4KYOB

Alanine-glyoxylate aminotransferase variant k390a in complex with the tpr domain of human pex5p
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
315
structure length
286
Chain Sequence
QFEEENPLRDHPQPFEEGLRRLQEGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACETLRDWLRYTPAYAHLVDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFGLPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transport protein
molecule keywords Serine-pyruvate aminotransferase
publication title Ligand-Induced Compaction of the PEX5 Receptor-Binding Cavity Impacts Protein Import Efficiency into Peroxisomes.
pubmed doi rcsb
source organism Homo sapiens
total genus 115
structure length 286
sequence length 315
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13181 TPR_8 Tetratricopeptide repeat
B PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4kyoB00
4JA7A 2PQNA 4HOQA 3AS5A 4AY5A 5CCMA 5FZQA 3PDNA 2LNIA 3LPZA 3JYSA 5KJKA 2XEVA 3SZ7A 1A17A 3KAEA 4AY6A 3PE3A 2FF4A 4G25A 3CVLA 4HOSA 2VQ2A 3QWWA 2XGOA 3OXGA 1NA3A 4XIFA 3ZN3A 3TAXA 3RU0A 2V5FA 5G05J 5A7DB 5JJ7A 4W9RA 4KYOB 2VGXA 3OXLA 3VTYA 3ZPJA 1Y8MA 5LCWJ 3UUXA 3CKBA 2XCCA 4GCNA 3ASDA 2C2LA 5C1DA 3TG5A 1KT0A 5BNWA 2J9QA 4WNFA 3S7JA 2FO7A 3QDNA 2P58C 2KCVA 4GCOA 4UI9K 5D0OD 5ARFA 5KJNA 4KXKB 3U3WA 3LYAA 4ABNA 3LKUA 1FCHA 4WNDA 3ESKA 4H7YA 3FFLA 4I2WA 3RO2A 3S7DA 4EQFA 4JL0A 5KJMA 4UI9J 2FBNA 4I17A 3NF1A 4GA1A 3GW4A 4YVQC 5JJ6A 2FI7A 5AYWD 3ZHEB 4BTBA 2KCLA 3FP3A 5DIZA 2DBAA 5HI7A 2LSUA 3RKVA 3QWPA 4O6FA 3TG4A 3MA5A 4GPKA 3EDTB 3ASHA 1TJCA 4N5CA 4LEUA 3E4BA 4A1SA 5FTPA 4G1TA 3Q5MA 4GYWA 4AIFA 1B89A 3KS2A 2KATA 4WUYA 1ELWA 2VSNA 4N3AA 2JLBA 2Y4TA 3CK9A 4U0UA 4N2QA 5D0QD 4U0ZA 2PL2A 3IEGA 3GZ2A 1NA0A 3ZFWA 4G26A 3CEQA 4UQXA 3AS4A 3MKRA 4Y6WA 3WXXA 3CK7A 5EX0A 4HOTA 2BUGA 1XNFA 1HXIA 4ME2A 3LY7A 4GYOA 4G2VA 2L6JA 3VTXA 5FJYA 2QFCA 4AM9A 3QOUA 2C0LA 2VYIA 3RO3A 1ZU2A 1P5QA 2KCKA 2WQHA 3OXFA 4BT8A 3Q47B 5FT9A 4N39A 2XGSA 1IHGA 3R9AB 4YNDA 5G04C 1KLXA 3ASFA 3RIBA 2VGYA 3U4TA 3Q49B 1E96B 2YQ8A 4CGVA 5LCWC 2IF4A 3ZHEA 4XI9A 3LCAA 2FEZA 4J0UA 4N3CA 4JHRA 4N3BA 4BTAA 2XPIA 2HR2A 4UQZA 5BW8C 1W3BA 4GA0A 3CKCA 2MHKA 5JJTA 4Y6CA 1YA0A 2PZIA 4BWRA 2LSVA 5HQ8A 3LY9A 5EKQD 3Q4AB 4NQ0A 4GZ3A 2NC9A 3CVPA 3CVNA 4RG6A 4UI9C 2R5SA 2UY1B 3HYMB 4HOUA 3AS8A 5FZRA 3GZ1A 4J8EA 2GW1A 3MV3B 4H7XA 4YVOA 2XCBA 2VSYA 5CHEE 4G24A 2XGMA 5CCLA 2Y4UA 5DBKA 3ASGA 1HZ4A 3TGOA 3CV0A 1KT1A 2HYZA 2C0MA 1WAO1 2PQRA 2OOEA 3MEKA 3QKYA 3O48A 1ZBPA 4UQYA 4APOA 3PE4A 3ULQA 1QQEA 2AVPA 2IFUA 4WNEA 3KD7A 1OUVA 4F3VA 2ONDA 4RG9A 5FZSA 5ARGA 5G04J 3GYZA 4CGWA 2WPVA 3CK8A 2YHCA 2VGXB 1QZ2A 3N71A 2I6HA 4I2ZA 5BT1A 5G05C 4I1AA 4J8FA 4N2SA 4NRHB 4IN3B 4B94A 1IYGA 4G23A 1HH8A 5M72A 4I9CA 3SF4A 3CVQA 3S7FA 3UQ3A 2Q7FA 5KJLA 5A6CA 4HORA 3RJVA 3UPVA 3LY8A 4GYYA 3QWVA 4U04A 1NZNA 1ELRA 1WM5A 4U0SA 4WNGA 4JA9A 3URZA 3MV2B 4XI0A 3FWVA 3BEEA 4GA2A 2HO1A 3S7BA 3ZGQA 4CDRA 4KBQA 1PC2A 2E2EA 4GZ6A 2UY1A 5EX3A 4U07A 2KC7A 3K9IA 4GZ5A 4J8DA 2UWJG 4BT9A 4I9EA 3Q15A
chains in the Genus database with same CATH superfamily
4JA7A 1Z3XA 3V2OA 2NXPA 3UT7A 5CCMA 5BPPA 2LNIA 3HXBA 2XEEA 4LNGA 2Y69E 3LPZA 2RKKA 2DYRE 4I6EA 4FADA 2X6HA 1K1AA 1MJ0A 2ZIRA 1TR4A 4KZ0A 3NOGD 1ELKA 4G25A 3C3OA 4DJAA 3QWWA 3SGHA 2XGOA 5ENPD 3DBSA 3SFYA 3D9OA 5G05J 1INZA 1H0AA 2WXNA 5JJ7A 4JD2G 3ZU7B 3KSQA 4KYOB 2F8XK 3Q9NC 4DLOA 3VTYA 3NOCD 5FQ4A 1BD8A 1QNFA 3EHNA 1DCEA 4YDYA 3E33A 5KCMA 3R7QA 1O1TA 2I1JA 2A4ZA 2GRRB 4GCNA 3ASDA 5AN8A 3E32A 2OVFA 2C2LA 3HXFA 2EIJE 1KT0A 5CBNA 1UJKA 2CHZA 1H6KA 4L9PA 3QDNA 2X6FA 3LKUA 4UWGA 3L82A 4ILIA 3RO2A 1IKND 3B7BA 1DC2A 2J08A 4ANVA 4K5CA 2FI7A 4AEZC 4TV3A 4BTBA 3NBNB 2VGEA 4FLBA 4JW1A 1S64A 2J4BA 2LSUA 3OAWA 2P2CP 2R02A 3TG4A 4PDXA 3QAQA 3ASHA 3C3RA 3FTWA 2CFZA 5JA4D 1D8DA 1HX8A 4U8YD 4A1SA 2AWIA 4FHJA 5AJLA 4DLQA 4BX9A 3CVUA 3ZKJA 4AIFA 1B89A 2WXHA 3ZEFA 4WUYA 2VSNA 5CERB 3MCXA 2R59A 4U0UA 3NAWA 2DIWA 5D0QD 4P29A 1JWGA 3CQCB 2PL2A 4TRQA 3IEGA 3QB2A 3ZFWA 4ZFHA 2ILRA 4LNBA 3G2SA 1EDUA 4LNUD 4UWHA 3EUVA 1N9AA 1HFAA 4YDWA 2P9SG 3UM1A 2L9BA 3SHFA 1XNFA 3APFA 4ME2A 4BSZB 4KVOA 3LY7A 4GB9A 3EU5A 4G2VA 5G2NA 4XEIG 1UN9A 5AAOA 3L9TA 3LVQE 1DNPA 2VYIA 1K8KG 1ZU2A 3FUHA 1P5QA 2WQHA 3GZSA 3OXFA 4M3OA 3Q47B 1LD8A 3ZIMA 1IHGA 4DX2A 2GRNB 2IONA 3HG0D 2VGYA 3CSTA 2OV8A 1S63A 4GMJA 5ANRA 2A5EA 2I1KA 4JHJA 4HB5A 4J7WA 2FEZA 4J0UA 4BTAA 1H2UA 1BPOA 2HR2A 2WXPA 3PZ2A 3UINC 1YA0A 2PZIA 1FT1A 3U9WA 4BWRA 3PRZA 2LSVA 1K3ZD 1IQRA 3Q4AB 5FINA 2VJ8A 3EIQC 2UY1B 3HYMB 4AOFA 2WXOA 5JHBA 3GZ1A 3L13A 4J8EA 2GW1A 2E0IA 3FUIA 2LXMA 3W9GA 1PY1A 3PNTB 3MV3B 2AJAA 4HS2A 1H19A 1UN8A 4WWPA 5BXOA 4EBAA 3SFZA 2AXVA 4M7CA 3CV0A 4LSZE 4HQDA 1WAO1 1TYQG 2PQRA 2PM6A 5BUZA 3ULQA 5FIOA 4HBDA 4ANUA 4OVVA 2GRLA 2B0OE 4L2YA 4EECA 1V55E 3SBTB 2IFUA 4IULA 3J5PA 4F3VA 3GYZA 3FUJA 4TXPA 3V30A 4CGWA 1SW6A 3DEOA 4JHKA 2WPVA 1Z6TA 2R03A 4K5BA 1OY3D 2JEKA 2YHCA 5J08A 1JCSA 2I6HA 3B7RL 4I2ZA 5BT1A 5G05C 4I1AA 4GMRA 4EZJA 3AJIA 3R7RA 4L1BA 4CCAA 3UX4A 1UJJA 4G23A 1DCQA 1TEZA 4PH4B 2LAHA 3SF4A 3CVQA 4C0MA 3P1UA 2P9PG 5A6CA 4F1PA 4HORA 3ML8A 5D66A 1Q2ZA 1WY6A 2ZXWE 3DSTA 4GYYA 3UXGA 4Q96A 4MS6A 1ELRA 1NFIE 2P9UG 2XQ0A 3FTZA 4PS8A 4J8SA 3D3MA 3TWRA 1N4SA 3FWVA 5HKPA 3BEEA 2CHWA 1FVHA 1DVPA 2E2EA 1Z3YA 4CT0A 4WWNA 3ENEA 3ZYLA 3NZSA 5CEAA 5CEDB 2RFMA 5C2YA 4BT9A 3Q79A 3Q15A 4HOQA 1OWOA 4EZLA 4A63B 3D9NA 4AJWA 3CHPA 5FZQA 3PDNA 4U95D 5H7PA 3FUNA 2AXUA 4B8CB 4HFGA 4TXQA 3B95A 5EN5D 3SZ7A 3D9LA 1A17A 1TNOA 3E30A 4R7LA 4AY6A 4XKCA 3PE3A 1WDYA 1UW4B 4XX5A 2RD0A 5AQBA 5CRUA 2VQ2A 3CVYA 4FHKA 4B93B 5ENQD 3ZN3A 3TAXA 1OXJA 1TNYA 2IO2C 3B7TA 5ENNA 3JQ1A 2VGXA 3ZPJA 1OWLA 2QYUA 3UUXA 2OEVA 4RVBA 4UWLA 1SA4A 4GTPA 1TN6A 2WXLA 3ZVVA 4O1OA 1HE8A 1S70B 5C1DA 3TWTA 5ITZF 3SI5A 3V31A 1TN8A 3PH0C 3U66A 2IJGX 5BNWA 5FQ6A 4I1OB 1UOHA 3PUJA 4E85A 5AARA 1OCRE 4GCOA 5ARFA 4KXKB 3U3WA 4LERA 3U64A 4JEHA 3ESKA 5B1AE 3MZLB 4EQFA 3S7DA 4JL0A 2XHEA 3NF1A 4CZ2D 3HXEA 3DSWA 3EHQA 2H6GA 1HU3A 2KCLA 5DIZA 3FULA 1LTXA 2L6BA 3FEYA 1OWMA 3DSUA 2NYJA 4Q94A 2XENA 1TN7A 3C72A 1HO8A 4LEUA 2R17C 5AQ9A 4KMOA 5KWDA 3DXKG 1RW2A 4BFRA 3FUMA 1GW6A 4AVXA 1QBQA 1LD7A 1ELWA 1PAQA 3D9HA 3C5RA 3ZYMA 2Y4TA 3VLFA 3LDZA 4GTMA 3UT4A 3IXEA 1MYOA 4PUCA 3PZ4A 4U63A 4U0ZA 3VLDA 3BG0B 2XRYA 4BEPA 2FULA 3SO8A 3GZ2A 4C48B 1NA0A 1SZ9A 1SZAA 1H6PA 3BG1B 3WG7E 3S2AA 3CEQA 4F53A 3CK7A 3WXXA 1TJFA 5EX0A 2BUGA 3AG3E 3SBSA 3CHQA 3Q9UC 3G2UA 4QFVA 2VSOE 3D9JA 2QFCA 4GTOA 3QOUA 4FU3A 3FH7A 1N11A 4JPSA 3FUEA 2KCKA 1E8ZA 1N4PA 3ZNGA 5T4YA 5CMYA 4BT8A 3CLJA 3DPDA 2XGSA 4GTRA 4ACKA 3G2VA 1E90A 3ZXSA 4DK5A 3FY4A 4L7TA 2VTBA 5AIJA 1X5BA 4CGVA 2YNQA 4B89A 3PREA 2PM7A 1G3NB 4OAUC 3JCKC 5IY5E 3FUFA 2XPIA 5T8IA 5ENTD 2WXJA 4UQZA 5ENSD 1W3BA 4V3IA 4U8VD 5AQ7A 3FTYA 3O4ZA 2F0YA 5EKQD 4HRMB 3V2XA 4GZ3A 2BKGA 3CVNA 2DYSE 1KPSB 3ZW3A 3JUIA 1KZPA 2WM9A 4F6RD 2IOSA 3AS8A 4UWFA 5FZRA 5EIBE 3T5XA 1OCCE 1HG2A 3HVEA 2XCBA 2XGMA 5DBKA 5J90A 3ZRHA 3PEVB 4QQIA 3TGOA 1OCOE 2B6CA 1BLXB 1U3DA 1N95A 2C0MA 3UIOC 3HXCA 4HRNA 2OOEA 4AP2A 2WQ7A 1MX2A 4OAVB 4DI3A 4XZ4A 4BERA 4APOA 3PE4A 3TWQA 3EHRA 4ATGA 1NP7A 4WNEA 3LS8A 2ONDA 5CECB 4DPRA 5ARGA 3ZYKA 2Y3AA 3CK8A 3FU5A 2H6IA 2VGXB 1QZ2A 4NACA 3DSVA 4GU5A 1V54E 4GZDA 4N2SA 3APCA 1OCZE 4NRHB 1UG3A 5CRVA 4IN3B 4B94A 5LX8A 4ANXA 1IYGA 4C0EA 2DVWA 3HHMA 4I9CA 2Q7FA 3DWLG 3TWSA 3CVWA 3IV0A 3B7UX 1YMPA 4AV7A 3Q7FA 3TXNA 3RRNB 3QJZA 5A23A 1NZNA 1E7VA 4WNGA 2GROB 4ANWA 4CRWA 1QYMA 2KM4A 2EQXA 2IOLA 2EIKE 4XI0A 5AQAA 1YCSB 3TWXA 3SD5A 2FO1E 4CDRA 1PC2A 4GZ6A 3LVRE 2J09A 1ZB1A 2RG8A 2V4HC 3T9KA 4JXTA 3K9IA 4GZ5A 3PZDA 4FJZA 1JCRA 3FTVA 4I9EA 5LP0A 2V8SE 3BU8A 4O60A 2NSZA 3JXIA 2P9LG 3JYSA 4N5QA 4J6IA 4URKA 4HLEA 2ETAA 4A55A 1L5JA 4CDNA 4CDMA 4HOSA 3RK6A 4BSXA 1N54A 2V4LA 3RRMB 4NIKA 1NA3A 2V5FA 1SQMA 3FU0A 4W9RA 4GPMA 1Y8MA 2BTDA 3EHMA 3CHSA 2R05A 1FT2A 3CVVA 2X3MA 3CKBA 2XS8A 5ENRD 5EDSA 1AWCB 2X6JA 4UUCA 3AG2E 3ABME 3E37A 2YHEA 3TG5A 2BEDA 3D9IA 1RZ4A 3D9KA 2FO7A 2KCVA 4UI9K 5D0OD 2WQ6A 5KJNA 3LYAA 3G2TA 1HS6A 4MLPA 3T8KA 1FCHA 4ACLA 2ETBA 1H2TC 3J5QB 5AENA 2IEJA 4LUNU 4H7YA 3V79K 4I2WA 3Q73A 2VTBB 2FBNA 4I17A 2ZU6B 3TWUA 3APDA 4YVQC 2ZGGA 4EPZA 5AYWD 1Y6IA 4JC8A 5EIDA 2Y1LE 3FP3A 4HLLA 4HVBA 4APFA 4IRUA 3B7SA 2GRMA 3LJ3A 4O6FA 4GPKA 1HG5A 3EDTB 1N94A 4N5CA 4TUMA 1XGWA 3TXMA 4KZCA 3MYVA 5FTPA 1BI7B 3ULEG 3Q5MA 3ZUVB 4GTQA 4FC8A 2JLBA 5CBOA 3CVXA 3DPYA 5FQ7A 4BX8A 4DX6D 3HVEB 2IQCA 3G2WA 3UM2A 3PVLA 2YINA 3ABLE 3PEUB 4G26A 2GGFA 5FWQA 3AS4A 1SVXA 3MKRA 4B8AA 4HOTA 1O1SA 4G8KA 3FH8A 3VTXA 5FJYA 4AM9A 1OT8A 3CR3A 4F7AA 4TUUA 3RO3A 4EZKA 5BV1A 4N39A 2QZAA 1IQUA 4YNDA 3HRAA 1KLXA 3ASFA 2PNNA 1YYHA 3TJPA 3Q49B 2GRPB 1E96B 5LCWC 2IF4A 3UIPC 4KT6B 3PNLB 3ZXPA 3ZHEA 4XI9A 3LCAA 4N3CA 4JHRA 1JWFA 4N3BA 2KZTA 2VSXE 1AP7A 5BW8C 2RFAA 4GA0A 1NI1A 2LO6A 4A1GA 2MHKA 5JJTA 1N4RA 1K1BA 1JCQA 3FU6A 5HQ8A 3AU5A 3I3NA 3AAAC 1Z5SC 4RG6A 4UI9C 1KZOA 4NURA 2R5SA 4GTTA 1HF8A 3BUAA 3DSXA 3JXJA 1FPPA 4JEUA 4J8YA 2VSYA 5CHEE 2HM8A 5KBAA 5CCLA 2Y4UA 4I43A 2J49A 3MJWA 3ASGA 4K03A 1E8WA 2BF0X 2WXIA 2X38A 3RSEG 2I2OA 3PZ3A 5ENOD 3JQ0A 3SY2A 2DCPA 1EF1C 2F8YA 4GMLA 3DEPA 2L0TB 1EPUA 3MEKA 3QKYA 1U3CA 1NL4A 4UQYA 5CMWA 1BU9A 2CHXA 1WG0A 5JHAA 1QQEA 4BETA 2AVPA 3KD7A 1OUVA 3FEXA 4RG9A 5FZSA 3L6AA 5G04J 3MX3A 2HE0A 5HS0A 3N71A 1MZCA 3IHVA 5KNGA 3SNXA 1IXVA 4LG6A 5LFAA 4J8FA 3Q7AA 4F1SA 4XE0A 4LCTA 1JUQA 3FUKA 5M72A 1SA5A 3SQVA 3S7FA 2WVIA 3UKUG 4AXHA 4CT4A 5KJLA 3MGBA 3RJVA 2OCCE 3L22A 3UPVA 3LY8A 2DZNA 2ZISA 3KSLA 2JABA 2MOWA 3W9FA 4O1PA 3LEWA 4U0SA 2J07A 3QK0A 1E7UA 3MV2B 4CEMA 3HXDA 2A5UA 3MKQA 4JVSA 5EYPF 2HO1A 3S7BA 3UT8A 2V5QC 4KBQA 2GRQB 3PZ1A 5AJDA 2KC7A 1MQSA 2WXMA 4J8DA 4HXIA 3T5VA 4RLYA 4I6GA 2X6IA 3ISMC 2PQNA 3VLEA 3AS5A 4AY5A 4DX5D 3X2QE 3UM3A 4B0ZA 5KJKA 2XEVA 3SFXA 2WXFA 4PS3A 3FTXA 4ILGA 3KAEA 3I4RB 3CSFA 4DX7D 4FP7A 1D8EA 4A3TA 3CQGB 2FF4A 3CHMA 3CVLA 3ONKA 3OXGA 5B3SE 4XIFA 3NZUA 4GZCA 3RU0A 2XZDG 4JB8P 5A7DB 4OYSA 4DI4A 2LAIA 3OXLA 2P9KG 3ASOE 4KVMA 3ABKE 2QY7A 3E34A 5LCWJ 3IKOB 3OTNA 2XCCA 5B1BE 2IY0C 1IHBA 3AG4E 3D9MA 1A5EA 2J9QA 4WNFA 3UI2A 3S7JA 3EU9A 3HIZA 4RQIA 2P58C 4DX1A 1X81A 2LXLA 1LF8A 4ABNA 4WWOA 4BESA 1TNZA 1O1RA 1N4QA 4L23A 5E75A 4WNDA 1N0QA 2DZOA 2EILE 3FFLA 3FTSA 5KJMA 1EYHA 3PS6A 4UI9J 2WXQA 4GA1A 3GW4A 5JJ6A 2CG3A 3KEAA 4MBGA 2XZTG 3ZHEB 3TWVA 2WMNA 2Y0BG 4EBAG 3FU3A 2IU1A 2DBAA 5HI7A 2KZTB 4PS7A 3RKVA 3QWPA 2DWZA 3LXUX 4FLHA 3MA5A 2WXGA 1TJCA 4Q69A 3TL5A 4A3VA 3CIAA 2J4DA 5EILA 2IO3C 5BXUA 3E4BA 3EIJA 3I4GA 2EINE 3BQOA 4G1TA 3R9MA 4GYWA 4JZYA 3KS2A 2KATA 2H6FA 1D9SA 4N3AA 3ONLA 2OEWA 2XPZA 2AW6A 3CK9A 3ML9A 4ILHB 4N2QA 4U7EB 4UWKA 2BKKB 4ATZD 3L17A 3UMVA 4C9BB 3IHYA 4DUIA 4UQXA 2XRZA 4Y6WA 3D9PA 1HXIA 3CHOA 4GYOA 1O5MA 3C3QA 2L6JA 4YDOA 1S0PA 3AG1E 3FHEA 2P9NG 1VDYA 4GAAA 3UM0A 2C0LA 3FTUA 2WB2A 4Z68A 4ZHBA 1BI8B 4I1MA 3I5PA 5FT9A 4DRXE 2H6HA 3R9AB 1TNUA 5G04C 3Q78A 4RSYA 4MRUA 5T3RA 3FUDA 3QARA 3RIBA 3U4TA 3F6QA 2YQ8A 3QC1A 4U8HA 1E8XA 4BY6A 5JMND 3L16A 3CGHA 2XEHA 2L0IA 5G55A 3ZYQA 4HI9A 1E8YA 2MYOA 1JPLA 3CKCA 1H2VC 4Y6CA 4CYMD 3LY9A 3CHRA 3DSSA 4K0RA 2ETCA 3RAUA 3DXMG 4X8QA 3NB2A 5EYLA 3MKQB 1U2VG 4NQ0A 2XS1A 4GTVA 1MX4A 2LUHA 2NC9A 3CVPA 2WXKA 4E6HA 4HOUA 2WXRA 3B13A 3ESLA 4K5AB 2OVBA 4GTSA 4I6JA 5E76A 2QC9A 3TWWA 4YVOA 4H7XA 4XKBA 2X6KA 3LJNA 4FJYA 2P9IG 4G24A 3NQPA 2I9CA 5D2MC 1HZ4A 4OVUA 4D10C 2EIME 1KT1A 2HYZA 2V0PA 4HNAD 1MHQA 4LRZA 5LOZA 2M63A 3O48A 3T8MA 3FH5A 1ZBPA 1FVFA 3UKRG 5ANLA 3QNKA 5HRYA 1MX6A 1TNBA 3IBEA 3ASNE 4U96D 4TXRA 3ULYA 3C98A 5FQ8A 3JUEA 2ZGDA 4YDEA 1HH8A 4EHMA 3PUKA 4L2LA 5KNHD 3UQ3A 2MRIA 2F37A 1N52A 1OWPA 3L08A 3EJNA 2CFUA 4FULA 2KXPC 3P2BA 3QWVA 4U04A 4HRLA 2XPYA 1WM5A 4G11A 4WAFA 3KEZA 2CG2A 3RRUA 3UTMA 2QYJA 4JA9A 2R2LA 1OWNA 3URZA 2KBXA 4HI8A 4G8LA 4GA2A 3L54A 3ZGQA 4MKTA 2UY1A 4FA6A 1H6OA 5EX3A 4U07A 2WMOA 2J8SD 5BV0A 3HDXA 3AU4A 1N0RA 2UWJG 4IYPA 2AXZA 3DRAA 3FDHA 3Q75A
chains in the Genus database with same CATH topology
5LP0A 2X6IA 2V8SE 4JA7A 1Z3XA 2PQNA 3VLEA 4HOQA 1OWOA 2NXPA 4EZLA 3AS5A 4AY5A 3D9NA 3UT7A 4AJWA 5BPPA 5CCMA 3CHPA 5FZQA 2NSZA 3PDNA 2LNIA 3FUNA 3LPZA 2AXUA 4B0ZA 4B8CB 3JYSA 5KJKA 4I6EA 4HFGA 2XEVA 4FADA 2X6HA 2WXFA 4J6IA 4PS3A 3SZ7A 4URKA 4HLEA 3FTXA 3D9LA 4ILGA 1A17A 3KAEA 3I4RB 4R7LA 4AY6A 3CSFA 3PE3A 4XKCA 4A55A 1L5JA 4CDNA 4FP7A 1UW4B 4XX5A 3CQGB 4KZ0A 2RD0A 4A3TA 2FF4A 1ELKA 4G25A 3CHMA 3CVLA 4CDMA 2VQ2A 4DJAA 3CVYA 4HOSA 4FHKA 3RK6A 3ONKA 4BSXA 3QWWA 1N54A 2XGOA 3SGHA 2V4LA 3RRMB 3DBSA 3OXGA 1NA3A 4XIFA 3NZUA 4GZCA 3ZN3A 3TAXA 3RU0A 2V5FA 3D9OA 5G05J 1INZA 1H0AA 1SQMA 2WXNA 5A7DB 5JJ7A 3FU0A 3B7TA 5ENNA 3JQ1A 4W9RA 4KYOB 2VGXA 4OYSA 4DLOA 4DI4A 2LAIA 3OXLA 3VTYA 3ZPJA 1Y8MA 2BTDA 3EHMA 4KVMA 1OWLA 2QY7A 3CHSA 5FQ4A 5LCWJ 1QNFA 3CVVA 3UUXA 2X3MA 3EHNA 3IKOB 4RVBA 4UWLA 5KCMA 3R7QA 2I1JA 3OTNA 2A4ZA 3CKBA 2WXLA 2XCCA 4GCNA 5EDSA 3ZVVA 3ASDA 1HE8A 2X6JA 2OVFA 2C2LA 2YHEA 5C1DA 3SI5A 3TG5A 1KT0A 3D9MA 3U66A 3PH0C 1UJKA 2IJGX 3D9IA 2J9QA 2CHZA 4WNFA 3S7JA 5BNWA 1H6KA 3D9KA 5FQ6A 3HIZA 4I1OB 3PUJA 4E85A 2FO7A 3QDNA 2P58C 2KCVA 4GCOA 4UI9K 5D0OD 5ARFA 2WQ6A 5KJNA 4KXKB 3U3WA 1LF8A 3LYAA 4ABNA 4WWOA 3G2TA 2X6FA 1HS6A 4MLPA 3LKUA 4L23A 5E75A 4LERA 1FCHA 4WNDA 3U64A 4ACLA 4JEHA 3ESKA 1H2TC 3MZLB 5AENA 4UWGA 4LUNU 4H7YA 4ILIA 3FFLA 4I2WA 3RO2A 3S7DA 4EQFA 2VTBB 4JL0A 3FTSA 5KJMA 1EYHA 2XHEA 3PS6A 4UI9J 2FBNA 4I17A 2ZU6B 3NF1A 2WXQA 3APDA 4GA1A 3GW4A 4YVQC 5JJ6A 2J08A 4ANVA 4EPZA 2CG3A 2FI7A 5AYWD 4AEZC 4TV3A 3ZHEB 1Y6IA 4BTBA 4FLBA 4JW1A 1HU3A 2KCLA 2WMNA 4EBAG 4JC8A 3FU3A 2J4BA 3FP3A 5DIZA 2IU1A 3FULA 2DBAA 4HVBA 4APFA 4IRUA 3FEYA 5HI7A 2KZTB 2LSUA 3B7SA 3OAWA 4PS7A 1OWMA 3RKVA 2GRMA 3LJ3A 3QWPA 4O6FA 3LXUX 3TG4A 4PDXA 4FLHA 3MA5A 4GPKA 3QAQA 1HG5A 3EDTB 2WXGA 3ASHA 3FTWA 1TJCA 4N5CA 4Q69A 4Q94A 3TL5A 1XGWA 2CFZA 3TXMA 4A3VA 3CIAA 2J4DA 1HO8A 4LEUA 4KZCA 1HX8A 3E4BA 3MYVA 4A1SA 2R17C 3EIJA 3I4GA 2AWIA 4KMOA 5FTPA 4FHJA 4G1TA 5AJLA 4DLQA 4BX9A 3Q5MA 4GYWA 4BFRA 3CVUA 3FUMA 4AIFA 4JZYA 1B89A 2WXHA 3KS2A 1GW6A 3ZEFA 2KATA 4AVXA 4WUYA 1PAQA 1ELWA 2VSNA 4N3AA 3ONLA 3ZYMA 4FC8A 2JLBA 2Y4TA 3VLFA 3CVXA 3LDZA 5FQ7A 3MCXA 2XPZA 2AW6A 2R59A 4BX8A 3CK9A 3UT4A 3ML9A 3HVEB 2IQCA 4ILHB 4PUCA 4U0UA 4N2QA 3G2WA 2DIWA 4U63A 4UWKA 5D0QD 3PVLA 4P29A 1JWGA 4U0ZA 3BG0B 3VLDA 3CQCB 2PL2A 4TRQA 2XRYA 3IEGA 2FULA 3GZ2A 1NA0A 3L17A 1SZ9A 1SZAA 3QB2A 3IHYA 3UMVA 2YINA 2ILRA 3ZFWA 4C9BB 3G2SA 1EDUA 3BG1B 3PEUB 4G26A 2GGFA 4UWHA 3S2AA 3CEQA 5FWQA 4UQXA 3AS4A 2XRZA 3MKRA 4Y6WA 4F53A 3D9PA 1HFAA 3CK7A 1TJFA 3WXXA 4B8AA 5EX0A 2L9BA 4HOTA 3SHFA 2BUGA 1XNFA 3APFA 3SBSA 1HXIA 4ME2A 3CHQA 4KVOA 3FH8A 3LY7A 3CHOA 3G2UA 4GYOA 4GB9A 4QFVA 4G2VA 5G2NA 2L6JA 1S0PA 3VTXA 2VSOE 3D9JA 5FJYA 1UN9A 2QFCA 3FHEA 4AM9A 3QOUA 1VDYA 4FU3A 4GAAA 3CR3A 2C0LA 3FH7A 4F7AA 3LVQE 3FTUA 4TUUA 2WB2A 1DNPA 2VYIA 4JPSA 3FUEA 3RO3A 1ZU2A 3FUHA 1P5QA 1E8ZA 2KCKA 2WQHA 3GZSA 3OXFA 4I1MA 5T4YA 4EZKA 5BV1A 5CMYA 4BT8A 4M3OA 3Q47B 3CLJA 3I5PA 5FT9A 3DPDA 4N39A 2XGSA 3ZIMA 1IHGA 1IQUA 3R9AB 4ACKA 3G2VA 4YNDA 1E90A 3ZXSA 5G04C 4DK5A 4RSYA 1KLXA 3FY4A 3ASFA 4MRUA 2IONA 5T3RA 3FUDA 3QARA 3RIBA 4L7TA 2VGYA 3U4TA 2VTBA 3TJPA 3Q49B 5AIJA 1E96B 1X5BA 2YQ8A 3CSTA 3QC1A 4CGVA 5LCWC 4U8HA 1E8XA 2IF4A 2OV8A 4KT6B 4BY6A 3L16A 3PNLB 3CGHA 2YNQA 4GMJA 5ANRA 3ZHEA 4B89A 3PREA 2I1KA 4XI9A 2L0IA 2PM7A 4JHJA 3LCAA 5G55A 3JCKC 3ZYQA 2FEZA 4J0UA 4N3CA 4JHRA 1E8YA 1JWFA 4N3BA 3FUFA 4BTAA 1H2UA 2KZTA 2VSXE 1BPOA 2XPIA 2HR2A 1JPLA 2WXPA 5T8IA 2WXJA 4UQZA 5BW8C 1W3BA 4V3IA 4GA0A 3CKCA 2LO6A 4A1GA 1H2VC 2MHKA 5JJTA 4Y6CA 1YA0A 2PZIA 3FTYA 3O4ZA 3U9WA 4BWRA 3FU6A 3PRZA 2LSVA 5HQ8A 3LY9A 3CHRA 5EKQD 3AU5A 4K0RA 3I3NA 1IQRA 3Q4AB 2VJ8A 3MKQB 4NQ0A 4GZ3A 2NC9A 3CVPA 3EIQC 3CVNA 3ZW3A 2WXKA 4RG6A 3JUIA 4UI9C 4NURA 4E6HA 2WM9A 2R5SA 2UY1B 3HYMB 1HF8A 2IOSA 3AS8A 2WXOA 4HOUA 4UWFA 4AOFA 5FZRA 3GZ1A 2WXRA 5JHBA 3B13A 3T5XA 3L13A 4J8EA 2GW1A 3ESLA 2E0IA 2OVBA 3FUIA 1HG2A 1PY1A 3PNTB 4I6JA 5E76A 3MV3B 4H7XA 4XKBA 2X6KA 3HVEA 4YVOA 2XCBA 4JEUA 4FJYA 2VSYA 1H19A 4HS2A 1UN8A 5CHEE 4G24A 4WWPA 2XGMA 2HM8A 5CCLA 3NQPA 2Y4UA 4EBAA 4I43A 2J49A 5DBKA 3MJWA 2I9CA 5J90A 3ZRHA 3ASGA 1HZ4A 3PEVB 4K03A 1E8WA 2BF0X 2WXIA 2X38A 4OVUA 3SFZA 3TGOA 2AXVA 2I2OA 4D10C 3JQ0A 3CV0A 1KT1A 2HYZA 2DCPA 2C0MA 1EF1C 1WAO1 2V0PA 4GMLA 2PQRA 2L0TB 2OOEA 1EPUA 1MHQA 3MEKA 4LRZA 3QKYA 2PM6A 2M63A 1U3CA 5LOZA 3O48A 3T8MA 4AP2A 3FH5A 2WQ7A 1ZBPA 4UQYA 4DI3A 5BUZA 4XZ4A 4APOA 3PE4A 3Q15A 3ULQA 5CMWA 1FVFA 5ANLA 3QNKA 4ATGA 2CHXA 4OVVA 4ANUA 2GRLA 4L2YA 4EECA 5JHAA 3SBTB 1NP7A 1QQEA 2AVPA 2IFUA 4IULA 4WNEA 3KD7A 1OUVA 3LS8A 4F3VA 3FEXA 2ONDA 4RG9A 5FZSA 4DPRA 5ARGA 3IBEA 3L6AA 3ZYKA 5G04J 3GYZA 3FUJA 4CGWA 4JHKA 2WPVA 1Z6TA 2Y3AA 3CK8A 3FU5A 2JEKA 3MX3A 2YHCA 5J08A 2VGXB 1QZ2A 3N71A 4NACA 3IHVA 4GU5A 2I6HA 3B7RL 4I2ZA 5BT1A 4GZDA 3SNXA 5G05C 4I1AA 5LFAA 3C98A 4J8FA 5FQ8A 3APCA 4N2SA 4F1SA 4EZJA 4NRHB 4XE0A 4LCTA 1UG3A 3R7RA 4IN3B 4L1BA 4B94A 1JUQA 4CCAA 3UX4A 1UJJA 4ANXA 5LX8A 4C0EA 3FUKA 1IYGA 4G23A 1HH8A 5M72A 1TEZA 3HHMA 4I9CA 4PH4B 2LAHA 3SF4A 3CVQA 3PUKA 4C0MA 3P1UA 4L2LA 3S7FA 3UQ3A 2WVIA 2MRIA 2Q7FA 4AXHA 4CT4A 1N52A 3CVWA 3IV0A 5KJLA 3MGBA 3B7UX 5A6CA 4HORA 3RJVA 1OWPA 3ML8A 3L08A 3UPVA 3L22A 1WY6A 3LY8A 4AV7A 3EJNA 3TXNA 3RRNB 2CFUA 4FULA 4GYYA 3P2BA 3QWVA 3QJZA 5A23A 4U04A 1NZNA 4Q96A 4MS6A 1E7VA 2XPYA 1ELRA 2MOWA 1WM5A 4G11A 3LEWA 4U0SA 4WAFA 3KEZA 2CG2A 4WNGA 3RRUA 2J07A 3QK0A 4ANWA 2XQ0A 4CRWA 4JA9A 2KM4A 2EQXA 3FTZA 4PS8A 1E7UA 1OWNA 2IOLA 3MV2B 3URZA 4J8SA 3D3MA 4XI0A 4CEMA 3FWVA 2A5UA 3BEEA 2CHWA 3MKQA 4GA2A 4JVSA 3L54A 2HO1A 1FVHA 3S7BA 3SD5A 3UT8A 3ZGQA 4CDRA 4KBQA 1DVPA 1PC2A 2E2EA 1Z3YA 4MKTA 4GZ6A 2UY1A 3LVRE 4CT0A 2J09A 4FA6A 5EX3A 4U07A 5AJDA 2RG8A 2KC7A 2WMOA 5BV0A 4WWNA 1MQSA 3ENEA 3ZYLA 3HDXA 3NZSA 4JXTA 2WXMA 3K9IA 3AU4A 4GZ5A 3PZDA 4FJZA 4J8DA 4HXIA 2UWJG 3FTVA 4IYPA 5C2YA 2AXZA 3T5VA 4BT9A 4I9EA 3FDHA 1U3DA 4I6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JA7 A;  2PQN A;  4HOQ A;  3AS5 A;  4AY5 A;  5CCM A;  5FZQ A;  3PDN A;  2LNI A;  3LPZ A;  3JYS A;  5KJK A;  2XEV A;  3SZ7 A;  1A17 A;  3KAE A;  4AY6 A;  3PE3 A;  2FF4 A;  4G25 A;  3CVL A;  4HOS A;  2VQ2 A;  3QWW A;  2XGO A;  3OXG A;  1NA3 A;  4XIF A;  3ZN3 A;  3TAX A;  3RU0 A;  2V5F A;  5G05 J;  5A7D B;  5JJ7 A;  4W9R A;  4KYO B;  2VGX A;  3OXL A;  3VTY A;  3ZPJ A;  1Y8M A;  5LCW J;  3UUX A;  3CKB A;  2XCC A;  4GCN A;  3ASD A;  2C2L A;  5C1D A;  3TG5 A;  1KT0 A;  5BNW A;  2J9Q A;  4WNF A;  3S7J A;  2FO7 A;  3QDN A;  2P58 C;  2KCV A;  4GCO A;  4UI9 K;  5D0O D;  5ARF A;  5KJN A;  4KXK B;  3U3W A;  3LYA A;  4ABN A;  3LKU A;  1FCH A;  4WND A;  3ESK A;  4H7Y A;  3FFL A;  4I2W A;  3RO2 A;  3S7D A;  4EQF A;  4JL0 A;  5KJM A;  4UI9 J;  2FBN A;  4I17 A;  3NF1 A;  4GA1 A;  3GW4 A;  4YVQ C;  5JJ6 A;  2FI7 A;  5AYW D;  3ZHE B;  4BTB A;  2KCL A;  3FP3 A;  5DIZ A;  2DBA A;  5HI7 A;  2LSU A;  3RKV A;  3QWP A;  4O6F A;  3TG4 A;  3MA5 A;  4GPK A;  3EDT B;  3ASH A;  1TJC A;  4N5C A;  4LEU A;  3E4B A;  4A1S A;  5FTP A;  4G1T A;  3Q5M A;  4GYW A;  4AIF A;  1B89 A;  3KS2 A;  2KAT A;  4WUY A;  1ELW A;  2VSN A;  4N3A A;  2JLB A;  2Y4T A;  3CK9 A;  4U0U A;  4N2Q A;  5D0Q D;  4U0Z A;  2PL2 A;  3IEG A;  3GZ2 A;  1NA0 A;  3ZFW A;  4G26 A;  3CEQ A;  4UQX A;  3AS4 A;  3MKR A;  4Y6W A;  3WXX A;  3CK7 A;  5EX0 A;  4HOT A;  2BUG A;  1XNF A;  1HXI A;  4ME2 A;  3LY7 A;  4GYO A;  4G2V A;  2L6J A;  3VTX A;  5FJY A;  2QFC A;  4AM9 A;  3QOU A;  2C0L A;  2VYI A;  3RO3 A;  1ZU2 A;  1P5Q A;  2KCK A;  2WQH A;  3OXF A;  4BT8 A;  3Q47 B;  5FT9 A;  4N39 A;  2XGS A;  1IHG A;  3R9A B;  4YND A;  5G04 C;  1KLX A;  3ASF A;  3RIB A;  2VGY A;  3U4T A;  3Q49 B;  1E96 B;  2YQ8 A;  4CGV A;  5LCW C;  2IF4 A;  3ZHE A;  4XI9 A;  3LCA A;  2FEZ A;  4J0U A;  4N3C A;  4JHR A;  4N3B A;  4BTA A;  2XPI A;  2HR2 A;  4UQZ A;  5BW8 C;  1W3B A;  4GA0 A;  3CKC A;  2MHK A;  5JJT A;  4Y6C A;  1YA0 A;  2PZI A;  4BWR A;  2LSV A;  5HQ8 A;  3LY9 A;  5EKQ D;  3Q4A B;  4NQ0 A;  4GZ3 A;  2NC9 A;  3CVP A;  3CVN A;  4RG6 A;  4UI9 C;  2R5S A;  2UY1 B;  3HYM B;  4HOU A;  3AS8 A;  5FZR A;  3GZ1 A;  4J8E A;  2GW1 A;  3MV3 B;  4H7X A;  4YVO A;  2XCB A;  2VSY A;  5CHE E;  4G24 A;  2XGM A;  5CCL A;  2Y4U A;  5DBK A;  3ASG A;  1HZ4 A;  3TGO A;  3CV0 A;  1KT1 A;  2HYZ A;  2C0M A;  1WAO 1;  2PQR A;  2OOE A;  3MEK A;  3QKY A;  3O48 A;  1ZBP A;  4UQY A;  4APO A;  3PE4 A;  3ULQ A;  1QQE A;  2AVP A;  2IFU A;  4WNE A;  3KD7 A;  1OUV A;  4F3V A;  2OND A;  4RG9 A;  5FZS A;  5ARG A;  5G04 J;  3GYZ A;  4CGW A;  2WPV A;  3CK8 A;  2YHC A;  2VGX B;  1QZ2 A;  3N71 A;  2I6H A;  4I2Z A;  5BT1 A;  5G05 C;  4I1A A;  4J8F A;  4N2S A;  4NRH B;  4IN3 B;  4B94 A;  1IYG A;  4G23 A;  1HH8 A;  5M72 A;  4I9C A;  3SF4 A;  3CVQ A;  3S7F A;  3UQ3 A;  2Q7F A;  5KJL A;  5A6C A;  4HOR A;  3RJV A;  3UPV A;  3LY8 A;  4GYY A;  3QWV A;  4U04 A;  1NZN A;  1ELR A;  1WM5 A;  4U0S A;  4WNG A;  4JA9 A;  3URZ A;  3MV2 B;  4XI0 A;  3FWV A;  3BEE A;  4GA2 A;  2HO1 A;  3S7B A;  3ZGQ A;  4CDR A;  4KBQ A;  1PC2 A;  2E2E A;  4GZ6 A;  2UY1 A;  5EX3 A;  4U07 A;  2KC7 A;  3K9I A;  4GZ5 A;  4J8D A;  2UWJ G;  4BT9 A;  4I9E A;  3Q15 A; 
#chains in the Genus database with same CATH topology
 4JA7 A;  1Z3X A;  3V2O A;  2NXP A;  3UT7 A;  5CCM A;  5BPP A;  2LNI A;  3HXB A;  2XEE A;  4LNG A;  2Y69 E;  3LPZ A;  2RKK A;  2DYR E;  4I6E A;  4FAD A;  2X6H A;  1K1A A;  1MJ0 A;  2ZIR A;  1TR4 A;  4KZ0 A;  3NOG D;  1ELK A;  4G25 A;  3C3O A;  4DJA A;  3QWW A;  3SGH A;  2XGO A;  5ENP D;  3DBS A;  3SFY A;  3D9O A;  5G05 J;  1INZ A;  1H0A A;  2WXN A;  5JJ7 A;  4JD2 G;  3ZU7 B;  3KSQ A;  4KYO B;  2F8X K;  3Q9N C;  4DLO A;  3VTY A;  3NOC D;  5FQ4 A;  1BD8 A;  1QNF A;  3EHN A;  1DCE A;  4YDY A;  3E33 A;  5KCM A;  3R7Q A;  1O1T A;  2I1J A;  2A4Z A;  2GRR B;  4GCN A;  3ASD A;  5AN8 A;  3E32 A;  2OVF A;  2C2L A;  3HXF A;  2EIJ E;  1KT0 A;  5CBN A;  1UJK A;  2CHZ A;  1H6K A;  4L9P A;  3QDN A;  2X6F A;  3LKU A;  4UWG A;  3L82 A;  4ILI A;  3RO2 A;  1IKN D;  3B7B A;  1DC2 A;  2J08 A;  4ANV A;  4K5C A;  2FI7 A;  4AEZ C;  4TV3 A;  4BTB A;  3NBN B;  2VGE A;  4FLB A;  4JW1 A;  1S64 A;  2J4B A;  2LSU A;  3OAW A;  2P2C P;  2R02 A;  3TG4 A;  4PDX A;  3QAQ A;  3ASH A;  3C3R A;  3FTW A;  2CFZ A;  5JA4 D;  1D8D A;  1HX8 A;  4U8Y D;  4A1S A;  2AWI A;  4FHJ A;  5AJL A;  4DLQ A;  4BX9 A;  3CVU A;  3ZKJ A;  4AIF A;  1B89 A;  2WXH A;  3ZEF A;  4WUY A;  2VSN A;  5CER B;  3MCX A;  2R59 A;  4U0U A;  3NAW A;  2DIW A;  5D0Q D;  4P29 A;  1JWG A;  3CQC B;  2PL2 A;  4TRQ A;  3IEG A;  3QB2 A;  3ZFW A;  4ZFH A;  2ILR A;  4LNB A;  3G2S A;  1EDU A;  4LNU D;  4UWH A;  3EUV A;  1N9A A;  1HFA A;  4YDW A;  2P9S G;  3UM1 A;  2L9B A;  3SHF A;  1XNF A;  3APF A;  4ME2 A;  4BSZ B;  4KVO A;  3LY7 A;  4GB9 A;  3EU5 A;  4G2V A;  5G2N A;  4XEI G;  1UN9 A;  5AAO A;  3L9T A;  3LVQ E;  1DNP A;  2VYI A;  1K8K G;  1ZU2 A;  3FUH A;  1P5Q A;  2WQH A;  3GZS A;  3OXF A;  4M3O A;  3Q47 B;  1LD8 A;  3ZIM A;  1IHG A;  4DX2 A;  2GRN B;  2ION A;  3HG0 D;  2VGY A;  3CST A;  2OV8 A;  1S63 A;  4GMJ A;  5ANR A;  2A5E A;  2I1K A;  4JHJ A;  4HB5 A;  4J7W A;  2FEZ A;  4J0U A;  4BTA A;  1H2U A;  1BPO A;  2HR2 A;  2WXP A;  3PZ2 A;  3UIN C;  1YA0 A;  2PZI A;  1FT1 A;  3U9W A;  4BWR A;  3PRZ A;  2LSV A;  1K3Z D;  1IQR A;  3Q4A B;  5FIN A;  2VJ8 A;  3EIQ C;  2UY1 B;  3HYM B;  4AOF A;  2WXO A;  5JHB A;  3GZ1 A;  3L13 A;  4J8E A;  2GW1 A;  2E0I A;  3FUI A;  2LXM A;  3W9G A;  1PY1 A;  3PNT B;  3MV3 B;  2AJA A;  4HS2 A;  1H19 A;  1UN8 A;  4WWP A;  5BXO A;  4EBA A;  3SFZ A;  2AXV A;  4M7C A;  3CV0 A;  4LSZ E;  4HQD A;  1WAO 1;  1TYQ G;  2PQR A;  2PM6 A;  5BUZ A;  3ULQ A;  5FIO A;  4HBD A;  4ANU A;  4OVV A;  2GRL A;  2B0O E;  4L2Y A;  4EEC A;  1V55 E;  3SBT B;  2IFU A;  4IUL A;  3J5P A;  4F3V A;  3GYZ A;  3FUJ A;  4TXP A;  3V30 A;  4CGW A;  1SW6 A;  3DEO A;  4JHK A;  2WPV A;  1Z6T A;  2R03 A;  4K5B A;  1OY3 D;  2JEK A;  2YHC A;  5J08 A;  1JCS A;  2I6H A;  3B7R L;  4I2Z A;  5BT1 A;  5G05 C;  4I1A A;  4GMR A;  4EZJ A;  3AJI A;  3R7R A;  4L1B A;  4CCA A;  3UX4 A;  1UJJ A;  4G23 A;  1DCQ A;  1TEZ A;  4PH4 B;  2LAH A;  3SF4 A;  3CVQ A;  4C0M A;  3P1U A;  2P9P G;  5A6C A;  4F1P A;  4HOR A;  3ML8 A;  5D66 A;  1Q2Z A;  1WY6 A;  2ZXW E;  3DST A;  4GYY A;  3UXG A;  4Q96 A;  4MS6 A;  1ELR A;  1NFI E;  2P9U G;  2XQ0 A;  3FTZ A;  4PS8 A;  4J8S A;  3D3M A;  3TWR A;  1N4S A;  3FWV A;  5HKP A;  3BEE A;  2CHW A;  1FVH A;  1DVP A;  2E2E A;  1Z3Y A;  4CT0 A;  4WWN A;  3ENE A;  3ZYL A;  3NZS A;  5CEA A;  5CED B;  2RFM A;  5C2Y A;  4BT9 A;  3Q79 A;  3Q15 A;  4HOQ A;  1OWO A;  4EZL A;  4A63 B;  3D9N A;  4AJW A;  3CHP A;  5FZQ A;  3PDN A;  4U95 D;  5H7P A;  3FUN A;  2AXU A;  4B8C B;  4HFG A;  4TXQ A;  3B95 A;  5EN5 D;  3SZ7 A;  3D9L A;  1A17 A;  1TNO A;  3E30 A;  4R7L A;  4AY6 A;  4XKC A;  3PE3 A;  1WDY A;  1UW4 B;  4XX5 A;  2RD0 A;  5AQB A;  5CRU A;  2VQ2 A;  3CVY A;  4FHK A;  4B93 B;  5ENQ D;  3ZN3 A;  3TAX A;  1OXJ A;  1TNY A;  2IO2 C;  3B7T A;  5ENN A;  3JQ1 A;  2VGX A;  3ZPJ A;  1OWL A;  2QYU A;  3UUX A;  2OEV A;  4RVB A;  4UWL A;  1SA4 A;  4GTP A;  1TN6 A;  2WXL A;  3ZVV A;  4O1O A;  1HE8 A;  1S70 B;  5C1D A;  3TWT A;  5ITZ F;  3SI5 A;  3V31 A;  1TN8 A;  3PH0 C;  3U66 A;  2IJG X;  5BNW A;  5FQ6 A;  4I1O B;  1UOH A;  3PUJ A;  4E85 A;  5AAR A;  1OCR E;  4GCO A;  5ARF A;  4KXK B;  3U3W A;  4LER A;  3U64 A;  4JEH A;  3ESK A;  5B1A E;  3MZL B;  4EQF A;  3S7D A;  4JL0 A;  2XHE A;  3NF1 A;  4CZ2 D;  3HXE A;  3DSW A;  3EHQ A;  2H6G A;  1HU3 A;  2KCL A;  5DIZ A;  3FUL A;  1LTX A;  2L6B A;  3FEY A;  1OWM A;  3DSU A;  2NYJ A;  4Q94 A;  2XEN A;  1TN7 A;  3C72 A;  1HO8 A;  4LEU A;  2R17 C;  5AQ9 A;  4KMO A;  5KWD A;  3DXK G;  1RW2 A;  4BFR A;  3FUM A;  1GW6 A;  4AVX A;  1QBQ A;  1LD7 A;  1ELW A;  1PAQ A;  3D9H A;  3C5R A;  3ZYM A;  2Y4T A;  3VLF A;  3LDZ A;  4GTM A;  3UT4 A;  3IXE A;  1MYO A;  4PUC A;  3PZ4 A;  4U63 A;  4U0Z A;  3VLD A;  3BG0 B;  2XRY A;  4BEP A;  2FUL A;  3SO8 A;  3GZ2 A;  4C48 B;  1NA0 A;  1SZ9 A;  1SZA A;  1H6P A;  3BG1 B;  3WG7 E;  3S2A A;  3CEQ A;  4F53 A;  3CK7 A;  3WXX A;  1TJF A;  5EX0 A;  2BUG A;  3AG3 E;  3SBS A;  3CHQ A;  3Q9U C;  3G2U A;  4QFV A;  2VSO E;  3D9J A;  2QFC A;  4GTO A;  3QOU A;  4FU3 A;  3FH7 A;  1N11 A;  4JPS A;  3FUE A;  2KCK A;  1E8Z A;  1N4P A;  3ZNG A;  5T4Y A;  5CMY A;  4BT8 A;  3CLJ A;  3DPD A;  2XGS A;  4GTR A;  4ACK A;  3G2V A;  1E90 A;  3ZXS A;  4DK5 A;  3FY4 A;  4L7T A;  2VTB A;  5AIJ A;  1X5B A;  4CGV A;  2YNQ A;  4B89 A;  3PRE A;  2PM7 A;  1G3N B;  4OAU C;  3JCK C;  5IY5 E;  3FUF A;  2XPI A;  5T8I A;  5ENT D;  2WXJ A;  4UQZ A;  5ENS D;  1W3B A;  4V3I A;  4U8V D;  5AQ7 A;  3FTY A;  3O4Z A;  2F0Y A;  5EKQ D;  4HRM B;  3V2X A;  4GZ3 A;  2BKG A;  3CVN A;  2DYS E;  1KPS B;  3ZW3 A;  3JUI A;  1KZP A;  2WM9 A;  4F6R D;  2IOS A;  3AS8 A;  4UWF A;  5FZR A;  5EIB E;  3T5X A;  1OCC E;  1HG2 A;  3HVE A;  2XCB A;  2XGM A;  5DBK A;  5J90 A;  3ZRH A;  3PEV B;  4QQI A;  3TGO A;  1OCO E;  2B6C A;  1BLX B;  1U3D A;  1N95 A;  2C0M A;  3UIO C;  3HXC A;  4HRN A;  2OOE A;  4AP2 A;  2WQ7 A;  1MX2 A;  4OAV B;  4DI3 A;  4XZ4 A;  4BER A;  4APO A;  3PE4 A;  3TWQ A;  3EHR A;  4ATG A;  1NP7 A;  4WNE A;  3LS8 A;  2OND A;  5CEC B;  4DPR A;  5ARG A;  3ZYK A;  2Y3A A;  3CK8 A;  3FU5 A;  2H6I A;  2VGX B;  1QZ2 A;  4NAC A;  3DSV A;  4GU5 A;  1V54 E;  4GZD A;  4N2S A;  3APC A;  1OCZ E;  4NRH B;  1UG3 A;  5CRV A;  4IN3 B;  4B94 A;  5LX8 A;  4ANX A;  1IYG A;  4C0E A;  2DVW A;  3HHM A;  4I9C A;  2Q7F A;  3DWL G;  3TWS A;  3CVW A;  3IV0 A;  3B7U X;  1YMP A;  4AV7 A;  3Q7F A;  3TXN A;  3RRN B;  3QJZ A;  5A23 A;  1NZN A;  1E7V A;  4WNG A;  2GRO B;  4ANW A;  4CRW A;  1QYM A;  2KM4 A;  2EQX A;  2IOL A;  2EIK E;  4XI0 A;  5AQA A;  1YCS B;  3TWX A;  3SD5 A;  2FO1 E;  4CDR A;  1PC2 A;  4GZ6 A;  3LVR E;  2J09 A;  1ZB1 A;  2RG8 A;  2V4H C;  3T9K A;  4JXT A;  3K9I A;  4GZ5 A;  3PZD A;  4FJZ A;  1JCR A;  3FTV A;  4I9E A;  5LP0 A;  2V8S E;  3BU8 A;  4O60 A;  2NSZ A;  3JXI A;  2P9L G;  3JYS A;  4N5Q A;  4J6I A;  4URK A;  4HLE A;  2ETA A;  4A55 A;  1L5J A;  4CDN A;  4CDM A;  4HOS A;  3RK6 A;  4BSX A;  1N54 A;  2V4L A;  3RRM B;  4NIK A;  1NA3 A;  2V5F A;  1SQM A;  3FU0 A;  4W9R A;  4GPM A;  1Y8M A;  2BTD A;  3EHM A;  3CHS A;  2R05 A;  1FT2 A;  3CVV A;  2X3M A;  3CKB A;  2XS8 A;  5ENR D;  5EDS A;  1AWC B;  2X6J A;  4UUC A;  3AG2 E;  3ABM E;  3E37 A;  2YHE A;  3TG5 A;  2BED A;  3D9I A;  1RZ4 A;  3D9K A;  2FO7 A;  2KCV A;  4UI9 K;  5D0O D;  2WQ6 A;  5KJN A;  3LYA A;  3G2T A;  1HS6 A;  4MLP A;  3T8K A;  1FCH A;  4ACL A;  2ETB A;  1H2T C;  3J5Q B;  5AEN A;  2IEJ A;  4LUN U;  4H7Y A;  3V79 K;  4I2W A;  3Q73 A;  2VTB B;  2FBN A;  4I17 A;  2ZU6 B;  3TWU A;  3APD A;  4YVQ C;  2ZGG A;  4EPZ A;  5AYW D;  1Y6I A;  4JC8 A;  5EID A;  2Y1L E;  3FP3 A;  4HLL A;  4HVB A;  4APF A;  4IRU A;  3B7S A;  2GRM A;  3LJ3 A;  4O6F A;  4GPK A;  1HG5 A;  3EDT B;  1N94 A;  4N5C A;  4TUM A;  1XGW A;  3TXM A;  4KZC A;  3MYV A;  5FTP A;  1BI7 B;  3ULE G;  3Q5M A;  3ZUV B;  4GTQ A;  4FC8 A;  2JLB A;  5CBO A;  3CVX A;  3DPY A;  5FQ7 A;  4BX8 A;  4DX6 D;  3HVE B;  2IQC A;  3G2W A;  3UM2 A;  3PVL A;  2YIN A;  3ABL E;  3PEU B;  4G26 A;  2GGF A;  5FWQ A;  3AS4 A;  1SVX A;  3MKR A;  4B8A A;  4HOT A;  1O1S A;  4G8K A;  3FH8 A;  3VTX A;  5FJY A;  4AM9 A;  1OT8 A;  3CR3 A;  4F7A A;  4TUU A;  3RO3 A;  4EZK A;  5BV1 A;  4N39 A;  2QZA A;  1IQU A;  4YND A;  3HRA A;  1KLX A;  3ASF A;  2PNN A;  1YYH A;  3TJP A;  3Q49 B;  2GRP B;  1E96 B;  5LCW C;  2IF4 A;  3UIP C;  4KT6 B;  3PNL B;  3ZXP A;  3ZHE A;  4XI9 A;  3LCA A;  4N3C A;  4JHR A;  1JWF A;  4N3B A;  2KZT A;  2VSX E;  1AP7 A;  5BW8 C;  2RFA A;  4GA0 A;  1NI1 A;  2LO6 A;  4A1G A;  2MHK A;  5JJT A;  1N4R A;  1K1B A;  1JCQ A;  3FU6 A;  5HQ8 A;  3AU5 A;  3I3N A;  3AAA C;  1Z5S C;  4RG6 A;  4UI9 C;  1KZO A;  4NUR A;  2R5S A;  4GTT A;  1HF8 A;  3BUA A;  3DSX A;  3JXJ A;  1FPP A;  4JEU A;  4J8Y A;  2VSY A;  5CHE E;  2HM8 A;  5KBA A;  5CCL A;  2Y4U A;  4I43 A;  2J49 A;  3MJW A;  3ASG A;  4K03 A;  1E8W A;  2BF0 X;  2WXI A;  2X38 A;  3RSE G;  2I2O A;  3PZ3 A;  5ENO D;  3JQ0 A;  3SY2 A;  2DCP A;  1EF1 C;  2F8Y A;  4GML A;  3DEP A;  2L0T B;  1EPU A;  3MEK A;  3QKY A;  1U3C A;  1NL4 A;  4UQY A;  5CMW A;  1BU9 A;  2CHX A;  1WG0 A;  5JHA A;  1QQE A;  4BET A;  2AVP A;  3KD7 A;  1OUV A;  3FEX A;  4RG9 A;  5FZS A;  3L6A A;  5G04 J;  3MX3 A;  2HE0 A;  5HS0 A;  3N71 A;  1MZC A;  3IHV A;  5KNG A;  3SNX A;  1IXV A;  4LG6 A;  5LFA A;  4J8F A;  3Q7A A;  4F1S A;  4XE0 A;  4LCT A;  1JUQ A;  3FUK A;  5M72 A;  1SA5 A;  3SQV A;  3S7F A;  2WVI A;  3UKU G;  4AXH A;  4CT4 A;  5KJL A;  3MGB A;  3RJV A;  2OCC E;  3L22 A;  3UPV A;  3LY8 A;  2DZN A;  2ZIS A;  3KSL A;  2JAB A;  2MOW A;  3W9F A;  4O1P A;  3LEW A;  4U0S A;  2J07 A;  3QK0 A;  1E7U A;  3MV2 B;  4CEM A;  3HXD A;  2A5U A;  3MKQ A;  4JVS A;  5EYP F;  2HO1 A;  3S7B A;  3UT8 A;  2V5Q C;  4KBQ A;  2GRQ B;  3PZ1 A;  5AJD A;  2KC7 A;  1MQS A;  2WXM A;  4J8D A;  4HXI A;  3T5V A;  4RLY A;  4I6G A;  2X6I A;  3ISM C;  2PQN A;  3VLE A;  3AS5 A;  4AY5 A;  4DX5 D;  3X2Q E;  3UM3 A;  4B0Z A;  5KJK A;  2XEV A;  3SFX A;  2WXF A;  4PS3 A;  3FTX A;  4ILG A;  3KAE A;  3I4R B;  3CSF A;  4DX7 D;  4FP7 A;  1D8E A;  4A3T A;  3CQG B;  2FF4 A;  3CHM A;  3CVL A;  3ONK A;  3OXG A;  5B3S E;  4XIF A;  3NZU A;  4GZC A;  3RU0 A;  2XZD G;  4JB8 P;  5A7D B;  4OYS A;  4DI4 A;  2LAI A;  3OXL A;  2P9K G;  3ASO E;  4KVM A;  3ABK E;  2QY7 A;  3E34 A;  5LCW J;  3IKO B;  3OTN A;  2XCC A;  5B1B E;  2IY0 C;  1IHB A;  3AG4 E;  3D9M A;  1A5E A;  2J9Q A;  4WNF A;  3UI2 A;  3S7J A;  3EU9 A;  3HIZ A;  4RQI A;  2P58 C;  4DX1 A;  1X81 A;  2LXL A;  1LF8 A;  4ABN A;  4WWO A;  4BES A;  1TNZ A;  1O1R A;  1N4Q A;  4L23 A;  5E75 A;  4WND A;  1N0Q A;  2DZO A;  2EIL E;  3FFL A;  3FTS A;  5KJM A;  1EYH A;  3PS6 A;  4UI9 J;  2WXQ A;  4GA1 A;  3GW4 A;  5JJ6 A;  2CG3 A;  3KEA A;  4MBG A;  2XZT G;  3ZHE B;  3TWV A;  2WMN A;  2Y0B G;  4EBA G;  3FU3 A;  2IU1 A;  2DBA A;  5HI7 A;  2KZT B;  4PS7 A;  3RKV A;  3QWP A;  2DWZ A;  3LXU X;  4FLH A;  3MA5 A;  2WXG A;  1TJC A;  4Q69 A;  3TL5 A;  4A3V A;  3CIA A;  2J4D A;  5EIL A;  2IO3 C;  5BXU A;  3E4B A;  3EIJ A;  3I4G A;  2EIN E;  3BQO A;  4G1T A;  3R9M A;  4GYW A;  4JZY A;  3KS2 A;  2KAT A;  2H6F A;  1D9S A;  4N3A A;  3ONL A;  2OEW A;  2XPZ A;  2AW6 A;  3CK9 A;  3ML9 A;  4ILH B;  4N2Q A;  4U7E B;  4UWK A;  2BKK B;  4ATZ D;  3L17 A;  3UMV A;  4C9B B;  3IHY A;  4DUI A;  4UQX A;  2XRZ A;  4Y6W A;  3D9P A;  1HXI A;  3CHO A;  4GYO A;  1O5M A;  3C3Q A;  2L6J A;  4YDO A;  1S0P A;  3AG1 E;  3FHE A;  2P9N G;  1VDY A;  4GAA A;  3UM0 A;  2C0L A;  3FTU A;  2WB2 A;  4Z68 A;  4ZHB A;  1BI8 B;  4I1M A;  3I5P A;  5FT9 A;  4DRX E;  2H6H A;  3R9A B;  1TNU A;  5G04 C;  3Q78 A;  4RSY A;  4MRU A;  5T3R A;  3FUD A;  3QAR A;  3RIB A;  3U4T A;  3F6Q A;  2YQ8 A;  3QC1 A;  4U8H A;  1E8X A;  4BY6 A;  5JMN D;  3L16 A;  3CGH A;  2XEH A;  2L0I A;  5G55 A;  3ZYQ A;  4HI9 A;  1E8Y A;  2MYO A;  1JPL A;  3CKC A;  1H2V C;  4Y6C A;  4CYM D;  3LY9 A;  3CHR A;  3DSS A;  4K0R A;  2ETC A;  3RAU A;  3DXM G;  4X8Q A;  3NB2 A;  5EYL A;  3MKQ B;  1U2V G;  4NQ0 A;  2XS1 A;  4GTV A;  1MX4 A;  2LUH A;  2NC9 A;  3CVP A;  2WXK A;  4E6H A;  4HOU A;  2WXR A;  3B13 A;  3ESL A;  4K5A B;  2OVB A;  4GTS A;  4I6J A;  5E76 A;  2QC9 A;  3TWW A;  4YVO A;  4H7X A;  4XKB A;  2X6K A;  3LJN A;  4FJY A;  2P9I G;  4G24 A;  3NQP A;  2I9C A;  5D2M C;  1HZ4 A;  4OVU A;  4D10 C;  2EIM E;  1KT1 A;  2HYZ A;  2V0P A;  4HNA D;  1MHQ A;  4LRZ A;  5LOZ A;  2M63 A;  3O48 A;  3T8M A;  3FH5 A;  1ZBP A;  1FVF A;  3UKR G;  5ANL A;  3QNK A;  5HRY A;  1MX6 A;  1TNB A;  3IBE A;  3ASN E;  4U96 D;  4TXR A;  3ULY A;  3C98 A;  5FQ8 A;  3JUE A;  2ZGD A;  4YDE A;  1HH8 A;  4EHM A;  3PUK A;  4L2L A;  5KNH D;  3UQ3 A;  2MRI A;  2F37 A;  1N52 A;  1OWP A;  3L08 A;  3EJN A;  2CFU A;  4FUL A;  2KXP C;  3P2B A;  3QWV A;  4U04 A;  4HRL A;  2XPY A;  1WM5 A;  4G11 A;  4WAF A;  3KEZ A;  2CG2 A;  3RRU A;  3UTM A;  2QYJ A;  4JA9 A;  2R2L A;  1OWN A;  3URZ A;  2KBX A;  4HI8 A;  4G8L A;  4GA2 A;  3L54 A;  3ZGQ A;  4MKT A;  2UY1 A;  4FA6 A;  1H6O A;  5EX3 A;  4U07 A;  2WMO A;  2J8S D;  5BV0 A;  3HDX A;  3AU4 A;  1N0R A;  2UWJ G;  4IYP A;  2AXZ A;  3DRA A;  3FDH A;  3Q75 A; 
#chains in the Genus database with same CATH homology
 5LP0 A;  2X6I A;  2V8S E;  4JA7 A;  1Z3X A;  2PQN A;  3VLE A;  4HOQ A;  1OWO A;  2NXP A;  4EZL A;  3AS5 A;  4AY5 A;  3D9N A;  3UT7 A;  4AJW A;  5BPP A;  5CCM A;  3CHP A;  5FZQ A;  2NSZ A;  3PDN A;  2LNI A;  3FUN A;  3LPZ A;  2AXU A;  4B0Z A;  4B8C B;  3JYS A;  5KJK A;  4I6E A;  4HFG A;  2XEV A;  4FAD A;  2X6H A;  2WXF A;  4J6I A;  4PS3 A;  3SZ7 A;  4URK A;  4HLE A;  3FTX A;  3D9L A;  4ILG A;  1A17 A;  3KAE A;  3I4R B;  4R7L A;  4AY6 A;  3CSF A;  3PE3 A;  4XKC A;  4A55 A;  1L5J A;  4CDN A;  4FP7 A;  1UW4 B;  4XX5 A;  3CQG B;  4KZ0 A;  2RD0 A;  4A3T A;  2FF4 A;  1ELK A;  4G25 A;  3CHM A;  3CVL A;  4CDM A;  2VQ2 A;  4DJA A;  3CVY A;  4HOS A;  4FHK A;  3RK6 A;  3ONK A;  4BSX A;  3QWW A;  1N54 A;  2XGO A;  3SGH A;  2V4L A;  3RRM B;  3DBS A;  3OXG A;  1NA3 A;  4XIF A;  3NZU A;  4GZC A;  3ZN3 A;  3TAX A;  3RU0 A;  2V5F A;  3D9O A;  5G05 J;  1INZ A;  1H0A A;  1SQM A;  2WXN A;  5A7D B;  5JJ7 A;  3FU0 A;  3B7T A;  5ENN A;  3JQ1 A;  4W9R A;  4KYO B;  2VGX A;  4OYS A;  4DLO A;  4DI4 A;  2LAI A;  3OXL A;  3VTY A;  3ZPJ A;  1Y8M A;  2BTD A;  3EHM A;  4KVM A;  1OWL A;  2QY7 A;  3CHS A;  5FQ4 A;  5LCW J;  1QNF A;  3CVV A;  3UUX A;  2X3M A;  3EHN A;  3IKO B;  4RVB A;  4UWL A;  5KCM A;  3R7Q A;  2I1J A;  3OTN A;  2A4Z A;  3CKB A;  2WXL A;  2XCC A;  4GCN A;  5EDS A;  3ZVV A;  3ASD A;  1HE8 A;  2X6J A;  2OVF A;  2C2L A;  2YHE A;  5C1D A;  3SI5 A;  3TG5 A;  1KT0 A;  3D9M A;  3U66 A;  3PH0 C;  1UJK A;  2IJG X;  3D9I A;  2J9Q A;  2CHZ A;  4WNF A;  3S7J A;  5BNW A;  1H6K A;  3D9K A;  5FQ6 A;  3HIZ A;  4I1O B;  3PUJ A;  4E85 A;  2FO7 A;  3QDN A;  2P58 C;  2KCV A;  4GCO A;  4UI9 K;  5D0O D;  5ARF A;  2WQ6 A;  5KJN A;  4KXK B;  3U3W A;  1LF8 A;  3LYA A;  4ABN A;  4WWO A;  3G2T A;  2X6F A;  1HS6 A;  4MLP A;  3LKU A;  4L23 A;  5E75 A;  4LER A;  1FCH A;  4WND A;  3U64 A;  4ACL A;  4JEH A;  3ESK A;  1H2T C;  3MZL B;  5AEN A;  4UWG A;  4LUN U;  4H7Y A;  4ILI A;  3FFL A;  4I2W A;  3RO2 A;  3S7D A;  4EQF A;  2VTB B;  4JL0 A;  3FTS A;  5KJM A;  1EYH A;  2XHE A;  3PS6 A;  4UI9 J;  2FBN A;  4I17 A;  2ZU6 B;  3NF1 A;  2WXQ A;  3APD A;  4GA1 A;  3GW4 A;  4YVQ C;  5JJ6 A;  2J08 A;  4ANV A;  4EPZ A;  2CG3 A;  2FI7 A;  5AYW D;  4AEZ C;  4TV3 A;  3ZHE B;  1Y6I A;  4BTB A;  4FLB A;  4JW1 A;  1HU3 A;  2KCL A;  2WMN A;  4EBA G;  4JC8 A;  3FU3 A;  2J4B A;  3FP3 A;  5DIZ A;  2IU1 A;  3FUL A;  2DBA A;  4HVB A;  4APF A;  4IRU A;  3FEY A;  5HI7 A;  2KZT B;  2LSU A;  3B7S A;  3OAW A;  4PS7 A;  1OWM A;  3RKV A;  2GRM A;  3LJ3 A;  3QWP A;  4O6F A;  3LXU X;  3TG4 A;  4PDX A;  4FLH A;  3MA5 A;  4GPK A;  3QAQ A;  1HG5 A;  3EDT B;  2WXG A;  3ASH A;  3FTW A;  1TJC A;  4N5C A;  4Q69 A;  4Q94 A;  3TL5 A;  1XGW A;  2CFZ A;  3TXM A;  4A3V A;  3CIA A;  2J4D A;  1HO8 A;  4LEU A;  4KZC A;  1HX8 A;  3E4B A;  3MYV A;  4A1S A;  2R17 C;  3EIJ A;  3I4G A;  2AWI A;  4KMO A;  5FTP A;  4FHJ A;  4G1T A;  5AJL A;  4DLQ A;  4BX9 A;  3Q5M A;  4GYW A;  4BFR A;  3CVU A;  3FUM A;  4AIF A;  4JZY A;  1B89 A;  2WXH A;  3KS2 A;  1GW6 A;  3ZEF A;  2KAT A;  4AVX A;  4WUY A;  1PAQ A;  1ELW A;  2VSN A;  4N3A A;  3ONL A;  3ZYM A;  4FC8 A;  2JLB A;  2Y4T A;  3VLF A;  3CVX A;  3LDZ A;  5FQ7 A;  3MCX A;  2XPZ A;  2AW6 A;  2R59 A;  4BX8 A;  3CK9 A;  3UT4 A;  3ML9 A;  3HVE B;  2IQC A;  4ILH B;  4PUC A;  4U0U A;  4N2Q A;  3G2W A;  2DIW A;  4U63 A;  4UWK A;  5D0Q D;  3PVL A;  4P29 A;  1JWG A;  4U0Z A;  3BG0 B;  3VLD A;  3CQC B;  2PL2 A;  4TRQ A;  2XRY A;  3IEG A;  2FUL A;  3GZ2 A;  1NA0 A;  3L17 A;  1SZ9 A;  1SZA A;  3QB2 A;  3IHY A;  3UMV A;  2YIN A;  2ILR A;  3ZFW A;  4C9B B;  3G2S A;  1EDU A;  3BG1 B;  3PEU B;  4G26 A;  2GGF A;  4UWH A;  3S2A A;  3CEQ A;  5FWQ A;  4UQX A;  3AS4 A;  2XRZ A;  3MKR A;  4Y6W A;  4F53 A;  3D9P A;  1HFA A;  3CK7 A;  1TJF A;  3WXX A;  4B8A A;  5EX0 A;  2L9B A;  4HOT A;  3SHF A;  2BUG A;  1XNF A;  3APF A;  3SBS A;  1HXI A;  4ME2 A;  3CHQ A;  4KVO A;  3FH8 A;  3LY7 A;  3CHO A;  3G2U A;  4GYO A;  4GB9 A;  4QFV A;  4G2V A;  5G2N A;  2L6J A;  1S0P A;  3VTX A;  2VSO E;  3D9J A;  5FJY A;  1UN9 A;  2QFC A;  3FHE A;  4AM9 A;  3QOU A;  1VDY A;  4FU3 A;  4GAA A;  3CR3 A;  2C0L A;  3FH7 A;  4F7A A;  3LVQ E;  3FTU A;  4TUU A;  2WB2 A;  1DNP A;  2VYI A;  4JPS A;  3FUE A;  3RO3 A;  1ZU2 A;  3FUH A;  1P5Q A;  1E8Z A;  2KCK A;  2WQH A;  3GZS A;  3OXF A;  4I1M A;  5T4Y A;  4EZK A;  5BV1 A;  5CMY A;  4BT8 A;  4M3O A;  3Q47 B;  3CLJ A;  3I5P A;  5FT9 A;  3DPD A;  4N39 A;  2XGS A;  3ZIM A;  1IHG A;  1IQU A;  3R9A B;  4ACK A;  3G2V A;  4YND A;  1E90 A;  3ZXS A;  5G04 C;  4DK5 A;  4RSY A;  1KLX A;  3FY4 A;  3ASF A;  4MRU A;  2ION A;  5T3R A;  3FUD A;  3QAR A;  3RIB A;  4L7T A;  2VGY A;  3U4T A;  2VTB A;  3TJP A;  3Q49 B;  5AIJ A;  1E96 B;  1X5B A;  2YQ8 A;  3CST A;  3QC1 A;  4CGV A;  5LCW C;  4U8H A;  1E8X A;  2IF4 A;  2OV8 A;  4KT6 B;  4BY6 A;  3L16 A;  3PNL B;  3CGH A;  2YNQ A;  4GMJ A;  5ANR A;  3ZHE A;  4B89 A;  3PRE A;  2I1K A;  4XI9 A;  2L0I A;  2PM7 A;  4JHJ A;  3LCA A;  5G55 A;  3JCK C;  3ZYQ A;  2FEZ A;  4J0U A;  4N3C A;  4JHR A;  1E8Y A;  1JWF A;  4N3B A;  3FUF A;  4BTA A;  1H2U A;  2KZT A;  2VSX E;  1BPO A;  2XPI A;  2HR2 A;  1JPL A;  2WXP A;  5T8I A;  2WXJ A;  4UQZ A;  5BW8 C;  1W3B A;  4V3I A;  4GA0 A;  3CKC A;  2LO6 A;  4A1G A;  1H2V C;  2MHK A;  5JJT A;  4Y6C A;  1YA0 A;  2PZI A;  3FTY A;  3O4Z A;  3U9W A;  4BWR A;  3FU6 A;  3PRZ A;  2LSV A;  5HQ8 A;  3LY9 A;  3CHR A;  5EKQ D;  3AU5 A;  4K0R A;  3I3N A;  1IQR A;  3Q4A B;  2VJ8 A;  3MKQ B;  4NQ0 A;  4GZ3 A;  2NC9 A;  3CVP A;  3EIQ C;  3CVN A;  3ZW3 A;  2WXK A;  4RG6 A;  3JUI A;  4UI9 C;  4NUR A;  4E6H A;  2WM9 A;  2R5S A;  2UY1 B;  3HYM B;  1HF8 A;  2IOS A;  3AS8 A;  2WXO A;  4HOU A;  4UWF A;  4AOF A;  5FZR A;  3GZ1 A;  2WXR A;  5JHB A;  3B13 A;  3T5X A;  3L13 A;  4J8E A;  2GW1 A;  3ESL A;  2E0I A;  2OVB A;  3FUI A;  1HG2 A;  1PY1 A;  3PNT B;  4I6J A;  5E76 A;  3MV3 B;  4H7X A;  4XKB A;  2X6K A;  3HVE A;  4YVO A;  2XCB A;  4JEU A;  4FJY A;  2VSY A;  1H19 A;  4HS2 A;  1UN8 A;  5CHE E;  4G24 A;  4WWP A;  2XGM A;  2HM8 A;  5CCL A;  3NQP A;  2Y4U A;  4EBA A;  4I43 A;  2J49 A;  5DBK A;  3MJW A;  2I9C A;  5J90 A;  3ZRH A;  3ASG A;  1HZ4 A;  3PEV B;  4K03 A;  1E8W A;  2BF0 X;  2WXI A;  2X38 A;  4OVU A;  3SFZ A;  3TGO A;  2AXV A;  2I2O A;  4D10 C;  3JQ0 A;  3CV0 A;  1KT1 A;  2HYZ A;  2DCP A;  2C0M A;  1EF1 C;  1WAO 1;  2V0P A;  4GML A;  2PQR A;  2L0T B;  2OOE A;  1EPU A;  1MHQ A;  3MEK A;  4LRZ A;  3QKY A;  2PM6 A;  2M63 A;  1U3C A;  5LOZ A;  3O48 A;  3T8M A;  4AP2 A;  3FH5 A;  2WQ7 A;  1ZBP A;  4UQY A;  4DI3 A;  5BUZ A;  4XZ4 A;  4APO A;  3PE4 A;  3Q15 A;  3ULQ A;  5CMW A;  1FVF A;  5ANL A;  3QNK A;  4ATG A;  2CHX A;  4OVV A;  4ANU A;  2GRL A;  4L2Y A;  4EEC A;  5JHA A;  3SBT B;  1NP7 A;  1QQE A;  2AVP A;  2IFU A;  4IUL A;  4WNE A;  3KD7 A;  1OUV A;  3LS8 A;  4F3V A;  3FEX A;  2OND A;  4RG9 A;  5FZS A;  4DPR A;  5ARG A;  3IBE A;  3L6A A;  3ZYK A;  5G04 J;  3GYZ A;  3FUJ A;  4CGW A;  4JHK A;  2WPV A;  1Z6T A;  2Y3A A;  3CK8 A;  3FU5 A;  2JEK A;  3MX3 A;  2YHC A;  5J08 A;  2VGX B;  1QZ2 A;  3N71 A;  4NAC A;  3IHV A;  4GU5 A;  2I6H A;  3B7R L;  4I2Z A;  5BT1 A;  4GZD A;  3SNX A;  5G05 C;  4I1A A;  5LFA A;  3C98 A;  4J8F A;  5FQ8 A;  3APC A;  4N2S A;  4F1S A;  4EZJ A;  4NRH B;  4XE0 A;  4LCT A;  1UG3 A;  3R7R A;  4IN3 B;  4L1B A;  4B94 A;  1JUQ A;  4CCA A;  3UX4 A;  1UJJ A;  4ANX A;  5LX8 A;  4C0E A;  3FUK A;  1IYG A;  4G23 A;  1HH8 A;  5M72 A;  1TEZ A;  3HHM A;  4I9C A;  4PH4 B;  2LAH A;  3SF4 A;  3CVQ A;  3PUK A;  4C0M A;  3P1U A;  4L2L A;  3S7F A;  3UQ3 A;  2WVI A;  2MRI A;  2Q7F A;  4AXH A;  4CT4 A;  1N52 A;  3CVW A;  3IV0 A;  5KJL A;  3MGB A;  3B7U X;  5A6C A;  4HOR A;  3RJV A;  1OWP A;  3ML8 A;  3L08 A;  3UPV A;  3L22 A;  1WY6 A;  3LY8 A;  4AV7 A;  3EJN A;  3TXN A;  3RRN B;  2CFU A;  4FUL A;  4GYY A;  3P2B A;  3QWV A;  3QJZ A;  5A23 A;  4U04 A;  1NZN A;  4Q96 A;  4MS6 A;  1E7V A;  2XPY A;  1ELR A;  2MOW A;  1WM5 A;  4G11 A;  3LEW A;  4U0S A;  4WAF A;  3KEZ A;  2CG2 A;  4WNG A;  3RRU A;  2J07 A;  3QK0 A;  4ANW A;  2XQ0 A;  4CRW A;  4JA9 A;  2KM4 A;  2EQX A;  3FTZ A;  4PS8 A;  1E7U A;  1OWN A;  2IOL A;  3MV2 B;  3URZ A;  4J8S A;  3D3M A;  4XI0 A;  4CEM A;  3FWV A;  2A5U A;  3BEE A;  2CHW A;  3MKQ A;  4GA2 A;  4JVS A;  3L54 A;  2HO1 A;  1FVH A;  3S7B A;  3SD5 A;  3UT8 A;  3ZGQ A;  4CDR A;  4KBQ A;  1DVP A;  1PC2 A;  2E2E A;  1Z3Y A;  4MKT A;  4GZ6 A;  2UY1 A;  3LVR E;  4CT0 A;  2J09 A;  4FA6 A;  5EX3 A;  4U07 A;  5AJD A;  2RG8 A;  2KC7 A;  2WMO A;  5BV0 A;  4WWN A;  1MQS A;  3ENE A;  3ZYL A;  3HDX A;  3NZS A;  4JXT A;  2WXM A;  3K9I A;  3AU4 A;  4GZ5 A;  3PZD A;  4FJZ A;  4J8D A;  4HXI A;  2UWJ G;  3FTV A;  4IYP A;  5C2Y A;  2AXZ A;  3T5V A;  4BT9 A;  4I9E A;  3FDH A;  1U3D A;  4I6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...