4KYOB

Alanine-glyoxylate aminotransferase variant k390a in complex with the tpr domain of human pex5p
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
315
structure length
286
Chain Sequence
QFEEENPLRDHPQPFEEGLRRLQEGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACETLRDWLRYTPAYAHLVDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFGLPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Ligand-Induced Compaction of the PEX5 Receptor-Binding Cavity Impacts Protein Import Efficiency into Peroxisomes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transport protein
molecule keywords Serine-pyruvate aminotransferase
total genus 115
structure length 286
sequence length 315
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13181 TPR_8 Tetratricopeptide repeat
B PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4kyoB00
4I2ZA 2UWJG 3CK7A 3Q49B 5JJ7A 4GZ3A 3UQ3A 2LNIA 3ASHA 2KATA 2QFCA 3ESKA 2XCCA 2LSUA 3KD7A 4NRHB 4BT8A 3FFLA 2FEZA 3CKBA 2HYZA 2UY1A 3AS8A 3HYMB 3QDNA 4G25A 4HOUA 3LKUA 3QWPA 2HO1A 3CVQA 3ASFA 3GYZA 4N2SA 4O6FA 3CVPA 4BTAA 4GZ5A 3WXXA 2KCLA 4WUYA 4XIFA 1YA0A 3LY7A 5EX0A 2P58C 2NC9A 3ZPJA 3ZHEB 3TGOA 5G04J 2VGXB 3MV3B 2VYIA 5M72A 2PQNA 3GZ2A 3RIBA 2XGOA 4G2VA 4G26A 3N71A 3RJVA 4BTBA 3RO2A 3MKRA 2I6HA 4GZ6A 3CV0A 3LY8A 4B94A 3Q15A 5FT9A 2XPIA 4YVOA 2PZIA 4GYWA 2Q7FA 4HOQA 3K9IA 3SZ7A 4GA2A 2DBAA 4U0ZA 5HI7A 3KAEA 4G23A 5CCLA 2V5FA 4GA1A 1ELRA 2JLBA 5JJTA 4NQ0A 5DBKA 1HXIA 2J9QA 4I17A 3QOUA 4UQYA 4J8FA 1QQEA 1KT0A 4YNDA 3RKVA 4APOA 5G05C 5BNWA 4GPKA 4N2QA 4J8EA 5A6CA 3PE4A 4I9EA 4RG9A 3QKYA 4G24A 5FJYA 1ZU2A 4G1TA 2KC7A 3GZ1A 1WAO1 3IEGA 4JHRA 4EQFA 5DIZA 4HORA 3RO3A 2YQ8A 4LEUA 3Q47B 2E2EA 4WNGA 4YVQC 5EKQD 3MV2B 5FZRA 3S7JA 4AM9A 3BEEA 3ASGA 3JYSA 3URZA 3ZFWA 5FZQA 3UUXA 4KXKB 3CK8A 3FWVA 3FP3A 3QWWA 4U04A 4XI0A 3S7DA 1NA3A 1P5QA 1ELWA 5EX3A 3CVNA 2IFUA 5AYWD 2PQRA 4BWRA 2PL2A 2WQHA 3CEQA 5BT1A 1E96B 4UQZA 4GYOA 3OXFA 3ZN3A 4WNFA 2XCBA 4GYYA 4J8DA 3Q4AB 3CK9A 5ARGA 3U3WA 4N3CA 4ABNA 3LCAA 5BW8C 3AS5A 2FF4A 3S7BA 1NA0A 4IN3B 4CGVA 1ZBPA 2WPVA 5G05J 2FBNA 2GW1A 2VGYA 4JA9A 4WNDA 4UI9K 4CGWA 1NZNA 2ONDA 3PDNA 2HR2A 3KS2A 2VSNA 4RG6A 3RU0A 2FO7A 1KT1A 2VGXA 4I1AA 4WNEA 3ZHEA 4AY6A 3CKCA 3ULQA 2Y4TA 4AY5A 4A1SA 3O48A 4GA0A 4H7YA 4U0SA 3SF4A 1OUVA 3LPZA 5FTPA 2OOEA 3ZGQA 4H7XA 3TG4A 2AVPA 2IF4A 3EDTB 2KCVA 2UY1B 3MA5A 3QWVA 2R5SA 5FZSA 4N3BA 1W3BA 3VTYA 2C0MA 4JA7A 2BUGA 4Y6CA 3U4TA 2YHCA 1IYGA 1KLXA 3TAXA 4KBQA 4GCOA 3LY9A 4KYOB 1XNFA 5D0OD 5G04C 4N5CA 4W9RA 1PC2A 1A17A 1B89A 4UI9J 3LYAA 1TJCA 5KJMA 2Y4UA 5CHEE 2L6JA 5LCWJ 1FCHA 5D0QD 1Y8MA 3Q5MA 4U0UA 2XGMA 3GW4A 4GCNA 4I2WA 3AS4A 4ME2A 4N3AA 4Y6WA 5A7DB 5KJLA 5LCWC 4HOTA 2FI7A 3R9AB 1HH8A 2KCKA 4N39A 4UQXA 3VTXA 4CDRA 4AIFA 5ARFA 3ASDA 4JL0A 4HOSA 3S7FA 2C0LA 5C1DA 1WM5A 4U07A 4UI9C 3CVLA 1IHGA 4F3VA 5CCMA 1HZ4A 5HQ8A 3MEKA 2MHKA 3OXLA 5KJNA 2VQ2A 2C2LA 3UPVA 3PE3A 2XGSA 3TG5A 5KJKA 5JJ6A 4XI9A 3NF1A 4BT9A 3OXGA 2XEVA 4I9CA 4J0UA 1QZ2A 3E4BA 2LSVA 2VSYA
chains in the Genus database with same CATH superfamily
2UWJG 4NRHB 2WXKA 2FEZA 4JD2G 4DK5A 3ASFA 4N2SA 4JW1A 3ABKE 1SA4A 3GZ2A 2MRIA 4GZDA 2ZU6B 4BTBA 2V8SE 4EZJA 3CV0A 4E6HA 2MYOA 3ZNGA 1HXIA 4RQIA 4GB9A 1GW6A 2CG3A 3LVQE 4TV3A 4APFA 3V2XA 3ASNE 3FUJA 5FWQA 1TN8A 4A3TA 1D9SA 1TR4A 1X5BA 3WG7E 3HIZA 1H0AA 3U3WA 3UTMA 3AS5A 2R02A 1WDYA 5G05J 1H6OA 2AW6A 4RG6A 3CKCA 2XZDG 4U0SA 4C0EA 3W9FA 2AVPA 2OV8A 3FEYA 3FY4A 3UT4A 4N3BA 3FHEA 3APCA 2V0PA 2WVIA 3SHFA 2DWZA 4FJZA 1Y8MA 2F37A 3PREA 3DXMG 3GW4A 4N3AA 5ENPD 2I1KA 4N39A 3IHYA 2C0LA 1WM5A 2IO3C 4A3VA 4HNAD 3FTYA 3QJZA 3B7BA 3JUEA 4NACA 3FU5A 3E33A 3TG5A 3CVUA 2WXQA 4ILHB 4MBGA 2VSYA 5ENOD 4HRLA 1S70B 4ACLA 1BI7B 1YA0A 3LS8A 2R59A 3SO8A 2I6HA 4BERA 3U66A 4GTPA 4K03A 2AWIA 2PZIA 4Q69A 1DVPA 4TXQA 4GA1A 4G11A 3VLDA 3QOUA 5IY5E 1MHQA 3I4RB 5AJDA 1VDYA 2CFZA 3DSWA 3RO3A 2YQ8A 3CHRA 2YHEA 4EZLA 2JEKA 2Y1LE 3MV2B 4UWFA 3ZFWA 2QC9A 3MZLB 1ELKA 2EILE 1E96B 4XX5A 3BQOA 5ARGA 2EINE 3S7BA 2XENA 4FP7A 2FBNA 4U96D 5CMYA 4C48B 4G8KA 3MKQB 4A1SA 3TWTA 4H7YA 3KEZA 3SFYA 3EDTB 5FIOA 2UY1B 3CVWA 4J8YA 3Q78A 2GRPB 3CVXA 1MZCA 2LAHA 1Z6TA 4HRNA 2X6HA 4R7LA 1PAQA 5HRYA 1OWOA 2KCKA 3QAQA 4AP2A 4YDWA 4NURA 2J09A 4PS8A 4DLOA 5KJNA 2YNQA 3OXGA 5CBOA 1H6KA 3JCKC 3Q9UC 4ATGA 2LSUA 3HYMB 3KEAA 3APDA 2KCLA 4K5CA 3RRUA 5G04J 3ZIMA 4B0ZA 4K5AB 3FTSA 2VTBB 4XEIG 3LY8A 4U0ZA 1N94A 2ZISA 2VJ8A 4GTMA 4XKCA 1UOHA 4J8FA 4JEUA 4U8HA 3VLFA 4J8EA 3PE4A 1OWNA 1E8YA 3UINC 5FZRA 3UIPC 1D8DA 5BV1A 2R03A 3QWWA 4XI0A 2VTBA 2PL2A 4GMJA 3ZYLA 3G2TA 1OCOE 2XRZA 4Q96A 4J8DA 4YDOA 2ETCA 5CEAA 1UG3A 1G3NB 2F8YA 2ONDA 4JPSA 3CHMA 1E8ZA 2RD0A 5EILA 1JPLA 4N5QA 1IYGA 4LERA 4Y6CA 3L9TA 3IXEA 2DIWA 1PC2A 4W9RA 4EBAA 3D9OA 4GCNA 4CYMD 4CRWA 4FHJA 1LD7A 3BG0B 4L2LA 2IY0C 2XGSA 2P2CP 1UJJA 3Q49B 4GZ3A 4BEPA 2LNIA 3OAWA 4HVBA 2L0IA 3HDXA 2GRLA 4DI4A 2L6BA 5A23A 5ITZF 4GA2A 1N11A 3Q9NC 2JLBA 4GTQA 3DWLG 3ZEFA 2P9NG 2WMNA 1ZU2A 3IEGA 1OY3D 3FUIA 1HX8A 4KXKB 2I2OA 5EIDA 1ELWA 3L54A 5EX3A 1H2TC 3EHRA 1TNYA 3G2VA 3FUMA 2WPVA 2J08A 3UM1A 3DBSA 1OUVA 3EHNA 3LPZA 2XEEA 4PH4B 3V79K 3VTYA 2BUGA 2WXGA 3B7RL 1KLXA 2GRMA 4LCTA 4N5CA 1H2VC 2PNNA 5KJLA 2LAIA 5C2YA 5ARFA 4X8QA 3IHVA 2VSOE 1FVHA 5KJKA 3NF1A 2XHEA 3S2AA 2VSXE 1RZ4A 1NL4A 2GGFA 3ESKA 2B6CA 4HOUA 2HYZA 3QWPA 3DSVA 3CVPA 3V2OA 5BUZA 3ULYA 3QNKA 5EDSA 1SA5A 3G2SA 3CSTA 3RIBA 3NB2A 3RJVA 2CFUA 2J4DA 4GYWA 5EYLA 4HOQA 3ONLA 2H6IA 2HM8A 5CMWA 5HS0A 4I17A 4F53A 1EF1C 1TYQG 3Q7AA 1RW2A 4HBDA 3CVVA 4JVSA 3SD5A 3BEEA 3NZSA 1U3DA 5EYPF 4Q94A 3QB2A 3FTUA 2P9SG 3PUKA 3OXFA 4AJWA 1NA0A 2VGYA 3RK6A 4UI9K 4DRXE 2VSNA 2ETAA 5D2MC 5ENSD 1L5JA 3V30A 2PM7A 1NFIE 1N0QA 1E7UA 4JA7A 1MX6A 1SQMA 2YHCA 2I9CA 2KZTB 3JXJA 2Y4UA 3JQ1A 5KWDA 2XGMA 1TNZA 4XE0A 4CDRA 1QNFA 4ZFHA 1SZAA 4F3VA 1V54E 3CVLA 1H6PA 3QK0A 2ETBA 2H6HA 4MLPA 3D9KA 3AG2E 5FQ7A 5B3SE 3X2QE 3B7TA 3CVYA 3SFXA 5JJ7A 2GRQB 2IONA 1H19A 3KD7A 3EU5A 3CKBA 2UY1A 5AIJA 3LKUA 3CVQA 4AVXA 5H7PA 3L13A 4MKTA 4GMLA 4KT6B 1TNUA 4TRQA 3ZXPA 3D9JA 1SVXA 1N4RA 3KAEA 3RRNB 3W9GA 3D9MA 5FQ4A 3R9MA 3HXBA 4CT0A 1KT0A 4APOA 2P9PG 1MQSA 4HORA 4L23A 5DIZA 4K0RA 5EKQD 4AM9A 3D9IA 1U2VG 3JYSA 4HQDA 3D9HA 3FP3A 3S7DA 3DSSA 5JA4D 4UQZA 4GYYA 3DEOA 4N3CA 4ABNA 5KBAA 1LF8A 3DSUA 1JWGA 5E76A 5T4YA 3CLJA 3PEVB 2B0OE 2AJAA 3O48A 4QQIA 2LXMA 2QZAA 2NXPA 2C0MA 3U4TA 3LY9A 3TJPA 3AG4E 2WXMA 1TEZA 3HXFA 4Y6WA 2WXOA 4ME2A 2OEWA 5G55A 2J49A 5HQ8A 3PRZA 1N9AA 1E8WA 1V55E 4HI8A 3UPVA 3ZYQA 3T5XA 1NI1A 5ANLA 1OXJA 5G2NA 1WG0A 4P29A 2XZTG 3FUFA 4FA6A 2X6IA 3NBNB 2NSZA 4FLBA 2NC9A 2XRYA 2J4BA 5LP0A 4G26A 2A5EA 1HG2A 4A63B 2KXPC 5LX8A 4LSZE 5HKPA 4HLLA 3FTVA 5BPPA 2IEJA 3ULEG 4URKA 5BNWA 4RG9A 5FJYA 4EQFA 1N4QA 3FH5A 3GZSA 3HXEA 5EN5D 4JEHA 1S0PA 2PQRA 3UI2A 4JHJA 3ZUVB 2QYUA 3AJIA 4HLEA 4EECA 3PDNA 2FO7A 3CIAA 4BFRA 4HB5A 4J6IA 4HS2A 2R5SA 3LJ3A 4BESA 4A55A 4GCOA 3PZ1A 1A17A 1FCHA 3AAAC 2DZNA 3Q5MA 5A7DB 2KM4A 4F1SA 1MYOA 1O1RA 1IKND 4KZCA 3SBTB 2LXLA 4O1PA 2WQ7A 1S63A 3MJWA 4CEMA 4AXHA 4D10C 3IBEA 5JMND 4Z68A 1N0RA 3NAWA 2PQNA 4AOFA 4GTOA 2X6FA 2WXHA 4L1BA 2IO2C 1KZOA 3FUNA 3KSLA 4AV7A 3QKYA 4C0MA 2RFMA 5ANRA 1WAO1 4JHRA 3FULA 3Q47B 2E2EA 4BX9A 4FU3A 4DX6D 4WAFA 3B7UX 4GZCA 2WB2A 3ASOE 2NYJA 1TN6A 1NZNA 3KS2A 1HF8A 5AJLA 2VGXA 4U8YD 3ONKA 5ENQD 3DSTA 2V4HC 4GTVA 2H6GA 4ATZD 5FZSA 4DJAA 1E8XA 3PS6A 1HG5A 5CRVA 4B93B 1B89A 1INZA 3PVLA 3ZYKA 2FI7A 1KPSB 2XQ0A 3EIQC 2MHKA 3MYVA 4GTSA 2C2LA 1UW4B 5BV0A 4YDYA 3QC1A 4IYPA 4B8CB 2X3MA 4BT8A 4G8LA 1UN9A 1BU9A 3TL5A 5EX0A 3CSFA 3ZW3A 3O4ZA 4OVVA 3EIJA 4I6EA 2KBXA 3UKUG 2CHXA 4B94A 3SNXA 2XPIA 3C72A 3E34A 5JJTA 3SQVA 4N2QA 4PS7A 4HFGA 1OWLA 2ZGGA 4J8SA 5AENA 1P5QA 3FEXA 3E32A 3KSQA 3R7RA 2CHWA 4WNFA 2F0YA 3T8MA 2BKGA 3FTXA 2FF4A 1MX4A 2H6FA 3HXDA 3ULQA 3T9KA 4TUMA 2KCVA 5T3RA 5T8IA 4JXTA 3V31A 3FU6A 5G04C 3IKOB 3L08A 4I6JA 5LFAA 3AS4A 4KVOA 3ISMC 3D9LA 5CBNA 4ILGA 3LVRE 3CHQA 4RSYA 5JJ6A 1IQRA 1QZ2A 3TWUA 3JQ0A 3D9NA 2KATA 2XCCA 3CQGB 3QDNA 2A5UA 1TJFA 2CHZA 1DCEA 4PDXA 2VGXB 3MV3B 5M72A 4RVBA 3FUHA 4DLQA 3UX4A 2AXZA 1YYHA 2DBAA 1Z5SC 1UN8A 2CG2A 1QQEA 3CHSA 2V4LA 4CT4A 2QY7A 3S7JA 1AP7A 5FZQA 4U04A 2P9KG 3CEQA 4GYOA 3ENEA 2M63A 5CERB 5BW8C 2BEDA 2OCCE 1HO8A 4TXRA 2GW1A 2WXIA 2WQ6A 1FT2A 1H2UA 3L17A 4ACKA 5BT1A 1FVFA 3QWVA 1O1SA 3TWRA 2FO1E 1BI8B 3D9PA 2Y3AA 1PY1A 2WXNA 4EBAG 5LCWJ 4FLHA 5D0QD 3R9AB 4UQXA 2KZTA 4JZYA 1EPUA 1Z3YA 4NIKA 3HVEB 2HE0A 3PE3A 3SY2A 1TN7A 5KNGA 2A4ZA 3LDZA 3LJNA 5DBKA 2QFCA 4L9PA 1IXVA 3F6QA 4FC8A 4YDEA 3UT7A 4ANVA 4XIFA 2P9LG 3DXKG 3BG1B 1MX2A 4KZ0A 1FPPA 3Q15A 5FT9A 4YVOA 3K9IA 1IQUA 2DYRE 5CCLA 4XZ4A 2J9QA 3IV0A 3OTNA 4C9BB 4UQYA 4U95D 5ENTD 4YNDA 2XS1A 4G1TA 5KCMA 3TXMA 4LEUA 4WNGA 3PNTB 5AQBA 3ASGA 3TWQA 3UIOC 3HRAA 4M7CA 1K8KG 2DVWA 5ENRD 3UT8A 4OAVB 3MCXA 2XCBA 4ILIA 4U63A 4IN3B 5AN8A 2BF0X 3ZHEA 2Y4TA 2X6KA 3SBSA 4BSXA 2GRNB 3FU0A 3PUJA 3U64A 1DNPA 4XKBA 1WY6A 1XNFA 2BTDA 4LNUD 4RLYA 4UI9J 3LYAA 5CECB 3ZRHA 4JL0A 4U07A 4UI9C 4K5BA 4CZ2D 4WWPA 4DX2A 2EQXA 5ENNA 5LOZA 2XEVA 4CDMA 4LNGA 3FUEA 2LSVA 4QFVA 3ZKJA 3HXCA 2IOSA 2WXJA 4CDNA 4I1AA 4WNEA 1OCZE 2MOWA 4WUYA 5FQ6A 2P58C 4JB8P 2J8SD 2VYIA 1N4PA 2XGOA 3J5PA 3ZYMA 2Y69E 5JHAA 3ZU7B 4M3OA 2XEHA 4J7WA 4G23A 4L2YA 1N54A 4NQ0A 3HG0D 1Y6IA 3RKVA 1FT1A 4LNBA 5BXOA 5A6CA 4I9EA 4ZHBA 3APFA 3FDHA 5E75A 3JUIA 4YVQC 3P1UA 4I1OB 3ZVVA 4KVMA 4V3IA 3D3MA 3ZN3A 2PM6A 3I5PA 1QYMA 3LXUX 2ZXWE 4JA9A 3UM0A 3RSEG 4WWNA 4AY5A 4GA0A 3B7SA 3ZGQA 1DC2A 3I4GA 2IF4A 2EIKE 3PNLB 2WMOA 1OT8A 3TWVA 3BUAA 1N4SA 2I1JA 1OWMA 1TJCA 3PZ3A 4BY6A 5B1BE 2ZIRA 1Q2ZA 2XS8A 2IJGX 4HOSA 3CR3A 3B13A 5CRUA 3MEKA 2VQ2A 4E85A 3TWWA 1YMPA 4U8VD 4XI9A 3Q7FA 4J0UA 3FTWA 1A5EA 4FADA 2L9BA 2GROB 4F6RD 3AS8A 3QARA 3EHQA 4UWKA 3R7QA 2GRRB 3C5RA 2WXRA 1EYHA 3ZHEB 1BD8A 4G2VA 3I3NA 3CHPA 3ZXSA 3EU9A 3P2BA 5AARA 1SW6A 3AG3E 3DEPA 3PZ2A 3FH7A 3TWXA 5B1AE 2LUHA 5D66A 1UJKA 1O5MA 3G2WA 5FQ8A 4PUCA 2IFUA 2L0TB 4DX7D 5CEDB 3J5QB 3CK9A 2IU1A 3FUDA 2XPZA 2HR2A 4HOTA 3RU0A 2RKKA 1KT1A 3ABLE 1O1TA 4UUCA 5FINA 3TG4A 5LCWC 2WXFA 3CGHA 5AQAA 1QBQA 4I43A 1LD8A 1DCQA 3MGBA 2L6JA 1S64A 1SZ9A 4GAAA 4UWLA 3ML9A 3ABME 2OEVA 3FH8A 1XGWA 1N52A 4CCAA 2ILRA 3L16A 3CQCB 1D8EA 4LUNU 1E7VA 3E4BA 4MRUA 3C98A 4I2ZA 4GTTA 3ASHA 4BSZB 3AG1E 1K3ZD 3C3RA 3DSXA 4G25A 4UWGA 3GYZA 4O6FA 4BTAA 3WXXA 3BU8A 3NOCD 3DPDA 4U7EB 4I1MA 2J07A 4JC8A 2F8XK 3MKRA 4GZ6A 4LG6A 5JHBA 4EPZA 3E37A 3C3OA 2X6JA 2WM9A 3G2UA 2R2LA 2V5FA 4ANXA 1ELRA 4DX5D 1MJ0A 3AU4A 3DRAA 2XPYA 2E0IA 5AQ7A 2Y0BG 4GMRA 3FTZA 3UUXA 3NOGD 3CVNA 1LTXA 2WQHA 3AU5A 4HRMB 3EHMA 3RRMB 3TWSA 4LRZA 4CGVA 1ZBPA 4F7AA 3NZUA 2OVFA 3C3QA 3SF4A 2DYSE 2OOEA 1JCQA 1NP7A 4H7XA 3PZDA 4OAUC 5BXUA 1OCRE 1Z3XA 3Q73A 2QYJA 4TXPA 4I2WA 4DI3A 2R17C 2WXPA 3VTXA 1K1BA 4BETA 1HU3A 3PEUB 2V5QC 1JCRA 3B95A 3SGHA 5AQ9A 3FU3A 4BT9A 3UKRG 3UQ3A 3FFLA 2BKKB 4O1OA 2HO1A 2P9IG 2RG8A 2EIME 3LY7A 3TGOA 3ZPJA 3CHOA 5EIBE 3N71A 4FHKA 4MS6A 2X38A 2Q7FA 4IULA 3DPYA 3PH0C 3EJNA 5G05C 3HVEA 4G24A 4GPMA 4B8AA 3GZ1A 2RFAA 2DZOA 1U3CA 3U9WA 4TUUA 3CK8A 3FWVA 4FJYA 4BWRA 1JCSA 3Q4AB 3UXGA 4IRUA 3LCAA 3EUVA 4JHKA 4CGWA 2LO6A 3T5VA 3T8KA 1YCSB 4B89A 3PZ4A 1KZPA 4KBQA 4F1PA 4AEZC 3ESLA 1TNBA 1TNOA 5KJMA 5CHEE 1ZB1A 5J90A 1HE8A 4U0UA 3Q79A 5AAOA 1HH8A 3RAUA 2AXVA 3ML8A 3S7FA 5CCMA 4A1GA 3UM2A 3OXLA 4ANUA 1IHBA 3FUKA 2VGEA 1BPOA 2P9UG 4EZKA 4HXIA 3CK7A 3UMVA 3Q75A 4OVUA 1HS6A 5D0OD 3L22A 4L7TA 2IOLA 4GTRA 4GZ5A 3MKQA 4ANWA 2FULA 4I6GA 3RO2A 2R05A 1HFAA 4DPRA 2JABA 3SZ7A 5HI7A 1EDUA 3LEWA 3E30A 4HI9A 2EIJE 4FULA 4O60A 1BLXB 4UWHA 3MX3A 4GPKA 2ZGDA 2KC7A 3L82A 2WXLA 2OVBA 3URZA 2YINA 4GU5A 1NA3A 5AYWD 3VLEA 3HHMA 3UM3A 3SFZA 4WNDA 2AXUA 1N95A 4EHMA 4AY6A 3TXNA 5KNHD 1JWFA 4BX8A 1OWPA 5FTPA 1E90A 2DCPA 4AIFA 4DX1A 3MA5A 3NQPA 3JXIA 1W3BA 3TAXA 3SI5A 5J08A 1K1AA 1X81A 4KYOB 3L6AA 4KMOA 4PS3A 4WWOA 3ASDA 5C1DA 1IHGA 1OCCE 1HZ4A 2IQCA 4OYSA 1AWCB 1JUQA 4DUIA 4I9CA
chains in the Genus database with same CATH topology
2UWJG 4FADA 2GGFA 2L9BA 3ESKA 4NRHB 2WXKA 4BT8A 2FEZA 4HOUA 2HYZA 3AS8A 3QARA 3QWPA 4DK5A 1UN9A 3ASFA 4JW1A 4UWKA 3CVPA 4N2SA 3R7QA 5BUZA 2WXRA 3QNKA 5EDSA 3TL5A 1EYHA 5EX0A 3CSFA 3ZHEB 3G2SA 3ZW3A 3CSTA 3GZ2A 2MRIA 3O4ZA 3EIJA 3I3NA 4G2VA 4OVVA 3RIBA 4GZDA 2ZU6B 3RJVA 4BTBA 4I6EA 2CHXA 2CFUA 2V8SE 4EZJA 3CV0A 4B94A 3CHPA 4E6HA 3ZXSA 3SNXA 2XPIA 3P2BA 2J4DA 4GYWA 4HOQA 3ONLA 2HM8A 5CMWA 5JJTA 1HXIA 4I17A 4GB9A 4F53A 1GW6A 1EF1C 2CG3A 4N2QA 3LVQE 4PS7A 4TV3A 4APFA 3FH7A 3FUJA 4HFGA 5FWQA 1OWLA 3CVVA 1UJKA 4A3TA 4JVSA 3SD5A 3BEEA 3NZSA 1U3DA 4J8SA 3G2WA 4Q94A 5AENA 1P5QA 3FEXA 4PUCA 5FQ8A 3QB2A 2IFUA 1X5BA 3FTUA 2L0TB 3HIZA 3PUKA 3OXFA 3R7RA 2CHWA 1H0AA 4WNFA 3CK9A 3T8MA 4AJWA 3U3WA 2IU1A 3AS5A 3FTXA 2FF4A 1NA0A 5G05J 2VGYA 3RK6A 3FUDA 4UI9K 2AW6A 2XPZA 4RG6A 2HR2A 4HOTA 2VSNA 3RU0A 1KT1A 3CKCA 3ULQA 1L5JA 4U0SA 2PM7A 4C0EA 3TG4A 2AVPA 2OV8A 2KCVA 5LCWC 3FEYA 3FY4A 1E7UA 2WXFA 3CGHA 3FHEA 4N3BA 4JA7A 5T3RA 5T8IA 3UT4A 1SQMA 2YHCA 4JXTA 2I9CA 3FU6A 4I43A 2KZTB 3APCA 3IKOB 5G04C 3L08A 2V0PA 2WVIA 4I6JA 3MGBA 3SHFA 2Y4UA 2L6JA 4FJZA 1SZ9A 1Y8MA 3JQ1A 3PREA 4GAAA 4UWLA 2XGMA 3GW4A 3ML9A 4N3AA 3AS4A 4KVOA 5LFAA 3D9LA 2I1KA 4XE0A 4CDRA 4N39A 3FH8A 3IHYA 1QNFA 4ILGA 1SZAA 2C0LA 1WM5A 1XGWA 4F3VA 3CVLA 1N52A 4CCAA 3LVRE 3QK0A 2ILRA 4MLPA 4A3VA 3D9KA 3CHQA 3FTYA 3L16A 3QJZA 4RSYA 4NACA 3FU5A 5FQ7A 3TG5A 5JJ6A 1IQRA 3CQCB 3CVUA 4LUNU 2WXQA 3B7TA 1QZ2A 3CVYA 1E7VA 3E4BA 4ILHB 4MRUA 3C98A 2VSYA 4I2ZA 3JQ0A 3D9NA 5JJ7A 2IONA 3ASHA 2KATA 2XCCA 1H19A 3KD7A 4ACLA 3CKBA 3CQGB 2UY1A 3QDNA 4G25A 4UWGA 5AIJA 3LKUA 3CVQA 4AVXA 3GYZA 2A5UA 3L13A 4MKTA 4O6FA 1TJFA 4BTAA 3WXXA 4GMLA 1YA0A 2CHZA 3LS8A 4PDXA 4KT6B 3DPDA 2R59A 2VGXB 3MV3B 5M72A 4TRQA 4I1MA 2J07A 4JC8A 4RVBA 3D9JA 3MKRA 2I6HA 4GZ6A 5JHBA 4EPZA 3U66A 3FUHA 4DLQA 4K03A 3UX4A 2AXZA 2X6JA 2AWIA 2PZIA 2WM9A 4Q69A 2DBAA 3G2UA 3KAEA 1UN8A 3RRNB 3D9MA 1DVPA 5FQ4A 2CG2A 4CT0A 2V5FA 4GA1A 4ANXA 1ELRA 4G11A 3VLDA 3AU4A 3QOUA 1QQEA 3CHSA 1KT0A 4APOA 2V4LA 1MHQA 3I4RB 5AJDA 1VDYA 2XPYA 2E0IA 1MQSA 4HORA 2CFZA 4L23A 5DIZA 4CT4A 3RO3A 2QY7A 2YQ8A 3CHRA 2YHEA 4K0RA 2JEKA 3D9IA 3FTZA 3MV2B 5EKQD 3S7JA 4UWFA 4AM9A 3JYSA 3ZFWA 5FZQA 3UUXA 3FP3A 4U04A 3S7DA 3CVNA 3MZLB 1ELKA 2WQHA 3CEQA 3AU5A 1E96B 4UQZA 3EHMA 4GYOA 3RRMB 4XX5A 4GYYA 3ENEA 5ARGA 4N3CA 4ABNA 2M63A 4LRZA 5BW8C 3S7BA 4CGVA 1HO8A 1LF8A 1ZBPA 4FP7A 2FBNA 2GW1A 2WXIA 1JWGA 5CMYA 5E76A 4F7AA 5T4YA 3CLJA 3NZUA 3PEVB 2WQ6A 1H2UA 3MKQB 4A1SA 2OVFA 3L17A 3O48A 4H7YA 3KEZA 3SF4A 4ACKA 2OOEA 1NP7A 4H7XA 5BT1A 3EDTB 1FVFA 2UY1B 2NXPA 3QWVA 3CVWA 2C0MA 3U4TA 3PZDA 3CVXA 3D9PA 3LY9A 2Y3AA 1PY1A 2LAHA 1Z6TA 3TJPA 2WXNA 1Z3XA 4EBAG 5LCWJ 2X6HA 4FLHA 1PAQA 4R7LA 2WXMA 1TEZA 5D0QD 4I2WA 4Y6WA 2WXOA 4ME2A 4DI3A 1OWOA 2R17C 2WXPA 5G55A 3R9AB 2KCKA 4UQXA 2KZTA 3QAQA 4JZYA 3VTXA 4AP2A 1EPUA 1Z3YA 2J49A 1HU3A 4NURA 2J09A 3PEUB 4PS8A 5HQ8A 3PRZA 3HVEB 4DLOA 5KJNA 1E8WA 3SGHA 3UPVA 3PE3A 3ZYQA 3T5XA 3FU3A 2YNQA 4BT9A 3OXGA 2A4ZA 5ANLA 3LDZA 5G2NA 1H6KA 3JCKC 5DBKA 3UQ3A 2QFCA 4P29A 4ATGA 2LSUA 3FUFA 3FFLA 3HYMB 4FA6A 3APDA 2HO1A 4FC8A 2X6IA 3UT7A 4ANVA 2RG8A 2KCLA 2NSZA 4XIFA 3LY7A 4FLBA 2NC9A 3ZPJA 3TGOA 3RRUA 2XRYA 5G04J 2J4BA 3ZIMA 4B0ZA 3CHOA 5LP0A 3FTSA 3N71A 3BG1B 4G26A 2VTBB 4FHKA 4KZ0A 4MS6A 2X38A 3LY8A 1HG2A 3Q15A 5FT9A 4YVOA 5LX8A 2Q7FA 3K9IA 4IULA 1IQUA 4U0ZA 3FTVA 5CCLA 4XZ4A 5BPPA 3PH0C 2J9QA 3IV0A 3OTNA 2VJ8A 4XKCA 4C9BB 4UQYA 4J8FA 4JEUA 3EJNA 4U8HA 4YNDA 5BNWA 4URKA 5G05C 3HVEA 3VLFA 4J8EA 3PE4A 1OWNA 4RG9A 4G24A 5FJYA 4B8AA 1E8YA 4G1TA 5KCMA 3GZ1A 3TXMA 4EQFA 4LEUA 1U3CA 3FH5A 4WNGA 3U9WA 5FZRA 3GZSA 3PNTB 3ASGA 5BV1A 4TUUA 3CK8A 3FWVA 3QWWA 4FJYA 4XI0A 2VTBA 3UT8A 4JEHA 1S0PA 2PQRA 4BWRA 2PL2A 4GMJA 3ZYLA 3G2TA 3MCXA 2XRZA 4JHJA 2XCBA 4Q96A 4J8DA 3Q4AB 4ILIA 4IRUA 3LCAA 4HLEA 4U63A 4EECA 4IN3B 4JHKA 1UG3A 4CGWA 2ONDA 3PDNA 4JPSA 2LO6A 3T5VA 2FO7A 2BF0X 3ZHEA 3CHMA 2Y4TA 2X6KA 3CIAA 3SBSA 4BFRA 1E8ZA 4BSXA 4J6IA 2RD0A 4HS2A 3FU0A 4B89A 1JPLA 2R5SA 3PUJA 3U64A 1DNPA 4LERA 4Y6CA 1IYGA 3LJ3A 4XKBA 1WY6A 4A55A 4KBQA 4GCOA 1XNFA 2BTDA 4AEZC 3ESLA 2DIWA 1PC2A 1A17A 4W9RA 4EBAA 4UI9J 3LYAA 5KJMA 5CHEE 3D9OA 5J90A 1FCHA 1HE8A 3Q5MA 4U0UA 4GCNA 5A7DB 2KM4A 4F1SA 1HH8A 3ZRHA 2AXVA 3ML8A 4JL0A 3S7FA 5CCMA 4U07A 4UI9C 4A1GA 4CRWA 4FHJA 4KZCA 4WWPA 3OXLA 3BG0B 4ANUA 2EQXA 4L2LA 5ENNA 3SBTB 2XGSA 5LOZA 3FUKA 1BPOA 2XEVA 4CDMA 1UJJA 2WQ7A 3FUEA 2LSVA 4EZKA 4HXIA 3CK7A 3Q49B 4QFVA 4GZ3A 2LNIA 3UMVA 3MJWA 4CEMA 2IOSA 4OVUA 1HS6A 2WXJA 4AXHA 4I1AA 4WNEA 5D0OD 4CDNA 3OAWA 3IBEA 4D10C 3L22A 4L7TA 2MOWA 2IOLA 4HVBA 4GZ5A 4WUYA 5FQ6A 2L0IA 3MKQA 2P58C 3HDXA 4ANWA 2GRLA 4DI4A 2VYIA 2PQNA 2FULA 4AOFA 2XGOA 4I6GA 3RO2A 5A23A 3ZYMA 1HFAA 4DPRA 5JHAA 4M3OA 3SZ7A 4GA2A 5HI7A 2X6FA 1EDUA 2WXHA 3LEWA 4G23A 4L1BA 4L2YA 1N54A 2JLBA 4NQ0A 4FULA 1Y6IA 3ZEFA 4UWHA 3RKVA 3MX3A 3FUNA 4GPKA 5A6CA 4I9EA 4AV7A 3QKYA 4C0MA 2WMNA 1ZU2A 3APFA 5ANRA 2KC7A 3FDHA 1WAO1 3IEGA 3FULA 4JHRA 5E75A 3JUIA 4YVQC 3P1UA 3Q47B 2E2EA 3FUIA 4BX9A 2WXLA 4I1OB 2OVBA 1HX8A 3URZA 2YINA 4KXKB 2I2OA 4FU3A 4WAFA 4GU5A 1NA3A 5AYWD 1ELWA 3L54A 5EX3A 3ZVVA 4KVMA 4V3IA 3B7UX 3D3MA 3VLEA 3ZN3A 3HHMA 4GZCA 2PM6A 3I5PA 4EZLA 1H2TC 2WB2A 3G2VA 3FUMA 2WPVA 3LXUX 4JA9A 3SFZA 4WNDA 2AXUA 1NZNA 2J08A 3KS2A 1HF8A 5AJLA 2VGXA 4AY6A 3TXNA 4WWNA 1JWFA 4AY5A 4BX8A 3ONKA 3DBSA 1OWPA 4GA0A 1OUVA 3B7SA 3EHNA 3LPZA 4PH4B 5FTPA 3ZGQA 1E90A 3I4GA 2DCPA 4AIFA 2IF4A 5FZSA 3MA5A 3VTYA 4DJAA 3NQPA 1W3BA 2BUGA 2WXGA 3PNLB 1E8XA 3B7RL 2WMOA 1KLXA 3TAXA 2GRMA 3PS6A 1HG5A 4LCTA 3SI5A 5J08A 4KYOB 4N5CA 2I1JA 3L6AA 1H2VC 1OWMA 1B89A 1TJCA 1INZA 4BY6A 3PVLA 3ZYKA 5KJLA 4KMOA 4PS3A 2FI7A 2IJGX 4WWOA 4HOSA 2XQ0A 2LAIA 3B13A 3CR3A 3ASDA 5ARFA 5C2YA 5C1DA 1IHGA 3IHVA 1HZ4A 3EIQC 2VSOE 1FVHA 2MHKA 3MEKA 2VQ2A 4E85A 3MYVA 2IQCA 4OYSA 2C2LA 1UW4B 5BV0A 5KJKA 3QC1A 4XI9A 3NF1A 2XHEA 4IYPA 2VSXE 1JUQA 3S2AA 4B8CB 4I9CA 4J0UA 3FTWA 2X3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I2Z A;  2UWJ G;  3CK7 A;  3Q49 B;  5JJ7 A;  4GZ3 A;  3UQ3 A;  2LNI A;  3ASH A;  2KAT A;  2QFC A;  3ESK A;  2XCC A;  2LSU A;  3KD7 A;  4NRH B;  4BT8 A;  3FFL A;  2FEZ A;  3CKB A;  2HYZ A;  2UY1 A;  3AS8 A;  3HYM B;  3QDN A;  4G25 A;  4HOU A;  3LKU A;  3QWP A;  2HO1 A;  3CVQ A;  3ASF A;  3GYZ A;  4N2S A;  4O6F A;  3CVP A;  4BTA A;  4GZ5 A;  3WXX A;  2KCL A;  4WUY A;  4XIF A;  1YA0 A;  3LY7 A;  5EX0 A;  2P58 C;  2NC9 A;  3ZPJ A;  3ZHE B;  3TGO A;  5G04 J;  2VGX B;  3MV3 B;  2VYI A;  5M72 A;  2PQN A;  3GZ2 A;  3RIB A;  2XGO A;  4G2V A;  4G26 A;  3N71 A;  3RJV A;  4BTB A;  3RO2 A;  3MKR A;  2I6H A;  4GZ6 A;  3CV0 A;  3LY8 A;  4B94 A;  3Q15 A;  5FT9 A;  2XPI A;  4YVO A;  2PZI A;  4GYW A;  2Q7F A;  4HOQ A;  3K9I A;  3SZ7 A;  4GA2 A;  2DBA A;  4U0Z A;  5HI7 A;  3KAE A;  4G23 A;  5CCL A;  2V5F A;  4GA1 A;  1ELR A;  2JLB A;  5JJT A;  4NQ0 A;  5DBK A;  1HXI A;  2J9Q A;  4I17 A;  3QOU A;  4UQY A;  4J8F A;  1QQE A;  1KT0 A;  4YND A;  3RKV A;  4APO A;  5G05 C;  5BNW A;  4GPK A;  4N2Q A;  4J8E A;  5A6C A;  3PE4 A;  4I9E A;  4RG9 A;  3QKY A;  4G24 A;  5FJY A;  1ZU2 A;  4G1T A;  2KC7 A;  3GZ1 A;  1WAO 1;  3IEG A;  4JHR A;  4EQF A;  5DIZ A;  4HOR A;  3RO3 A;  2YQ8 A;  4LEU A;  3Q47 B;  2E2E A;  4WNG A;  4YVQ C;  5EKQ D;  3MV2 B;  5FZR A;  3S7J A;  4AM9 A;  3BEE A;  3ASG A;  3JYS A;  3URZ A;  3ZFW A;  5FZQ A;  3UUX A;  4KXK B;  3CK8 A;  3FWV A;  3FP3 A;  3QWW A;  4U04 A;  4XI0 A;  3S7D A;  1NA3 A;  1P5Q A;  1ELW A;  5EX3 A;  3CVN A;  2IFU A;  5AYW D;  2PQR A;  4BWR A;  2PL2 A;  2WQH A;  3CEQ A;  5BT1 A;  1E96 B;  4UQZ A;  4GYO A;  3OXF A;  3ZN3 A;  4WNF A;  2XCB A;  4GYY A;  4J8D A;  3Q4A B;  3CK9 A;  5ARG A;  3U3W A;  4N3C A;  4ABN A;  3LCA A;  5BW8 C;  3AS5 A;  2FF4 A;  3S7B A;  1NA0 A;  4IN3 B;  4CGV A;  1ZBP A;  2WPV A;  5G05 J;  2FBN A;  2GW1 A;  2VGY A;  4JA9 A;  4WND A;  4UI9 K;  4CGW A;  1NZN A;  2OND A;  3PDN A;  2HR2 A;  3KS2 A;  2VSN A;  4RG6 A;  3RU0 A;  2FO7 A;  1KT1 A;  2VGX A;  4I1A A;  4WNE A;  3ZHE A;  4AY6 A;  3CKC A;  3ULQ A;  2Y4T A;  4AY5 A;  4A1S A;  3O48 A;  4GA0 A;  4H7Y A;  4U0S A;  3SF4 A;  1OUV A;  3LPZ A;  5FTP A;  2OOE A;  3ZGQ A;  4H7X A;  3TG4 A;  2AVP A;  2IF4 A;  3EDT B;  2KCV A;  2UY1 B;  3MA5 A;  3QWV A;  2R5S A;  5FZS A;  4N3B A;  1W3B A;  3VTY A;  2C0M A;  4JA7 A;  2BUG A;  4Y6C A;  3U4T A;  2YHC A;  1IYG A;  1KLX A;  3TAX A;  4KBQ A;  4GCO A;  3LY9 A;  4KYO B;  1XNF A;  5D0O D;  5G04 C;  4N5C A;  4W9R A;  1PC2 A;  1A17 A;  1B89 A;  4UI9 J;  3LYA A;  1TJC A;  5KJM A;  2Y4U A;  5CHE E;  2L6J A;  5LCW J;  1FCH A;  5D0Q D;  1Y8M A;  3Q5M A;  4U0U A;  2XGM A;  3GW4 A;  4GCN A;  4I2W A;  3AS4 A;  4ME2 A;  4N3A A;  4Y6W A;  5A7D B;  5KJL A;  5LCW C;  4HOT A;  2FI7 A;  3R9A B;  1HH8 A;  2KCK A;  4N39 A;  4UQX A;  3VTX A;  4CDR A;  4AIF A;  5ARF A;  3ASD A;  4JL0 A;  4HOS A;  3S7F A;  2C0L A;  5C1D A;  1WM5 A;  4U07 A;  4UI9 C;  3CVL A;  1IHG A;  4F3V A;  5CCM A;  1HZ4 A;  5HQ8 A;  3MEK A;  2MHK A;  3OXL A;  5KJN A;  2VQ2 A;  2C2L A;  3UPV A;  3PE3 A;  2XGS A;  3TG5 A;  5KJK A;  5JJ6 A;  4XI9 A;  3NF1 A;  4BT9 A;  3OXG A;  2XEV A;  4I9C A;  4J0U A;  1QZ2 A;  3E4B A;  2LSV A;  2VSY A; 
#chains in the Genus database with same CATH topology
 2UWJ G;  4NRH B;  2WXK A;  2FEZ A;  4JD2 G;  4DK5 A;  3ASF A;  4N2S A;  4JW1 A;  3ABK E;  1SA4 A;  3GZ2 A;  2MRI A;  4GZD A;  2ZU6 B;  4BTB A;  2V8S E;  4EZJ A;  3CV0 A;  4E6H A;  2MYO A;  3ZNG A;  1HXI A;  4RQI A;  4GB9 A;  1GW6 A;  2CG3 A;  3LVQ E;  4TV3 A;  4APF A;  3V2X A;  3ASN E;  3FUJ A;  5FWQ A;  1TN8 A;  4A3T A;  1D9S A;  1TR4 A;  1X5B A;  3WG7 E;  3HIZ A;  1H0A A;  3U3W A;  3UTM A;  3AS5 A;  2R02 A;  1WDY A;  5G05 J;  1H6O A;  2AW6 A;  4RG6 A;  3CKC A;  2XZD G;  4U0S A;  4C0E A;  3W9F A;  2AVP A;  2OV8 A;  3FEY A;  3FY4 A;  3UT4 A;  4N3B A;  3FHE A;  3APC A;  2V0P A;  2WVI A;  3SHF A;  2DWZ A;  4FJZ A;  1Y8M A;  2F37 A;  3PRE A;  3DXM G;  3GW4 A;  4N3A A;  5ENP D;  2I1K A;  4N39 A;  3IHY A;  2C0L A;  1WM5 A;  2IO3 C;  4A3V A;  4HNA D;  3FTY A;  3QJZ A;  3B7B A;  3JUE A;  4NAC A;  3FU5 A;  3E33 A;  3TG5 A;  3CVU A;  2WXQ A;  4ILH B;  4MBG A;  2VSY A;  5ENO D;  4HRL A;  1S70 B;  4ACL A;  1BI7 B;  1YA0 A;  3LS8 A;  2R59 A;  3SO8 A;  2I6H A;  4BER A;  3U66 A;  4GTP A;  4K03 A;  2AWI A;  2PZI A;  4Q69 A;  1DVP A;  4TXQ A;  4GA1 A;  4G11 A;  3VLD A;  3QOU A;  5IY5 E;  1MHQ A;  3I4R B;  5AJD A;  1VDY A;  2CFZ A;  3DSW A;  3RO3 A;  2YQ8 A;  3CHR A;  2YHE A;  4EZL A;  2JEK A;  2Y1L E;  3MV2 B;  4UWF A;  3ZFW A;  2QC9 A;  3MZL B;  1ELK A;  2EIL E;  1E96 B;  4XX5 A;  3BQO A;  5ARG A;  2EIN E;  3S7B A;  2XEN A;  4FP7 A;  2FBN A;  4U96 D;  5CMY A;  4C48 B;  4G8K A;  3MKQ B;  4A1S A;  3TWT A;  4H7Y A;  3KEZ A;  3SFY A;  3EDT B;  5FIO A;  2UY1 B;  3CVW A;  4J8Y A;  3Q78 A;  2GRP B;  3CVX A;  1MZC A;  2LAH A;  1Z6T A;  4HRN A;  2X6H A;  4R7L A;  1PAQ A;  5HRY A;  1OWO A;  2KCK A;  3QAQ A;  4AP2 A;  4YDW A;  4NUR A;  2J09 A;  4PS8 A;  4DLO A;  5KJN A;  2YNQ A;  3OXG A;  5CBO A;  1H6K A;  3JCK C;  3Q9U C;  4ATG A;  2LSU A;  3HYM B;  3KEA A;  3APD A;  2KCL A;  4K5C A;  3RRU A;  5G04 J;  3ZIM A;  4B0Z A;  4K5A B;  3FTS A;  2VTB B;  4XEI G;  3LY8 A;  4U0Z A;  1N94 A;  2ZIS A;  2VJ8 A;  4GTM A;  4XKC A;  1UOH A;  4J8F A;  4JEU A;  4U8H A;  3VLF A;  4J8E A;  3PE4 A;  1OWN A;  1E8Y A;  3UIN C;  5FZR A;  3UIP C;  1D8D A;  5BV1 A;  2R03 A;  3QWW A;  4XI0 A;  2VTB A;  2PL2 A;  4GMJ A;  3ZYL A;  3G2T A;  1OCO E;  2XRZ A;  4Q96 A;  4J8D A;  4YDO A;  2ETC A;  5CEA A;  1UG3 A;  1G3N B;  2F8Y A;  2OND A;  4JPS A;  3CHM A;  1E8Z A;  2RD0 A;  5EIL A;  1JPL A;  4N5Q A;  1IYG A;  4LER A;  4Y6C A;  3L9T A;  3IXE A;  2DIW A;  1PC2 A;  4W9R A;  4EBA A;  3D9O A;  4GCN A;  4CYM D;  4CRW A;  4FHJ A;  1LD7 A;  3BG0 B;  4L2L A;  2IY0 C;  2XGS A;  2P2C P;  1UJJ A;  3Q49 B;  4GZ3 A;  4BEP A;  2LNI A;  3OAW A;  4HVB A;  2L0I A;  3HDX A;  2GRL A;  4DI4 A;  2L6B A;  5A23 A;  5ITZ F;  4GA2 A;  1N11 A;  3Q9N C;  2JLB A;  4GTQ A;  3DWL G;  3ZEF A;  2P9N G;  2WMN A;  1ZU2 A;  3IEG A;  1OY3 D;  3FUI A;  1HX8 A;  4KXK B;  2I2O A;  5EID A;  1ELW A;  3L54 A;  5EX3 A;  1H2T C;  3EHR A;  1TNY A;  3G2V A;  3FUM A;  2WPV A;  2J08 A;  3UM1 A;  3DBS A;  1OUV A;  3EHN A;  3LPZ A;  2XEE A;  4PH4 B;  3V79 K;  3VTY A;  2BUG A;  2WXG A;  3B7R L;  1KLX A;  2GRM A;  4LCT A;  4N5C A;  1H2V C;  2PNN A;  5KJL A;  2LAI A;  5C2Y A;  5ARF A;  4X8Q A;  3IHV A;  2VSO E;  1FVH A;  5KJK A;  3NF1 A;  2XHE A;  3S2A A;  2VSX E;  1RZ4 A;  1NL4 A;  2GGF A;  3ESK A;  2B6C A;  4HOU A;  2HYZ A;  3QWP A;  3DSV A;  3CVP A;  3V2O A;  5BUZ A;  3ULY A;  3QNK A;  5EDS A;  1SA5 A;  3G2S A;  3CST A;  3RIB A;  3NB2 A;  3RJV A;  2CFU A;  2J4D A;  4GYW A;  5EYL A;  4HOQ A;  3ONL A;  2H6I A;  2HM8 A;  5CMW A;  5HS0 A;  4I17 A;  4F53 A;  1EF1 C;  1TYQ G;  3Q7A A;  1RW2 A;  4HBD A;  3CVV A;  4JVS A;  3SD5 A;  3BEE A;  3NZS A;  1U3D A;  5EYP F;  4Q94 A;  3QB2 A;  3FTU A;  2P9S G;  3PUK A;  3OXF A;  4AJW A;  1NA0 A;  2VGY A;  3RK6 A;  4UI9 K;  4DRX E;  2VSN A;  2ETA A;  5D2M C;  5ENS D;  1L5J A;  3V30 A;  2PM7 A;  1NFI E;  1N0Q A;  1E7U A;  4JA7 A;  1MX6 A;  1SQM A;  2YHC A;  2I9C A;  2KZT B;  3JXJ A;  2Y4U A;  3JQ1 A;  5KWD A;  2XGM A;  1TNZ A;  4XE0 A;  4CDR A;  1QNF A;  4ZFH A;  1SZA A;  4F3V A;  1V54 E;  3CVL A;  1H6P A;  3QK0 A;  2ETB A;  2H6H A;  4MLP A;  3D9K A;  3AG2 E;  5FQ7 A;  5B3S E;  3X2Q E;  3B7T A;  3CVY A;  3SFX A;  5JJ7 A;  2GRQ B;  2ION A;  1H19 A;  3KD7 A;  3EU5 A;  3CKB A;  2UY1 A;  5AIJ A;  3LKU A;  3CVQ A;  4AVX A;  5H7P A;  3L13 A;  4MKT A;  4GML A;  4KT6 B;  1TNU A;  4TRQ A;  3ZXP A;  3D9J A;  1SVX A;  1N4R A;  3KAE A;  3RRN B;  3W9G A;  3D9M A;  5FQ4 A;  3R9M A;  3HXB A;  4CT0 A;  1KT0 A;  4APO A;  2P9P G;  1MQS A;  4HOR A;  4L23 A;  5DIZ A;  4K0R A;  5EKQ D;  4AM9 A;  3D9I A;  1U2V G;  3JYS A;  4HQD A;  3D9H A;  3FP3 A;  3S7D A;  3DSS A;  5JA4 D;  4UQZ A;  4GYY A;  3DEO A;  4N3C A;  4ABN A;  5KBA A;  1LF8 A;  3DSU A;  1JWG A;  5E76 A;  5T4Y A;  3CLJ A;  3PEV B;  2B0O E;  2AJA A;  3O48 A;  4QQI A;  2LXM A;  2QZA A;  2NXP A;  2C0M A;  3U4T A;  3LY9 A;  3TJP A;  3AG4 E;  2WXM A;  1TEZ A;  3HXF A;  4Y6W A;  2WXO A;  4ME2 A;  2OEW A;  5G55 A;  2J49 A;  5HQ8 A;  3PRZ A;  1N9A A;  1E8W A;  1V55 E;  4HI8 A;  3UPV A;  3ZYQ A;  3T5X A;  1NI1 A;  5ANL A;  1OXJ A;  5G2N A;  1WG0 A;  4P29 A;  2XZT G;  3FUF A;  4FA6 A;  2X6I A;  3NBN B;  2NSZ A;  4FLB A;  2NC9 A;  2XRY A;  2J4B A;  5LP0 A;  4G26 A;  2A5E A;  1HG2 A;  4A63 B;  2KXP C;  5LX8 A;  4LSZ E;  5HKP A;  4HLL A;  3FTV A;  5BPP A;  2IEJ A;  3ULE G;  4URK A;  5BNW A;  4RG9 A;  5FJY A;  4EQF A;  1N4Q A;  3FH5 A;  3GZS A;  3HXE A;  5EN5 D;  4JEH A;  1S0P A;  2PQR A;  3UI2 A;  4JHJ A;  3ZUV B;  2QYU A;  3AJI A;  4HLE A;  4EEC A;  3PDN A;  2FO7 A;  3CIA A;  4BFR A;  4HB5 A;  4J6I A;  4HS2 A;  2R5S A;  3LJ3 A;  4BES A;  4A55 A;  4GCO A;  3PZ1 A;  1A17 A;  1FCH A;  3AAA C;  2DZN A;  3Q5M A;  5A7D B;  2KM4 A;  4F1S A;  1MYO A;  1O1R A;  1IKN D;  4KZC A;  3SBT B;  2LXL A;  4O1P A;  2WQ7 A;  1S63 A;  3MJW A;  4CEM A;  4AXH A;  4D10 C;  3IBE A;  5JMN D;  4Z68 A;  1N0R A;  3NAW A;  2PQN A;  4AOF A;  4GTO A;  2X6F A;  2WXH A;  4L1B A;  2IO2 C;  1KZO A;  3FUN A;  3KSL A;  4AV7 A;  3QKY A;  4C0M A;  2RFM A;  5ANR A;  1WAO 1;  4JHR A;  3FUL A;  3Q47 B;  2E2E A;  4BX9 A;  4FU3 A;  4DX6 D;  4WAF A;  3B7U X;  4GZC A;  2WB2 A;  3ASO E;  2NYJ A;  1TN6 A;  1NZN A;  3KS2 A;  1HF8 A;  5AJL A;  2VGX A;  4U8Y D;  3ONK A;  5ENQ D;  3DST A;  2V4H C;  4GTV A;  2H6G A;  4ATZ D;  5FZS A;  4DJA A;  1E8X A;  3PS6 A;  1HG5 A;  5CRV A;  4B93 B;  1B89 A;  1INZ A;  3PVL A;  3ZYK A;  2FI7 A;  1KPS B;  2XQ0 A;  3EIQ C;  2MHK A;  3MYV A;  4GTS A;  2C2L A;  1UW4 B;  5BV0 A;  4YDY A;  3QC1 A;  4IYP A;  4B8C B;  2X3M A;  4BT8 A;  4G8L A;  1UN9 A;  1BU9 A;  3TL5 A;  5EX0 A;  3CSF A;  3ZW3 A;  3O4Z A;  4OVV A;  3EIJ A;  4I6E A;  2KBX A;  3UKU G;  2CHX A;  4B94 A;  3SNX A;  2XPI A;  3C72 A;  3E34 A;  5JJT A;  3SQV A;  4N2Q A;  4PS7 A;  4HFG A;  1OWL A;  2ZGG A;  4J8S A;  5AEN A;  1P5Q A;  3FEX A;  3E32 A;  3KSQ A;  3R7R A;  2CHW A;  4WNF A;  2F0Y A;  3T8M A;  2BKG A;  3FTX A;  2FF4 A;  1MX4 A;  2H6F A;  3HXD A;  3ULQ A;  3T9K A;  4TUM A;  2KCV A;  5T3R A;  5T8I A;  4JXT A;  3V31 A;  3FU6 A;  5G04 C;  3IKO B;  3L08 A;  4I6J A;  5LFA A;  3AS4 A;  4KVO A;  3ISM C;  3D9L A;  5CBN A;  4ILG A;  3LVR E;  3CHQ A;  4RSY A;  5JJ6 A;  1IQR A;  1QZ2 A;  3TWU A;  3JQ0 A;  3D9N A;  2KAT A;  2XCC A;  3CQG B;  3QDN A;  2A5U A;  1TJF A;  2CHZ A;  1DCE A;  4PDX A;  2VGX B;  3MV3 B;  5M72 A;  4RVB A;  3FUH A;  4DLQ A;  3UX4 A;  2AXZ A;  1YYH A;  2DBA A;  1Z5S C;  1UN8 A;  2CG2 A;  1QQE A;  3CHS A;  2V4L A;  4CT4 A;  2QY7 A;  3S7J A;  1AP7 A;  5FZQ A;  4U04 A;  2P9K G;  3CEQ A;  4GYO A;  3ENE A;  2M63 A;  5CER B;  5BW8 C;  2BED A;  2OCC E;  1HO8 A;  4TXR A;  2GW1 A;  2WXI A;  2WQ6 A;  1FT2 A;  1H2U A;  3L17 A;  4ACK A;  5BT1 A;  1FVF A;  3QWV A;  1O1S A;  3TWR A;  2FO1 E;  1BI8 B;  3D9P A;  2Y3A A;  1PY1 A;  2WXN A;  4EBA G;  5LCW J;  4FLH A;  5D0Q D;  3R9A B;  4UQX A;  2KZT A;  4JZY A;  1EPU A;  1Z3Y A;  4NIK A;  3HVE B;  2HE0 A;  3PE3 A;  3SY2 A;  1TN7 A;  5KNG A;  2A4Z A;  3LDZ A;  3LJN A;  5DBK A;  2QFC A;  4L9P A;  1IXV A;  3F6Q A;  4FC8 A;  4YDE A;  3UT7 A;  4ANV A;  4XIF A;  2P9L G;  3DXK G;  3BG1 B;  1MX2 A;  4KZ0 A;  1FPP A;  3Q15 A;  5FT9 A;  4YVO A;  3K9I A;  1IQU A;  2DYR E;  5CCL A;  4XZ4 A;  2J9Q A;  3IV0 A;  3OTN A;  4C9B B;  4UQY A;  4U95 D;  5ENT D;  4YND A;  2XS1 A;  4G1T A;  5KCM A;  3TXM A;  4LEU A;  4WNG A;  3PNT B;  5AQB A;  3ASG A;  3TWQ A;  3UIO C;  3HRA A;  4M7C A;  1K8K G;  2DVW A;  5ENR D;  3UT8 A;  4OAV B;  3MCX A;  2XCB A;  4ILI A;  4U63 A;  4IN3 B;  5AN8 A;  2BF0 X;  3ZHE A;  2Y4T A;  2X6K A;  3SBS A;  4BSX A;  2GRN B;  3FU0 A;  3PUJ A;  3U64 A;  1DNP A;  4XKB A;  1WY6 A;  1XNF A;  2BTD A;  4LNU D;  4RLY A;  4UI9 J;  3LYA A;  5CEC B;  3ZRH A;  4JL0 A;  4U07 A;  4UI9 C;  4K5B A;  4CZ2 D;  4WWP A;  4DX2 A;  2EQX A;  5ENN A;  5LOZ A;  2XEV A;  4CDM A;  4LNG A;  3FUE A;  2LSV A;  4QFV A;  3ZKJ A;  3HXC A;  2IOS A;  2WXJ A;  4CDN A;  4I1A A;  4WNE A;  1OCZ E;  2MOW A;  4WUY A;  5FQ6 A;  2P58 C;  4JB8 P;  2J8S D;  2VYI A;  1N4P A;  2XGO A;  3J5P A;  3ZYM A;  2Y69 E;  5JHA A;  3ZU7 B;  4M3O A;  2XEH A;  4J7W A;  4G23 A;  4L2Y A;  1N54 A;  4NQ0 A;  3HG0 D;  1Y6I A;  3RKV A;  1FT1 A;  4LNB A;  5BXO A;  5A6C A;  4I9E A;  4ZHB A;  3APF A;  3FDH A;  5E75 A;  3JUI A;  4YVQ C;  3P1U A;  4I1O B;  3ZVV A;  4KVM A;  4V3I A;  3D3M A;  3ZN3 A;  2PM6 A;  3I5P A;  1QYM A;  3LXU X;  2ZXW E;  4JA9 A;  3UM0 A;  3RSE G;  4WWN A;  4AY5 A;  4GA0 A;  3B7S A;  3ZGQ A;  1DC2 A;  3I4G A;  2IF4 A;  2EIK E;  3PNL B;  2WMO A;  1OT8 A;  3TWV A;  3BUA A;  1N4S A;  2I1J A;  1OWM A;  1TJC A;  3PZ3 A;  4BY6 A;  5B1B E;  2ZIR A;  1Q2Z A;  2XS8 A;  2IJG X;  4HOS A;  3CR3 A;  3B13 A;  5CRU A;  3MEK A;  2VQ2 A;  4E85 A;  3TWW A;  1YMP A;  4U8V D;  4XI9 A;  3Q7F A;  4J0U A;  3FTW A;  1A5E A;  4FAD A;  2L9B A;  2GRO B;  4F6R D;  3AS8 A;  3QAR A;  3EHQ A;  4UWK A;  3R7Q A;  2GRR B;  3C5R A;  2WXR A;  1EYH A;  3ZHE B;  1BD8 A;  4G2V A;  3I3N A;  3CHP A;  3ZXS A;  3EU9 A;  3P2B A;  5AAR A;  1SW6 A;  3AG3 E;  3DEP A;  3PZ2 A;  3FH7 A;  3TWX A;  5B1A E;  2LUH A;  5D66 A;  1UJK A;  1O5M A;  3G2W A;  5FQ8 A;  4PUC A;  2IFU A;  2L0T B;  4DX7 D;  5CED B;  3J5Q B;  3CK9 A;  2IU1 A;  3FUD A;  2XPZ A;  2HR2 A;  4HOT A;  3RU0 A;  2RKK A;  1KT1 A;  3ABL E;  1O1T A;  4UUC A;  5FIN A;  3TG4 A;  5LCW C;  2WXF A;  3CGH A;  5AQA A;  1QBQ A;  4I43 A;  1LD8 A;  1DCQ A;  3MGB A;  2L6J A;  1S64 A;  1SZ9 A;  4GAA A;  4UWL A;  3ML9 A;  3ABM E;  2OEV A;  3FH8 A;  1XGW A;  1N52 A;  4CCA A;  2ILR A;  3L16 A;  3CQC B;  1D8E A;  4LUN U;  1E7V A;  3E4B A;  4MRU A;  3C98 A;  4I2Z A;  4GTT A;  3ASH A;  4BSZ B;  3AG1 E;  1K3Z D;  3C3R A;  3DSX A;  4G25 A;  4UWG A;  3GYZ A;  4O6F A;  4BTA A;  3WXX A;  3BU8 A;  3NOC D;  3DPD A;  4U7E B;  4I1M A;  2J07 A;  4JC8 A;  2F8X K;  3MKR A;  4GZ6 A;  4LG6 A;  5JHB A;  4EPZ A;  3E37 A;  3C3O A;  2X6J A;  2WM9 A;  3G2U A;  2R2L A;  2V5F A;  4ANX A;  1ELR A;  4DX5 D;  1MJ0 A;  3AU4 A;  3DRA A;  2XPY A;  2E0I A;  5AQ7 A;  2Y0B G;  4GMR A;  3FTZ A;  3UUX A;  3NOG D;  3CVN A;  1LTX A;  2WQH A;  3AU5 A;  4HRM B;  3EHM A;  3RRM B;  3TWS A;  4LRZ A;  4CGV A;  1ZBP A;  4F7A A;  3NZU A;  2OVF A;  3C3Q A;  3SF4 A;  2DYS E;  2OOE A;  1JCQ A;  1NP7 A;  4H7X A;  3PZD A;  4OAU C;  5BXU A;  1OCR E;  1Z3X A;  3Q73 A;  2QYJ A;  4TXP A;  4I2W A;  4DI3 A;  2R17 C;  2WXP A;  3VTX A;  1K1B A;  4BET A;  1HU3 A;  3PEU B;  2V5Q C;  1JCR A;  3B95 A;  3SGH A;  5AQ9 A;  3FU3 A;  4BT9 A;  3UKR G;  3UQ3 A;  3FFL A;  2BKK B;  4O1O A;  2HO1 A;  2P9I G;  2RG8 A;  2EIM E;  3LY7 A;  3TGO A;  3ZPJ A;  3CHO A;  5EIB E;  3N71 A;  4FHK A;  4MS6 A;  2X38 A;  2Q7F A;  4IUL A;  3DPY A;  3PH0 C;  3EJN A;  5G05 C;  3HVE A;  4G24 A;  4GPM A;  4B8A A;  3GZ1 A;  2RFA A;  2DZO A;  1U3C A;  3U9W A;  4TUU A;  3CK8 A;  3FWV A;  4FJY A;  4BWR A;  1JCS A;  3Q4A B;  3UXG A;  4IRU A;  3LCA A;  3EUV A;  4JHK A;  4CGW A;  2LO6 A;  3T5V A;  3T8K A;  1YCS B;  4B89 A;  3PZ4 A;  1KZP A;  4KBQ A;  4F1P A;  4AEZ C;  3ESL A;  1TNB A;  1TNO A;  5KJM A;  5CHE E;  1ZB1 A;  5J90 A;  1HE8 A;  4U0U A;  3Q79 A;  5AAO A;  1HH8 A;  3RAU A;  2AXV A;  3ML8 A;  3S7F A;  5CCM A;  4A1G A;  3UM2 A;  3OXL A;  4ANU A;  1IHB A;  3FUK A;  2VGE A;  1BPO A;  2P9U G;  4EZK A;  4HXI A;  3CK7 A;  3UMV A;  3Q75 A;  4OVU A;  1HS6 A;  5D0O D;  3L22 A;  4L7T A;  2IOL A;  4GTR A;  4GZ5 A;  3MKQ A;  4ANW A;  2FUL A;  4I6G A;  3RO2 A;  2R05 A;  1HFA A;  4DPR A;  2JAB A;  3SZ7 A;  5HI7 A;  1EDU A;  3LEW A;  3E30 A;  4HI9 A;  2EIJ E;  4FUL A;  4O60 A;  1BLX B;  4UWH A;  3MX3 A;  4GPK A;  2ZGD A;  2KC7 A;  3L82 A;  2WXL A;  2OVB A;  3URZ A;  2YIN A;  4GU5 A;  1NA3 A;  5AYW D;  3VLE A;  3HHM A;  3UM3 A;  3SFZ A;  4WND A;  2AXU A;  1N95 A;  4EHM A;  4AY6 A;  3TXN A;  5KNH D;  1JWF A;  4BX8 A;  1OWP A;  5FTP A;  1E90 A;  2DCP A;  4AIF A;  4DX1 A;  3MA5 A;  3NQP A;  3JXI A;  1W3B A;  3TAX A;  3SI5 A;  5J08 A;  1K1A A;  1X81 A;  4KYO B;  3L6A A;  4KMO A;  4PS3 A;  4WWO A;  3ASD A;  5C1D A;  1IHG A;  1OCC E;  1HZ4 A;  2IQC A;  4OYS A;  1AWC B;  1JUQ A;  4DUI A;  4I9C A; 
#chains in the Genus database with same CATH homology
 2UWJ G;  4FAD A;  2GGF A;  2L9B A;  3ESK A;  4NRH B;  2WXK A;  4BT8 A;  2FEZ A;  4HOU A;  2HYZ A;  3AS8 A;  3QAR A;  3QWP A;  4DK5 A;  1UN9 A;  3ASF A;  4JW1 A;  4UWK A;  3CVP A;  4N2S A;  3R7Q A;  5BUZ A;  2WXR A;  3QNK A;  5EDS A;  3TL5 A;  1EYH A;  5EX0 A;  3CSF A;  3ZHE B;  3G2S A;  3ZW3 A;  3CST A;  3GZ2 A;  2MRI A;  3O4Z A;  3EIJ A;  3I3N A;  4G2V A;  4OVV A;  3RIB A;  4GZD A;  2ZU6 B;  3RJV A;  4BTB A;  4I6E A;  2CHX A;  2CFU A;  2V8S E;  4EZJ A;  3CV0 A;  4B94 A;  3CHP A;  4E6H A;  3ZXS A;  3SNX A;  2XPI A;  3P2B A;  2J4D A;  4GYW A;  4HOQ A;  3ONL A;  2HM8 A;  5CMW A;  5JJT A;  1HXI A;  4I17 A;  4GB9 A;  4F53 A;  1GW6 A;  1EF1 C;  2CG3 A;  4N2Q A;  3LVQ E;  4PS7 A;  4TV3 A;  4APF A;  3FH7 A;  3FUJ A;  4HFG A;  5FWQ A;  1OWL A;  3CVV A;  1UJK A;  4A3T A;  4JVS A;  3SD5 A;  3BEE A;  3NZS A;  1U3D A;  4J8S A;  3G2W A;  4Q94 A;  5AEN A;  1P5Q A;  3FEX A;  4PUC A;  5FQ8 A;  3QB2 A;  2IFU A;  1X5B A;  3FTU A;  2L0T B;  3HIZ A;  3PUK A;  3OXF A;  3R7R A;  2CHW A;  1H0A A;  4WNF A;  3CK9 A;  3T8M A;  4AJW A;  3U3W A;  2IU1 A;  3AS5 A;  3FTX A;  2FF4 A;  1NA0 A;  5G05 J;  2VGY A;  3RK6 A;  3FUD A;  4UI9 K;  2AW6 A;  2XPZ A;  4RG6 A;  2HR2 A;  4HOT A;  2VSN A;  3RU0 A;  1KT1 A;  3CKC A;  3ULQ A;  1L5J A;  4U0S A;  2PM7 A;  4C0E A;  3TG4 A;  2AVP A;  2OV8 A;  2KCV A;  5LCW C;  3FEY A;  3FY4 A;  1E7U A;  2WXF A;  3CGH A;  3FHE A;  4N3B A;  4JA7 A;  5T3R A;  5T8I A;  3UT4 A;  1SQM A;  2YHC A;  4JXT A;  2I9C A;  3FU6 A;  4I43 A;  2KZT B;  3APC A;  3IKO B;  5G04 C;  3L08 A;  2V0P A;  2WVI A;  4I6J A;  3MGB A;  3SHF A;  2Y4U A;  2L6J A;  4FJZ A;  1SZ9 A;  1Y8M A;  3JQ1 A;  3PRE A;  4GAA A;  4UWL A;  2XGM A;  3GW4 A;  3ML9 A;  4N3A A;  3AS4 A;  4KVO A;  5LFA A;  3D9L A;  2I1K A;  4XE0 A;  4CDR A;  4N39 A;  3FH8 A;  3IHY A;  1QNF A;  4ILG A;  1SZA A;  2C0L A;  1WM5 A;  1XGW A;  4F3V A;  3CVL A;  1N52 A;  4CCA A;  3LVR E;  3QK0 A;  2ILR A;  4MLP A;  4A3V A;  3D9K A;  3CHQ A;  3FTY A;  3L16 A;  3QJZ A;  4RSY A;  4NAC A;  3FU5 A;  5FQ7 A;  3TG5 A;  5JJ6 A;  1IQR A;  3CQC B;  3CVU A;  4LUN U;  2WXQ A;  3B7T A;  1QZ2 A;  3CVY A;  1E7V A;  3E4B A;  4ILH B;  4MRU A;  3C98 A;  2VSY A;  4I2Z A;  3JQ0 A;  3D9N A;  5JJ7 A;  2ION A;  3ASH A;  2KAT A;  2XCC A;  1H19 A;  3KD7 A;  4ACL A;  3CKB A;  3CQG B;  2UY1 A;  3QDN A;  4G25 A;  4UWG A;  5AIJ A;  3LKU A;  3CVQ A;  4AVX A;  3GYZ A;  2A5U A;  3L13 A;  4MKT A;  4O6F A;  1TJF A;  4BTA A;  3WXX A;  4GML A;  1YA0 A;  2CHZ A;  3LS8 A;  4PDX A;  4KT6 B;  3DPD A;  2R59 A;  2VGX B;  3MV3 B;  5M72 A;  4TRQ A;  4I1M A;  2J07 A;  4JC8 A;  4RVB A;  3D9J A;  3MKR A;  2I6H A;  4GZ6 A;  5JHB A;  4EPZ A;  3U66 A;  3FUH A;  4DLQ A;  4K03 A;  3UX4 A;  2AXZ A;  2X6J A;  2AWI A;  2PZI A;  2WM9 A;  4Q69 A;  2DBA A;  3G2U A;  3KAE A;  1UN8 A;  3RRN B;  3D9M A;  1DVP A;  5FQ4 A;  2CG2 A;  4CT0 A;  2V5F A;  4GA1 A;  4ANX A;  1ELR A;  4G11 A;  3VLD A;  3AU4 A;  3QOU A;  1QQE A;  3CHS A;  1KT0 A;  4APO A;  2V4L A;  1MHQ A;  3I4R B;  5AJD A;  1VDY A;  2XPY A;  2E0I A;  1MQS A;  4HOR A;  2CFZ A;  4L23 A;  5DIZ A;  4CT4 A;  3RO3 A;  2QY7 A;  2YQ8 A;  3CHR A;  2YHE A;  4K0R A;  2JEK A;  3D9I A;  3FTZ A;  3MV2 B;  5EKQ D;  3S7J A;  4UWF A;  4AM9 A;  3JYS A;  3ZFW A;  5FZQ A;  3UUX A;  3FP3 A;  4U04 A;  3S7D A;  3CVN A;  3MZL B;  1ELK A;  2WQH A;  3CEQ A;  3AU5 A;  1E96 B;  4UQZ A;  3EHM A;  4GYO A;  3RRM B;  4XX5 A;  4GYY A;  3ENE A;  5ARG A;  4N3C A;  4ABN A;  2M63 A;  4LRZ A;  5BW8 C;  3S7B A;  4CGV A;  1HO8 A;  1LF8 A;  1ZBP A;  4FP7 A;  2FBN A;  2GW1 A;  2WXI A;  1JWG A;  5CMY A;  5E76 A;  4F7A A;  5T4Y A;  3CLJ A;  3NZU A;  3PEV B;  2WQ6 A;  1H2U A;  3MKQ B;  4A1S A;  2OVF A;  3L17 A;  3O48 A;  4H7Y A;  3KEZ A;  3SF4 A;  4ACK A;  2OOE A;  1NP7 A;  4H7X A;  5BT1 A;  3EDT B;  1FVF A;  2UY1 B;  2NXP A;  3QWV A;  3CVW A;  2C0M A;  3U4T A;  3PZD A;  3CVX A;  3D9P A;  3LY9 A;  2Y3A A;  1PY1 A;  2LAH A;  1Z6T A;  3TJP A;  2WXN A;  1Z3X A;  4EBA G;  5LCW J;  2X6H A;  4FLH A;  1PAQ A;  4R7L A;  2WXM A;  1TEZ A;  5D0Q D;  4I2W A;  4Y6W A;  2WXO A;  4ME2 A;  4DI3 A;  1OWO A;  2R17 C;  2WXP A;  5G55 A;  3R9A B;  2KCK A;  4UQX A;  2KZT A;  3QAQ A;  4JZY A;  3VTX A;  4AP2 A;  1EPU A;  1Z3Y A;  2J49 A;  1HU3 A;  4NUR A;  2J09 A;  3PEU B;  4PS8 A;  5HQ8 A;  3PRZ A;  3HVE B;  4DLO A;  5KJN A;  1E8W A;  3SGH A;  3UPV A;  3PE3 A;  3ZYQ A;  3T5X A;  3FU3 A;  2YNQ A;  4BT9 A;  3OXG A;  2A4Z A;  5ANL A;  3LDZ A;  5G2N A;  1H6K A;  3JCK C;  5DBK A;  3UQ3 A;  2QFC A;  4P29 A;  4ATG A;  2LSU A;  3FUF A;  3FFL A;  3HYM B;  4FA6 A;  3APD A;  2HO1 A;  4FC8 A;  2X6I A;  3UT7 A;  4ANV A;  2RG8 A;  2KCL A;  2NSZ A;  4XIF A;  3LY7 A;  4FLB A;  2NC9 A;  3ZPJ A;  3TGO A;  3RRU A;  2XRY A;  5G04 J;  2J4B A;  3ZIM A;  4B0Z A;  3CHO A;  5LP0 A;  3FTS A;  3N71 A;  3BG1 B;  4G26 A;  2VTB B;  4FHK A;  4KZ0 A;  4MS6 A;  2X38 A;  3LY8 A;  1HG2 A;  3Q15 A;  5FT9 A;  4YVO A;  5LX8 A;  2Q7F A;  3K9I A;  4IUL A;  1IQU A;  4U0Z A;  3FTV A;  5CCL A;  4XZ4 A;  5BPP A;  3PH0 C;  2J9Q A;  3IV0 A;  3OTN A;  2VJ8 A;  4XKC A;  4C9B B;  4UQY A;  4J8F A;  4JEU A;  3EJN A;  4U8H A;  4YND A;  5BNW A;  4URK A;  5G05 C;  3HVE A;  3VLF A;  4J8E A;  3PE4 A;  1OWN A;  4RG9 A;  4G24 A;  5FJY A;  4B8A A;  1E8Y A;  4G1T A;  5KCM A;  3GZ1 A;  3TXM A;  4EQF A;  4LEU A;  1U3C A;  3FH5 A;  4WNG A;  3U9W A;  5FZR A;  3GZS A;  3PNT B;  3ASG A;  5BV1 A;  4TUU A;  3CK8 A;  3FWV A;  3QWW A;  4FJY A;  4XI0 A;  2VTB A;  3UT8 A;  4JEH A;  1S0P A;  2PQR A;  4BWR A;  2PL2 A;  4GMJ A;  3ZYL A;  3G2T A;  3MCX A;  2XRZ A;  4JHJ A;  2XCB A;  4Q96 A;  4J8D A;  3Q4A B;  4ILI A;  4IRU A;  3LCA A;  4HLE A;  4U63 A;  4EEC A;  4IN3 B;  4JHK A;  1UG3 A;  4CGW A;  2OND A;  3PDN A;  4JPS A;  2LO6 A;  3T5V A;  2FO7 A;  2BF0 X;  3ZHE A;  3CHM A;  2Y4T A;  2X6K A;  3CIA A;  3SBS A;  4BFR A;  1E8Z A;  4BSX A;  4J6I A;  2RD0 A;  4HS2 A;  3FU0 A;  4B89 A;  1JPL A;  2R5S A;  3PUJ A;  3U64 A;  1DNP A;  4LER A;  4Y6C A;  1IYG A;  3LJ3 A;  4XKB A;  1WY6 A;  4A55 A;  4KBQ A;  4GCO A;  1XNF A;  2BTD A;  4AEZ C;  3ESL A;  2DIW A;  1PC2 A;  1A17 A;  4W9R A;  4EBA A;  4UI9 J;  3LYA A;  5KJM A;  5CHE E;  3D9O A;  5J90 A;  1FCH A;  1HE8 A;  3Q5M A;  4U0U A;  4GCN A;  5A7D B;  2KM4 A;  4F1S A;  1HH8 A;  3ZRH A;  2AXV A;  3ML8 A;  4JL0 A;  3S7F A;  5CCM A;  4U07 A;  4UI9 C;  4A1G A;  4CRW A;  4FHJ A;  4KZC A;  4WWP A;  3OXL A;  3BG0 B;  4ANU A;  2EQX A;  4L2L A;  5ENN A;  3SBT B;  2XGS A;  5LOZ A;  3FUK A;  1BPO A;  2XEV A;  4CDM A;  1UJJ A;  2WQ7 A;  3FUE A;  2LSV A;  4EZK A;  4HXI A;  3CK7 A;  3Q49 B;  4QFV A;  4GZ3 A;  2LNI A;  3UMV A;  3MJW A;  4CEM A;  2IOS A;  4OVU A;  1HS6 A;  2WXJ A;  4AXH A;  4I1A A;  4WNE A;  5D0O D;  4CDN A;  3OAW A;  3IBE A;  4D10 C;  3L22 A;  4L7T A;  2MOW A;  2IOL A;  4HVB A;  4GZ5 A;  4WUY A;  5FQ6 A;  2L0I A;  3MKQ A;  2P58 C;  3HDX A;  4ANW A;  2GRL A;  4DI4 A;  2VYI A;  2PQN A;  2FUL A;  4AOF A;  2XGO A;  4I6G A;  3RO2 A;  5A23 A;  3ZYM A;  1HFA A;  4DPR A;  5JHA A;  4M3O A;  3SZ7 A;  4GA2 A;  5HI7 A;  2X6F A;  1EDU A;  2WXH A;  3LEW A;  4G23 A;  4L1B A;  4L2Y A;  1N54 A;  2JLB A;  4NQ0 A;  4FUL A;  1Y6I A;  3ZEF A;  4UWH A;  3RKV A;  3MX3 A;  3FUN A;  4GPK A;  5A6C A;  4I9E A;  4AV7 A;  3QKY A;  4C0M A;  2WMN A;  1ZU2 A;  3APF A;  5ANR A;  2KC7 A;  3FDH A;  1WAO 1;  3IEG A;  3FUL A;  4JHR A;  5E75 A;  3JUI A;  4YVQ C;  3P1U A;  3Q47 B;  2E2E A;  3FUI A;  4BX9 A;  2WXL A;  4I1O B;  2OVB A;  1HX8 A;  3URZ A;  2YIN A;  4KXK B;  2I2O A;  4FU3 A;  4WAF A;  4GU5 A;  1NA3 A;  5AYW D;  1ELW A;  3L54 A;  5EX3 A;  3ZVV A;  4KVM A;  4V3I A;  3B7U X;  3D3M A;  3VLE A;  3ZN3 A;  3HHM A;  4GZC A;  2PM6 A;  3I5P A;  4EZL A;  1H2T C;  2WB2 A;  3G2V A;  3FUM A;  2WPV A;  3LXU X;  4JA9 A;  3SFZ A;  4WND A;  2AXU A;  1NZN A;  2J08 A;  3KS2 A;  1HF8 A;  5AJL A;  2VGX A;  4AY6 A;  3TXN A;  4WWN A;  1JWF A;  4AY5 A;  4BX8 A;  3ONK A;  3DBS A;  1OWP A;  4GA0 A;  1OUV A;  3B7S A;  3EHN A;  3LPZ A;  4PH4 B;  5FTP A;  3ZGQ A;  1E90 A;  3I4G A;  2DCP A;  4AIF A;  2IF4 A;  5FZS A;  3MA5 A;  3VTY A;  4DJA A;  3NQP A;  1W3B A;  2BUG A;  2WXG A;  3PNL B;  1E8X A;  3B7R L;  2WMO A;  1KLX A;  3TAX A;  2GRM A;  3PS6 A;  1HG5 A;  4LCT A;  3SI5 A;  5J08 A;  4KYO B;  4N5C A;  2I1J A;  3L6A A;  1H2V C;  1OWM A;  1B89 A;  1TJC A;  1INZ A;  4BY6 A;  3PVL A;  3ZYK A;  5KJL A;  4KMO A;  4PS3 A;  2FI7 A;  2IJG X;  4WWO A;  4HOS A;  2XQ0 A;  2LAI A;  3B13 A;  3CR3 A;  3ASD A;  5ARF A;  5C2Y A;  5C1D A;  1IHG A;  3IHV A;  1HZ4 A;  3EIQ C;  2VSO E;  1FVH A;  2MHK A;  3MEK A;  2VQ2 A;  4E85 A;  3MYV A;  2IQC A;  4OYS A;  2C2L A;  1UW4 B;  5BV0 A;  5KJK A;  3QC1 A;  4XI9 A;  3NF1 A;  2XHE A;  4IYP A;  2VSX E;  1JUQ A;  3S2A A;  4B8C B;  4I9C A;  4J0U A;  3FTW A;  2X3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...