1TYQG

Crystal structure of arp2/3 complex with bound atp and calcium
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
141
structure length
134
Chain Sequence
FRKVDVDEYDENKFVDEAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Actin-related protein 3
publication title Crystal structures of actin-related protein 2/3 complex with bound ATP or ADP
pubmed doi rcsb
total genus 42
structure length 134
sequence length 141
ec nomenclature
pdb deposition date 2004-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 1tyqG00
2P9NG 3DXMG 1K8KG 3DXKG 2P9PG 1TYQG 3UKUG 3DWLG 4JD2G 3UKRG 3ULEG 2P9KG 3RSEG 2P9UG 1U2VG 2P9LG 2P9IG 4XEIG 2P9SG
chains in the Genus database with same CATH superfamily
1JWFA 3QJZA 4L1BA 4K5AB 3U4TA 3D9OA 5G05J 4A63B 2XPIA 3O48A 2H6GA 5FIOA 2XCBA 4BESA 3LS8A 2X6FA 3R7QA 3B95A 2DZOA 4GMRA 2RFAA 3C3RA 2H6FA 3DXKG 3GZSA 4M7CA 1KPSB 4HI9A 3ASFA 3IKOB 3SF4A 1QNFA 3L13A 4B0ZA 3QDNA 1H2UA 5FZQA 2J07A 3F6QA 3RRUA 2P9LG 3ZYQA 5ENRD 1SA5A 2AVPA 3LXUX 2XRYA 3FTUA 2A4ZA 1IXVA 4KYOB 1TN8A 5CEDB 3MZLB 1N9AA 3R9MA 4GAAA 5FINA 3CVNA 2QFCA 4GMLA 4QFVA 4J8DA 3BU8A 2DWZA 1U3DA 4BTAA 5EN5D 4JXTA 4C0MA 4TUUA 3ESLA 3EIJA 4G1TA 2XS8A 2KZTB 2GW1A 3TWWA 4NIKA 4F53A 2YHEA 5CCMA 5AQBA 4U7EB 4L9PA 3EHMA 5HKPA 5JJ7A 3QARA 1TN6A 5HQ8A 3C72A 3RJVA 5C2YA 3D9KA 1E7VA 3HIZA 3SD5A 5AQ7A 3ASDA 3JUEA 2IY0C 4O1PA 3APFA 4LCTA 4BT9A 2ILRA 2FO1E 2WQ7A 3PEUB 2MHKA 2XGSA 3DSXA 4JA7A 2JABA 4IYPA 3UKRG 1N52A 3U66A 5JJTA 1HO8A 1A5EA 2L6JA 4CDNA 4U8YD 3ZN3A 1TEZA 1V55E 1JUQA 5HRYA 2CG3A 4GPMA 4G8LA 3CV0A 1EYHA 3FUHA 2DCPA 3S7BA 4UWHA 1N4SA 1S0PA 3Q7AA 1SZ9A 2QYUA 3D9IA 5KJKA 1O1SA 3BQOA 3FUMA 4G25A 3CK9A 5FTPA 2P9SG 4XE0A 3DRAA 4K5CA 1AP7A 2AJAA 4FLHA 3FEYA 4LNBA 2ZGGA 5ANRA 2WPVA 5M72A 2XZDG 2LO6A 3SFYA 4OAUC 4XX5A 4U0ZA 1WY6A 2EILE 2IU1A 3FUFA 4UQZA 4HORA 3SGHA 2KBXA 3D9JA 3B7SA 1OWNA 2OVBA 4J8YA 4KZCA 4TXRA 5G04C 3AAAC 1TJCA 5BXOA 4F1PA 3SHFA 2XCCA 3NOGD 4G11A 1XNFA 2OEVA 2R2LA 3UX4A 3ZXPA 2RKKA 2R5SA 2H6HA 1D8DA 3TG5A 4WNDA 1PY1A 3LYAA 3CVPA 3L82A 4HLEA 4WWNA 1JCQA 4HNAD 3B7UX 4M3OA 4CCAA 3UI2A 4GYWA 2WXNA 3MYVA 2KATA 3O4ZA 2FULA 3KAEA 4X8QA 2WM9A 1N0QA 1HZ4A 4ACLA 2R02A 4D10C 1YCSB 1Z3XA 3SY2A 3ENEA 4L23A 4UWFA 1UJJA 2P9UG 4EPZA 3UIPC 1H0AA 3FU5A 5G55A 3FHEA 4FC8A 3CHQA 1K1BA 4EHMA 4BSXA 3NZUA 1LD7A 3TAXA 1TNZA 2CFZA 1Z3YA 1DCQA 4DLQA 2VGXB 3UTMA 1HG2A 3CHMA 4FULA 5EKQD 4CGWA 2B6CA 4GTSA 4U0UA 3JCKC 1E96B 3P1UA 4GZ6A 2Y0BG 4NACA 3SI5A 3FUNA 1Z5SC 1YA0A 4DI4A 3NZSA 3EU5A 2J08A 2WXRA 4GZDA 3I4GA 3OXFA 4I1OB 1EF1C 3E37A 4F6RD 1BU9A 1OWOA 4XIFA 3CVLA 3VLEA 5CRVA 2BKKB 1K8KG 3PZ3A 3FTWA 4GTTA 3HDXA 3FULA 3W9GA 3RRNB 3PEVB 3G2SA 1O1TA 2WB2A 3MGBA 3SBSA 3ZXSA 3DSVA 3J5QB 4PUCA 1U2VG 2RG8A 4HVBA 3PNTB 3MJWA 4W9RA 2XPYA 4J6IA 4JHJA 3P2BA 4BTBA 1KZPA 4UI9K 4C9BB 2NYJA 2VSNA 3NQPA 4YNDA 2IONA 4QQIA 3VLDA 2F8YA 3MKRA 2FBNA 2J8SD 3UXGA 2LNIA 4ACKA 1KT0A 4EZJA 2OEWA 4I17A 2RD0A 4CDRA 4ABNA 3QKYA 4Y6CA 3PREA 3DBSA 4FHJA 4EBAA 2WXPA 3WXXA 1S64A 4DK5A 1O1RA 4OVUA 4DJAA 3D3MA 2NXPA 3ZU7B 1ZU2A 5FZRA 5B3SE 5KJNA 4HRMB 3QNKA 3MV2B 3AS8A 3ULEG 4HI8A 2LAIA 4EBAG 1E90A 3RU0A 2X6HA 3MEKA 4ANVA 3DWLG 1NA0A 2P9KG 4A55A 2DVWA 3HYMB 4J7WA 2KCVA 4G23A 3ZUVB 2PNNA 3S7DA 3UPVA 3FTYA 3T8KA 2PM7A 4Y6WA 5ENNA 2AXZA 4U8HA 3NF1A 1Z6TA 2B0OE 3QK0A 3FDHA 4HRNA 1OY3D 3GZ2A 2NSZA 2V4LA 3CQCB 3G2WA 5FT9A 1H6KA 3APDA 4J8EA 1N0RA 4LUNU 2P9PG 3BG1B 2X3MA 3ASHA 3FP3A 2EQXA 5AARA 2CHWA 1N95A 2OOEA 4A3VA 3ZPJA 4Q69A 5AJLA 1TNYA 4DX6D 1SZAA 3PZ4A 3G2UA 3R9AB 4BT8A 3PUJA 4APFA 1FCHA 2MRIA 3CLJA 2X6KA 1Y8MA 5ENOD 5CBOA 2OV8A 3KD7A 2DBAA 4JW1A 3OXLA 1MQSA 5KNHD 3LPZA 1YMPA 1UOHA 4CYMD 2ZGDA 3DSSA 3TWTA 2V0PA 2XS1A 1DNPA 2JEKA 3ZKJA 5BPPA 2P9NG 1ELWA 3MA5A 3B13A 2VJ8A 2KZTA 3VLFA 1WM5A 4YDEA 1BLXB 1DC2A 3TWXA 4JC8A 3S7JA 3SZ7A 4B8AA 4UWLA 3KSQA 5ARGA 4CEMA 3DSTA 3FUIA 5CECB 1TN7A 5CCLA 3Q4AB 2XGMA 1LD8A 3RO2A 2DZNA 3C5RA 3HXDA 4JHKA 2Y69E 3GYZA 3JQ0A 3RO3A 3URZA 4BY6A 5T4YA 4I2WA 4OAVB 4U95D 4CT4A 3Q79A 3FFLA 3CQGB 4PDXA 4KMOA 5FWQA 3QWWA 3L54A 3ASNE 3IHYA 4J8FA 2XQ0A 1DVPA 1S70B 5BV1A 5LX8A 4O6FA 3FTSA 3U64A 4I6JA 1G3NB 2F8XK 4GZCA 3ZNGA 1Y6IA 4B93B 5FJYA 4FP7A 4LERA 3CSTA 4KZ0A 1QZ2A 3AS4A 3T8MA 3BG0B 1NI1A 4KVOA 3LDZA 5KBAA 3S7FA 1U3CA 2VSXE 5T3RA 4YVOA 2H6IA 4ANXA 2PM6A 4AM9A 3FUDA 3FWVA 3D9HA 4BERA 2WMOA 4GB9A 2YINA 5BW8C 4A3TA 1NZNA 2VSYA 4AY5A 4LG6A 4ATGA 5FQ8A 3PDNA 2FF4A 3E34A 5CHEE 3FH8A 4XEIG 2VYIA 1IYGA 3TWRA 3HXCA 3GW4A 4GZ5A 2PZIA 3KEAA 1OXJA 1WDYA 3UIOC 3C98A 3D9MA 2LSUA 5FQ4A 3CHSA 4BSZB 2NC9A 4XZ4A 3DPYA 2RFMA 2GRRB 4ILIA 5BNWA 4RQIA 3ZRHA 5CEAA 4L2LA 3FY4A 4DI3A 5ENPD 5KJMA 2XHEA 4FA6A 3QWVA 2L0IA 4AP2A 2IQCA 4DX5D 3ML8A 1H19A 4DUIA 1MX4A 1WAO1 3D9LA 5BXUA 3B7BA 3HXEA 3U9WA 1RW2A 3PZ1A 4NURA 5CMYA 4UI9J 4V3IA 3G2VA 3FTZA 4AVXA 1HXIA 4FU3A 4G24A 4PS3A 4C0EA 4JD2G 4JL0A 3LY9A 4KVMA 2VGXA 3RAUA 4XKCA 4DLOA 1E7UA 3OXGA 2KCLA 4DX1A 2EIJE 1HF8A 1P5QA 3CEQA 3D9PA 4AXHA 1QBQA 2HM8A 3L22A 3TWUA 2VGEA 2J9QA 1MX6A 3HG0D 4R7LA 4HOSA 2V4HC 5IY5E 2XZTG 3QAQA 2EIME 4I2ZA 2C0MA 3FU0A 1FT2A 2GRQB 4N5CA 2YNQA 2IOSA 2I1JA 5B1BE 2L9BA 1JPLA 2I1KA 3L17A 1D9SA 3CVQA 2GROB 1BPOA 5ANLA 4I6EA 2IJGX 4BWRA 1YYHA 1MHQA 3L08A 4URKA 1ZB1A 2P2CP 2VTBA 4I1AA 3JXIA 5ARFA 1QQEA 5J08A 2HE0A 2X6JA 2FO7A 4I43A 4RG9A 3E30A 4TUMA 3ZIMA 1TNOA 2GRNB 3ZYMA 2AWIA 5EX3A 4AY6A 4WNGA 4GPKA 3IV0A 3EHNA 3HXBA 3LY7A 3UT4A 3Q78A 3I4RB 1MYOA 2R03A 3CHOA 4CT0A 4RSYA 4WUYA 4WWPA 1INZA 3LEWA 2CHXA 3DPDA 4WAFA 3J5PA 1JCRA 5E76A 3ULQA 1A17A 3CVXA 3L9TA 2KM4A 4YDYA 2YQ8A 4AEZC 3ABKE 2I2OA 1FVFA 4N39A 4PS8A 1JCSA 1HH8A 4IULA 4HRLA 5T8IA 3ZYKA 3CHPA 3HHMA 4AV7A 4ATZD 3OAWA 3BEEA 4JHRA 3ZHEB 2WXLA 3PH0C 4J8SA 3K9IA 2VTBB 5CRUA 4GA0A 5ENSD 5EIDA 4U04A 2WVIA 4LEUA 2F37A 2XPZA 3CKBA 4E85A 1D8EA 1HU3A 3DSUA 2XEEA 2XEHA 1HE8A 3T5VA 3TXMA 4XI9A 5AAOA 2HR2A 5A23A 3Q5MA 4ILGA 4I1MA 2FEZA 4B89A 4HOUA 4G2VA 5JJ6A 2IF4A 2KXPC 5FQ7A 3FTXA 2V5FA 3Q9UC 4BEPA 4ILHB 1ZBPA 2CFUA 3MV3B 4BFRA 3EU9A 2VSOE 3PVLA 1MZCA 3AU5A 3B7RL 4LNUD 4JB8P 2FI7A 3HVEB 1BI7B 4YDWA 3PE4A 1HS6A 1N4QA 5JHAA 4DX2A 3CVUA 3ZEFA 2IO3C 4GTPA 3W9FA 4GYOA 3RIBA 2L0TB 2R05A 4GTMA 4O60A 1EPUA 3RK6A 3DSWA 4EZKA 3TGOA 4ANWA 3X2QE 2J4BA 2X6IA 1H6PA 4DRXE 3ASOE 5EDSA 5A6CA 1LF8A 4K5BA 4OVVA 1S63A 4LRZA 1DCEA 1UN8A 5BT1A 4C48B 3AJIA 4GTRA 3B7TA 4UQYA 3UQ3A 5LCWJ 4GYYA 1RZ4A 4GTQA 1FVHA 2QC9A 3RKVA 3SBTB 4TXPA 2ETCA 5AQAA 2V8SE 4AJWA 3D9NA 4TXQA 4RLYA 3RSEG 1B89A 2KCKA 2WXKA 3Q15A 1XGWA 3IEGA 3UT7A 2HYZA 4RVBA 2XRZA 4KBQA 4UWGA 5G2NA 4UQXA 3Q9NC 1N94A 2GGFA 2Y3AA 3EHRA 4F3VA 5JHBA 1E8XA 3LVQE 3TXNA 3TWVA 4IRUA 3Q75A 4HFGA 1FT1A 1TNUA 3CK7A 2E0IA 3AS5A 3Q7FA 3OTNA 4KXKB 5JMND 3FU3A 3AG2E 1FPPA 3CIAA 5ENTD 4N3BA 4CGVA 2KC7A 3SFZA 1OWLA 1JWGA 4GU5A 3PS6A 5KNGA 4HS2A 4APOA 3HRAA 4AOFA 4B8CB 3EJNA 4J0UA 1N54A 4HQDA 2EIKE 3UMVA 5AQ9A 2V5QC 3AG3E 3SQVA 3SO8A 2WXMA 3HXFA 2QZAA 2WXOA 3E32A 4FLBA 4B94A 1V54E 1E8WA 4UI9C 4GTVA 3DEOA 3ESKA 1PAQA 3CSFA 2HO1A 4JEUA 3JUIA 3EIQC 3ZYLA 3I5PA 3LY8A 2BKGA 2IOLA 5KCMA 4XI0A 2CHZA 3N71A 1PC2A 4I6GA 2UWJG 3Q73A 2GRPB 3AU4A 2F0YA 3ASGA 3SFXA 4NQ0A 2CG2A 3UM1A 2DIWA 5DIZA 1O5MA 1K1AA 3ZFWA 1OUVA 3TWSA 3UKUG 4DPRA 1IQRA 5E75A 5CERB 2AXVA 3QC1A 4CRWA 4UUCA 4HXIA 5KWDA 1AWCB 3PZDA 4MBGA 4Q96A 4GZ3A 3T9KA 3CHRA 3Q49B 2AXUA 3CK8A 4K03A 1X5BA 5EILA 4O1OA 1N4PA 5D66A 4F7AA 1UN9A 2M63A 2X38A 2J4DA 2GRLA 1OCRE 3L16A 4GA1A 4BETA 2A5EA 4HLLA 4P29A 4A1SA 2WQHA 3TL5A 3PZ2A 5KJLA 2Y1LE 3T5XA 2GRMA 3FTVA 2IFUA 2IO2C 1HX8A 2E2EA 4ME2A 1EDUA 4JZYA 2ETBA 3FU6A 2R17C 3TJPA 4WNEA 2ZISA 3CR3A 2Q7FA 3CVWA 3AG1E 2WMNA 3PE3A 2WXQA 3LVRE 4NRHB 3CKCA 4PS7A 3DXMG 3C3OA 4A1GA 4H7XA 1UG3A 3ML9A 3FUEA 2EINE 3UM0A 4WWOA 4N3AA 1KLXA 2LXMA 2PQNA 2ZXWE 3QOUA 2VGYA 2OCCE 2WXFA 1IKND 2ONDA 3CVVA 2R59A 3VTYA 1BI8B 1SVXA 2LAHA 3IBEA 3E4BA 1UW4B 2AW6A 5EYLA 3PRZA 4DX7D 3TWQA 1OCCE 1SW6A 2PL2A 2J49A 4GCNA 2UY1A 5C1DA 4ZFHA 3MCXA 3ZGQA 4BX9A 1H6OA 2I6HA 2ETAA 2LUHA 1ELRA 2VQ2A 1NA3A 4N5QA 3ABME 2P58C 1NFIE 3MX3A 4KT6B 5LOZA 4HB5A 1N11A 2J09A 3APCA 1IHBA 3GZ1A 4MRUA 4MLPA 3KEZA 4HOQA 5CBNA 4L7TA 5ITZF 2WXIA 3JQ1A 2Y4UA 2ZIRA 4IN3B 1KT1A 3UM2A 1OT8A 4U8VD 5AIJA 1K3ZD 5FQ6A 5HI7A 3C3QA 2L6BA 3RRMB 4FJZA 1L5JA 1VDYA 4YVQC 4JPSA 4GTOA 1H2TC 4JVSA 3V2OA 3SNXA 2PQRA 3ONKA 3FEXA 3ZHEA 2UY1B 4PH4B 5BUZA 2WQ6A 2C0LA 3WG7E 3FUKA 4G8KA 3V30A 2MYOA 1Q2ZA 2IEJA 3NOCD 5A7DB 5LCWC 3LJ3A 3V31A 1KZOA 2P9IG 3CGHA 4I9EA 5ENQD 1OCOE 4EECA 4LNGA 3MKQA 2ZU6B 5EX0A 4RG6A 1E8ZA 4GCOA 3LJNA 2A5UA 5AENA 3HVEA 5J90A 3ISMC 2YHCA 2JLBA 1GW6A 1MJ0A 3EUVA 4U63A 3I3NA 5DBKA 4ANUA 3ABLE 2BEDA 3UINC 3FH5A 2XGOA 5AYWD 5EIBE 4K0RA 3KS2A 3EHQA 4I9CA 4BX8A 1OWMA 4G26A 4CDMA 3BUAA 4JA9A 4L2YA 2OVFA 3FH7A 4U0SA 2QY7A 3U3WA 2LXLA 5G04J 1MX2A 4GA2A 1LTXA 4WNFA 5G05C 3MKQB 3IHVA 3QB2A 1IHGA 3NB2A 3FUJA 4N2QA 2QYJA 3QWPA 1ELKA 1TJFA 3ONLA 2DYSE 5CMWA 1HG5A 2WXHA 3NAWA 5D2MC 1SQMA 4UWKA 3EDTB 3IXEA 3LCAA 1QYMA 5LP0A 4EQFA 2WXGA 3DEPA 4YDOA 3V2XA 5AN8A 4Z68A 3PNLB 5HS0A 5BV0A 3NBNB 4GMJA 4FADA 4MS6A 3UM3A 4F1SA 2MOWA 5FZSA 1BD8A 2DYRE 3UUXA 2BUGA 1TYQG 3KSLA 3ULYA 2BF0X 4U96D 1H2VC 3VTXA 4Q94A 1TR4A 4EZLA 4TRQA 2LSVA 1E8YA 2XENA 3E33A 4FJYA 3TG4A 4HOTA 3R7RA 5JA4D 1UJKA 4MKTA 1HFAA 3G2TA 1OWPA 2I9CA 4JEHA 3AG4E 4N2SA 4OYSA 4XKBA 3ZVVA 5LFAA 4LSZE 3S2AA 3V79K 3LKUA 5EYPF 1WG0A 1X81A 2BTDA 2XEVA 3JXJA 1NL4A 2C2LA 4TV3A 5AJDA 3ZW3A 1NP7A 1W3BA 4FHKA 5B1AE 5D0OD 4ZHBA 5H7PA 1SA4A 4N3CA 5D0QD 4HBDA 2WXJA 3PUKA 4E6HA 4U07A 1OCZE 3CVYA 3JYSA 3Q47B 4CZ2D 1IQUA 3UT8A 1N4RA 4H7YA 3L6AA 4AIFA 1TNBA 2Y4TA
chains in the Genus database with same CATH topology
2P9NG 3DXMG 1K8KG 3DXKG 2P9PG 1TYQG 3UKUG 3DWLG 4JD2G 3UKRG 3ULEG 2P9KG 3RSEG 2P9UG 1U2VG 2P9LG 2P9IG 4XEIG 2P9SG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9N G;  3DXM G;  1K8K G;  3DXK G;  2P9P G;  1TYQ G;  3UKU G;  3DWL G;  4JD2 G;  3UKR G;  3ULE G;  2P9K G;  3RSE G;  2P9U G;  1U2V G;  2P9L G;  2P9I G;  4XEI G;  2P9S G; 
#chains in the Genus database with same CATH topology
 1JWF A;  3QJZ A;  4L1B A;  4K5A B;  3U4T A;  3D9O A;  5G05 J;  4A63 B;  2XPI A;  3O48 A;  2H6G A;  5FIO A;  2XCB A;  4BES A;  3LS8 A;  2X6F A;  3R7Q A;  3B95 A;  2DZO A;  4GMR A;  2RFA A;  3C3R A;  2H6F A;  3DXK G;  3GZS A;  4M7C A;  1KPS B;  4HI9 A;  3ASF A;  3IKO B;  3SF4 A;  1QNF A;  3L13 A;  4B0Z A;  3QDN A;  1H2U A;  5FZQ A;  2J07 A;  3F6Q A;  3RRU A;  2P9L G;  3ZYQ A;  5ENR D;  1SA5 A;  2AVP A;  3LXU X;  2XRY A;  3FTU A;  2A4Z A;  1IXV A;  4KYO B;  1TN8 A;  5CED B;  3MZL B;  1N9A A;  3R9M A;  4GAA A;  5FIN A;  3CVN A;  2QFC A;  4GML A;  4QFV A;  4J8D A;  3BU8 A;  2DWZ A;  1U3D A;  4BTA A;  5EN5 D;  4JXT A;  4C0M A;  4TUU A;  3ESL A;  3EIJ A;  4G1T A;  2XS8 A;  2KZT B;  2GW1 A;  3TWW A;  4NIK A;  4F53 A;  2YHE A;  5CCM A;  5AQB A;  4U7E B;  4L9P A;  3EHM A;  5HKP A;  5JJ7 A;  3QAR A;  1TN6 A;  5HQ8 A;  3C72 A;  3RJV A;  5C2Y A;  3D9K A;  1E7V A;  3HIZ A;  3SD5 A;  5AQ7 A;  3ASD A;  3JUE A;  2IY0 C;  4O1P A;  3APF A;  4LCT A;  4BT9 A;  2ILR A;  2FO1 E;  2WQ7 A;  3PEU B;  2MHK A;  2XGS A;  3DSX A;  4JA7 A;  2JAB A;  4IYP A;  3UKR G;  1N52 A;  3U66 A;  5JJT A;  1HO8 A;  1A5E A;  2L6J A;  4CDN A;  4U8Y D;  3ZN3 A;  1TEZ A;  1V55 E;  1JUQ A;  5HRY A;  2CG3 A;  4GPM A;  4G8L A;  3CV0 A;  1EYH A;  3FUH A;  2DCP A;  3S7B A;  4UWH A;  1N4S A;  1S0P A;  3Q7A A;  1SZ9 A;  2QYU A;  3D9I A;  5KJK A;  1O1S A;  3BQO A;  3FUM A;  4G25 A;  3CK9 A;  5FTP A;  2P9S G;  4XE0 A;  3DRA A;  4K5C A;  1AP7 A;  2AJA A;  4FLH A;  3FEY A;  4LNB A;  2ZGG A;  5ANR A;  2WPV A;  5M72 A;  2XZD G;  2LO6 A;  3SFY A;  4OAU C;  4XX5 A;  4U0Z A;  1WY6 A;  2EIL E;  2IU1 A;  3FUF A;  4UQZ A;  4HOR A;  3SGH A;  2KBX A;  3D9J A;  3B7S A;  1OWN A;  2OVB A;  4J8Y A;  4KZC A;  4TXR A;  5G04 C;  3AAA C;  1TJC A;  5BXO A;  4F1P A;  3SHF A;  2XCC A;  3NOG D;  4G11 A;  1XNF A;  2OEV A;  2R2L A;  3UX4 A;  3ZXP A;  2RKK A;  2R5S A;  2H6H A;  1D8D A;  3TG5 A;  4WND A;  1PY1 A;  3LYA A;  3CVP A;  3L82 A;  4HLE A;  4WWN A;  1JCQ A;  4HNA D;  3B7U X;  4M3O A;  4CCA A;  3UI2 A;  4GYW A;  2WXN A;  3MYV A;  2KAT A;  3O4Z A;  2FUL A;  3KAE A;  4X8Q A;  2WM9 A;  1N0Q A;  1HZ4 A;  4ACL A;  2R02 A;  4D10 C;  1YCS B;  1Z3X A;  3SY2 A;  3ENE A;  4L23 A;  4UWF A;  1UJJ A;  2P9U G;  4EPZ A;  3UIP C;  1H0A A;  3FU5 A;  5G55 A;  3FHE A;  4FC8 A;  3CHQ A;  1K1B A;  4EHM A;  4BSX A;  3NZU A;  1LD7 A;  3TAX A;  1TNZ A;  2CFZ A;  1Z3Y A;  1DCQ A;  4DLQ A;  2VGX B;  3UTM A;  1HG2 A;  3CHM A;  4FUL A;  5EKQ D;  4CGW A;  2B6C A;  4GTS A;  4U0U A;  3JCK C;  1E96 B;  3P1U A;  4GZ6 A;  2Y0B G;  4NAC A;  3SI5 A;  3FUN A;  1Z5S C;  1YA0 A;  4DI4 A;  3NZS A;  3EU5 A;  2J08 A;  2WXR A;  4GZD A;  3I4G A;  3OXF A;  4I1O B;  1EF1 C;  3E37 A;  4F6R D;  1BU9 A;  1OWO A;  4XIF A;  3CVL A;  3VLE A;  5CRV A;  2BKK B;  1K8K G;  3PZ3 A;  3FTW A;  4GTT A;  3HDX A;  3FUL A;  3W9G A;  3RRN B;  3PEV B;  3G2S A;  1O1T A;  2WB2 A;  3MGB A;  3SBS A;  3ZXS A;  3DSV A;  3J5Q B;  4PUC A;  1U2V G;  2RG8 A;  4HVB A;  3PNT B;  3MJW A;  4W9R A;  2XPY A;  4J6I A;  4JHJ A;  3P2B A;  4BTB A;  1KZP A;  4UI9 K;  4C9B B;  2NYJ A;  2VSN A;  3NQP A;  4YND A;  2ION A;  4QQI A;  3VLD A;  2F8Y A;  3MKR A;  2FBN A;  2J8S D;  3UXG A;  2LNI A;  4ACK A;  1KT0 A;  4EZJ A;  2OEW A;  4I17 A;  2RD0 A;  4CDR A;  4ABN A;  3QKY A;  4Y6C A;  3PRE A;  3DBS A;  4FHJ A;  4EBA A;  2WXP A;  3WXX A;  1S64 A;  4DK5 A;  1O1R A;  4OVU A;  4DJA A;  3D3M A;  2NXP A;  3ZU7 B;  1ZU2 A;  5FZR A;  5B3S E;  5KJN A;  4HRM B;  3QNK A;  3MV2 B;  3AS8 A;  3ULE G;  4HI8 A;  2LAI A;  4EBA G;  1E90 A;  3RU0 A;  2X6H A;  3MEK A;  4ANV A;  3DWL G;  1NA0 A;  2P9K G;  4A55 A;  2DVW A;  3HYM B;  4J7W A;  2KCV A;  4G23 A;  3ZUV B;  2PNN A;  3S7D A;  3UPV A;  3FTY A;  3T8K A;  2PM7 A;  4Y6W A;  5ENN A;  2AXZ A;  4U8H A;  3NF1 A;  1Z6T A;  2B0O E;  3QK0 A;  3FDH A;  4HRN A;  1OY3 D;  3GZ2 A;  2NSZ A;  2V4L A;  3CQC B;  3G2W A;  5FT9 A;  1H6K A;  3APD A;  4J8E A;  1N0R A;  4LUN U;  2P9P G;  3BG1 B;  2X3M A;  3ASH A;  3FP3 A;  2EQX A;  5AAR A;  2CHW A;  1N95 A;  2OOE A;  4A3V A;  3ZPJ A;  4Q69 A;  5AJL A;  1TNY A;  4DX6 D;  1SZA A;  3PZ4 A;  3G2U A;  3R9A B;  4BT8 A;  3PUJ A;  4APF A;  1FCH A;  2MRI A;  3CLJ A;  2X6K A;  1Y8M A;  5ENO D;  5CBO A;  2OV8 A;  3KD7 A;  2DBA A;  4JW1 A;  3OXL A;  1MQS A;  5KNH D;  3LPZ A;  1YMP A;  1UOH A;  4CYM D;  2ZGD A;  3DSS A;  3TWT A;  2V0P A;  2XS1 A;  1DNP A;  2JEK A;  3ZKJ A;  5BPP A;  2P9N G;  1ELW A;  3MA5 A;  3B13 A;  2VJ8 A;  2KZT A;  3VLF A;  1WM5 A;  4YDE A;  1BLX B;  1DC2 A;  3TWX A;  4JC8 A;  3S7J A;  3SZ7 A;  4B8A A;  4UWL A;  3KSQ A;  5ARG A;  4CEM A;  3DST A;  3FUI A;  5CEC B;  1TN7 A;  5CCL A;  3Q4A B;  2XGM A;  1LD8 A;  3RO2 A;  2DZN A;  3C5R A;  3HXD A;  4JHK A;  2Y69 E;  3GYZ A;  3JQ0 A;  3RO3 A;  3URZ A;  4BY6 A;  5T4Y A;  4I2W A;  4OAV B;  4U95 D;  4CT4 A;  3Q79 A;  3FFL A;  3CQG B;  4PDX A;  4KMO A;  5FWQ A;  3QWW A;  3L54 A;  3ASN E;  3IHY A;  4J8F A;  2XQ0 A;  1DVP A;  1S70 B;  5BV1 A;  5LX8 A;  4O6F A;  3FTS A;  3U64 A;  4I6J A;  1G3N B;  2F8X K;  4GZC A;  3ZNG A;  1Y6I A;  4B93 B;  5FJY A;  4FP7 A;  4LER A;  3CST A;  4KZ0 A;  1QZ2 A;  3AS4 A;  3T8M A;  3BG0 B;  1NI1 A;  4KVO A;  3LDZ A;  5KBA A;  3S7F A;  1U3C A;  2VSX E;  5T3R A;  4YVO A;  2H6I A;  4ANX A;  2PM6 A;  4AM9 A;  3FUD A;  3FWV A;  3D9H A;  4BER A;  2WMO A;  4GB9 A;  2YIN A;  5BW8 C;  4A3T A;  1NZN A;  2VSY A;  4AY5 A;  4LG6 A;  4ATG A;  5FQ8 A;  3PDN A;  2FF4 A;  3E34 A;  5CHE E;  3FH8 A;  4XEI G;  2VYI A;  1IYG A;  3TWR A;  3HXC A;  3GW4 A;  4GZ5 A;  2PZI A;  3KEA A;  1OXJ A;  1WDY A;  3UIO C;  3C98 A;  3D9M A;  2LSU A;  5FQ4 A;  3CHS A;  4BSZ B;  2NC9 A;  4XZ4 A;  3DPY A;  2RFM A;  2GRR B;  4ILI A;  5BNW A;  4RQI A;  3ZRH A;  5CEA A;  4L2L A;  3FY4 A;  4DI3 A;  5ENP D;  5KJM A;  2XHE A;  4FA6 A;  3QWV A;  2L0I A;  4AP2 A;  2IQC A;  4DX5 D;  3ML8 A;  1H19 A;  4DUI A;  1MX4 A;  1WAO 1;  3D9L A;  5BXU A;  3B7B A;  3HXE A;  3U9W A;  1RW2 A;  3PZ1 A;  4NUR A;  5CMY A;  4UI9 J;  4V3I A;  3G2V A;  3FTZ A;  4AVX A;  1HXI A;  4FU3 A;  4G24 A;  4PS3 A;  4C0E A;  4JD2 G;  4JL0 A;  3LY9 A;  4KVM A;  2VGX A;  3RAU A;  4XKC A;  4DLO A;  1E7U A;  3OXG A;  2KCL A;  4DX1 A;  2EIJ E;  1HF8 A;  1P5Q A;  3CEQ A;  3D9P A;  4AXH A;  1QBQ A;  2HM8 A;  3L22 A;  3TWU A;  2VGE A;  2J9Q A;  1MX6 A;  3HG0 D;  4R7L A;  4HOS A;  2V4H C;  5IY5 E;  2XZT G;  3QAQ A;  2EIM E;  4I2Z A;  2C0M A;  3FU0 A;  1FT2 A;  2GRQ B;  4N5C A;  2YNQ A;  2IOS A;  2I1J A;  5B1B E;  2L9B A;  1JPL A;  2I1K A;  3L17 A;  1D9S A;  3CVQ A;  2GRO B;  1BPO A;  5ANL A;  4I6E A;  2IJG X;  4BWR A;  1YYH A;  1MHQ A;  3L08 A;  4URK A;  1ZB1 A;  2P2C P;  2VTB A;  4I1A A;  3JXI A;  5ARF A;  1QQE A;  5J08 A;  2HE0 A;  2X6J A;  2FO7 A;  4I43 A;  4RG9 A;  3E30 A;  4TUM A;  3ZIM A;  1TNO A;  2GRN B;  3ZYM A;  2AWI A;  5EX3 A;  4AY6 A;  4WNG A;  4GPK A;  3IV0 A;  3EHN A;  3HXB A;  3LY7 A;  3UT4 A;  3Q78 A;  3I4R B;  1MYO A;  2R03 A;  3CHO A;  4CT0 A;  4RSY A;  4WUY A;  4WWP A;  1INZ A;  3LEW A;  2CHX A;  3DPD A;  4WAF A;  3J5P A;  1JCR A;  5E76 A;  3ULQ A;  1A17 A;  3CVX A;  3L9T A;  2KM4 A;  4YDY A;  2YQ8 A;  4AEZ C;  3ABK E;  2I2O A;  1FVF A;  4N39 A;  4PS8 A;  1JCS A;  1HH8 A;  4IUL A;  4HRL A;  5T8I A;  3ZYK A;  3CHP A;  3HHM A;  4AV7 A;  4ATZ D;  3OAW A;  3BEE A;  4JHR A;  3ZHE B;  2WXL A;  3PH0 C;  4J8S A;  3K9I A;  2VTB B;  5CRU A;  4GA0 A;  5ENS D;  5EID A;  4U04 A;  2WVI A;  4LEU A;  2F37 A;  2XPZ A;  3CKB A;  4E85 A;  1D8E A;  1HU3 A;  3DSU A;  2XEE A;  2XEH A;  1HE8 A;  3T5V A;  3TXM A;  4XI9 A;  5AAO A;  2HR2 A;  5A23 A;  3Q5M A;  4ILG A;  4I1M A;  2FEZ A;  4B89 A;  4HOU A;  4G2V A;  5JJ6 A;  2IF4 A;  2KXP C;  5FQ7 A;  3FTX A;  2V5F A;  3Q9U C;  4BEP A;  4ILH B;  1ZBP A;  2CFU A;  3MV3 B;  4BFR A;  3EU9 A;  2VSO E;  3PVL A;  1MZC A;  3AU5 A;  3B7R L;  4LNU D;  4JB8 P;  2FI7 A;  3HVE B;  1BI7 B;  4YDW A;  3PE4 A;  1HS6 A;  1N4Q A;  5JHA A;  4DX2 A;  3CVU A;  3ZEF A;  2IO3 C;  4GTP A;  3W9F A;  4GYO A;  3RIB A;  2L0T B;  2R05 A;  4GTM A;  4O60 A;  1EPU A;  3RK6 A;  3DSW A;  4EZK A;  3TGO A;  4ANW A;  3X2Q E;  2J4B A;  2X6I A;  1H6P A;  4DRX E;  3ASO E;  5EDS A;  5A6C A;  1LF8 A;  4K5B A;  4OVV A;  1S63 A;  4LRZ A;  1DCE A;  1UN8 A;  5BT1 A;  4C48 B;  3AJI A;  4GTR A;  3B7T A;  4UQY A;  3UQ3 A;  5LCW J;  4GYY A;  1RZ4 A;  4GTQ A;  1FVH A;  2QC9 A;  3RKV A;  3SBT B;  4TXP A;  2ETC A;  5AQA A;  2V8S E;  4AJW A;  3D9N A;  4TXQ A;  4RLY A;  3RSE G;  1B89 A;  2KCK A;  2WXK A;  3Q15 A;  1XGW A;  3IEG A;  3UT7 A;  2HYZ A;  4RVB A;  2XRZ A;  4KBQ A;  4UWG A;  5G2N A;  4UQX A;  3Q9N C;  1N94 A;  2GGF A;  2Y3A A;  3EHR A;  4F3V A;  5JHB A;  1E8X A;  3LVQ E;  3TXN A;  3TWV A;  4IRU A;  3Q75 A;  4HFG A;  1FT1 A;  1TNU A;  3CK7 A;  2E0I A;  3AS5 A;  3Q7F A;  3OTN A;  4KXK B;  5JMN D;  3FU3 A;  3AG2 E;  1FPP A;  3CIA A;  5ENT D;  4N3B A;  4CGV A;  2KC7 A;  3SFZ A;  1OWL A;  1JWG A;  4GU5 A;  3PS6 A;  5KNG A;  4HS2 A;  4APO A;  3HRA A;  4AOF A;  4B8C B;  3EJN A;  4J0U A;  1N54 A;  4HQD A;  2EIK E;  3UMV A;  5AQ9 A;  2V5Q C;  3AG3 E;  3SQV A;  3SO8 A;  2WXM A;  3HXF A;  2QZA A;  2WXO A;  3E32 A;  4FLB A;  4B94 A;  1V54 E;  1E8W A;  4UI9 C;  4GTV A;  3DEO A;  3ESK A;  1PAQ A;  3CSF A;  2HO1 A;  4JEU A;  3JUI A;  3EIQ C;  3ZYL A;  3I5P A;  3LY8 A;  2BKG A;  2IOL A;  5KCM A;  4XI0 A;  2CHZ A;  3N71 A;  1PC2 A;  4I6G A;  2UWJ G;  3Q73 A;  2GRP B;  3AU4 A;  2F0Y A;  3ASG A;  3SFX A;  4NQ0 A;  2CG2 A;  3UM1 A;  2DIW A;  5DIZ A;  1O5M A;  1K1A A;  3ZFW A;  1OUV A;  3TWS A;  3UKU G;  4DPR A;  1IQR A;  5E75 A;  5CER B;  2AXV A;  3QC1 A;  4CRW A;  4UUC A;  4HXI A;  5KWD A;  1AWC B;  3PZD A;  4MBG A;  4Q96 A;  4GZ3 A;  3T9K A;  3CHR A;  3Q49 B;  2AXU A;  3CK8 A;  4K03 A;  1X5B A;  5EIL A;  4O1O A;  1N4P A;  5D66 A;  4F7A A;  1UN9 A;  2M63 A;  2X38 A;  2J4D A;  2GRL A;  1OCR E;  3L16 A;  4GA1 A;  4BET A;  2A5E A;  4HLL A;  4P29 A;  4A1S A;  2WQH A;  3TL5 A;  3PZ2 A;  5KJL A;  2Y1L E;  3T5X A;  2GRM A;  3FTV A;  2IFU A;  2IO2 C;  1HX8 A;  2E2E A;  4ME2 A;  1EDU A;  4JZY A;  2ETB A;  3FU6 A;  2R17 C;  3TJP A;  4WNE A;  2ZIS A;  3CR3 A;  2Q7F A;  3CVW A;  3AG1 E;  2WMN A;  3PE3 A;  2WXQ A;  3LVR E;  4NRH B;  3CKC A;  4PS7 A;  3DXM G;  3C3O A;  4A1G A;  4H7X A;  1UG3 A;  3ML9 A;  3FUE A;  2EIN E;  3UM0 A;  4WWO A;  4N3A A;  1KLX A;  2LXM A;  2PQN A;  2ZXW E;  3QOU A;  2VGY A;  2OCC E;  2WXF A;  1IKN D;  2OND A;  3CVV A;  2R59 A;  3VTY A;  1BI8 B;  1SVX A;  2LAH A;  3IBE A;  3E4B A;  1UW4 B;  2AW6 A;  5EYL A;  3PRZ A;  4DX7 D;  3TWQ A;  1OCC E;  1SW6 A;  2PL2 A;  2J49 A;  4GCN A;  2UY1 A;  5C1D A;  4ZFH A;  3MCX A;  3ZGQ A;  4BX9 A;  1H6O A;  2I6H A;  2ETA A;  2LUH A;  1ELR A;  2VQ2 A;  1NA3 A;  4N5Q A;  3ABM E;  2P58 C;  1NFI E;  3MX3 A;  4KT6 B;  5LOZ A;  4HB5 A;  1N11 A;  2J09 A;  3APC A;  1IHB A;  3GZ1 A;  4MRU A;  4MLP A;  3KEZ A;  4HOQ A;  5CBN A;  4L7T A;  5ITZ F;  2WXI A;  3JQ1 A;  2Y4U A;  2ZIR A;  4IN3 B;  1KT1 A;  3UM2 A;  1OT8 A;  4U8V D;  5AIJ A;  1K3Z D;  5FQ6 A;  5HI7 A;  3C3Q A;  2L6B A;  3RRM B;  4FJZ A;  1L5J A;  1VDY A;  4YVQ C;  4JPS A;  4GTO A;  1H2T C;  4JVS A;  3V2O A;  3SNX A;  2PQR A;  3ONK A;  3FEX A;  3ZHE A;  2UY1 B;  4PH4 B;  5BUZ A;  2WQ6 A;  2C0L A;  3WG7 E;  3FUK A;  4G8K A;  3V30 A;  2MYO A;  1Q2Z A;  2IEJ A;  3NOC D;  5A7D B;  5LCW C;  3LJ3 A;  3V31 A;  1KZO A;  2P9I G;  3CGH A;  4I9E A;  5ENQ D;  1OCO E;  4EEC A;  4LNG A;  3MKQ A;  2ZU6 B;  5EX0 A;  4RG6 A;  1E8Z A;  4GCO A;  3LJN A;  2A5U A;  5AEN A;  3HVE A;  5J90 A;  3ISM C;  2YHC A;  2JLB A;  1GW6 A;  1MJ0 A;  3EUV A;  4U63 A;  3I3N A;  5DBK A;  4ANU A;  3ABL E;  2BED A;  3UIN C;  3FH5 A;  2XGO A;  5AYW D;  5EIB E;  4K0R A;  3KS2 A;  3EHQ A;  4I9C A;  4BX8 A;  1OWM A;  4G26 A;  4CDM A;  3BUA A;  4JA9 A;  4L2Y A;  2OVF A;  3FH7 A;  4U0S A;  2QY7 A;  3U3W A;  2LXL A;  5G04 J;  1MX2 A;  4GA2 A;  1LTX A;  4WNF A;  5G05 C;  3MKQ B;  3IHV A;  3QB2 A;  1IHG A;  3NB2 A;  3FUJ A;  4N2Q A;  2QYJ A;  3QWP A;  1ELK A;  1TJF A;  3ONL A;  2DYS E;  5CMW A;  1HG5 A;  2WXH A;  3NAW A;  5D2M C;  1SQM A;  4UWK A;  3EDT B;  3IXE A;  3LCA A;  1QYM A;  5LP0 A;  4EQF A;  2WXG A;  3DEP A;  4YDO A;  3V2X A;  5AN8 A;  4Z68 A;  3PNL B;  5HS0 A;  5BV0 A;  3NBN B;  4GMJ A;  4FAD A;  4MS6 A;  3UM3 A;  4F1S A;  2MOW A;  5FZS A;  1BD8 A;  2DYR E;  3UUX A;  2BUG A;  1TYQ G;  3KSL A;  3ULY A;  2BF0 X;  4U96 D;  1H2V C;  3VTX A;  4Q94 A;  1TR4 A;  4EZL A;  4TRQ A;  2LSV A;  1E8Y A;  2XEN A;  3E33 A;  4FJY A;  3TG4 A;  4HOT A;  3R7R A;  5JA4 D;  1UJK A;  4MKT A;  1HFA A;  3G2T A;  1OWP A;  2I9C A;  4JEH A;  3AG4 E;  4N2S A;  4OYS A;  4XKB A;  3ZVV A;  5LFA A;  4LSZ E;  3S2A A;  3V79 K;  3LKU A;  5EYP F;  1WG0 A;  1X81 A;  2BTD A;  2XEV A;  3JXJ A;  1NL4 A;  2C2L A;  4TV3 A;  5AJD A;  3ZW3 A;  1NP7 A;  1W3B A;  4FHK A;  5B1A E;  5D0O D;  4ZHB A;  5H7P A;  1SA4 A;  4N3C A;  5D0Q D;  4HBD A;  2WXJ A;  3PUK A;  4E6H A;  4U07 A;  1OCZ E;  3CVY A;  3JYS A;  3Q47 B;  4CZ2 D;  1IQU A;  3UT8 A;  1N4R A;  4H7Y A;  3L6A A;  4AIF A;  1TNB A;  2Y4T A; 
#chains in the Genus database with same CATH homology
 2P9N G;  3DXM G;  1K8K G;  3DXK G;  2P9P G;  1TYQ G;  3UKU G;  3DWL G;  4JD2 G;  3UKR G;  3ULE G;  2P9K G;  3RSE G;  2P9U G;  1U2V G;  2P9L G;  2P9I G;  4XEI G;  2P9S G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...