 3WXXA 2DIWA 4B94A 3FU5A 5D66A 1MJ0A 5J08A 5FQ6A 1KLXA 2VTBB 5DBKA 3LY8A 4KXKB 5BNWA 3CEQA 3Q9NC 5EYPF 5AQBA 5LP0A 4I6GA 4APOA 2CHZA 4BTBA 3FUEA 5D0QD 3FUKA 4BY6A 1TJFA 3QWWA 3ZHEB 2P9UG 1N4SA 3PNTB 3HXCA 4K5CA 3DSUA 4DX1A 3FTYA 2WVIA 1JUQA 3EIQC 2OVFA 4EHMA 1K3ZD 4N3BA 5FINA 3L82A 4W9RA 1B89A 1ZU2A 4A3TA 3MKRA 1HZ4A 4J0UA 4GZ3A 1H6PA 2L6BA 4J8EA 4AV7A 2HYZA 3DBSA 5D0OD 1ELWA 2GRLA 3ZUVB 1E90A 1IXVA 4N2SA 3PH0C 4BFRA 4A63B 5LOZA 4WNGA 4N3CA 1BLXB 2DBAA 2P58C 2GRQB 3EHQA 2XEEA 5ENOD 3MV3B 4B93B 3JUEA 2OV8A 3UMVA 1Z3XA 1HU3A 2WXNA 4LRZA 3PUJA 4I9EA 2BTDA 3KD7A 3BUAA 3B7UX 5EN5D 3PVLA 3Q79A 3T5XA 2AJAA 2PL2A 4N5CA 2WMOA 2X3MA 2XPZA 2NSZA 5G55A 3QWPA 4WWPA 5HI7A 4HRNA 4XZ4A 5ENNA 3DSXA 3HXFA 3HIZA 3RJVA 1E96B 4U8HA 2V0PA 3B13A 2XHEA 3PEUB 3U64A 3FUNA 2NYJA 2YQ8A 1Y8MA 4K0RA 5AIJA 4FLBA 3DSWA 1IKND 4HQDA 2ZGDA 4HOSA 3FP3A 3BQOA 4J8YA 3O48A 3LEWA 5FQ8A 2PZIA 3JQ0A 1E8ZA 3UINC 2CG2A 3QDNA 3TL5A 3Q4AB 2YHCA 4TRQA 3I3NA 5AQ9A 3NBNB 3GYZA 1TR4A 4XEIG 3AU4A 4JHRA 1VDYA 4EZLA 2Y69E 3T8MA 2ETAA 1JWGA 5T4YA 3PRZA 1KT0A 4JEUA 2GRRB 1IQRA 2IO3C 4AM9A 3SQVA 1UW4B 5B3SE 4LERA 2KATA 4NIKA 4OAVB 1D8DA 2DCPA 2PQRA 4HORA 2RKKA 5H7PA 3J5PA 3V2XA 2CFZA 2JLBA 1D8EA 3UT8A 1JCQA 5FZRA 3UT7A 5BPPA 4AY5A 5B1BE 4FADA 4IN3B 4J6IA 3W9FA 3AG3E 4YNDA 1P5QA 4HOQA 3CQGB 2F8YA 3KSQA 5CHEE 3FH7A 1UN9A 3CK7A 3LPZA 2WXOA 4UI9K 1JCSA 2F37A 2V5FA 3L9TA 5AQ7A 3LY7A 2LNIA 4HFGA 3X2QE 2OCCE 5BV1A 5AN8A 2R02A 5FIOA 2LUHA 3KAEA 4ACKA 3SI5A 5KNHD 1FT1A 1GW6A 1S70B 3VLFA 3ABLE 5CEAA 4BESA 5FTPA 2GW1A 2AWIA 3FDHA 4GMLA 4JB8P 2JEKA 1TNUA 3TWTA 4EPZA 5ENPD 4GMJA 4AJWA 2LSUA 4HI8A 5CCLA 5FZSA 3SD5A 4L9PA 2IFUA 3IHVA 1O5MA 2VYIA 2WXMA 5EKQD 4DK5A 5J90A 4GPMA 4U04A 4FU3A 2ZXWE 2I2OA 1MHQA 2J9QA 2XS1A 2V5QC 3AG2E 5ARFA 2XPYA 4GTTA 4AEZC 2I6HA 2XPIA 3ZYQA 3FTUA 1H6KA 3FUDA 5CBNA 3MKQA 5EX0A 2EINE 4RG6A 3APCA 4GTRA 4XI9A 4U07A 1HH8A 2HM8A 3PNLB 3UPVA 3KSLA 3TWWA 3V79K 4N5QA 1ZB1A 2F0YA 3C3QA 1EYHA 2WB2A 3Q9UC 5G05C 2WPVA 3G2WA 3LYAA 3EU9A 4UWFA 2Q7FA 5JHAA 3D3MA 3ULYA 3L22A 2VGXA 4GTOA 3RO3A 1SZAA 3FTWA 4L2LA 4Y6CA 1WM5A 3UUXA 1TNOA 3B7RL 2RD0A 3SY2A 2NXPA 2VSXE 5CECB 3CVXA 4UWKA 2X6IA 5LFAA 3B7BA 2XQ0A 4HNAD 1UN8A 4M7CA 3NZSA 4CT0A 2WXLA 3MYVA 4RSYA 4YVOA 2P9LG 1BI7B 4BETA 3CLJA 4BSXA 4PDXA 3U4TA 1QZ2A 4CDMA 3TG4A 4TV3A 2ILRA 3ML8A 4U63A 3FH5A 2FI7A 1ELRA 1MYOA 2WQ7A 2WXPA 3SGHA 3D9NA 1MQSA 4UWLA 3ML9A 4WNEA 3NQPA 1QNFA 4I1MA 5AYWD 3GZ1A 1O1SA 1IHGA 2V8SE 5HS0A 3DSSA 3QC1A 1TEZA 4U7EB 3TG5A 3PS6A 3RSEG 3CK8A 4KBQA 4FJYA 3ULEG 4FJZA 1N0RA 1OUVA 4E6HA 4KMOA 3Q73A 4HBDA 2OVBA 1TNZA 4XI0A 1OT8A 2P9KG 4I17A 3IBEA 4O6FA 3TWXA 2IQCA 4JHJA 3JCKC 3QKYA 3ZYMA 4YDWA 3UI2A 3RRMB 1MZCA 3HXEA 2VGXB 3L16A 3ONLA 3P2BA 4CRWA 2VSOE 2VGYA 1EPUA 4DLQA 3CVPA 3U9WA 3ZU7B 2EIJE 3MJWA 1HG2A 1H6OA 4HOTA 3CVLA 5EILA 3EHNA 3PZ4A 3CHRA 1SVXA 3AG1E 4I1OB 2PM6A 4FP7A 4KZCA 3V31A 5G04C 5JJ7A 1OCRE 3NZUA 2PQNA 3TXNA 4TUMA 2C0LA 3CVVA 4BERA 1U3DA 3L13A 4PS7A 4O1PA 1QBQA 3RO2A 2GROB 2AVPA 2XRYA 1YMPA 1Z6TA 5ENSD 4C9BB 4U8YD 4DRXE 4ILHB 3FFLA 4PUCA 2M63A 5B1AE 3CHQA 5A6CA 2XGMA 4IULA 2Y3AA 4ANVA 2E0IA 2AW6A 2J08A 4CYMD 1BPOA 4X8QA 1LD8A 4I6JA 3VLEA 3DSTA 4A3VA 4LSZE 2L0IA 2A5EA 4TUUA 2PNNA 1ELKA 1U3CA 3BU8A 3QB2A 4GPKA 2QYUA 4EBAA 3TWUA 4Q96A 3SFXA 4AIFA 2MRIA 5FQ7A 3U3WA 3UT4A 4MBGA 1FT2A 2FO1E 1V55E 2KCVA 3OXGA 1OXJA 1MX4A 4I2WA 1FPPA 4GA0A 5A23A 3VTYA 3IEGA 3ULQA 3JQ1A 3AS8A 3CKBA 3D9LA 5ENTD 2XCCA 5BT1A 2IY0C 1E8YA 5LCWJ 1YCSB 4EZKA 5KJNA 3ZVVA 4F3VA 4XE0A 2XGSA 4AXHA 4XKBA 3F6QA 4F53A 3FUJA 2A5UA 5G2NA 2KC7A 2IF4A 1LF8A 3FTZA 2R03A 3G2UA 3ASDA 3BG1B 3PE4A 5AARA 1X81A 1E7VA 1OCCE 3QJZA 2YHEA 3AU5A 3AG4E 2DYRE 1NI1A 3QNKA 2ZU6B 3S7DA 2I1KA 3NOCD 5JHBA 1NZNA 3E32A 3FU3A 4YDYA 2XGOA 5AENA 3FULA 4DPRA 5JJ6A 3IKOB 4LNBA 3ZFWA 5CERB 4WWOA 5HRYA 2XRZA 2J4DA 3LVRE 3ZPJA 3ZYKA 2WXJA 3CVWA 3WG7E 4L7TA 3HDXA 3PZ1A 3SNXA 4GA2A 3ZNGA 3B95A 3OXLA 5CEDB 2NC9A 3GZ2A 4PH4B 4GTMA 3TGOA 1KPSB 2P9SG 2DYSE 1BD8A 3TWVA 3V2OA 2X6JA 2KBXA 4LCTA 3ZXPA 4RG9A 3E33A 2EIKE 5ENQD 3LCAA 3HVEA 3ASOE 2ETCA 3EIJA 2KM4A 3R7RA 4NACA 2X6FA 1SA4A 4FLHA 3C98A 4KYOB 3CVUA 3GW4A 4DJAA 3PDNA 1KZPA 5KBAA 3QAQA 2ONDA 2ETBA 4LNGA 5E76A 1LTXA 4HLEA 2QFCA 1KZOA 2VJ8A 4KZ0A 3AS4A 3L54A 3NAWA 4OVUA 4G8LA 4GCOA 3E30A 1XNFA 5HKPA 4ILGA 2AXVA 2J09A 2IJGX 3ABKE 1SQMA 3G2TA 3PUKA 4OAUC 4F1PA 3R9MA 2R17C 1HXIA 4LG6A 3SFYA 4DUIA 4J8DA 4PS8A 5FZQA 3TXMA 1HFAA 3ASFA 3D9IA 4PS3A 3P1UA 2C0MA 4YVQC 1NA3A 1TN6A 4B8CB 4ANXA 1DCEA 4A55A 4D10C 1SW6A 3IV0A 2XS8A 4GZ6A 1L5JA 1TYQG 2KXPC 1JCRA 3FUMA 2FULA 4UQYA 3ZXSA 4K5AB 3RRNB 1KT1A 3B7SA 4GU5A 1PAQA 1N0QA 5FJYA 2IEJA 4C0MA 3AAAC 1TJCA 4GB9A 3Q75A 3DRAA 3ESKA 3EDTB 5M72A 3TWSA 3I4RB 2HE0A 4ANWA 2RFMA 4YDEA 3B7TA 4CCAA 4BTAA 2LSVA 3KEZA 3S2AA 4BT8A 4H7YA 4G26A 4DI3A 3HVEB 2GGFA 3FTSA 1UJJA 3G2VA 3PZDA 3TWQA 3UIPC 2R59A 4L23A 4GA1A 4ZHBA 3DEOA 2OEVA 1O1TA 4QQIA 5BUZA 3CVYA 1PC2A 1WY6A 4JPSA 3JXIA 4AVXA 2IOLA 3FH8A 4U0UA 2HR2A 3LXUX 4FULA 3I4GA 4MRUA 1XGWA 3UTMA 3CV0A 3D9OA 3ENEA 3OAWA 3PZ2A 3UX4A 4E85A 4O60A 4TXQA 3ASGA 3DXKG 3AJIA 2QYJA 5EYLA 1E8WA 3U66A 2C2LA 3Q7FA 1HX8A 5CMWA 2MOWA 2WMNA 1W3BA 2J8SD 3CIAA 1H2UA 5C2YA 2L0TB 3HYMB 4FA6A 4UQZA 3CHPA 3LKUA 4N2QA 2DZNA 4LEUA 4GZ5A 5CRUA 3FTXA 2P9NG 3APDA 3R9AB 3D9JA 2RG8A 3MZLB 4GAAA 4G2VA 3PZ3A 1YYHA 2IOSA 5E75A 5ENRD 3E34A 2X6HA 4HRMB 5KNGA 4EZJA 4UUCA 4F7AA 5C1DA 2XENA 3FUIA 5CRVA 3S7FA 3CSFA 5A7DB 3O4ZA 1OWNA 2CHWA 3HRAA 2VTBA 3QARA 4EECA 4G8KA 4FHJA 3UM1A 3JXJA 4J8SA 4GYWA 3C5RA 2KCLA 4UWGA 5JJTA 3MV2B 3OTNA 2UY1A 3Q7AA 4TXPA 2ZGGA 4EQFA 3MKQB 5AAOA 3EUVA 3CK9A 4GTVA 1HG5A 2J49A 3C3RA 4JVSA 2LXLA 1INZA 2XZDG 3ZEFA 1K1AA 4CZ2D 2WQHA 1ZBPA 3N71A 1IQUA 1H2TC 1S63A 1EDUA 4APFA 3FU6A 5D2MC 3Q47B 1OWMA 2MHKA 3QK0A 2AXZA 4B89A 3D9HA 4F1SA 3MX3A 1WAO1 2BEDA 5BXUA 1JWFA 5EIBE 4U0ZA 2GRNB 3C3OA 1OWPA 3K9IA 5G05J 3G2SA 5FT9A 1OCOE 3Q49B 4G24A 4LUNU 1N54A 1HO8A 3BEEA 2FEZA 2PM7A 3VTXA 3NB2A 3ONKA 4F6RD 2DVWA 3QWVA 4P29A 5EX3A 4C48B 1FVFA 2AXUA 5KCMA 1S64A 3IHYA 2L9BA 5CBOA 4AY6A 4AOFA 1DCQA 4RLYA 4JHKA 3E37A 2WQ6A 4U96D 1RZ4A 3CHSA 4GZDA 4J7WA 4ABNA 1SZ9A 4MLPA 2WXRA 2WXFA 3EHRA 2WXQA 1AP7A 4Y6WA 4GCNA 2KZTA 3S7BA 5JMND 3EU5A 2P9IG 3FU0A 2ZISA 4ATZD 1HE8A 3FEXA 2UY1B 4HS2A 2XEVA 1N4QA 4H7XA 3UQ3A 4U95D 1Z5SC 2VSYA 4NQ0A 1QYMA 2B0OE 1MX2A 5ITZF 1QQEA 2WM9A 3KS2A 3RU0A 3FEYA 3JUIA 1U2VG 3HXDA 4MS6A 2VSNA 3MEKA 2DWZA 1FCHA 3DPDA 2V4HC 5HQ8A 1MX6A 3E4BA 1D9SA 3L6AA 4JEHA 4OVVA 4UI9C 2X38A 4ANUA 1K8KG 2A4ZA 3DWLG 4TXRA 3RIBA 1NA0A 3UXGA 4O1OA 3SBSA 4ILIA 4B0ZA 5IY5E 2QZAA
chains in the Genus database with same CATH topology
4JA9A 1X5BA 2NXPA 1HFAA 3ASFA 3D9IA 2VSXE 3CVXA 1NP7A 5CCMA 4PS3A 3P1UA 2C0MA 4DLOA 4YVQC 4I6EA 1NA3A 3GZSA 3ZGQA 3T5VA 4ATGA 4UWKA 2X6IA 1FVHA 4B8CB 5LFAA 3CKCA 4ANXA 2XQ0A 4XIFA 1UN8A 4A55A 1JPLA 4D10C 3FTVA 3NZSA 3PEVB 4JL0A 4CT0A 2WXLA 4AP2A 3MYVA 3IV0A 4RSYA 1OWOA 1L5JA 2DIWA 4GZ6A 4YVOA 3WXXA 4IRUA 4B94A 4CEMA 3FU5A 5BV0A 3CLJA 3FUMA 2FULA 4BSXA 4PDXA 4UQYA 5G04J 3U4TA 3ZXSA 5J08A 3RRNB 3ZN3A 1KT1A 3B7SA 1QZ2A 4CDMA 4GU5A 5FQ6A 1KLXA 3Q5MA 3TG4A 2VTBB 1PAQA 4TV3A 2ILRA 5DBKA 4QFVA 3LY8A 5FJYA 4C0MA 3Q15A 4HVBA 1TJCA 3EHMA 4GB9A 3R7QA 2KZTB 3CQCB 5ANRA 3ESKA 3EDTB 4KXKB 5M72A 4V3IA 5BNWA 4NURA 3CEQA 3LJ3A 3I4RB 3ML8A 4ANWA 3LS8A 4U63A 5LP0A 4XKCA 3FH5A 4I6GA 4APOA 2CHZA 4WUYA 4BTBA 3B7TA 2FI7A 3BG0B 3FUEA 5D0QD 4CCAA 3FUKA 1ELRA 5T3RA 4BTAA 2LSVA 3KEZA 2WQ7A 2WXPA 3HHMA 4U0SA 3SGHA 1TJFA 3D9NA 3QWWA 4BY6A 1MQSA 4UWLA 3S2AA 3ZHEB 3CR3A 3LVQE 3ML9A 4BT8A 4H7YA 4G26A 4DI3A 4WNEA 2BF0X 3HVEB 3NQPA 2GGFA 3PNTB 1QNFA 4I1MA 5AYWD 3FTSA 3GZ1A 4CT4A 1UJJA 3G2VA 3PZDA 3FTYA 1IHGA 2R59A 2V8SE 2WVIA 4L23A 4GA1A 1JUQA 3QC1A 3RK6A 3EIQC 2OVFA 3L17A 1TEZA 4N3BA 3TG5A 3PS6A 3SBTB 3CK8A 3FWVA 4KBQA 4UWHA 2LO6A 4FJYA 5BUZA 3CVYA 2V4LA 1B89A 1ZU2A 4W9RA 4A3TA 4FJZA 2IONA 3MKRA 2FO7A 1PC2A 1HZ4A 4J0UA 1OUVA 4GZ3A 4E6HA 1WY6A 4KMOA 4JPSA 5LX8A 2Y4TA 4AVXA 4J8EA 4AV7A 2HYZA 3DBSA 2OVBA 4XI0A 5D0OD 1ELWA 2GRLA 2IOLA 3FH8A 4I17A 2HR2A 3LXUX 1E90A 2KCKA 4U0UA 3IBEA 4FULA 4O6FA 5BW8C 3I4GA 4N2SA 2IQCA 4JHJA 2J07A 1YA0A 4MRUA 3FUHA 1XGWA 3PH0C 1H0AA 4BFRA 3JCKC 3QKYA 4G23A 3ZYMA 3CV0A 3D9OA 3ENEA 3OAWA 5LOZA 4WNGA 4N3CA 3UX4A 4E85A 1OWLA 5T8IA 3RRMB 2DBAA 4I9CA 2P58C 2VGXB 3ASGA 3L16A 3ONLA 3P2BA 4CRWA 5KJLA 2VSOE 3FY4A 3MV3B 4WNFA 2OV8A 2VGYA 3UMVA 1DNPA 1EPUA 1Z3XA 1HU3A 2WXNA 1E8WA 4DLQA 3CVPA 4LRZA 3PUJA 2C2LA 4C0EA 4I9EA 3U66A 2BTDA 3U9WA 1HX8A 3KD7A 2MOWA 2WMNA 1W3BA 5CMWA 3B7UX 3CIAA 1H2UA 5C2YA 2L0TB 1UG3A 3HYMB 3MJWA 3SF4A 5DIZA 1HG2A 3SFZA 1EF1C 4UQZA 4HOTA 3PVLA 3T5XA 3CVLA 3CHPA 4R7LA 3EHNA 4CDRA 3CHRA 4JXTA 3LKUA 3ZRHA 4N2QA 2PL2A 4LEUA 4GZ5A 4I1OB 4N5CA 2WMOA 2PM6A 4FP7A 5KJMA 4KZCA 4UI9J 3FTXA 5G04C 5JJ7A 3APDA 2X3MA 2XPZA 2NSZA 3NZUA 2PQNA 3TXNA 4IYPA 5G55A 2C0LA 3QWPA 3D9JA 4WWPA 5HI7A 3ASHA 3R9AB 2RG8A 3CVVA 2YNQA 1U3DA 4XZ4A 3MZLB 5ANLA 2BUGA 3L13A 4PS7A 4GAAA 4ACLA 5ENNA 4UQXA 3HIZA 4G2VA 4L2YA 2QY7A 3EJNA 3CHOA 4JZYA 2IOSA 3RJVA 3RO2A 4M3OA 5E75A 3LDZA 1E96B 2XRYA 2AVPA 2CFUA 2V0PA 4U8HA 5ARGA 3B13A 1Z6TA 4K03A 3ZW3A 4C9BB 2XHEA 2X6HA 3PEUB 3U64A 3FUNA 4EZJA 4ILHB 4F7AA 1Z3YA 2YQ8A 3FFLA 1Y8MA 4PUCA 2M63A 4K0RA 5AIJA 5C1DA 4FLBA 3CHQA 3FUIA 5A6CA 2XGMA 4FC8A 3FHEA 4IULA 2Y3AA 4ANVA 4HOSA 3FP3A 2E0IA 3S7FA 3CSFA 3O48A 2AW6A 3TAXA 3PREA 2J08A 5A7DB 3LEWA 3O4ZA 1OWNA 2CHWA 1BPOA 5FQ8A 2CG3A 2PZIA 2VTBA 2EQXA 3JQ0A 4I6JA 3VLEA 3QARA 1E8ZA 4EECA 4FHJA 4A3VA 4URKA 2L0IA 3CVNA 4G25A 4J8SA 4GYWA 2CG2A 3QDNA 4TUUA 3TL5A 4GYOA 1H19A 4BWRA 2KCLA 4EBAG 4UWGA 4WWNA 1ELKA 5JJTA 3Q4AB 1U3CA 3MV2B 3OTNA 3QB2A 4GPKA 2YHCA 4TRQA 3I3NA 2XCBA 2UY1A 3GYZA 4EBAA 4EQFA 3MKQB 4Q96A 4AIFA 4L1BA 2MRIA 3AU4A 3CK9A 5FQ7A 3U3WA 4JHRA 1VDYA 1HG5A 2J49A 4JVSA 3UT4A 4EZLA 1INZA 4KVOA 3S7JA 1JWGA 4KT6B 5T4YA 3T8MA 2UWJG 3PRZA 1KT0A 4JEUA 2KCVA 3OXGA 3ZEFA 4N3AA 4CDNA 4Q94A 1IQRA 2WQHA 4AM9A 4A1GA 1ZBPA 4I2WA 1UW4B 4GA0A 3N71A 1IQUA 1H2TC 2FBNA 3IEGA 2KATA 4LERA 3ULQA 3VTYA 5A23A 1EDUA 3JQ1A 4APFA 2DCPA 3AS8A 3FU6A 5KJKA 3CKBA 3D9LA 3Q47B 2PQRA 4HORA 1OWMA 4MKTA 2XCCA 3TJPA 5BT1A 3D9KA 1E8YA 5LCWJ 2MHKA 3OXFA 4EZKA 5KJNA 3QK0A 5CMYA 3ZVVA 2CFZA 2JLBA 4F3VA 2AXZA 4B89A 3UT8A 4XE0A 5FZRA 3UT7A 2OOEA 4AY5A 2XGSA 4F1SA 5BPPA 5FWQA 3MX3A 4FADA 1WAO1 4AXHA 4IN3B 4J6IA 4XKBA 2X6KA 4F53A 1JWFA 2LAIA 1P5QA 3FUJA 4HOQA 4YNDA 1UJKA 4U0ZA 2A5UA 3CQGB 2IU1A 5CHEE 5G2NA 3FH7A 2KC7A 1UN9A 2IF4A 3CK7A 1LF8A 5FQ4A 3LPZA 2WXOA 4I2ZA 3ZYLA 3FTZA 4HOUA 4UI9K 4XX5A 3G2UA 1OWPA 1PY1A 3K9IA 5G05J 3SZ7A 2V5FA 3ASDA 3BG1B 3G2SA 3MGBA 4BX8A 5FT9A 3PE4A 3Q49B 1E7VA 3QJZA 2YHEA 1N54A 3AU5A 3CHMA 4G24A 4LUNU 4BX9A 1HO8A 3BEEA 3LY7A 2LNIA 3QNKA 4HFGA 2FEZA 2ZU6B 4NRHB 2I1KA 3S7DA 3RKVA 2GRMA 3VLDA 5BV1A 5JHBA 2PM7A 1NZNA 3VTXA 3ONKA 3FU3A 3MA5A 1A17A 2XGOA 3MCXA 3QWVA 4P29A 5EX3A 2I9CA 5AENA 3KAEA 3FULA 5AJLA 4ACKA 5JJ6A 3SI5A 4DPRA 2WXKA 1FVFA 2AXUA 3IKOB 5KCMA 3ZFWA 4WWOA 1GW6A 2L6JA 3VLFA 3IHYA 4Q69A 2L9BA 3ZIMA 4AY6A 4AOFA 2XRZA 4KVMA 4JHKA 5FTPA 2J4DA 2WQ6A 2GW1A 3I5PA 3LVRE 2AWIA 3FDHA 3ZPJA 3ZYKA 2WXJA 4GMLA 3CHSA 4GZDA 4BT9A 2JEKA 3CVWA 4ABNA 3CGHA 1SZ9A 4L7TA 3PE3A 4MLPA 2WXRA 4JC8A 2WXFA 3ESLA 2E2EA 3HDXA 3SNXA 3URZA 4EPZA 4GA2A 3OXLA 4GMJA 4G1TA 4AJWA 3FUFA 2LAHA 2LSUA 4I43A 2WXQA 4JA7A 5CCLA 2NC9A 5FZSA 4Y6WA 3GZ2A 4PH4B 2WXHA 4GCNA 3SD5A 3D9MA 2KZTA 2CHXA 3S7BA 2IFUA 4GZCA 3IHVA 3CVQA 4JW1A 3TGOA 1E7UA 4B8AA 2VYIA 3FU0A 2WXMA 5EKQD 3RRUA 4DK5A 5J90A 1HE8A 2R5SA 3FEXA 3QOUA 2UY1B 4HS2A 2XEVA 4U04A 2X6JA 4FU3A 4G11A 1DVPA 1N52A 2I2OA 2YINA 4H7XA 4J8FA 1MHQA 3UQ3A 4LCTA 2J9QA 4RG9A 3L08A 4OYSA 5ARFA 2VSYA 3NF1A 4CGVA 2XPYA 4NQ0A 3ZHEA 4ME2A 3LCAA 3HVEA 5LCWC 3D9PA 1QQEA 2I6HA 2XPIA 4AEZC 1HS6A 2KM4A 3EIJA 3R7RA 3ZYQA 4NACA 2WM9A 1S0PA 1Y6IA 2X6FA 3FTUA 4FLHA 1H6KA 3KS2A 3FUDA 3C98A 3FEYA 3JUIA 3MKQA 4KYOB 5EX0A 3RU0A 4DI4A 3CVUA 4FHKA 3LY9A 4MS6A 2VSNA 3GW4A 4DJAA 3PDNA 3APFA 4N39A 4CGWA 4RG6A 3QAQA 3APCA 3CSTA 4XI9A 4U07A 1HH8A 2HM8A 2FF4A 3AS5A 3MEKA 2ONDA 1H2VC 3PNLB 2WXGA 1FCHA 5E76A 3UPVA 4HLEA 4I1AA 3DPDA 2QFCA 4WNDA 4A1SA 1EYHA 1HF8A 5HQ8A 2WB2A 2HO1A 2VJ8A 4KZ0A 3AS4A 4WAFA 5G05C 3L54A 3E4BA 2WPVA 3G2WA 4OVUA 2I1JA 4RVBA 3L6AA 2Y4UA 4JEHA 1E8XA 4GCOA 4FA6A 3LYAA 5AJDA 1XNFA 4OVVA 4UI9C 2X38A 4UWFA 4ANUA 2Q7FA 4ILGA 2AXVA 5JHAA 2A4ZA 2J09A 2IJGX 3D3MA 5EDSA 3RIBA 1NA0A 1SQMA 3G2TA 2VGXA 3L22A 3PUKA 3SBSA 3RO3A 1SZAA 4ILIA 1IYGA 3FTWA 4L2LA 4Y6CA 4GYYA 1WM5A 4HXIA 2R17C 3SHFA 4B0ZA 2WXIA 3UUXA 1HXIA 4J8DA 4PS8A 5FZQA 2VQ2A 3B7RL 2J4BA 3JYSA 2RD0A 3TXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JA9 A;  3ASF A;  5CCM A;  2C0M A;  4YVQ C;  1NA3 A;  3ZGQ A;  3CKC A;  4XIF A;  4JL0 A;  4YVO A;  3WXX A;  4GZ6 A;  4B94 A;  4UQY A;  5G04 J;  3U4T A;  3ZN3 A;  1KT1 A;  1QZ2 A;  3TG4 A;  1KLX A;  3Q5M A;  5DBK A;  3LY8 A;  5FJY A;  3Q15 A;  1TJC A;  3ESK A;  3EDT B;  4KXK B;  5M72 A;  5BNW A;  3CEQ A;  4APO A;  4WUY A;  4BTB A;  2FI7 A;  5D0Q D;  1ELR A;  4BTA A;  2LSV A;  4U0S A;  3QWW A;  3ZHE B;  4BT8 A;  4H7Y A;  4G26 A;  4WNE A;  5AYW D;  3GZ1 A;  1IHG A;  4GA1 A;  4N3B A;  3TG5 A;  3CK8 A;  3FWV A;  4KBQ A;  4W9R A;  1B89 A;  1ZU2 A;  3MKR A;  2FO7 A;  1PC2 A;  1HZ4 A;  4J0U A;  1OUV A;  4GZ3 A;  2Y4T A;  4J8E A;  2HYZ A;  5D0O D;  4XI0 A;  1ELW A;  4I17 A;  4U0U A;  2HR2 A;  5BW8 C;  2KCK A;  4N2S A;  4O6F A;  1YA0 A;  4G23 A;  3QKY A;  3CV0 A;  4WNG A;  4N3C A;  2DBA A;  4I9C A;  2P58 C;  2VGX B;  3ASG A;  5KJL A;  3MV3 B;  4WNF A;  2VGY A;  3CVP A;  2C2L A;  4I9E A;  3KD7 A;  1W3B A;  3HYM B;  3SF4 A;  5DIZ A;  4UQZ A;  4HOT A;  3CVL A;  4CDR A;  3LKU A;  4N2Q A;  2PL2 A;  4LEU A;  4GZ5 A;  4N5C A;  5KJM A;  4UI9 J;  5G04 C;  5JJ7 A;  2PQN A;  2C0L A;  3QWP A;  5HI7 A;  3R9A B;  3ASH A;  2BUG A;  4UQX A;  4G2V A;  3RJV A;  3RO2 A;  5ARG A;  1E96 B;  2AVP A;  2YQ8 A;  3FFL A;  1Y8M A;  5C1D A;  5A6C A;  2XGM A;  4HOS A;  3FP3 A;  3S7F A;  3O48 A;  3TAX A;  5A7D B;  2PZI A;  3CVN A;  4G25 A;  4GYW A;  3QDN A;  4GYO A;  4BWR A;  2KCL A;  5JJT A;  3Q4A B;  3MV2 B;  4GPK A;  2YHC A;  2XCB A;  2UY1 A;  3GYZ A;  4EQF A;  4AIF A;  3CK9 A;  3U3W A;  4JHR A;  3S7J A;  2UWJ G;  1KT0 A;  2KCV A;  3OXG A;  4N3A A;  2WQH A;  4AM9 A;  1ZBP A;  4I2W A;  4GA0 A;  3N71 A;  2FBN A;  3IEG A;  2KAT A;  3ULQ A;  3VTY A;  3AS8 A;  5KJK A;  3CKB A;  3Q47 B;  2PQR A;  4HOR A;  2XCC A;  5BT1 A;  5LCW J;  2MHK A;  3OXF A;  5KJN A;  2JLB A;  4F3V A;  5FZR A;  2OOE A;  4AY5 A;  2XGS A;  1WAO 1;  4IN3 B;  4YND A;  1P5Q A;  4HOQ A;  4U0Z A;  5CHE E;  2KC7 A;  2IF4 A;  3CK7 A;  3LPZ A;  4I2Z A;  4HOU A;  4UI9 K;  3K9I A;  5G05 J;  3SZ7 A;  2V5F A;  3ASD A;  5FT9 A;  3PE4 A;  3Q49 B;  4G24 A;  3BEE A;  3LY7 A;  2LNI A;  2FEZ A;  4NRH B;  3S7D A;  3RKV A;  1NZN A;  3VTX A;  3MA5 A;  1A17 A;  2XGO A;  3QWV A;  5EX3 A;  3KAE A;  5JJ6 A;  3ZFW A;  2L6J A;  4AY6 A;  5FTP A;  2GW1 A;  3ZPJ A;  4BT9 A;  4ABN A;  3PE3 A;  2E2E A;  3URZ A;  4GA2 A;  3OXL A;  4G1T A;  2LSU A;  4JA7 A;  5CCL A;  2NC9 A;  5FZS A;  4Y6W A;  3GZ2 A;  4GCN A;  3S7B A;  2IFU A;  3CVQ A;  3TGO A;  2VYI A;  5EKQ D;  2R5S A;  3QOU A;  2UY1 B;  2XEV A;  4U04 A;  4H7X A;  4J8F A;  3UQ3 A;  2J9Q A;  4RG9 A;  5ARF A;  2VSY A;  3NF1 A;  4CGV A;  4NQ0 A;  3ZHE A;  4ME2 A;  3LCA A;  5LCW C;  1QQE A;  2I6H A;  2XPI A;  3KS2 A;  3RU0 A;  4KYO B;  5EX0 A;  3LY9 A;  2VSN A;  3GW4 A;  3PDN A;  4N39 A;  4CGW A;  4RG6 A;  4XI9 A;  4U07 A;  1HH8 A;  3MEK A;  2FF4 A;  3AS5 A;  2OND A;  1FCH A;  3UPV A;  4I1A A;  2QFC A;  4WND A;  4A1S A;  5HQ8 A;  2HO1 A;  3AS4 A;  5G05 C;  3E4B A;  2WPV A;  2Y4U A;  4GCO A;  3LYA A;  1XNF A;  4UI9 C;  2Q7F A;  3RIB A;  1NA0 A;  2VGX A;  3RO3 A;  1IYG A;  4Y6C A;  4GYY A;  1WM5 A;  3UUX A;  1HXI A;  4J8D A;  5FZQ A;  2VQ2 A;  3JYS A; 
#chains in the Genus database with same CATH topology
 4JA9 A;  1X5B A;  1NP7 A;  4DLO A;  2MYO A;  4K5B A;  3ZGQ A;  3T5V A;  1O1R A;  3CKC A;  2ZIR A;  3FTV A;  3PEV B;  4AP2 A;  1OWO A;  4CEM A;  4IRU A;  5G04 J;  2B6C A;  2H6F A;  3ISM C;  4GTQ A;  3ZN3 A;  3SO8 A;  3C72 A;  3Q5M A;  4QFV A;  3Q15 A;  4HVB A;  3EHM A;  3R7Q A;  2KZT B;  3CQC B;  5ANR A;  4V3I A;  4NUR A;  1OCZ E;  3LJ3 A;  3LS8 A;  4XKC A;  4WUY A;  5KWD A;  2IO2 C;  2BKK B;  3BG0 B;  4U8V D;  5T3R A;  1N4P A;  3DXM G;  3HHM A;  2LXM A;  4U0S A;  1N94 A;  3CR3 A;  3LVQ E;  1TNY A;  2BF0 X;  4HRL A;  4CT4 A;  2RFA A;  2EIL E;  3RK6 A;  3L17 A;  3SBT B;  3FWV A;  4UWH A;  2LO6 A;  2V4L A;  2ION A;  2FO7 A;  5LX8 A;  2Y4T A;  2F8X K;  1A5E A;  5BW8 C;  2KCK A;  2QC9 A;  2J07 A;  1YA0 A;  4DX6 D;  3FUH A;  1H0A A;  3T9K A;  3UKU G;  4G23 A;  1SA5 A;  2R2L A;  3DPY A;  1OWL A;  2H6H A;  3UIO C;  5T8I A;  4I9C A;  5KJL A;  4WNF A;  3FY4 A;  1DNP A;  1G3N B;  4C0E A;  1TN8 A;  2R05 A;  1Q2Z A;  1UG3 A;  3SFZ A;  3SF4 A;  5DIZ A;  1EF1 C;  3UKR G;  4HB5 A;  3T8K A;  4R7L A;  4CDR A;  4JXT A;  4RQI A;  3ZRH A;  1WDY A;  3TWR A;  5KJM A;  3DSV A;  4UI9 J;  1N95 A;  1UOH A;  4IYP A;  3ASH A;  2YNQ A;  5ANL A;  2BUG A;  1WG0 A;  4ACL A;  4UQX A;  4L2Y A;  2QY7 A;  3EJN A;  3CHO A;  4JZY A;  1N9A A;  4M3O A;  3LDZ A;  5ARG A;  2CFU A;  4K03 A;  3ZW3 A;  1Z3Y A;  3V30 A;  4FC8 A;  3FHE A;  1DC2 A;  2XZT G;  3UM2 A;  3TAX A;  3PRE A;  4LNU D;  4DX5 D;  2CG3 A;  2EQX A;  3DEP A;  4GTS A;  3J5Q B;  4URK A;  3CVN A;  4HI9 A;  4G25 A;  2EIM E;  3UM0 A;  4GYO A;  1H19 A;  4BWR A;  1AWC B;  4EBA G;  4WWN A;  2XCB A;  1IHB A;  2DZO A;  2BKG A;  1K1B A;  3NOG D;  4L1B A;  4JD2 G;  4KVO A;  3S7J A;  4KT6 B;  3ABM E;  2UWJ G;  4N3A A;  4CDN A;  4Q94 A;  2OEW A;  4A1G A;  2FBN A;  5BXO A;  5KJK A;  4MKT A;  3TJP A;  1V54 E;  3D9K A;  1TNB A;  3OXF A;  5CMY A;  1N11 A;  2OOE A;  5FWQ A;  1RW2 A;  2X6K A;  2LAI A;  2Y0B G;  1UJK A;  2IU1 A;  4YDO A;  5FQ4 A;  1N4R A;  4I2Z A;  4HLL A;  3ZYL A;  4HOU A;  2Y1L E;  2P2C P;  4XX5 A;  4BSZ B;  1PY1 A;  3HG0 D;  3SZ7 A;  3MGB A;  4BX8 A;  3HXB A;  3RAU A;  4BX9 A;  3CHM A;  2H6I A;  3KEA A;  4BEP A;  4NRH B;  3VLD A;  3RKV A;  2GRM A;  3MA5 A;  1A17 A;  3MCX A;  2I9C A;  5AJL A;  2WXK A;  4Z68 A;  2L6J A;  4Q69 A;  3ZIM A;  1OY3 D;  4KVM A;  3I5P A;  1TN7 A;  4BT9 A;  4DX7 D;  2XEH A;  3LJN A;  3CGH A;  3PE3 A;  4JC8 A;  3ESL A;  2E2E A;  3URZ A;  3W9G A;  4G1T A;  3FUF A;  2LAH A;  4I43 A;  4JA7 A;  3IXE A;  2WXH A;  3D9M A;  2CHX A;  4GZC A;  3CVQ A;  2VGE A;  4JW1 A;  1E7U A;  4B8A A;  3RRU A;  2R5S A;  3QOU A;  5EID A;  4G11 A;  1DVP A;  1N52 A;  2YIN A;  4J8F A;  3L08 A;  4OYS A;  4GTP A;  3NF1 A;  4CGV A;  3ZHE A;  4ME2 A;  1NFI E;  2JAB A;  5LCW C;  3D9P A;  1HS6 A;  2GRP B;  1S0P A;  1Y6I A;  5AQA A;  2P9P G;  4ZFH A;  4DI4 A;  4FHK A;  3LY9 A;  3APF A;  4N39 A;  4CGW A;  1NL4 A;  3CST A;  2FF4 A;  3AS5 A;  1H2V C;  2WXG A;  4I1A A;  4WND A;  4A1S A;  1HF8 A;  4GMR A;  2HO1 A;  2H6G A;  4WAF A;  2I1J A;  4RVB A;  2Y4U A;  1E8X A;  5AJD A;  5EDS A;  3UM3 A;  1IYG A;  3Q78 A;  1BI8 B;  4GYY A;  4HXI A;  3SHF A;  2WXI A;  4DX2 A;  2VQ2 A;  3ZKJ A;  2J4B A;  3JYS A;  5JA4 D;  3ASN E;  5CCM A;  4I6E A;  3GZS A;  1LD7 A;  4ATG A;  1FVH A;  1BU9 A;  4XIF A;  1JPL A;  4JL0 A;  5BV0 A;  3WXX A;  2DIW A;  4B94 A;  3FU5 A;  5D66 A;  1MJ0 A;  5J08 A;  5FQ6 A;  1KLX A;  2VTB B;  5DBK A;  3LY8 A;  4KXK B;  5BNW A;  3CEQ A;  3Q9N C;  5EYP F;  5AQB A;  5LP0 A;  4I6G A;  4APO A;  2CHZ A;  4BTB A;  3FUE A;  5D0Q D;  3FUK A;  4BY6 A;  1TJF A;  3QWW A;  3ZHE B;  2P9U G;  1N4S A;  3PNT B;  3HXC A;  4K5C A;  3DSU A;  4DX1 A;  3FTY A;  2WVI A;  1JUQ A;  3EIQ C;  2OVF A;  4EHM A;  1K3Z D;  4N3B A;  5FIN A;  3L82 A;  4W9R A;  1B89 A;  1ZU2 A;  4A3T A;  3MKR A;  1HZ4 A;  4J0U A;  4GZ3 A;  1H6P A;  2L6B A;  4J8E A;  4AV7 A;  2HYZ A;  3DBS A;  5D0O D;  1ELW A;  2GRL A;  3ZUV B;  1E90 A;  1IXV A;  4N2S A;  3PH0 C;  4BFR A;  4A63 B;  5LOZ A;  4WNG A;  4N3C A;  1BLX B;  2DBA A;  2P58 C;  2GRQ B;  3EHQ A;  2XEE A;  5ENO D;  3MV3 B;  4B93 B;  3JUE A;  2OV8 A;  3UMV A;  1Z3X A;  1HU3 A;  2WXN A;  4LRZ A;  3PUJ A;  4I9E A;  2BTD A;  3KD7 A;  3BUA A;  3B7U X;  5EN5 D;  3PVL A;  3Q79 A;  3T5X A;  2AJA A;  2PL2 A;  4N5C A;  2WMO A;  2X3M A;  2XPZ A;  2NSZ A;  5G55 A;  3QWP A;  4WWP A;  5HI7 A;  4HRN A;  4XZ4 A;  5ENN A;  3DSX A;  3HXF A;  3HIZ A;  3RJV A;  1E96 B;  4U8H A;  2V0P A;  3B13 A;  2XHE A;  3PEU B;  3U64 A;  3FUN A;  2NYJ A;  2YQ8 A;  1Y8M A;  4K0R A;  5AIJ A;  4FLB A;  3DSW A;  1IKN D;  4HQD A;  2ZGD A;  4HOS A;  3FP3 A;  3BQO A;  4J8Y A;  3O48 A;  3LEW A;  5FQ8 A;  2PZI A;  3JQ0 A;  1E8Z A;  3UIN C;  2CG2 A;  3QDN A;  3TL5 A;  3Q4A B;  2YHC A;  4TRQ A;  3I3N A;  5AQ9 A;  3NBN B;  3GYZ A;  1TR4 A;  4XEI G;  3AU4 A;  4JHR A;  1VDY A;  4EZL A;  2Y69 E;  3T8M A;  2ETA A;  1JWG A;  5T4Y A;  3PRZ A;  1KT0 A;  4JEU A;  2GRR B;  1IQR A;  2IO3 C;  4AM9 A;  3SQV A;  1UW4 B;  5B3S E;  4LER A;  2KAT A;  4NIK A;  4OAV B;  1D8D A;  2DCP A;  2PQR A;  4HOR A;  2RKK A;  5H7P A;  3J5P A;  3V2X A;  2CFZ A;  2JLB A;  1D8E A;  3UT8 A;  1JCQ A;  5FZR A;  3UT7 A;  5BPP A;  4AY5 A;  5B1B E;  4FAD A;  4IN3 B;  4J6I A;  3W9F A;  3AG3 E;  4YND A;  1P5Q A;  4HOQ A;  3CQG B;  2F8Y A;  3KSQ A;  5CHE E;  3FH7 A;  1UN9 A;  3CK7 A;  3LPZ A;  2WXO A;  4UI9 K;  1JCS A;  2F37 A;  2V5F A;  3L9T A;  5AQ7 A;  3LY7 A;  2LNI A;  4HFG A;  3X2Q E;  2OCC E;  5BV1 A;  5AN8 A;  2R02 A;  5FIO A;  2LUH A;  3KAE A;  4ACK A;  3SI5 A;  5KNH D;  1FT1 A;  1GW6 A;  1S70 B;  3VLF A;  3ABL E;  5CEA A;  4BES A;  5FTP A;  2GW1 A;  2AWI A;  3FDH A;  4GML A;  4JB8 P;  2JEK A;  1TNU A;  3TWT A;  4EPZ A;  5ENP D;  4GMJ A;  4AJW A;  2LSU A;  4HI8 A;  5CCL A;  5FZS A;  3SD5 A;  4L9P A;  2IFU A;  3IHV A;  1O5M A;  2VYI A;  2WXM A;  5EKQ D;  4DK5 A;  5J90 A;  4GPM A;  4U04 A;  4FU3 A;  2ZXW E;  2I2O A;  1MHQ A;  2J9Q A;  2XS1 A;  2V5Q C;  3AG2 E;  5ARF A;  2XPY A;  4GTT A;  4AEZ C;  2I6H A;  2XPI A;  3ZYQ A;  3FTU A;  1H6K A;  3FUD A;  5CBN A;  3MKQ A;  5EX0 A;  2EIN E;  4RG6 A;  3APC A;  4GTR A;  4XI9 A;  4U07 A;  1HH8 A;  2HM8 A;  3PNL B;  3UPV A;  3KSL A;  3TWW A;  3V79 K;  4N5Q A;  1ZB1 A;  2F0Y A;  3C3Q A;  1EYH A;  2WB2 A;  3Q9U C;  5G05 C;  2WPV A;  3G2W A;  3LYA A;  3EU9 A;  4UWF A;  2Q7F A;  5JHA A;  3D3M A;  3ULY A;  3L22 A;  2VGX A;  4GTO A;  3RO3 A;  1SZA A;  3FTW A;  4L2L A;  4Y6C A;  1WM5 A;  3UUX A;  1TNO A;  3B7R L;  2RD0 A;  3SY2 A;  2NXP A;  2VSX E;  5CEC B;  3CVX A;  4UWK A;  2X6I A;  5LFA A;  3B7B A;  2XQ0 A;  4HNA D;  1UN8 A;  4M7C A;  3NZS A;  4CT0 A;  2WXL A;  3MYV A;  4RSY A;  4YVO A;  2P9L G;  1BI7 B;  4BET A;  3CLJ A;  4BSX A;  4PDX A;  3U4T A;  1QZ2 A;  4CDM A;  3TG4 A;  4TV3 A;  2ILR A;  3ML8 A;  4U63 A;  3FH5 A;  2FI7 A;  1ELR A;  1MYO A;  2WQ7 A;  2WXP A;  3SGH A;  3D9N A;  1MQS A;  4UWL A;  3ML9 A;  4WNE A;  3NQP A;  1QNF A;  4I1M A;  5AYW D;  3GZ1 A;  1O1S A;  1IHG A;  2V8S E;  5HS0 A;  3DSS A;  3QC1 A;  1TEZ A;  4U7E B;  3TG5 A;  3PS6 A;  3RSE G;  3CK8 A;  4KBQ A;  4FJY A;  3ULE G;  4FJZ A;  1N0R A;  1OUV A;  4E6H A;  4KMO A;  3Q73 A;  4HBD A;  2OVB A;  1TNZ A;  4XI0 A;  1OT8 A;  2P9K G;  4I17 A;  3IBE A;  4O6F A;  3TWX A;  2IQC A;  4JHJ A;  3JCK C;  3QKY A;  3ZYM A;  4YDW A;  3UI2 A;  3RRM B;  1MZC A;  3HXE A;  2VGX B;  3L16 A;  3ONL A;  3P2B A;  4CRW A;  2VSO E;  2VGY A;  1EPU A;  4DLQ A;  3CVP A;  3U9W A;  3ZU7 B;  2EIJ E;  3MJW A;  1HG2 A;  1H6O A;  4HOT A;  3CVL A;  5EIL A;  3EHN A;  3PZ4 A;  3CHR A;  1SVX A;  3AG1 E;  4I1O B;  2PM6 A;  4FP7 A;  4KZC A;  3V31 A;  5G04 C;  5JJ7 A;  1OCR E;  3NZU A;  2PQN A;  3TXN A;  4TUM A;  2C0L A;  3CVV A;  4BER A;  1U3D A;  3L13 A;  4PS7 A;  4O1P A;  1QBQ A;  3RO2 A;  2GRO B;  2AVP A;  2XRY A;  1YMP A;  1Z6T A;  5ENS D;  4C9B B;  4U8Y D;  4DRX E;  4ILH B;  3FFL A;  4PUC A;  2M63 A;  5B1A E;  3CHQ A;  5A6C A;  2XGM A;  4IUL A;  2Y3A A;  4ANV A;  2E0I A;  2AW6 A;  2J08 A;  4CYM D;  1BPO A;  4X8Q A;  1LD8 A;  4I6J A;  3VLE A;  3DST A;  4A3V A;  4LSZ E;  2L0I A;  2A5E A;  4TUU A;  2PNN A;  1ELK A;  1U3C A;  3BU8 A;  3QB2 A;  4GPK A;  2QYU A;  4EBA A;  3TWU A;  4Q96 A;  3SFX A;  4AIF A;  2MRI A;  5FQ7 A;  3U3W A;  3UT4 A;  4MBG A;  1FT2 A;  2FO1 E;  1V55 E;  2KCV A;  3OXG A;  1OXJ A;  1MX4 A;  4I2W A;  1FPP A;  4GA0 A;  5A23 A;  3VTY A;  3IEG A;  3ULQ A;  3JQ1 A;  3AS8 A;  3CKB A;  3D9L A;  5ENT D;  2XCC A;  5BT1 A;  2IY0 C;  1E8Y A;  5LCW J;  1YCS B;  4EZK A;  5KJN A;  3ZVV A;  4F3V A;  4XE0 A;  2XGS A;  4AXH A;  4XKB A;  3F6Q A;  4F53 A;  3FUJ A;  2A5U A;  5G2N A;  2KC7 A;  2IF4 A;  1LF8 A;  3FTZ A;  2R03 A;  3G2U A;  3ASD A;  3BG1 B;  3PE4 A;  5AAR A;  1X81 A;  1E7V A;  1OCC E;  3QJZ A;  2YHE A;  3AU5 A;  3AG4 E;  2DYR E;  1NI1 A;  3QNK A;  2ZU6 B;  3S7D A;  2I1K A;  3NOC D;  5JHB A;  1NZN A;  3E32 A;  3FU3 A;  4YDY A;  2XGO A;  5AEN A;  3FUL A;  4DPR A;  5JJ6 A;  3IKO B;  4LNB A;  3ZFW A;  5CER B;  4WWO A;  5HRY A;  2XRZ A;  2J4D A;  3LVR E;  3ZPJ A;  3ZYK A;  2WXJ A;  3CVW A;  3WG7 E;  4L7T A;  3HDX A;  3PZ1 A;  3SNX A;  4GA2 A;  3ZNG A;  3B95 A;  3OXL A;  5CED B;  2NC9 A;  3GZ2 A;  4PH4 B;  4GTM A;  3TGO A;  1KPS B;  2P9S G;  2DYS E;  1BD8 A;  3TWV A;  3V2O A;  2X6J A;  2KBX A;  4LCT A;  3ZXP A;  4RG9 A;  3E33 A;  2EIK E;  5ENQ D;  3LCA A;  3HVE A;  3ASO E;  2ETC A;  3EIJ A;  2KM4 A;  3R7R A;  4NAC A;  2X6F A;  1SA4 A;  4FLH A;  3C98 A;  4KYO B;  3CVU A;  3GW4 A;  4DJA A;  3PDN A;  1KZP A;  5KBA A;  3QAQ A;  2OND A;  2ETB A;  4LNG A;  5E76 A;  1LTX A;  4HLE A;  2QFC A;  1KZO A;  2VJ8 A;  4KZ0 A;  3AS4 A;  3L54 A;  3NAW A;  4OVU A;  4G8L A;  4GCO A;  3E30 A;  1XNF A;  5HKP A;  4ILG A;  2AXV A;  2J09 A;  2IJG X;  3ABK E;  1SQM A;  3G2T A;  3PUK A;  4OAU C;  4F1P A;  3R9M A;  2R17 C;  1HXI A;  4LG6 A;  3SFY A;  4DUI A;  4J8D A;  4PS8 A;  5FZQ A;  3TXM A;  1HFA A;  3ASF A;  3D9I A;  4PS3 A;  3P1U A;  2C0M A;  4YVQ C;  1NA3 A;  1TN6 A;  4B8C B;  4ANX A;  1DCE A;  4A55 A;  4D10 C;  1SW6 A;  3IV0 A;  2XS8 A;  4GZ6 A;  1L5J A;  1TYQ G;  2KXP C;  1JCR A;  3FUM A;  2FUL A;  4UQY A;  3ZXS A;  4K5A B;  3RRN B;  1KT1 A;  3B7S A;  4GU5 A;  1PAQ A;  1N0Q A;  5FJY A;  2IEJ A;  4C0M A;  3AAA C;  1TJC A;  4GB9 A;  3Q75 A;  3DRA A;  3ESK A;  3EDT B;  5M72 A;  3TWS A;  3I4R B;  2HE0 A;  4ANW A;  2RFM A;  4YDE A;  3B7T A;  4CCA A;  4BTA A;  2LSV A;  3KEZ A;  3S2A A;  4BT8 A;  4H7Y A;  4G26 A;  4DI3 A;  3HVE B;  2GGF A;  3FTS A;  1UJJ A;  3G2V A;  3PZD A;  3TWQ A;  3UIP C;  2R59 A;  4L23 A;  4GA1 A;  4ZHB A;  3DEO A;  2OEV A;  1O1T A;  4QQI A;  5BUZ A;  3CVY A;  1PC2 A;  1WY6 A;  4JPS A;  3JXI A;  4AVX A;  2IOL A;  3FH8 A;  4U0U A;  2HR2 A;  3LXU X;  4FUL A;  3I4G A;  4MRU A;  1XGW A;  3UTM A;  3CV0 A;  3D9O A;  3ENE A;  3OAW A;  3PZ2 A;  3UX4 A;  4E85 A;  4O60 A;  4TXQ A;  3ASG A;  3DXK G;  3AJI A;  2QYJ A;  5EYL A;  1E8W A;  3U66 A;  2C2L A;  3Q7F A;  1HX8 A;  5CMW A;  2MOW A;  2WMN A;  1W3B A;  2J8S D;  3CIA A;  1H2U A;  5C2Y A;  2L0T B;  3HYM B;  4FA6 A;  4UQZ A;  3CHP A;  3LKU A;  4N2Q A;  2DZN A;  4LEU A;  4GZ5 A;  5CRU A;  3FTX A;  2P9N G;  3APD A;  3R9A B;  3D9J A;  2RG8 A;  3MZL B;  4GAA A;  4G2V A;  3PZ3 A;  1YYH A;  2IOS A;  5E75 A;  5ENR D;  3E34 A;  2X6H A;  4HRM B;  5KNG A;  4EZJ A;  4UUC A;  4F7A A;  5C1D A;  2XEN A;  3FUI A;  5CRV A;  3S7F A;  3CSF A;  5A7D B;  3O4Z A;  1OWN A;  2CHW A;  3HRA A;  2VTB A;  3QAR A;  4EEC A;  4G8K A;  4FHJ A;  3UM1 A;  3JXJ A;  4J8S A;  4GYW A;  3C5R A;  2KCL A;  4UWG A;  5JJT A;  3MV2 B;  3OTN A;  2UY1 A;  3Q7A A;  4TXP A;  2ZGG A;  4EQF A;  3MKQ B;  5AAO A;  3EUV A;  3CK9 A;  4GTV A;  1HG5 A;  2J49 A;  3C3R A;  4JVS A;  2LXL A;  1INZ A;  2XZD G;  3ZEF A;  1K1A A;  4CZ2 D;  2WQH A;  1ZBP A;  3N71 A;  1IQU A;  1H2T C;  1S63 A;  1EDU A;  4APF A;  3FU6 A;  5D2M C;  3Q47 B;  1OWM A;  2MHK A;  3QK0 A;  2AXZ A;  4B89 A;  3D9H A;  4F1S A;  3MX3 A;  1WAO 1;  2BED A;  5BXU A;  1JWF A;  5EIB E;  4U0Z A;  2GRN B;  3C3O A;  1OWP A;  3K9I A;  5G05 J;  3G2S A;  5FT9 A;  1OCO E;  3Q49 B;  4G24 A;  4LUN U;  1N54 A;  1HO8 A;  3BEE A;  2FEZ A;  2PM7 A;  3VTX A;  3NB2 A;  3ONK A;  4F6R D;  2DVW A;  3QWV A;  4P29 A;  5EX3 A;  4C48 B;  1FVF A;  2AXU A;  5KCM A;  1S64 A;  3IHY A;  2L9B A;  5CBO A;  4AY6 A;  4AOF A;  1DCQ A;  4RLY A;  4JHK A;  3E37 A;  2WQ6 A;  4U96 D;  1RZ4 A;  3CHS A;  4GZD A;  4J7W A;  4ABN A;  1SZ9 A;  4MLP A;  2WXR A;  2WXF A;  3EHR A;  2WXQ A;  1AP7 A;  4Y6W A;  4GCN A;  2KZT A;  3S7B A;  5JMN D;  3EU5 A;  2P9I G;  3FU0 A;  2ZIS A;  4ATZ D;  1HE8 A;  3FEX A;  2UY1 B;  4HS2 A;  2XEV A;  1N4Q A;  4H7X A;  3UQ3 A;  4U95 D;  1Z5S C;  2VSY A;  4NQ0 A;  1QYM A;  2B0O E;  1MX2 A;  5ITZ F;  1QQE A;  2WM9 A;  3KS2 A;  3RU0 A;  3FEY A;  3JUI A;  1U2V G;  3HXD A;  4MS6 A;  2VSN A;  3MEK A;  2DWZ A;  1FCH A;  3DPD A;  2V4H C;  5HQ8 A;  1MX6 A;  3E4B A;  1D9S A;  3L6A A;  4JEH A;  4OVV A;  4UI9 C;  2X38 A;  4ANU A;  1K8K G;  2A4Z A;  3DWL G;  4TXR A;  3RIB A;  1NA0 A;  3UXG A;  4O1O A;  3SBS A;  4ILI A;  4B0Z A;  5IY5 E;  2QZA A; 
#chains in the Genus database with same CATH homology
 4JA9 A;  1X5B A;  2NXP A;  1HFA A;  3ASF A;  3D9I A;  2VSX E;  3CVX A;  1NP7 A;  5CCM A;  4PS3 A;  3P1U A;  2C0M A;  4DLO A;  4YVQ C;  4I6E A;  1NA3 A;  3GZS A;  3ZGQ A;  3T5V A;  4ATG A;  4UWK A;  2X6I A;  1FVH A;  4B8C B;  5LFA A;  3CKC A;  4ANX A;  2XQ0 A;  4XIF A;  1UN8 A;  4A55 A;  1JPL A;  4D10 C;  3FTV A;  3NZS A;  3PEV B;  4JL0 A;  4CT0 A;  2WXL A;  4AP2 A;  3MYV A;  3IV0 A;  4RSY A;  1OWO A;  1L5J A;  2DIW A;  4GZ6 A;  4YVO A;  3WXX A;  4IRU A;  4B94 A;  4CEM A;  3FU5 A;  5BV0 A;  3CLJ A;  3FUM A;  2FUL A;  4BSX A;  4PDX A;  4UQY A;  5G04 J;  3U4T A;  3ZXS A;  5J08 A;  3RRN B;  3ZN3 A;  1KT1 A;  3B7S A;  1QZ2 A;  4CDM A;  4GU5 A;  5FQ6 A;  1KLX A;  3Q5M A;  3TG4 A;  2VTB B;  1PAQ A;  4TV3 A;  2ILR A;  5DBK A;  4QFV A;  3LY8 A;  5FJY A;  4C0M A;  3Q15 A;  4HVB A;  1TJC A;  3EHM A;  4GB9 A;  3R7Q A;  2KZT B;  3CQC B;  5ANR A;  3ESK A;  3EDT B;  4KXK B;  5M72 A;  4V3I A;  5BNW A;  4NUR A;  3CEQ A;  3LJ3 A;  3I4R B;  3ML8 A;  4ANW A;  3LS8 A;  4U63 A;  5LP0 A;  4XKC A;  3FH5 A;  4I6G A;  4APO A;  2CHZ A;  4WUY A;  4BTB A;  3B7T A;  2FI7 A;  3BG0 B;  3FUE A;  5D0Q D;  4CCA A;  3FUK A;  1ELR A;  5T3R A;  4BTA A;  2LSV A;  3KEZ A;  2WQ7 A;  2WXP A;  3HHM A;  4U0S A;  3SGH A;  1TJF A;  3D9N A;  3QWW A;  4BY6 A;  1MQS A;  4UWL A;  3S2A A;  3ZHE B;  3CR3 A;  3LVQ E;  3ML9 A;  4BT8 A;  4H7Y A;  4G26 A;  4DI3 A;  4WNE A;  2BF0 X;  3HVE B;  3NQP A;  2GGF A;  3PNT B;  1QNF A;  4I1M A;  5AYW D;  3FTS A;  3GZ1 A;  4CT4 A;  1UJJ A;  3G2V A;  3PZD A;  3FTY A;  1IHG A;  2R59 A;  2V8S E;  2WVI A;  4L23 A;  4GA1 A;  1JUQ A;  3QC1 A;  3RK6 A;  3EIQ C;  2OVF A;  3L17 A;  1TEZ A;  4N3B A;  3TG5 A;  3PS6 A;  3SBT B;  3CK8 A;  3FWV A;  4KBQ A;  4UWH A;  2LO6 A;  4FJY A;  5BUZ A;  3CVY A;  2V4L A;  1B89 A;  1ZU2 A;  4W9R A;  4A3T A;  4FJZ A;  2ION A;  3MKR A;  2FO7 A;  1PC2 A;  1HZ4 A;  4J0U A;  1OUV A;  4GZ3 A;  4E6H A;  1WY6 A;  4KMO A;  4JPS A;  5LX8 A;  2Y4T A;  4AVX A;  4J8E A;  4AV7 A;  2HYZ A;  3DBS A;  2OVB A;  4XI0 A;  5D0O D;  1ELW A;  2GRL A;  2IOL A;  3FH8 A;  4I17 A;  2HR2 A;  3LXU X;  1E90 A;  2KCK A;  4U0U A;  3IBE A;  4FUL A;  4O6F A;  5BW8 C;  3I4G A;  4N2S A;  2IQC A;  4JHJ A;  2J07 A;  1YA0 A;  4MRU A;  3FUH A;  1XGW A;  3PH0 C;  1H0A A;  4BFR A;  3JCK C;  3QKY A;  4G23 A;  3ZYM A;  3CV0 A;  3D9O A;  3ENE A;  3OAW A;  5LOZ A;  4WNG A;  4N3C A;  3UX4 A;  4E85 A;  1OWL A;  5T8I A;  3RRM B;  2DBA A;  4I9C A;  2P58 C;  2VGX B;  3ASG A;  3L16 A;  3ONL A;  3P2B A;  4CRW A;  5KJL A;  2VSO E;  3FY4 A;  3MV3 B;  4WNF A;  2OV8 A;  2VGY A;  3UMV A;  1DNP A;  1EPU A;  1Z3X A;  1HU3 A;  2WXN A;  1E8W A;  4DLQ A;  3CVP A;  4LRZ A;  3PUJ A;  2C2L A;  4C0E A;  4I9E A;  3U66 A;  2BTD A;  3U9W A;  1HX8 A;  3KD7 A;  2MOW A;  2WMN A;  1W3B A;  5CMW A;  3B7U X;  3CIA A;  1H2U A;  5C2Y A;  2L0T B;  1UG3 A;  3HYM B;  3MJW A;  3SF4 A;  5DIZ A;  1HG2 A;  3SFZ A;  1EF1 C;  4UQZ A;  4HOT A;  3PVL A;  3T5X A;  3CVL A;  3CHP A;  4R7L A;  3EHN A;  4CDR A;  3CHR A;  4JXT A;  3LKU A;  3ZRH A;  4N2Q A;  2PL2 A;  4LEU A;  4GZ5 A;  4I1O B;  4N5C A;  2WMO A;  2PM6 A;  4FP7 A;  5KJM A;  4KZC A;  4UI9 J;  3FTX A;  5G04 C;  5JJ7 A;  3APD A;  2X3M A;  2XPZ A;  2NSZ A;  3NZU A;  2PQN A;  3TXN A;  4IYP A;  5G55 A;  2C0L A;  3QWP A;  3D9J A;  4WWP A;  5HI7 A;  3ASH A;  3R9A B;  2RG8 A;  3CVV A;  2YNQ A;  1U3D A;  4XZ4 A;  3MZL B;  5ANL A;  2BUG A;  3L13 A;  4PS7 A;  4GAA A;  4ACL A;  5ENN A;  4UQX A;  3HIZ A;  4G2V A;  4L2Y A;  2QY7 A;  3EJN A;  3CHO A;  4JZY A;  2IOS A;  3RJV A;  3RO2 A;  4M3O A;  5E75 A;  3LDZ A;  1E96 B;  2XRY A;  2AVP A;  2CFU A;  2V0P A;  4U8H A;  5ARG A;  3B13 A;  1Z6T A;  4K03 A;  3ZW3 A;  4C9B B;  2XHE A;  2X6H A;  3PEU B;  3U64 A;  3FUN A;  4EZJ A;  4ILH B;  4F7A A;  1Z3Y A;  2YQ8 A;  3FFL A;  1Y8M A;  4PUC A;  2M63 A;  4K0R A;  5AIJ A;  5C1D A;  4FLB A;  3CHQ A;  3FUI A;  5A6C A;  2XGM A;  4FC8 A;  3FHE A;  4IUL A;  2Y3A A;  4ANV A;  4HOS A;  3FP3 A;  2E0I A;  3S7F A;  3CSF A;  3O48 A;  2AW6 A;  3TAX A;  3PRE A;  2J08 A;  5A7D B;  3LEW A;  3O4Z A;  1OWN A;  2CHW A;  1BPO A;  5FQ8 A;  2CG3 A;  2PZI A;  2VTB A;  2EQX A;  3JQ0 A;  4I6J A;  3VLE A;  3QAR A;  1E8Z A;  4EEC A;  4FHJ A;  4A3V A;  4URK A;  2L0I A;  3CVN A;  4G25 A;  4J8S A;  4GYW A;  2CG2 A;  3QDN A;  4TUU A;  3TL5 A;  4GYO A;  1H19 A;  4BWR A;  2KCL A;  4EBA G;  4UWG A;  4WWN A;  1ELK A;  5JJT A;  3Q4A B;  1U3C A;  3MV2 B;  3OTN A;  3QB2 A;  4GPK A;  2YHC A;  4TRQ A;  3I3N A;  2XCB A;  2UY1 A;  3GYZ A;  4EBA A;  4EQF A;  3MKQ B;  4Q96 A;  4AIF A;  4L1B A;  2MRI A;  3AU4 A;  3CK9 A;  5FQ7 A;  3U3W A;  4JHR A;  1VDY A;  1HG5 A;  2J49 A;  4JVS A;  3UT4 A;  4EZL A;  1INZ A;  4KVO A;  3S7J A;  1JWG A;  4KT6 B;  5T4Y A;  3T8M A;  2UWJ G;  3PRZ A;  1KT0 A;  4JEU A;  2KCV A;  3OXG A;  3ZEF A;  4N3A A;  4CDN A;  4Q94 A;  1IQR A;  2WQH A;  4AM9 A;  4A1G A;  1ZBP A;  4I2W A;  1UW4 B;  4GA0 A;  3N71 A;  1IQU A;  1H2T C;  2FBN A;  3IEG A;  2KAT A;  4LER A;  3ULQ A;  3VTY A;  5A23 A;  1EDU A;  3JQ1 A;  4APF A;  2DCP A;  3AS8 A;  3FU6 A;  5KJK A;  3CKB A;  3D9L A;  3Q47 B;  2PQR A;  4HOR A;  1OWM A;  4MKT A;  2XCC A;  3TJP A;  5BT1 A;  3D9K A;  1E8Y A;  5LCW J;  2MHK A;  3OXF A;  4EZK A;  5KJN A;  3QK0 A;  5CMY A;  3ZVV A;  2CFZ A;  2JLB A;  4F3V A;  2AXZ A;  4B89 A;  3UT8 A;  4XE0 A;  5FZR A;  3UT7 A;  2OOE A;  4AY5 A;  2XGS A;  4F1S A;  5BPP A;  5FWQ A;  3MX3 A;  4FAD A;  1WAO 1;  4AXH A;  4IN3 B;  4J6I A;  4XKB A;  2X6K A;  4F53 A;  1JWF A;  2LAI A;  1P5Q A;  3FUJ A;  4HOQ A;  4YND A;  1UJK A;  4U0Z A;  2A5U A;  3CQG B;  2IU1 A;  5CHE E;  5G2N A;  3FH7 A;  2KC7 A;  1UN9 A;  2IF4 A;  3CK7 A;  1LF8 A;  5FQ4 A;  3LPZ A;  2WXO A;  4I2Z A;  3ZYL A;  3FTZ A;  4HOU A;  4UI9 K;  4XX5 A;  3G2U A;  1OWP A;  1PY1 A;  3K9I A;  5G05 J;  3SZ7 A;  2V5F A;  3ASD A;  3BG1 B;  3G2S A;  3MGB A;  4BX8 A;  5FT9 A;  3PE4 A;  3Q49 B;  1E7V A;  3QJZ A;  2YHE A;  1N54 A;  3AU5 A;  3CHM A;  4G24 A;  4LUN U;  4BX9 A;  1HO8 A;  3BEE A;  3LY7 A;  2LNI A;  3QNK A;  4HFG A;  2FEZ A;  2ZU6 B;  4NRH B;  2I1K A;  3S7D A;  3RKV A;  2GRM A;  3VLD A;  5BV1 A;  5JHB A;  2PM7 A;  1NZN A;  3VTX A;  3ONK A;  3FU3 A;  3MA5 A;  1A17 A;  2XGO A;  3MCX A;  3QWV A;  4P29 A;  5EX3 A;  2I9C A;  5AEN A;  3KAE A;  3FUL A;  5AJL A;  4ACK A;  5JJ6 A;  3SI5 A;  4DPR A;  2WXK A;  1FVF A;  2AXU A;  3IKO B;  5KCM A;  3ZFW A;  4WWO A;  1GW6 A;  2L6J A;  3VLF A;  3IHY A;  4Q69 A;  2L9B A;  3ZIM A;  4AY6 A;  4AOF A;  2XRZ A;  4KVM A;  4JHK A;  5FTP A;  2J4D A;  2WQ6 A;  2GW1 A;  3I5P A;  3LVR E;  2AWI A;  3FDH A;  3ZPJ A;  3ZYK A;  2WXJ A;  4GML A;  3CHS A;  4GZD A;  4BT9 A;  2JEK A;  3CVW A;  4ABN A;  3CGH A;  1SZ9 A;  4L7T A;  3PE3 A;  4MLP A;  2WXR A;  4JC8 A;  2WXF A;  3ESL A;  2E2E A;  3HDX A;  3SNX A;  3URZ A;  4EPZ A;  4GA2 A;  3OXL A;  4GMJ A;  4G1T A;  4AJW A;  3FUF A;  2LAH A;  2LSU A;  4I43 A;  2WXQ A;  4JA7 A;  5CCL A;  2NC9 A;  5FZS A;  4Y6W A;  3GZ2 A;  4PH4 B;  2WXH A;  4GCN A;  3SD5 A;  3D9M A;  2KZT A;  2CHX A;  3S7B A;  2IFU A;  4GZC A;  3IHV A;  3CVQ A;  4JW1 A;  3TGO A;  1E7U A;  4B8A A;  2VYI A;  3FU0 A;  2WXM A;  5EKQ D;  3RRU A;  4DK5 A;  5J90 A;  1HE8 A;  2R5S A;  3FEX A;  3QOU A;  2UY1 B;  4HS2 A;  2XEV A;  4U04 A;  2X6J A;  4FU3 A;  4G11 A;  1DVP A;  1N52 A;  2I2O A;  2YIN A;  4H7X A;  4J8F A;  1MHQ A;  3UQ3 A;  4LCT A;  2J9Q A;  4RG9 A;  3L08 A;  4OYS A;  5ARF A;  2VSY A;  3NF1 A;  4CGV A;  2XPY A;  4NQ0 A;  3ZHE A;  4ME2 A;  3LCA A;  3HVE A;  5LCW C;  3D9P A;  1QQE A;  2I6H A;  2XPI A;  4AEZ C;  1HS6 A;  2KM4 A;  3EIJ A;  3R7R A;  3ZYQ A;  4NAC A;  2WM9 A;  1S0P A;  1Y6I A;  2X6F A;  3FTU A;  4FLH A;  1H6K A;  3KS2 A;  3FUD A;  3C98 A;  3FEY A;  3JUI A;  3MKQ A;  4KYO B;  5EX0 A;  3RU0 A;  4DI4 A;  3CVU A;  4FHK A;  3LY9 A;  4MS6 A;  2VSN A;  3GW4 A;  4DJA A;  3PDN A;  3APF A;  4N39 A;  4CGW A;  4RG6 A;  3QAQ A;  3APC A;  3CST A;  4XI9 A;  4U07 A;  1HH8 A;  2HM8 A;  2FF4 A;  3AS5 A;  3MEK A;  2OND A;  1H2V C;  3PNL B;  2WXG A;  1FCH A;  5E76 A;  3UPV A;  4HLE A;  4I1A A;  3DPD A;  2QFC A;  4WND A;  4A1S A;  1EYH A;  1HF8 A;  5HQ8 A;  2WB2 A;  2HO1 A;  2VJ8 A;  4KZ0 A;  3AS4 A;  4WAF A;  5G05 C;  3L54 A;  3E4B A;  2WPV A;  3G2W A;  4OVU A;  2I1J A;  4RVB A;  3L6A A;  2Y4U A;  4JEH A;  1E8X A;  4GCO A;  4FA6 A;  3LYA A;  5AJD A;  1XNF A;  4OVV A;  4UI9 C;  2X38 A;  4UWF A;  4ANU A;  2Q7F A;  4ILG A;  2AXV A;  5JHA A;  2A4Z A;  2J09 A;  2IJG X;  3D3M A;  5EDS A;  3RIB A;  1NA0 A;  1SQM A;  3G2T A;  2VGX A;  3L22 A;  3PUK A;  3SBS A;  3RO3 A;  1SZA A;  4ILI A;  1IYG A;  3FTW A;  4L2L A;  4Y6C A;  4GYY A;  1WM5 A;  4HXI A;  2R17 C;  3SHF A;  4B0Z A;  2WXI A;  3UUX A;  1HXI A;  4J8D A;  4PS8 A;  5FZQ A;  2VQ2 A;  3B7R L;  2J4B A;  3JYS A;  2RD0 A;  3TXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...