1TYQG

Crystal structure of arp2/3 complex with bound atp and calcium
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
141
structure length
134
Chain Sequence
b'FRKVDVDEYDENKFVDEAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 3
publication title Crystal structures of actin-related protein 2/3 complex with bound ATP or ADP
pubmed doi rcsb
molecule tags Structural protein
total genus 42
structure length 134
sequence length 141
ec nomenclature
pdb deposition date 2004-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 1tyqG00
2P9IG 2P9KG 1K8KG 3DXMG 2P9SG 2P9NG 4XEIG 2P9LG 1TYQG 3UKUG 1U2VG 2P9PG 3RSEG 3DWLG 3DXKG 2P9UG 3UKRG 4JD2G 3ULEG
chains in the Genus database with same CATH superfamily
3U4TA 1HF8A 4XZ4A 3UXGA 2B0OE 2OEVA 3FUMA 3SBTB 4LEUA 5KWDA 2L6BA 2VSOE 5DBKA 3NF1A 4J8YA 3OAWA 3SHFA 4CYMD 4CGWA 1E7VA 3TG5A 4U07A 3ABLE 2KZTB 2FO7A 5AENA 3E34A 2OOEA 1O5MA 4GTTA 2DZOA 3LY8A 2XQ0A 5CRUA 2H6IA 3B7BA 4N2QA 1QYMA 4U0SA 4ILIA 2LO6A 1EF1C 1JCRA 5D2MC 3ML9A 4FADA 3DBSA 2YNQA 2YINA 4U0UA 4A3TA 1FVHA 2C0LA 2AWIA 3ZUVB 1TJCA 5EYLA 2WVIA 3SD5A 3MX3A 4HVBA 2DCPA 5FT9A 1INZA 2P58C 1N4QA 1TYQG 2PM6A 3FU0A 2HYZA 3FUFA 5C2YA 1TN8A 1OWPA 4K5AB 4GTQA 2NSZA 3ENEA 4DJAA 4O6FA 2X6KA 2XEHA 3TXNA 1OXJA 4GTMA 1BI8B 4CGVA 1PC2A 1H6OA 1AWCB 4TUUA 1UG3A 3KEAA 4GTOA 3D9LA 3ONKA 4NACA 4EZKA 2ZGDA 5KJNA 2XZTG 4MLPA 1BU9A 4KZCA 2KCKA 4JHRA 5EIDA 5FQ4A 4XI0A 4DLQA 1KZPA 5FWQA 4ILGA 4GMJA 4PS3A 2BUGA 4U8HA 3ASFA 3CHSA 4I43A 4YVOA 1IQRA 4CDMA 5JJ6A 4GA1A 3LDZA 3CVPA 4IRUA 3DXMG 3ULQA 4ACLA 1OWOA 4CDNA 2OV8A 1N11A 3FFLA 3UM0A 3FU6A 3TWXA 5KJLA 5KCMA 3D9PA 2X38A 4H7YA 4AXHA 2DVWA 5AQBA 4ANUA 3FTXA 4WNFA 4GMRA 1DC2A 4BEPA 5T4YA 2UWJG 4Y6WA 3MJWA 4XKCA 4ZHBA 1NFIE 2WXRA 1UW4B 4IYPA 4KZ0A 3UIPC 1YCSB 3KD7A 3CSTA 4JHJA 3LS8A 3G2UA 4FJYA 3BG1B 1DCEA 1LTXA 3GZSA 4PS8A 5JMND 4HLLA 4J7WA 4HI9A 3AG2E 3J5QB 4GZCA 4JA7A 4RG9A 4J0UA 1E8WA 1NZNA 5BXUA 1TN6A 4EECA 4PH4B 4WNGA 5A6CA 3CSFA 1KPSB 3SQVA 5BV0A 3SZ7A 5ARFA 3WXXA 2UY1A 3EHQA 3IBEA 3HVEB 4AEZC 4F1PA 4M3OA 2ETAA 4ANXA 3Q9UC 3B7UX 4JHKA 4B8AA 4APFA 1TEZA 2A5UA 5KNHD 2LNIA 4C48B 4GYYA 3AU5A 3HXEA 3TXMA 3NZUA 1OWLA 3D9JA 4X8QA 4JVSA 4J8FA 2XEVA 2IEJA 2R59A 3RU0A 3ISMC 1DNPA 2V5FA 3EHNA 3AS5A 1IHGA 2V4LA 3AJIA 3LJ3A 2BTDA 2YHCA 5ENQD 2I2OA 3FEXA 5FQ6A 3C3RA 2QFCA 3CLJA 2LUHA 4G23A 4GPMA 3CGHA 2IU1A 3UM3A 3PREA 1WAO1 1WM5A 2KM4A 5H7PA 3I3NA 4GU5A 5LFAA 3BQOA 5ENSD 4U8YD 4MKTA 5FQ8A 1K8KG 2Y69E 1NI1A 2GRRB 5BW8C 5BUZA 1TJFA 4DI4A 1FCHA 4K5BA 1MX4A 1HX8A 4J8SA 4LUNU 5AQ9A 1QBQA 4ATGA 1U2VG 3PZ1A 3U66A 4GTPA 4AJWA 3EU9A 5EDSA 2IO2C 3FUJA 4NURA 3PZ2A 3ZFWA 3DSWA 3FY4A 2F37A 4FU3A 4O1PA 4G8KA 4NIKA 3V79K 5ENPD 4JPSA 3ABME 3G2TA 1X81A 3L17A 1O1RA 3URZA 1NA0A 3HXBA 1ELKA 3FTYA 4DPRA 4L2YA 2ZIRA 5ENTD 4F53A 2QC9A 4GB9A 3OXLA 2XGMA 5CCLA 2X6HA 2DBAA 3FUNA 3VLFA 5HRYA 2R03A 4FA6A 3B13A 3D9HA 3PE4A 4KMOA 3QARA 4LG6A 2KC7A 5E75A 1HG2A 5AN8A 4K03A 3W9FA 3UX4A 3Q7AA 2B6CA 1SZ9A 2EINE 3JUIA 3V2XA 4N3BA 1K1AA 3FEYA 3UUXA 2KXPC 4DLOA 5ENRD 4DX1A 3GYZA 5HKPA 4L1BA 2KBXA 3F6QA 4OAUC 5AIJA 1TN7A 4ABNA 3FH7A 4OAVB 4DK5A 5EX3A 2NC9A 1ELWA 2OCCE 4GYOA 3UTMA 1K1BA 3Q15A 3DSXA 3DEPA 2XENA 3S7BA 4FLBA 3DSVA 4L2LA 5CBOA 4LRZA 3IXEA 2GGFA 3QNKA 3EUVA 1NP7A 4G24A 3HG0D 4GZ6A 2V0PA 4JC8A 4V3IA 1HU3A 4FLHA 2PQRA 2WB2A 4GA2A 3NQPA 3QWVA 3JQ0A 3JQ1A 2HM8A 4N3CA 4EZLA 4DRXE 4KT6B 3C3OA 1SVXA 2P9LG 2WMOA 4JB8P 5ANRA 3FTVA 3JXJA 2IF4A 2AXUA 5FZQA 3NB2A 3FUHA 2ETCA 4G11A 3NBNB 2GRQB 3HVEA 2MHKA 3RK6A 1DVPA 3HHMA 4EZJA 4URKA 5ARGA 3ASOE 3T9KA 1MHQA 2DIWA 5EYPF 2WXJA 3MEKA 1MZCA 2VYIA 3NOGD 3UT4A 4AP2A 2XPYA 3D9NA 2CG2A 4KVMA 4KVOA 4OYSA 1UJKA 4JEUA 3DPYA 3ULEG 3EHRA 4BX8A 4BTBA 2C2LA 3MV3B 2XGSA 2JABA 2WXOA 2WXLA 1OCRE 4OVUA 3JCKC 3VTYA 4MBGA 1A5EA 2VGYA 2BKGA 3Q79A 4UUCA 4YDOA 4J8DA 3HRAA 3ZHEB 3KSQA 3FTUA 3FUEA 1SA4A 2WMNA 4PS7A 2DWZA 4BSXA 3TL5A 1JCSA 5AARA 3MKRA 3UI2A 4GPKA 3FHEA 1EYHA 2J08A 2IONA 1D8EA 2VGEA 3UKRG 5HS0A 4AM9A 3S7JA 1OCOE 2WQ6A 1H2VC 2KCLA 4BESA 3UKUG 3D3MA 4G2VA 3RJVA 3JUEA 2XHEA 2AW6A 1JWFA 3ZU7B 1U3DA 3SY2A 3UMVA 5JHBA 4CT0A 3MCXA 3L08A 2IY0C 2L9BA 3QKYA 2WPVA 4A1SA 4HLEA 2GRPB 3FUKA 3KAEA 1ZBPA 1ELRA 3FU3A 3S7FA 3ZNGA 1PY1A 3ABKE 4U04A 5FINA 4B0ZA 3UM1A 4AOFA 1GW6A 1TR4A 2ZU6B 3V30A 2Y4TA 1KT0A 2QYJA 5T3RA 1QNFA 2I1JA 2J09A 5EKQD 3DSUA 1XGWA 2EIME 2Y0BG 3P1UA 3NZSA 2AXZA 5CERB 1OCCE 3CQCB 4BT9A 1S63A 4B94A 3PH0C 1UN8A 2MOWA 2P9NG 3RRUA 4HOUA 2LSUA 2J4BA 3EHMA 4DX5D 2VJ8A 3R7QA 3B7SA 3R9MA 2RKKA 3DXKG 3QWPA 3AS4A 3LVRE 4GCNA 3SBSA 5BXOA 3ZPJA 3CV0A 4WUYA 1EPUA 2WXIA 4DX6D 2XZDG 2F0YA 4H7XA 2JEKA 4DUIA 1AP7A 2VSXE 3G2WA 2L0TB 3MGBA 4AY6A 3QOUA 3UT7A 3PRZA 3CKBA 1OWMA 4LCTA 2ZISA 5D66A 1X5BA 3TAXA 2J9QA 1A17A 4FHKA 4WWNA 2R17C 4O1OA 1Y6IA 1SA5A 3QDNA 3TWTA 1TNUA 4CEMA 3UIOC 2E0IA 3L9TA 4XX5A 2OVFA 5HQ8A 4ZFHA 2PM7A 4HFGA 4C0MA 2VTBB 4JZYA 2CFUA 3BU8A 3CVUA 3L6AA 3T5VA 1MX6A 3RAUA 1SZAA 3C98A 1BLXB 1N0QA 4I6JA 3ZVVA 3MA5A 4HOQA 3L13A 4Y6CA 4KYOB 4GZDA 4BWRA 4TRQA 3L22A 5G04C 1D9SA 4A1GA 3B95A 4L9PA 5ENNA 5JJTA 2NXPA 3CVWA 2VSNA 5D0OD 3BEEA 4BFRA 4K0RA 5KJMA 2H6HA 2EIJE 3EIJA 2RD0A 5C1DA 1SQMA 1IQUA 3CVYA 4G8LA 3CK9A 2XS1A 2ZGGA 5B1AE 1QQEA 2E2EA 2XRYA 2EIKE 1E96B 3ML8A 3CIAA 3ZHEA 4QFVA 5EX0A 2PQNA 3PEVB 3CR3A 4ME2A 1HZ4A 3CKCA 1JWGA 4TUMA 4RLYA 2KZTA 2VQ2A 4FJZA 2MYOA 5KJKA 2BEDA 4CDRA 2I9CA 2J49A 5FZSA 4K5CA 3TG4A 3QWWA 4NRHB 2ONDA 4N2SA 2FBNA 5DIZA 2Y3AA 2XPIA 3Q5MA 1N4SA 1OT8A 4UI9C 4U0ZA 3TJPA 2FF4A 4YDEA 4G26A 1JPLA 1FPPA 1Y8MA 3MZLB 4RG6A 2CHXA 3RSEG 5FIOA 1IKND 1KT1A 3FULA 2PZIA 4FHJA 5CBNA 3ESKA 3VLEA 4GA0A 3AU4A 5LCWC 3GW4A 4XKBA 4RQIA 3B7RL 1Z5SC 3EJNA 3PE3A 3E30A 3E32A 5J08A 4N39A 4QQIA 2WXHA 2OEWA 4JW1A 4U63A 5IY5E 3FDHA 4AIFA 4MS6A 3EDTB 1TNBA 4LSZE 4UQYA 4A55A 4I6GA 2RFAA 3Q4AB 4UWFA 4TXPA 4UI9K 1V54E 3V31A 5AYWD 4TXRA 5E76A 5G05C 2AXVA 2PL2A 3D9KA 3OXGA 3RO3A 3LY7A 2EQXA 3FTZA 4HRLA 1OWNA 3UM2A 1G3NB 2F8YA 3FWVA 4HS2A 2KATA 1N95A 4JL0A 4AY5A 3CHQA 4EHMA 1N54A 3EIQC 5LX8A 2CG3A 1KLXA 4E6HA 4U95D 4DX2A 4W9RA 2FEZA 4GMLA 3LY9A 5CRVA 3UPVA 3ZYLA 1H6PA 2Y1LE 3C72A 3RKVA 4BX9A 3ZYQA 3CVVA 2I6HA 2M63A 3FH5A 2DZNA 3ZKJA 4UQZA 5CMYA 3D9OA 2IJGX 1N4PA 3GZ2A 2WQHA 4ANWA 4UQXA 5LOZA 3NAWA 2KCVA 5CEAA 1L5JA 3TWVA 3HIZA 2OVBA 4P29A 5EILA 5AAOA 1V55E 3HXDA 3U9WA 3IKOB 2CHZA 1S64A 1HO8A 1QZ2A 3RIBA 1HFAA 1N9AA 3ZEFA 3X2QE 3DSTA 5T8IA 1DCQA 3CK8A 2FO1E 4G25A 2WXKA 3CEQA 4JD2G 3CHRA 1E8XA 3R7RA 5EN5D 4XEIG 5G55A 2AVPA 2XCCA 2UY1B 1UJJA 2Y4UA 3LPZA 3DEOA 3SO8A 3G2VA 5G2NA 2F8XK 3W9GA 3SI5A 4I1MA 3LCAA 2ILRA 4HBDA 2V5QC 1IYGA 4XE0A 3SFZA 2J07A 1MYOA 3FTSA 1Z6TA 2WXGA 1Q2ZA 4BSZB 2H6GA 4XIFA 3PEUB 3CHOA 4F1SA 1ZU2A 1IXVA 1MQSA 1YYHA 3CVQA 2R05A 1LF8A 4Q94A 3UQ3A 3I4GA 3CVNA 5B3SE 4E85A 3Q47B 3FUIA 3LKUA 4HORA 3R9AB 1TNYA 4L23A 4C0EA 3TWWA 1B89A 3IEGA 3ASNE 3ZYKA 1HE8A 4I1OB 5BV1A 3DWLG 3MKQB 4GAAA 4HOTA 3ZW3A 3CHMA 3T8MA 2P9IG 1YA0A 4R7LA 5KNGA 4O60A 4N3AA 3EU5A 1Z3YA 4WNDA 5ITZF 3I5PA 4Q96A 3FUDA 2LXLA 3L54A 2WXPA 5CEDB 3Q9NC 4B89A 5B1BE 2GRMA 3LVQE 3GZ1A 3TWSA 3S2AA 3CK7A 1NA3A 3NOCD 1OY3D 4J8EA 1WDYA 2L6JA 2WXMA 1TNOA 1ZB1A 2WXQA 4OVVA 2RG8A 4RSYA 1H2UA 3SFXA 1E8ZA 3ZIMA 1VDYA 3FP3A 4APOA 1JUQA 1OCZE 5ANLA 4L7TA 3O4ZA 3HXFA 4CT4A 3AAAC 2GW1A 1EDUA 2P2CP 4F7AA 3PZDA 2P9KG 3LYAA 3PNLB 5D0QD 3FH8A 3Q73A 1E90A 1E7UA 2LAIA 3DSSA 1YMPA 4WWPA 1FT2A 3LXUX 2P9UG 4YNDA 3KEZA 4YDWA 2R5SA 3Q7FA 1KZOA 1HS6A 2HR2A 4U8VD 4I2ZA 1MX2A 3ZRHA 4GTSA 3I4RB 3HDXA 5CECB 2P9SG 4D10C 1BPOA 4TV3A 4U7EB 4BTAA 3MV2B 4A3VA 2X3MA 3FTWA 2HE0A 2J8SD 3AS8A 2X6JA 3SGHA 2XS8A 4HQDA 2J4DA 4MRUA 1O1SA 1HG5A 1Z3XA 2H6FA 2X6FA 1XNFA 5ENOD 2IO3C 5KBAA 2Q7FA 5CCMA 5FJYA 4I6EA 2CFZA 2AJAA 3ZGQA 5FTPA 4A63B 4NQ0A 3TGOA 3QC1A 4GZ5A 4BETA 1E8YA 2ETBA 3QB2A 1N94A 4I9EA 1D8DA 3ZXSA 4GZ3A 5BPPA 4N5QA 2JLBA 1H0AA 4AV7A 4ILHB 4FULA 4BY6A 4HXIA 2A4ZA 2R2LA 4PDXA 4DX7D 2X6IA 3K9IA 1N0RA 1HH8A 3P2BA 4UWHA 2VGXB 2YHEA 5A7DB 1RZ4A 4YVQC 4HRNA 3ZN3A 2FI7A 4IN3B 5AQ7A 3OXFA 3PUKA 2P9PG 3JYSA 2GRLA 4Z68A 3PDNA 4GTVA 2ZXWE 4J6IA 4HRMB 5AJDA 1N52A 2QYUA 3TWQA 3ONLA 2VSYA 4CZ2D 3UT8A 4B93B 5JHAA 3IV0A 4FC8A 3T8KA 1NL4A 1BD8A 2XCBA 2FULA 5FQ7A 5BT1A 3SF4A 1WY6A 3AG4E 2GRNB 2BKKB 3QJZA 4IULA 3D9MA 2BF0X 1SW6A 3L82A 1UOHA 2I1KA 3C3QA 3E37A 4UWGA 5CHEE 3RO2A 1LD8A 4PUCA 2LXMA 4JA9A 1K3ZD 4WAFA 4CRWA 2V4HC 3ASHA 2NYJA 1UN9A 2WXNA 3WG7E 2XGOA 3MKQA 4I17A 3RRNB 3HXCA 3AG3E 1P5QA 4EPZA 2R02A 1FVFA 1FT1A 4GYWA 5LP0A 4EBAA 1JCQA 3TWUA 5AJLA 2YQ8A 2V8SE 1MJ0A 3ULYA 1BI7B 3SNXA 2WQ7A 3U64A 4C9BB 2QZAA 4WNEA 3KS2A 1LD7A 4I9CA 3PUJA 3SFYA 4GTRA 2A5EA 2HO1A 3KSLA 4JXTA 4M7CA 4CCAA 4LNBA 4N5CA 4KXKB 3FU5A 5G04J 3UINC 2WXFA 4LERA 2XRZA 4BT8A 4HOSA 2XPZA 3S7DA 5HI7A 3PNTB 3V2OA 4F6RD 3DRAA 5FZRA 1PAQA 3DPDA 1OUVA 4ANVA 4XI9A 3CHPA 4UWLA 1O1TA 4I1AA 4DI3A 3L16A 2DYSE 5BNWA 4BERA 3Q75A 3ASGA 4U96D 3BG0B 3AG1E 5M72A 4HNAD 2IOLA 2IOSA 5CMWA 3C5RA 1S0PA 3QK0A 1IHBA 2C0MA 3U3WA 4TXQA 2DYRE 2PNNA 2L0IA 3N71A 3IHVA 5A23A 3RRMB 3LEWA 3ZXPA 2QY7A 1H19A 2EILE 4JEHA 3TWRA 5EIBE 3LJNA 3E33A 3Q78A 2XEEA 4RVBA 1H2TC 4UI9J 1HXIA 4GCOA 4UWKA 2WM9A 3E4BA 4HI8A 1TNZA 3IHYA 3BUAA 2LSVA 3MYVA 4Q69A 3J5PA 4EQFA 5JJ7A 2VTBA 4LNGA 3D9IA 3PZ3A 1N4RA 4AVXA 4EBAG 3O48A 5LCWJ 3APFA 3CQGB 3VLDA 5JA4D 3ESLA 4LNUD 3ZYMA 3ASDA 2VGXA 3Q49B 4ACKA 4YDYA 3CVLA 3APCA 4FP7A 5J90A 3APDA 4B8CB 1U3CA 1W3BA 3PZ4A 4G1TA 1RW2A 3OTNA 3CVXA 2IFUA 3QAQA 4I2WA 2LAHA 2GROB 2RFMA 3PVLA 4HB5A 5G05J 3VTXA 3T5XA 4WWOA 2CHWA 4F3VA 3B7TA 2MRIA 1H6KA 1S70B 1WG0A 4KBQA 3G2SA 3HYMB 3PS6A 2IQCA 4ATZD 3JXIA 5AQAA
chains in the Genus database with same CATH topology
2P9IG 2P9KG 1K8KG 3DXMG 2P9SG 2P9NG 4XEIG 2P9LG 1TYQG 3UKUG 1U2VG 2P9PG 3RSEG 3DWLG 3DXKG 2P9UG 3UKRG 4JD2G 3ULEG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9I G;  2P9K G;  1K8K G;  3DXM G;  2P9S G;  2P9N G;  4XEI G;  2P9L G;  1TYQ G;  3UKU G;  1U2V G;  2P9P G;  3RSE G;  3DWL G;  3DXK G;  2P9U G;  3UKR G;  4JD2 G;  3ULE G; 
#chains in the Genus database with same CATH topology
 3U4T A;  1HF8 A;  4XZ4 A;  3UXG A;  2B0O E;  2OEV A;  3FUM A;  3SBT B;  4LEU A;  5KWD A;  2L6B A;  2VSO E;  5DBK A;  3NF1 A;  4J8Y A;  3OAW A;  3SHF A;  4CYM D;  4CGW A;  1E7V A;  3TG5 A;  4U07 A;  3ABL E;  2KZT B;  2FO7 A;  5AEN A;  3E34 A;  2OOE A;  1O5M A;  4GTT A;  2DZO A;  3LY8 A;  2XQ0 A;  5CRU A;  2H6I A;  3B7B A;  4N2Q A;  1QYM A;  4U0S A;  4ILI A;  2LO6 A;  1EF1 C;  1JCR A;  5D2M C;  3ML9 A;  4FAD A;  3DBS A;  2YNQ A;  2YIN A;  4U0U A;  4A3T A;  1FVH A;  2C0L A;  2AWI A;  3ZUV B;  1TJC A;  5EYL A;  2WVI A;  3SD5 A;  3MX3 A;  4HVB A;  2DCP A;  5FT9 A;  1INZ A;  2P58 C;  1N4Q A;  1TYQ G;  2PM6 A;  3FU0 A;  2HYZ A;  3FUF A;  5C2Y A;  1TN8 A;  1OWP A;  4K5A B;  4GTQ A;  2NSZ A;  3ENE A;  4DJA A;  4O6F A;  2X6K A;  2XEH A;  3TXN A;  1OXJ A;  4GTM A;  1BI8 B;  4CGV A;  1PC2 A;  1H6O A;  1AWC B;  4TUU A;  1UG3 A;  3KEA A;  4GTO A;  3D9L A;  3ONK A;  4NAC A;  4EZK A;  2ZGD A;  5KJN A;  2XZT G;  4MLP A;  1BU9 A;  4KZC A;  2KCK A;  4JHR A;  5EID A;  5FQ4 A;  4XI0 A;  4DLQ A;  1KZP A;  5FWQ A;  4ILG A;  4GMJ A;  4PS3 A;  2BUG A;  4U8H A;  3ASF A;  3CHS A;  4I43 A;  4YVO A;  1IQR A;  4CDM A;  5JJ6 A;  4GA1 A;  3LDZ A;  3CVP A;  4IRU A;  3DXM G;  3ULQ A;  4ACL A;  1OWO A;  4CDN A;  2OV8 A;  1N11 A;  3FFL A;  3UM0 A;  3FU6 A;  3TWX A;  5KJL A;  5KCM A;  3D9P A;  2X38 A;  4H7Y A;  4AXH A;  2DVW A;  5AQB A;  4ANU A;  3FTX A;  4WNF A;  4GMR A;  1DC2 A;  4BEP A;  5T4Y A;  2UWJ G;  4Y6W A;  3MJW A;  4XKC A;  4ZHB A;  1NFI E;  2WXR A;  1UW4 B;  4IYP A;  4KZ0 A;  3UIP C;  1YCS B;  3KD7 A;  3CST A;  4JHJ A;  3LS8 A;  3G2U A;  4FJY A;  3BG1 B;  1DCE A;  1LTX A;  3GZS A;  4PS8 A;  5JMN D;  4HLL A;  4J7W A;  4HI9 A;  3AG2 E;  3J5Q B;  4GZC A;  4JA7 A;  4RG9 A;  4J0U A;  1E8W A;  1NZN A;  5BXU A;  1TN6 A;  4EEC A;  4PH4 B;  4WNG A;  5A6C A;  3CSF A;  1KPS B;  3SQV A;  5BV0 A;  3SZ7 A;  5ARF A;  3WXX A;  2UY1 A;  3EHQ A;  3IBE A;  3HVE B;  4AEZ C;  4F1P A;  4M3O A;  2ETA A;  4ANX A;  3Q9U C;  3B7U X;  4JHK A;  4B8A A;  4APF A;  1TEZ A;  2A5U A;  5KNH D;  2LNI A;  4C48 B;  4GYY A;  3AU5 A;  3HXE A;  3TXM A;  3NZU A;  1OWL A;  3D9J A;  4X8Q A;  4JVS A;  4J8F A;  2XEV A;  2IEJ A;  2R59 A;  3RU0 A;  3ISM C;  1DNP A;  2V5F A;  3EHN A;  3AS5 A;  1IHG A;  2V4L A;  3AJI A;  3LJ3 A;  2BTD A;  2YHC A;  5ENQ D;  2I2O A;  3FEX A;  5FQ6 A;  3C3R A;  2QFC A;  3CLJ A;  2LUH A;  4G23 A;  4GPM A;  3CGH A;  2IU1 A;  3UM3 A;  3PRE A;  1WAO 1;  1WM5 A;  2KM4 A;  5H7P A;  3I3N A;  4GU5 A;  5LFA A;  3BQO A;  5ENS D;  4U8Y D;  4MKT A;  5FQ8 A;  1K8K G;  2Y69 E;  1NI1 A;  2GRR B;  5BW8 C;  5BUZ A;  1TJF A;  4DI4 A;  1FCH A;  4K5B A;  1MX4 A;  1HX8 A;  4J8S A;  4LUN U;  5AQ9 A;  1QBQ A;  4ATG A;  1U2V G;  3PZ1 A;  3U66 A;  4GTP A;  4AJW A;  3EU9 A;  5EDS A;  2IO2 C;  3FUJ A;  4NUR A;  3PZ2 A;  3ZFW A;  3DSW A;  3FY4 A;  2F37 A;  4FU3 A;  4O1P A;  4G8K A;  4NIK A;  3V79 K;  5ENP D;  4JPS A;  3ABM E;  3G2T A;  1X81 A;  3L17 A;  1O1R A;  3URZ A;  1NA0 A;  3HXB A;  1ELK A;  3FTY A;  4DPR A;  4L2Y A;  2ZIR A;  5ENT D;  4F53 A;  2QC9 A;  4GB9 A;  3OXL A;  2XGM A;  5CCL A;  2X6H A;  2DBA A;  3FUN A;  3VLF A;  5HRY A;  2R03 A;  4FA6 A;  3B13 A;  3D9H A;  3PE4 A;  4KMO A;  3QAR A;  4LG6 A;  2KC7 A;  5E75 A;  1HG2 A;  5AN8 A;  4K03 A;  3W9F A;  3UX4 A;  3Q7A A;  2B6C A;  1SZ9 A;  2EIN E;  3JUI A;  3V2X A;  4N3B A;  1K1A A;  3FEY A;  3UUX A;  2KXP C;  4DLO A;  5ENR D;  4DX1 A;  3GYZ A;  5HKP A;  4L1B A;  2KBX A;  3F6Q A;  4OAU C;  5AIJ A;  1TN7 A;  4ABN A;  3FH7 A;  4OAV B;  4DK5 A;  5EX3 A;  2NC9 A;  1ELW A;  2OCC E;  4GYO A;  3UTM A;  1K1B A;  3Q15 A;  3DSX A;  3DEP A;  2XEN A;  3S7B A;  4FLB A;  3DSV A;  4L2L A;  5CBO A;  4LRZ A;  3IXE A;  2GGF A;  3QNK A;  3EUV A;  1NP7 A;  4G24 A;  3HG0 D;  4GZ6 A;  2V0P A;  4JC8 A;  4V3I A;  1HU3 A;  4FLH A;  2PQR A;  2WB2 A;  4GA2 A;  3NQP A;  3QWV A;  3JQ0 A;  3JQ1 A;  2HM8 A;  4N3C A;  4EZL A;  4DRX E;  4KT6 B;  3C3O A;  1SVX A;  2P9L G;  2WMO A;  4JB8 P;  5ANR A;  3FTV A;  3JXJ A;  2IF4 A;  2AXU A;  5FZQ A;  3NB2 A;  3FUH A;  2ETC A;  4G11 A;  3NBN B;  2GRQ B;  3HVE A;  2MHK A;  3RK6 A;  1DVP A;  3HHM A;  4EZJ A;  4URK A;  5ARG A;  3ASO E;  3T9K A;  1MHQ A;  2DIW A;  5EYP F;  2WXJ A;  3MEK A;  1MZC A;  2VYI A;  3NOG D;  3UT4 A;  4AP2 A;  2XPY A;  3D9N A;  2CG2 A;  4KVM A;  4KVO A;  4OYS A;  1UJK A;  4JEU A;  3DPY A;  3ULE G;  3EHR A;  4BX8 A;  4BTB A;  2C2L A;  3MV3 B;  2XGS A;  2JAB A;  2WXO A;  2WXL A;  1OCR E;  4OVU A;  3JCK C;  3VTY A;  4MBG A;  1A5E A;  2VGY A;  2BKG A;  3Q79 A;  4UUC A;  4YDO A;  4J8D A;  3HRA A;  3ZHE B;  3KSQ A;  3FTU A;  3FUE A;  1SA4 A;  2WMN A;  4PS7 A;  2DWZ A;  4BSX A;  3TL5 A;  1JCS A;  5AAR A;  3MKR A;  3UI2 A;  4GPK A;  3FHE A;  1EYH A;  2J08 A;  2ION A;  1D8E A;  2VGE A;  3UKR G;  5HS0 A;  4AM9 A;  3S7J A;  1OCO E;  2WQ6 A;  1H2V C;  2KCL A;  4BES A;  3UKU G;  3D3M A;  4G2V A;  3RJV A;  3JUE A;  2XHE A;  2AW6 A;  1JWF A;  3ZU7 B;  1U3D A;  3SY2 A;  3UMV A;  5JHB A;  4CT0 A;  3MCX A;  3L08 A;  2IY0 C;  2L9B A;  3QKY A;  2WPV A;  4A1S A;  4HLE A;  2GRP B;  3FUK A;  3KAE A;  1ZBP A;  1ELR A;  3FU3 A;  3S7F A;  3ZNG A;  1PY1 A;  3ABK E;  4U04 A;  5FIN A;  4B0Z A;  3UM1 A;  4AOF A;  1GW6 A;  1TR4 A;  2ZU6 B;  3V30 A;  2Y4T A;  1KT0 A;  2QYJ A;  5T3R A;  1QNF A;  2I1J A;  2J09 A;  5EKQ D;  3DSU A;  1XGW A;  2EIM E;  2Y0B G;  3P1U A;  3NZS A;  2AXZ A;  5CER B;  1OCC E;  3CQC B;  4BT9 A;  1S63 A;  4B94 A;  3PH0 C;  1UN8 A;  2MOW A;  2P9N G;  3RRU A;  4HOU A;  2LSU A;  2J4B A;  3EHM A;  4DX5 D;  2VJ8 A;  3R7Q A;  3B7S A;  3R9M A;  2RKK A;  3DXK G;  3QWP A;  3AS4 A;  3LVR E;  4GCN A;  3SBS A;  5BXO A;  3ZPJ A;  3CV0 A;  4WUY A;  1EPU A;  2WXI A;  4DX6 D;  2XZD G;  2F0Y A;  4H7X A;  2JEK A;  4DUI A;  1AP7 A;  2VSX E;  3G2W A;  2L0T B;  3MGB A;  4AY6 A;  3QOU A;  3UT7 A;  3PRZ A;  3CKB A;  1OWM A;  4LCT A;  2ZIS A;  5D66 A;  1X5B A;  3TAX A;  2J9Q A;  1A17 A;  4FHK A;  4WWN A;  2R17 C;  4O1O A;  1Y6I A;  1SA5 A;  3QDN A;  3TWT A;  1TNU A;  4CEM A;  3UIO C;  2E0I A;  3L9T A;  4XX5 A;  2OVF A;  5HQ8 A;  4ZFH A;  2PM7 A;  4HFG A;  4C0M A;  2VTB B;  4JZY A;  2CFU A;  3BU8 A;  3CVU A;  3L6A A;  3T5V A;  1MX6 A;  3RAU A;  1SZA A;  3C98 A;  1BLX B;  1N0Q A;  4I6J A;  3ZVV A;  3MA5 A;  4HOQ A;  3L13 A;  4Y6C A;  4KYO B;  4GZD A;  4BWR A;  4TRQ A;  3L22 A;  5G04 C;  1D9S A;  4A1G A;  3B95 A;  4L9P A;  5ENN A;  5JJT A;  2NXP A;  3CVW A;  2VSN A;  5D0O D;  3BEE A;  4BFR A;  4K0R A;  5KJM A;  2H6H A;  2EIJ E;  3EIJ A;  2RD0 A;  5C1D A;  1SQM A;  1IQU A;  3CVY A;  4G8L A;  3CK9 A;  2XS1 A;  2ZGG A;  5B1A E;  1QQE A;  2E2E A;  2XRY A;  2EIK E;  1E96 B;  3ML8 A;  3CIA A;  3ZHE A;  4QFV A;  5EX0 A;  2PQN A;  3PEV B;  3CR3 A;  4ME2 A;  1HZ4 A;  3CKC A;  1JWG A;  4TUM A;  4RLY A;  2KZT A;  2VQ2 A;  4FJZ A;  2MYO A;  5KJK A;  2BED A;  4CDR A;  2I9C A;  2J49 A;  5FZS A;  4K5C A;  3TG4 A;  3QWW A;  4NRH B;  2OND A;  4N2S A;  2FBN A;  5DIZ A;  2Y3A A;  2XPI A;  3Q5M A;  1N4S A;  1OT8 A;  4UI9 C;  4U0Z A;  3TJP A;  2FF4 A;  4YDE A;  4G26 A;  1JPL A;  1FPP A;  1Y8M A;  3MZL B;  4RG6 A;  2CHX A;  3RSE G;  5FIO A;  1IKN D;  1KT1 A;  3FUL A;  2PZI A;  4FHJ A;  5CBN A;  3ESK A;  3VLE A;  4GA0 A;  3AU4 A;  5LCW C;  3GW4 A;  4XKB A;  4RQI A;  3B7R L;  1Z5S C;  3EJN A;  3PE3 A;  3E30 A;  3E32 A;  5J08 A;  4N39 A;  4QQI A;  2WXH A;  2OEW A;  4JW1 A;  4U63 A;  5IY5 E;  3FDH A;  4AIF A;  4MS6 A;  3EDT B;  1TNB A;  4LSZ E;  4UQY A;  4A55 A;  4I6G A;  2RFA A;  3Q4A B;  4UWF A;  4TXP A;  4UI9 K;  1V54 E;  3V31 A;  5AYW D;  4TXR A;  5E76 A;  5G05 C;  2AXV A;  2PL2 A;  3D9K A;  3OXG A;  3RO3 A;  3LY7 A;  2EQX A;  3FTZ A;  4HRL A;  1OWN A;  3UM2 A;  1G3N B;  2F8Y A;  3FWV A;  4HS2 A;  2KAT A;  1N95 A;  4JL0 A;  4AY5 A;  3CHQ A;  4EHM A;  1N54 A;  3EIQ C;  5LX8 A;  2CG3 A;  1KLX A;  4E6H A;  4U95 D;  4DX2 A;  4W9R A;  2FEZ A;  4GML A;  3LY9 A;  5CRV A;  3UPV A;  3ZYL A;  1H6P A;  2Y1L E;  3C72 A;  3RKV A;  4BX9 A;  3ZYQ A;  3CVV A;  2I6H A;  2M63 A;  3FH5 A;  2DZN A;  3ZKJ A;  4UQZ A;  5CMY A;  3D9O A;  2IJG X;  1N4P A;  3GZ2 A;  2WQH A;  4ANW A;  4UQX A;  5LOZ A;  3NAW A;  2KCV A;  5CEA A;  1L5J A;  3TWV A;  3HIZ A;  2OVB A;  4P29 A;  5EIL A;  5AAO A;  1V55 E;  3HXD A;  3U9W A;  3IKO B;  2CHZ A;  1S64 A;  1HO8 A;  1QZ2 A;  3RIB A;  1HFA A;  1N9A A;  3ZEF A;  3X2Q E;  3DST A;  5T8I A;  1DCQ A;  3CK8 A;  2FO1 E;  4G25 A;  2WXK A;  3CEQ A;  4JD2 G;  3CHR A;  1E8X A;  3R7R A;  5EN5 D;  4XEI G;  5G55 A;  2AVP A;  2XCC A;  2UY1 B;  1UJJ A;  2Y4U A;  3LPZ A;  3DEO A;  3SO8 A;  3G2V A;  5G2N A;  2F8X K;  3W9G A;  3SI5 A;  4I1M A;  3LCA A;  2ILR A;  4HBD A;  2V5Q C;  1IYG A;  4XE0 A;  3SFZ A;  2J07 A;  1MYO A;  3FTS A;  1Z6T A;  2WXG A;  1Q2Z A;  4BSZ B;  2H6G A;  4XIF A;  3PEU B;  3CHO A;  4F1S A;  1ZU2 A;  1IXV A;  1MQS A;  1YYH A;  3CVQ A;  2R05 A;  1LF8 A;  4Q94 A;  3UQ3 A;  3I4G A;  3CVN A;  5B3S E;  4E85 A;  3Q47 B;  3FUI A;  3LKU A;  4HOR A;  3R9A B;  1TNY A;  4L23 A;  4C0E A;  3TWW A;  1B89 A;  3IEG A;  3ASN E;  3ZYK A;  1HE8 A;  4I1O B;  5BV1 A;  3DWL G;  3MKQ B;  4GAA A;  4HOT A;  3ZW3 A;  3CHM A;  3T8M A;  2P9I G;  1YA0 A;  4R7L A;  5KNG A;  4O60 A;  4N3A A;  3EU5 A;  1Z3Y A;  4WND A;  5ITZ F;  3I5P A;  4Q96 A;  3FUD A;  2LXL A;  3L54 A;  2WXP A;  5CED B;  3Q9N C;  4B89 A;  5B1B E;  2GRM A;  3LVQ E;  3GZ1 A;  3TWS A;  3S2A A;  3CK7 A;  1NA3 A;  3NOC D;  1OY3 D;  4J8E A;  1WDY A;  2L6J A;  2WXM A;  1TNO A;  1ZB1 A;  2WXQ A;  4OVV A;  2RG8 A;  4RSY A;  1H2U A;  3SFX A;  1E8Z A;  3ZIM A;  1VDY A;  3FP3 A;  4APO A;  1JUQ A;  1OCZ E;  5ANL A;  4L7T A;  3O4Z A;  3HXF A;  4CT4 A;  3AAA C;  2GW1 A;  1EDU A;  2P2C P;  4F7A A;  3PZD A;  2P9K G;  3LYA A;  3PNL B;  5D0Q D;  3FH8 A;  3Q73 A;  1E90 A;  1E7U A;  2LAI A;  3DSS A;  1YMP A;  4WWP A;  1FT2 A;  3LXU X;  2P9U G;  4YND A;  3KEZ A;  4YDW A;  2R5S A;  3Q7F A;  1KZO A;  1HS6 A;  2HR2 A;  4U8V D;  4I2Z A;  1MX2 A;  3ZRH A;  4GTS A;  3I4R B;  3HDX A;  5CEC B;  2P9S G;  4D10 C;  1BPO A;  4TV3 A;  4U7E B;  4BTA A;  3MV2 B;  4A3V A;  2X3M A;  3FTW A;  2HE0 A;  2J8S D;  3AS8 A;  2X6J A;  3SGH A;  2XS8 A;  4HQD A;  2J4D A;  4MRU A;  1O1S A;  1HG5 A;  1Z3X A;  2H6F A;  2X6F A;  1XNF A;  5ENO D;  2IO3 C;  5KBA A;  2Q7F A;  5CCM A;  5FJY A;  4I6E A;  2CFZ A;  2AJA A;  3ZGQ A;  5FTP A;  4A63 B;  4NQ0 A;  3TGO A;  3QC1 A;  4GZ5 A;  4BET A;  1E8Y A;  2ETB A;  3QB2 A;  1N94 A;  4I9E A;  1D8D A;  3ZXS A;  4GZ3 A;  5BPP A;  4N5Q A;  2JLB A;  1H0A A;  4AV7 A;  4ILH B;  4FUL A;  4BY6 A;  4HXI A;  2A4Z A;  2R2L A;  4PDX A;  4DX7 D;  2X6I A;  3K9I A;  1N0R A;  1HH8 A;  3P2B A;  4UWH A;  2VGX B;  2YHE A;  5A7D B;  1RZ4 A;  4YVQ C;  4HRN A;  3ZN3 A;  2FI7 A;  4IN3 B;  5AQ7 A;  3OXF A;  3PUK A;  2P9P G;  3JYS A;  2GRL A;  4Z68 A;  3PDN A;  4GTV A;  2ZXW E;  4J6I A;  4HRM B;  5AJD A;  1N52 A;  2QYU A;  3TWQ A;  3ONL A;  2VSY A;  4CZ2 D;  3UT8 A;  4B93 B;  5JHA A;  3IV0 A;  4FC8 A;  3T8K A;  1NL4 A;  1BD8 A;  2XCB A;  2FUL A;  5FQ7 A;  5BT1 A;  3SF4 A;  1WY6 A;  3AG4 E;  2GRN B;  2BKK B;  3QJZ A;  4IUL A;  3D9M A;  2BF0 X;  1SW6 A;  3L82 A;  1UOH A;  2I1K A;  3C3Q A;  3E37 A;  4UWG A;  5CHE E;  3RO2 A;  1LD8 A;  4PUC A;  2LXM A;  4JA9 A;  1K3Z D;  4WAF A;  4CRW A;  2V4H C;  3ASH A;  2NYJ A;  1UN9 A;  2WXN A;  3WG7 E;  2XGO A;  3MKQ A;  4I17 A;  3RRN B;  3HXC A;  3AG3 E;  1P5Q A;  4EPZ A;  2R02 A;  1FVF A;  1FT1 A;  4GYW A;  5LP0 A;  4EBA A;  1JCQ A;  3TWU A;  5AJL A;  2YQ8 A;  2V8S E;  1MJ0 A;  3ULY A;  1BI7 B;  3SNX A;  2WQ7 A;  3U64 A;  4C9B B;  2QZA A;  4WNE A;  3KS2 A;  1LD7 A;  4I9C A;  3PUJ A;  3SFY A;  4GTR A;  2A5E A;  2HO1 A;  3KSL A;  4JXT A;  4M7C A;  4CCA A;  4LNB A;  4N5C A;  4KXK B;  3FU5 A;  5G04 J;  3UIN C;  2WXF A;  4LER A;  2XRZ A;  4BT8 A;  4HOS A;  2XPZ A;  3S7D A;  5HI7 A;  3PNT B;  3V2O A;  4F6R D;  3DRA A;  5FZR A;  1PAQ A;  3DPD A;  1OUV A;  4ANV A;  4XI9 A;  3CHP A;  4UWL A;  1O1T A;  4I1A A;  4DI3 A;  3L16 A;  2DYS E;  5BNW A;  4BER A;  3Q75 A;  3ASG A;  4U96 D;  3BG0 B;  3AG1 E;  5M72 A;  4HNA D;  2IOL A;  2IOS A;  5CMW A;  3C5R A;  1S0P A;  3QK0 A;  1IHB A;  2C0M A;  3U3W A;  4TXQ A;  2DYR E;  2PNN A;  2L0I A;  3N71 A;  3IHV A;  5A23 A;  3RRM B;  3LEW A;  3ZXP A;  2QY7 A;  1H19 A;  2EIL E;  4JEH A;  3TWR A;  5EIB E;  3LJN A;  3E33 A;  3Q78 A;  2XEE A;  4RVB A;  1H2T C;  4UI9 J;  1HXI A;  4GCO A;  4UWK A;  2WM9 A;  3E4B A;  4HI8 A;  1TNZ A;  3IHY A;  3BUA A;  2LSV A;  3MYV A;  4Q69 A;  3J5P A;  4EQF A;  5JJ7 A;  2VTB A;  4LNG A;  3D9I A;  3PZ3 A;  1N4R A;  4AVX A;  4EBA G;  3O48 A;  5LCW J;  3APF A;  3CQG B;  3VLD A;  5JA4 D;  3ESL A;  4LNU D;  3ZYM A;  3ASD A;  2VGX A;  3Q49 B;  4ACK A;  4YDY A;  3CVL A;  3APC A;  4FP7 A;  5J90 A;  3APD A;  4B8C B;  1U3C A;  1W3B A;  3PZ4 A;  4G1T A;  1RW2 A;  3OTN A;  3CVX A;  2IFU A;  3QAQ A;  4I2W A;  2LAH A;  2GRO B;  2RFM A;  3PVL A;  4HB5 A;  5G05 J;  3VTX A;  3T5X A;  4WWO A;  2CHW A;  4F3V A;  3B7T A;  2MRI A;  1H6K A;  1S70 B;  1WG0 A;  4KBQ A;  3G2S A;  3HYM B;  3PS6 A;  2IQC A;  4ATZ D;  3JXI A;  5AQA A; 
#chains in the Genus database with same CATH homology
 2P9I G;  2P9K G;  1K8K G;  3DXM G;  2P9S G;  2P9N G;  4XEI G;  2P9L G;  1TYQ G;  3UKU G;  1U2V G;  2P9P G;  3RSE G;  3DWL G;  3DXK G;  2P9U G;  3UKR G;  4JD2 G;  3ULE G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...