4C0MA

Crystal structure of the n terminal domain of wild type trif (tir- domain-containing adapter-inducing interferon-beta)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
140
structure length
140
Chain Sequence
GPSLPSAFDILGAAGQDKLLYLKHKLKTPRPGCQGQDLLHAMVLLKLGQETEARISLEALKADAVARLVARQWAGVDSTEDPEEPPDVSWAVARLYHLLAEEKLCPASLRDVAYQEAVRTLSSRDDHRLGELQDEARNRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TIR DOMAIN-CONTAINING ADAPTER MOLECULE 1
publication title The Tlr Signalling Adaptor Trif/Ticam-1 Has an N-Terminal Helical Domain with Structural Similarity to Ifit Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 48
structure length 140
sequence length 140
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17798 TRIF-NTD TRIF N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.780 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4c0mA00
4C0MA 4BSXA 2M63A
chains in the Genus database with same CATH superfamily
3CVXA 3I4GA 2LAIA 4AY5A 4RG9A 4DI3A 3PS6A 2QZAA 2WQ6A 4YDEA 4U0UA 2FI7A 4LRZA 2OVFA 3GZ1A 3SQVA 3SO8A 4QFVA 1WG0A 3PUKA 4DX5D 1U3CA 1TNYA 1N0QA 4TV3A 4NACA 2BKKB 5KWDA 2EINE 1DVPA 3G2UA 5T8IA 1RW2A 3DXKG 1HU3A 2L0TB 2GRPB 4G8KA 2KCKA 1TNBA 3MKRA 3NF1A 2IQCA 3HYMB 3I5PA 1YYHA 2QYUA 4UI9K 3RRNB 3NQPA 5ENTD 4EZKA 3QARA 4OYSA 1O1RA 3IEGA 3QWWA 4OVUA 3WG7E 4BEPA 2ZGDA 2VSYA 4EBAA 1X81A 2IY0C 4ABNA 4XKCA 4GA1A 3ULQA 4A3VA 3E33A 2P9UG 2ILRA 4N39A 3T8KA 4LNBA 1TNUA 1S63A 3UM0A 1NL4A 3SD5A 1L5JA 4B93B 1FCHA 1N0RA 1O1SA 2M63A 4JVSA 5BXUA 2PM6A 3PRZA 3CSFA 4LNUD 3ZU7B 1S0PA 2QC9A 3C72A 4U0SA 2E0IA 3IHVA 1H6OA 4G25A 5ENOD 3C98A 2IOSA 3Q4AB 3WXXA 4U07A 1IXVA 3T5VA 4KBQA 1UJJA 1UW4B 2HYZA 4J8EA 3X2QE 4HFGA 3UM2A 3BU8A 5FZSA 3QWPA 5ANLA 4C48B 5KNHD 3ZFWA 4I43A 4J8FA 4TUMA 4ANWA 3UM1A 3AG3E 3UINC 4AOFA 2XEVA 1ZB1A 2NXPA 3RAUA 5ENQD 2L6JA 3PREA 2JEKA 1HG5A 2HR2A 3RSEG 3ZN3A 1JCSA 2XHEA 1TJCA 1YCSB 5DBKA 3S2AA 4LNGA 3D9MA 2KATA 3HXEA 2F8XK 4GCNA 2KCLA 1UN9A 2KBXA 4Q69A 3PZ3A 2QY7A 1FPPA 2IF4A 3FDHA 2LXLA 2MYOA 2XGOA 2Y4TA 3PVLA 4GTMA 5JJ7A 2RG8A 3ESKA 2WM9A 3EUVA 1IHGA 3IV0A 2DZOA 3FUNA 3QKYA 4E6HA 3ENEA 4IULA 3BG0B 1N4SA 2PNNA 2KM4A 2YHEA 3E4BA 5FT9A 4YVQC 4FHKA 3VLEA 3KEAA 2CHXA 2V4HC 2FULA 3CV0A 4X8QA 4K0RA 3E37A 3LKUA 4GPKA 2XPYA 3DBSA 2CG2A 2KXPC 4JA7A 3CHOA 2BEDA 3L9TA 1KZPA 1D8DA 3PNTB 3QK0A 2LNIA 3OAWA 5JA4D 2IONA 1TN7A 5FZRA 4UWGA 3UT4A 1KZOA 4K5BA 5G2NA 3CGHA 4AXHA 4FA6A 2FEZA 4ZHBA 1TYQG 4ME2A 5EIDA 2IFUA 4I6JA 4B8AA 3UQ3A 1FVFA 3UXGA 2XRYA 4J6IA 4HOTA 4DRXE 2FBNA 1G3NB 1D9SA 5B3SE 4FJZA 4C0EA 3FP3A 1SZ9A 4ATZD 4A1GA 3JUEA 1ELWA 2V4LA 1TEZA 1MQSA 3JYSA 3LY8A 3DSUA 3NB2A 1SQMA 5FWQA 5BPPA 5FJYA 3FUHA 1NA0A 1INZA 4ILIA 5CBOA 2WXLA 2NSZA 4JC8A 3CHSA 3EU5A 2A4ZA 4KYOB 3FTZA 5FIOA 2VGEA 1P5QA 4DLOA 5A23A 3S7DA 4PS3A 5A7DB 4L23A 4H7XA 4RQIA 3ULYA 3ZRHA 4F7AA 2PZIA 2GGFA 3MA5A 2CHZA 4CEMA 5B1BE 2J4BA 2MOWA 4K5CA 1HZ4A 3B7BA 3TG5A 3D9OA 4GYWA 4G1TA 2JABA 2AXVA 5D2MC 4WNDA 4JHJA 3Q15A 4JHKA 2LSVA 1TJFA 4GU5A 5KJLA 1E7VA 2PQRA 3J5QB 3FULA 4Z68A 3CIAA 4WWOA 3IBEA 3Q79A 3HXFA 4I6GA 1SA4A 4RG6A 4GZDA 4L1BA 4CDRA 4URKA 1MX4A 3V30A 5JHAA 1JUQA 2OV8A 1NFIE 4MBGA 3MKQA 3QWVA 2DCPA 2J9QA 2RFMA 5G05C 4NRHB 2XZDG 3OXLA 4MS6A 2BF0X 4PS7A 4KZ0A 1XGWA 3UT7A 2Y1LE 1QZ2A 2A5UA 3LS8A 3TJPA 4WUYA 1E8XA 5IY5E 3V2XA 3SGHA 5CBNA 4JHRA 1E90A 4APFA 4I6EA 4PS8A 4APOA 1EF1C 4GZ6A 4FP7A 5D0QD 3V79K 4HI8A 4KT6B 5LFAA 1SW6A 3NBNB 3IKOB 4UQYA 3NZSA 3APDA 3U4TA 3UT8A 5D0OD 2VGXA 2P9IG 4WNGA 4GB9A 4DUIA 2VYIA 3PNLB 4NURA 4BWRA 3QC1A 3O4ZA 4GTTA 3TWVA 4ACKA 1NZNA 3FH7A 4GMRA 2X3MA 3UKRG 5CCMA 3FH5A 5JJTA 3EHMA 3G2WA 3TWXA 2WXQA 2AJAA 4BY6A 4GYYA 4CDMA 4GTOA 1PC2A 3URZA 1HH8A 4G2VA 4HQDA 1HF8A 2HE0A 4U04A 3TXNA 2XPZA 2HM8A 4GYOA 4GTVA 4IN3B 4UQZA 5KCMA 3ASDA 3UIOC 3FTSA 1SVXA 1ELKA 4AEZC 2PL2A 3TWWA 1TNOA 1DCQA 1N4QA 2MRIA 1EYHA 2LO6A 2KZTB 5FZQA 3LY7A 1MX2A 4E85A 4JZYA 5AQ7A 4CRWA 4LUNU 5BNWA 1PY1A 1QNFA 3DSWA 1N4PA 2CG3A 2WXOA 2C0MA 4XIFA 3B95A 3QJZA 4Q94A 5C2YA 3KD7A 4A63B 4IRUA 5BXOA 4U8YD 4V3IA 5EN5D 3QDNA 1NA3A 4MRUA 3C5RA 4U95D 1SA5A 2LAHA 4N3AA 5H7PA 1TR4A 5BV1A 3DSXA 3SFYA 1WAO1 2J07A 1KPSB 1O1TA 4B89A 3EDTB 3SFZA 4XZ4A 3T8MA 3VTXA 3FUFA 3UKUG 4B94A 2UY1A 3CHQA 5FQ6A 1N11A 4YDWA 4TXRA 3EU9A 4BX8A 1QQEA 3D9KA 3CSTA 3B7SA 1YA0A 5J08A 2C0LA 2L6BA 4L2LA 3VLFA 3B7UX 5ITZF 1OCRE 2NC9A 4UWLA 4TXPA 3EHQA 2GRLA 2X6IA 1TNZA 4NQ0A 4RVBA 3SF4A 2XEHA 1LD8A 4GTSA 4CDNA 5AJLA 3FU3A 1OXJA 4WNEA 2J09A 3DWLG 4I1OB 1H19A 2FF4A 4C0MA 5M72A 3MKQB 4U7EB 3ZYMA 4HLLA 5D66A 4AV7A 3CVYA 3CK9A 4M7CA 3EIJA 5CEDB 3HVEB 3PZ4A 5EKQD 3D9NA 1E8WA 2LSUA 4KMOA 3PZ1A 3CVUA 5AAOA 2X6HA 2L9BA 1N54A 3LJNA 3ZNGA 3L16A 3IXEA 3U64A 4O1OA 5KJMA 2VGXB 3PE4A 3TWUA 4G26A 4AVXA 1EDUA 3MJWA 2P9PG 1JPLA 2BKGA 5EIBE 5KBAA 3SY2A 3TG4A 2WXPA 1DNPA 3FH8A 2MHKA 2NYJA 3S7JA 3AS5A 4EECA 2WXMA 4TXQA 5AQBA 2B6CA 3Q9UC 4I2ZA 2Y3AA 4L9PA 1H2UA 1OCZE 4DX6D 3L82A 3ONLA 4FHJA 5DIZA 2H6GA 1YMPA 4XX5A 3RO3A 3DPYA 3D9LA 2F8YA 3AS8A 2PM7A 5BT1A 1OWOA 2P58C 2B0OE 2I1JA 3AAAC 3FUMA 1TN8A 1U3DA 1FVHA 1S64A 1JWGA 3W9GA 2E2EA 3CR3A 4GA0A 5J90A 4GCOA 3UTMA 3Q75A 3R9MA 5JMND 3JCKC 5CEAA 3ABME 4GPMA 1V54E 3MYVA 3E34A 2WMNA 4WNFA 3LDZA 5LCWC 4JA9A 2KC7A 3ESLA 4KZCA 4GMJA 1HFAA 2DYRE 4GMLA 2I1KA 2KZTA 4UI9C 2IEJA 3ASFA 3FUKA 4CYMD 1LTXA 1E8YA 3OXFA 2OEVA 2WXKA 1ZU2A 4HVBA 4YNDA 2F37A 2I6HA 3Q9NC 3LPZA 3IHYA 3FEYA 4D10C 2L0IA 3P1UA 2XPIA 4B8CB 2QFCA 1TN6A 4XI0A 5EX3A 3MEKA 3C3OA 2UY1B 2V0PA 3HIZA 1V55E 1HXIA 1Q2ZA 1MYOA 1BLXB 2KCVA 2R59A 4N2QA 4JXTA 2X6JA 4YVOA 2XGMA 3DEOA 2ETAA 2XGSA 5CHEE 5CRVA 2VSXE 2H6HA 3FUDA 4GTQA 4JEHA 4YDYA 1WY6A 5ENRD 2V5FA 2AWIA 3CQGB 5LOZA 4UWHA 3PEVB 3CQCB 2YNQA 4GZ3A 3C3QA 1W3BA 3W9FA 2AXUA 1RZ4A 1NI1A 4PDXA 3GZ2A 3ZW3A 2UWJG 4MKTA 3NOGD 3KS2A 2DYSE 4DK5A 5G55A 5T4YA 3CKCA 5HRYA 2R17C 3ULEG 4KXKB 3E30A 3OTNA 5EYPF 1OCCE 3EJNA 3N71A 1LD7A 3SFXA 2XENA 4HRMB 4GA2A 3SBTB 3UMVA 2ETBA 3FUEA 4AIFA 4I1MA 2VSNA 1OCOE 2J49A 2WXHA 3CHMA 2C2LA 4L2YA 4HRLA 2IJGX 4LSZE 3CK8A 4ZFHA 1BU9A 4AP2A 4J0UA 1O5MA 4HXIA 4I9EA 4EHMA 3HVEA 4AJWA 3NAWA 3MGBA 5HQ8A 4K5AB 5AQ9A 3DXMG 4G24A 4J8YA 1IYGA 3JQ1A 3G2VA 2H6IA 2DVWA 2VQ2A 3L13A 4GZCA 3HHMA 5BUZA 3QAQA 2EQXA 3MX3A 5G05J 3ZEFA 3VLDA 3KSQA 4N5CA 1H6PA 4O1PA 3RJVA 1H6KA 1HO8A 2ZISA 5ARGA 3PE3A 3LYAA 3AG2E 3RKVA 4N2SA 3ONKA 1DC2A 1UJKA 2XZTG 3TGOA 4J8SA 3TAXA 3K9IA 5ENNA 3FU5A 5CMWA 2QYJA 3D9PA 2R03A 5ANRA 2R5SA 2GRRB 3SI5A 2IU1A 5FQ8A 2WXJA 4ANXA 2P9NG 3FU6A 4EPZA 1XNFA 1MX6A 3BG1B 4HB5A 1HG2A 2RFAA 3UPVA 4G8LA 3DSVA 4LERA 2P9KG 4F1PA 2GRMA 3PZ2A 5EYLA 4BT8A 3ASOE 2JLBA 2XCBA 1U2VG 4JEUA 3ZYKA 3AG4E 3CK7A 2ZIRA 3FU0A 4ANVA 4I2WA 5G04C 3U9WA 2ZXWE 2PQNA 4TRQA 1D8EA 3VTYA 4EQFA 3Q7AA 3APCA 3DSTA 5AIJA 4RLYA 3UX4A 2ZU6B 3SNXA 4BESA 3GZSA 1AP7A 1OWNA 2XEEA 4RSYA 1N9AA 4OVVA 4U8HA 2P9LG 4OAUC 3I4RB 4I9CA 3FTYA 2P9SG 3RO2A 4CGWA 2WMOA 5JJ6A 3RRUA 4DLQA 2YINA 4UWKA 1GW6A 3PH0C 4NIKA 2YHCA 3B7RL 3ZPJA 4XE0A 2WB2A 3FUIA 5KNGA 3ZIMA 4C9BB 3ASNE 2OVBA 2WXFA 3CVPA 5EILA 3B13A 3JUIA 3TWQA 2YQ8A 5AENA 3CVQA 2XRZA 2GROB 3ASGA 2LUHA 3RIBA 4ATGA 4U8VD 2R2LA 3OXGA 3TXMA 2OCCE 3CKBA 5LX8A 1WDYA 2EILE 4LEUA 4FC8A 3FEXA 3DRAA 1HX8A 2WXRA 1BI7B 1K1BA 4I17A 3HRAA 3AJIA 4HOQA 3CVNA 2ONDA 5E76A 1Z3YA 3Q49B 4FU3A 2Y4UA 4WAFA 3U66A 4CGVA 3T9KA 4DI4A 1Z5SC 2DIWA 5AYWD 3L17A 3L08A 4DJAA 2WQHA 3BEEA 1KT0A 4JPSA 4HNAD 3PZDA 3SZ7A 5KJNA 3Q7FA 2ETCA 2OEWA 2VJ8A 2RD0A 3FTXA 3RRMB 5FTPA 5JHBA 4W9RA 3E32A 4KVMA 2X38A 1KT1A 5E75A 4AY6A 1JCQA 1JCRA 4EZJA 3ZKJA 5AQAA 5FINA 2XS8A 4HRNA 3JQ0A 3GYZA 3Q78A 4UUCA 3RU0A 1K3ZD 5T3RA 3ABKE 3FFLA 4U96D 4BT9A 5KJKA 1Y6IA 1OY3D 3R7QA 3QOUA 5LP0A 1N94A 1K1AA 1E96B 3ZXSA 4BSZB 3D9HA 4F1SA 1IQRA 2DBAA 3BUAA 3P2BA 4F3VA 3ZUVB 2VTBB 1AWCB 3RK6A 4FADA 4G11A 1JWFA 2CFUA 2CFZA 3LY9A 4U63A 1QBQA 5FQ4A 4IYPA 4AM9A 2EIKE 4Q96A 4GAAA 2AW6A 3LXUX 4A3TA 2V8SE 4MLPA 3ZHEB 4J7WA 1IQUA 2H6FA 1NP7A 4Y6WA 3C3RA 1H2TC 3PDNA 2Q7FA 3L54A 3MV2B 4DX2A 2VGYA 3AS4A 2J8SD 2HO1A 1BPOA 2F0YA 3UUXA 2J08A 1E8ZA 3L6AA 2XS1A 2X6FA 1H0AA 1OT8A 2GRNB 3KEZA 5CRUA 3FUJA 3UI2A 4HOUA 4TUUA 3HXDA 4U0ZA 5B1AE 2GW1A 2I2OA 3LVQE 3EHRA 3MCXA 1X5BA 4GTPA 3TWTA 3PUJA 3AG1E 1BD8A 2WXGA 5AARA 4KVOA 2IO2C 4LG6A 3KSLA 2LXMA 1HE8A 4A1SA 4F53A 1KLXA 3HDXA 2WXNA 3QNKA 4G23A 1B89A 4YDOA 4JW1A 3D9JA 3G2SA 3CVWA 5A6CA 3HXBA 3O48A 3CHPA 2ZGGA 5LCWJ 3BQOA 3FTVA 4N5QA 3G2TA 4BTBA 3SHFA 2RKKA 3GW4A 1FT1A 3HG0D 4FJYA 1OWMA 1OWLA 4DPRA 1ZBPA 4UI9J 3LCAA 4GTRA 4JD2G 3CVVA 4O60A 4WWNA 4BERA 3ZYLA 1IHBA 1BI8B 3ABLE 3F6QA 3APFA 4N3BA 1Y8MA 2FO1E 2IO3C 4HORA 3U3WA 4L7TA 5C1DA 2WXIA 4DX7D 1PAQA 4FLHA 3KAEA 4Y6CA 4DX1A 3CVLA 1Z3XA 4ILHB 3Q5MA 4XEIG 4ANUA 3FY4A 3AU5A 2FO7A 1EPUA 4HS2A 1UG3A 5HI7A 3DPDA 5EX0A 1OWPA 2AVPA 3NOCD 4QQIA 4A55A 3CHRA 4HI9A 1HS6A 3HXCA 3UIPC 4FULA 3CEQA 5BW8C 1H2VC 3B7TA 3JXIA 1OUVA 4UWFA 2V5QC 3ML8A 3QB2A 5CERB 3R7RA 5BV0A 3FHEA 3CLJA 3LEWA 3Q73A 3S7BA 2OOEA 4WWPA 3ASHA 2Y69E 2DWZA 3ML9A 5CMYA 1ELRA 5EDSA 3NZUA 4CT4A 4HBDA 1Z6TA 3PEUB 4BX9A 3TWRA 1A5EA 3DEPA 3ZYQA 4B0ZA 1LF8A 1K8KG 2WQ7A 3ZVVA 2R02A 4M3OA 3V2OA 5CECB 4H7YA 4EZLA 2GRQB 2X6KA 3L22A 4R7LA 4O6FA 4EBAG 3AU4A 5HKPA 3V31A 4JL0A 4JB8P 3EIQC 3EHNA 3I3NA 2EIJE 1WM5A 3TWSA 5CCLA 3T5XA 2BUGA 2XCCA 3FTWA 1N52A 3S7FA 3LJ3A 1N4RA 4PH4B 2BTDA 5HS0A 2VTBA 4XKBA 4K03A 1MHQA 1E7UA 4PUCA 4I1AA 4BTAA 2XQ0A 2I9CA 4CCAA 1VDYA 5AJDA 3ZXPA 5ENSD 3FWVA 3DSSA 3FTUA 4GZ5A 4ACLA 4HOSA 3ZHEA 3LVRE 2DZNA 1SZAA 2A5EA 3D9IA 3MV3B 5AN8A 3ISMC 1UOHA 2WPVA 5FQ7A 4HLEA 3ZGQA 4J8DA 1UN8A 1QYMA 4UQXA 5ENPD 2EIME 1N95A 2CHWA 2J4DA 4CZ2D 1A17A 4FLBA 2AXZA 1MJ0A 4ILGA 2IOLA 4P29A 3J5PA 3SBSA 4BFRA 2P2CP 5ARFA 3UM3A 2Y0BG 4XI9A 3Q47B 3MZLB 3D3MA 4F6RD 4OAVB 4LCTA 2VSOE 1MZCA 1IKND 2R05A 3R9AB 1FT2A 3JXJA 5G04J 4CT0A 3TL5A 1DCEA 1S70B 4N3CA 4BSXA 4BETA 2WVIA
chains in the Genus database with same CATH topology
3GYZA 3CVXA 3I4GA 1ZU2A 4HVBA 4YNDA 3OXLA 4MS6A 3RU0A 2BF0X 2LAIA 4PS7A 4KZ0A 4RG9A 4AY5A 1XGWA 5T3RA 3UT7A 4DI3A 3FFLA 1QZ2A 2A5UA 3LS8A 2I6HA 3TJPA 4BT9A 4WUYA 1E8XA 3PS6A 5KJKA 2WQ6A 1Y6IA 3SGHA 3R7QA 4JHRA 1E90A 4U0UA 4APFA 2FI7A 4I6EA 4LRZA 3LPZA 2OVFA 4PS8A 3GZ1A 3IHYA 4APOA 1EF1C 3QOUA 3FEYA 4GZ6A 4D10C 5LP0A 4FP7A 4QFVA 2L0IA 5D0QD 3PUKA 1E96B 3P1UA 2XPIA 1U3CA 3ZXSA 4KT6B 4B8CB 4TV3A 2QFCA 5LFAA 4NACA 4XI0A 1IQRA 4F1SA 2DBAA 3MEKA 1DVPA 2UY1B 3P2BA 5EX3A 4F3VA 3G2UA 2V0PA 3IKOB 5T8IA 4UQYA 3HIZA 2VTBB 1HXIA 3RK6A 1HU3A 3NZSA 2L0TB 3APDA 4FADA 3U4TA 3UT8A 2KCVA 4G11A 5D0OD 1JWFA 2VGXA 2CFUA 2CFZA 2KCKA 2R59A 3LY9A 4N2QA 4U63A 3MKRA 3NF1A 4WNGA 2IQCA 5FQ4A 4IYPA 4AM9A 4JXTA 2X6JA 4Q96A 4YVOA 4GB9A 4GAAA 2WVIA 2AW6A 3HYMB 2VYIA 3I5PA 3PNLB 2XGMA 4NURA 3QC1A 4UI9K 3RRNB 4BWRA 3NQPA 3O4ZA 3LXUX 4A3TA 4EZKA 3QARA 2XGSA 2V8SE 4OYSA 4MLPA 3IEGA 5CHEE 3QWWA 3ZHEB 4ACKA 2VSXE 1IQUA 4OVUA 1NZNA 3FUDA 3FH7A 4JEHA 1WY6A 2V5FA 1NP7A 2X3MA 2VSYA 4Y6WA 5CCMA 4EBAA 2AWIA 3CQGB 5LOZA 1H2TC 3FH5A 4UWHA 3PDNA 3PEVB 3CQCB 2Q7FA 4ABNA 2YNQA 3L54A 3MV2B 4GZ3A 5JJTA 2VGYA 1W3BA 3AS4A 3EHMA 3G2WA 4XKCA 2AXUA 4GA1A 2HO1A 1BPOA 3ULQA 4A3VA 4PDXA 3GZ2A 3UUXA 3ZW3A 2J08A 1E8ZA 2ILRA 2UWJG 3L6AA 4MKTA 2X6FA 2WXQA 4N39A 4BY6A 1H0AA 3KS2A 4GYYA 4CDMA 4DK5A 3URZA 1PC2A 5G55A 1HH8A 5T4YA 4G2VA 3KEZA 3CKCA 1L5JA 1HF8A 1FCHA 3FUJA 3SD5A 4HOUA 4TUUA 2M63A 2R17C 4U04A 4JVSA 4U0ZA 3TXNA 2XPZA 2HM8A 4GYOA 4IN3B 4UQZA 5KCMA 3ASDA 3FTSA 2PM6A 2GW1A 4KXKB 3OTNA 3PRZA 2I2OA 3LVQE 3MCXA 1ELKA 1X5BA 3EJNA 3N71A 3PUJA 4AEZC 3CSFA 2PL2A 4GA2A 2WXGA 1S0PA 4U0SA 3SBTB 2E0IA 3IHVA 4G25A 4KVOA 2MRIA 1EYHA 3C98A 2LO6A 3UMVA 2IOSA 3FUEA 3Q4AB 3WXXA 4AIFA 4U07A 2KZTB 4I1MA 5FZQA 3LY7A 2VSNA 3T5VA 4E85A 4JZYA 4KBQA 1HE8A 1UJJA 2J49A 4A1SA 1UW4B 4CRWA 4F53A 2HYZA 1KLXA 4J8EA 4LUNU 2WXHA 3HDXA 3CHMA 2WXNA 3QNKA 4HFGA 5BNWA 4G23A 5FZSA 1B89A 3QWPA 4JW1A 5ANLA 1PY1A 1QNFA 2C2LA 4L2YA 3ZFWA 4I43A 2CG3A 2WXOA 3D9JA 3G2SA 2C0MA 2IJGX 4J8FA 3CVWA 3CK8A 5A6CA 4ANWA 4XIFA 3QJZA 4Q94A 4AP2A 5C2YA 4AOFA 4J0UA 3O48A 3CHPA 2XEVA 4HXIA 4I9EA 3KD7A 2NXPA 3HVEA 5LCWJ 2L6JA 4AJWA 3FTVA 3PREA 3MGBA 5HQ8A 4IRUA 2JEKA 1HG5A 3G2TA 4G24A 4BTBA 3SHFA 2HR2A 3GW4A 1IYGA 4V3IA 3JQ1A 3G2VA 3ZN3A 2XHEA 1TJCA 1OWMA 1OWLA 4FJYA 2VQ2A 4DPRA 3QDNA 1NA3A 3L13A 4MRUA 1ZBPA 5DBKA 3S2AA 4UI9J 3LCAA 3D9MA 2KATA 4GZCA 3HHMA 5BUZA 2LAHA 4N3AA 3QAQA 2EQXA 3MX3A 4GCNA 5G05J 5BV1A 3ZEFA 2KCLA 3CVVA 4WWNA 3ZYLA 1UN9A 3VLDA 1WAO1 4Q69A 2J07A 4N5CA 3RJVA 2QY7A 3APFA 4B89A 3EDTB 4N3BA 3SFZA 1H6KA 1Y8MA 1HO8A 5ARGA 2IF4A 3FDHA 3PE3A 2XGOA 3LYAA 3RKVA 2Y4TA 4HORA 4N2SA 4XZ4A 3T8MA 3U3WA 3ONKA 3VTXA 3FUFA 3PVLA 4L7TA 5C1DA 5JJ7A 1UJKA 4B94A 3TGOA 2UY1A 3CHQA 2WXIA 4J8SA 5FQ6A 2RG8A 3TAXA 3ESKA 1PAQA 4FLHA 3K9IA 3KAEA 2WM9A 4Y6CA 5ENNA 3FU5A 1IHGA 3IV0A 4BX8A 3CVLA 1QQEA 3D9KA 3FUNA 3CSTA 3QKYA 5CMWA 3B7SA 1Z3XA 4E6HA 1YA0A 3D9PA 5ANRA 3ENEA 5J08A 2R5SA 4ILHB 2C0LA 3BG0B 4IULA 2KM4A 3Q5MA 2YHEA 3SI5A 3E4BA 4L2LA 5FT9A 2IU1A 3VLFA 5FQ8A 2WXJA 4YVQC 4FHKA 4ANUA 4ANXA 3VLEA 3B7UX 3FY4A 2CHXA 3AU5A 2FO7A 1EPUA 3FU6A 4HS2A 1UG3A 2FULA 2NC9A 3CV0A 4UWLA 4EPZA 5HI7A 4K0RA 3DPDA 3LKUA 5EX0A 1XNFA 4GPKA 1OWPA 3BG1B 2XPYA 2AVPA 2GRLA 1HG2A 2X6IA 3UPVA 4A55A 4NQ0A 4RVBA 3DBSA 3CHRA 3SF4A 4LERA 2CG2A 1HS6A 4CDNA 2GRMA 5AJLA 3FU3A 4FULA 3CHOA 4JA7A 4WNEA 3CEQA 5BW8C 1H2VC 4BT8A 3B7TA 2JLBA 2XCBA 4JEUA 3ZYKA 3CK7A 3PNTB 3FU0A 2J09A 3QK0A 2LNIA 3OAWA 4ANVA 4I2WA 5G04C 1OUVA 2IONA 4UWFA 3U9WA 4I1OB 2PQNA 1H19A 4TRQA 3ML8A 3QB2A 2FF4A 3R7RA 5BV0A 3FHEA 4C0MA 5M72A 3MKQB 5FZRA 3CLJA 3ZYMA 3LEWA 3VTYA 4EQFA 4UWGA 3UT4A 3S7BA 2OOEA 4AV7A 3APCA 3CVYA 4WWPA 3ASHA 5AIJA 3CK9A 3EIJA 5G2NA 3CGHA 4AXHA 4FA6A 3UX4A 2ZU6B 2FEZA 3ML9A 5CMYA 1ELRA 3HVEB 5EKQD 3SNXA 5EDSA 3NZUA 3GZSA 4ME2A 4CT4A 1OWNA 4RSYA 3D9NA 4OVVA 4U8HA 1E8WA 1Z6TA 3PEUB 4BX9A 2IFUA 2LSUA 4KMOA 3ZYQA 4B0ZA 4I6JA 3I4RB 4B8AA 1LF8A 3UQ3A 2WQ7A 3CVUA 4I9CA 1FVFA 3ZVVA 2XRYA 4J6IA 4M3OA 2X6HA 4HOTA 2L9BA 3FTYA 2FBNA 3RO2A 4H7YA 4FJZA 1N54A 4CGWA 3L16A 4C0EA 3FP3A 4EZLA 1SZ9A 3U64A 2X6KA 2WMOA 5JJ6A 4A1GA 3L22A 3RRUA 4R7LA 4O6FA 4EBAG 1ELWA 5KJMA 4DLQA 2V4LA 3AU4A 2VGXB 2YINA 3PE4A 4JL0A 4UWKA 1TEZA 1MQSA 3JYSA 4G26A 3LY8A 4AVXA 1GW6A 1EDUA 3MJWA 3PH0C 1SQMA 1JPLA 5FWQA 2YHCA 5BPPA 3B7RL 3EIQC 3EHNA 3ZPJA 3I3NA 3TG4A 4XE0A 2WXPA 5FJYA 3FUHA 1NA0A 2WB2A 1INZA 1WM5A 1DNPA 3FUIA 3FH8A 4ILIA 3ZIMA 2MHKA 4C9BB 5CCLA 3S7JA 3AS5A 3T5XA 4EECA 2BUGA 2XCCA 2WXMA 2WXLA 2NSZA 3FTWA 2OVBA 1N52A 2WXFA 3CVPA 4JC8A 3S7FA 3LJ3A 3CHSA 4PH4B 2BTDA 3B13A 4I2ZA 3JUIA 2Y3AA 2VTBA 2YQ8A 2A4ZA 4XKBA 5AENA 3CVQA 1H2UA 3FTZA 4K03A 4KYOB 1MHQA 2XRZA 3ONLA 1P5QA 4FHJA 4DLOA 1E7UA 4PUCA 5DIZA 3S7DA 5A23A 3ASGA 4I1AA 4PS3A 3RIBA 4ATGA 5A7DB 4BTAA 4L23A 2XQ0A 3OXGA 4H7XA 2I9CA 3TXMA 3ZRHA 4F7AA 3CKBA 2PZIA 4XX5A 5LX8A 3RO3A 2GGFA 3MA5A 2CHZA 4CCAA 4LEUA 4FC8A 1VDYA 3FEXA 5AJDA 4CEMA 3FWVA 2J4BA 2MOWA 1HX8A 3FTUA 4GZ5A 3D9LA 1HZ4A 2WXRA 3TG5A 4ACLA 4HOSA 3ZHEA 3LVRE 3AS8A 1SZAA 4I17A 3D9OA 4GYWA 4HOQA 4G1TA 3CVNA 3D9IA 2PM7A 2ONDA 2AXVA 5E76A 1Z3YA 3MV3B 5BT1A 4WNDA 1OWOA 3Q49B 4JHJA 2P58C 4FU3A 3Q15A 2Y4UA 2I1JA 4WAFA 4JHKA 2WPVA 3U66A 2LSVA 4CGVA 1TJFA 5FQ7A 3FUMA 4HLEA 3ZGQA 4GU5A 4DI4A 5KJLA 4J8DA 1E7VA 1U3DA 1UN8A 2DIWA 2PQRA 1FVHA 4UQXA 1JWGA 3FULA 2E2EA 5AYWD 3L17A 3CIAA 3L08A 2CHWA 4WWOA 2WQHA 3CR3A 4GA0A 3BEEA 1KT0A 2J4DA 4DJAA 5J90A 4GCOA 4JPSA 3IBEA 3PZDA 1A17A 4FLBA 2AXZA 3SZ7A 4ILGA 3JCKC 2IOLA 4P29A 5KJNA 3SBSA 4BFRA 4I6GA 3MYVA 2VJ8A 5ARFA 2RD0A 3FTXA 2WMNA 3RRMB 4RG6A 4GZDA 4WNFA 3LDZA 4XI9A 3Q47B 5LCWC 3MZLB 5FTPA 4JA9A 5JHBA 2KC7A 4L1BA 3D3MA 3ESLA 4KZCA 4GMJA 4W9RA 4KVMA 2X38A 4LCTA 4CDRA 2VSOE 1HFAA 4URKA 4GMLA 1KT1A 2I1KA 5E75A 2KZTA 5JHAA 4UI9C 4AY6A 1JUQA 4EZJA 3R9AB 2OV8A 3ASFA 5G04J 4CT0A 3TL5A 3FUKA 3MKQA 3QWVA 2DCPA 3JQ0A 4N3CA 1E8YA 3OXFA 2J9QA 4BSXA 5G05C 4NRHB 2WXKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C0M A;  4BSX A;  2M63 A; 
#chains in the Genus database with same CATH topology
 3CVX A;  3I4G A;  2LAI A;  4AY5 A;  4RG9 A;  4DI3 A;  3PS6 A;  2QZA A;  2WQ6 A;  4YDE A;  4U0U A;  2FI7 A;  4LRZ A;  2OVF A;  3GZ1 A;  3SQV A;  3SO8 A;  4QFV A;  1WG0 A;  3PUK A;  4DX5 D;  1U3C A;  1TNY A;  1N0Q A;  4TV3 A;  4NAC A;  2BKK B;  5KWD A;  2EIN E;  1DVP A;  3G2U A;  5T8I A;  1RW2 A;  3DXK G;  1HU3 A;  2L0T B;  2GRP B;  4G8K A;  2KCK A;  1TNB A;  3MKR A;  3NF1 A;  2IQC A;  3HYM B;  3I5P A;  1YYH A;  2QYU A;  4UI9 K;  3RRN B;  3NQP A;  5ENT D;  4EZK A;  3QAR A;  4OYS A;  1O1R A;  3IEG A;  3QWW A;  4OVU A;  3WG7 E;  4BEP A;  2ZGD A;  2VSY A;  4EBA A;  1X81 A;  2IY0 C;  4ABN A;  4XKC A;  4GA1 A;  3ULQ A;  4A3V A;  3E33 A;  2P9U G;  2ILR A;  4N39 A;  3T8K A;  4LNB A;  1TNU A;  1S63 A;  3UM0 A;  1NL4 A;  3SD5 A;  1L5J A;  4B93 B;  1FCH A;  1N0R A;  1O1S A;  2M63 A;  4JVS A;  5BXU A;  2PM6 A;  3PRZ A;  3CSF A;  4LNU D;  3ZU7 B;  1S0P A;  2QC9 A;  3C72 A;  4U0S A;  2E0I A;  3IHV A;  1H6O A;  4G25 A;  5ENO D;  3C98 A;  2IOS A;  3Q4A B;  3WXX A;  4U07 A;  1IXV A;  3T5V A;  4KBQ A;  1UJJ A;  1UW4 B;  2HYZ A;  4J8E A;  3X2Q E;  4HFG A;  3UM2 A;  3BU8 A;  5FZS A;  3QWP A;  5ANL A;  4C48 B;  5KNH D;  3ZFW A;  4I43 A;  4J8F A;  4TUM A;  4ANW A;  3UM1 A;  3AG3 E;  3UIN C;  4AOF A;  2XEV A;  1ZB1 A;  2NXP A;  3RAU A;  5ENQ D;  2L6J A;  3PRE A;  2JEK A;  1HG5 A;  2HR2 A;  3RSE G;  3ZN3 A;  1JCS A;  2XHE A;  1TJC A;  1YCS B;  5DBK A;  3S2A A;  4LNG A;  3D9M A;  2KAT A;  3HXE A;  2F8X K;  4GCN A;  2KCL A;  1UN9 A;  2KBX A;  4Q69 A;  3PZ3 A;  2QY7 A;  1FPP A;  2IF4 A;  3FDH A;  2LXL A;  2MYO A;  2XGO A;  2Y4T A;  3PVL A;  4GTM A;  5JJ7 A;  2RG8 A;  3ESK A;  2WM9 A;  3EUV A;  1IHG A;  3IV0 A;  2DZO A;  3FUN A;  3QKY A;  4E6H A;  3ENE A;  4IUL A;  3BG0 B;  1N4S A;  2PNN A;  2KM4 A;  2YHE A;  3E4B A;  5FT9 A;  4YVQ C;  4FHK A;  3VLE A;  3KEA A;  2CHX A;  2V4H C;  2FUL A;  3CV0 A;  4X8Q A;  4K0R A;  3E37 A;  3LKU A;  4GPK A;  2XPY A;  3DBS A;  2CG2 A;  2KXP C;  4JA7 A;  3CHO A;  2BED A;  3L9T A;  1KZP A;  1D8D A;  3PNT B;  3QK0 A;  2LNI A;  3OAW A;  5JA4 D;  2ION A;  1TN7 A;  5FZR A;  4UWG A;  3UT4 A;  1KZO A;  4K5B A;  5G2N A;  3CGH A;  4AXH A;  4FA6 A;  2FEZ A;  4ZHB A;  1TYQ G;  4ME2 A;  5EID A;  2IFU A;  4I6J A;  4B8A A;  3UQ3 A;  1FVF A;  3UXG A;  2XRY A;  4J6I A;  4HOT A;  4DRX E;  2FBN A;  1G3N B;  1D9S A;  5B3S E;  4FJZ A;  4C0E A;  3FP3 A;  1SZ9 A;  4ATZ D;  4A1G A;  3JUE A;  1ELW A;  2V4L A;  1TEZ A;  1MQS A;  3JYS A;  3LY8 A;  3DSU A;  3NB2 A;  1SQM A;  5FWQ A;  5BPP A;  5FJY A;  3FUH A;  1NA0 A;  1INZ A;  4ILI A;  5CBO A;  2WXL A;  2NSZ A;  4JC8 A;  3CHS A;  3EU5 A;  2A4Z A;  4KYO B;  3FTZ A;  5FIO A;  2VGE A;  1P5Q A;  4DLO A;  5A23 A;  3S7D A;  4PS3 A;  5A7D B;  4L23 A;  4H7X A;  4RQI A;  3ULY A;  3ZRH A;  4F7A A;  2PZI A;  2GGF A;  3MA5 A;  2CHZ A;  4CEM A;  5B1B E;  2J4B A;  2MOW A;  4K5C A;  1HZ4 A;  3B7B A;  3TG5 A;  3D9O A;  4GYW A;  4G1T A;  2JAB A;  2AXV A;  5D2M C;  4WND A;  4JHJ A;  3Q15 A;  4JHK A;  2LSV A;  1TJF A;  4GU5 A;  5KJL A;  1E7V A;  2PQR A;  3J5Q B;  3FUL A;  4Z68 A;  3CIA A;  4WWO A;  3IBE A;  3Q79 A;  3HXF A;  4I6G A;  1SA4 A;  4RG6 A;  4GZD A;  4L1B A;  4CDR A;  4URK A;  1MX4 A;  3V30 A;  5JHA A;  1JUQ A;  2OV8 A;  1NFI E;  4MBG A;  3MKQ A;  3QWV A;  2DCP A;  2J9Q A;  2RFM A;  5G05 C;  4NRH B;  2XZD G;  3OXL A;  4MS6 A;  2BF0 X;  4PS7 A;  4KZ0 A;  1XGW A;  3UT7 A;  2Y1L E;  1QZ2 A;  2A5U A;  3LS8 A;  3TJP A;  4WUY A;  1E8X A;  5IY5 E;  3V2X A;  3SGH A;  5CBN A;  4JHR A;  1E90 A;  4APF A;  4I6E A;  4PS8 A;  4APO A;  1EF1 C;  4GZ6 A;  4FP7 A;  5D0Q D;  3V79 K;  4HI8 A;  4KT6 B;  5LFA A;  1SW6 A;  3NBN B;  3IKO B;  4UQY A;  3NZS A;  3APD A;  3U4T A;  3UT8 A;  5D0O D;  2VGX A;  2P9I G;  4WNG A;  4GB9 A;  4DUI A;  2VYI A;  3PNL B;  4NUR A;  4BWR A;  3QC1 A;  3O4Z A;  4GTT A;  3TWV A;  4ACK A;  1NZN A;  3FH7 A;  4GMR A;  2X3M A;  3UKR G;  5CCM A;  3FH5 A;  5JJT A;  3EHM A;  3G2W A;  3TWX A;  2WXQ A;  2AJA A;  4BY6 A;  4GYY A;  4CDM A;  4GTO A;  1PC2 A;  3URZ A;  1HH8 A;  4G2V A;  4HQD A;  1HF8 A;  2HE0 A;  4U04 A;  3TXN A;  2XPZ A;  2HM8 A;  4GYO A;  4GTV A;  4IN3 B;  4UQZ A;  5KCM A;  3ASD A;  3UIO C;  3FTS A;  1SVX A;  1ELK A;  4AEZ C;  2PL2 A;  3TWW A;  1TNO A;  1DCQ A;  1N4Q A;  2MRI A;  1EYH A;  2LO6 A;  2KZT B;  5FZQ A;  3LY7 A;  1MX2 A;  4E85 A;  4JZY A;  5AQ7 A;  4CRW A;  4LUN U;  5BNW A;  1PY1 A;  1QNF A;  3DSW A;  1N4P A;  2CG3 A;  2WXO A;  2C0M A;  4XIF A;  3B95 A;  3QJZ A;  4Q94 A;  5C2Y A;  3KD7 A;  4A63 B;  4IRU A;  5BXO A;  4U8Y D;  4V3I A;  5EN5 D;  3QDN A;  1NA3 A;  4MRU A;  3C5R A;  4U95 D;  1SA5 A;  2LAH A;  4N3A A;  5H7P A;  1TR4 A;  5BV1 A;  3DSX A;  3SFY A;  1WAO 1;  2J07 A;  1KPS B;  1O1T A;  4B89 A;  3EDT B;  3SFZ A;  4XZ4 A;  3T8M A;  3VTX A;  3FUF A;  3UKU G;  4B94 A;  2UY1 A;  3CHQ A;  5FQ6 A;  1N11 A;  4YDW A;  4TXR A;  3EU9 A;  4BX8 A;  1QQE A;  3D9K A;  3CST A;  3B7S A;  1YA0 A;  5J08 A;  2C0L A;  2L6B A;  4L2L A;  3VLF A;  3B7U X;  5ITZ F;  1OCR E;  2NC9 A;  4UWL A;  4TXP A;  3EHQ A;  2GRL A;  2X6I A;  1TNZ A;  4NQ0 A;  4RVB A;  3SF4 A;  2XEH A;  1LD8 A;  4GTS A;  4CDN A;  5AJL A;  3FU3 A;  1OXJ A;  4WNE A;  2J09 A;  3DWL G;  4I1O B;  1H19 A;  2FF4 A;  4C0M A;  5M72 A;  3MKQ B;  4U7E B;  3ZYM A;  4HLL A;  5D66 A;  4AV7 A;  3CVY A;  3CK9 A;  4M7C A;  3EIJ A;  5CED B;  3HVE B;  3PZ4 A;  5EKQ D;  3D9N A;  1E8W A;  2LSU A;  4KMO A;  3PZ1 A;  3CVU A;  5AAO A;  2X6H A;  2L9B A;  1N54 A;  3LJN A;  3ZNG A;  3L16 A;  3IXE A;  3U64 A;  4O1O A;  5KJM A;  2VGX B;  3PE4 A;  3TWU A;  4G26 A;  4AVX A;  1EDU A;  3MJW A;  2P9P G;  1JPL A;  2BKG A;  5EIB E;  5KBA A;  3SY2 A;  3TG4 A;  2WXP A;  1DNP A;  3FH8 A;  2MHK A;  2NYJ A;  3S7J A;  3AS5 A;  4EEC A;  2WXM A;  4TXQ A;  5AQB A;  2B6C A;  3Q9U C;  4I2Z A;  2Y3A A;  4L9P A;  1H2U A;  1OCZ E;  4DX6 D;  3L82 A;  3ONL A;  4FHJ A;  5DIZ A;  2H6G A;  1YMP A;  4XX5 A;  3RO3 A;  3DPY A;  3D9L A;  2F8Y A;  3AS8 A;  2PM7 A;  5BT1 A;  1OWO A;  2P58 C;  2B0O E;  2I1J A;  3AAA C;  3FUM A;  1TN8 A;  1U3D A;  1FVH A;  1S64 A;  1JWG A;  3W9G A;  2E2E A;  3CR3 A;  4GA0 A;  5J90 A;  4GCO A;  3UTM A;  3Q75 A;  3R9M A;  5JMN D;  3JCK C;  5CEA A;  3ABM E;  4GPM A;  1V54 E;  3MYV A;  3E34 A;  2WMN A;  4WNF A;  3LDZ A;  5LCW C;  4JA9 A;  2KC7 A;  3ESL A;  4KZC A;  4GMJ A;  1HFA A;  2DYR E;  4GML A;  2I1K A;  2KZT A;  4UI9 C;  2IEJ A;  3ASF A;  3FUK A;  4CYM D;  1LTX A;  1E8Y A;  3OXF A;  2OEV A;  2WXK A;  1ZU2 A;  4HVB A;  4YND A;  2F37 A;  2I6H A;  3Q9N C;  3LPZ A;  3IHY A;  3FEY A;  4D10 C;  2L0I A;  3P1U A;  2XPI A;  4B8C B;  2QFC A;  1TN6 A;  4XI0 A;  5EX3 A;  3MEK A;  3C3O A;  2UY1 B;  2V0P A;  3HIZ A;  1V55 E;  1HXI A;  1Q2Z A;  1MYO A;  1BLX B;  2KCV A;  2R59 A;  4N2Q A;  4JXT A;  2X6J A;  4YVO A;  2XGM A;  3DEO A;  2ETA A;  2XGS A;  5CHE E;  5CRV A;  2VSX E;  2H6H A;  3FUD A;  4GTQ A;  4JEH A;  4YDY A;  1WY6 A;  5ENR D;  2V5F A;  2AWI A;  3CQG B;  5LOZ A;  4UWH A;  3PEV B;  3CQC B;  2YNQ A;  4GZ3 A;  3C3Q A;  1W3B A;  3W9F A;  2AXU A;  1RZ4 A;  1NI1 A;  4PDX A;  3GZ2 A;  3ZW3 A;  2UWJ G;  4MKT A;  3NOG D;  3KS2 A;  2DYS E;  4DK5 A;  5G55 A;  5T4Y A;  3CKC A;  5HRY A;  2R17 C;  3ULE G;  4KXK B;  3E30 A;  3OTN A;  5EYP F;  1OCC E;  3EJN A;  3N71 A;  1LD7 A;  3SFX A;  2XEN A;  4HRM B;  4GA2 A;  3SBT B;  3UMV A;  2ETB A;  3FUE A;  4AIF A;  4I1M A;  2VSN A;  1OCO E;  2J49 A;  2WXH A;  3CHM A;  2C2L A;  4L2Y A;  4HRL A;  2IJG X;  4LSZ E;  3CK8 A;  4ZFH A;  1BU9 A;  4AP2 A;  4J0U A;  1O5M A;  4HXI A;  4I9E A;  4EHM A;  3HVE A;  4AJW A;  3NAW A;  3MGB A;  5HQ8 A;  4K5A B;  5AQ9 A;  3DXM G;  4G24 A;  4J8Y A;  1IYG A;  3JQ1 A;  3G2V A;  2H6I A;  2DVW A;  2VQ2 A;  3L13 A;  4GZC A;  3HHM A;  5BUZ A;  3QAQ A;  2EQX A;  3MX3 A;  5G05 J;  3ZEF A;  3VLD A;  3KSQ A;  4N5C A;  1H6P A;  4O1P A;  3RJV A;  1H6K A;  1HO8 A;  2ZIS A;  5ARG A;  3PE3 A;  3LYA A;  3AG2 E;  3RKV A;  4N2S A;  3ONK A;  1DC2 A;  1UJK A;  2XZT G;  3TGO A;  4J8S A;  3TAX A;  3K9I A;  5ENN A;  3FU5 A;  5CMW A;  2QYJ A;  3D9P A;  2R03 A;  5ANR A;  2R5S A;  2GRR B;  3SI5 A;  2IU1 A;  5FQ8 A;  2WXJ A;  4ANX A;  2P9N G;  3FU6 A;  4EPZ A;  1XNF A;  1MX6 A;  3BG1 B;  4HB5 A;  1HG2 A;  2RFA A;  3UPV A;  4G8L A;  3DSV A;  4LER A;  2P9K G;  4F1P A;  2GRM A;  3PZ2 A;  5EYL A;  4BT8 A;  3ASO E;  2JLB A;  2XCB A;  1U2V G;  4JEU A;  3ZYK A;  3AG4 E;  3CK7 A;  2ZIR A;  3FU0 A;  4ANV A;  4I2W A;  5G04 C;  3U9W A;  2ZXW E;  2PQN A;  4TRQ A;  1D8E A;  3VTY A;  4EQF A;  3Q7A A;  3APC A;  3DST A;  5AIJ A;  4RLY A;  3UX4 A;  2ZU6 B;  3SNX A;  4BES A;  3GZS A;  1AP7 A;  1OWN A;  2XEE A;  4RSY A;  1N9A A;  4OVV A;  4U8H A;  2P9L G;  4OAU C;  3I4R B;  4I9C A;  3FTY A;  2P9S G;  3RO2 A;  4CGW A;  2WMO A;  5JJ6 A;  3RRU A;  4DLQ A;  2YIN A;  4UWK A;  1GW6 A;  3PH0 C;  4NIK A;  2YHC A;  3B7R L;  3ZPJ A;  4XE0 A;  2WB2 A;  3FUI A;  5KNG A;  3ZIM A;  4C9B B;  3ASN E;  2OVB A;  2WXF A;  3CVP A;  5EIL A;  3B13 A;  3JUI A;  3TWQ A;  2YQ8 A;  5AEN A;  3CVQ A;  2XRZ A;  2GRO B;  3ASG A;  2LUH A;  3RIB A;  4ATG A;  4U8V D;  2R2L A;  3OXG A;  3TXM A;  2OCC E;  3CKB A;  5LX8 A;  1WDY A;  2EIL E;  4LEU A;  4FC8 A;  3FEX A;  3DRA A;  1HX8 A;  2WXR A;  1BI7 B;  1K1B A;  4I17 A;  3HRA A;  3AJI A;  4HOQ A;  3CVN A;  2OND A;  5E76 A;  1Z3Y A;  3Q49 B;  4FU3 A;  2Y4U A;  4WAF A;  3U66 A;  4CGV A;  3T9K A;  4DI4 A;  1Z5S C;  2DIW A;  5AYW D;  3L17 A;  3L08 A;  4DJA A;  2WQH A;  3BEE A;  1KT0 A;  4JPS A;  4HNA D;  3PZD A;  3SZ7 A;  5KJN A;  3Q7F A;  2ETC A;  2OEW A;  2VJ8 A;  2RD0 A;  3FTX A;  3RRM B;  5FTP A;  5JHB A;  4W9R A;  3E32 A;  4KVM A;  2X38 A;  1KT1 A;  5E75 A;  4AY6 A;  1JCQ A;  1JCR A;  4EZJ A;  3ZKJ A;  5AQA A;  5FIN A;  2XS8 A;  4HRN A;  3JQ0 A;  3GYZ A;  3Q78 A;  4UUC A;  3RU0 A;  1K3Z D;  5T3R A;  3ABK E;  3FFL A;  4U96 D;  4BT9 A;  5KJK A;  1Y6I A;  1OY3 D;  3R7Q A;  3QOU A;  5LP0 A;  1N94 A;  1K1A A;  1E96 B;  3ZXS A;  4BSZ B;  3D9H A;  4F1S A;  1IQR A;  2DBA A;  3BUA A;  3P2B A;  4F3V A;  3ZUV B;  2VTB B;  1AWC B;  3RK6 A;  4FAD A;  4G11 A;  1JWF A;  2CFU A;  2CFZ A;  3LY9 A;  4U63 A;  1QBQ A;  5FQ4 A;  4IYP A;  4AM9 A;  2EIK E;  4Q96 A;  4GAA A;  2AW6 A;  3LXU X;  4A3T A;  2V8S E;  4MLP A;  3ZHE B;  4J7W A;  1IQU A;  2H6F A;  1NP7 A;  4Y6W A;  3C3R A;  1H2T C;  3PDN A;  2Q7F A;  3L54 A;  3MV2 B;  4DX2 A;  2VGY A;  3AS4 A;  2J8S D;  2HO1 A;  1BPO A;  2F0Y A;  3UUX A;  2J08 A;  1E8Z A;  3L6A A;  2XS1 A;  2X6F A;  1H0A A;  1OT8 A;  2GRN B;  3KEZ A;  5CRU A;  3FUJ A;  3UI2 A;  4HOU A;  4TUU A;  3HXD A;  4U0Z A;  5B1A E;  2GW1 A;  2I2O A;  3LVQ E;  3EHR A;  3MCX A;  1X5B A;  4GTP A;  3TWT A;  3PUJ A;  3AG1 E;  1BD8 A;  2WXG A;  5AAR A;  4KVO A;  2IO2 C;  4LG6 A;  3KSL A;  2LXM A;  1HE8 A;  4A1S A;  4F53 A;  1KLX A;  3HDX A;  2WXN A;  3QNK A;  4G23 A;  1B89 A;  4YDO A;  4JW1 A;  3D9J A;  3G2S A;  3CVW A;  5A6C A;  3HXB A;  3O48 A;  3CHP A;  2ZGG A;  5LCW J;  3BQO A;  3FTV A;  4N5Q A;  3G2T A;  4BTB A;  3SHF A;  2RKK A;  3GW4 A;  1FT1 A;  3HG0 D;  4FJY A;  1OWM A;  1OWL A;  4DPR A;  1ZBP A;  4UI9 J;  3LCA A;  4GTR A;  4JD2 G;  3CVV A;  4O60 A;  4WWN A;  4BER A;  3ZYL A;  1IHB A;  1BI8 B;  3ABL E;  3F6Q A;  3APF A;  4N3B A;  1Y8M A;  2FO1 E;  2IO3 C;  4HOR A;  3U3W A;  4L7T A;  5C1D A;  2WXI A;  4DX7 D;  1PAQ A;  4FLH A;  3KAE A;  4Y6C A;  4DX1 A;  3CVL A;  1Z3X A;  4ILH B;  3Q5M A;  4XEI G;  4ANU A;  3FY4 A;  3AU5 A;  2FO7 A;  1EPU A;  4HS2 A;  1UG3 A;  5HI7 A;  3DPD A;  5EX0 A;  1OWP A;  2AVP A;  3NOC D;  4QQI A;  4A55 A;  3CHR A;  4HI9 A;  1HS6 A;  3HXC A;  3UIP C;  4FUL A;  3CEQ A;  5BW8 C;  1H2V C;  3B7T A;  3JXI A;  1OUV A;  4UWF A;  2V5Q C;  3ML8 A;  3QB2 A;  5CER B;  3R7R A;  5BV0 A;  3FHE A;  3CLJ A;  3LEW A;  3Q73 A;  3S7B A;  2OOE A;  4WWP A;  3ASH A;  2Y69 E;  2DWZ A;  3ML9 A;  5CMY A;  1ELR A;  5EDS A;  3NZU A;  4CT4 A;  4HBD A;  1Z6T A;  3PEU B;  4BX9 A;  3TWR A;  1A5E A;  3DEP A;  3ZYQ A;  4B0Z A;  1LF8 A;  1K8K G;  2WQ7 A;  3ZVV A;  2R02 A;  4M3O A;  3V2O A;  5CEC B;  4H7Y A;  4EZL A;  2GRQ B;  2X6K A;  3L22 A;  4R7L A;  4O6F A;  4EBA G;  3AU4 A;  5HKP A;  3V31 A;  4JL0 A;  4JB8 P;  3EIQ C;  3EHN A;  3I3N A;  2EIJ E;  1WM5 A;  3TWS A;  5CCL A;  3T5X A;  2BUG A;  2XCC A;  3FTW A;  1N52 A;  3S7F A;  3LJ3 A;  1N4R A;  4PH4 B;  2BTD A;  5HS0 A;  2VTB A;  4XKB A;  4K03 A;  1MHQ A;  1E7U A;  4PUC A;  4I1A A;  4BTA A;  2XQ0 A;  2I9C A;  4CCA A;  1VDY A;  5AJD A;  3ZXP A;  5ENS D;  3FWV A;  3DSS A;  3FTU A;  4GZ5 A;  4ACL A;  4HOS A;  3ZHE A;  3LVR E;  2DZN A;  1SZA A;  2A5E A;  3D9I A;  3MV3 B;  5AN8 A;  3ISM C;  1UOH A;  2WPV A;  5FQ7 A;  4HLE A;  3ZGQ A;  4J8D A;  1UN8 A;  1QYM A;  4UQX A;  5ENP D;  2EIM E;  1N95 A;  2CHW A;  2J4D A;  4CZ2 D;  1A17 A;  4FLB A;  2AXZ A;  1MJ0 A;  4ILG A;  2IOL A;  4P29 A;  3J5P A;  3SBS A;  4BFR A;  2P2C P;  5ARF A;  3UM3 A;  2Y0B G;  4XI9 A;  3Q47 B;  3MZL B;  3D3M A;  4F6R D;  4OAV B;  4LCT A;  2VSO E;  1MZC A;  1IKN D;  2R05 A;  3R9A B;  1FT2 A;  3JXJ A;  5G04 J;  4CT0 A;  3TL5 A;  1DCE A;  1S70 B;  4N3C A;  4BSX A;  4BET A;  2WVI A; 
#chains in the Genus database with same CATH homology
 3GYZ A;  3CVX A;  3I4G A;  1ZU2 A;  4HVB A;  4YND A;  3OXL A;  4MS6 A;  3RU0 A;  2BF0 X;  2LAI A;  4PS7 A;  4KZ0 A;  4RG9 A;  4AY5 A;  1XGW A;  5T3R A;  3UT7 A;  4DI3 A;  3FFL A;  1QZ2 A;  2A5U A;  3LS8 A;  2I6H A;  3TJP A;  4BT9 A;  4WUY A;  1E8X A;  3PS6 A;  5KJK A;  2WQ6 A;  1Y6I A;  3SGH A;  3R7Q A;  4JHR A;  1E90 A;  4U0U A;  4APF A;  2FI7 A;  4I6E A;  4LRZ A;  3LPZ A;  2OVF A;  4PS8 A;  3GZ1 A;  3IHY A;  4APO A;  1EF1 C;  3QOU A;  3FEY A;  4GZ6 A;  4D10 C;  5LP0 A;  4FP7 A;  4QFV A;  2L0I A;  5D0Q D;  3PUK A;  1E96 B;  3P1U A;  2XPI A;  1U3C A;  3ZXS A;  4KT6 B;  4B8C B;  4TV3 A;  2QFC A;  5LFA A;  4NAC A;  4XI0 A;  1IQR A;  4F1S A;  2DBA A;  3MEK A;  1DVP A;  2UY1 B;  3P2B A;  5EX3 A;  4F3V A;  3G2U A;  2V0P A;  3IKO B;  5T8I A;  4UQY A;  3HIZ A;  2VTB B;  1HXI A;  3RK6 A;  1HU3 A;  3NZS A;  2L0T B;  3APD A;  4FAD A;  3U4T A;  3UT8 A;  2KCV A;  4G11 A;  5D0O D;  1JWF A;  2VGX A;  2CFU A;  2CFZ A;  2KCK A;  2R59 A;  3LY9 A;  4N2Q A;  4U63 A;  3MKR A;  3NF1 A;  4WNG A;  2IQC A;  5FQ4 A;  4IYP A;  4AM9 A;  4JXT A;  2X6J A;  4Q96 A;  4YVO A;  4GB9 A;  4GAA A;  2WVI A;  2AW6 A;  3HYM B;  2VYI A;  3I5P A;  3PNL B;  2XGM A;  4NUR A;  3QC1 A;  4UI9 K;  3RRN B;  4BWR A;  3NQP A;  3O4Z A;  3LXU X;  4A3T A;  4EZK A;  3QAR A;  2XGS A;  2V8S E;  4OYS A;  4MLP A;  3IEG A;  5CHE E;  3QWW A;  3ZHE B;  4ACK A;  2VSX E;  1IQU A;  4OVU A;  1NZN A;  3FUD A;  3FH7 A;  4JEH A;  1WY6 A;  2V5F A;  1NP7 A;  2X3M A;  2VSY A;  4Y6W A;  5CCM A;  4EBA A;  2AWI A;  3CQG B;  5LOZ A;  1H2T C;  3FH5 A;  4UWH A;  3PDN A;  3PEV B;  3CQC B;  2Q7F A;  4ABN A;  2YNQ A;  3L54 A;  3MV2 B;  4GZ3 A;  5JJT A;  2VGY A;  1W3B A;  3AS4 A;  3EHM A;  3G2W A;  4XKC A;  2AXU A;  4GA1 A;  2HO1 A;  1BPO A;  3ULQ A;  4A3V A;  4PDX A;  3GZ2 A;  3UUX A;  3ZW3 A;  2J08 A;  1E8Z A;  2ILR A;  2UWJ G;  3L6A A;  4MKT A;  2X6F A;  2WXQ A;  4N39 A;  4BY6 A;  1H0A A;  3KS2 A;  4GYY A;  4CDM A;  4DK5 A;  3URZ A;  1PC2 A;  5G55 A;  1HH8 A;  5T4Y A;  4G2V A;  3KEZ A;  3CKC A;  1L5J A;  1HF8 A;  1FCH A;  3FUJ A;  3SD5 A;  4HOU A;  4TUU A;  2M63 A;  2R17 C;  4U04 A;  4JVS A;  4U0Z A;  3TXN A;  2XPZ A;  2HM8 A;  4GYO A;  4IN3 B;  4UQZ A;  5KCM A;  3ASD A;  3FTS A;  2PM6 A;  2GW1 A;  4KXK B;  3OTN A;  3PRZ A;  2I2O A;  3LVQ E;  3MCX A;  1ELK A;  1X5B A;  3EJN A;  3N71 A;  3PUJ A;  4AEZ C;  3CSF A;  2PL2 A;  4GA2 A;  2WXG A;  1S0P A;  4U0S A;  3SBT B;  2E0I A;  3IHV A;  4G25 A;  4KVO A;  2MRI A;  1EYH A;  3C98 A;  2LO6 A;  3UMV A;  2IOS A;  3FUE A;  3Q4A B;  3WXX A;  4AIF A;  4U07 A;  2KZT B;  4I1M A;  5FZQ A;  3LY7 A;  2VSN A;  3T5V A;  4E85 A;  4JZY A;  4KBQ A;  1HE8 A;  1UJJ A;  2J49 A;  4A1S A;  1UW4 B;  4CRW A;  4F53 A;  2HYZ A;  1KLX A;  4J8E A;  4LUN U;  2WXH A;  3HDX A;  3CHM A;  2WXN A;  3QNK A;  4HFG A;  5BNW A;  4G23 A;  5FZS A;  1B89 A;  3QWP A;  4JW1 A;  5ANL A;  1PY1 A;  1QNF A;  2C2L A;  4L2Y A;  3ZFW A;  4I43 A;  2CG3 A;  2WXO A;  3D9J A;  3G2S A;  2C0M A;  2IJG X;  4J8F A;  3CVW A;  3CK8 A;  5A6C A;  4ANW A;  4XIF A;  3QJZ A;  4Q94 A;  4AP2 A;  5C2Y A;  4AOF A;  4J0U A;  3O48 A;  3CHP A;  2XEV A;  4HXI A;  4I9E A;  3KD7 A;  2NXP A;  3HVE A;  5LCW J;  2L6J A;  4AJW A;  3FTV A;  3PRE A;  3MGB A;  5HQ8 A;  4IRU A;  2JEK A;  1HG5 A;  3G2T A;  4G24 A;  4BTB A;  3SHF A;  2HR2 A;  3GW4 A;  1IYG A;  4V3I A;  3JQ1 A;  3G2V A;  3ZN3 A;  2XHE A;  1TJC A;  1OWM A;  1OWL A;  4FJY A;  2VQ2 A;  4DPR A;  3QDN A;  1NA3 A;  3L13 A;  4MRU A;  1ZBP A;  5DBK A;  3S2A A;  4UI9 J;  3LCA A;  3D9M A;  2KAT A;  4GZC A;  3HHM A;  5BUZ A;  2LAH A;  4N3A A;  3QAQ A;  2EQX A;  3MX3 A;  4GCN A;  5G05 J;  5BV1 A;  3ZEF A;  2KCL A;  3CVV A;  4WWN A;  3ZYL A;  1UN9 A;  3VLD A;  1WAO 1;  4Q69 A;  2J07 A;  4N5C A;  3RJV A;  2QY7 A;  3APF A;  4B89 A;  3EDT B;  4N3B A;  3SFZ A;  1H6K A;  1Y8M A;  1HO8 A;  5ARG A;  2IF4 A;  3FDH A;  3PE3 A;  2XGO A;  3LYA A;  3RKV A;  2Y4T A;  4HOR A;  4N2S A;  4XZ4 A;  3T8M A;  3U3W A;  3ONK A;  3VTX A;  3FUF A;  3PVL A;  4L7T A;  5C1D A;  5JJ7 A;  1UJK A;  4B94 A;  3TGO A;  2UY1 A;  3CHQ A;  2WXI A;  4J8S A;  5FQ6 A;  2RG8 A;  3TAX A;  3ESK A;  1PAQ A;  4FLH A;  3K9I A;  3KAE A;  2WM9 A;  4Y6C A;  5ENN A;  3FU5 A;  1IHG A;  3IV0 A;  4BX8 A;  3CVL A;  1QQE A;  3D9K A;  3FUN A;  3CST A;  3QKY A;  5CMW A;  3B7S A;  1Z3X A;  4E6H A;  1YA0 A;  3D9P A;  5ANR A;  3ENE A;  5J08 A;  2R5S A;  4ILH B;  2C0L A;  3BG0 B;  4IUL A;  2KM4 A;  3Q5M A;  2YHE A;  3SI5 A;  3E4B A;  4L2L A;  5FT9 A;  2IU1 A;  3VLF A;  5FQ8 A;  2WXJ A;  4YVQ C;  4FHK A;  4ANU A;  4ANX A;  3VLE A;  3B7U X;  3FY4 A;  2CHX A;  3AU5 A;  2FO7 A;  1EPU A;  3FU6 A;  4HS2 A;  1UG3 A;  2FUL A;  2NC9 A;  3CV0 A;  4UWL A;  4EPZ A;  5HI7 A;  4K0R A;  3DPD A;  3LKU A;  5EX0 A;  1XNF A;  4GPK A;  1OWP A;  3BG1 B;  2XPY A;  2AVP A;  2GRL A;  1HG2 A;  2X6I A;  3UPV A;  4A55 A;  4NQ0 A;  4RVB A;  3DBS A;  3CHR A;  3SF4 A;  4LER A;  2CG2 A;  1HS6 A;  4CDN A;  2GRM A;  5AJL A;  3FU3 A;  4FUL A;  3CHO A;  4JA7 A;  4WNE A;  3CEQ A;  5BW8 C;  1H2V C;  4BT8 A;  3B7T A;  2JLB A;  2XCB A;  4JEU A;  3ZYK A;  3CK7 A;  3PNT B;  3FU0 A;  2J09 A;  3QK0 A;  2LNI A;  3OAW A;  4ANV A;  4I2W A;  5G04 C;  1OUV A;  2ION A;  4UWF A;  3U9W A;  4I1O B;  2PQN A;  1H19 A;  4TRQ A;  3ML8 A;  3QB2 A;  2FF4 A;  3R7R A;  5BV0 A;  3FHE A;  4C0M A;  5M72 A;  3MKQ B;  5FZR A;  3CLJ A;  3ZYM A;  3LEW A;  3VTY A;  4EQF A;  4UWG A;  3UT4 A;  3S7B A;  2OOE A;  4AV7 A;  3APC A;  3CVY A;  4WWP A;  3ASH A;  5AIJ A;  3CK9 A;  3EIJ A;  5G2N A;  3CGH A;  4AXH A;  4FA6 A;  3UX4 A;  2ZU6 B;  2FEZ A;  3ML9 A;  5CMY A;  1ELR A;  3HVE B;  5EKQ D;  3SNX A;  5EDS A;  3NZU A;  3GZS A;  4ME2 A;  4CT4 A;  1OWN A;  4RSY A;  3D9N A;  4OVV A;  4U8H A;  1E8W A;  1Z6T A;  3PEU B;  4BX9 A;  2IFU A;  2LSU A;  4KMO A;  3ZYQ A;  4B0Z A;  4I6J A;  3I4R B;  4B8A A;  1LF8 A;  3UQ3 A;  2WQ7 A;  3CVU A;  4I9C A;  1FVF A;  3ZVV A;  2XRY A;  4J6I A;  4M3O A;  2X6H A;  4HOT A;  2L9B A;  3FTY A;  2FBN A;  3RO2 A;  4H7Y A;  4FJZ A;  1N54 A;  4CGW A;  3L16 A;  4C0E A;  3FP3 A;  4EZL A;  1SZ9 A;  3U64 A;  2X6K A;  2WMO A;  5JJ6 A;  4A1G A;  3L22 A;  3RRU A;  4R7L A;  4O6F A;  4EBA G;  1ELW A;  5KJM A;  4DLQ A;  2V4L A;  3AU4 A;  2VGX B;  2YIN A;  3PE4 A;  4JL0 A;  4UWK A;  1TEZ A;  1MQS A;  3JYS A;  4G26 A;  3LY8 A;  4AVX A;  1GW6 A;  1EDU A;  3MJW A;  3PH0 C;  1SQM A;  1JPL A;  5FWQ A;  2YHC A;  5BPP A;  3B7R L;  3EIQ C;  3EHN A;  3ZPJ A;  3I3N A;  3TG4 A;  4XE0 A;  2WXP A;  5FJY A;  3FUH A;  1NA0 A;  2WB2 A;  1INZ A;  1WM5 A;  1DNP A;  3FUI A;  3FH8 A;  4ILI A;  3ZIM A;  2MHK A;  4C9B B;  5CCL A;  3S7J A;  3AS5 A;  3T5X A;  4EEC A;  2BUG A;  2XCC A;  2WXM A;  2WXL A;  2NSZ A;  3FTW A;  2OVB A;  1N52 A;  2WXF A;  3CVP A;  4JC8 A;  3S7F A;  3LJ3 A;  3CHS A;  4PH4 B;  2BTD A;  3B13 A;  4I2Z A;  3JUI A;  2Y3A A;  2VTB A;  2YQ8 A;  2A4Z A;  4XKB A;  5AEN A;  3CVQ A;  1H2U A;  3FTZ A;  4K03 A;  4KYO B;  1MHQ A;  2XRZ A;  3ONL A;  1P5Q A;  4FHJ A;  4DLO A;  1E7U A;  4PUC A;  5DIZ A;  3S7D A;  5A23 A;  3ASG A;  4I1A A;  4PS3 A;  3RIB A;  4ATG A;  5A7D B;  4BTA A;  4L23 A;  2XQ0 A;  3OXG A;  4H7X A;  2I9C A;  3TXM A;  3ZRH A;  4F7A A;  3CKB A;  2PZI A;  4XX5 A;  5LX8 A;  3RO3 A;  2GGF A;  3MA5 A;  2CHZ A;  4CCA A;  4LEU A;  4FC8 A;  1VDY A;  3FEX A;  5AJD A;  4CEM A;  3FWV A;  2J4B A;  2MOW A;  1HX8 A;  3FTU A;  4GZ5 A;  3D9L A;  1HZ4 A;  2WXR A;  3TG5 A;  4ACL A;  4HOS A;  3ZHE A;  3LVR E;  3AS8 A;  1SZA A;  4I17 A;  3D9O A;  4GYW A;  4HOQ A;  4G1T A;  3CVN A;  3D9I A;  2PM7 A;  2OND A;  2AXV A;  5E76 A;  1Z3Y A;  3MV3 B;  5BT1 A;  4WND A;  1OWO A;  3Q49 B;  4JHJ A;  2P58 C;  4FU3 A;  3Q15 A;  2Y4U A;  2I1J A;  4WAF A;  4JHK A;  2WPV A;  3U66 A;  2LSV A;  4CGV A;  1TJF A;  5FQ7 A;  3FUM A;  4HLE A;  3ZGQ A;  4GU5 A;  4DI4 A;  5KJL A;  4J8D A;  1E7V A;  1U3D A;  1UN8 A;  2DIW A;  2PQR A;  1FVH A;  4UQX A;  1JWG A;  3FUL A;  2E2E A;  5AYW D;  3L17 A;  3CIA A;  3L08 A;  2CHW A;  4WWO A;  2WQH A;  3CR3 A;  4GA0 A;  3BEE A;  1KT0 A;  2J4D A;  4DJA A;  5J90 A;  4GCO A;  4JPS A;  3IBE A;  3PZD A;  1A17 A;  4FLB A;  2AXZ A;  3SZ7 A;  4ILG A;  3JCK C;  2IOL A;  4P29 A;  5KJN A;  3SBS A;  4BFR A;  4I6G A;  3MYV A;  2VJ8 A;  5ARF A;  2RD0 A;  3FTX A;  2WMN A;  3RRM B;  4RG6 A;  4GZD A;  4WNF A;  3LDZ A;  4XI9 A;  3Q47 B;  5LCW C;  3MZL B;  5FTP A;  4JA9 A;  5JHB A;  2KC7 A;  4L1B A;  3D3M A;  3ESL A;  4KZC A;  4GMJ A;  4W9R A;  4KVM A;  2X38 A;  4LCT A;  4CDR A;  2VSO E;  1HFA A;  4URK A;  4GML A;  1KT1 A;  2I1K A;  5E75 A;  2KZT A;  5JHA A;  4UI9 C;  4AY6 A;  1JUQ A;  4EZJ A;  3R9A B;  2OV8 A;  3ASF A;  5G04 J;  4CT0 A;  3TL5 A;  3FUK A;  3MKQ A;  3QWV A;  2DCP A;  3JQ0 A;  4N3C A;  1E8Y A;  3OXF A;  2J9Q A;  4BSX A;  5G05 C;  4NRH B;  2WXK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...