4KYOB

Alanine-glyoxylate aminotransferase variant k390a in complex with the tpr domain of human pex5p
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
315
structure length
286
Chain Sequence
QFEEENPLRDHPQPFEEGLRRLQEGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACETLRDWLRYTPAYAHLVDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFGLPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine-pyruvate aminotransferase
publication title Ligand-Induced Compaction of the PEX5 Receptor-Binding Cavity Impacts Protein Import Efficiency into Peroxisomes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transport protein
total genus 115
structure length 286
sequence length 315
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13181 TPR_8 Tetratricopeptide repeat
B PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4kyoB00
4GYYA 3Q5MA 3JYSA 5FJYA 5A7DB 4GCOA 1OUVA 2KATA 3N71A 3Q47B 4YNDA 4BT9A 3ZHEB 2BUGA 5BNWA 2DBAA 4U07A 5CCLA 1NA0A 1YA0A 2V5FA 3EDTB 1E96B 4G2VA 2KCVA 3CEQA 3MA5A 2VSYA 3CK7A 1ZU2A 4HOUA 3CK8A 3FWVA 1P5QA 2FI7A 4IN3B 3GYZA 2PZIA 2ONDA 3CVNA 3PE4A 2GW1A 5JJ6A 3LY9A 5A6CA 1PC2A 3RKVA 3K9IA 3LY7A 4ABNA 5C1DA 3R9AB 2VGYA 4CGWA 3GW4A 3AS8A 4I9CA 1FCHA 4NQ0A 4GZ6A 1QQEA 3SZ7A 2XGMA 4JA7A 3QWVA 3CK9A 3E4BA 3QDNA 3VTYA 3HYMB 4J0UA 5FZQA 2XEVA 4BTAA 5G05J 4UQYA 3LCAA 2LNIA 4U04A 1HH8A 2WPVA 3LKUA 2C0MA 3ASFA 2VGXA 5EX3A 2XCCA 4XI9A 5EKQD 3ZFWA 4G26A 4N3BA 3TGOA 3ULQA 4N2QA 3LYAA 3TG5A 2UY1B 5FT9A 2IFUA 4WNEA 2Q7FA 5D0QD 2JLBA 3ZGQA 5G05C 4WNFA 3MV3B 5G04J 4B94A 2XGSA 4Y6CA 3CKBA 1A17A 5FZSA 2C0LA 4G1TA 3U3WA 2I6HA 2KC7A 3QKYA 4I2WA 4YVQC 3IEGA 3MKRA 4WUYA 3ASGA 4KYOB 2C2LA 2R5SA 5DIZA 3S7FA 3QWPA 1IYGA 5LCWJ 2YHCA 3ZHEA 3BEEA 3CKCA 1QZ2A 2NC9A 2IF4A 4GCNA 2PL2A 5G04C 2FEZA 2LSVA 1IHGA 2VSNA 3CV0A 3AS4A 4J8EA 5CCMA 3KAEA 3OXFA 2PQNA 3OXGA 2Y4TA 2FO7A 3WXXA 4APOA 3PDNA 4U0SA 3Q15A 4XIFA 1WAO1 4GZ3A 2XGOA 3URZA 5ARGA 1NZNA 1TJCA 4G24A 3CVLA 1ZBPA 2HO1A 4N5CA 4HOSA 4UI9J 5LCWC 5BW8C 3UQ3A 2PQRA 2MHKA 4HOQA 5ARFA 1ELWA 4ME2A 4RG6A 5KJLA 3CVQA 4N39A 4I9EA 4G25A 3FP3A 4GA0A 3S7JA 2OOEA 4I2ZA 3PE3A 3RU0A 3AS5A 3GZ2A 5AYWD 1ELRA 2KCLA 4UQXA 4N3AA 2J9QA 3UUXA 5HQ8A 2FF4A 4UI9K 4YVOA 2E2EA 3FFLA 3OXLA 4GYOA 5FTPA 4U0ZA 4XI0A 4UI9C 4GA2A 3ZPJA 1KT0A 2YQ8A 3RJVA 4N3CA 4KXKB 4RG9A 4F3VA 3TAXA 4GPKA 5KJMA 4BT8A 2XCBA 1KLXA 5HI7A 3U4TA 2VQ2A 1NA3A 5JJTA 4WNGA 3Q49B 4U0UA 1KT1A 3ASHA 2P58C 2HR2A 2LSUA 3MEKA 4A1SA 4H7YA 4G23A 4HOTA 2Y4UA 4CDRA 4BTBA 4I17A 5D0OD 4UQZA 4BWRA 1WM5A 2UWJG 5KJKA 1W3BA 3SF4A 3TG4A 4EQFA 2XPIA 3ZN3A 2KCKA 3VTXA 5M72A 3UPVA 3ESKA 1Y8MA 5DBKA 4AM9A 2QFCA 5FZRA 5BT1A 3S7DA 4Y6WA 4AIFA 4JL0A 3LPZA 5EX0A 3NF1A 3KD7A 2VGXB 4J8FA 3RO3A 3LY8A 4JA9A 4WNDA 4O6FA 2WQHA 4AY6A 3O48A 4N2SA 3RIBA 4JHRA 5KJNA 3ASDA 1XNFA 3QOUA 4NRHB 4GA1A 4GYWA 4J8DA 1B89A 1HXIA 5JJ7A 3KS2A 2VYIA 3Q4AB 3RO2A 4HORA 4LEUA 1HZ4A 3MV2B 5CHEE 3GZ1A 4H7XA 3CVPA 2HYZA 4I1AA 3QWWA 4KBQA 4W9RA 4AY5A 2AVPA 2UY1A 4GZ5A 2L6JA 3S7BA 4CGVA 2FBNA
chains in the Genus database with same CATH superfamily
3MKQB 2R05A 3D9HA 4I6JA 4GMJA 3LS8A 5BNWA 4K5AB 4U07A 3EDTB 3HXBA 3MGBA 4GMLA 3CEQA 4XEIG 4AP2A 2A4ZA 1DCQA 1WG0A 1ZU2A 4L2LA 4DX6D 3UIOC 3EIJA 1SZAA 3CK8A 1K3ZD 3C3RA 4HQDA 3C5RA 4XKBA 2PZIA 3PE4A 4MRUA 3DBSA 1JUQA 1MZCA 2EIKE 2XHEA 5A6CA 5JMND 3SFXA 1PC2A 3IV0A 3LY7A 4R7LA 1S63A 5AJDA 1Z3YA 3TWQA 1IKND 5FIOA 4DRXE 3B7UX 1HFAA 1FCHA 3ABME 4NQ0A 4AOFA 4YDEA 3FU6A 3ZW3A 2EIJE 4CCAA 5ENRD 3SZ7A 2FULA 4ILHB 4K03A 5T8IA 3QDNA 1H6PA 5G05J 4ILGA 5FINA 5B1AE 5LOZA 4GTMA 2LNIA 4KZCA 4U04A 1BLXB 1HH8A 4B8AA 2L9BA 5BV1A 3TWWA 1E8XA 2WPVA 3JXJA 2C0MA 4OAUC 2XZTG 3NB2A 4G26A 2YINA 1E7UA 3DXMG 5AIJA 4DX7D 3ULQA 1IQUA 1K8KG 1GW6A 4B89A 3PS6A 4GAAA 5D0QD 4HVBA 2JLBA 4GMRA 2WM9A 3ABLE 4D10C 3MV3B 3HIZA 2X6KA 5JHBA 4L2YA 4K0RA 2XEEA 2XGSA 5ENOD 3CKBA 3NZSA 5AQ7A 3C3OA 3CVYA 5H7PA 3U3WA 2OEVA 3UMVA 4C9BB 3RRMB 2KZTA 3LJNA 3ZU7B 3V2XA 4I2WA 3IEGA 1N54A 4GTPA 4F7AA 3MKRA 5JA4D 4C48B 3V31A 3S7FA 5BV0A 1SA5A 1U3CA 2OCCE 4FADA 1YYHA 3FTXA 2NC9A 2IF4A 3I5PA 5T3RA 4HBDA 4DUIA 4Q94A 4ANUA 2V5QC 2X6HA 3OXFA 1E8ZA 3UTMA 2PQNA 1RW2A 2A5UA 3DWLG 4KT6B 5HS0A 3CVVA 4FC8A 2XENA 2F8XK 4ACLA 4APOA 1OWMA 3PDNA 3ZYKA 3LEWA 3URZA 5ARGA 3ZXSA 5ANRA 4KZ0A 2HO1A 2ZGDA 4N5CA 5BW8C 3Q75A 3JUEA 2EILE 4AXHA 3UT8A 2PQRA 3FUMA 1EF1C 2V0PA 5AQ9A 3G2SA 5LP0A 3D9LA 4HOQA 1NL4A 3APCA 3ONKA 4RG6A 3MX3A 4DX2A 2GRQB 3UT7A 4N39A 4Q96A 3NZUA 3S7JA 3ULEG 2NXPA 3SQVA 5ENSD 3PZ1A 4WWOA 1E8WA 2KCLA 3QARA 4N3AA 3SGHA 4G11A 1XGWA 4FLBA 2FF4A 3HRAA 4BY6A 4YVOA 4OAVB 3C72A 4MBGA 4TXPA 4XI0A 3EU9A 4UI9C 5CMYA 2P9LG 4EZJA 2KZTB 2WXRA 1QNFA 3I4RB 4CDMA 3V79K 4MLPA 3TAXA 5CMWA 4BT8A 1X5BA 2XCBA 1KLXA 3PUJA 2BF0X 4O1OA 1UN8A 5JJTA 3RRUA 2Y69E 2P58C 4HI9A 4O60A 5D2MC 1SQMA 3MEKA 4F6RD 3NOGD 1Z3XA 3L13A 4AEZC 4HOTA 2HE0A 2I2OA 4CDRA 4ZHBA 3P2BA 4I17A 3UM2A 4BWRA 3FTUA 1OCCE 2LAHA 2WXOA 4FLHA 1OCRE 2DIWA 2KCKA 3HG0D 3ESKA 1Y8MA 4KVMA 3FUJA 3FULA 2MOWA 3B95A 3S7DA 4Y6WA 3MYVA 4JL0A 3LPZA 5EX0A 3QNKA 3RK6A 1N11A 3PVLA 4BERA 2IJGX 4J8FA 3CLJA 3BQOA 4UUCA 1OWPA 4WNDA 3TWTA 4EZKA 1TNZA 2V4LA 2DZOA 4AY6A 4N2SA 4JHRA 5KJNA 2R59A 5G2NA 5CEAA 5LX8A 2VJ8A 4PS3A 3JXIA 3DSWA 4GA1A 4E6HA 4TRQA 3ZNGA 4TV3A 3Q4AB 3RO2A 1HZ4A 1H6KA 3MV2B 2P9KG 3FU3A 4UWHA 5KBAA 4FULA 3QWWA 4KBQA 4HRNA 4DI3A 4Q69A 4Z68A 3CSTA 3FY4A 4TUMA 2JABA 3Q5MA 2F8YA 4GCOA 1FT2A 5E76A 3FH5A 1QBQA 4YDOA 3TWSA 3ZHEB 4HXIA 5CCLA 3J5QB 4JPSA 1H2TC 1E96B 3TJPA 2R17C 4G2VA 4ILIA 2VSYA 4GB9A 2WMOA 3CK7A 3OTNA 3TWUA 3VLFA 2ZU6B 3FWVA 4IN3B 3ONLA 2AWIA 2ONDA 3CVNA 2GW1A 1K1BA 3RKVA 3CIAA 2P9UG 4GZDA 4BSXA 5C1DA 3FEXA 2M63A 4A3VA 3FDHA 3I3NA 4I9CA 4WWPA 3ENEA 4I1MA 4ANVA 3PH0C 3F6QA 3ISMC 5FQ7A 4DLOA 3PREA 4J0UA 3ZRHA 3GZSA 3FTYA 5ENTD 4U96D 3PZDA 2XS8A 4GTSA 2WXKA 3QK0A 2WXQA 3UIPC 4CEMA 4YDWA 4NIKA 5HRYA 4I1OB 2WQ6A 3LKUA 4GZCA 3ASFA 2VGXA 5FQ6A 5EX3A 2XCCA 4XI9A 3PRZA 1A5EA 3EHNA 3W9FA 3Q9UC 1DCEA 5BXOA 5ANLA 3D3MA 3FUEA 4JW1A 3JUIA 5EN5D 3FTZA 2ETCA 4KMOA 4WNEA 2Q7FA 3SBSA 2IQCA 4WNFA 1FT1A 4U8VD 3B7RL 3FU5A 4B8CB 4G1TA 2J4DA 3UX4A 2H6HA 4A63B 2KC7A 5KWDA 1JCSA 3CQGB 1N0RA 5BPPA 1TNYA 3JQ0A 4KYOB 2R5SA 5DIZA 1UW4B 2DCPA 1HE8A 3QWPA 4A1GA 3AG4E 5J08A 2YNQA 1QZ2A 4JXTA 4HNAD 2PL2A 5G04C 2FEZA 2LSVA 4JEHA 1IHGA 3CV0A 1D8DA 3KAEA 3DRAA 3NAWA 3VLEA 4CRWA 2Y4TA 3D9KA 1MX2A 4M3OA 3WXXA 1DNPA 4U0SA 5KNHD 3UM0A 5EYLA 3Q15A 4LUNU 1MX6A 2J8SD 1FPPA 3KSLA 1WAO1 2XGOA 3CVLA 4UI9J 3FTWA 5LCWC 1N9AA 5AENA 1Z6TA 2P9PG 4E85A 1N4RA 3HDXA 5ARFA 2IOSA 2L0IA 5T4YA 4FA6A 4HS2A 1N0QA 3NOCD 3CVQA 2WXMA 4G25A 4GA0A 2WXIA 4M7CA 3TWXA 2OOEA 3QC1A 2GRMA 5AYWD 2J49A 3PUKA 2A5EA 3FH8A 1HG2A 2J09A 2KM4A 2WXGA 1N4SA 4U8HA 1E90A 5D66A 2B0OE 3WG7E 2GGFA 2EINE 5EIDA 4GA2A 2YQ8A 3L6AA 4N3CA 4GTOA 2WVIA 2MYOA 4U95D 3ASOE 1LD8A 1U3DA 2VSOE 4GPKA 3SO8A 5ITZF 3QJZA 5KJMA 2P9IG 4IYPA 1S64A 4WWNA 5HI7A 3D9MA 2DZNA 2VQ2A 4LERA 1NA3A 5CEDB 2XPZA 4UWKA 5KNGA 2CHWA 3CGHA 2X6FA 3UM3A 2IOLA 4PDXA 4PUCA 1AWCB 1FVFA 2LSUA 3L9TA 3ML9A 3IHYA 4A1SA 4H7YA 4G23A 1KZPA 4RQIA 5D0OD 3SF4A 3TG4A 2XPIA 5AQAA 3ZN3A 4TXRA 4HLEA 4J8YA 4OVVA 1EPUA 1EYHA 3LVQE 1JWGA 4AIFA 3SBTB 2B6CA 2P2CP 3E37A 3PZ4A 3RO3A 4XE0A 4TXQA 1EDUA 4O6FA 2J08A 3B7BA 3SI5A 4LSZE 3RAUA 5EDSA 1O1SA 5ENQD 3R7QA 3L22A 2VTBA 4J8DA 2ETAA 2J07A 1B89A 3SFZA 3D9OA 1O5MA 4G8LA 3ZXPA 4MS6A 2P9NG 4JHKA 3CVPA 4W9RA 4L7TA 2AVPA 2UY1A 4HRMB 2X3MA 3ML8A 3S7BA 4CGVA 4GTQA 2FBNA 4QQIA 3JYSA 5FJYA 5A7DB 1V54E 1OCOE 3PNLB 2KATA 2KXPC 3N71A 3TL5A 2PNNA 4B0ZA 1S0PA 4YNDA 4BT9A 2BUGA 5CRVA 2DBAA 2ZGGA 3ZUVB 1YA0A 2OEWA 2GRRB 1UJKA 2RD0A 2Y1LE 2ZXWE 2IU1A 2X6JA 4HOUA 4FHKA 5G55A 1P5QA 2IO3C 3GYZA 1D8EA 3Q73A 4YDYA 1IQRA 3LY9A 1ELKA 3Q78A 3IKOB 2YHEA 4ABNA 4FJZA 5A23A 1NP7A 2VGYA 4FP7A 1K1AA 5FQ8A 3GW4A 3AS8A 5J90A 3C3QA 1V55E 2NYJA 1AP7A 3ULYA 2XGMA 3DPDA 2L0TB 2RFAA 1BI7B 3BUAA 1DVPA 2CFUA 5FQ4A 3E4BA 4URKA 4K5BA 4BTAA 1TR4A 3QAQA 4UQYA 3LCAA 3V2OA 1IXVA 1H0AA 4GTTA 2DVWA 1HG5A 1SW6A 1TN7A 4LRZA 3RSEG 4ANWA 3CVWA 4WAFA 4A55A 2P9SG 3U64A 3V30A 3TWVA 3S2AA 5EKQD 2DWZA 4DLQA 1O1RA 4G8KA 1OT8A 4N2QA 3AG1E 2LXMA 3TG5A 4I6EA 2UY1B 4JZYA 5FT9A 3HXEA 1JCRA 1PY1A 3ZGQA 1Y6IA 3T9KA 3L17A 5G04J 1OXJA 5JHAA 4FJYA 3CQCB 3PZ3A 3I4GA 3EJNA 4Y6CA 3SFYA 4C0MA 4EBAA 2I9CA 4N5QA 3QKYA 1SVXA 3HVEA 2H6FA 1E8YA 3RRNB 2FO1E 2IEJA 1HU3A 3R9MA 4WUYA 3ASGA 4L9PA 2IONA 3MKQA 3UXGA 4CZ2D 4GTVA 3X2QE 2XRZA 4F53A 3FUIA 1IYGA 5LCWJ 1JWFA 2R2LA 2YHCA 3AU4A 3BEEA 2XZDG 3ZVVA 2IO2C 4U8YD 1TNUA 3CKCA 4GCNA 1HX8A 1TNBA 3DPYA 4J6IA 3AS4A 5CCMA 4JVSA 4EECA 3TWRA 5AAOA 4BSZB 3G2VA 1ZB1A 3OXGA 2FO7A 4LCTA 3CSFA 1INZA 3VLDA 4DJAA 2ZISA 3CHRA 3E30A 4GZ3A 1SZ9A 1NZNA 4G24A 5CERB 2AXZA 1YMPA 4EBAG 1JPLA 2E0IA 1UN9A 1ELWA 2WXHA 5KJLA 5CECB 1RZ4A 3O4ZA 1KPSB 3AAAC 3FP3A 2ETBA 3PE3A 3RU0A 3AS5A 2RFMA 1TNOA 4U63A 4B93B 1S70B 3HHMA 4UI9K 3FFLA 3OXLA 4GYOA 1OWNA 3R7RA 4OYSA 3C98A 2OVBA 3B7SA 4KXKB 3HXFA 2WXNA 3PEUB 2AXUA 4FU3A 1OCZE 4EPZA 4LNBA 4XKCA 4F3VA 1NFIE 3FU0A 2BKGA 2CHZA 2QC9A 4ANXA 3L82A 2WB2A 3Q49B 4U0UA 2DYRE 3FH7A 3KEZA 3ASHA 2J4BA 3T5XA 2I1JA 2RKKA 3LVRE 3FUKA 5FWQA 4K5CA 1E7VA 3W9GA 4TUUA 5CRUA 4GPMA 1NI1A 4BTBA 1HS6A 4CT4A 4UQZA 3IBEA 2CHXA 4PS7A 1WM5A 4JEUA 2UWJG 4EHMA 3APFA 5KJKA 3HXDA 1BU9A 3VTXA 2QY7A 1BPOA 4IULA 4GU5A 2OVFA 5DBKA 4AM9A 2QFCA 2IY0C 5FZRA 2VGXB 1D9SA 4LG6A 3ZIMA 4EZLA 4JA9A 1L5JA 3G2TA 2WQHA 3O48A 3EUVA 4ATZD 1HF8A 2CG2A 1X81A 2F0YA 3TXMA 2VGEA 1TN6A 3EHRA 3UINC 4XZ4A 3ASDA 4AV7A 4P29A 1XNFA 3UKUG 1LD7A 2XPYA 4GYWA 1HXIA 3T8KA 5JJ7A 3KS2A 2VYIA 4HORA 4PS8A 3ASNE 3KEAA 4FHJA 1PAQA 5EILA 2XQ0A 2CFZA 1LF8A 3CR3A 3DSUA 1BD8A 4AY5A 3UT4A 4GZ5A 3OAWA 2L6JA 1N52A 4GYYA 3Q7FA 4RLYA 1OUVA 2WXPA 3Q47B 3BG1B 3HXCA 4CT0A 1NA0A 2V5FA 4L1BA 2KCVA 3MA5A 3Q7AA 4HLLA 3IXEA 2Y0BG 4JHJA 3ZYLA 3D9IA 4BX9A 3FHEA 2FI7A 2CG3A 5C2YA 2QZAA 4PH4B 5JJ6A 3PEVB 2BEDA 3DEPA 4HRLA 2GRLA 3K9IA 3E33A 3AG2E 3U66A 1N94A 3R9AB 5BXUA 3AJIA 5CBOA 4CGWA 4BX8A 1WDYA 1IHBA 2QYJA 3UI2A 1BI8B 1N4QA 1OWLA 4DX1A 4GZ6A 2WQ7A 1QQEA 4RSYA 3EIQC 1MQSA 3CHMA 4A3TA 3NBNB 1N95A 4CDNA 1O1TA 4JA7A 3SY2A 3QWVA 3CK9A 3DEOA 3JQ1A 1SA4A 4J7WA 3VTYA 3HYMB 5FZQA 1MHQA 2NSZA 2XEVA 5EIBE 3AG3E 5AN8A 2QYUA 2V4HC 4QFVA 1VDYA 5AJLA 2LXLA 1N4PA 2MRIA 2BKKB 3E32A 3ZFWA 2LUHA 3IHVA 4N3BA 3TGOA 5KCMA 3LJ3A 3QB2A 4O1PA 3AU5A 3DXKG 2PM7A 3LYAA 3CHSA 3J5PA 2IFUA 4LNUD 3E34A 3CHOA 1TEZA 5G05C 5E75A 2VSXE 3FUDA 3L16A 4J8SA 2R02A 4B94A 4AVXA 3U9WA 1TJFA 3G2WA 1A17A 5FZSA 2C0LA 4CYMD 2I6HA 3CVXA 1HO8A 4L23A 3ABKE 3DSTA 4YVQC 2LAIA 4XX5A 1TYQG 4U7EB 4F1PA 3PNTB 4NACA 4UWLA 4UWFA 3EU5A 2JEKA 2C2LA 2XS1A 2XRYA 4C0EA 1Z5SC 3ZHEA 2GRNB 4HI8A 3G2UA 1UG3A 5B1BE 2OV8A 2VSNA 4J8EA 4HB5A 4I6GA 3B13A 1DC2A 3EHQA 1UOHA 3Q79A 3ZYQA 3APDA 3UM1A 2Y3AA 4XIFA 2L6BA 1OWOA 3CHQA 4ZFHA 3ZYMA 2V8SE 1TJCA 5B3SE 1H6OA 1ZBPA 4HOSA 4DI4A 4UWGA 3UQ3A 1Q2ZA 3ZEFA 2VTBB 2MHKA 3DSSA 3MZLB 2R03A 5AARA 3MCXA 4ME2A 3CVUA 5ENNA 2ILRA 5CBNA 4V3IA 2ZIRA 4I9EA 3LXUX 1LTXA 2BTDA 4I2ZA 1WY6A 3GZ2A 1ELRA 5AQBA 2DYSE 4UQXA 1U2VG 2J9QA 3FTSA 4OVUA 3UUXA 3ZKJA 2H6IA 2WXJA 5HQ8A 2XEHA 2E2EA 5FTPA 4AJWA 4U0ZA 2PM6A 2F37A 3ZPJA 3FUHA 1KT0A 3FUFA 3RJVA 2WXFA 4RG9A 2KBXA 3DSXA 3BG0B 3CHPA 3D9JA 4RVBA 3ESLA 3SNXA 5BUZA 2X38A 3U4TA 4JD2G 5ENPD 4WNGA 2WMNA 1KT1A 2HR2A 4BFRA 4IRUA 4JB8P 2AJAA 2Y4UA 4MKTA 2AXVA 2GRPB 4F1SA 3SHFA 2H6GA 3FTVA 4APFA 2I1KA 4DPRA 2LO6A 1FVHA 1OY3D 1KZOA 1W3BA 2WXLA 4EQFA 3SD5A 1MX4A 2X6IA 3NQPA 4BETA 4KVOA 5M72A 2GROB 3UPVA 4ATGA 3MJWA 5EYPF 5BT1A 4JC8A 2RG8A 3LDZA 3EHMA 3NF1A 3KD7A 3B7TA 3PZ2A 1H2VC 4I43A 1QYMA 3T8MA 3LY8A 4ACKA 1H2UA 3KSQA 1YCSB 4NURA 3RIBA 3P1UA 3T5VA 4HFGA 5LFAA 1G3NB 2EQXA 3QOUA 4NRHB 4X8QA 3L54A 1UJJA 3Q9NC 2EIME 3FEYA 4DK5A 4LEUA 5HKPA 3L08A 4GTRA 2AW6A 4BEPA 1TN8A 3JCKC 5CHEE 1MJ0A 3UKRG 3GZ1A 3BU8A 4H7XA 3TXNA 4LNGA 2HYZA 4I1AA 3DSVA 1MYOA 4BESA 3HVEB 3FUNA 5IY5E 4DX5D 1H19A 3D9PA 1JCQA 3D9NA 2HM8A
chains in the Genus database with same CATH topology
1N52A 4GYYA 3MKQB 3Q5MA 3JYSA 5FJYA 5A7DB 4GCOA 3PNLB 1OUVA 2KATA 2WXPA 5E76A 3N71A 3TL5A 3Q47B 3FH5A 3BG1B 1S0PA 4B0ZA 4I6JA 4YNDA 4BT9A 4CT0A 4GMJA 3LS8A 3ZHEB 2BUGA 4HXIA 5BNWA 2DBAA 4U07A 5CCLA 1NA0A 4JPSA 1YA0A 2V5FA 1H2TC 1E96B 3EDTB 2R17C 4G2VA 3TJPA 4L1BA 3MGBA 1UJKA 2KCVA 2RD0A 3CEQA 3MA5A 4GMLA 4ILIA 2IU1A 2VSYA 4GB9A 4AP2A 4JHJA 3ZYLA 2WMOA 3D9IA 2A4ZA 4BX9A 3FHEA 2X6JA 3CK7A 1ZU2A 4HOUA 4L2LA 4FHKA 3OTNA 5G55A 3VLFA 3EIJA 1SZAA 3CK8A 2ZU6B 1P5QA 2FI7A 3FWVA 4IN3B 2CG3A 3GYZA 3ONLA 5C2YA 2AWIA 4XKBA 2PZIA 2ONDA 3CVNA 3PE4A 4MRUA 2GW1A 3DBSA 4PH4B 1JUQA 1IQRA 5JJ6A 2XHEA 3LY9A 5A6CA 3PEVB 1PC2A 1ELKA 3IKOB 3RKVA 2GRLA 2YHEA 3CIAA 3IV0A 3K9IA 3LY7A 4GZDA 4R7LA 4ABNA 4BSXA 5C1DA 5AJDA 3U66A 1Z3YA 4FJZA 3R9AB 3FEXA 2M63A 5A23A 1NP7A 4A3VA 2VGYA 4CGWA 4BX8A 4FP7A 3FDHA 5FQ8A 3GW4A 3AS8A 5J90A 3B7UX 1OWLA 1HFAA 3I3NA 4I9CA 1FCHA 4WWPA 4NQ0A 4AOFA 3ENEA 4I1MA 4GZ6A 4ANVA 2WQ7A 3PH0C 1QQEA 4RSYA 3FU6A 3ZW3A 3EIQC 1MQSA 3CHMA 4A3TA 4CCAA 4CDNA 3SZ7A 2XGMA 2FULA 3DPDA 4JA7A 2L0TB 3QWVA 3CK9A 3JQ1A 5FQ7A 4DLOA 3PREA 1DVPA 2CFUA 4ILHB 3E4BA 3QDNA 4K03A 5FQ4A 5T8IA 3VTYA 4URKA 3HYMB 4J0UA 3ZRHA 5FZQA 1MHQA 2NSZA 2XEVA 3GZSA 4BTAA 5G05J 4ILGA 3QAQA 4UQYA 3FTYA 3LCAA 5LOZA 1H0AA 3PZDA 2LNIA 4KZCA 2WXKA 4U04A 1HH8A 4B8AA 3QK0A 2L9BA 1VDYA 1HG5A 2WXQA 4QFVA 4CEMA 5BV1A 1E8XA 5AJLA 4I1OB 2WQ6A 4LRZA 2WPVA 3LKUA 2C0MA 2MRIA 4GZCA 4ANWA 3CVWA 3ASFA 4WAFA 2VGXA 5FQ6A 4A55A 5EX3A 2XCCA 3U64A 4XI9A 3PRZA 3S2AA 5EKQD 3ZFWA 4G26A 3EHNA 2YINA 3IHVA 4N3BA 4DLQA 1E7UA 3TGOA 5AIJA 5KCMA 3LJ3A 3ULQA 3QB2A 3AU5A 5ANLA 4N2QA 3D3MA 3FUEA 2PM7A 1IQUA 3LYAA 4JW1A 1GW6A 3TG5A 3JUIA 4I6EA 2UY1B 3PS6A 3CHSA 4JZYA 4GAAA 4B89A 3FTZA 5FT9A 2IFUA 4KMOA 4WNEA 2Q7FA 5D0QD 3CHOA 4HVBA 2JLBA 3SBSA 1PY1A 1TEZA 2IQCA 2WM9A 3ZGQA 5G05C 4D10C 1Y6IA 4WNFA 5E75A 3MV3B 2VSXE 3FUDA 3L16A 3L17A 4J8SA 5G04J 3HIZA 2X6KA 5JHAA 5JHBA 4FJYA 3CQCB 4L2YA 4GPKA 4K0RA 4B94A 4AVXA 3I4GA 3B7RL 3EJNA 2XGSA 3FU5A 3U9WA 1TJFA 3G2WA 4Y6CA 4B8CB 3CKBA 1A17A 3NZSA 5FZSA 4C0MA 2C0LA 4G1TA 2J4DA 3CVYA 3U3WA 3UX4A 3UMVA 4C9BB 4EBAA 3RRMB 2I9CA 2I6HA 2KC7A 2KZTA 3CVXA 1HO8A 4L23A 3QKYA 3HVEA 1E8YA 4I2WA 3RRNB 4YVQC 2LAIA 4XX5A 3CQGB 3IEGA 1HU3A 3PNTB 1N54A 4NACA 4UWLA 5BPPA 4F7AA 3MKRA 4UWFA 3ASGA 4WUYA 2JEKA 3JQ0A 2IONA 3MKQA 2C2LA 4KYOB 2R5SA 5DIZA 1UW4B 2DCPA 2XRZA 1HE8A 2XRYA 4C0EA 3S7FA 3QWPA 4F53A 3FUIA 1IYGA 5LCWJ 1JWFA 4A1GA 2YHCA 3ZHEA 3AU4A 3BEEA 3ZVVA 5BV0A 3G2UA 1U3CA 4FADA 5J08A 1UG3A 2YNQA 3CKCA 1QZ2A 3FTXA 2NC9A 4JXTA 2IF4A 3I5PA 4GCNA 5T3RA 2PL2A 5G04C 2FEZA 1HX8A 2LSVA 2OV8A 4Q94A 4ANUA 4JEHA 4J6IA 1IHGA 2VSNA 3CV0A 3AS4A 4J8EA 2X6HA 5CCMA 4JVSA 4EECA 3KAEA 4I6GA 3B13A 3VLEA 3OXFA 1E8ZA 4CRWA 2PQNA 3G2VA 2A5UA 3APDA 3OXGA 4KT6B 3ZYQA 2Y4TA 4FC8A 3CVVA 2FO7A 4LCTA 3D9KA 3CSFA 3WXXA 4M3OA 1INZA 4ACLA 4APOA 1DNPA 1OWMA 3PDNA 3ZYKA 4U0SA 3VLDA 4DJAA 2Y3AA 3Q15A 4LUNU 4XIFA 3LEWA 1OWOA 3CHRA 1WAO1 3CHQA 4GZ3A 1SZ9A 2XGOA 3ZYMA 3URZA 5ARGA 2V8SE 5ANRA 3ZXSA 1NZNA 1TJCA 4G24A 3CVLA 4KZ0A 1ZBPA 2HO1A 4N5CA 4HOSA 4UI9J 4DI4A 4UWGA 2AXZA 3FTWA 5LCWC 5BW8C 3UQ3A 5AENA 4AXHA 3UT8A 3ZEFA 2PQRA 1Z6TA 2VTBB 3FUMA 1EF1C 2MHKA 2V0PA 4EBAG 3G2SA 5LP0A 3D9LA 4E85A 4HOQA 3MZLB 3HDXA 1JPLA 2E0IA 1UN9A 2IOSA 3MCXA 3APCA 1ELWA 3ONKA 5ARFA 4ME2A 3CVUA 2WXHA 4RG6A 5ENNA 5KJLA 3MX3A 2L0IA 2ILRA 5T4YA 4FA6A 3O4ZA 4HS2A 3UT7A 3CVQA 4N39A 4Q96A 4V3IA 3NZUA 2WXMA 4I9EA 4G25A 3FP3A 4GA0A 3LXUX 3S7JA 2WXIA 2NXPA 2OOEA 3QC1A 2BTDA 3PE3A 4I2ZA 3RU0A 4WWOA 1E8WA 3AS5A 1WY6A 2GRMA 3GZ2A 5AYWD 1ELRA 2J49A 2KCLA 3PUKA 4UQXA 3QARA 4N3AA 3SGHA 2J9QA 1XGWA 4G11A 3FTSA 4OVUA 3UUXA 3FH8A 2WXJA 1HG2A 4FLBA 2J09A 2KM4A 5HQ8A 4U63A 2FF4A 4BY6A 3HHMA 4UI9K 2WXGA 4YVOA 2E2EA 3FFLA 4U8HA 3OXLA 1E90A 4GYOA 5FTPA 4AJWA 2GGFA 4U0ZA 4XI0A 4UI9C 2PM6A 1OWNA 4GA2A 5CMYA 3ZPJA 3FUHA 1KT0A 4EZJA 2YQ8A 3FUFA 3L6AA 3RJVA 3R7RA 4N3CA 4OYSA 3C98A 2KZTB 2WXRA 2OVBA 1QNFA 2WXFA 3I4RB 3B7SA 4KXKB 4RG9A 2WVIA 2WXNA 4CDMA 4MLPA 3PEUB 2AXUA 1U3DA 2VSOE 3BG0B 4FU3A 3TAXA 4EPZA 4XKCA 3CHPA 4F3VA 3QJZA 5CMWA 4BT8A 1X5BA 2XCBA 3FU0A 2CHZA 5KJMA 3D9JA 4IYPA 1KLXA 4RVBA 3ESLA 3PUJA 4WWNA 3SNXA 5BUZA 4ANXA 2BF0X 5HI7A 2X38A 3D9MA 2VQ2A 4LERA 3U4TA 1NA3A 2WB2A 2XPZA 4UWKA 1UN8A 5JJTA 2CHWA 3CGHA 4WNGA 3Q49B 4U0UA 3RRUA 3FH7A 2WMNA 2X6FA 3KEZA 1KT1A 3ASHA 2J4BA 2P58C 3T5XA 2IOLA 4PDXA 4PUCA 1SQMA 2HR2A 2I1JA 1FVFA 2LSUA 3MEKA 4BFRA 3ML9A 1Z3XA 3IHYA 4IRUA 4A1SA 4H7YA 3L13A 4G23A 4AEZC 3LVRE 3FUKA 5FWQA 4HOTA 2Y4UA 4MKTA 2AXVA 1E7VA 4F1SA 2I2OA 3SHFA 4TUUA 3FTVA 4CDRA 4APFA 3P2BA 2I1KA 4DPRA 4BTBA 2LO6A 1FVHA 1HS6A 4I17A 4CT4A 5D0OD 4UQZA 4BWRA 3IBEA 3FTUA 2CHXA 4PS7A 1WM5A 4JEUA 2LAHA 2UWJG 3APFA 5KJKA 1W3BA 3SF4A 2WXOA 3TG4A 4FLHA 2WXLA 4EQFA 3SD5A 2X6IA 3NQPA 2DIWA 2XPIA 3ZN3A 2KCKA 3VTXA 2QY7A 4KVOA 1BPOA 4HLEA 5M72A 3UPVA 3ESKA 4IULA 1Y8MA 4GU5A 4KVMA 4OVVA 4ATGA 2OVFA 3MJWA 3FUJA 3FULA 5DBKA 4AM9A 1EPUA 1EYHA 2QFCA 3LVQE 5FZRA 5BT1A 2MOWA 3S7DA 1JWGA 4JC8A 4Y6WA 4AIFA 2RG8A 3MYVA 4JL0A 3LPZA 3LDZA 3SBTB 5EX0A 3QNKA 3EHMA 3RK6A 3NF1A 3KD7A 3B7TA 1H2VC 4I43A 2VGXB 3PVLA 3T8MA 2IJGX 4J8FA 3CLJA 4XE0A 3LY8A 3RO3A 1OWPA 4ACKA 3ZIMA 1H2UA 4EZLA 4JA9A 4WNDA 1L5JA 3G2TA 4EZKA 1EDUA 2V4LA 4O6FA 2J08A 2WQHA 4AY6A 3O48A 3SI5A 4N2SA 1HF8A 2CG2A 4NURA 3RIBA 4JHRA 5KJNA 2R59A 3TXMA 5G2NA 5EDSA 3P1UA 3T5VA 5LX8A 2VJ8A 4HFGA 4PS3A 5LFAA 4XZ4A 3ASDA 4P29A 2EQXA 4AV7A 1XNFA 3R7QA 3QOUA 4NRHB 3L22A 3L54A 2XPYA 4GA1A 4GYWA 4J8DA 2VTBA 1UJJA 2J07A 4E6HA 1B89A 1HXIA 4TRQA 4TV3A 3SFZA 5JJ7A 3KS2A 2VYIA 3Q4AB 3D9OA 3RO2A 4HORA 4PS8A 3FEYA 4DK5A 4LEUA 3L08A 1HZ4A 1H6KA 2AW6A 3MV2B 4FHJA 3JCKC 5CHEE 3FU3A 1PAQA 2XQ0A 3GZ1A 4MS6A 4JHKA 4UWHA 2CFZA 4FULA 1LF8A 4H7XA 3TXNA 3CR3A 3CVPA 2HYZA 4I1AA 3QWWA 4KBQA 4W9RA 4L7TA 4DI3A 3HVEB 3FUNA 4AY5A 2AVPA 4Q69A 1H19A 2UY1A 3UT4A 3D9PA 4GZ5A 3OAWA 2L6JA 3D9NA 2HM8A 2X3MA 3CSTA 3ML8A 3S7BA 4CGVA 3FY4A 2FBNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GYY A;  3Q5M A;  3JYS A;  5FJY A;  5A7D B;  4GCO A;  1OUV A;  2KAT A;  3N71 A;  3Q47 B;  4YND A;  4BT9 A;  3ZHE B;  2BUG A;  5BNW A;  2DBA A;  4U07 A;  5CCL A;  1NA0 A;  1YA0 A;  2V5F A;  3EDT B;  1E96 B;  4G2V A;  2KCV A;  3CEQ A;  3MA5 A;  2VSY A;  3CK7 A;  1ZU2 A;  4HOU A;  3CK8 A;  3FWV A;  1P5Q A;  2FI7 A;  4IN3 B;  3GYZ A;  2PZI A;  2OND A;  3CVN A;  3PE4 A;  2GW1 A;  5JJ6 A;  3LY9 A;  5A6C A;  1PC2 A;  3RKV A;  3K9I A;  3LY7 A;  4ABN A;  5C1D A;  3R9A B;  2VGY A;  4CGW A;  3GW4 A;  3AS8 A;  4I9C A;  1FCH A;  4NQ0 A;  4GZ6 A;  1QQE A;  3SZ7 A;  2XGM A;  4JA7 A;  3QWV A;  3CK9 A;  3E4B A;  3QDN A;  3VTY A;  3HYM B;  4J0U A;  5FZQ A;  2XEV A;  4BTA A;  5G05 J;  4UQY A;  3LCA A;  2LNI A;  4U04 A;  1HH8 A;  2WPV A;  3LKU A;  2C0M A;  3ASF A;  2VGX A;  5EX3 A;  2XCC A;  4XI9 A;  5EKQ D;  3ZFW A;  4G26 A;  4N3B A;  3TGO A;  3ULQ A;  4N2Q A;  3LYA A;  3TG5 A;  2UY1 B;  5FT9 A;  2IFU A;  4WNE A;  2Q7F A;  5D0Q D;  2JLB A;  3ZGQ A;  5G05 C;  4WNF A;  3MV3 B;  5G04 J;  4B94 A;  2XGS A;  4Y6C A;  3CKB A;  1A17 A;  5FZS A;  2C0L A;  4G1T A;  3U3W A;  2I6H A;  2KC7 A;  3QKY A;  4I2W A;  4YVQ C;  3IEG A;  3MKR A;  4WUY A;  3ASG A;  4KYO B;  2C2L A;  2R5S A;  5DIZ A;  3S7F A;  3QWP A;  1IYG A;  5LCW J;  2YHC A;  3ZHE A;  3BEE A;  3CKC A;  1QZ2 A;  2NC9 A;  2IF4 A;  4GCN A;  2PL2 A;  5G04 C;  2FEZ A;  2LSV A;  1IHG A;  2VSN A;  3CV0 A;  3AS4 A;  4J8E A;  5CCM A;  3KAE A;  3OXF A;  2PQN A;  3OXG A;  2Y4T A;  2FO7 A;  3WXX A;  4APO A;  3PDN A;  4U0S A;  3Q15 A;  4XIF A;  1WAO 1;  4GZ3 A;  2XGO A;  3URZ A;  5ARG A;  1NZN A;  1TJC A;  4G24 A;  3CVL A;  1ZBP A;  2HO1 A;  4N5C A;  4HOS A;  4UI9 J;  5LCW C;  5BW8 C;  3UQ3 A;  2PQR A;  2MHK A;  4HOQ A;  5ARF A;  1ELW A;  4ME2 A;  4RG6 A;  5KJL A;  3CVQ A;  4N39 A;  4I9E A;  4G25 A;  3FP3 A;  4GA0 A;  3S7J A;  2OOE A;  4I2Z A;  3PE3 A;  3RU0 A;  3AS5 A;  3GZ2 A;  5AYW D;  1ELR A;  2KCL A;  4UQX A;  4N3A A;  2J9Q A;  3UUX A;  5HQ8 A;  2FF4 A;  4UI9 K;  4YVO A;  2E2E A;  3FFL A;  3OXL A;  4GYO A;  5FTP A;  4U0Z A;  4XI0 A;  4UI9 C;  4GA2 A;  3ZPJ A;  1KT0 A;  2YQ8 A;  3RJV A;  4N3C A;  4KXK B;  4RG9 A;  4F3V A;  3TAX A;  4GPK A;  5KJM A;  4BT8 A;  2XCB A;  1KLX A;  5HI7 A;  3U4T A;  2VQ2 A;  1NA3 A;  5JJT A;  4WNG A;  3Q49 B;  4U0U A;  1KT1 A;  3ASH A;  2P58 C;  2HR2 A;  2LSU A;  3MEK A;  4A1S A;  4H7Y A;  4G23 A;  4HOT A;  2Y4U A;  4CDR A;  4BTB A;  4I17 A;  5D0O D;  4UQZ A;  4BWR A;  1WM5 A;  2UWJ G;  5KJK A;  1W3B A;  3SF4 A;  3TG4 A;  4EQF A;  2XPI A;  3ZN3 A;  2KCK A;  3VTX A;  5M72 A;  3UPV A;  3ESK A;  1Y8M A;  5DBK A;  4AM9 A;  2QFC A;  5FZR A;  5BT1 A;  3S7D A;  4Y6W A;  4AIF A;  4JL0 A;  3LPZ A;  5EX0 A;  3NF1 A;  3KD7 A;  2VGX B;  4J8F A;  3RO3 A;  3LY8 A;  4JA9 A;  4WND A;  4O6F A;  2WQH A;  4AY6 A;  3O48 A;  4N2S A;  3RIB A;  4JHR A;  5KJN A;  3ASD A;  1XNF A;  3QOU A;  4NRH B;  4GA1 A;  4GYW A;  4J8D A;  1B89 A;  1HXI A;  5JJ7 A;  3KS2 A;  2VYI A;  3Q4A B;  3RO2 A;  4HOR A;  4LEU A;  1HZ4 A;  3MV2 B;  5CHE E;  3GZ1 A;  4H7X A;  3CVP A;  2HYZ A;  4I1A A;  3QWW A;  4KBQ A;  4W9R A;  4AY5 A;  2AVP A;  2UY1 A;  4GZ5 A;  2L6J A;  3S7B A;  4CGV A;  2FBN A; 
#chains in the Genus database with same CATH topology
 3MKQ B;  2R05 A;  3D9H A;  4I6J A;  4GMJ A;  3LS8 A;  5BNW A;  4K5A B;  4U07 A;  3EDT B;  3HXB A;  3MGB A;  4GML A;  3CEQ A;  4XEI G;  4AP2 A;  2A4Z A;  1DCQ A;  1WG0 A;  1ZU2 A;  4L2L A;  4DX6 D;  3UIO C;  3EIJ A;  1SZA A;  3CK8 A;  1K3Z D;  3C3R A;  4HQD A;  3C5R A;  4XKB A;  2PZI A;  3PE4 A;  4MRU A;  3DBS A;  1JUQ A;  1MZC A;  2EIK E;  2XHE A;  5A6C A;  5JMN D;  3SFX A;  1PC2 A;  3IV0 A;  3LY7 A;  4R7L A;  1S63 A;  5AJD A;  1Z3Y A;  3TWQ A;  1IKN D;  5FIO A;  4DRX E;  3B7U X;  1HFA A;  1FCH A;  3ABM E;  4NQ0 A;  4AOF A;  4YDE A;  3FU6 A;  3ZW3 A;  2EIJ E;  4CCA A;  5ENR D;  3SZ7 A;  2FUL A;  4ILH B;  4K03 A;  5T8I A;  3QDN A;  1H6P A;  5G05 J;  4ILG A;  5FIN A;  5B1A E;  5LOZ A;  4GTM A;  2LNI A;  4KZC A;  4U04 A;  1BLX B;  1HH8 A;  4B8A A;  2L9B A;  5BV1 A;  3TWW A;  1E8X A;  2WPV A;  3JXJ A;  2C0M A;  4OAU C;  2XZT G;  3NB2 A;  4G26 A;  2YIN A;  1E7U A;  3DXM G;  5AIJ A;  4DX7 D;  3ULQ A;  1IQU A;  1K8K G;  1GW6 A;  4B89 A;  3PS6 A;  4GAA A;  5D0Q D;  4HVB A;  2JLB A;  4GMR A;  2WM9 A;  3ABL E;  4D10 C;  3MV3 B;  3HIZ A;  2X6K A;  5JHB A;  4L2Y A;  4K0R A;  2XEE A;  2XGS A;  5ENO D;  3CKB A;  3NZS A;  5AQ7 A;  3C3O A;  3CVY A;  5H7P A;  3U3W A;  2OEV A;  3UMV A;  4C9B B;  3RRM B;  2KZT A;  3LJN A;  3ZU7 B;  3V2X A;  4I2W A;  3IEG A;  1N54 A;  4GTP A;  4F7A A;  3MKR A;  5JA4 D;  4C48 B;  3V31 A;  3S7F A;  5BV0 A;  1SA5 A;  1U3C A;  2OCC E;  4FAD A;  1YYH A;  3FTX A;  2NC9 A;  2IF4 A;  3I5P A;  5T3R A;  4HBD A;  4DUI A;  4Q94 A;  4ANU A;  2V5Q C;  2X6H A;  3OXF A;  1E8Z A;  3UTM A;  2PQN A;  1RW2 A;  2A5U A;  3DWL G;  4KT6 B;  5HS0 A;  3CVV A;  4FC8 A;  2XEN A;  2F8X K;  4ACL A;  4APO A;  1OWM A;  3PDN A;  3ZYK A;  3LEW A;  3URZ A;  5ARG A;  3ZXS A;  5ANR A;  4KZ0 A;  2HO1 A;  2ZGD A;  4N5C A;  5BW8 C;  3Q75 A;  3JUE A;  2EIL E;  4AXH A;  3UT8 A;  2PQR A;  3FUM A;  1EF1 C;  2V0P A;  5AQ9 A;  3G2S A;  5LP0 A;  3D9L A;  4HOQ A;  1NL4 A;  3APC A;  3ONK A;  4RG6 A;  3MX3 A;  4DX2 A;  2GRQ B;  3UT7 A;  4N39 A;  4Q96 A;  3NZU A;  3S7J A;  3ULE G;  2NXP A;  3SQV A;  5ENS D;  3PZ1 A;  4WWO A;  1E8W A;  2KCL A;  3QAR A;  4N3A A;  3SGH A;  4G11 A;  1XGW A;  4FLB A;  2FF4 A;  3HRA A;  4BY6 A;  4YVO A;  4OAV B;  3C72 A;  4MBG A;  4TXP A;  4XI0 A;  3EU9 A;  4UI9 C;  5CMY A;  2P9L G;  4EZJ A;  2KZT B;  2WXR A;  1QNF A;  3I4R B;  4CDM A;  3V79 K;  4MLP A;  3TAX A;  5CMW A;  4BT8 A;  1X5B A;  2XCB A;  1KLX A;  3PUJ A;  2BF0 X;  4O1O A;  1UN8 A;  5JJT A;  3RRU A;  2Y69 E;  2P58 C;  4HI9 A;  4O60 A;  5D2M C;  1SQM A;  3MEK A;  4F6R D;  3NOG D;  1Z3X A;  3L13 A;  4AEZ C;  4HOT A;  2HE0 A;  2I2O A;  4CDR A;  4ZHB A;  3P2B A;  4I17 A;  3UM2 A;  4BWR A;  3FTU A;  1OCC E;  2LAH A;  2WXO A;  4FLH A;  1OCR E;  2DIW A;  2KCK A;  3HG0 D;  3ESK A;  1Y8M A;  4KVM A;  3FUJ A;  3FUL A;  2MOW A;  3B95 A;  3S7D A;  4Y6W A;  3MYV A;  4JL0 A;  3LPZ A;  5EX0 A;  3QNK A;  3RK6 A;  1N11 A;  3PVL A;  4BER A;  2IJG X;  4J8F A;  3CLJ A;  3BQO A;  4UUC A;  1OWP A;  4WND A;  3TWT A;  4EZK A;  1TNZ A;  2V4L A;  2DZO A;  4AY6 A;  4N2S A;  4JHR A;  5KJN A;  2R59 A;  5G2N A;  5CEA A;  5LX8 A;  2VJ8 A;  4PS3 A;  3JXI A;  3DSW A;  4GA1 A;  4E6H A;  4TRQ A;  3ZNG A;  4TV3 A;  3Q4A B;  3RO2 A;  1HZ4 A;  1H6K A;  3MV2 B;  2P9K G;  3FU3 A;  4UWH A;  5KBA A;  4FUL A;  3QWW A;  4KBQ A;  4HRN A;  4DI3 A;  4Q69 A;  4Z68 A;  3CST A;  3FY4 A;  4TUM A;  2JAB A;  3Q5M A;  2F8Y A;  4GCO A;  1FT2 A;  5E76 A;  3FH5 A;  1QBQ A;  4YDO A;  3TWS A;  3ZHE B;  4HXI A;  5CCL A;  3J5Q B;  4JPS A;  1H2T C;  1E96 B;  3TJP A;  2R17 C;  4G2V A;  4ILI A;  2VSY A;  4GB9 A;  2WMO A;  3CK7 A;  3OTN A;  3TWU A;  3VLF A;  2ZU6 B;  3FWV A;  4IN3 B;  3ONL A;  2AWI A;  2OND A;  3CVN A;  2GW1 A;  1K1B A;  3RKV A;  3CIA A;  2P9U G;  4GZD A;  4BSX A;  5C1D A;  3FEX A;  2M63 A;  4A3V A;  3FDH A;  3I3N A;  4I9C A;  4WWP A;  3ENE A;  4I1M A;  4ANV A;  3PH0 C;  3F6Q A;  3ISM C;  5FQ7 A;  4DLO A;  3PRE A;  4J0U A;  3ZRH A;  3GZS A;  3FTY A;  5ENT D;  4U96 D;  3PZD A;  2XS8 A;  4GTS A;  2WXK A;  3QK0 A;  2WXQ A;  3UIP C;  4CEM A;  4YDW A;  4NIK A;  5HRY A;  4I1O B;  2WQ6 A;  3LKU A;  4GZC A;  3ASF A;  2VGX A;  5FQ6 A;  5EX3 A;  2XCC A;  4XI9 A;  3PRZ A;  1A5E A;  3EHN A;  3W9F A;  3Q9U C;  1DCE A;  5BXO A;  5ANL A;  3D3M A;  3FUE A;  4JW1 A;  3JUI A;  5EN5 D;  3FTZ A;  2ETC A;  4KMO A;  4WNE A;  2Q7F A;  3SBS A;  2IQC A;  4WNF A;  1FT1 A;  4U8V D;  3B7R L;  3FU5 A;  4B8C B;  4G1T A;  2J4D A;  3UX4 A;  2H6H A;  4A63 B;  2KC7 A;  5KWD A;  1JCS A;  3CQG B;  1N0R A;  5BPP A;  1TNY A;  3JQ0 A;  4KYO B;  2R5S A;  5DIZ A;  1UW4 B;  2DCP A;  1HE8 A;  3QWP A;  4A1G A;  3AG4 E;  5J08 A;  2YNQ A;  1QZ2 A;  4JXT A;  4HNA D;  2PL2 A;  5G04 C;  2FEZ A;  2LSV A;  4JEH A;  1IHG A;  3CV0 A;  1D8D A;  3KAE A;  3DRA A;  3NAW A;  3VLE A;  4CRW A;  2Y4T A;  3D9K A;  1MX2 A;  4M3O A;  3WXX A;  1DNP A;  4U0S A;  5KNH D;  3UM0 A;  5EYL A;  3Q15 A;  4LUN U;  1MX6 A;  2J8S D;  1FPP A;  3KSL A;  1WAO 1;  2XGO A;  3CVL A;  4UI9 J;  3FTW A;  5LCW C;  1N9A A;  5AEN A;  1Z6T A;  2P9P G;  4E85 A;  1N4R A;  3HDX A;  5ARF A;  2IOS A;  2L0I A;  5T4Y A;  4FA6 A;  4HS2 A;  1N0Q A;  3NOC D;  3CVQ A;  2WXM A;  4G25 A;  4GA0 A;  2WXI A;  4M7C A;  3TWX A;  2OOE A;  3QC1 A;  2GRM A;  5AYW D;  2J49 A;  3PUK A;  2A5E A;  3FH8 A;  1HG2 A;  2J09 A;  2KM4 A;  2WXG A;  1N4S A;  4U8H A;  1E90 A;  5D66 A;  2B0O E;  3WG7 E;  2GGF A;  2EIN E;  5EID A;  4GA2 A;  2YQ8 A;  3L6A A;  4N3C A;  4GTO A;  2WVI A;  2MYO A;  4U95 D;  3ASO E;  1LD8 A;  1U3D A;  2VSO E;  4GPK A;  3SO8 A;  5ITZ F;  3QJZ A;  5KJM A;  2P9I G;  4IYP A;  1S64 A;  4WWN A;  5HI7 A;  3D9M A;  2DZN A;  2VQ2 A;  4LER A;  1NA3 A;  5CED B;  2XPZ A;  4UWK A;  5KNG A;  2CHW A;  3CGH A;  2X6F A;  3UM3 A;  2IOL A;  4PDX A;  4PUC A;  1AWC B;  1FVF A;  2LSU A;  3L9T A;  3ML9 A;  3IHY A;  4A1S A;  4H7Y A;  4G23 A;  1KZP A;  4RQI A;  5D0O D;  3SF4 A;  3TG4 A;  2XPI A;  5AQA A;  3ZN3 A;  4TXR A;  4HLE A;  4J8Y A;  4OVV A;  1EPU A;  1EYH A;  3LVQ E;  1JWG A;  4AIF A;  3SBT B;  2B6C A;  2P2C P;  3E37 A;  3PZ4 A;  3RO3 A;  4XE0 A;  4TXQ A;  1EDU A;  4O6F A;  2J08 A;  3B7B A;  3SI5 A;  4LSZ E;  3RAU A;  5EDS A;  1O1S A;  5ENQ D;  3R7Q A;  3L22 A;  2VTB A;  4J8D A;  2ETA A;  2J07 A;  1B89 A;  3SFZ A;  3D9O A;  1O5M A;  4G8L A;  3ZXP A;  4MS6 A;  2P9N G;  4JHK A;  3CVP A;  4W9R A;  4L7T A;  2AVP A;  2UY1 A;  4HRM B;  2X3M A;  3ML8 A;  3S7B A;  4CGV A;  4GTQ A;  2FBN A;  4QQI A;  3JYS A;  5FJY A;  5A7D B;  1V54 E;  1OCO E;  3PNL B;  2KAT A;  2KXP C;  3N71 A;  3TL5 A;  2PNN A;  4B0Z A;  1S0P A;  4YND A;  4BT9 A;  2BUG A;  5CRV A;  2DBA A;  2ZGG A;  3ZUV B;  1YA0 A;  2OEW A;  2GRR B;  1UJK A;  2RD0 A;  2Y1L E;  2ZXW E;  2IU1 A;  2X6J A;  4HOU A;  4FHK A;  5G55 A;  1P5Q A;  2IO3 C;  3GYZ A;  1D8E A;  3Q73 A;  4YDY A;  1IQR A;  3LY9 A;  1ELK A;  3Q78 A;  3IKO B;  2YHE A;  4ABN A;  4FJZ A;  5A23 A;  1NP7 A;  2VGY A;  4FP7 A;  1K1A A;  5FQ8 A;  3GW4 A;  3AS8 A;  5J90 A;  3C3Q A;  1V55 E;  2NYJ A;  1AP7 A;  3ULY A;  2XGM A;  3DPD A;  2L0T B;  2RFA A;  1BI7 B;  3BUA A;  1DVP A;  2CFU A;  5FQ4 A;  3E4B A;  4URK A;  4K5B A;  4BTA A;  1TR4 A;  3QAQ A;  4UQY A;  3LCA A;  3V2O A;  1IXV A;  1H0A A;  4GTT A;  2DVW A;  1HG5 A;  1SW6 A;  1TN7 A;  4LRZ A;  3RSE G;  4ANW A;  3CVW A;  4WAF A;  4A55 A;  2P9S G;  3U64 A;  3V30 A;  3TWV A;  3S2A A;  5EKQ D;  2DWZ A;  4DLQ A;  1O1R A;  4G8K A;  1OT8 A;  4N2Q A;  3AG1 E;  2LXM A;  3TG5 A;  4I6E A;  2UY1 B;  4JZY A;  5FT9 A;  3HXE A;  1JCR A;  1PY1 A;  3ZGQ A;  1Y6I A;  3T9K A;  3L17 A;  5G04 J;  1OXJ A;  5JHA A;  4FJY A;  3CQC B;  3PZ3 A;  3I4G A;  3EJN A;  4Y6C A;  3SFY A;  4C0M A;  4EBA A;  2I9C A;  4N5Q A;  3QKY A;  1SVX A;  3HVE A;  2H6F A;  1E8Y A;  3RRN B;  2FO1 E;  2IEJ A;  1HU3 A;  3R9M A;  4WUY A;  3ASG A;  4L9P A;  2ION A;  3MKQ A;  3UXG A;  4CZ2 D;  4GTV A;  3X2Q E;  2XRZ A;  4F53 A;  3FUI A;  1IYG A;  5LCW J;  1JWF A;  2R2L A;  2YHC A;  3AU4 A;  3BEE A;  2XZD G;  3ZVV A;  2IO2 C;  4U8Y D;  1TNU A;  3CKC A;  4GCN A;  1HX8 A;  1TNB A;  3DPY A;  4J6I A;  3AS4 A;  5CCM A;  4JVS A;  4EEC A;  3TWR A;  5AAO A;  4BSZ B;  3G2V A;  1ZB1 A;  3OXG A;  2FO7 A;  4LCT A;  3CSF A;  1INZ A;  3VLD A;  4DJA A;  2ZIS A;  3CHR A;  3E30 A;  4GZ3 A;  1SZ9 A;  1NZN A;  4G24 A;  5CER B;  2AXZ A;  1YMP A;  4EBA G;  1JPL A;  2E0I A;  1UN9 A;  1ELW A;  2WXH A;  5KJL A;  5CEC B;  1RZ4 A;  3O4Z A;  1KPS B;  3AAA C;  3FP3 A;  2ETB A;  3PE3 A;  3RU0 A;  3AS5 A;  2RFM A;  1TNO A;  4U63 A;  4B93 B;  1S70 B;  3HHM A;  4UI9 K;  3FFL A;  3OXL A;  4GYO A;  1OWN A;  3R7R A;  4OYS A;  3C98 A;  2OVB A;  3B7S A;  4KXK B;  3HXF A;  2WXN A;  3PEU B;  2AXU A;  4FU3 A;  1OCZ E;  4EPZ A;  4LNB A;  4XKC A;  4F3V A;  1NFI E;  3FU0 A;  2BKG A;  2CHZ A;  2QC9 A;  4ANX A;  3L82 A;  2WB2 A;  3Q49 B;  4U0U A;  2DYR E;  3FH7 A;  3KEZ A;  3ASH A;  2J4B A;  3T5X A;  2I1J A;  2RKK A;  3LVR E;  3FUK A;  5FWQ A;  4K5C A;  1E7V A;  3W9G A;  4TUU A;  5CRU A;  4GPM A;  1NI1 A;  4BTB A;  1HS6 A;  4CT4 A;  4UQZ A;  3IBE A;  2CHX A;  4PS7 A;  1WM5 A;  4JEU A;  2UWJ G;  4EHM A;  3APF A;  5KJK A;  3HXD A;  1BU9 A;  3VTX A;  2QY7 A;  1BPO A;  4IUL A;  4GU5 A;  2OVF A;  5DBK A;  4AM9 A;  2QFC A;  2IY0 C;  5FZR A;  2VGX B;  1D9S A;  4LG6 A;  3ZIM A;  4EZL A;  4JA9 A;  1L5J A;  3G2T A;  2WQH A;  3O48 A;  3EUV A;  4ATZ D;  1HF8 A;  2CG2 A;  1X81 A;  2F0Y A;  3TXM A;  2VGE A;  1TN6 A;  3EHR A;  3UIN C;  4XZ4 A;  3ASD A;  4AV7 A;  4P29 A;  1XNF A;  3UKU G;  1LD7 A;  2XPY A;  4GYW A;  1HXI A;  3T8K A;  5JJ7 A;  3KS2 A;  2VYI A;  4HOR A;  4PS8 A;  3ASN E;  3KEA A;  4FHJ A;  1PAQ A;  5EIL A;  2XQ0 A;  2CFZ A;  1LF8 A;  3CR3 A;  3DSU A;  1BD8 A;  4AY5 A;  3UT4 A;  4GZ5 A;  3OAW A;  2L6J A;  1N52 A;  4GYY A;  3Q7F A;  4RLY A;  1OUV A;  2WXP A;  3Q47 B;  3BG1 B;  3HXC A;  4CT0 A;  1NA0 A;  2V5F A;  4L1B A;  2KCV A;  3MA5 A;  3Q7A A;  4HLL A;  3IXE A;  2Y0B G;  4JHJ A;  3ZYL A;  3D9I A;  4BX9 A;  3FHE A;  2FI7 A;  2CG3 A;  5C2Y A;  2QZA A;  4PH4 B;  5JJ6 A;  3PEV B;  2BED A;  3DEP A;  4HRL A;  2GRL A;  3K9I A;  3E33 A;  3AG2 E;  3U66 A;  1N94 A;  3R9A B;  5BXU A;  3AJI A;  5CBO A;  4CGW A;  4BX8 A;  1WDY A;  1IHB A;  2QYJ A;  3UI2 A;  1BI8 B;  1N4Q A;  1OWL A;  4DX1 A;  4GZ6 A;  2WQ7 A;  1QQE A;  4RSY A;  3EIQ C;  1MQS A;  3CHM A;  4A3T A;  3NBN B;  1N95 A;  4CDN A;  1O1T A;  4JA7 A;  3SY2 A;  3QWV A;  3CK9 A;  3DEO A;  3JQ1 A;  1SA4 A;  4J7W A;  3VTY A;  3HYM B;  5FZQ A;  1MHQ A;  2NSZ A;  2XEV A;  5EIB E;  3AG3 E;  5AN8 A;  2QYU A;  2V4H C;  4QFV A;  1VDY A;  5AJL A;  2LXL A;  1N4P A;  2MRI A;  2BKK B;  3E32 A;  3ZFW A;  2LUH A;  3IHV A;  4N3B A;  3TGO A;  5KCM A;  3LJ3 A;  3QB2 A;  4O1P A;  3AU5 A;  3DXK G;  2PM7 A;  3LYA A;  3CHS A;  3J5P A;  2IFU A;  4LNU D;  3E34 A;  3CHO A;  1TEZ A;  5G05 C;  5E75 A;  2VSX E;  3FUD A;  3L16 A;  4J8S A;  2R02 A;  4B94 A;  4AVX A;  3U9W A;  1TJF A;  3G2W A;  1A17 A;  5FZS A;  2C0L A;  4CYM D;  2I6H A;  3CVX A;  1HO8 A;  4L23 A;  3ABK E;  3DST A;  4YVQ C;  2LAI A;  4XX5 A;  1TYQ G;  4U7E B;  4F1P A;  3PNT B;  4NAC A;  4UWL A;  4UWF A;  3EU5 A;  2JEK A;  2C2L A;  2XS1 A;  2XRY A;  4C0E A;  1Z5S C;  3ZHE A;  2GRN B;  4HI8 A;  3G2U A;  1UG3 A;  5B1B E;  2OV8 A;  2VSN A;  4J8E A;  4HB5 A;  4I6G A;  3B13 A;  1DC2 A;  3EHQ A;  1UOH A;  3Q79 A;  3ZYQ A;  3APD A;  3UM1 A;  2Y3A A;  4XIF A;  2L6B A;  1OWO A;  3CHQ A;  4ZFH A;  3ZYM A;  2V8S E;  1TJC A;  5B3S E;  1H6O A;  1ZBP A;  4HOS A;  4DI4 A;  4UWG A;  3UQ3 A;  1Q2Z A;  3ZEF A;  2VTB B;  2MHK A;  3DSS A;  3MZL B;  2R03 A;  5AAR A;  3MCX A;  4ME2 A;  3CVU A;  5ENN A;  2ILR A;  5CBN A;  4V3I A;  2ZIR A;  4I9E A;  3LXU X;  1LTX A;  2BTD A;  4I2Z A;  1WY6 A;  3GZ2 A;  1ELR A;  5AQB A;  2DYS E;  4UQX A;  1U2V G;  2J9Q A;  3FTS A;  4OVU A;  3UUX A;  3ZKJ A;  2H6I A;  2WXJ A;  5HQ8 A;  2XEH A;  2E2E A;  5FTP A;  4AJW A;  4U0Z A;  2PM6 A;  2F37 A;  3ZPJ A;  3FUH A;  1KT0 A;  3FUF A;  3RJV A;  2WXF A;  4RG9 A;  2KBX A;  3DSX A;  3BG0 B;  3CHP A;  3D9J A;  4RVB A;  3ESL A;  3SNX A;  5BUZ A;  2X38 A;  3U4T A;  4JD2 G;  5ENP D;  4WNG A;  2WMN A;  1KT1 A;  2HR2 A;  4BFR A;  4IRU A;  4JB8 P;  2AJA A;  2Y4U A;  4MKT A;  2AXV A;  2GRP B;  4F1S A;  3SHF A;  2H6G A;  3FTV A;  4APF A;  2I1K A;  4DPR A;  2LO6 A;  1FVH A;  1OY3 D;  1KZO A;  1W3B A;  2WXL A;  4EQF A;  3SD5 A;  1MX4 A;  2X6I A;  3NQP A;  4BET A;  4KVO A;  5M72 A;  2GRO B;  3UPV A;  4ATG A;  3MJW A;  5EYP F;  5BT1 A;  4JC8 A;  2RG8 A;  3LDZ A;  3EHM A;  3NF1 A;  3KD7 A;  3B7T A;  3PZ2 A;  1H2V C;  4I43 A;  1QYM A;  3T8M A;  3LY8 A;  4ACK A;  1H2U A;  3KSQ A;  1YCS B;  4NUR A;  3RIB A;  3P1U A;  3T5V A;  4HFG A;  5LFA A;  1G3N B;  2EQX A;  3QOU A;  4NRH B;  4X8Q A;  3L54 A;  1UJJ A;  3Q9N C;  2EIM E;  3FEY A;  4DK5 A;  4LEU A;  5HKP A;  3L08 A;  4GTR A;  2AW6 A;  4BEP A;  1TN8 A;  3JCK C;  5CHE E;  1MJ0 A;  3UKR G;  3GZ1 A;  3BU8 A;  4H7X A;  3TXN A;  4LNG A;  2HYZ A;  4I1A A;  3DSV A;  1MYO A;  4BES A;  3HVE B;  3FUN A;  5IY5 E;  4DX5 D;  1H19 A;  3D9P A;  1JCQ A;  3D9N A;  2HM8 A; 
#chains in the Genus database with same CATH homology
 1N52 A;  4GYY A;  3MKQ B;  3Q5M A;  3JYS A;  5FJY A;  5A7D B;  4GCO A;  3PNL B;  1OUV A;  2KAT A;  2WXP A;  5E76 A;  3N71 A;  3TL5 A;  3Q47 B;  3FH5 A;  3BG1 B;  1S0P A;  4B0Z A;  4I6J A;  4YND A;  4BT9 A;  4CT0 A;  4GMJ A;  3LS8 A;  3ZHE B;  2BUG A;  4HXI A;  5BNW A;  2DBA A;  4U07 A;  5CCL A;  1NA0 A;  4JPS A;  1YA0 A;  2V5F A;  1H2T C;  1E96 B;  3EDT B;  2R17 C;  4G2V A;  3TJP A;  4L1B A;  3MGB A;  1UJK A;  2KCV A;  2RD0 A;  3CEQ A;  3MA5 A;  4GML A;  4ILI A;  2IU1 A;  2VSY A;  4GB9 A;  4AP2 A;  4JHJ A;  3ZYL A;  2WMO A;  3D9I A;  2A4Z A;  4BX9 A;  3FHE A;  2X6J A;  3CK7 A;  1ZU2 A;  4HOU A;  4L2L A;  4FHK A;  3OTN A;  5G55 A;  3VLF A;  3EIJ A;  1SZA A;  3CK8 A;  2ZU6 B;  1P5Q A;  2FI7 A;  3FWV A;  4IN3 B;  2CG3 A;  3GYZ A;  3ONL A;  5C2Y A;  2AWI A;  4XKB A;  2PZI A;  2OND A;  3CVN A;  3PE4 A;  4MRU A;  2GW1 A;  3DBS A;  4PH4 B;  1JUQ A;  1IQR A;  5JJ6 A;  2XHE A;  3LY9 A;  5A6C A;  3PEV B;  1PC2 A;  1ELK A;  3IKO B;  3RKV A;  2GRL A;  2YHE A;  3CIA A;  3IV0 A;  3K9I A;  3LY7 A;  4GZD A;  4R7L A;  4ABN A;  4BSX A;  5C1D A;  5AJD A;  3U66 A;  1Z3Y A;  4FJZ A;  3R9A B;  3FEX A;  2M63 A;  5A23 A;  1NP7 A;  4A3V A;  2VGY A;  4CGW A;  4BX8 A;  4FP7 A;  3FDH A;  5FQ8 A;  3GW4 A;  3AS8 A;  5J90 A;  3B7U X;  1OWL A;  1HFA A;  3I3N A;  4I9C A;  1FCH A;  4WWP A;  4NQ0 A;  4AOF A;  3ENE A;  4I1M A;  4GZ6 A;  4ANV A;  2WQ7 A;  3PH0 C;  1QQE A;  4RSY A;  3FU6 A;  3ZW3 A;  3EIQ C;  1MQS A;  3CHM A;  4A3T A;  4CCA A;  4CDN A;  3SZ7 A;  2XGM A;  2FUL A;  3DPD A;  4JA7 A;  2L0T B;  3QWV A;  3CK9 A;  3JQ1 A;  5FQ7 A;  4DLO A;  3PRE A;  1DVP A;  2CFU A;  4ILH B;  3E4B A;  3QDN A;  4K03 A;  5FQ4 A;  5T8I A;  3VTY A;  4URK A;  3HYM B;  4J0U A;  3ZRH A;  5FZQ A;  1MHQ A;  2NSZ A;  2XEV A;  3GZS A;  4BTA A;  5G05 J;  4ILG A;  3QAQ A;  4UQY A;  3FTY A;  3LCA A;  5LOZ A;  1H0A A;  3PZD A;  2LNI A;  4KZC A;  2WXK A;  4U04 A;  1HH8 A;  4B8A A;  3QK0 A;  2L9B A;  1VDY A;  1HG5 A;  2WXQ A;  4QFV A;  4CEM A;  5BV1 A;  1E8X A;  5AJL A;  4I1O B;  2WQ6 A;  4LRZ A;  2WPV A;  3LKU A;  2C0M A;  2MRI A;  4GZC A;  4ANW A;  3CVW A;  3ASF A;  4WAF A;  2VGX A;  5FQ6 A;  4A55 A;  5EX3 A;  2XCC A;  3U64 A;  4XI9 A;  3PRZ A;  3S2A A;  5EKQ D;  3ZFW A;  4G26 A;  3EHN A;  2YIN A;  3IHV A;  4N3B A;  4DLQ A;  1E7U A;  3TGO A;  5AIJ A;  5KCM A;  3LJ3 A;  3ULQ A;  3QB2 A;  3AU5 A;  5ANL A;  4N2Q A;  3D3M A;  3FUE A;  2PM7 A;  1IQU A;  3LYA A;  4JW1 A;  1GW6 A;  3TG5 A;  3JUI A;  4I6E A;  2UY1 B;  3PS6 A;  3CHS A;  4JZY A;  4GAA A;  4B89 A;  3FTZ A;  5FT9 A;  2IFU A;  4KMO A;  4WNE A;  2Q7F A;  5D0Q D;  3CHO A;  4HVB A;  2JLB A;  3SBS A;  1PY1 A;  1TEZ A;  2IQC A;  2WM9 A;  3ZGQ A;  5G05 C;  4D10 C;  1Y6I A;  4WNF A;  5E75 A;  3MV3 B;  2VSX E;  3FUD A;  3L16 A;  3L17 A;  4J8S A;  5G04 J;  3HIZ A;  2X6K A;  5JHA A;  5JHB A;  4FJY A;  3CQC B;  4L2Y A;  4GPK A;  4K0R A;  4B94 A;  4AVX A;  3I4G A;  3B7R L;  3EJN A;  2XGS A;  3FU5 A;  3U9W A;  1TJF A;  3G2W A;  4Y6C A;  4B8C B;  3CKB A;  1A17 A;  3NZS A;  5FZS A;  4C0M A;  2C0L A;  4G1T A;  2J4D A;  3CVY A;  3U3W A;  3UX4 A;  3UMV A;  4C9B B;  4EBA A;  3RRM B;  2I9C A;  2I6H A;  2KC7 A;  2KZT A;  3CVX A;  1HO8 A;  4L23 A;  3QKY A;  3HVE A;  1E8Y A;  4I2W A;  3RRN B;  4YVQ C;  2LAI A;  4XX5 A;  3CQG B;  3IEG A;  1HU3 A;  3PNT B;  1N54 A;  4NAC A;  4UWL A;  5BPP A;  4F7A A;  3MKR A;  4UWF A;  3ASG A;  4WUY A;  2JEK A;  3JQ0 A;  2ION A;  3MKQ A;  2C2L A;  4KYO B;  2R5S A;  5DIZ A;  1UW4 B;  2DCP A;  2XRZ A;  1HE8 A;  2XRY A;  4C0E A;  3S7F A;  3QWP A;  4F53 A;  3FUI A;  1IYG A;  5LCW J;  1JWF A;  4A1G A;  2YHC A;  3ZHE A;  3AU4 A;  3BEE A;  3ZVV A;  5BV0 A;  3G2U A;  1U3C A;  4FAD A;  5J08 A;  1UG3 A;  2YNQ A;  3CKC A;  1QZ2 A;  3FTX A;  2NC9 A;  4JXT A;  2IF4 A;  3I5P A;  4GCN A;  5T3R A;  2PL2 A;  5G04 C;  2FEZ A;  1HX8 A;  2LSV A;  2OV8 A;  4Q94 A;  4ANU A;  4JEH A;  4J6I A;  1IHG A;  2VSN A;  3CV0 A;  3AS4 A;  4J8E A;  2X6H A;  5CCM A;  4JVS A;  4EEC A;  3KAE A;  4I6G A;  3B13 A;  3VLE A;  3OXF A;  1E8Z A;  4CRW A;  2PQN A;  3G2V A;  2A5U A;  3APD A;  3OXG A;  4KT6 B;  3ZYQ A;  2Y4T A;  4FC8 A;  3CVV A;  2FO7 A;  4LCT A;  3D9K A;  3CSF A;  3WXX A;  4M3O A;  1INZ A;  4ACL A;  4APO A;  1DNP A;  1OWM A;  3PDN A;  3ZYK A;  4U0S A;  3VLD A;  4DJA A;  2Y3A A;  3Q15 A;  4LUN U;  4XIF A;  3LEW A;  1OWO A;  3CHR A;  1WAO 1;  3CHQ A;  4GZ3 A;  1SZ9 A;  2XGO A;  3ZYM A;  3URZ A;  5ARG A;  2V8S E;  5ANR A;  3ZXS A;  1NZN A;  1TJC A;  4G24 A;  3CVL A;  4KZ0 A;  1ZBP A;  2HO1 A;  4N5C A;  4HOS A;  4UI9 J;  4DI4 A;  4UWG A;  2AXZ A;  3FTW A;  5LCW C;  5BW8 C;  3UQ3 A;  5AEN A;  4AXH A;  3UT8 A;  3ZEF A;  2PQR A;  1Z6T A;  2VTB B;  3FUM A;  1EF1 C;  2MHK A;  2V0P A;  4EBA G;  3G2S A;  5LP0 A;  3D9L A;  4E85 A;  4HOQ A;  3MZL B;  3HDX A;  1JPL A;  2E0I A;  1UN9 A;  2IOS A;  3MCX A;  3APC A;  1ELW A;  3ONK A;  5ARF A;  4ME2 A;  3CVU A;  2WXH A;  4RG6 A;  5ENN A;  5KJL A;  3MX3 A;  2L0I A;  2ILR A;  5T4Y A;  4FA6 A;  3O4Z A;  4HS2 A;  3UT7 A;  3CVQ A;  4N39 A;  4Q96 A;  4V3I A;  3NZU A;  2WXM A;  4I9E A;  4G25 A;  3FP3 A;  4GA0 A;  3LXU X;  3S7J A;  2WXI A;  2NXP A;  2OOE A;  3QC1 A;  2BTD A;  3PE3 A;  4I2Z A;  3RU0 A;  4WWO A;  1E8W A;  3AS5 A;  1WY6 A;  2GRM A;  3GZ2 A;  5AYW D;  1ELR A;  2J49 A;  2KCL A;  3PUK A;  4UQX A;  3QAR A;  4N3A A;  3SGH A;  2J9Q A;  1XGW A;  4G11 A;  3FTS A;  4OVU A;  3UUX A;  3FH8 A;  2WXJ A;  1HG2 A;  4FLB A;  2J09 A;  2KM4 A;  5HQ8 A;  4U63 A;  2FF4 A;  4BY6 A;  3HHM A;  4UI9 K;  2WXG A;  4YVO A;  2E2E A;  3FFL A;  4U8H A;  3OXL A;  1E90 A;  4GYO A;  5FTP A;  4AJW A;  2GGF A;  4U0Z A;  4XI0 A;  4UI9 C;  2PM6 A;  1OWN A;  4GA2 A;  5CMY A;  3ZPJ A;  3FUH A;  1KT0 A;  4EZJ A;  2YQ8 A;  3FUF A;  3L6A A;  3RJV A;  3R7R A;  4N3C A;  4OYS A;  3C98 A;  2KZT B;  2WXR A;  2OVB A;  1QNF A;  2WXF A;  3I4R B;  3B7S A;  4KXK B;  4RG9 A;  2WVI A;  2WXN A;  4CDM A;  4MLP A;  3PEU B;  2AXU A;  1U3D A;  2VSO E;  3BG0 B;  4FU3 A;  3TAX A;  4EPZ A;  4XKC A;  3CHP A;  4F3V A;  3QJZ A;  5CMW A;  4BT8 A;  1X5B A;  2XCB A;  3FU0 A;  2CHZ A;  5KJM A;  3D9J A;  4IYP A;  1KLX A;  4RVB A;  3ESL A;  3PUJ A;  4WWN A;  3SNX A;  5BUZ A;  4ANX A;  2BF0 X;  5HI7 A;  2X38 A;  3D9M A;  2VQ2 A;  4LER A;  3U4T A;  1NA3 A;  2WB2 A;  2XPZ A;  4UWK A;  1UN8 A;  5JJT A;  2CHW A;  3CGH A;  4WNG A;  3Q49 B;  4U0U A;  3RRU A;  3FH7 A;  2WMN A;  2X6F A;  3KEZ A;  1KT1 A;  3ASH A;  2J4B A;  2P58 C;  3T5X A;  2IOL A;  4PDX A;  4PUC A;  1SQM A;  2HR2 A;  2I1J A;  1FVF A;  2LSU A;  3MEK A;  4BFR A;  3ML9 A;  1Z3X A;  3IHY A;  4IRU A;  4A1S A;  4H7Y A;  3L13 A;  4G23 A;  4AEZ C;  3LVR E;  3FUK A;  5FWQ A;  4HOT A;  2Y4U A;  4MKT A;  2AXV A;  1E7V A;  4F1S A;  2I2O A;  3SHF A;  4TUU A;  3FTV A;  4CDR A;  4APF A;  3P2B A;  2I1K A;  4DPR A;  4BTB A;  2LO6 A;  1FVH A;  1HS6 A;  4I17 A;  4CT4 A;  5D0O D;  4UQZ A;  4BWR A;  3IBE A;  3FTU A;  2CHX A;  4PS7 A;  1WM5 A;  4JEU A;  2LAH A;  2UWJ G;  3APF A;  5KJK A;  1W3B A;  3SF4 A;  2WXO A;  3TG4 A;  4FLH A;  2WXL A;  4EQF A;  3SD5 A;  2X6I A;  3NQP A;  2DIW A;  2XPI A;  3ZN3 A;  2KCK A;  3VTX A;  2QY7 A;  4KVO A;  1BPO A;  4HLE A;  5M72 A;  3UPV A;  3ESK A;  4IUL A;  1Y8M A;  4GU5 A;  4KVM A;  4OVV A;  4ATG A;  2OVF A;  3MJW A;  3FUJ A;  3FUL A;  5DBK A;  4AM9 A;  1EPU A;  1EYH A;  2QFC A;  3LVQ E;  5FZR A;  5BT1 A;  2MOW A;  3S7D A;  1JWG A;  4JC8 A;  4Y6W A;  4AIF A;  2RG8 A;  3MYV A;  4JL0 A;  3LPZ A;  3LDZ A;  3SBT B;  5EX0 A;  3QNK A;  3EHM A;  3RK6 A;  3NF1 A;  3KD7 A;  3B7T A;  1H2V C;  4I43 A;  2VGX B;  3PVL A;  3T8M A;  2IJG X;  4J8F A;  3CLJ A;  4XE0 A;  3LY8 A;  3RO3 A;  1OWP A;  4ACK A;  3ZIM A;  1H2U A;  4EZL A;  4JA9 A;  4WND A;  1L5J A;  3G2T A;  4EZK A;  1EDU A;  2V4L A;  4O6F A;  2J08 A;  2WQH A;  4AY6 A;  3O48 A;  3SI5 A;  4N2S A;  1HF8 A;  2CG2 A;  4NUR A;  3RIB A;  4JHR A;  5KJN A;  2R59 A;  3TXM A;  5G2N A;  5EDS A;  3P1U A;  3T5V A;  5LX8 A;  2VJ8 A;  4HFG A;  4PS3 A;  5LFA A;  4XZ4 A;  3ASD A;  4P29 A;  2EQX A;  4AV7 A;  1XNF A;  3R7Q A;  3QOU A;  4NRH B;  3L22 A;  3L54 A;  2XPY A;  4GA1 A;  4GYW A;  4J8D A;  2VTB A;  1UJJ A;  2J07 A;  4E6H A;  1B89 A;  1HXI A;  4TRQ A;  4TV3 A;  3SFZ A;  5JJ7 A;  3KS2 A;  2VYI A;  3Q4A B;  3D9O A;  3RO2 A;  4HOR A;  4PS8 A;  3FEY A;  4DK5 A;  4LEU A;  3L08 A;  1HZ4 A;  1H6K A;  2AW6 A;  3MV2 B;  4FHJ A;  3JCK C;  5CHE E;  3FU3 A;  1PAQ A;  2XQ0 A;  3GZ1 A;  4MS6 A;  4JHK A;  4UWH A;  2CFZ A;  4FUL A;  1LF8 A;  4H7X A;  3TXN A;  3CR3 A;  3CVP A;  2HYZ A;  4I1A A;  3QWW A;  4KBQ A;  4W9R A;  4L7T A;  4DI3 A;  3HVE B;  3FUN A;  4AY5 A;  2AVP A;  4Q69 A;  1H19 A;  2UY1 A;  3UT4 A;  3D9P A;  4GZ5 A;  3OAW A;  2L6J A;  3D9N A;  2HM8 A;  2X3M A;  3CST A;  3ML8 A;  3S7B A;  4CGV A;  3FY4 A;  2FBN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...