4C0MA

Crystal structure of the n terminal domain of wild type trif (tir- domain-containing adapter-inducing interferon-beta)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
140
structure length
140
Chain Sequence
GPSLPSAFDILGAAGQDKLLYLKHKLKTPRPGCQGQDLLHAMVLLKLGQETEARISLEALKADAVARLVARQWAGVDSTEDPEEPPDVSWAVARLYHLLAEEKLCPASLRDVAYQEAVRTLSSRDDHRLGELQDEARNRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Tlr Signalling Adaptor Trif/Ticam-1 Has an N-Terminal Helical Domain with Structural Similarity to Ifit Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords TIR DOMAIN-CONTAINING ADAPTER MOLECULE 1
total genus 48
structure length 140
sequence length 140
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17798 TRIF-NTD TRIF N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.780 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4c0mA00
4C0MA 4BSXA 2M63A
chains in the Genus database with same CATH superfamily
4GTMA 3U9WA 3CHMA 4JD2G 2VJ8A 2LNIA 3ZYMA 4W9RA 5E76A 4P29A 4MBGA 2P2CP 3OTNA 3CVYA 3TWXA 2EIJE 2LAIA 1UG3A 3FUIA 3ISMC 2YHEA 3B7UX 3SZ7A 1QNFA 4MS6A 4ANXA 4AP2A 1SQMA 1OT8A 3UXGA 4LG6A 4L2LA 4BTAA 4ILIA 4J7WA 4ANUA 4K5CA 3F6QA 4CCAA 3ZYLA 1DC2A 4PS8A 2WMNA 2LAHA 3LVRE 2XGSA 3FH8A 3D9OA 3E34A 4WNFA 3HVEB 4I1OB 1U3CA 3EHRA 1SW6A 1UN9A 2CHXA 3O4ZA 4DLOA 4A3TA 1MX6A 3QOUA 2JEKA 5DIZA 2V0PA 2ETBA 3SHFA 5B3SE 4GA2A 4LNGA 3I5PA 3NZSA 5LX8A 3HIZA 3PUKA 3Q49B 4TXPA 1TNBA 4GA0A 1ELRA 4F7AA 4IYPA 1YYHA 3FUEA 5D0OD 2A4ZA 4GZDA 4CEMA 5FZSA 3T8KA 3FTUA 1K3ZD 2X6HA 3G2WA 2FULA 4XI0A 4HBDA 2LUHA 5G55A 4BSZB 1FCHA 3V30A 2F0YA 4B94A 3ZU7B 4TUMA 5KJMA 4TUUA 4CYMD 4GPKA 4BX9A 5B1BE 4CGVA 1KLXA 1OCRE 3K9IA 2F8XK 3UMVA 4BSXA 2OCCE 2NXPA 3ZHEA 5LP0A 3DPYA 5LCWC 4B8AA 2XPZA 1H6OA 3TG5A 2AXVA 3R9MA 3CVPA 3ASNE 5FQ7A 4Y6WA 5FIOA 3HVEA 1W3BA 2FEZA 3CSTA 3JXJA 2IF4A 4OVUA 3S7JA 5AQAA 4ZFHA 4JHKA 5G04C 2QYUA 4B8CB 3SD5A 1KT0A 4GZ5A 3U64A 4FULA 2H6GA 3RSEG 4A55A 1TN7A 1KT1A 1X81A 4MRUA 3SF4A 3OXFA 4HOQA 4HFGA 3U4TA 1EDUA 1Y8MA 2VSNA 5EX3A 3ENEA 3NAWA 4UQYA 3VLDA 3PZ1A 2B0OE 2X6FA 1LD8A 2UY1B 1E90A 1E96B 1UN8A 4QFVA 4GCOA 3PEUB 1U3DA 3QWVA 4F3VA 5ENOD 1N4RA 4AOFA 1N0RA 4Q69A 1E8WA 2HM8A 3NB2A 2VGXA 2JABA 4N3CA 2WVIA 4JA9A 2H6FA 4BWRA 3DSTA 4BESA 4BT9A 5AENA 3RRMB 3ZUVB 3LXUX 3CEQA 1N0QA 2AW6A 2X3MA 2Y3AA 3GZSA 1OXJA 3ABLE 1ELWA 5EIBE 5CCMA 3ASOE 1FVHA 1E7UA 2X38A 2CFZA 3ASDA 3T8MA 3Q78A 5HQ8A 1NFIE 3Q7AA 3ZNGA 2IY0C 3UM0A 4GTOA 3L08A 2V5FA 3CHSA 4ZHBA 1OWNA 1HH8A 1TN6A 3DXMG 2L6JA 3IKOB 4XIFA 2DIWA 4G11A 5H7PA 4DRXE 3RAUA 1O1SA 4L2YA 3QWWA 4J0UA 4KXKB 1JCQA 4G8KA 5JHAA 4XEIG 4KT6B 5ENQD 3SFZA 5KJLA 2CFUA 3P2BA 5BW8C 3Q7FA 3HXBA 1IYGA 5T4YA 2DBAA 3MZLB 1RZ4A 3EHMA 3FU3A 2XEHA 4F1PA 4HOTA 4AV7A 4I2ZA 5KNGA 1K1AA 3C3QA 1IHGA 3PE3A 4DX7D 5BXOA 5HS0A 2IQCA 4J8DA 4UUCA 3SGHA 3AG3E 4GTRA 4ABNA 3LYAA 4N5QA 3BQOA 1SZAA 2LSUA 5FZQA 4OAUC 4X8QA 1ZB1A 4G24A 2ZISA 2HYZA 2OVFA 2YQ8A 2RKKA 5KCMA 2R59A 4PS7A 3Q47B 2WXIA 4NIKA 5ENNA 4H7XA 4DJAA 3VLEA 4GB9A 2MYOA 3Q75A 5EYPF 3ZGQA 1G3NB 4IN3B 3U66A 4C0MA 4GAAA 5ARGA 3PE4A 2RFMA 2EINE 3RO3A 4O1PA 3B95A 2V4HC 2LXLA 3ZRHA 2HR2A 2FBNA 3CVNA 2OOEA 4K5AB 4ILGA 4DI4A 4CT4A 1NZNA 1H6KA 1PAQA 3EIJA 3UT4A 4OVVA 2P9LG 1WDYA 2XZTG 1D8DA 3UIOC 3FUNA 3UX4A 4N3AA 3FULA 4Q94A 4AY5A 4WWNA 4BEPA 3D9MA 2VSOE 3IHYA 4I1MA 2A5UA 1N4PA 4ATZD 4I9EA 5AYWD 4HNAD 4RG6A 2BF0X 1D8EA 4U8YD 2PNNA 2WQ7A 4V3IA 1TNZA 5BNWA 4LUNU 4PS3A 3TWQA 1O1TA 3JUEA 2P9IG 2YINA 3FEYA 3C3RA 1VDYA 5FINA 3AU5A 3SI5A 1PC2A 4JEUA 1SA5A 2WXKA 4IRUA 3TWUA 4B0ZA 2X6KA 2EIME 3FUFA 3WXXA 4DX6D 2IOSA 2WXLA 3CQCB 1Q2ZA 1MZCA 2RG8A 3CQGB 4CT0A 2BKGA 1N4QA 4CRWA 5DBKA 4L9PA 2WM9A 5BXUA 4GMJA 1OUVA 5CBNA 3FY4A 5EDSA 4DPRA 2ZGGA 3L54A 1OCZE 1SVXA 3LEWA 5ARFA 5D66A 2V5QC 2XZDG 1XGWA 1YCSB 1Z3YA 3DSUA 3DXKG 1TJCA 3KEAA 2J4BA 1N9AA 4U8HA 4N3BA 3ESLA 3QKYA 2WXFA 3NOGD 3R7QA 3BU8A 3DPDA 2VSXE 3PREA 4J8EA 1JCSA 4WUYA 3UQ3A 3LJ3A 2ETCA 5G05C 4DLQA 2BEDA 3CR3A 3C72A 2F37A 1EYHA 2J49A 5G05J 3D9PA 3GZ1A 5JJ6A 2MHKA 5FJYA 3L6AA 3UT8A 3ZYKA 3V31A 2WXPA 4Y6CA 2ZIRA 1S70B 2R5SA 3QDNA 4G1TA 4U63A 2Q7FA 4J8FA 1UW4B 4K03A 1OWOA 3D9JA 3ZVVA 3Q5MA 2J07A 3SQVA 4HRNA 3BEEA 1K1BA 4O6FA 3DSWA 3EHQA 5JJ7A 3V2XA 2ZU6B 2VQ2A 5FZRA 5AQBA 3PZ4A 2P9NG 1JCRA 2JLBA 2WXOA 1HZ4A 1S64A 2OEWA 2LSVA 3B7TA 1MJ0A 3PVLA 3Q15A 3UM2A 1MHQA 2VGXB 1E8XA 4RG9A 1MX4A 3UINC 2DYSE 2CHZA 2UWJG 3LY9A 2R17C 3LY8A 3ZYQA 4APOA 2PQNA 3Q9NC 4B89A 1P5QA 2GRPB 3UM1A 3IBEA 2WXMA 3ZN3A 4U8VD 3FP3A 5AIJA 4MLPA 3ASGA 3FUHA 1LTXA 3RIBA 4BT8A 4I43A 3FTSA 3DEOA 2L6BA 1BU9A 4EZKA 1NP7A 2FF4A 3UKRG 3FTZA 3C3OA 3B13A 3CV0A 2OV8A 3AU4A 3AS8A 4L23A 1UJJA 3J5QB 3ZW3A 1IHBA 3CKBA 3BG0B 2WQ6A 2GRRB 3MX3A 4H7YA 4FA6A 1QYMA 3JQ1A 5T3RA 1H19A 4KZ0A 2Y4UA 3ML8A 5FTPA 1GW6A 3FEXA 2GRLA 3HXEA 3UT7A 5LFAA 4AXHA 3J5PA 3ML9A 4A63B 2DYRE 5CEDB 3MKRA 5BV0A 4WNGA 1WG0A 3CK8A 3ZEFA 2L0IA 1OWMA 5KBAA 2XCBA 1H2TC 4I6EA 5AQ7A 4AEZC 4I17A 5JJTA 3ZFWA 2VGEA 2BUGA 1O5MA 5C1DA 2NSZA 3NBNB 2DVWA 2KZTB 5AJLA 1AP7A 4KVOA 5CBOA 1H2UA 4I6GA 4XX5A 5CEAA 3TG4A 4ATGA 3D9HA 4HLEA 3V79K 4MKTA 3LPZA 2GROB 2EILE 3CHPA 1NL4A 2B6CA 4NRHB 3O48A 3CSFA 2AJAA 3SFXA 3ZXPA 2IEJA 4DX1A 2VSYA 2LO6A 3APCA 3PZ2A 4XKCA 3AJIA 5HI7A 5EILA 3NOCD 1DCQA 1WY6A 4GU5A 3ASHA 4G2VA 3CHQA 2KCKA 3FDHA 4APFA 4G23A 3URZA 4U04A 4JW1A 4FU3A 4GZ3A 3MEKA 2AXZA 2XQ0A 3B7RL 3PH0C 3CK7A 3DSVA 5CCLA 3KEZA 5A23A 3RU0A 3U3WA 3DRAA 3UPVA 3UKUG 4DX5D 1H2VC 1OY3D 4GTVA 3JQ0A 3T9KA 4LEUA 3CVWA 3QAQA 1HS6A 3SO8A 4Z68A 4UQXA 1NA3A 3FUMA 5CECB 2EQXA 4WNEA 4QQIA 3QB2A 4G26A 3RK6A 1JWGA 3ULQA 4U95D 2HO1A 3TJPA 4WAFA 5AAOA 5LCWJ 1EF1C 3UI2A 2R03A 4TXRA 2DCPA 3ULEG 3HRAA 4YDOA 3HXCA 1HG2A 3D9IA 1TN8A 2XENA 2XGMA 2KC7A 5FQ6A 5KJNA 4EQFA 4CDRA 4XE0A 2XGOA 4HRMB 3FWVA 1BD8A 4C9BB 2YHCA 5EX0A 4JXTA 3FH7A 2E2EA 3G2UA 1WM5A 2XCCA 3MKQB 1OWLA 4A3VA 1TNUA 1S63A 1E7VA 4GYWA 1TR4A 2BKKB 2IOLA 5BV1A 1AWCB 4EPZA 4L1BA 4N2SA 3L16A 1SA4A 4I2WA 1E8YA 2IJGX 2A5EA 3Q79A 1UOHA 4EECA 3E4BA 1TNYA 4U0SA 2ONDA 4E6HA 3B7BA 3EDTB 1TNOA 2BTDA 3MYVA 2AWIA 2WXJA 5J90A 3CIAA 3LJNA 4HXIA 5CMWA 4N2QA 3CLJA 3Q4AB 4E85A 3L17A 2GW1A 4HORA 3RRNB 1HE8A 4A1GA 1QZ2A 2R05A 1MX2A 2KCLA 3DEPA 3LCAA 4U96D 3HHMA 1OWPA 4TRQA 2FO1E 4NACA 5D2MC 2XS1A 3MV3B 2V4LA 4EBAG 5A7DB 2CG2A 3OAWA 3TGOA 4ACLA 1KZOA 1B89A 4GZ6A 3GW4A 3FUKA 3UUXA 3LVQE 3MV2B 4FLBA 5FQ4A 1U2VG 5ANLA 2DWZA 4D10C 1HU3A 4GYYA 4GYOA 1BI7B 4HS2A 2XPYA 3FUDA 2WXQA 5T8IA 5EIDA 2P9SG 4WNDA 2J9QA 3GZ2A 2NYJA 4FADA 2IONA 4O1OA 2WQHA 1RW2A 3QARA 1NA0A 2R02A 3ONKA 3KD7A 3TWVA 2KBXA 5BT1A 3CHOA 1ZU2A 3NZUA 3TL5A 3JYSA 3PUJA 4L7TA 5J08A 4AM9A 3E32A 1TEZA 1WAO1 5G04J 4YDYA 3KSQA 3P1UA 1OCCE 3LDZA 4YNDA 5ENTD 3EJNA 3G2SA 2H6HA 1JUQA 2I2OA 3ABKE 1N94A 5B1AE 1INZA 2R2LA 1S0PA 4RQIA 4EZLA 2C2LA 3UTMA 2J09A 2KCVA 4PDXA 3QJZA 4LSZE 1FT1A 3UM3A 3LY7A 3FTXA 4JB8P 4EBAA 2PM7A 3TXMA 4GCNA 2XRYA 4LRZA 3WG7E 3JCKC 2L0TB 1Y6IA 4DK5A 2I6HA 2UY1A 1E8ZA 4F1SA 2IO2C 2FI7A 4GA1A 2OVBA 4LNUD 5CHEE 3VTXA 4N39A 2VTBA 3NQPA 3C98A 3ZPJA 3CVXA 3CK9A 4HOSA 3Q9UC 3HXFA 3APFA 2QFCA 3G2VA 4J6IA 1PY1A 4O60A 1A5EA 1BI8B 5JA4D 3EHNA 3ZKJA 3BG1B 1OCOE 1EPUA 3PS6A 3TWRA 3ABME 3D9KA 3UIPC 4FJZA 2J4DA 1NI1A 3CKCA 4LCTA 3S7BA 3AG4E 5ENPD 2L9BA 5CERB 4GTQA 3D3MA 4FLHA 4XKBA 1D9SA 4HLLA 3L13A 3AG1E 1V54E 4U7EB 2KM4A 2KXPC 2X6JA 2WXNA 3SBSA 2NC9A 1HXIA 1N52A 2J8SD 4YVOA 1JWFA 3DSSA 1QQEA 2ILRA 3FU6A 5IY5E 3CVLA 2F8YA 3S7DA 3TWTA 3SNXA 2ZXWE 1N95A 1UJKA 3C5RA 5HRYA 2WXGA 3BUAA 2I9CA 4UI9C 2QYJA 2HE0A 5JHBA 5FT9A 1H0AA 1N54A 2IO3C 4Q96A 4DI3A 1HG5A 2J08A 5HKPA 1K8KG 4CGWA 2XRZA 4XZ4A 3OXLA 1DNPA 3I4GA 3Q73A 4FHKA 1HX8A 3TWWA 1LF8A 1IQUA 2KATA 4RVBA 4URKA 3RRUA 3SBTB 3CVUA 2C0LA 3HXDA 5AJDA 1V55E 4GTTA 3L22A 4ILHB 5AN8A 2DZNA 4F53A 4AJWA 3MA5A 4PUCA 2OEVA 5E75A 2WB2A 1TYQG 1Z6TA 2CHWA 3ULYA 3EIQC 3ZXSA 2MOWA 3QNKA 5ANRA 4HVBA 3FHEA 3PNTB 3JXIA 3QC1A 4JZYA 4BX8A 3W9FA 1Z5SC 5M72A 4AVXA 4DUIA 2PZIA 2QC9A 3IEGA 4WWPA 4JHJA 5ENRD 3VTYA 2XPIA 2ZGDA 4HQDA 1ZBPA 3DBSA 3APDA 2XHEA 1MYOA 1FPPA 2P58C 3KS2A 4C0EA 4NQ0A 2LXMA 4JL0A 3CVQA 1YMPA 3RO2A 3ESKA 4LERA 4A1SA 4M7CA 4GTSA 5CRUA 1FT2A 2PM6A 4K5BA 2CG3A 3R7RA 5KWDA 3FTVA 1HO8A 4EZJA 2P9PG 5AQ9A 3LKUA 4DX2A 3EU9A 4I9CA 5EYLA 4G25A 3E37A 5AARA 3FH5A 1QBQA 4RSYA 5EKQD 2P9UG 2WXRA 4RLYA 2EIKE 3DWLG 2IFUA 4YDWA 3CGHA 4GMRA 4UI9K 4M3OA 4YDEA 4U07A 3L82A 2GRMA 4WWOA 1A17A 4BTBA 4JEHA 4I1AA 5ITZF 1SZ9A 2FO7A 3N71A 1IQRA 1FVFA 3HDXA 3PZDA 2IU1A 3AAAC 1Z3XA 5JMND 4GMLA 5LOZA 4HRLA 3SFYA 1DCEA 5BPPA 3IV0A 3CHRA 4IULA 4TV3A 2RD0A 2VYIA 4JC8A 3S2AA 3T5XA 3OXGA 1DVPA 3PDNA 4U0ZA 1JPLA 3RJVA 4BETA 4JPSA 4FHJA 4BERA 4ME2A 2M63A 4NURA 3FU0A 4CZ2D 4GPMA 3JUIA 2Y69E 4K0RA 3GYZA 5ENSD 3ASFA 3RKVA 5FQ8A 4CDNA 3FTWA 4JA7A 4LNBA 2H6IA 3FTYA 4JVSA 4UWHA 2AXUA 5KJKA 3R9AB 2GRNB 1IKND 2QY7A 2VTBB 3E33A 3KAEA 4BY6A 1L5JA 4JHRA 2MRIA 4AY6A 3E30A 3G2TA 5G2NA 4KZCA 3ZHEB 4ACKA 4UWGA 2ETAA 2KZTA 1ELKA 3AS5A 2VGYA 3KSLA 4OAVB 2XS8A 3D9LA 3FU5A 4C48B 3X2QE 1HFAA 3V2OA 3MJWA 4KVMA 3LS8A 4AIFA 4CDMA 3QK0A 4UI9J 2RFAA 2WMOA 2QZAA 3VLFA 1BPOA 3NF1A 5A6CA 1X5BA 4PH4B 4F6RD 4BFRA 3TAXA 2E0IA 2I1KA 3SY2A 3PZ3A 4J8YA 3T5VA 4J8SA 2Y1LE 1YA0A 3MCXA 2V8SE 2X6IA 4GTPA 2DZOA 3DSXA 4HI9A 5EN5D 5BUZA 3HG0D 4B93B 3MKQA 3TXNA 4ANVA 2GRQB 1N4SA 3EU5A 5CMYA 3L9TA 4GZCA 2WXHA 3EUVA 3ZIMA 4UQZA 1N11A 4TXQA 4I6JA 2P9KG 4KMOA 2GGFA 1BLXB 4U0UA 4N5CA 4FC8A 2I1JA 3S7FA 5KNHD 5D0QD 3CVVA 2AVPA 4HI8A 1MQSA 1XNFA 3PEVB 5C2YA 1H6PA 2PQRA 3PRZA 5CRVA 1LD7A 3IHVA 3W9GA 3AS4A 4HB5A 4UWLA 3TWSA 3ONLA 4HOUA 1TJFA 4OYSA 4UWKA 1O1RA 3PNLB 2Y4TA 3B7SA 1KZPA 2Y0BG 1KPSB 4ANWA 4KYOB 2XEEA 4XI9A 5FWQA 4KBQA 3FUJA 2WPVA 3HYMB 2YNQA 4EHMA 3AG2E 1IXVA 2C0MA 3I4RB 4UWFA 4FP7A 3D9NA 4FJYA 1HF8A 2XEVA 3FFLA 2PL2A 4R7LA 3I3NA 3IXEA 3QWPA 3MGBA 4YVQC 4G8LA
chains in the Genus database with same CATH topology
1UJKA 3U9WA 4JW1A 2WXGA 3CHMA 4FU3A 4GZ3A 2I9CA 3FUNA 3UX4A 4UI9C 2VJ8A 2LNIA 3MEKA 3ZYMA 4W9RA 5E76A 2AXZA 4N3AA 4P29A 5JHBA 2XQ0A 3B7RL 1H0AA 3FULA 5FT9A 1N54A 3OTNA 4Q94A 3CVYA 4AY5A 3PH0C 4WWNA 2LAIA 4Q96A 3CK7A 4DI3A 3D9MA 1UG3A 2VSOE 1HG5A 3FUIA 2J08A 3IHYA 3KEZA 4I1MA 2A5UA 5CCLA 2YHEA 5A23A 3B7UX 3SZ7A 4CGWA 4I9EA 1QNFA 5AYWD 4MS6A 4ANXA 4AP2A 3RU0A 1SQMA 4XZ4A 3U3WA 2XRZA 3UPVA 3OXLA 1DNPA 3I4GA 4RG6A 2BF0X 4FHKA 1H2VC 2WQ7A 1HX8A 4L2LA 4BTAA 4V3IA 1LF8A 1IQUA 2KATA 4ILIA 4RVBA 4URKA 3JQ0A 4LEUA 3CVWA 3RRUA 3QAQA 4ANUA 1HS6A 5BNWA 4CCAA 4LUNU 4PS3A 3SBTB 3ZYLA 3CVUA 4UQXA 1NA3A 3FUMA 2C0LA 2EQXA 4WNEA 4PS8A 2WMNA 2LAHA 5AJDA 3QB2A 3LVRE 2XGSA 3FH8A 4G26A 3RK6A 2YINA 3D9OA 3L22A 4ILHB 3FEYA 1JWGA 3ULQA 1VDYA 4F53A 4AJWA 3MA5A 4PUCA 2HO1A 3AU5A 5E75A 3SI5A 4WNFA 1PC2A 2WB2A 4JEUA 3TJPA 1Z6TA 3HVEB 2CHWA 4I1OB 1U3CA 2WXKA 4IRUA 3EIQC 4WAFA 5LCWJ 1UN9A 1EF1C 3ZXSA 2MOWA 3QNKA 5ANRA 2CHXA 4HVBA 3FHEA 3PNTB 2X6KA 4B0ZA 3O4ZA 4DLOA 3FUFA 3WXXA 2DCPA 3QC1A 4A3TA 4JZYA 3QOUA 2JEKA 5DIZA 4BX8A 2V0PA 1HG2A 2IOSA 3D9IA 3SHFA 2XGMA 4GA2A 5M72A 4AVXA 2WXLA 2KC7A 3I5PA 5FQ6A 3CQCB 4EQFA 2PZIA 4XE0A 2RG8A 4CDRA 5KJNA 2XGOA 3CQGB 3IEGA 3FWVA 3NZSA 4JHJA 4WWPA 4C9BB 4CT0A 5LX8A 3HIZA 2YHCA 3VTYA 2XPIA 3PUKA 5EX0A 4JXTA 3Q49B 4CRWA 3FH7A 2E2EA 4GA0A 1ELRA 5DBKA 4F7AA 1ZBPA 3DBSA 3G2UA 2WM9A 4IYPA 3APDA 3FUEA 5D0OD 4GMJA 2XHEA 1OUVA 2A4ZA 3FY4A 2P58C 1WM5A 4GZDA 2XCCA 3KS2A 5EDSA 4DPRA 3MKQB 1OWLA 4A3VA 4CEMA 5FZSA 3FTUA 2X6HA 4C0EA 4NQ0A 3G2WA 3L54A 1E7VA 4JL0A 3CVQA 2FULA 4XI0A 3LEWA 4GYWA 5ARFA 3RO2A 3ESKA 4LERA 5G55A 4A1SA 2IOLA 1FCHA 5BV1A 1XGWA 4B94A 1Z3YA 2PM6A 5KJMA 2CG3A 3R7RA 1TJCA 3FTVA 4EPZA 1HO8A 4L1BA 4TUUA 4EZJA 4GPKA 2J4BA 4U8HA 4BX9A 3LKUA 4N2SA 3L16A 4N3BA 4CGVA 3ESLA 4I2WA 1E8YA 2IJGX 3QKYA 4I9CA 2WXFA 1KLXA 4G25A 3K9IA 4EECA 3E4BA 3R7QA 3FH5A 3DPDA 4RSYA 5EKQD 4U0SA 3UMVA 4BSXA 2VSXE 3PREA 2WXRA 4J8EA 2ONDA 2NXPA 4WUYA 3UQ3A 3LJ3A 2IFUA 3EDTB 4E6HA 3CGHA 5G05C 4DLQA 2BTDA 3CR3A 3ZHEA 1EYHA 2J49A 5G05J 3D9PA 3MYVA 4UI9K 5LP0A 4M3OA 2AWIA 4U07A 5LCWC 4WWOA 2GRMA 3GZ1A 5JJ6A 1A17A 4B8AA 4BTBA 2MHKA 5FJYA 2WXJA 4JEHA 2XPZA 3CIAA 4I1AA 5J90A 1SZ9A 4HXIA 2FO7A 3TG5A 5CMWA 3CLJA 3Q4AB 4N2QA 4E85A 3N71A 1IQRA 2AXVA 3L6AA 3UT8A 1FVFA 3HDXA 3PZDA 3ZYKA 3L17A 2GW1A 3CVPA 4HORA 3RRNB 1HE8A 2IU1A 4A1GA 5FQ7A 2WXPA 1Z3XA 4Y6WA 4GMLA 1QZ2A 5LOZA 4Y6CA 3HVEA 1W3BA 2FEZA 3CSTA 2IF4A 2KCLA 4OVUA 2R5SA 3LCAA 3QDNA 3S7JA 3HHMA 1OWPA 4TRQA 4G1TA 5BPPA 4U63A 3IV0A 2Q7FA 4NACA 4JHKA 4J8FA 5G04C 4B8CB 1UW4B 4K03A 3SD5A 1OWOA 1KT0A 3CHRA 3D9JA 4GZ5A 4IULA 4TV3A 3U64A 3ZVVA 2RD0A 2VYIA 3MV3B 3Q5MA 2V4LA 4FULA 2J07A 4A55A 4EBAG 4JC8A 3SF4A 1KT1A 4MRUA 3OXFA 4HOQA 5A7DB 2CG2A 4HFGA 3OAWA 3S2AA 3OXGA 3T5XA 1DVPA 3BEEA 3PDNA 3TGOA 4ACLA 4U0ZA 3U4TA 1EDUA 1Y8MA 4O6FA 1JPLA 2VSNA 5EX3A 3RJVA 3ENEA 4UQYA 3VLDA 5JJ7A 4JPSA 1B89A 4FHJA 4GZ6A 3GW4A 2X6FA 2M63A 4ME2A 4NURA 3FU0A 3FUKA 3UUXA 3LVQE 2UY1B 3MV2B 3JUIA 1E90A 1E96B 1UN8A 2ZU6B 4FLBA 4K0RA 4QFVA 3GYZA 2VQ2A 4GCOA 3ASFA 3PEUB 1U3DA 5FZRA 3QWVA 5FQ4A 3RKVA 5FQ8A 4F3VA 4CDNA 5ANLA 2JLBA 2WXOA 4AOFA 3FTWA 4Q69A 1HZ4A 2LSVA 4D10C 1E8WA 3B7TA 4JA7A 3PVLA 3Q15A 1HU3A 2HM8A 4GYYA 4GYOA 1MHQA 2VGXB 1E8XA 4RG9A 3FTYA 4HS2A 2CHZA 2VGXA 2UWJG 2XPYA 4JVSA 2WVIA 4N3CA 4UWHA 2AXUA 3FUDA 2R17C 3LY8A 3LY9A 2WXQA 3ZYQA 5KJKA 5T8IA 4APOA 4JA9A 4BWRA 4WNDA 3R9AB 2PQNA 4B89A 4BT9A 5AENA 1P5QA 2J9QA 2QY7A 3GZ2A 3RRMB 2VTBB 3LXUX 4FADA 3KAEA 2IONA 4BY6A 3CEQA 3IBEA 1L5JA 4JHRA 2WXMA 2WQHA 2MRIA 3ZN3A 4AY6A 3QARA 3FP3A 2AW6A 5AIJA 4MLPA 1NA0A 2X3MA 2Y3AA 3GZSA 3ONKA 3ASGA 3KD7A 3G2TA 3FUHA 5BT1A 3CHOA 5G2NA 4KZCA 3RIBA 3ZHEB 1ELWA 1ZU2A 3NZUA 3TL5A 4BT8A 4ACKA 3JYSA 3PUJA 4UWGA 4L7TA 5J08A 2KZTA 4I43A 5CCMA 4AM9A 1ELKA 3FTSA 3AS5A 1FVHA 1E7UA 1TEZA 4EZKA 2VGYA 2X38A 2CFZA 3ASDA 1NP7A 1WAO1 5G04J 2FF4A 3P1UA 4OVVA 3T8MA 5HQ8A 3D9LA 3FTZA 3FU5A 3LDZA 1HFAA 4YNDA 3MJWA 4KVMA 3L08A 2V5FA 3B13A 3EJNA 3G2SA 3LS8A 3CHSA 4AIFA 4CDMA 3QK0A 1OWNA 1JUQA 3CV0A 2I2OA 2OV8A 4UI9J 2WMOA 3AU4A 3AS8A 4L23A 3VLFA 1BPOA 1HH8A 3IKOB 1UJJA 2L6JA 4XIFA 3NF1A 3ZW3A 5A6CA 2DIWA 4G11A 1INZA 1X5BA 4PH4B 3CKBA 4BFRA 3BG0B 4L2YA 2WQ6A 1S0PA 3TAXA 3QWWA 4J0UA 4EZLA 2C2LA 4KXKB 5JHAA 2E0IA 3MX3A 4H7YA 4FA6A 2J09A 2KCVA 4PDXA 2I1KA 3QJZA 4KT6B 3JQ1A 5T3RA 3SFZA 1H19A 4KZ0A 5KJLA 2Y4UA 3LY7A 3T5VA 4J8SA 2CFUA 1YA0A 3MCXA 3FTXA 3ML8A 3P2BA 2V8SE 2X6IA 5FTPA 5BW8C 1GW6A 4EBAA 5BUZA 2PM7A 3FEXA 3TXMA 2GRLA 1IYGA 3MKQA 5T4YA 2DBAA 4GCNA 3MZLB 2XRYA 3TXNA 3EHMA 4ANVA 3FU3A 3UT7A 4AXHA 5LFAA 4LRZA 3ML9A 3JCKC 5CMYA 2L0TB 4HOTA 4AV7A 4I2ZA 1Y6IA 4GZCA 4DK5A 3MKRA 5BV0A 2WXHA 1IHGA 3PE3A 4WNGA 3CK8A 2I6HA 2UY1A 3ZEFA 2L0IA 3ZIMA 1E8ZA 4F1SA 1OWMA 4UQZA 2IQCA 4J8DA 2FI7A 4GA1A 2OVBA 2XCBA 3SGHA 1H2TC 4I6EA 5CHEE 3VTXA 4N39A 4I6JA 4ABNA 4KMOA 2GGFA 2VTBA 3NQPA 3LYAA 3C98A 3ZPJA 4I17A 4U0UA 4AEZC 4N5CA 5JJTA 3CVXA 3CK9A 4FC8A 4HOSA 1SZAA 3APFA 2I1JA 2LSUA 3ZFWA 2QFCA 3G2VA 4J6IA 5FZQA 1PY1A 3S7FA 2BUGA 5C1DA 5D0QD 2NSZA 3CVVA 4G24A 2KZTB 5AJLA 2AVPA 2HYZA 4KVOA 2OVFA 1MQSA 2YQ8A 1XNFA 1H2UA 4I6GA 5KCMA 3PEVB 5C2YA 3EHNA 3BG1B 2R59A 2PQRA 1EPUA 3PRZA 4PS7A 3Q47B 3IHVA 3PS6A 4XX5A 3AS4A 3TG4A 4UWLA 4ATGA 2WXIA 3D9KA 4HLEA 5ENNA 4FJZA 3ONLA 2J4DA 4H7XA 4HOUA 3CKCA 1TJFA 4MKTA 4OYSA 4UWKA 3LPZA 4DJAA 4LCTA 3VLEA 3PNLB 3S7BA 2Y4TA 3B7SA 3CHPA 4GB9A 4ANWA 2L9BA 3ZGQA 4NRHB 4KYOB 4XI9A 3D3MA 3O48A 4FLHA 5FWQA 3CSFA 4KBQA 4XKBA 3FUJA 3L13A 4IN3B 3U66A 2KM4A 2VSYA 2WPVA 3HYMB 2YNQA 4GAAA 4C0MA 2LO6A 3APCA 2X6JA 2WXNA 4XKCA 5ARGA 3PE4A 3SBSA 5HI7A 2NC9A 1HXIA 1N52A 3RO3A 1WY6A 4YVOA 4GU5A 2HR2A 3ZRHA 2FBNA 3ASHA 1JWFA 4G2VA 3CHQA 2C0MA 1QQEA 2ILRA 3CVNA 2KCKA 2OOEA 3I4RB 4UWFA 3FU6A 4FP7A 3FDHA 3D9NA 4FJYA 1HF8A 4APFA 4ILGA 2XEVA 3CVLA 3FFLA 4DI4A 2PL2A 4G23A 3S7DA 3URZA 4CT4A 4R7LA 1NZNA 3I3NA 1H6KA 1PAQA 3EIJA 3QWPA 4U04A 3MGBA 4YVQC 3SNXA 3UT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C0M A;  4BSX A;  2M63 A; 
#chains in the Genus database with same CATH topology
 4GTM A;  3U9W A;  3CHM A;  4JD2 G;  2VJ8 A;  2LNI A;  3ZYM A;  4W9R A;  5E76 A;  4P29 A;  4MBG A;  2P2C P;  3OTN A;  3CVY A;  3TWX A;  2EIJ E;  2LAI A;  1UG3 A;  3FUI A;  3ISM C;  2YHE A;  3B7U X;  3SZ7 A;  1QNF A;  4MS6 A;  4ANX A;  4AP2 A;  1SQM A;  1OT8 A;  3UXG A;  4LG6 A;  4L2L A;  4BTA A;  4ILI A;  4J7W A;  4ANU A;  4K5C A;  3F6Q A;  4CCA A;  3ZYL A;  1DC2 A;  4PS8 A;  2WMN A;  2LAH A;  3LVR E;  2XGS A;  3FH8 A;  3D9O A;  3E34 A;  4WNF A;  3HVE B;  4I1O B;  1U3C A;  3EHR A;  1SW6 A;  1UN9 A;  2CHX A;  3O4Z A;  4DLO A;  4A3T A;  1MX6 A;  3QOU A;  2JEK A;  5DIZ A;  2V0P A;  2ETB A;  3SHF A;  5B3S E;  4GA2 A;  4LNG A;  3I5P A;  3NZS A;  5LX8 A;  3HIZ A;  3PUK A;  3Q49 B;  4TXP A;  1TNB A;  4GA0 A;  1ELR A;  4F7A A;  4IYP A;  1YYH A;  3FUE A;  5D0O D;  2A4Z A;  4GZD A;  4CEM A;  5FZS A;  3T8K A;  3FTU A;  1K3Z D;  2X6H A;  3G2W A;  2FUL A;  4XI0 A;  4HBD A;  2LUH A;  5G55 A;  4BSZ B;  1FCH A;  3V30 A;  2F0Y A;  4B94 A;  3ZU7 B;  4TUM A;  5KJM A;  4TUU A;  4CYM D;  4GPK A;  4BX9 A;  5B1B E;  4CGV A;  1KLX A;  1OCR E;  3K9I A;  2F8X K;  3UMV A;  4BSX A;  2OCC E;  2NXP A;  3ZHE A;  5LP0 A;  3DPY A;  5LCW C;  4B8A A;  2XPZ A;  1H6O A;  3TG5 A;  2AXV A;  3R9M A;  3CVP A;  3ASN E;  5FQ7 A;  4Y6W A;  5FIO A;  3HVE A;  1W3B A;  2FEZ A;  3CST A;  3JXJ A;  2IF4 A;  4OVU A;  3S7J A;  5AQA A;  4ZFH A;  4JHK A;  5G04 C;  2QYU A;  4B8C B;  3SD5 A;  1KT0 A;  4GZ5 A;  3U64 A;  4FUL A;  2H6G A;  3RSE G;  4A55 A;  1TN7 A;  1KT1 A;  1X81 A;  4MRU A;  3SF4 A;  3OXF A;  4HOQ A;  4HFG A;  3U4T A;  1EDU A;  1Y8M A;  2VSN A;  5EX3 A;  3ENE A;  3NAW A;  4UQY A;  3VLD A;  3PZ1 A;  2B0O E;  2X6F A;  1LD8 A;  2UY1 B;  1E90 A;  1E96 B;  1UN8 A;  4QFV A;  4GCO A;  3PEU B;  1U3D A;  3QWV A;  4F3V A;  5ENO D;  1N4R A;  4AOF A;  1N0R A;  4Q69 A;  1E8W A;  2HM8 A;  3NB2 A;  2VGX A;  2JAB A;  4N3C A;  2WVI A;  4JA9 A;  2H6F A;  4BWR A;  3DST A;  4BES A;  4BT9 A;  5AEN A;  3RRM B;  3ZUV B;  3LXU X;  3CEQ A;  1N0Q A;  2AW6 A;  2X3M A;  2Y3A A;  3GZS A;  1OXJ A;  3ABL E;  1ELW A;  5EIB E;  5CCM A;  3ASO E;  1FVH A;  1E7U A;  2X38 A;  2CFZ A;  3ASD A;  3T8M A;  3Q78 A;  5HQ8 A;  1NFI E;  3Q7A A;  3ZNG A;  2IY0 C;  3UM0 A;  4GTO A;  3L08 A;  2V5F A;  3CHS A;  4ZHB A;  1OWN A;  1HH8 A;  1TN6 A;  3DXM G;  2L6J A;  3IKO B;  4XIF A;  2DIW A;  4G11 A;  5H7P A;  4DRX E;  3RAU A;  1O1S A;  4L2Y A;  3QWW A;  4J0U A;  4KXK B;  1JCQ A;  4G8K A;  5JHA A;  4XEI G;  4KT6 B;  5ENQ D;  3SFZ A;  5KJL A;  2CFU A;  3P2B A;  5BW8 C;  3Q7F A;  3HXB A;  1IYG A;  5T4Y A;  2DBA A;  3MZL B;  1RZ4 A;  3EHM A;  3FU3 A;  2XEH A;  4F1P A;  4HOT A;  4AV7 A;  4I2Z A;  5KNG A;  1K1A A;  3C3Q A;  1IHG A;  3PE3 A;  4DX7 D;  5BXO A;  5HS0 A;  2IQC A;  4J8D A;  4UUC A;  3SGH A;  3AG3 E;  4GTR A;  4ABN A;  3LYA A;  4N5Q A;  3BQO A;  1SZA A;  2LSU A;  5FZQ A;  4OAU C;  4X8Q A;  1ZB1 A;  4G24 A;  2ZIS A;  2HYZ A;  2OVF A;  2YQ8 A;  2RKK A;  5KCM A;  2R59 A;  4PS7 A;  3Q47 B;  2WXI A;  4NIK A;  5ENN A;  4H7X A;  4DJA A;  3VLE A;  4GB9 A;  2MYO A;  3Q75 A;  5EYP F;  3ZGQ A;  1G3N B;  4IN3 B;  3U66 A;  4C0M A;  4GAA A;  5ARG A;  3PE4 A;  2RFM A;  2EIN E;  3RO3 A;  4O1P A;  3B95 A;  2V4H C;  2LXL A;  3ZRH A;  2HR2 A;  2FBN A;  3CVN A;  2OOE A;  4K5A B;  4ILG A;  4DI4 A;  4CT4 A;  1NZN A;  1H6K A;  1PAQ A;  3EIJ A;  3UT4 A;  4OVV A;  2P9L G;  1WDY A;  2XZT G;  1D8D A;  3UIO C;  3FUN A;  3UX4 A;  4N3A A;  3FUL A;  4Q94 A;  4AY5 A;  4WWN A;  4BEP A;  3D9M A;  2VSO E;  3IHY A;  4I1M A;  2A5U A;  1N4P A;  4ATZ D;  4I9E A;  5AYW D;  4HNA D;  4RG6 A;  2BF0 X;  1D8E A;  4U8Y D;  2PNN A;  2WQ7 A;  4V3I A;  1TNZ A;  5BNW A;  4LUN U;  4PS3 A;  3TWQ A;  1O1T A;  3JUE A;  2P9I G;  2YIN A;  3FEY A;  3C3R A;  1VDY A;  5FIN A;  3AU5 A;  3SI5 A;  1PC2 A;  4JEU A;  1SA5 A;  2WXK A;  4IRU A;  3TWU A;  4B0Z A;  2X6K A;  2EIM E;  3FUF A;  3WXX A;  4DX6 D;  2IOS A;  2WXL A;  3CQC B;  1Q2Z A;  1MZC A;  2RG8 A;  3CQG B;  4CT0 A;  2BKG A;  1N4Q A;  4CRW A;  5DBK A;  4L9P A;  2WM9 A;  5BXU A;  4GMJ A;  1OUV A;  5CBN A;  3FY4 A;  5EDS A;  4DPR A;  2ZGG A;  3L54 A;  1OCZ E;  1SVX A;  3LEW A;  5ARF A;  5D66 A;  2V5Q C;  2XZD G;  1XGW A;  1YCS B;  1Z3Y A;  3DSU A;  3DXK G;  1TJC A;  3KEA A;  2J4B A;  1N9A A;  4U8H A;  4N3B A;  3ESL A;  3QKY A;  2WXF A;  3NOG D;  3R7Q A;  3BU8 A;  3DPD A;  2VSX E;  3PRE A;  4J8E A;  1JCS A;  4WUY A;  3UQ3 A;  3LJ3 A;  2ETC A;  5G05 C;  4DLQ A;  2BED A;  3CR3 A;  3C72 A;  2F37 A;  1EYH A;  2J49 A;  5G05 J;  3D9P A;  3GZ1 A;  5JJ6 A;  2MHK A;  5FJY A;  3L6A A;  3UT8 A;  3ZYK A;  3V31 A;  2WXP A;  4Y6C A;  2ZIR A;  1S70 B;  2R5S A;  3QDN A;  4G1T A;  4U63 A;  2Q7F A;  4J8F A;  1UW4 B;  4K03 A;  1OWO A;  3D9J A;  3ZVV A;  3Q5M A;  2J07 A;  3SQV A;  4HRN A;  3BEE A;  1K1B A;  4O6F A;  3DSW A;  3EHQ A;  5JJ7 A;  3V2X A;  2ZU6 B;  2VQ2 A;  5FZR A;  5AQB A;  3PZ4 A;  2P9N G;  1JCR A;  2JLB A;  2WXO A;  1HZ4 A;  1S64 A;  2OEW A;  2LSV A;  3B7T A;  1MJ0 A;  3PVL A;  3Q15 A;  3UM2 A;  1MHQ A;  2VGX B;  1E8X A;  4RG9 A;  1MX4 A;  3UIN C;  2DYS E;  2CHZ A;  2UWJ G;  3LY9 A;  2R17 C;  3LY8 A;  3ZYQ A;  4APO A;  2PQN A;  3Q9N C;  4B89 A;  1P5Q A;  2GRP B;  3UM1 A;  3IBE A;  2WXM A;  3ZN3 A;  4U8V D;  3FP3 A;  5AIJ A;  4MLP A;  3ASG A;  3FUH A;  1LTX A;  3RIB A;  4BT8 A;  4I43 A;  3FTS A;  3DEO A;  2L6B A;  1BU9 A;  4EZK A;  1NP7 A;  2FF4 A;  3UKR G;  3FTZ A;  3C3O A;  3B13 A;  3CV0 A;  2OV8 A;  3AU4 A;  3AS8 A;  4L23 A;  1UJJ A;  3J5Q B;  3ZW3 A;  1IHB A;  3CKB A;  3BG0 B;  2WQ6 A;  2GRR B;  3MX3 A;  4H7Y A;  4FA6 A;  1QYM A;  3JQ1 A;  5T3R A;  1H19 A;  4KZ0 A;  2Y4U A;  3ML8 A;  5FTP A;  1GW6 A;  3FEX A;  2GRL A;  3HXE A;  3UT7 A;  5LFA A;  4AXH A;  3J5P A;  3ML9 A;  4A63 B;  2DYR E;  5CED B;  3MKR A;  5BV0 A;  4WNG A;  1WG0 A;  3CK8 A;  3ZEF A;  2L0I A;  1OWM A;  5KBA A;  2XCB A;  1H2T C;  4I6E A;  5AQ7 A;  4AEZ C;  4I17 A;  5JJT A;  3ZFW A;  2VGE A;  2BUG A;  1O5M A;  5C1D A;  2NSZ A;  3NBN B;  2DVW A;  2KZT B;  5AJL A;  1AP7 A;  4KVO A;  5CBO A;  1H2U A;  4I6G A;  4XX5 A;  5CEA A;  3TG4 A;  4ATG A;  3D9H A;  4HLE A;  3V79 K;  4MKT A;  3LPZ A;  2GRO B;  2EIL E;  3CHP A;  1NL4 A;  2B6C A;  4NRH B;  3O48 A;  3CSF A;  2AJA A;  3SFX A;  3ZXP A;  2IEJ A;  4DX1 A;  2VSY A;  2LO6 A;  3APC A;  3PZ2 A;  4XKC A;  3AJI A;  5HI7 A;  5EIL A;  3NOC D;  1DCQ A;  1WY6 A;  4GU5 A;  3ASH A;  4G2V A;  3CHQ A;  2KCK A;  3FDH A;  4APF A;  4G23 A;  3URZ A;  4U04 A;  4JW1 A;  4FU3 A;  4GZ3 A;  3MEK A;  2AXZ A;  2XQ0 A;  3B7R L;  3PH0 C;  3CK7 A;  3DSV A;  5CCL A;  3KEZ A;  5A23 A;  3RU0 A;  3U3W A;  3DRA A;  3UPV A;  3UKU G;  4DX5 D;  1H2V C;  1OY3 D;  4GTV A;  3JQ0 A;  3T9K A;  4LEU A;  3CVW A;  3QAQ A;  1HS6 A;  3SO8 A;  4Z68 A;  4UQX A;  1NA3 A;  3FUM A;  5CEC B;  2EQX A;  4WNE A;  4QQI A;  3QB2 A;  4G26 A;  3RK6 A;  1JWG A;  3ULQ A;  4U95 D;  2HO1 A;  3TJP A;  4WAF A;  5AAO A;  5LCW J;  1EF1 C;  3UI2 A;  2R03 A;  4TXR A;  2DCP A;  3ULE G;  3HRA A;  4YDO A;  3HXC A;  1HG2 A;  3D9I A;  1TN8 A;  2XEN A;  2XGM A;  2KC7 A;  5FQ6 A;  5KJN A;  4EQF A;  4CDR A;  4XE0 A;  2XGO A;  4HRM B;  3FWV A;  1BD8 A;  4C9B B;  2YHC A;  5EX0 A;  4JXT A;  3FH7 A;  2E2E A;  3G2U A;  1WM5 A;  2XCC A;  3MKQ B;  1OWL A;  4A3V A;  1TNU A;  1S63 A;  1E7V A;  4GYW A;  1TR4 A;  2BKK B;  2IOL A;  5BV1 A;  1AWC B;  4EPZ A;  4L1B A;  4N2S A;  3L16 A;  1SA4 A;  4I2W A;  1E8Y A;  2IJG X;  2A5E A;  3Q79 A;  1UOH A;  4EEC A;  3E4B A;  1TNY A;  4U0S A;  2OND A;  4E6H A;  3B7B A;  3EDT B;  1TNO A;  2BTD A;  3MYV A;  2AWI A;  2WXJ A;  5J90 A;  3CIA A;  3LJN A;  4HXI A;  5CMW A;  4N2Q A;  3CLJ A;  3Q4A B;  4E85 A;  3L17 A;  2GW1 A;  4HOR A;  3RRN B;  1HE8 A;  4A1G A;  1QZ2 A;  2R05 A;  1MX2 A;  2KCL A;  3DEP A;  3LCA A;  4U96 D;  3HHM A;  1OWP A;  4TRQ A;  2FO1 E;  4NAC A;  5D2M C;  2XS1 A;  3MV3 B;  2V4L A;  4EBA G;  5A7D B;  2CG2 A;  3OAW A;  3TGO A;  4ACL A;  1KZO A;  1B89 A;  4GZ6 A;  3GW4 A;  3FUK A;  3UUX A;  3LVQ E;  3MV2 B;  4FLB A;  5FQ4 A;  1U2V G;  5ANL A;  2DWZ A;  4D10 C;  1HU3 A;  4GYY A;  4GYO A;  1BI7 B;  4HS2 A;  2XPY A;  3FUD A;  2WXQ A;  5T8I A;  5EID A;  2P9S G;  4WND A;  2J9Q A;  3GZ2 A;  2NYJ A;  4FAD A;  2ION A;  4O1O A;  2WQH A;  1RW2 A;  3QAR A;  1NA0 A;  2R02 A;  3ONK A;  3KD7 A;  3TWV A;  2KBX A;  5BT1 A;  3CHO A;  1ZU2 A;  3NZU A;  3TL5 A;  3JYS A;  3PUJ A;  4L7T A;  5J08 A;  4AM9 A;  3E32 A;  1TEZ A;  1WAO 1;  5G04 J;  4YDY A;  3KSQ A;  3P1U A;  1OCC E;  3LDZ A;  4YND A;  5ENT D;  3EJN A;  3G2S A;  2H6H A;  1JUQ A;  2I2O A;  3ABK E;  1N94 A;  5B1A E;  1INZ A;  2R2L A;  1S0P A;  4RQI A;  4EZL A;  2C2L A;  3UTM A;  2J09 A;  2KCV A;  4PDX A;  3QJZ A;  4LSZ E;  1FT1 A;  3UM3 A;  3LY7 A;  3FTX A;  4JB8 P;  4EBA A;  2PM7 A;  3TXM A;  4GCN A;  2XRY A;  4LRZ A;  3WG7 E;  3JCK C;  2L0T B;  1Y6I A;  4DK5 A;  2I6H A;  2UY1 A;  1E8Z A;  4F1S A;  2IO2 C;  2FI7 A;  4GA1 A;  2OVB A;  4LNU D;  5CHE E;  3VTX A;  4N39 A;  2VTB A;  3NQP A;  3C98 A;  3ZPJ A;  3CVX A;  3CK9 A;  4HOS A;  3Q9U C;  3HXF A;  3APF A;  2QFC A;  3G2V A;  4J6I A;  1PY1 A;  4O60 A;  1A5E A;  1BI8 B;  5JA4 D;  3EHN A;  3ZKJ A;  3BG1 B;  1OCO E;  1EPU A;  3PS6 A;  3TWR A;  3ABM E;  3D9K A;  3UIP C;  4FJZ A;  2J4D A;  1NI1 A;  3CKC A;  4LCT A;  3S7B A;  3AG4 E;  5ENP D;  2L9B A;  5CER B;  4GTQ A;  3D3M A;  4FLH A;  4XKB A;  1D9S A;  4HLL A;  3L13 A;  3AG1 E;  1V54 E;  4U7E B;  2KM4 A;  2KXP C;  2X6J A;  2WXN A;  3SBS A;  2NC9 A;  1HXI A;  1N52 A;  2J8S D;  4YVO A;  1JWF A;  3DSS A;  1QQE A;  2ILR A;  3FU6 A;  5IY5 E;  3CVL A;  2F8Y A;  3S7D A;  3TWT A;  3SNX A;  2ZXW E;  1N95 A;  1UJK A;  3C5R A;  5HRY A;  2WXG A;  3BUA A;  2I9C A;  4UI9 C;  2QYJ A;  2HE0 A;  5JHB A;  5FT9 A;  1H0A A;  1N54 A;  2IO3 C;  4Q96 A;  4DI3 A;  1HG5 A;  2J08 A;  5HKP A;  1K8K G;  4CGW A;  2XRZ A;  4XZ4 A;  3OXL A;  1DNP A;  3I4G A;  3Q73 A;  4FHK A;  1HX8 A;  3TWW A;  1LF8 A;  1IQU A;  2KAT A;  4RVB A;  4URK A;  3RRU A;  3SBT B;  3CVU A;  2C0L A;  3HXD A;  5AJD A;  1V55 E;  4GTT A;  3L22 A;  4ILH B;  5AN8 A;  2DZN A;  4F53 A;  4AJW A;  3MA5 A;  4PUC A;  2OEV A;  5E75 A;  2WB2 A;  1TYQ G;  1Z6T A;  2CHW A;  3ULY A;  3EIQ C;  3ZXS A;  2MOW A;  3QNK A;  5ANR A;  4HVB A;  3FHE A;  3PNT B;  3JXI A;  3QC1 A;  4JZY A;  4BX8 A;  3W9F A;  1Z5S C;  5M72 A;  4AVX A;  4DUI A;  2PZI A;  2QC9 A;  3IEG A;  4WWP A;  4JHJ A;  5ENR D;  3VTY A;  2XPI A;  2ZGD A;  4HQD A;  1ZBP A;  3DBS A;  3APD A;  2XHE A;  1MYO A;  1FPP A;  2P58 C;  3KS2 A;  4C0E A;  4NQ0 A;  2LXM A;  4JL0 A;  3CVQ A;  1YMP A;  3RO2 A;  3ESK A;  4LER A;  4A1S A;  4M7C A;  4GTS A;  5CRU A;  1FT2 A;  2PM6 A;  4K5B A;  2CG3 A;  3R7R A;  5KWD A;  3FTV A;  1HO8 A;  4EZJ A;  2P9P G;  5AQ9 A;  3LKU A;  4DX2 A;  3EU9 A;  4I9C A;  5EYL A;  4G25 A;  3E37 A;  5AAR A;  3FH5 A;  1QBQ A;  4RSY A;  5EKQ D;  2P9U G;  2WXR A;  4RLY A;  2EIK E;  3DWL G;  2IFU A;  4YDW A;  3CGH A;  4GMR A;  4UI9 K;  4M3O A;  4YDE A;  4U07 A;  3L82 A;  2GRM A;  4WWO A;  1A17 A;  4BTB A;  4JEH A;  4I1A A;  5ITZ F;  1SZ9 A;  2FO7 A;  3N71 A;  1IQR A;  1FVF A;  3HDX A;  3PZD A;  2IU1 A;  3AAA C;  1Z3X A;  5JMN D;  4GML A;  5LOZ A;  4HRL A;  3SFY A;  1DCE A;  5BPP A;  3IV0 A;  3CHR A;  4IUL A;  4TV3 A;  2RD0 A;  2VYI A;  4JC8 A;  3S2A A;  3T5X A;  3OXG A;  1DVP A;  3PDN A;  4U0Z A;  1JPL A;  3RJV A;  4BET A;  4JPS A;  4FHJ A;  4BER A;  4ME2 A;  2M63 A;  4NUR A;  3FU0 A;  4CZ2 D;  4GPM A;  3JUI A;  2Y69 E;  4K0R A;  3GYZ A;  5ENS D;  3ASF A;  3RKV A;  5FQ8 A;  4CDN A;  3FTW A;  4JA7 A;  4LNB A;  2H6I A;  3FTY A;  4JVS A;  4UWH A;  2AXU A;  5KJK A;  3R9A B;  2GRN B;  1IKN D;  2QY7 A;  2VTB B;  3E33 A;  3KAE A;  4BY6 A;  1L5J A;  4JHR A;  2MRI A;  4AY6 A;  3E30 A;  3G2T A;  5G2N A;  4KZC A;  3ZHE B;  4ACK A;  4UWG A;  2ETA A;  2KZT A;  1ELK A;  3AS5 A;  2VGY A;  3KSL A;  4OAV B;  2XS8 A;  3D9L A;  3FU5 A;  4C48 B;  3X2Q E;  1HFA A;  3V2O A;  3MJW A;  4KVM A;  3LS8 A;  4AIF A;  4CDM A;  3QK0 A;  4UI9 J;  2RFA A;  2WMO A;  2QZA A;  3VLF A;  1BPO A;  3NF1 A;  5A6C A;  1X5B A;  4PH4 B;  4F6R D;  4BFR A;  3TAX A;  2E0I A;  2I1K A;  3SY2 A;  3PZ3 A;  4J8Y A;  3T5V A;  4J8S A;  2Y1L E;  1YA0 A;  3MCX A;  2V8S E;  2X6I A;  4GTP A;  2DZO A;  3DSX A;  4HI9 A;  5EN5 D;  5BUZ A;  3HG0 D;  4B93 B;  3MKQ A;  3TXN A;  4ANV A;  2GRQ B;  1N4S A;  3EU5 A;  5CMY A;  3L9T A;  4GZC A;  2WXH A;  3EUV A;  3ZIM A;  4UQZ A;  1N11 A;  4TXQ A;  4I6J A;  2P9K G;  4KMO A;  2GGF A;  1BLX B;  4U0U A;  4N5C A;  4FC8 A;  2I1J A;  3S7F A;  5KNH D;  5D0Q D;  3CVV A;  2AVP A;  4HI8 A;  1MQS A;  1XNF A;  3PEV B;  5C2Y A;  1H6P A;  2PQR A;  3PRZ A;  5CRV A;  1LD7 A;  3IHV A;  3W9G A;  3AS4 A;  4HB5 A;  4UWL A;  3TWS A;  3ONL A;  4HOU A;  1TJF A;  4OYS A;  4UWK A;  1O1R A;  3PNL B;  2Y4T A;  3B7S A;  1KZP A;  2Y0B G;  1KPS B;  4ANW A;  4KYO B;  2XEE A;  4XI9 A;  5FWQ A;  4KBQ A;  3FUJ A;  2WPV A;  3HYM B;  2YNQ A;  4EHM A;  3AG2 E;  1IXV A;  2C0M A;  3I4R B;  4UWF A;  4FP7 A;  3D9N A;  4FJY A;  1HF8 A;  2XEV A;  3FFL A;  2PL2 A;  4R7L A;  3I3N A;  3IXE A;  3QWP A;  3MGB A;  4YVQ C;  4G8L A; 
#chains in the Genus database with same CATH homology
 1UJK A;  3U9W A;  4JW1 A;  2WXG A;  3CHM A;  4FU3 A;  4GZ3 A;  2I9C A;  3FUN A;  3UX4 A;  4UI9 C;  2VJ8 A;  2LNI A;  3MEK A;  3ZYM A;  4W9R A;  5E76 A;  2AXZ A;  4N3A A;  4P29 A;  5JHB A;  2XQ0 A;  3B7R L;  1H0A A;  3FUL A;  5FT9 A;  1N54 A;  3OTN A;  4Q94 A;  3CVY A;  4AY5 A;  3PH0 C;  4WWN A;  2LAI A;  4Q96 A;  3CK7 A;  4DI3 A;  3D9M A;  1UG3 A;  2VSO E;  1HG5 A;  3FUI A;  2J08 A;  3IHY A;  3KEZ A;  4I1M A;  2A5U A;  5CCL A;  2YHE A;  5A23 A;  3B7U X;  3SZ7 A;  4CGW A;  4I9E A;  1QNF A;  5AYW D;  4MS6 A;  4ANX A;  4AP2 A;  3RU0 A;  1SQM A;  4XZ4 A;  3U3W A;  2XRZ A;  3UPV A;  3OXL A;  1DNP A;  3I4G A;  4RG6 A;  2BF0 X;  4FHK A;  1H2V C;  2WQ7 A;  1HX8 A;  4L2L A;  4BTA A;  4V3I A;  1LF8 A;  1IQU A;  2KAT A;  4ILI A;  4RVB A;  4URK A;  3JQ0 A;  4LEU A;  3CVW A;  3RRU A;  3QAQ A;  4ANU A;  1HS6 A;  5BNW A;  4CCA A;  4LUN U;  4PS3 A;  3SBT B;  3ZYL A;  3CVU A;  4UQX A;  1NA3 A;  3FUM A;  2C0L A;  2EQX A;  4WNE A;  4PS8 A;  2WMN A;  2LAH A;  5AJD A;  3QB2 A;  3LVR E;  2XGS A;  3FH8 A;  4G26 A;  3RK6 A;  2YIN A;  3D9O A;  3L22 A;  4ILH B;  3FEY A;  1JWG A;  3ULQ A;  1VDY A;  4F53 A;  4AJW A;  3MA5 A;  4PUC A;  2HO1 A;  3AU5 A;  5E75 A;  3SI5 A;  4WNF A;  1PC2 A;  2WB2 A;  4JEU A;  3TJP A;  1Z6T A;  3HVE B;  2CHW A;  4I1O B;  1U3C A;  2WXK A;  4IRU A;  3EIQ C;  4WAF A;  5LCW J;  1UN9 A;  1EF1 C;  3ZXS A;  2MOW A;  3QNK A;  5ANR A;  2CHX A;  4HVB A;  3FHE A;  3PNT B;  2X6K A;  4B0Z A;  3O4Z A;  4DLO A;  3FUF A;  3WXX A;  2DCP A;  3QC1 A;  4A3T A;  4JZY A;  3QOU A;  2JEK A;  5DIZ A;  4BX8 A;  2V0P A;  1HG2 A;  2IOS A;  3D9I A;  3SHF A;  2XGM A;  4GA2 A;  5M72 A;  4AVX A;  2WXL A;  2KC7 A;  3I5P A;  5FQ6 A;  3CQC B;  4EQF A;  2PZI A;  4XE0 A;  2RG8 A;  4CDR A;  5KJN A;  2XGO A;  3CQG B;  3IEG A;  3FWV A;  3NZS A;  4JHJ A;  4WWP A;  4C9B B;  4CT0 A;  5LX8 A;  3HIZ A;  2YHC A;  3VTY A;  2XPI A;  3PUK A;  5EX0 A;  4JXT A;  3Q49 B;  4CRW A;  3FH7 A;  2E2E A;  4GA0 A;  1ELR A;  5DBK A;  4F7A A;  1ZBP A;  3DBS A;  3G2U A;  2WM9 A;  4IYP A;  3APD A;  3FUE A;  5D0O D;  4GMJ A;  2XHE A;  1OUV A;  2A4Z A;  3FY4 A;  2P58 C;  1WM5 A;  4GZD A;  2XCC A;  3KS2 A;  5EDS A;  4DPR A;  3MKQ B;  1OWL A;  4A3V A;  4CEM A;  5FZS A;  3FTU A;  2X6H A;  4C0E A;  4NQ0 A;  3G2W A;  3L54 A;  1E7V A;  4JL0 A;  3CVQ A;  2FUL A;  4XI0 A;  3LEW A;  4GYW A;  5ARF A;  3RO2 A;  3ESK A;  4LER A;  5G55 A;  4A1S A;  2IOL A;  1FCH A;  5BV1 A;  1XGW A;  4B94 A;  1Z3Y A;  2PM6 A;  5KJM A;  2CG3 A;  3R7R A;  1TJC A;  3FTV A;  4EPZ A;  1HO8 A;  4L1B A;  4TUU A;  4EZJ A;  4GPK A;  2J4B A;  4U8H A;  4BX9 A;  3LKU A;  4N2S A;  3L16 A;  4N3B A;  4CGV A;  3ESL A;  4I2W A;  1E8Y A;  2IJG X;  3QKY A;  4I9C A;  2WXF A;  1KLX A;  4G25 A;  3K9I A;  4EEC A;  3E4B A;  3R7Q A;  3FH5 A;  3DPD A;  4RSY A;  5EKQ D;  4U0S A;  3UMV A;  4BSX A;  2VSX E;  3PRE A;  2WXR A;  4J8E A;  2OND A;  2NXP A;  4WUY A;  3UQ3 A;  3LJ3 A;  2IFU A;  3EDT B;  4E6H A;  3CGH A;  5G05 C;  4DLQ A;  2BTD A;  3CR3 A;  3ZHE A;  1EYH A;  2J49 A;  5G05 J;  3D9P A;  3MYV A;  4UI9 K;  5LP0 A;  4M3O A;  2AWI A;  4U07 A;  5LCW C;  4WWO A;  2GRM A;  3GZ1 A;  5JJ6 A;  1A17 A;  4B8A A;  4BTB A;  2MHK A;  5FJY A;  2WXJ A;  4JEH A;  2XPZ A;  3CIA A;  4I1A A;  5J90 A;  1SZ9 A;  4HXI A;  2FO7 A;  3TG5 A;  5CMW A;  3CLJ A;  3Q4A B;  4N2Q A;  4E85 A;  3N71 A;  1IQR A;  2AXV A;  3L6A A;  3UT8 A;  1FVF A;  3HDX A;  3PZD A;  3ZYK A;  3L17 A;  2GW1 A;  3CVP A;  4HOR A;  3RRN B;  1HE8 A;  2IU1 A;  4A1G A;  5FQ7 A;  2WXP A;  1Z3X A;  4Y6W A;  4GML A;  1QZ2 A;  5LOZ A;  4Y6C A;  3HVE A;  1W3B A;  2FEZ A;  3CST A;  2IF4 A;  2KCL A;  4OVU A;  2R5S A;  3LCA A;  3QDN A;  3S7J A;  3HHM A;  1OWP A;  4TRQ A;  4G1T A;  5BPP A;  4U63 A;  3IV0 A;  2Q7F A;  4NAC A;  4JHK A;  4J8F A;  5G04 C;  4B8C B;  1UW4 B;  4K03 A;  3SD5 A;  1OWO A;  1KT0 A;  3CHR A;  3D9J A;  4GZ5 A;  4IUL A;  4TV3 A;  3U64 A;  3ZVV A;  2RD0 A;  2VYI A;  3MV3 B;  3Q5M A;  2V4L A;  4FUL A;  2J07 A;  4A55 A;  4EBA G;  4JC8 A;  3SF4 A;  1KT1 A;  4MRU A;  3OXF A;  4HOQ A;  5A7D B;  2CG2 A;  4HFG A;  3OAW A;  3S2A A;  3OXG A;  3T5X A;  1DVP A;  3BEE A;  3PDN A;  3TGO A;  4ACL A;  4U0Z A;  3U4T A;  1EDU A;  1Y8M A;  4O6F A;  1JPL A;  2VSN A;  5EX3 A;  3RJV A;  3ENE A;  4UQY A;  3VLD A;  5JJ7 A;  4JPS A;  1B89 A;  4FHJ A;  4GZ6 A;  3GW4 A;  2X6F A;  2M63 A;  4ME2 A;  4NUR A;  3FU0 A;  3FUK A;  3UUX A;  3LVQ E;  2UY1 B;  3MV2 B;  3JUI A;  1E90 A;  1E96 B;  1UN8 A;  2ZU6 B;  4FLB A;  4K0R A;  4QFV A;  3GYZ A;  2VQ2 A;  4GCO A;  3ASF A;  3PEU B;  1U3D A;  5FZR A;  3QWV A;  5FQ4 A;  3RKV A;  5FQ8 A;  4F3V A;  4CDN A;  5ANL A;  2JLB A;  2WXO A;  4AOF A;  3FTW A;  4Q69 A;  1HZ4 A;  2LSV A;  4D10 C;  1E8W A;  3B7T A;  4JA7 A;  3PVL A;  3Q15 A;  1HU3 A;  2HM8 A;  4GYY A;  4GYO A;  1MHQ A;  2VGX B;  1E8X A;  4RG9 A;  3FTY A;  4HS2 A;  2CHZ A;  2VGX A;  2UWJ G;  2XPY A;  4JVS A;  2WVI A;  4N3C A;  4UWH A;  2AXU A;  3FUD A;  2R17 C;  3LY8 A;  3LY9 A;  2WXQ A;  3ZYQ A;  5KJK A;  5T8I A;  4APO A;  4JA9 A;  4BWR A;  4WND A;  3R9A B;  2PQN A;  4B89 A;  4BT9 A;  5AEN A;  1P5Q A;  2J9Q A;  2QY7 A;  3GZ2 A;  3RRM B;  2VTB B;  3LXU X;  4FAD A;  3KAE A;  2ION A;  4BY6 A;  3CEQ A;  3IBE A;  1L5J A;  4JHR A;  2WXM A;  2WQH A;  2MRI A;  3ZN3 A;  4AY6 A;  3QAR A;  3FP3 A;  2AW6 A;  5AIJ A;  4MLP A;  1NA0 A;  2X3M A;  2Y3A A;  3GZS A;  3ONK A;  3ASG A;  3KD7 A;  3G2T A;  3FUH A;  5BT1 A;  3CHO A;  5G2N A;  4KZC A;  3RIB A;  3ZHE B;  1ELW A;  1ZU2 A;  3NZU A;  3TL5 A;  4BT8 A;  4ACK A;  3JYS A;  3PUJ A;  4UWG A;  4L7T A;  5J08 A;  2KZT A;  4I43 A;  5CCM A;  4AM9 A;  1ELK A;  3FTS A;  3AS5 A;  1FVH A;  1E7U A;  1TEZ A;  4EZK A;  2VGY A;  2X38 A;  2CFZ A;  3ASD A;  1NP7 A;  1WAO 1;  5G04 J;  2FF4 A;  3P1U A;  4OVV A;  3T8M A;  5HQ8 A;  3D9L A;  3FTZ A;  3FU5 A;  3LDZ A;  1HFA A;  4YND A;  3MJW A;  4KVM A;  3L08 A;  2V5F A;  3B13 A;  3EJN A;  3G2S A;  3LS8 A;  3CHS A;  4AIF A;  4CDM A;  3QK0 A;  1OWN A;  1JUQ A;  3CV0 A;  2I2O A;  2OV8 A;  4UI9 J;  2WMO A;  3AU4 A;  3AS8 A;  4L23 A;  3VLF A;  1BPO A;  1HH8 A;  3IKO B;  1UJJ A;  2L6J A;  4XIF A;  3NF1 A;  3ZW3 A;  5A6C A;  2DIW A;  4G11 A;  1INZ A;  1X5B A;  4PH4 B;  3CKB A;  4BFR A;  3BG0 B;  4L2Y A;  2WQ6 A;  1S0P A;  3TAX A;  3QWW A;  4J0U A;  4EZL A;  2C2L A;  4KXK B;  5JHA A;  2E0I A;  3MX3 A;  4H7Y A;  4FA6 A;  2J09 A;  2KCV A;  4PDX A;  2I1K A;  3QJZ A;  4KT6 B;  3JQ1 A;  5T3R A;  3SFZ A;  1H19 A;  4KZ0 A;  5KJL A;  2Y4U A;  3LY7 A;  3T5V A;  4J8S A;  2CFU A;  1YA0 A;  3MCX A;  3FTX A;  3ML8 A;  3P2B A;  2V8S E;  2X6I A;  5FTP A;  5BW8 C;  1GW6 A;  4EBA A;  5BUZ A;  2PM7 A;  3FEX A;  3TXM A;  2GRL A;  1IYG A;  3MKQ A;  5T4Y A;  2DBA A;  4GCN A;  3MZL B;  2XRY A;  3TXN A;  3EHM A;  4ANV A;  3FU3 A;  3UT7 A;  4AXH A;  5LFA A;  4LRZ A;  3ML9 A;  3JCK C;  5CMY A;  2L0T B;  4HOT A;  4AV7 A;  4I2Z A;  1Y6I A;  4GZC A;  4DK5 A;  3MKR A;  5BV0 A;  2WXH A;  1IHG A;  3PE3 A;  4WNG A;  3CK8 A;  2I6H A;  2UY1 A;  3ZEF A;  2L0I A;  3ZIM A;  1E8Z A;  4F1S A;  1OWM A;  4UQZ A;  2IQC A;  4J8D A;  2FI7 A;  4GA1 A;  2OVB A;  2XCB A;  3SGH A;  1H2T C;  4I6E A;  5CHE E;  3VTX A;  4N39 A;  4I6J A;  4ABN A;  4KMO A;  2GGF A;  2VTB A;  3NQP A;  3LYA A;  3C98 A;  3ZPJ A;  4I17 A;  4U0U A;  4AEZ C;  4N5C A;  5JJT A;  3CVX A;  3CK9 A;  4FC8 A;  4HOS A;  1SZA A;  3APF A;  2I1J A;  2LSU A;  3ZFW A;  2QFC A;  3G2V A;  4J6I A;  5FZQ A;  1PY1 A;  3S7F A;  2BUG A;  5C1D A;  5D0Q D;  2NSZ A;  3CVV A;  4G24 A;  2KZT B;  5AJL A;  2AVP A;  2HYZ A;  4KVO A;  2OVF A;  1MQS A;  2YQ8 A;  1XNF A;  1H2U A;  4I6G A;  5KCM A;  3PEV B;  5C2Y A;  3EHN A;  3BG1 B;  2R59 A;  2PQR A;  1EPU A;  3PRZ A;  4PS7 A;  3Q47 B;  3IHV A;  3PS6 A;  4XX5 A;  3AS4 A;  3TG4 A;  4UWL A;  4ATG A;  2WXI A;  3D9K A;  4HLE A;  5ENN A;  4FJZ A;  3ONL A;  2J4D A;  4H7X A;  4HOU A;  3CKC A;  1TJF A;  4MKT A;  4OYS A;  4UWK A;  3LPZ A;  4DJA A;  4LCT A;  3VLE A;  3PNL B;  3S7B A;  2Y4T A;  3B7S A;  3CHP A;  4GB9 A;  4ANW A;  2L9B A;  3ZGQ A;  4NRH B;  4KYO B;  4XI9 A;  3D3M A;  3O48 A;  4FLH A;  5FWQ A;  3CSF A;  4KBQ A;  4XKB A;  3FUJ A;  3L13 A;  4IN3 B;  3U66 A;  2KM4 A;  2VSY A;  2WPV A;  3HYM B;  2YNQ A;  4GAA A;  4C0M A;  2LO6 A;  3APC A;  2X6J A;  2WXN A;  4XKC A;  5ARG A;  3PE4 A;  3SBS A;  5HI7 A;  2NC9 A;  1HXI A;  1N52 A;  3RO3 A;  1WY6 A;  4YVO A;  4GU5 A;  2HR2 A;  3ZRH A;  2FBN A;  3ASH A;  1JWF A;  4G2V A;  3CHQ A;  2C0M A;  1QQE A;  2ILR A;  3CVN A;  2KCK A;  2OOE A;  3I4R B;  4UWF A;  3FU6 A;  4FP7 A;  3FDH A;  3D9N A;  4FJY A;  1HF8 A;  4APF A;  4ILG A;  2XEV A;  3CVL A;  3FFL A;  4DI4 A;  2PL2 A;  4G23 A;  3S7D A;  3URZ A;  4CT4 A;  4R7L A;  1NZN A;  3I3N A;  1H6K A;  1PAQ A;  3EIJ A;  3QWP A;  4U04 A;  3MGB A;  4YVQ C;  3SNX A;  3UT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...