4C0MA

Crystal structure of the n terminal domain of wild type trif (tir- domain-containing adapter-inducing interferon-beta)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
140
structure length
140
Chain Sequence
GPSLPSAFDILGAAGQDKLLYLKHKLKTPRPGCQGQDLLHAMVLLKLGQETEARISLEALKADAVARLVARQWAGVDSTEDPEEPPDVSWAVARLYHLLAEEKLCPASLRDVAYQEAVRTLSSRDDHRLGELQDEARNRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords TIR DOMAIN-CONTAINING ADAPTER MOLECULE 1
publication title The Tlr Signalling Adaptor Trif/Ticam-1 Has an N-Terminal Helical Domain with Structural Similarity to Ifit Proteins
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 140
sequence length 140
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17798 TRIF-NTD TRIF N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.780 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4c0mA00
4C0MA 4BSXA 2M63A
chains in the Genus database with same CATH superfamily
1MZCA 2LNIA 3TWQA 2IU1A 2OOEA 3HVEB 2WQ6A 2CG2A 2QZAA 1B89A 4GAAA 3KSLA 5KJMA 1O1SA 5CMWA 1D9SA 3SF4A 4GTOA 4U8YD 2KXPC 4N2SA 5AIJA 4UWHA 2L0TB 1JWGA 1TN7A 3UKUG 2WXJA 5A7DB 4U95D 2I6HA 2PM6A 1GW6A 2VJ8A 3TG4A 2ZIRA 1TJFA 2CG3A 4L9PA 2P58C 5FQ8A 4AJWA 4FC8A 1BU9A 4U8HA 2P9IG 1SA4A 4AM9A 2CFUA 1WDYA 2KCVA 2PQRA 2AVPA 3UT7A 2LXLA 4CT0A 3Q75A 4UWLA 5BT1A 2R03A 5BPPA 4Z68A 3UM2A 3CIAA 3UTMA 3UUXA 1ZB1A 3WXXA 1OY3D 3IV0A 2P9KG 3DPYA 5M72A 1SQMA 3EUVA 4U8VD 2YQ8A 5ENPD 4A1GA 2V5FA 4LG6A 3IKOB 3BQOA 1D8DA 4M7CA 4FU3A 4JHJA 5D0QD 1BI8B 2Y4UA 1FCHA 4B94A 3PNTB 4DUIA 4AY5A 4N3CA 3V31A 2JABA 5B1BE 1TNYA 2C0LA 3SY2A 5D0OD 3B7BA 4YDWA 4HLEA 2KZTA 4RG6A 4GCNA 2KZTB 4FP7A 3SBTB 1UJJA 2ZXWE 5CERB 2X38A 2V4LA 1JCQA 4G24A 3LXUX 3E4BA 4LNBA 5EN5D 3ISMC 3LVQE 1IYGA 4FLHA 2ETAA 3MGBA 3S7BA 4PS7A 2X6JA 4OAVB 1S64A 1HS6A 3G2SA 3D9HA 4GTTA 5KWDA 3G2TA 3QNKA 2HYZA 3BG1B 3APCA 1O1RA 3D9NA 4OYSA 3FTWA 4GTMA 3B7UX 2XEHA 4GYYA 4AVXA 4GA0A 3U4TA 4WWPA 4HFGA 4GZ5A 4UWKA 5KJNA 3CSFA 3CSTA 1E8ZA 4KZ0A 3ZGQA 2P9PG 5CCMA 3PZ2A 3TWWA 3JXIA 1E7UA 3EHNA 3GYZA 3SFYA 2XEEA 1SZAA 3PREA 4JVSA 3EHQA 4TXPA 3KEAA 4FA6A 4EHMA 4JC8A 4I43A 2Q7FA 3FFLA 1KLXA 5EIBE 5JJ6A 2EIME 3EIQC 2VGEA 3ZRHA 1RZ4A 3ZNGA 3EIJA 4GA2A 2LXMA 3JQ1A 3ULYA 2J4DA 2IO3C 4QFVA 1E8YA 2J09A 2WXQA 4EECA 1E8XA 1D8EA 4UUCA 4AXHA 4R7LA 1K8KG 4A63B 2WXLA 3ZIMA 1FVHA 3AS4A 4LCTA 4DX6D 3RJVA 2DYRE 2MYOA 2EINE 5KJLA 3RIBA 5HI7A 2OCCE 2FBNA 3NAWA 4DJAA 4HORA 2V8SE 1FT2A 4BX9A 3ML9A 3HRAA 1MYOA 4KZCA 3JCKC 3UT4A 4DLOA 4WWOA 3E30A 2V4HC 4ZHBA 5EX3A 3UIOC 4GYWA 2NSZA 2IOLA 3FUIA 3UINC 4HOSA 2I1JA 3OXGA 3EU9A 3VTYA 1N4PA 2BUGA 1DNPA 1TN6A 3QJZA 3JQ0A 3PE4A 2ZGDA 1E90A 3IEGA 4APFA 3Q79A 1OCOE 3CVQA 5LP0A 2A5UA 2GROB 1LTXA 3C72A 4B8AA 1EPUA 4BESA 3EDTB 2GRLA 3QKYA 4DPRA 4HOUA 1VDYA 3FUMA 3HYMB 3AG3E 2ZISA 4ME2A 1LD7A 1N4RA 3Q5MA 2LO6A 5EILA 4U04A 1WG0A 5G2NA 2EIKE 4BETA 3RAUA 2ILRA 5EIDA 5LCWJ 4CZ2D 4ILHB 2BTDA 3TG5A 2NC9A 4XI0A 3ZXSA 2LUHA 4GTVA 5CEAA 4PS3A 4BERA 4GB9A 1V54E 1EDUA 1QYMA 1H2UA 2KC7A 3RKVA 3UMVA 3HHMA 4CGWA 3Q15A 3C98A 3E37A 4I1AA 2A4ZA 2PL2A 1OWOA 4JD2G 4LNUD 1G3NB 5BV0A 3FULA 4UWFA 1FT1A 3B95A 4I2ZA 4O1OA 3TAXA 1MX6A 5AN8A 4NQ0A 2YNQA 4RG9A 3RRNB 3C5RA 4N39A 3ZEFA 2ONDA 2M63A 4QQIA 3NQPA 4UQYA 3U3WA 5FINA 1QBQA 2H6IA 4OAUC 3GZ1A 4LSZE 3L82A 4G8LA 3S7DA 4E6HA 1OT8A 5D66A 3UIPC 3L22A 4YDEA 3ONKA 1ZU2A 2NXPA 4OVVA 3HXDA 3CVLA 3LS8A 5C1DA 4L2LA 2QYUA 3ULEG 4B89A 4MLPA 1KZPA 1HX8A 3OXLA 1PAQA 3OXFA 4C9BB 2VYIA 1EYHA 3DSSA 4GTQA 2IONA 2XENA 3CQGB 4L7TA 5FZRA 1PC2A 3ZYMA 2L0IA 3JUEA 4G25A 2XCBA 3TL5A 3G2VA 1Z3YA 4K5CA 1IQRA 3FUJA 3BG0B 1FVFA 4B8CB 3R9AB 3CK7A 1H2TC 3G2UA 2I2OA 2WXNA 3FH7A 3CHPA 1MQSA 4I17A 4GCOA 5G05C 2H6HA 4WUYA 2GRPB 3L54A 4WNGA 3TXNA 1TN8A 3AU4A 5A23A 1QQEA 3ZVVA 5EYLA 3UI2A 4XIFA 1IQUA 5JHAA 1INZA 5G04C 2R5SA 1H0AA 4UI9J 4XKBA 2IF4A 3CEQA 4U7EB 3CHOA 4FHKA 4O60A 3KD7A 2GW1A 3L13A 4C0EA 4GZ6A 4I6GA 3AAAC 3DSXA 2R59A 4F1SA 5T4YA 3LY9A 3ASHA 1HG5A 5BW8C 5FTPA 3D9LA 4F6RD 2AXVA 4PS8A 4ILGA 3FTUA 2Y4TA 3E32A 4PDXA 4Q69A 3RRMB 4JA9A 4ANUA 2QFCA 4JW1A 3Q7AA 3W9FA 5BXUA 1U3CA 4B93B 5E76A 1K3ZD 5LX8A 5AENA 3L08A 4JZYA 4TUMA 2P9NG 1HZ4A 2CHZA 5HKPA 4YNDA 5FJYA 2DWZA 3FTZA 4G2VA 1Z3XA 4GZDA 3GZSA 2LAIA 4GMLA 3QWVA 3QOUA 4N2QA 2KCKA 1EF1C 1TR4A 3HXFA 4UI9K 1N95A 2IJGX 3U64A 3BU8A 3MV3B 4RVBA 3CVPA 2XPYA 4I6JA 3TWXA 2KM4A 4JHRA 4J8SA 5T3RA 2RFAA 1WY6A 4DX7D 3TWVA 2VGXA 1BD8A 5AQ7A 1Q2ZA 2VGXB 3SI5A 1JCSA 2E2EA 2WMNA 5JHBA 3URZA 2DZNA 3NZUA 1KZOA 2RFMA 4BX8A 2A5EA 2XQ0A 2VQ2A 3RK6A 3MCXA 3U9WA 4N3BA 4HNAD 3ULQA 3PUJA 2PZIA 3C3RA 5AARA 1N4SA 4TUUA 2UY1A 4LNGA 4CDNA 3EHMA 3SD5A 1Z5SC 2UY1B 1TEZA 4YVOA 4CRWA 3ML8A 1O5MA 3TWRA 1HO8A 4V3IA 4K03A 3DBSA 3CV0A 3UX4A 3EU5A 2WXPA 3ASNE 3L9TA 2R2LA 4GTSA 4J8FA 3E33A 1U2VG 4FHJA 3ZHEB 5EDSA 3B7RL 1HFAA 1OWPA 2XGSA 3FWVA 3Q47B 2XPIA 5KNGA 2RKKA 5KNHD 3CR3A 4UWGA 3PZ1A 1N9AA 2HE0A 2OEWA 2OVBA 5AQAA 4J8YA 5T8IA 3G2WA 2L9BA 1TNOA 3B7SA 4KVMA 1DCEA 4CCAA 3ZPJA 1ELKA 2P9LG 3MX3A 2F0YA 1MX4A 2VSOE 2CHWA 2V5QC 2HR2A 3AG4E 2C2LA 3QARA 5ENQD 3GZ2A 5ARGA 1S0PA 1UOHA 3CVXA 1TNBA 4WNEA 3OTNA 2P2CP 2VSXE 4GPKA 2F8XK 3MJWA 5ARFA 2J9QA 2XZTG 5JJ7A 1KPSB 1YCSB 4BY6A 4APOA 2F8YA 4JPSA 2MRIA 1OCRE 2WXOA 5KBAA 3HIZA 4N3AA 2KCLA 3ENEA 3SBSA 1FPPA 2FULA 3C3OA 3ZN3A 2J07A 1NL4A 3FEYA 2NYJA 3DEOA 3LY8A 3FTXA 4HVBA 2XRYA 4LERA 5CRVA 5AQBA 2FF4A 5AJLA 1K1AA 2Y1LE 4HXIA 3RSEG 4TXQA 3LYAA 5CBOA 4BT8A 4TXRA 3X2QE 5FZSA 3CKBA 3E34A 5FQ4A 3ASOE 5JJTA 4E85A 1N11A 2WXIA 4ANXA 3LJNA 3ASDA 3PUKA 3FH5A 2HO1A 1WAO1 3ZKJA 1P5QA 3CHSA 5AQ9A 2XEVA 1E8WA 3GW4A 4FULA 5JA4D 2UWJG 3CGHA 2WQHA 4DI3A 3B13A 2ETCA 2I9CA 2GRQB 4HI9A 1N0RA 4ZFHA 4AP2A 2BF0X 4C0MA 1HU3A 3FTSA 3DRAA 4JEUA 3CQCB 4AOFA 1H19A 3SFZA 4DX2A 5FQ7A 1S63A 1H2VC 2C0MA 1A17A 4PH4B 2X6HA 4K5AB 2KATA 3TXMA 3FEXA 1W3BA 4FADA 3NF1A 2YINA 3D9OA 4AV7A 4ANVA 3UM0A 3PZDA 3FU0A 3ESLA 3FY4A 3IHVA 4RLYA 4MKTA 3D9JA 5D2MC 4G26A 4JA7A 4X8QA 3Q73A 5AYWD 1V55E 2FI7A 5ANRA 2L6JA 3ESKA 3AS8A 4XE0A 2XS8A 4EPZA 3O4ZA 1NZNA 3L17A 4TRQA 1JUQA 1HH8A 2DZOA 4RSYA 2J8SD 3FUFA 3DPDA 2X3MA 4EQFA 5ENTD 5C2YA 3T9KA 3QB2A 3ONLA 4JHKA 5G04J 1Y6IA 4G8KA 2WXHA 4Y6WA 4JB8P 3RU0A 1SW6A 3JYSA 4NRHB 3FUHA 2IY0C 1SA5A 3FTYA 4BTBA 3NOGD 3NOCD 3Q78A 3D9KA 2BEDA 4CDRA 1KT0A 2WPVA 2YHCA 3Q9NC 4WNDA 5AJDA 2EIJE 1TJCA 3LDZA 3FHEA 3NB2A 2XS1A 3CHQA 2AJAA 3LKUA 3FTVA 3T8KA 3UPVA 2OVFA 4LEUA 4L2YA 3I3NA 1WM5A 3CKCA 4HRNA 3D9IA 4CYMD 3VTXA 4L23A 2OV8A 1IKND 3V79K 3CHMA 3R7RA 3UM1A 4U0SA 4ABNA 1QNFA 1NI1A 5G55A 4DX5D 4O6FA 3QDNA 5E75A 4UQXA 4KVOA 2PNNA 4XEIG 1XNFA 3ZYQA 4F1PA 2ZGGA 2B6CA 4XZ4A 1HF8A 4U0ZA 3N71A 2GRMA 1IHBA 3LCAA 4IULA 3V2OA 2CFZA 1DC2A 3MV2B 2AWIA 4ATGA 4BTAA 2QYJA 5KCMA 5BXOA 4BT9A 3J5PA 5CCLA 3Q49B 1OXJA 3Q4AB 5B1AE 3PRZA 1AP7A 4H7XA 1RW2A 3QAQA 4U07A 1UJKA 2AXUA 2J49A 4Q94A 4EZJA 2ETBA 2WXMA 2RD0A 4BFRA 3HXEA 3T5VA 1NFIE 3DEPA 2DBAA 4GTRA 3TJPA 2V0PA 1OUVA 3CLJA 3QWWA 3TGOA 2VGYA 5CMYA 3ZW3A 4A1SA 3ZXPA 3MZLB 3UT8A 4GU5A 2WQ7A 1NP7A 2WM9A 2WXRA 3JXJA 3AG2E 2LAHA 4J0UA 3MYVA 2PQNA 3AG1E 3KEZA 3EHRA 3PE3A 4W9RA 1N94A 5EYPF 4AIFA 5J08A 2XGMA 4K5BA 2IOSA 3ZU7B 2XPZA 3V2XA 4A3VA 3FUKA 3J5QB 4D10C 4HI8A 4FLBA 3APDA 1XGWA 4H7YA 4N5QA 3QC1A 2QY7A 3FH8A 3D3MA 1KT1A 3FUEA 3HG0D 2R17C 5DIZA 4A3TA 4J6IA 2KBXA 1YYHA 2I1KA 3T5XA 4CDMA 1Z6TA 4UI9C 5CBNA 3FU3A 1TNZA 3R9MA 1H6OA 3LVRE 4HS2A 3I4GA 4U63A 4I1OB 1NA0A 1OCZE 1N52A 5AAOA 2FO7A 2H6GA 3PZ4A 2GGFA 4U96D 2IEJA 4F53A 2QC9A 3DSTA 4ATZD 3P2BA 4AEZC 5IY5E 3FUNA 2IQCA 5FIOA 3S7FA 1LF8A 2WXKA 3VLEA 3ZHEA 4HB5A 2WXGA 4ILIA 3S7JA 1E7VA 1MX2A 4WWNA 3U66A 3AS5A 3D9MA 4FJZA 4LUNU 4O1PA 2MHKA 4KBQA 4P29A 3WG7E 2H6FA 4WNFA 4EZKA 1HXIA 3K9IA 4M3OA 2EQXA 4BSZB 3KSQA 3SGHA 4AY6A 1AWCB 3CVWA 4HOQA 3SNXA 4I9CA 3LY7A 2WVIA 3BEEA 3W9GA 4YVQC 4GA1A 3O48A 3Q9UC 1MJ0A 3ZUVB 4DLQA 2GRRB 1PY1A 5CECB 3FDHA 4C48B 3S2AA 5EKQD 3SZ7A 1NA3A 4GYOA 3LJ3A 4GMRA 4ACLA 3R7QA 4GPMA 4RQIA 3UKRG 4ACKA 3MKQA 2VTBA 4I9EA 3D9PA 4HRMB 3MKQB 2VTBB 3I5PA 5ENRD 5JMND 4YDYA 3JUIA 1OWMA 1SVXA 5CEDB 3IHYA 3C3QA 2DVWA 4NIKA 5J90A 1X81A 3TWTA 1K1BA 1JPLA 1YA0A 3CHRA 1O1TA 2IFUA 2WMOA 1OCCE 2X6IA 3CVVA 1LD8A 3UQ3A 2XHEA 4I2WA 4Q96A 3KAEA 2J08A 5FQ6A 3PS6A 4J7WA 3F6QA 2F37A 5ENSD 2RG8A 4TV3A 4I6EA 4YDOA 2YHEA 2XCCA 1E96B 3PEVB 3KS2A 5CRUA 4N5CA 2LSUA 3UXGA 5ENOD 3HXCA 2JLBA 4KXKB 4BWRA 4URKA 3LPZA 1H6KA 1L5JA 3ZYLA 1X5BA 3DSWA 3CVNA 3SQVA 3RRUA 5LOZA 1BPOA 1YMPA 3TWUA 4BEPA 3I4RB 3CVYA 3NBNB 2AXZA 2AW6A 1N4QA 2BKGA 2DYSE 1BLXB 3ABLE 5BNWA 4CEMA 1H6PA 5FWQA 3PEUB 4G11A 4XKCA 5ENNA 4PUCA 2P9UG 3HDXA 1N0QA 4MS6A 2BKKB 3QWPA 4GZ3A 4JXTA 3AJIA 1QZ2A 5HRYA 2OEVA 3VLDA 5KJKA 4HOTA 2FEZA 4F3VA 5HQ8A 1HE8A 4KMOA 5BV1A 1IXVA 5ANLA 4HQDA 4F7AA 4DRXE 4MRUA 5FT9A 4GTPA 3B7TA 2E0IA 1OWNA 2LSVA 1A5EA 3RO2A 3PVLA 3QK0A 2Y3AA 3UM3A 2XGOA 2B0OE 1MHQA 2L6BA 1JCRA 4KYOB 4ANWA 4HLLA 1ZBPA 1UG3A 4IRUA 2CHXA 2ZU6B 1JWFA 4JL0A 2WB2A 1DVPA 3DXKG 3PZ3A 3OAWA 4UQZA 5G05J 4I1MA 3RO3A 2HM8A 3FP3A 1S70B 3T8MA 3APFA 4NACA 4J8EA 5DBKA 2X6FA 2J4BA 1N54A 4BSXA 3ASFA 2P9SG 4Y6CA 3L6AA 3MKRA 2EILE 4L1BA 3P1UA 4OVUA 3LEWA 1TNUA 4WAFA 5ITZF 4U0UA 4GZCA 2IO2C 4FJYA 2Y69E 3VLFA 4LRZA 4A55A 2R05A 2XRZA 2GRNB 5EX0A 3PDNA 3IXEA 3SFXA 2Y0BG 3EJNA 4J8DA 2VSNA 2VSYA 4DK5A 1SZ9A 2MOWA 5A6CA 3SHFA 4DX1A 1UN8A 1DCQA 4MBGA 3FUDA 3HXBA 3BUAA 3IBEA 5FZQA 1Y8MA 4EBAA 1ELRA 4B0ZA 4NURA 3ABME 2DIWA 4DI4A 5LCWC 4K0RA 3DXMG 2XZDG 3ZFWA 4XI9A 3CK9A 3V30A 3DSUA 4XX5A 2R02A 2FO1E 5B3SE 4CT4A 4EBAG 3PH0C 5HS0A 4HBDA 3DSVA 3TWSA 1IHGA 4G1TA 2X6KA 4EZLA 1ELWA 3SO8A 1U3DA 4IYPA 1UN9A 4KT6B 5H7PA 5LFAA 3MEKA 4IN3B 2PM7A 4G23A 4HRLA 3Q7FA 2WXFA 4JEHA 3FU5A 3AU5A 1TYQG 3PNLB 5CHEE 2DCPA 3CK8A 4CGVA 3ASGA 3DWLG 5BUZA 1BI7B 3MA5A 4GMJA 3CVUA 3FU6A 1UW4B 3ABKE 3ZYKA 1OWLA 3L16A 2JEKA 1HG2A 3HVEA 3NZSA
chains in the Genus database with same CATH topology
3U66A 3AS5A 2LNIA 3D9MA 4N39A 3ZEFA 4E85A 2ONDA 4FJZA 2WXIA 2IU1A 2OOEA 4LUNU 3HVEB 4ANXA 2M63A 2MHKA 3ASDA 3NQPA 3PUKA 4KBQA 2CG2A 4P29A 4UQYA 1B89A 4GAAA 3FH5A 3U3WA 5KJMA 4WNFA 5CMWA 3SF4A 2HO1A 4EZKA 1WAO1 1HXIA 3K9IA 4M3OA 4N2SA 1P5QA 2EQXA 3CHSA 3GZ1A 5AIJA 4UWHA 2L0TB 2XEVA 1E8WA 1JWGA 3GW4A 4FULA 2UWJG 2WXJA 5A7DB 3CGHA 3S7DA 2WQHA 4E6HA 2I6HA 3SGHA 2PM6A 1GW6A 4DI3A 4AY6A 2VJ8A 3TG4A 3L22A 3ONKA 3B13A 1ZU2A 1TJFA 2CG3A 2I9CA 2NXPA 2P58C 4OVVA 3CVLA 3LS8A 5FQ8A 3CVWA 4HOQA 5C1DA 3SNXA 4I9CA 4AP2A 4L2LA 4AJWA 3LY7A 2BF0X 4FC8A 2WVIA 4B89A 3BEEA 4C0MA 4U8HA 1HU3A 4YVQC 4GA1A 3O48A 4MLPA 3FTSA 4AM9A 2CFUA 1HX8A 4JEUA 3OXLA 4DLQA 2KCVA 2PQRA 3CQCB 2AVPA 4AOFA 1PAQA 1H19A 1PY1A 3UT7A 3OXFA 4CT0A 4C9BB 3FDHA 3S2AA 5EKQD 3SFZA 2VYIA 3SZ7A 1NA3A 4GYOA 3LJ3A 1EYHA 5FQ7A 4UWLA 2IONA 5BT1A 1H2VC 4ACLA 2C0MA 1A17A 3CQGB 4L7TA 3R7QA 5BPPA 4PH4B 5FZRA 1PC2A 3ZYMA 4ACKA 3CIAA 3MKQA 2L0IA 4I9EA 4G25A 2VTBA 2XCBA 2X6HA 3TL5A 2KATA 3D9PA 3TXMA 3FEXA 1W3BA 3MKQB 3G2VA 3I5PA 3UUXA 2VTBB 1Z3YA 4FADA 3NF1A 3WXXA 2YINA 3IV0A 5M72A 1IQRA 3FUJA 1SQMA 3BG0B 3JUIA 1FVFA 3D9OA 4B8CB 4AV7A 4ANVA 1OWMA 3PZDA 3FU0A 3R9AB 3ESLA 3CK7A 1H2TC 3IHYA 3G2UA 2I2OA 2WXNA 3FH7A 3CHPA 1MQSA 2YQ8A 3FY4A 5J90A 3IHVA 4I17A 4MKTA 4GCOA 5G05C 3D9JA 4A1GA 2V5FA 1JPLA 1YA0A 3IKOB 4WUYA 4G26A 4JA7A 4FU3A 4JHJA 3CHRA 5D0QD 2IFUA 3L54A 2WMOA 5AYWD 4WNGA 3TXNA 2X6IA 2FI7A 3AU4A 2Y4UA 5A23A 3CVVA 5ANRA 3UQ3A 2L6JA 2XHEA 1QQEA 3ESKA 4I2WA 3ZVVA 1FCHA 4B94A 3AS8A 4Q96A 3PNTB 4XIFA 1IQUA 3KAEA 4XE0A 2J08A 4AY5A 5JHAA 5FQ6A 1INZA 5G04C 4N3CA 2R5SA 1H0AA 3PS6A 4UI9J 4XKBA 2IF4A 4EPZA 3CEQA 3O4ZA 2C0LA 1NZNA 3CHOA 3L17A 4TRQA 1JUQA 5D0OD 1HH8A 2RG8A 4TV3A 4RSYA 4HLEA 2KZTA 3FUFA 4FHKA 4I6EA 3DPDA 2X3MA 2YHEA 4RG6A 2XCCA 1E96B 4GCNA 4EQFA 3KD7A 3PEVB 2KZTB 3KS2A 5C2YA 2GW1A 4FP7A 3QB2A 3SBTB 4N5CA 1UJJA 3L13A 4C0EA 3ONLA 2X38A 4GZ6A 4I6GA 2V4LA 2WQ6A 4JHKA 5G04J 2LSUA 2R59A 4F1SA 5T4YA 1Y6IA 3LY9A 4G24A 2WXHA 4Y6WA 3ASHA 1HG5A 2JLBA 4KXKB 5BW8C 5FTPA 4BWRA 3LXUX 3RU0A 3D9LA 4URKA 3E4BA 3LPZA 3LVQE 3JYSA 1H6KA 4NRHB 2AXVA 3FUHA 1IYGA 4PS8A 1L5JA 4FLHA 4ILGA 3FTUA 3MGBA 3ZYLA 3FTYA 4BTBA 2Y4TA 4PDXA 3S7BA 4PS7A 2X6JA 4Q69A 1X5BA 3RRMB 3CVNA 4JA9A 4ANUA 3D9KA 4CDRA 2WPVA 1KT0A 2YHCA 2QFCA 4WNDA 1HS6A 5AJDA 3RRUA 5LOZA 4JW1A 1BPOA 1TJCA 3LDZA 3G2SA 3I4RB 3CVYA 3FHEA 2AXZA 3CHQA 3G2TA 1U3CA 2AW6A 3LKUA 2HYZA 3FTVA 3QNKA 5E76A 3BG1B 3UPVA 2OVFA 3APCA 5BNWA 4LEUA 4L2YA 4CEMA 5LX8A 5AENA 3L08A 3D9NA 4JZYA 3I3NA 3PEUB 4ILIA 3FTWA 4OYSA 5FWQA 4G11A 4XKCA 1HZ4A 1WM5A 3CKCA 2CHZA 3B7UX 4YNDA 5ENNA 4PUCA 4G2VA 3FTZA 4GYYA 4GA0A 5FJYA 1Z3XA 4AVXA 3HDXA 3D9IA 4GZDA 3GZSA 3VTXA 2LAIA 4L23A 4GMLA 2OV8A 4MS6A 3U4TA 3QWPA 4GZ3A 4JXTA 4WWPA 4HFGA 3QWVA 4GZ5A 4UWKA 1QZ2A 3QOUA 4N2QA 5KJNA 2KCKA 1EF1C 3CSFA 3VLDA 3CHMA 3CSTA 4UI9K 1E8ZA 3R7RA 4KZ0A 3ZGQA 2IJGX 5KJKA 4U0SA 5CCMA 3U64A 3MV3B 4RVBA 3CVPA 4ABNA 2XPYA 4I6JA 2KM4A 1QNFA 4HOTA 2FEZA 4F3VA 1E7UA 3EHNA 5HQ8A 1HE8A 3GYZA 4JHRA 4J8SA 4KMOA 5BV1A 5G55A 5ANLA 5T3RA 1WY6A 1SZAA 4O6FA 3QDNA 3PREA 5E75A 2VGXA 4JVSA 4UQXA 4KVOA 4F7AA 4MRUA 4FA6A 5FT9A 3B7TA 4JC8A 2VGXB 2E0IA 4I43A 1XNFA 2Q7FA 3FFLA 3SI5A 1OWNA 1KLXA 2E2EA 2WMNA 2LSVA 3ZYQA 5JHBA 3RO2A 3URZA 3PVLA 3QK0A 5JJ6A 4XZ4A 3NZUA 1HF8A 2Y3AA 2XGOA 4U0ZA 3EIQC 1MHQA 3N71A 2GRMA 4BX8A 4KYOB 3LCAA 4IULA 3ZRHA 2XQ0A 2VQ2A 4ANWA 3RK6A 3MCXA 2CFZA 3U9WA 1ZBPA 3EIJA 1UG3A 4GA2A 4IRUA 4N3BA 2CHXA 2ZU6B 1JWFA 3JQ1A 3MV2B 2AWIA 4JL0A 1DVPA 2J4DA 4ATGA 2WB2A 4BTAA 5KCMA 3OAWA 3ULQA 4UQZA 4QFVA 5G05J 4I1MA 3PUJA 1E8YA 3RO3A 2J09A 2WXQA 4BT9A 5CCLA 3Q49B 2HM8A 3FP3A 2PZIA 3Q4AB 3T8MA 4EECA 3PRZA 1E8XA 3APFA 4NACA 4H7XA 3QAQA 4TUUA 4AXHA 2UY1A 4R7LA 4CDNA 3EHMA 4J8EA 4U07A 2X6FA 5DBKA 2WXLA 3SD5A 1FVHA 3AS4A 1UJKA 2AXUA 2J49A 4LCTA 4Q94A 3ZIMA 4EZJA 2J4BA 3RRNB 2UY1B 1N54A 1TEZA 2WXMA 4YVOA 4BSXA 3RJVA 3ASFA 3ML8A 4CRWA 2RD0A 4Y6CA 3L6AA 1HO8A 3MKRA 4V3IA 4BFRA 4K03A 3DBSA 4L1BA 3CV0A 3UX4A 3P1UA 4OVUA 2WXPA 3T5VA 3LEWA 4J8FA 2DBAA 5KJLA 4FHJA 3RIBA 5HI7A 4WAFA 2FBNA 4U0UA 3TJPA 3ZHEB 4GZCA 2V0PA 1OUVA 3CLJA 4FJYA 4DJAA 4HORA 3QWWA 5EDSA 2V8SE 3B7RL 1HFAA 2VGYA 3ML9A 5CMYA 3VLFA 1OWPA 2XGSA 4A1SA 4LRZA 3ZW3A 4BX9A 3FWVA 3Q47B 4A55A 3MZLB 3TGOA 2XRZA 2XPIA 4KZCA 3JCKC 3UT8A 3UT4A 5EX0A 3CR3A 3PDNA 4GU5A 4UWGA 4DLOA 4WWOA 2WQ7A 1NP7A 2WM9A 2OVBA 2WXRA 3EJNA 4J8DA 2VSNA 5T8IA 5EX3A 2VSYA 2LAHA 2NSZA 3G2WA 4GYWA 2L9BA 2IOLA 3B7SA 3FUIA 4J0UA 4KVMA 3MYVA 4DK5A 4HOSA 2PQNA 1SZ9A 2I1JA 3OXGA 4CCAA 2MOWA 1ELKA 3ZPJA 5A6CA 3VTYA 2BUGA 1DNPA 3QJZA 3SHFA 3JQ0A 3PE4A 3MX3A 1UN8A 3KEZA 3PE3A 2VSOE 1E90A 2CHWA 3FUDA 3IEGA 4APFA 2HR2A 2C2LA 3CVQA 3IBEA 3QARA 4W9RA 5LP0A 5FZQA 3GZ2A 1Y8MA 4AIFA 4EBAA 5J08A 2A5UA 5ARGA 1S0PA 1ELRA 4B0ZA 2XGMA 4NURA 3CVXA 2IOSA 2DIWA 4B8AA 4DI4A 1EPUA 4WNEA 3OTNA 5LCWC 2XPZA 4K0RA 4A3VA 3EDTB 2GRLA 3QKYA 2VSXE 3FUKA 4D10C 4DPRA 4HOUA 1VDYA 3FUMA 4FLBA 4GPKA 3APDA 3HYMB 3ZFWA 3MJWA 1XGWA 4ME2A 5ARFA 4XI9A 3CK9A 2J9QA 4H7YA 3Q5MA 2LO6A 5JJ7A 4U04A 4BY6A 4XX5A 5G2NA 3QC1A 2QY7A 4APOA 3FH8A 3D3MA 4JPSA 2ILRA 3PH0C 4CT4A 2MRIA 4EBAG 2WXOA 1KT1A 5LCWJ 3FUEA 4ILHB 2R17C 5DIZA 3HIZA 4N3AA 1IHGA 4A3TA 4G1TA 2BTDA 3TG5A 2KCLA 3ENEA 2X6KA 4J6IA 1ELWA 2NC9A 1U3DA 2I1KA 3SBSA 4EZLA 4XI0A 2FULA 4IYPA 1UN9A 4KT6B 3ZN3A 3T5XA 3ZXSA 4CDMA 2J07A 3FEYA 4PS3A 1Z6TA 5LFAA 4UI9C 3MEKA 4IN3B 3LY8A 3FU3A 2PM7A 4GB9A 3FTXA 1EDUA 3LVRE 4G23A 3I4GA 2XRYA 4HS2A 4U63A 4HVBA 2WXFA 4I1OB 4LERA 1H2UA 1NA0A 4JEHA 2KC7A 3RKVA 3UMVA 1N52A 2FO7A 3HHMA 4CGWA 3FU5A 3AU5A 3Q15A 3C98A 3PNLB 5CHEE 2FF4A 4I1AA 2GGFA 2DCPA 5AJLA 2A4ZA 2PL2A 1OWOA 3CK8A 4HXIA 4CGVA 3ASGA 3LYAA 5BUZA 5BV0A 4F53A 4BT8A 3MA5A 4GMJA 3FULA 4UWFA 4WWNA 3P2BA 4AEZC 3FU6A 3CVUA 1UW4B 4I2ZA 3ZYKA 3FUNA 3TAXA 2IQCA 5FZSA 1OWLA 3CKBA 3S7FA 3L16A 1LF8A 2JEKA 2WXKA 4NQ0A 2YNQA 4RG9A 5FQ4A 3VLEA 1HG2A 3ZHEA 2WXGA 1E7VA 3S7JA 5JJTA 3HVEA 3NZSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C0M A;  4BSX A;  2M63 A; 
#chains in the Genus database with same CATH topology
 1MZC A;  2LNI A;  3TWQ A;  2IU1 A;  2OOE A;  3HVE B;  2WQ6 A;  2CG2 A;  2QZA A;  1B89 A;  4GAA A;  3KSL A;  5KJM A;  1O1S A;  5CMW A;  1D9S A;  3SF4 A;  4GTO A;  4U8Y D;  2KXP C;  4N2S A;  5AIJ A;  4UWH A;  2L0T B;  1JWG A;  1TN7 A;  3UKU G;  2WXJ A;  5A7D B;  4U95 D;  2I6H A;  2PM6 A;  1GW6 A;  2VJ8 A;  3TG4 A;  2ZIR A;  1TJF A;  2CG3 A;  4L9P A;  2P58 C;  5FQ8 A;  4AJW A;  4FC8 A;  1BU9 A;  4U8H A;  2P9I G;  1SA4 A;  4AM9 A;  2CFU A;  1WDY A;  2KCV A;  2PQR A;  2AVP A;  3UT7 A;  2LXL A;  4CT0 A;  3Q75 A;  4UWL A;  5BT1 A;  2R03 A;  5BPP A;  4Z68 A;  3UM2 A;  3CIA A;  3UTM A;  3UUX A;  1ZB1 A;  3WXX A;  1OY3 D;  3IV0 A;  2P9K G;  3DPY A;  5M72 A;  1SQM A;  3EUV A;  4U8V D;  2YQ8 A;  5ENP D;  4A1G A;  2V5F A;  4LG6 A;  3IKO B;  3BQO A;  1D8D A;  4M7C A;  4FU3 A;  4JHJ A;  5D0Q D;  1BI8 B;  2Y4U A;  1FCH A;  4B94 A;  3PNT B;  4DUI A;  4AY5 A;  4N3C A;  3V31 A;  2JAB A;  5B1B E;  1TNY A;  2C0L A;  3SY2 A;  5D0O D;  3B7B A;  4YDW A;  4HLE A;  2KZT A;  4RG6 A;  4GCN A;  2KZT B;  4FP7 A;  3SBT B;  1UJJ A;  2ZXW E;  5CER B;  2X38 A;  2V4L A;  1JCQ A;  4G24 A;  3LXU X;  3E4B A;  4LNB A;  5EN5 D;  3ISM C;  3LVQ E;  1IYG A;  4FLH A;  2ETA A;  3MGB A;  3S7B A;  4PS7 A;  2X6J A;  4OAV B;  1S64 A;  1HS6 A;  3G2S A;  3D9H A;  4GTT A;  5KWD A;  3G2T A;  3QNK A;  2HYZ A;  3BG1 B;  3APC A;  1O1R A;  3D9N A;  4OYS A;  3FTW A;  4GTM A;  3B7U X;  2XEH A;  4GYY A;  4AVX A;  4GA0 A;  3U4T A;  4WWP A;  4HFG A;  4GZ5 A;  4UWK A;  5KJN A;  3CSF A;  3CST A;  1E8Z A;  4KZ0 A;  3ZGQ A;  2P9P G;  5CCM A;  3PZ2 A;  3TWW A;  3JXI A;  1E7U A;  3EHN A;  3GYZ A;  3SFY A;  2XEE A;  1SZA A;  3PRE A;  4JVS A;  3EHQ A;  4TXP A;  3KEA A;  4FA6 A;  4EHM A;  4JC8 A;  4I43 A;  2Q7F A;  3FFL A;  1KLX A;  5EIB E;  5JJ6 A;  2EIM E;  3EIQ C;  2VGE A;  3ZRH A;  1RZ4 A;  3ZNG A;  3EIJ A;  4GA2 A;  2LXM A;  3JQ1 A;  3ULY A;  2J4D A;  2IO3 C;  4QFV A;  1E8Y A;  2J09 A;  2WXQ A;  4EEC A;  1E8X A;  1D8E A;  4UUC A;  4AXH A;  4R7L A;  1K8K G;  4A63 B;  2WXL A;  3ZIM A;  1FVH A;  3AS4 A;  4LCT A;  4DX6 D;  3RJV A;  2DYR E;  2MYO A;  2EIN E;  5KJL A;  3RIB A;  5HI7 A;  2OCC E;  2FBN A;  3NAW A;  4DJA A;  4HOR A;  2V8S E;  1FT2 A;  4BX9 A;  3ML9 A;  3HRA A;  1MYO A;  4KZC A;  3JCK C;  3UT4 A;  4DLO A;  4WWO A;  3E30 A;  2V4H C;  4ZHB A;  5EX3 A;  3UIO C;  4GYW A;  2NSZ A;  2IOL A;  3FUI A;  3UIN C;  4HOS A;  2I1J A;  3OXG A;  3EU9 A;  3VTY A;  1N4P A;  2BUG A;  1DNP A;  1TN6 A;  3QJZ A;  3JQ0 A;  3PE4 A;  2ZGD A;  1E90 A;  3IEG A;  4APF A;  3Q79 A;  1OCO E;  3CVQ A;  5LP0 A;  2A5U A;  2GRO B;  1LTX A;  3C72 A;  4B8A A;  1EPU A;  4BES A;  3EDT B;  2GRL A;  3QKY A;  4DPR A;  4HOU A;  1VDY A;  3FUM A;  3HYM B;  3AG3 E;  2ZIS A;  4ME2 A;  1LD7 A;  1N4R A;  3Q5M A;  2LO6 A;  5EIL A;  4U04 A;  1WG0 A;  5G2N A;  2EIK E;  4BET A;  3RAU A;  2ILR A;  5EID A;  5LCW J;  4CZ2 D;  4ILH B;  2BTD A;  3TG5 A;  2NC9 A;  4XI0 A;  3ZXS A;  2LUH A;  4GTV A;  5CEA A;  4PS3 A;  4BER A;  4GB9 A;  1V54 E;  1EDU A;  1QYM A;  1H2U A;  2KC7 A;  3RKV A;  3UMV A;  3HHM A;  4CGW A;  3Q15 A;  3C98 A;  3E37 A;  4I1A A;  2A4Z A;  2PL2 A;  1OWO A;  4JD2 G;  4LNU D;  1G3N B;  5BV0 A;  3FUL A;  4UWF A;  1FT1 A;  3B95 A;  4I2Z A;  4O1O A;  3TAX A;  1MX6 A;  5AN8 A;  4NQ0 A;  2YNQ A;  4RG9 A;  3RRN B;  3C5R A;  4N39 A;  3ZEF A;  2OND A;  2M63 A;  4QQI A;  3NQP A;  4UQY A;  3U3W A;  5FIN A;  1QBQ A;  2H6I A;  4OAU C;  3GZ1 A;  4LSZ E;  3L82 A;  4G8L A;  3S7D A;  4E6H A;  1OT8 A;  5D66 A;  3UIP C;  3L22 A;  4YDE A;  3ONK A;  1ZU2 A;  2NXP A;  4OVV A;  3HXD A;  3CVL A;  3LS8 A;  5C1D A;  4L2L A;  2QYU A;  3ULE G;  4B89 A;  4MLP A;  1KZP A;  1HX8 A;  3OXL A;  1PAQ A;  3OXF A;  4C9B B;  2VYI A;  1EYH A;  3DSS A;  4GTQ A;  2ION A;  2XEN A;  3CQG B;  4L7T A;  5FZR A;  1PC2 A;  3ZYM A;  2L0I A;  3JUE A;  4G25 A;  2XCB A;  3TL5 A;  3G2V A;  1Z3Y A;  4K5C A;  1IQR A;  3FUJ A;  3BG0 B;  1FVF A;  4B8C B;  3R9A B;  3CK7 A;  1H2T C;  3G2U A;  2I2O A;  2WXN A;  3FH7 A;  3CHP A;  1MQS A;  4I17 A;  4GCO A;  5G05 C;  2H6H A;  4WUY A;  2GRP B;  3L54 A;  4WNG A;  3TXN A;  1TN8 A;  3AU4 A;  5A23 A;  1QQE A;  3ZVV A;  5EYL A;  3UI2 A;  4XIF A;  1IQU A;  5JHA A;  1INZ A;  5G04 C;  2R5S A;  1H0A A;  4UI9 J;  4XKB A;  2IF4 A;  3CEQ A;  4U7E B;  3CHO A;  4FHK A;  4O60 A;  3KD7 A;  2GW1 A;  3L13 A;  4C0E A;  4GZ6 A;  4I6G A;  3AAA C;  3DSX A;  2R59 A;  4F1S A;  5T4Y A;  3LY9 A;  3ASH A;  1HG5 A;  5BW8 C;  5FTP A;  3D9L A;  4F6R D;  2AXV A;  4PS8 A;  4ILG A;  3FTU A;  2Y4T A;  3E32 A;  4PDX A;  4Q69 A;  3RRM B;  4JA9 A;  4ANU A;  2QFC A;  4JW1 A;  3Q7A A;  3W9F A;  5BXU A;  1U3C A;  4B93 B;  5E76 A;  1K3Z D;  5LX8 A;  5AEN A;  3L08 A;  4JZY A;  4TUM A;  2P9N G;  1HZ4 A;  2CHZ A;  5HKP A;  4YND A;  5FJY A;  2DWZ A;  3FTZ A;  4G2V A;  1Z3X A;  4GZD A;  3GZS A;  2LAI A;  4GML A;  3QWV A;  3QOU A;  4N2Q A;  2KCK A;  1EF1 C;  1TR4 A;  3HXF A;  4UI9 K;  1N95 A;  2IJG X;  3U64 A;  3BU8 A;  3MV3 B;  4RVB A;  3CVP A;  2XPY A;  4I6J A;  3TWX A;  2KM4 A;  4JHR A;  4J8S A;  5T3R A;  2RFA A;  1WY6 A;  4DX7 D;  3TWV A;  2VGX A;  1BD8 A;  5AQ7 A;  1Q2Z A;  2VGX B;  3SI5 A;  1JCS A;  2E2E A;  2WMN A;  5JHB A;  3URZ A;  2DZN A;  3NZU A;  1KZO A;  2RFM A;  4BX8 A;  2A5E A;  2XQ0 A;  2VQ2 A;  3RK6 A;  3MCX A;  3U9W A;  4N3B A;  4HNA D;  3ULQ A;  3PUJ A;  2PZI A;  3C3R A;  5AAR A;  1N4S A;  4TUU A;  2UY1 A;  4LNG A;  4CDN A;  3EHM A;  3SD5 A;  1Z5S C;  2UY1 B;  1TEZ A;  4YVO A;  4CRW A;  3ML8 A;  1O5M A;  3TWR A;  1HO8 A;  4V3I A;  4K03 A;  3DBS A;  3CV0 A;  3UX4 A;  3EU5 A;  2WXP A;  3ASN E;  3L9T A;  2R2L A;  4GTS A;  4J8F A;  3E33 A;  1U2V G;  4FHJ A;  3ZHE B;  5EDS A;  3B7R L;  1HFA A;  1OWP A;  2XGS A;  3FWV A;  3Q47 B;  2XPI A;  5KNG A;  2RKK A;  5KNH D;  3CR3 A;  4UWG A;  3PZ1 A;  1N9A A;  2HE0 A;  2OEW A;  2OVB A;  5AQA A;  4J8Y A;  5T8I A;  3G2W A;  2L9B A;  1TNO A;  3B7S A;  4KVM A;  1DCE A;  4CCA A;  3ZPJ A;  1ELK A;  2P9L G;  3MX3 A;  2F0Y A;  1MX4 A;  2VSO E;  2CHW A;  2V5Q C;  2HR2 A;  3AG4 E;  2C2L A;  3QAR A;  5ENQ D;  3GZ2 A;  5ARG A;  1S0P A;  1UOH A;  3CVX A;  1TNB A;  4WNE A;  3OTN A;  2P2C P;  2VSX E;  4GPK A;  2F8X K;  3MJW A;  5ARF A;  2J9Q A;  2XZT G;  5JJ7 A;  1KPS B;  1YCS B;  4BY6 A;  4APO A;  2F8Y A;  4JPS A;  2MRI A;  1OCR E;  2WXO A;  5KBA A;  3HIZ A;  4N3A A;  2KCL A;  3ENE A;  3SBS A;  1FPP A;  2FUL A;  3C3O A;  3ZN3 A;  2J07 A;  1NL4 A;  3FEY A;  2NYJ A;  3DEO A;  3LY8 A;  3FTX A;  4HVB A;  2XRY A;  4LER A;  5CRV A;  5AQB A;  2FF4 A;  5AJL A;  1K1A A;  2Y1L E;  4HXI A;  3RSE G;  4TXQ A;  3LYA A;  5CBO A;  4BT8 A;  4TXR A;  3X2Q E;  5FZS A;  3CKB A;  3E34 A;  5FQ4 A;  3ASO E;  5JJT A;  4E85 A;  1N11 A;  2WXI A;  4ANX A;  3LJN A;  3ASD A;  3PUK A;  3FH5 A;  2HO1 A;  1WAO 1;  3ZKJ A;  1P5Q A;  3CHS A;  5AQ9 A;  2XEV A;  1E8W A;  3GW4 A;  4FUL A;  5JA4 D;  2UWJ G;  3CGH A;  2WQH A;  4DI3 A;  3B13 A;  2ETC A;  2I9C A;  2GRQ B;  4HI9 A;  1N0R A;  4ZFH A;  4AP2 A;  2BF0 X;  4C0M A;  1HU3 A;  3FTS A;  3DRA A;  4JEU A;  3CQC B;  4AOF A;  1H19 A;  3SFZ A;  4DX2 A;  5FQ7 A;  1S63 A;  1H2V C;  2C0M A;  1A17 A;  4PH4 B;  2X6H A;  4K5A B;  2KAT A;  3TXM A;  3FEX A;  1W3B A;  4FAD A;  3NF1 A;  2YIN A;  3D9O A;  4AV7 A;  4ANV A;  3UM0 A;  3PZD A;  3FU0 A;  3ESL A;  3FY4 A;  3IHV A;  4RLY A;  4MKT A;  3D9J A;  5D2M C;  4G26 A;  4JA7 A;  4X8Q A;  3Q73 A;  5AYW D;  1V55 E;  2FI7 A;  5ANR A;  2L6J A;  3ESK A;  3AS8 A;  4XE0 A;  2XS8 A;  4EPZ A;  3O4Z A;  1NZN A;  3L17 A;  4TRQ A;  1JUQ A;  1HH8 A;  2DZO A;  4RSY A;  2J8S D;  3FUF A;  3DPD A;  2X3M A;  4EQF A;  5ENT D;  5C2Y A;  3T9K A;  3QB2 A;  3ONL A;  4JHK A;  5G04 J;  1Y6I A;  4G8K A;  2WXH A;  4Y6W A;  4JB8 P;  3RU0 A;  1SW6 A;  3JYS A;  4NRH B;  3FUH A;  2IY0 C;  1SA5 A;  3FTY A;  4BTB A;  3NOG D;  3NOC D;  3Q78 A;  3D9K A;  2BED A;  4CDR A;  1KT0 A;  2WPV A;  2YHC A;  3Q9N C;  4WND A;  5AJD A;  2EIJ E;  1TJC A;  3LDZ A;  3FHE A;  3NB2 A;  2XS1 A;  3CHQ A;  2AJA A;  3LKU A;  3FTV A;  3T8K A;  3UPV A;  2OVF A;  4LEU A;  4L2Y A;  3I3N A;  1WM5 A;  3CKC A;  4HRN A;  3D9I A;  4CYM D;  3VTX A;  4L23 A;  2OV8 A;  1IKN D;  3V79 K;  3CHM A;  3R7R A;  3UM1 A;  4U0S A;  4ABN A;  1QNF A;  1NI1 A;  5G55 A;  4DX5 D;  4O6F A;  3QDN A;  5E75 A;  4UQX A;  4KVO A;  2PNN A;  4XEI G;  1XNF A;  3ZYQ A;  4F1P A;  2ZGG A;  2B6C A;  4XZ4 A;  1HF8 A;  4U0Z A;  3N71 A;  2GRM A;  1IHB A;  3LCA A;  4IUL A;  3V2O A;  2CFZ A;  1DC2 A;  3MV2 B;  2AWI A;  4ATG A;  4BTA A;  2QYJ A;  5KCM A;  5BXO A;  4BT9 A;  3J5P A;  5CCL A;  3Q49 B;  1OXJ A;  3Q4A B;  5B1A E;  3PRZ A;  1AP7 A;  4H7X A;  1RW2 A;  3QAQ A;  4U07 A;  1UJK A;  2AXU A;  2J49 A;  4Q94 A;  4EZJ A;  2ETB A;  2WXM A;  2RD0 A;  4BFR A;  3HXE A;  3T5V A;  1NFI E;  3DEP A;  2DBA A;  4GTR A;  3TJP A;  2V0P A;  1OUV A;  3CLJ A;  3QWW A;  3TGO A;  2VGY A;  5CMY A;  3ZW3 A;  4A1S A;  3ZXP A;  3MZL B;  3UT8 A;  4GU5 A;  2WQ7 A;  1NP7 A;  2WM9 A;  2WXR A;  3JXJ A;  3AG2 E;  2LAH A;  4J0U A;  3MYV A;  2PQN A;  3AG1 E;  3KEZ A;  3EHR A;  3PE3 A;  4W9R A;  1N94 A;  5EYP F;  4AIF A;  5J08 A;  2XGM A;  4K5B A;  2IOS A;  3ZU7 B;  2XPZ A;  3V2X A;  4A3V A;  3FUK A;  3J5Q B;  4D10 C;  4HI8 A;  4FLB A;  3APD A;  1XGW A;  4H7Y A;  4N5Q A;  3QC1 A;  2QY7 A;  3FH8 A;  3D3M A;  1KT1 A;  3FUE A;  3HG0 D;  2R17 C;  5DIZ A;  4A3T A;  4J6I A;  2KBX A;  1YYH A;  2I1K A;  3T5X A;  4CDM A;  1Z6T A;  4UI9 C;  5CBN A;  3FU3 A;  1TNZ A;  3R9M A;  1H6O A;  3LVR E;  4HS2 A;  3I4G A;  4U63 A;  4I1O B;  1NA0 A;  1OCZ E;  1N52 A;  5AAO A;  2FO7 A;  2H6G A;  3PZ4 A;  2GGF A;  4U96 D;  2IEJ A;  4F53 A;  2QC9 A;  3DST A;  4ATZ D;  3P2B A;  4AEZ C;  5IY5 E;  3FUN A;  2IQC A;  5FIO A;  3S7F A;  1LF8 A;  2WXK A;  3VLE A;  3ZHE A;  4HB5 A;  2WXG A;  4ILI A;  3S7J A;  1E7V A;  1MX2 A;  4WWN A;  3U66 A;  3AS5 A;  3D9M A;  4FJZ A;  4LUN U;  4O1P A;  2MHK A;  4KBQ A;  4P29 A;  3WG7 E;  2H6F A;  4WNF A;  4EZK A;  1HXI A;  3K9I A;  4M3O A;  2EQX A;  4BSZ B;  3KSQ A;  3SGH A;  4AY6 A;  1AWC B;  3CVW A;  4HOQ A;  3SNX A;  4I9C A;  3LY7 A;  2WVI A;  3BEE A;  3W9G A;  4YVQ C;  4GA1 A;  3O48 A;  3Q9U C;  1MJ0 A;  3ZUV B;  4DLQ A;  2GRR B;  1PY1 A;  5CEC B;  3FDH A;  4C48 B;  3S2A A;  5EKQ D;  3SZ7 A;  1NA3 A;  4GYO A;  3LJ3 A;  4GMR A;  4ACL A;  3R7Q A;  4GPM A;  4RQI A;  3UKR G;  4ACK A;  3MKQ A;  2VTB A;  4I9E A;  3D9P A;  4HRM B;  3MKQ B;  2VTB B;  3I5P A;  5ENR D;  5JMN D;  4YDY A;  3JUI A;  1OWM A;  1SVX A;  5CED B;  3IHY A;  3C3Q A;  2DVW A;  4NIK A;  5J90 A;  1X81 A;  3TWT A;  1K1B A;  1JPL A;  1YA0 A;  3CHR A;  1O1T A;  2IFU A;  2WMO A;  1OCC E;  2X6I A;  3CVV A;  1LD8 A;  3UQ3 A;  2XHE A;  4I2W A;  4Q96 A;  3KAE A;  2J08 A;  5FQ6 A;  3PS6 A;  4J7W A;  3F6Q A;  2F37 A;  5ENS D;  2RG8 A;  4TV3 A;  4I6E A;  4YDO A;  2YHE A;  2XCC A;  1E96 B;  3PEV B;  3KS2 A;  5CRU A;  4N5C A;  2LSU A;  3UXG A;  5ENO D;  3HXC A;  2JLB A;  4KXK B;  4BWR A;  4URK A;  3LPZ A;  1H6K A;  1L5J A;  3ZYL A;  1X5B A;  3DSW A;  3CVN A;  3SQV A;  3RRU A;  5LOZ A;  1BPO A;  1YMP A;  3TWU A;  4BEP A;  3I4R B;  3CVY A;  3NBN B;  2AXZ A;  2AW6 A;  1N4Q A;  2BKG A;  2DYS E;  1BLX B;  3ABL E;  5BNW A;  4CEM A;  1H6P A;  5FWQ A;  3PEU B;  4G11 A;  4XKC A;  5ENN A;  4PUC A;  2P9U G;  3HDX A;  1N0Q A;  4MS6 A;  2BKK B;  3QWP A;  4GZ3 A;  4JXT A;  3AJI A;  1QZ2 A;  5HRY A;  2OEV A;  3VLD A;  5KJK A;  4HOT A;  2FEZ A;  4F3V A;  5HQ8 A;  1HE8 A;  4KMO A;  5BV1 A;  1IXV A;  5ANL A;  4HQD A;  4F7A A;  4DRX E;  4MRU A;  5FT9 A;  4GTP A;  3B7T A;  2E0I A;  1OWN A;  2LSV A;  1A5E A;  3RO2 A;  3PVL A;  3QK0 A;  2Y3A A;  3UM3 A;  2XGO A;  2B0O E;  1MHQ A;  2L6B A;  1JCR A;  4KYO B;  4ANW A;  4HLL A;  1ZBP A;  1UG3 A;  4IRU A;  2CHX A;  2ZU6 B;  1JWF A;  4JL0 A;  2WB2 A;  1DVP A;  3DXK G;  3PZ3 A;  3OAW A;  4UQZ A;  5G05 J;  4I1M A;  3RO3 A;  2HM8 A;  3FP3 A;  1S70 B;  3T8M A;  3APF A;  4NAC A;  4J8E A;  5DBK A;  2X6F A;  2J4B A;  1N54 A;  4BSX A;  3ASF A;  2P9S G;  4Y6C A;  3L6A A;  3MKR A;  2EIL E;  4L1B A;  3P1U A;  4OVU A;  3LEW A;  1TNU A;  4WAF A;  5ITZ F;  4U0U A;  4GZC A;  2IO2 C;  4FJY A;  2Y69 E;  3VLF A;  4LRZ A;  4A55 A;  2R05 A;  2XRZ A;  2GRN B;  5EX0 A;  3PDN A;  3IXE A;  3SFX A;  2Y0B G;  3EJN A;  4J8D A;  2VSN A;  2VSY A;  4DK5 A;  1SZ9 A;  2MOW A;  5A6C A;  3SHF A;  4DX1 A;  1UN8 A;  1DCQ A;  4MBG A;  3FUD A;  3HXB A;  3BUA A;  3IBE A;  5FZQ A;  1Y8M A;  4EBA A;  1ELR A;  4B0Z A;  4NUR A;  3ABM E;  2DIW A;  4DI4 A;  5LCW C;  4K0R A;  3DXM G;  2XZD G;  3ZFW A;  4XI9 A;  3CK9 A;  3V30 A;  3DSU A;  4XX5 A;  2R02 A;  2FO1 E;  5B3S E;  4CT4 A;  4EBA G;  3PH0 C;  5HS0 A;  4HBD A;  3DSV A;  3TWS A;  1IHG A;  4G1T A;  2X6K A;  4EZL A;  1ELW A;  3SO8 A;  1U3D A;  4IYP A;  1UN9 A;  4KT6 B;  5H7P A;  5LFA A;  3MEK A;  4IN3 B;  2PM7 A;  4G23 A;  4HRL A;  3Q7F A;  2WXF A;  4JEH A;  3FU5 A;  3AU5 A;  1TYQ G;  3PNL B;  5CHE E;  2DCP A;  3CK8 A;  4CGV A;  3ASG A;  3DWL G;  5BUZ A;  1BI7 B;  3MA5 A;  4GMJ A;  3CVU A;  3FU6 A;  1UW4 B;  3ABK E;  3ZYK A;  1OWL A;  3L16 A;  2JEK A;  1HG2 A;  3HVE A;  3NZS A; 
#chains in the Genus database with same CATH homology
 3U66 A;  3AS5 A;  2LNI A;  3D9M A;  4N39 A;  3ZEF A;  4E85 A;  2OND A;  4FJZ A;  2WXI A;  2IU1 A;  2OOE A;  4LUN U;  3HVE B;  4ANX A;  2M63 A;  2MHK A;  3ASD A;  3NQP A;  3PUK A;  4KBQ A;  2CG2 A;  4P29 A;  4UQY A;  1B89 A;  4GAA A;  3FH5 A;  3U3W A;  5KJM A;  4WNF A;  5CMW A;  3SF4 A;  2HO1 A;  4EZK A;  1WAO 1;  1HXI A;  3K9I A;  4M3O A;  4N2S A;  1P5Q A;  2EQX A;  3CHS A;  3GZ1 A;  5AIJ A;  4UWH A;  2L0T B;  2XEV A;  1E8W A;  1JWG A;  3GW4 A;  4FUL A;  2UWJ G;  2WXJ A;  5A7D B;  3CGH A;  3S7D A;  2WQH A;  4E6H A;  2I6H A;  3SGH A;  2PM6 A;  1GW6 A;  4DI3 A;  4AY6 A;  2VJ8 A;  3TG4 A;  3L22 A;  3ONK A;  3B13 A;  1ZU2 A;  1TJF A;  2CG3 A;  2I9C A;  2NXP A;  2P58 C;  4OVV A;  3CVL A;  3LS8 A;  5FQ8 A;  3CVW A;  4HOQ A;  5C1D A;  3SNX A;  4I9C A;  4AP2 A;  4L2L A;  4AJW A;  3LY7 A;  2BF0 X;  4FC8 A;  2WVI A;  4B89 A;  3BEE A;  4C0M A;  4U8H A;  1HU3 A;  4YVQ C;  4GA1 A;  3O48 A;  4MLP A;  3FTS A;  4AM9 A;  2CFU A;  1HX8 A;  4JEU A;  3OXL A;  4DLQ A;  2KCV A;  2PQR A;  3CQC B;  2AVP A;  4AOF A;  1PAQ A;  1H19 A;  1PY1 A;  3UT7 A;  3OXF A;  4CT0 A;  4C9B B;  3FDH A;  3S2A A;  5EKQ D;  3SFZ A;  2VYI A;  3SZ7 A;  1NA3 A;  4GYO A;  3LJ3 A;  1EYH A;  5FQ7 A;  4UWL A;  2ION A;  5BT1 A;  1H2V C;  4ACL A;  2C0M A;  1A17 A;  3CQG B;  4L7T A;  3R7Q A;  5BPP A;  4PH4 B;  5FZR A;  1PC2 A;  3ZYM A;  4ACK A;  3CIA A;  3MKQ A;  2L0I A;  4I9E A;  4G25 A;  2VTB A;  2XCB A;  2X6H A;  3TL5 A;  2KAT A;  3D9P A;  3TXM A;  3FEX A;  1W3B A;  3MKQ B;  3G2V A;  3I5P A;  3UUX A;  2VTB B;  1Z3Y A;  4FAD A;  3NF1 A;  3WXX A;  2YIN A;  3IV0 A;  5M72 A;  1IQR A;  3FUJ A;  1SQM A;  3BG0 B;  3JUI A;  1FVF A;  3D9O A;  4B8C B;  4AV7 A;  4ANV A;  1OWM A;  3PZD A;  3FU0 A;  3R9A B;  3ESL A;  3CK7 A;  1H2T C;  3IHY A;  3G2U A;  2I2O A;  2WXN A;  3FH7 A;  3CHP A;  1MQS A;  2YQ8 A;  3FY4 A;  5J90 A;  3IHV A;  4I17 A;  4MKT A;  4GCO A;  5G05 C;  3D9J A;  4A1G A;  2V5F A;  1JPL A;  1YA0 A;  3IKO B;  4WUY A;  4G26 A;  4JA7 A;  4FU3 A;  4JHJ A;  3CHR A;  5D0Q D;  2IFU A;  3L54 A;  2WMO A;  5AYW D;  4WNG A;  3TXN A;  2X6I A;  2FI7 A;  3AU4 A;  2Y4U A;  5A23 A;  3CVV A;  5ANR A;  3UQ3 A;  2L6J A;  2XHE A;  1QQE A;  3ESK A;  4I2W A;  3ZVV A;  1FCH A;  4B94 A;  3AS8 A;  4Q96 A;  3PNT B;  4XIF A;  1IQU A;  3KAE A;  4XE0 A;  2J08 A;  4AY5 A;  5JHA A;  5FQ6 A;  1INZ A;  5G04 C;  4N3C A;  2R5S A;  1H0A A;  3PS6 A;  4UI9 J;  4XKB A;  2IF4 A;  4EPZ A;  3CEQ A;  3O4Z A;  2C0L A;  1NZN A;  3CHO A;  3L17 A;  4TRQ A;  1JUQ A;  5D0O D;  1HH8 A;  2RG8 A;  4TV3 A;  4RSY A;  4HLE A;  2KZT A;  3FUF A;  4FHK A;  4I6E A;  3DPD A;  2X3M A;  2YHE A;  4RG6 A;  2XCC A;  1E96 B;  4GCN A;  4EQF A;  3KD7 A;  3PEV B;  2KZT B;  3KS2 A;  5C2Y A;  2GW1 A;  4FP7 A;  3QB2 A;  3SBT B;  4N5C A;  1UJJ A;  3L13 A;  4C0E A;  3ONL A;  2X38 A;  4GZ6 A;  4I6G A;  2V4L A;  2WQ6 A;  4JHK A;  5G04 J;  2LSU A;  2R59 A;  4F1S A;  5T4Y A;  1Y6I A;  3LY9 A;  4G24 A;  2WXH A;  4Y6W A;  3ASH A;  1HG5 A;  2JLB A;  4KXK B;  5BW8 C;  5FTP A;  4BWR A;  3LXU X;  3RU0 A;  3D9L A;  4URK A;  3E4B A;  3LPZ A;  3LVQ E;  3JYS A;  1H6K A;  4NRH B;  2AXV A;  3FUH A;  1IYG A;  4PS8 A;  1L5J A;  4FLH A;  4ILG A;  3FTU A;  3MGB A;  3ZYL A;  3FTY A;  4BTB A;  2Y4T A;  4PDX A;  3S7B A;  4PS7 A;  2X6J A;  4Q69 A;  1X5B A;  3RRM B;  3CVN A;  4JA9 A;  4ANU A;  3D9K A;  4CDR A;  2WPV A;  1KT0 A;  2YHC A;  2QFC A;  4WND A;  1HS6 A;  5AJD A;  3RRU A;  5LOZ A;  4JW1 A;  1BPO A;  1TJC A;  3LDZ A;  3G2S A;  3I4R B;  3CVY A;  3FHE A;  2AXZ A;  3CHQ A;  3G2T A;  1U3C A;  2AW6 A;  3LKU A;  2HYZ A;  3FTV A;  3QNK A;  5E76 A;  3BG1 B;  3UPV A;  2OVF A;  3APC A;  5BNW A;  4LEU A;  4L2Y A;  4CEM A;  5LX8 A;  5AEN A;  3L08 A;  3D9N A;  4JZY A;  3I3N A;  3PEU B;  4ILI A;  3FTW A;  4OYS A;  5FWQ A;  4G11 A;  4XKC A;  1HZ4 A;  1WM5 A;  3CKC A;  2CHZ A;  3B7U X;  4YND A;  5ENN A;  4PUC A;  4G2V A;  3FTZ A;  4GYY A;  4GA0 A;  5FJY A;  1Z3X A;  4AVX A;  3HDX A;  3D9I A;  4GZD A;  3GZS A;  3VTX A;  2LAI A;  4L23 A;  4GML A;  2OV8 A;  4MS6 A;  3U4T A;  3QWP A;  4GZ3 A;  4JXT A;  4WWP A;  4HFG A;  3QWV A;  4GZ5 A;  4UWK A;  1QZ2 A;  3QOU A;  4N2Q A;  5KJN A;  2KCK A;  1EF1 C;  3CSF A;  3VLD A;  3CHM A;  3CST A;  4UI9 K;  1E8Z A;  3R7R A;  4KZ0 A;  3ZGQ A;  2IJG X;  5KJK A;  4U0S A;  5CCM A;  3U64 A;  3MV3 B;  4RVB A;  3CVP A;  4ABN A;  2XPY A;  4I6J A;  2KM4 A;  1QNF A;  4HOT A;  2FEZ A;  4F3V A;  1E7U A;  3EHN A;  5HQ8 A;  1HE8 A;  3GYZ A;  4JHR A;  4J8S A;  4KMO A;  5BV1 A;  5G55 A;  5ANL A;  5T3R A;  1WY6 A;  1SZA A;  4O6F A;  3QDN A;  3PRE A;  5E75 A;  2VGX A;  4JVS A;  4UQX A;  4KVO A;  4F7A A;  4MRU A;  4FA6 A;  5FT9 A;  3B7T A;  4JC8 A;  2VGX B;  2E0I A;  4I43 A;  1XNF A;  2Q7F A;  3FFL A;  3SI5 A;  1OWN A;  1KLX A;  2E2E A;  2WMN A;  2LSV A;  3ZYQ A;  5JHB A;  3RO2 A;  3URZ A;  3PVL A;  3QK0 A;  5JJ6 A;  4XZ4 A;  3NZU A;  1HF8 A;  2Y3A A;  2XGO A;  4U0Z A;  3EIQ C;  1MHQ A;  3N71 A;  2GRM A;  4BX8 A;  4KYO B;  3LCA A;  4IUL A;  3ZRH A;  2XQ0 A;  2VQ2 A;  4ANW A;  3RK6 A;  3MCX A;  2CFZ A;  3U9W A;  1ZBP A;  3EIJ A;  1UG3 A;  4GA2 A;  4IRU A;  4N3B A;  2CHX A;  2ZU6 B;  1JWF A;  3JQ1 A;  3MV2 B;  2AWI A;  4JL0 A;  1DVP A;  2J4D A;  4ATG A;  2WB2 A;  4BTA A;  5KCM A;  3OAW A;  3ULQ A;  4UQZ A;  4QFV A;  5G05 J;  4I1M A;  3PUJ A;  1E8Y A;  3RO3 A;  2J09 A;  2WXQ A;  4BT9 A;  5CCL A;  3Q49 B;  2HM8 A;  3FP3 A;  2PZI A;  3Q4A B;  3T8M A;  4EEC A;  3PRZ A;  1E8X A;  3APF A;  4NAC A;  4H7X A;  3QAQ A;  4TUU A;  4AXH A;  2UY1 A;  4R7L A;  4CDN A;  3EHM A;  4J8E A;  4U07 A;  2X6F A;  5DBK A;  2WXL A;  3SD5 A;  1FVH A;  3AS4 A;  1UJK A;  2AXU A;  2J49 A;  4LCT A;  4Q94 A;  3ZIM A;  4EZJ A;  2J4B A;  3RRN B;  2UY1 B;  1N54 A;  1TEZ A;  2WXM A;  4YVO A;  4BSX A;  3RJV A;  3ASF A;  3ML8 A;  4CRW A;  2RD0 A;  4Y6C A;  3L6A A;  1HO8 A;  3MKR A;  4V3I A;  4BFR A;  4K03 A;  3DBS A;  4L1B A;  3CV0 A;  3UX4 A;  3P1U A;  4OVU A;  2WXP A;  3T5V A;  3LEW A;  4J8F A;  2DBA A;  5KJL A;  4FHJ A;  3RIB A;  5HI7 A;  4WAF A;  2FBN A;  4U0U A;  3TJP A;  3ZHE B;  4GZC A;  2V0P A;  1OUV A;  3CLJ A;  4FJY A;  4DJA A;  4HOR A;  3QWW A;  5EDS A;  2V8S E;  3B7R L;  1HFA A;  2VGY A;  3ML9 A;  5CMY A;  3VLF A;  1OWP A;  2XGS A;  4A1S A;  4LRZ A;  3ZW3 A;  4BX9 A;  3FWV A;  3Q47 B;  4A55 A;  3MZL B;  3TGO A;  2XRZ A;  2XPI A;  4KZC A;  3JCK C;  3UT8 A;  3UT4 A;  5EX0 A;  3CR3 A;  3PDN A;  4GU5 A;  4UWG A;  4DLO A;  4WWO A;  2WQ7 A;  1NP7 A;  2WM9 A;  2OVB A;  2WXR A;  3EJN A;  4J8D A;  2VSN A;  5T8I A;  5EX3 A;  2VSY A;  2LAH A;  2NSZ A;  3G2W A;  4GYW A;  2L9B A;  2IOL A;  3B7S A;  3FUI A;  4J0U A;  4KVM A;  3MYV A;  4DK5 A;  4HOS A;  2PQN A;  1SZ9 A;  2I1J A;  3OXG A;  4CCA A;  2MOW A;  1ELK A;  3ZPJ A;  5A6C A;  3VTY A;  2BUG A;  1DNP A;  3QJZ A;  3SHF A;  3JQ0 A;  3PE4 A;  3MX3 A;  1UN8 A;  3KEZ A;  3PE3 A;  2VSO E;  1E90 A;  2CHW A;  3FUD A;  3IEG A;  4APF A;  2HR2 A;  2C2L A;  3CVQ A;  3IBE A;  3QAR A;  4W9R A;  5LP0 A;  5FZQ A;  3GZ2 A;  1Y8M A;  4AIF A;  4EBA A;  5J08 A;  2A5U A;  5ARG A;  1S0P A;  1ELR A;  4B0Z A;  2XGM A;  4NUR A;  3CVX A;  2IOS A;  2DIW A;  4B8A A;  4DI4 A;  1EPU A;  4WNE A;  3OTN A;  5LCW C;  2XPZ A;  4K0R A;  4A3V A;  3EDT B;  2GRL A;  3QKY A;  2VSX E;  3FUK A;  4D10 C;  4DPR A;  4HOU A;  1VDY A;  3FUM A;  4FLB A;  4GPK A;  3APD A;  3HYM B;  3ZFW A;  3MJW A;  1XGW A;  4ME2 A;  5ARF A;  4XI9 A;  3CK9 A;  2J9Q A;  4H7Y A;  3Q5M A;  2LO6 A;  5JJ7 A;  4U04 A;  4BY6 A;  4XX5 A;  5G2N A;  3QC1 A;  2QY7 A;  4APO A;  3FH8 A;  3D3M A;  4JPS A;  2ILR A;  3PH0 C;  4CT4 A;  2MRI A;  4EBA G;  2WXO A;  1KT1 A;  5LCW J;  3FUE A;  4ILH B;  2R17 C;  5DIZ A;  3HIZ A;  4N3A A;  1IHG A;  4A3T A;  4G1T A;  2BTD A;  3TG5 A;  2KCL A;  3ENE A;  2X6K A;  4J6I A;  1ELW A;  2NC9 A;  1U3D A;  2I1K A;  3SBS A;  4EZL A;  4XI0 A;  2FUL A;  4IYP A;  1UN9 A;  4KT6 B;  3ZN3 A;  3T5X A;  3ZXS A;  4CDM A;  2J07 A;  3FEY A;  4PS3 A;  1Z6T A;  5LFA A;  4UI9 C;  3MEK A;  4IN3 B;  3LY8 A;  3FU3 A;  2PM7 A;  4GB9 A;  3FTX A;  1EDU A;  3LVR E;  4G23 A;  3I4G A;  2XRY A;  4HS2 A;  4U63 A;  4HVB A;  2WXF A;  4I1O B;  4LER A;  1H2U A;  1NA0 A;  4JEH A;  2KC7 A;  3RKV A;  3UMV A;  1N52 A;  2FO7 A;  3HHM A;  4CGW A;  3FU5 A;  3AU5 A;  3Q15 A;  3C98 A;  3PNL B;  5CHE E;  2FF4 A;  4I1A A;  2GGF A;  2DCP A;  5AJL A;  2A4Z A;  2PL2 A;  1OWO A;  3CK8 A;  4HXI A;  4CGV A;  3ASG A;  3LYA A;  5BUZ A;  5BV0 A;  4F53 A;  4BT8 A;  3MA5 A;  4GMJ A;  3FUL A;  4UWF A;  4WWN A;  3P2B A;  4AEZ C;  3FU6 A;  3CVU A;  1UW4 B;  4I2Z A;  3ZYK A;  3FUN A;  3TAX A;  2IQC A;  5FZS A;  1OWL A;  3CKB A;  3S7F A;  3L16 A;  1LF8 A;  2JEK A;  2WXK A;  4NQ0 A;  2YNQ A;  4RG9 A;  5FQ4 A;  3VLE A;  1HG2 A;  3ZHE A;  2WXG A;  1E7V A;  3S7J A;  5JJT A;  3HVE A;  3NZS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...