2QFCA

Crystal structure of bacillus thuringiensis plcr complexed with papr
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
284
structure length
284
Chain Sequence
AEKLGSEIKKIRVLRGLTQKQLSENICHQSEVSRIESGAVYPSMDILQGIAAKLQIPIIHFYEVLIYSDIERKKQFKDQVIMLCKQKRYKEIYNKVWNELKKEEYHPEFQQFLQWQYYVAAYVLKKVDYEYCILELKKLLNQQLTGIDVYQNLYIENAIANIYAENGYLKKGIDLFEQILKQLEALHDNEEFDVKVRYNHAKALYLDSRYEESLYQVNKAIEISCRINSMALIGQLYYQRGECLRKLEYEEAEIEDAYKKASFFFDILEMHAYKEALVNKISRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PlcR protein
publication title Structure of PlcR: Insights into virulence regulation and evolution of quorum sensing in Gram-positive bacteria
pubmed doi rcsb
source organism Bacillus thuringiensis serovar israelensis atcc 35646
molecule tags Transcription regulation
total genus 117
structure length 284
sequence length 284
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF18768 HTH_Bact Helix-turn-helix bacterial domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2qfcA00
3CKCA 2UY1A 3ESKA 3FFLA 2XGMA 5DBKA 3Q4AB 3IEGA 3OXFA 4G26A 4XIFA 3MV2B 3QOUA 5LCWJ 5HI7A 4I2ZA 4APOA 2YHCA 4GYWA 5FZQA 3VTYA 1TJCA 4UI9C 3LY9A 3SZ7A 2C0LA 3UQ3A 4WNEA 1ELWA 2UY1B 3Q15A 3ASHA 4BT9A 4HORA 5FJYA 3CVPA 3AS4A 4UI9K 3OXLA 5CHEE 4CDRA 4UQZA 3CK8A 3GW4A 1WM5A 4N3BA 5A7DB 1NA0A 1HZ4A 3QKYA 2HO1A 4GZ6A 5BT1A 5AYWD 2V5FA 4JL0A 3GYZA 4BTAA 1P5QA 4NQ0A 4I2WA 4RG6A 4YVOA 5EX3A 4I1AA 4BWRA 4IN3B 4F3VA 3S7JA 2MHKA 5FT9A 4G2VA 3TG5A 4AY6A 3RO2A 3WXXA 5KJKA 2LSUA 3ASGA 2WQHA 3QWVA 5C1DA 5EX0A 2QFCA 5KJMA 1YA0A 4Y6CA 5JJ6A 1ZBPA 1E96B 5D0OD 4GCOA 5G04C 5G05J 3Q47B 4J8EA 2VSNA 4I17A 3ZN3A 5JJTA 4GYYA 3QWPA 4U07A 4N2SA 3E4BA 1IYGA 3RO3A 4O6FA 4N3AA 3RKVA 5BW8C 3KS2A 5A6CA 4LEUA 2IFUA 3N71A 4UI9J 3GZ2A 5JJ7A 4U0SA 2VSYA 1NZNA 1HXIA 2KCVA 4B94A 3RJVA 4AIFA 1IHGA 3QWWA 1B89A 2LNIA 2VGXA 1QZ2A 5BNWA 4G1TA 2IF4A 4GZ3A 3FWVA 2XGOA 3MKRA 2L6JA 3VTXA 5CCMA 4EQFA 2PQNA 3RU0A 2VGXB 1ELRA 2UWJG 3LYAA 1KLXA 3CKBA 2WPVA 1PC2A 2OOEA 4N3CA 4WNGA 4N39A 4YVQC 3LKUA 5FZSA 2VYIA 3CV0A 5M72A 3SF4A 4JA7A 4UQXA 3PE4A 4HOTA 2PQRA 4WNFA 3ASFA 2Y4TA 5LCWC 4W9RA 4CGVA 5EKQD 2DBAA 2XEVA 3MA5A 4J0UA 1XNFA 4KYOB 5HQ8A 4JA9A 4U0UA 1KT0A 3CEQA 1ZU2A 3KD7A 4BTBA 3PE3A 3GZ1A 2KATA 2C2LA 3CK9A 4I9CA 3ZHEB 2XGSA 1WAO1 4I9EA 2FBNA 4Y6WA 3S7FA 2NC9A 3QDNA 3OXGA 5DIZA 5FTPA 3O48A 4AY5A 4JHRA 2VQ2A 5ARGA 4U04A 3KAEA 3BEEA 4N2QA 2VGYA 3PDNA 2HR2A 3K9IA 3U3WA 1A17A 3LY7A 3R9AB 3AS8A 3UUXA 5G05C 4GPKA 2AVPA 4GZ5A 3EDTB 4ABNA 2C0MA 5FZRA 1NA3A 4ME2A 4CGWA 3MV3B 3NF1A 3RIBA 3ASDA 5KJLA 4G23A 4GYOA 3S7DA 1HH8A 3LCAA 2BUGA 3U4TA 2KCLA 3TAXA 4AM9A 4KBQA 3FP3A 1KT1A 4XI0A 4RG9A 1FCHA 4A1SA 2FF4A 3Q5MA 2KCKA 5G04J 2FEZA 3CVQA 4N5CA 4UQYA 3ZFWA 2LSVA 4WUYA 3S7BA 2R5SA 3CK7A 2JLBA 4NRHB 3ULQA 4KXKB 4XI9A 4HOSA 2Y4UA 2FI7A 2XCBA 5ARFA 4GA1A 2KC7A 4GCNA 3ZHEA 3CVLA 2PL2A 3ZPJA 1QQEA 3ZGQA 4G25A 5KJNA 3LY8A 4HOUA 4G24A 2Q7FA 2P58C 3URZA 2I6HA 4HOQA 2FO7A 3UPVA 2HYZA 2XPIA 4J8FA 3JYSA 4GA0A 3AS5A 4BT8A 2GW1A 2XCCA 4J8DA 2E2EA 2ONDA 4H7XA 4U0ZA 2YQ8A 1Y8MA 2J9QA 5CCLA 4YNDA 3TGOA 4WNDA 3MEKA 2PZIA 5D0QD 1OUVA 1W3BA 3LPZA 4GA2A 3TG4A 3CVNA 3Q49B 4H7YA 3HYMB
chains in the Genus database with same CATH superfamily
3ESKA 2XGMA 3ZEFA 4HRLA 3Q4AB 2EIJE 3U64A 2XENA 4FLHA 5CMWA 3ESLA 3MV2B 1HS6A 1WDYA 5LCWJ 3EIQC 4UWHA 2XS1A 2C0LA 3UQ3A 3DSTA 3ASHA 3QC1A 5FJYA 3D9PA 3AS4A 4R7LA 3D9JA 4UI9K 5CHEE 5AQ9A 5AAOA 1NL4A 2H6HA 5A7DB 5BV1A 1IHBA 3T5XA 4GZ6A 5BT1A 2GRPB 5AYWD 4JC8A 4AOFA 4O1PA 3GYZA 4BTAA 2WXGA 4CT4A 4RG6A 5EX3A 4BWRA 1E8YA 4G2VA 4HI9A 1N4RA 1O5MA 2KXPC 3C3QA 3QWVA 1OWLA 3LXUX 2P9PG 1ZBPA 4JD2G 5D0OD 5ENNA 3UM3A 3O4ZA 1MJ0A 3BU8A 4DUIA 3AU5A 5ENOD 4J8EA 1HE8A 3ASNE 4GYYA 3QWPA 3EHMA 4U07A 4L2YA 3T8MA 1JUQA 1K1AA 2WXIA 3RKVA 3J5QB 3KS2A 3N71A 1O1TA 2XRZA 3Q9NC 2ZU6B 3HXEA 2VSYA 4TXRA 3HXBA 2KCVA 1NP7A 3L13A 3RJVA 1TNUA 5HS0A 1IHGA 3TXMA 3FEXA 2LNIA 2VGXA 3SFZA 3TXNA 5T3RA 2P9UG 5CBOA 3ISMC 2VJ8A 1HFAA 3MKRA 3UKRG 2L6JA 4ACKA 3RU0A 4E6HA 1ELRA 3LYAA 3B95A 2J4BA 1PC2A 3PUKA 4V3IA 3B7BA 2L6BA 1K1BA 4BESA 4JW1A 4GZDA 4MBGA 3ZRHA 5ENSD 2ZXWE 1JWGA 1N4QA 1H6KA 1MX6A 2IY0C 2ZGDA 2IONA 1V55E 4JEUA 3Q7FA 1IXVA 3W9GA 2GRQB 3FTWA 1DCQA 4WNFA 4XX5A 2A4ZA 3PEUB 2DVWA 1N94A 5LCWC 3L82A 2CFUA 3FTYA 4CGVA 3CHOA 3NAWA 3QNKA 2A5UA 3ABME 3SGHA 5EKQD 4J0UA 5FQ7A 2M63A 2J49A 5CERB 3FH5A 3Q78A 3CHRA 4PS8A 3G2WA 1ZU2A 5BUZA 4BTBA 1N52A 4YDYA 3UM2A 3FTVA 3CVVA 2C2LA 1LD7A 3IHVA 2XGSA 3UKUG 1MYOA 3QDNA 2ZISA 3TWRA 5EN5D 4LUNU 2ZIRA 5FQ6A 5CMYA 4WWNA 2V8SE 3PH0C 5JA4D 3BEEA 3TWVA 3PDNA 3U3WA 4I6JA 3CR3A 3TWUA 4JB8P 4GPKA 3Q75A 3EDTB 1E8WA 5FZRA 3FUHA 4CGWA 4HLEA 2X6IA 2F0YA 4HFGA 1D8EA 5AARA 3ML8A 3B7UX 3D9OA 1HH8A 3LCAA 2BUGA 2QC9A 4GZCA 3DSUA 4F53A 4EBAA 3RRNB 4XZ4A 5G2NA 4I6EA 3FUIA 2FF4A 3P2BA 2PM7A 4U8VD 3CIAA 3ZFWA 2CHZA 2DIWA 4JZYA 1UN8A 3DRAA 1SA4A 1X81A 3S7BA 3CK7A 1V54E 2CHXA 3BUAA 2R03A 4NRHB 3MGBA 3TL5A 4RSYA 1QYMA 5ARFA 3KSLA 3QARA 3ABKE 4GTQA 1KZPA 2CFZA 1QQEA 2QZAA 2I1JA 4DJAA 3C98A 4CRWA 3ZYLA 3CSTA 2BEDA 1FT2A 1DC2A 2XPIA 3T9KA 3ML9A 2L0IA 1EYHA 1EDUA 2E2EA 1Z5SC 3SNXA 4U0ZA 2YQ8A 3ENEA 4HLLA 3W9FA 2IO3C 4LNGA 4JEHA 2YINA 5JMND 4ANVA 3L54A 2IU1A 4PDXA 2WB2A 3MKQA 4GA2A 3TG4A 3BQOA 2DZNA 3CVNA 1JCSA 3JUEA 2IEJA 1N0QA 3FFLA 2LAIA 3G2SA 1TN8A 4HS2A 4F7AA 3QOUA 3PRZA 3C3RA 3IHYA 4APOA 4GYWA 4AV7A 3VTYA 4A3TA 3DBSA 4UI9C 5BXUA 2WXQA 4FA6A 3LY9A 3NOCD 4WNEA 1ELWA 3G2VA 3I3NA 1TN7A 1FPPA 3HIZA 4BT9A 3NOGD 1FVHA 3CVPA 4I1OB 2V4HC 3FY4A 5ENRD 1S64A 3E33A 1TYQG 3HVEA 3GW4A 1WM5A 3FU5A 2IQCA 3QKYA 4F1PA 4G8LA 2NYJA 4LNUD 3PZDA 2V5FA 4JL0A 3IBEA 1S70B 4J8SA 1P5QA 4I2WA 4I1AA 4F3VA 4PS7A 3C72A 4CYMD 3ZYKA 4L1BA 4HVBA 5FT9A 4AY6A 1FT1A 3LEWA 3WG7E 2WXRA 4Z68A 3ASGA 1WG0A 5C1DA 3FU3A 2GRMA 4Y6CA 1UN9A 2LAHA 3RK6A 3PEVB 3EHQA 3X2QE 3ULEG 2VSNA 1TNBA 4C0EA 3FEYA 1AP7A 3FUFA 5JJTA 1TR4A 1GW6A 4IULA 4N2SA 3E4BA 1QBQA 3FUKA 2V0PA 3EU9A 2A5EA 2V5QC 4FLBA 4N3AA 3FU6A 4GMLA 3S2AA 4LEUA 5JJ7A 3GZSA 4U0SA 1NZNA 3LVRE 4LERA 4OYSA 3DSWA 4AIFA 3D3MA 1B89A 3RRMB 3T5VA 4NIKA 1QZ2A 4HB5A 1UG3A 1MQSA 5FQ4A 4A55A 2XZTG 3APDA 3L16A 5EYPF 1FVFA 4FULA 3VTXA 5H7PA 3ZXPA 3TWSA 2X3MA 4URKA 5AJLA 2VGXB 5LX8A 1BI7B 1LF8A 2WPVA 2OOEA 4N3CA 1DCEA 2RKKA 5BPPA 4YVQC 4CT0A 2AXZA 1IKND 3UX4A 5FZSA 2FULA 2VYIA 1OXJA 3FU0A 2XRYA 4BX8A 1E90A 4HRMB 5JHAA 4HOTA 2JEKA 3LJ3A 3ASFA 2WQ6A 4ANWA 3HDXA 4K5BA 2I2OA 2XPYA 5EDSA 2XZDG 2LXLA 3CHQA 3C5RA 1Z3YA 2XEVA 4FHJA 5EIDA 4CZ2D 3E30A 3ZUVB 1QNFA 3AJIA 3KD7A 2OV8A 3PE3A 4EZKA 3GZ1A 3SHFA 1U2VG 3CK9A 3QB2A 4I9CA 2WQ7A 4GMJA 2LXMA 1WAO1 4I9EA 4K03A 2OEWA 4HBDA 1OT8A 3JQ0A 4UWLA 3FTXA 4Y6WA 3S7FA 2WMOA 4YDEA 3OXGA 5HKPA 4J6IA 2WXHA 3UM0A 4HI8A 4PUCA 3Q73A 3L22A 4CDMA 3VLDA 5ARGA 1X5BA 3FH8A 3AG2E 4JHJA 5C2YA 4OAVB 3K9IA 1A17A 1TNYA 2R2LA 5AIJA 4HRNA 3R9AB 4MLPA 2AVPA 1YCSB 4AVXA 4ABNA 1SZAA 4BFRA 1Z6TA 1NA3A 4ME2A 3ASDA 4K5AB 4GYOA 3UINC 3ULYA 2Y1LE 4JXTA 3I4RB 3IV0A 3D9MA 4BX9A 3FTSA 1Q2ZA 3DXKG 4AM9A 3KEAA 3BG1B 3FP3A 4BSZB 2YNQA 4RG9A 3ZYQA 3PVLA 1JPLA 3Q5MA 5G04J 2P9KG 2L9BA 1K8KG 3CVQA 4N5CA 3FULA 3I4GA 3RRUA 2R5SA 4U7EB 2JABA 4APFA 3JXJA 4ZFHA 3APFA 5IY5E 2FI7A 3UXGA 3SD5A 3UTMA 4GA1A 3NB2A 1EPUA 4I6GA 4B8AA 1G3NB 4N5QA 3CVLA 5AQ7A 3ZKJA 3RAUA 4DX2A 4B8CB 4GTSA 2J4DA 3PZ2A 3MX3A 4HOUA 5AENA 3D9LA 2P58C 5HRYA 2I6HA 3ZNGA 4IYPA 4GAAA 3AG4E 4TXPA 3UPVA 4J8FA 1S0PA 3VLFA 3AS5A 1E8ZA 2GW1A 4DI3A 2H6FA 3HXDA 2F8YA 3CHSA 4OVUA 4BSXA 2J9QA 2KBXA 3B7SA 4M7CA 4IRUA 3J5PA 3KEZA 3CQCB 1HF8A 3B7RL 4LRZA 1W3BA 4F1SA 3LPZA 2DWZA 2H6IA 4XE0A 1OY3D 4TUMA 3D9KA 3Q49B 1TNZA 5B1BE 2BKGA 4H7YA 2QYUA 3HYMB 3D9IA 1OWMA 3CKCA 2UY1A 3VLEA 2AXVA 3IEGA 3T8KA 4XIFA 3TWXA 2F37A 4I2ZA 2YHCA 3L17A 4HNAD 2KZTA 4WWPA 3MKQB 1WY6A 1TJCA 1YYHA 4FHKA 4OVVA 4FU3A 3ZYMA 1INZA 3Q15A 5ITZF 3SFYA 1TNOA 4C48B 4K0RA 4GPMA 2B0OE 1UW4B 2H6GA 3OXLA 4JHKA 1YMPA 4CDRA 4UQZA 3U9WA 3FUDA 3DXMG 4RLYA 3LJNA 4KZ0A 3IXEA 2OCCE 2HO1A 4GU5A 2PNNA 1MHQA 3FH7A 1VDYA 2ILRA 3TWTA 2WXJA 4YVOA 4IN3B 2AWIA 3HVEB 2MHKA 2WM9A 4LSZE 5B3SE 3NZUA 3TG5A 4RQIA 3RO2A 3WXXA 2LSUA 4WWOA 3LVQE 2QFCA 2X6FA 3P1UA 5EIBE 5JJ6A 2XEHA 2BKKB 2XEEA 5G04C 5G05J 2OVFA 3UIOC 2IOLA 2ETAA 2RD0A 2ETCA 4L23A 4GTPA 4MRUA 3CVWA 3IKOB 3HRAA 2GRNB 4I17A 1HG5A 4I43A 1IYGA 4DLQA 3R9MA 3RO3A 3PZ3A 5BW8C 5A6CA 2VTBA 2IFUA 1OWOA 4ATZD 3GZ2A 1HX8A 2R17C 1N11A 4JPSA 3DEPA 2EIME 1HXIA 3MJWA 2CG3A 5LFAA 3QWWA 2XS8A 1JCRA 2YHEA 5CECB 5E75A 1N9AA 2Y0BG 3I5PA 4DX5D 3UT8A 5BNWA 3HXCA 4G1TA 4FJZA 2IF4A 3L08A 2R05A 3FWVA 4BETA 2XGOA 3APCA 1BLXB 3CLJA 3SO8A 5CCMA 5J90A 2IJGX 2P2CP 4ACLA 2RFAA 2UWJG 3U66A 4DX6D 3CKBA 4WAFA 5JHBA 4BY6A 2QYJA 5T4YA 4B89A 4N39A 1BU9A 4DK5A 5KCMA 2J09A 2X38A 1LTXA 3LDZA 1UOHA 3L9TA 5M72A 3FTZA 4L2LA 3SF4A 5D2MC 4JA7A 4UQXA 3PE4A 4EHMA 3PZ1A 2PQRA 4U63A 4GTMA 4K5CA 2P9LG 4W9RA 3HG0D 5AN8A 2IOSA 2GGFA 4Q96A 3AG1E 4JVSA 3G2UA 4GTTA 5CRVA 2DBAA 3MA5A 5J08A 3E34A 4KYOB 5HQ8A 1RW2A 4JA9A 3PS6A 3LS8A 5CRUA 4TUUA 4XKBA 3DPYA 4U0UA 1SQMA 1OCZE 2J8SD 3FUNA 5E76A 1RZ4A 3JCKC 4KVOA 3ZHEB 1O1SA 4ILGA 5FTPA 3O48A 4G11A 4PH4B 3NQPA 3NZSA 2EQXA 3UMVA 4U04A 4LG6A 2J08A 3SFXA 4KT6B 3UI2A 3FHEA 3UUXA 5G05C 2VSXE 4AXHA 1N0RA 2HE0A 3OTNA 4U8HA 4G8KA 1U3DA 3RIBA 3TWQA 5FQ8A 1PAQA 4ILHB 2V4LA 2WXOA 4LNBA 2WXKA 3U4TA 1BPOA 3TAXA 3AU4A 1KT1A 2AXUA 1N95A 5AJDA 2QY7A 3MCXA 5KBAA 4XI0A 1FCHA 3FUEA 4A1SA 2XPZA 3EHRA 3JUIA 3ONKA 4FP7A 2KCKA 2FEZA 1UJJA 3FUMA 5BV0A 4UQYA 2LSVA 1SA5A 3PNTB 4F6RD 1IQUA 4ANUA 3FDHA 1BD8A 4HXIA 4ZHBA 4FC8A 1Y6IA 4EZJA 3PREA 2XCBA 4BERA 3ABLE 4UWKA 3QAQA 2WXFA 3ZHEA 3HHMA 2PL2A 1D9SA 3ZPJA 2LO6A 3V2XA 3ZGQA 4DRXE 4KVMA 2OEVA 3PUJA 1DNPA 4J7WA 1OWNA 2GROB 3EHNA 4UWGA 3URZA 4XEIG 4KMOA 3R7RA 2HYZA 2ETBA 3DSVA 2DCPA 4MKTA 4AJWA 4CDNA 4YDOA 2XCCA 2NXPA 3CGHA 2X6KA 4Q69A 1TJFA 1K3ZD 4OAUC 2HM8A 3SQVA 3TJPA 4QQIA 5ANLA 5CCLA 4DPRA 4YNDA 3TGOA 4GMRA 3MEKA 2WXMA 2WMNA 1H2VC 2PZIA 5D0QD 4Q94A 1OUVA 2R02A 2AW6A 4EBAG 2GRRB 5KNGA 2MOWA 2DYSE 1AWCB 5DBKA 3OXFA 4G26A 2XHEA 3CQGB 5HI7A 5EYLA 5FZQA 4D10C 2X6JA 4NACA 2Y69E 2RG8A 3SZ7A 4QFVA 2WXPA 2UY1B 1N4PA 1ZB1A 4A1GA 4P29A 2WXNA 3G2TA 4HORA 3D9HA 1H6PA 4C9BB 4CCAA 3HXFA 2KZTB 3SBSA 5KWDA 4GTVA 3CK8A 1SZ9A 3CVXA 4N3BA 3UT7A 4EPZA 1NA0A 1HZ4A 5EILA 3CSFA 1LD8A 2WVIA 1H2TC 2R59A 2DZOA 4EECA 4O1OA 2P9NG 3UIPC 4NQ0A 3S7JA 3DEOA 1KPSB 4B0ZA 4M3OA 1DVPA 5KJKA 2WQHA 3DPDA 5EX0A 3SBTB 5CBNA 5KJMA 5LP0A 1YA0A 1ELKA 4A3VA 1E96B 2EINE 4GCOA 3QJZA 1TEZA 1EF1C 2AJAA 3Q47B 3Q79A 1N4SA 4EZLA 2VGEA 2EIKE 3ZN3A 3ZXSA 2Y3AA 1IQRA 4E85A 1SVXA 3ZVVA 2BF0X 2OVBA 4O6FA 5LOZA 5FWQA 1L5JA 3UM1A 4UI9J 4I1MA 5B1AE 4B93B 5FINA 2P9SG 3JQ1A 4B94A 3C3OA 3OAWA 4U95D 1MX2A 3EUVA 1BI8B 2VTBB 2PM6A 1OCCE 3EIJA 1TN6A 3CHPA 5T8IA 5AQAA 2X6HA 4GZ3A 1HO8A 1H19A 3PZ4A 4GB9A 4GTOA 4L7TA 4EQFA 2PQNA 2GRLA 2CHWA 1KLXA 2P9IG 4WNGA 5CEAA 3FTUA 3LKUA 3ONLA 5ENTD 2I9CA 5FIOA 1HG2A 1H2UA 4C0MA 4U96D 3CV0A 1OCOE 3D9NA 5BXOA 2E0IA 4DX1A 3FUJA 3AG3E 2Y4TA 3F6QA 3R7QA 4FADA 1A5EA 3RSEG 4UUCA 5A23A 5AQBA 1NFIE 3TWWA 1H6OA 4ATGA 3V79K 1XNFA 3KSQA 2I1KA 2CG2A 3ZIMA 1KT0A 2EILE 2MYOA 4LCTA 5ENQD 2FO1E 3CEQA 4PS3A 2ZGGA 3EJNA 2KATA 1OWPA 3MYVA 3SI5A 1JCQA 3B13A 2FBNA 4A63B 2NC9A 1Z3XA 3L6AA 4KZCA 3SY2A 5DIZA 4AY5A 1O1RA 4NURA 4JHRA 4AEZC 2VQ2A 3ASOE 3BG0B 3KAEA 2NSZA 3DSSA 4N2QA 4AP2A 4ILIA 2VGYA 2XQ0A 2HR2A 1HU3A 3LY7A 3AS8A 4TXQA 1XGWA 4U8YD 4GZ5A 2VSOE 3UT4A 2C0MA 3MV3B 3NF1A 5KJLA 4G23A 1KZOA 3S7DA 3MZLB 1U3CA 2LUHA 2KCLA 4KBQA 4FJYA 3DSXA 3JXIA 4HQDA 1PY1A 4DLOA 1OCRE 3ZW3A 3AAAC 1JWFA 4XKCA 4YDWA 1MX4A 3E37A 1D8DA 3ZU7B 2L0TB 4O60A 1E7VA 5KNHD 4TRQA 4WUYA 3QK0A 3EU5A 1NI1A 2DYRE 3DWLG 2JLBA 3ULQA 4KXKB 4XI9A 4HOSA 2Y4UA 3V30A 3PNLB 3B7TA 3CHMA 5D66A 2KC7A 5CEDB 1E8XA 4GCNA 1MZCA 4X8QA 1E7UA 3Q7AA 4GTRA 5G55A 3CVUA 2RFMA 2MRIA 4G25A 4MS6A 4UWFA 5KJNA 3LY8A 4G24A 2Q7FA 4ANXA 4HOQA 2IO2C 4BEPA 2FO7A 1N54A 3E32A 4TV3A 5ANRA 4DX7D 3JYSA 3V31A 2WXLA 3V2OA 3Q9UC 4GA0A 4J8YA 2KM4A 4BT8A 4J8DA 2ONDA 3NBNB 4H7XA 1Y8MA 1SW6A 2BTDA 4CEMA 1S63A 4WNDA 5ENPD 3CVYA 4DI4A 1UJKA 2F8XK 4RVBA 2J07A 1H0AA 2B6CA 4L9PA
chains in the Genus database with same CATH topology
3CKCA 2UY1A 3ESKA 3FFLA 2MOWA 2XGMA 3VLEA 3ZEFA 5DBKA 2AXVA 3Q4AB 2LAIA 3IEGA 3G2SA 3OXFA 4G26A 3U64A 4HS2A 4F7AA 4FLHA 4XIFA 5CMWA 2XHEA 3CQGB 3ESLA 1HS6A 3MV2B 3QOUA 3PRZA 3IHYA 5HI7A 5LCWJ 4I2ZA 3EIQC 4APOA 2YHCA 3L17A 4GYWA 4AV7A 2KZTA 5FZQA 4WWPA 3MKQB 1WY6A 3VTYA 4A3TA 4D10C 1TJCA 4FHKA 4UWHA 3DBSA 2X6JA 4OVVA 4UI9C 4NACA 2WXQA 4FU3A 3ZYMA 4FA6A 2RG8A 3LY9A 3SZ7A 4QFVA 2C0LA 3UQ3A 2WXPA 1INZA 4WNEA 1ELWA 2UY1B 3G2VA 3I3NA 3Q15A 3ASHA 4A1GA 4P29A 2WXNA 3G2TA 3HIZA 4BT9A 3QC1A 4HORA 5FJYA 4C9BB 1FVHA 3CVPA 4I1OB 4K0RA 3D9PA 4CCAA 3AS4A 3FY4A 1UW4B 4R7LA 3D9JA 4UI9K 3OXLA 2KZTB 4JHKA 5CHEE 3SBSA 4CDRA 4UQZA 3HVEA 3CK8A 3GW4A 1SZ9A 1WM5A 3U9WA 3CVXA 4N3BA 3UT7A 5A7DB 4EPZA 5BV1A 3FUDA 1NA0A 3T5XA 1HZ4A 3FU5A 2IQCA 3QKYA 4KZ0A 3CSFA 2HO1A 4GZ6A 4GU5A 2WVIA 1H2TC 3PZDA 5BT1A 1MHQA 2R59A 5AYWD 4JC8A 2V5FA 4AOFA 3FH7A 4JL0A 3IBEA 4EECA 3GYZA 4BTAA 1VDYA 2ILRA 2WXGA 4J8SA 1P5QA 2WXJA 4NQ0A 4CT4A 4I2WA 4RG6A 4YVOA 5EX3A 4I1AA 4BWRA 4IN3B 4F3VA 4PS7A 3S7JA 2AWIA 1E8YA 3HVEB 2MHKA 2WM9A 4L1BA 3ZYKA 5FT9A 4HVBA 3NZUA 4G2VA 3TG5A 4B0ZA 4AY6A 4M3OA 3LEWA 1DVPA 2WXRA 3RO2A 3WXXA 5KJKA 2LSUA 3ASGA 2WQHA 3QWVA 4WWOA 3LVQE 5C1DA 1OWLA 2QFCA 2X6FA 3DPDA 3FU3A 3LXUX 3P1UA 5EX0A 3SBTB 5KJMA 1YA0A 5LP0A 1ELKA 2GRMA 4Y6CA 4A3VA 5JJ6A 1ZBPA 1UN9A 2LAHA 1E96B 3RK6A 3PEVB 4GCOA 5D0OD 3QJZA 5ENNA 5G05J 5G04C 3O4ZA 2OVFA 1TEZA 2IOLA 1EF1C 3Q47B 3AU5A 4J8EA 2VSNA 2RD0A 4L23A 4EZLA 4MRUA 1HE8A 3CVWA 3IKOB 4I17A 3FEYA 4C0EA 3FUFA 3ZN3A 4GYYA 3QWPA 3ZXSA 3EHMA 5JJTA 4U07A 2Y3AA 1GW6A 4IULA 1IQRA 1HG5A 4E85A 3E4BA 4I43A 4N2SA 3FUKA 4L2YA 2V0PA 3T8MA 1IYGA 1JUQA 4DLQA 3ZVVA 3RO3A 2BF0X 2OVBA 2WXIA 4FLBA 4O6FA 4N3AA 5LOZA 5FWQA 5BW8C 3FU6A 3RKVA 1L5JA 3KS2A 4GMLA 3S2AA 5A6CA 2VTBA 4LEUA 2IFUA 1OWOA 3N71A 3GZ2A 4UI9J 3GZSA 4U0SA 5JJ7A 4I1MA 2XRZA 1HX8A 2ZU6B 2R17C 4JPSA 2VSYA 1NZNA 3JQ1A 3LVRE 4LERA 1HXIA 2KCVA 4B94A 1NP7A 4OYSA 3L13A 3RJVA 3MJWA 4AIFA 3OAWA 2CG3A 1IHGA 5LFAA 3QWWA 2YHEA 3D3MA 3TXMA 3FEXA 1B89A 2LNIA 2VGXA 3RRMB 3SFZA 3T5VA 5E75A 3TXNA 1QZ2A 1UG3A 2VTBB 2PM6A 3I5PA 5T3RA 3UT8A 1MQSA 5FQ4A 3EIJA 5BNWA 3CHPA 4G1TA 5T8IA 4FJZA 4A55A 2IF4A 2X6HA 3L08A 4GZ3A 1HO8A 3FWVA 2XGOA 1H19A 1HFAA 2VJ8A 3APDA 3APCA 3L16A 3MKRA 1FVFA 2L6JA 4FULA 3VTXA 4GB9A 3CLJA 2X3MA 5CCMA 5J90A 2IJGX 4L7TA 4ACKA 4EQFA 2PQNA 4ACLA 4URKA 2GRLA 3RU0A 5AJLA 2VGXB 4E6HA 5LX8A 1LF8A 1ELRA 2UWJG 2CHWA 3LYAA 1KLXA 3U66A 3CKBA 2J4BA 4WAFA 2WPVA 5JHBA 1PC2A 2OOEA 3PUKA 4V3IA 4N3CA 4WNGA 4BY6A 3FTUA 5T4YA 4B89A 5BPPA 4N39A 4YVQC 3LKUA 4CT0A 2AXZA 3ONLA 4DK5A 4JW1A 3UX4A 4GZDA 5KCMA 2J09A 3ZRHA 2I9CA 2X38A 5FZSA 1HG2A 3LDZA 1H2UA 2FULA 4C0MA 1JWGA 2VYIA 3CV0A 1H6KA 3FU0A 5M72A 3D9NA 2XRYA 4BX8A 2E0IA 3FTZA 4L2LA 3SF4A 1E90A 4JA7A 5JHAA 2IONA 4UQXA 3PE4A 3FUJA 4JEUA 4HOTA 2JEKA 2PQRA 4U63A 3FTWA 4WNFA 3LJ3A 4XX5A 2A4ZA 3ASFA 3PEUB 2WQ6A 4ANWA 2Y4TA 5LCWC 4W9RA 3R7QA 3HDXA 2CFUA 4FADA 2IOSA 3FTYA 2GGFA 4CGVA 2I2OA 3CHOA 2XPYA 3QNKA 5EDSA 2A5UA 4Q96A 4JVSA 5EKQD 3SGHA 3G2UA 3CHQA 5A23A 1Z3YA 2DBAA 2XEVA 3MA5A 4FHJA 4J0UA 5FQ7A 4ATGA 5J08A 1XNFA 4KYOB 5HQ8A 2M63A 4JA9A 2J49A 3PS6A 2I1KA 3FH5A 2CG2A 3LS8A 4TUUA 4XKBA 3ZIMA 3CHRA 4U0UA 1KT0A 1SQMA 4LCTA 1QNFA 3CEQA 4PS8A 3G2WA 1ZU2A 5BUZA 3KD7A 2OV8A 4BTBA 3FUNA 1N52A 4PS3A 3EJNA 3PE3A 4EZKA 3GZ1A 2KATA 3FTVA 5E76A 3CVVA 2C2LA 3SHFA 1OWPA 3MYVA 3IHVA 3SI5A 3CK9A 3QB2A 4I9CA 2WQ7A 3JCKC 4KVOA 3ZHEB 4GMJA 2XGSA 1WAO1 4I9EA 4K03A 3B13A 3JQ0A 2FBNA 4ILGA 3FTXA 4UWLA 4Y6WA 3S7FA 2NC9A 3QDNA 1Z3XA 2WMOA 3L6AA 3OXGA 4KZCA 5DIZA 5FTPA 3O48A 4J6IA 2WXHA 4AY5A 4G11A 4PH4B 3NQPA 4NURA 4LUNU 4PUCA 4JHRA 4AEZC 3NZSA 2VQ2A 2EQXA 3L22A 5FQ6A 4CDMA 5CMYA 5ARGA 1X5BA 3FH8A 3BG0B 4WWNA 3VLDA 2V8SE 4U04A 3UMVA 3PH0C 3KAEA 3BEEA 4JHJA 2NSZA 5C2YA 4N2QA 4AP2A 4ILIA 2J08A 2VGYA 2XQ0A 3PDNA 2HR2A 3K9IA 4KT6B 3U3WA 1A17A 1HU3A 4I6JA 5AIJA 3CR3A 3LY7A 3R9AB 3FHEA 3AS8A 3UUXA 5G05C 4GPKA 1XGWA 2VSXE 4AXHA 4MLPA 2AVPA 4GZ5A 2VSOE 3OTNA 3EDTB 4AVXA 4ABNA 1E8WA 1SZAA 3UT4A 4U8HA 2C0MA 4BFRA 1Z6TA 5FZRA 1NA3A 3FUHA 4ME2A 4CGWA 3MV3B 3NF1A 3RIBA 1U3DA 3ASDA 5KJLA 4HLEA 2X6IA 1PAQA 4G23A 5FQ8A 4GYOA 3S7DA 4ILHB 3MZLB 4HFGA 1U3CA 4JXTA 3I4RB 3IV0A 2V4LA 3ML8A 3D9MA 2WXOA 4BX9A 3B7UX 3FTSA 3D9OA 1HH8A 3LCAA 2BUGA 2WXKA 4GZCA 3U4TA 1BPOA 2KCLA 3TAXA 4AM9A 4F53A 3AU4A 4KBQA 3BG1B 3FP3A 1KT1A 2AXUA 4FJYA 4EBAA 5AJDA 2QY7A 3RRNB 3MCXA 4XZ4A 2YNQA 4XI0A 4RG9A 1FCHA 3ZYQA 1PY1A 3FUEA 5G2NA 4DLOA 4A1SA 3ZW3A 4I6EA 1JWFA 3FUIA 3PVLA 4XKCA 2XPZA 1JPLA 2FF4A 3JUIA 3ONKA 3Q5MA 2KCKA 3P2BA 4FP7A 5G04J 2PM7A 2FEZA 1UJJA 2L9BA 3CIAA 3CVQA 3FUMA 4N5CA 5BV0A 2L0TB 3FULA 4UQYA 3ZFWA 3I4GA 2CHZA 1E7VA 2DIWA 4JZYA 1UN8A 3RRUA 2LSVA 4TRQA 4WUYA 3QK0A 3PNTB 3S7BA 2R5SA 3CK7A 1IQUA 4ANUA 2CHXA 3FDHA 4APFA 2JLBA 4NRHB 3MGBA 4HXIA 3ULQA 3TL5A 3APFA 4KXKB 4RSYA 4XI9A 2Y4UA 1Y6IA 4FC8A 3PREA 4EZJA 4HOSA 2FI7A 2XCBA 3PNLB 3B7TA 3CHMA 5ARFA 3SD5A 4GA1A 3QARA 4UWKA 2KC7A 1EPUA 1E8XA 4GCNA 3QAQA 4I6GA 4B8AA 1E7UA 2WXFA 3ZHEA 3CVLA 3HHMA 2PL2A 2CFZA 5G55A 3CVUA 3ZPJA 1QQEA 2I1JA 2LO6A 3ZGQA 4DJAA 2MRIA 3C98A 4KVMA 4B8CB 3PUJA 4G25A 4MS6A 2J4DA 4UWFA 5KJNA 3LY8A 3MX3A 1DNPA 4HOUA 4G24A 5AENA 2Q7FA 1OWNA 3EHNA 3D9LA 2P58C 4UWGA 4ANXA 4CRWA 3URZA 3ZYLA 2I6HA 4HOQA 3CSTA 4IYPA 4GAAA 4KMOA 2FO7A 1N54A 3R7RA 4TV3A 5ANRA 3UPVA 2HYZA 2XPIA 4J8FA 3JYSA 1S0PA 2WXLA 2DCPA 3ML9A 4GA0A 3VLFA 3AS5A 2KM4A 2L0IA 1E8ZA 4MKTA 4BT8A 4AJWA 2GW1A 4CDNA 4DI3A 1EYHA 2XCCA 2NXPA 3CGHA 4J8DA 2X6KA 1EDUA 4Q69A 2E2EA 1TJFA 2ONDA 2HM8A 4H7XA 3CHSA 4U0ZA 3SNXA 2YQ8A 3ENEA 3TJPA 1Y8MA 4OVUA 5ANLA 4BSXA 2J9QA 3B7SA 5CCLA 4IRUA 2BTDA 4CEMA 4DPRA 4YNDA 3TGOA 4JEHA 2YINA 3MEKA 2WXMA 4WNDA 3KEZA 3CVYA 2WMNA 1H2VC 2PZIA 3CQCB 1HF8A 5D0QD 3B7RL 4Q94A 4ANVA 1OUVA 3L54A 4DI4A 4LRZA 1UJKA 1W3BA 2IU1A 4PDXA 4F1SA 2WB2A 2AW6A 3LPZA 3MKQA 4GA2A 4XE0A 3TG4A 4EBAG 4RVBA 3D9KA 3CVNA 2J07A 3Q49B 1H0AA 4H7YA 3HYMB 3D9IA 1OWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CKC A;  2UY1 A;  3ESK A;  3FFL A;  2XGM A;  5DBK A;  3Q4A B;  3IEG A;  3OXF A;  4G26 A;  4XIF A;  3MV2 B;  3QOU A;  5LCW J;  5HI7 A;  4I2Z A;  4APO A;  2YHC A;  4GYW A;  5FZQ A;  3VTY A;  1TJC A;  4UI9 C;  3LY9 A;  3SZ7 A;  2C0L A;  3UQ3 A;  4WNE A;  1ELW A;  2UY1 B;  3Q15 A;  3ASH A;  4BT9 A;  4HOR A;  5FJY A;  3CVP A;  3AS4 A;  4UI9 K;  3OXL A;  5CHE E;  4CDR A;  4UQZ A;  3CK8 A;  3GW4 A;  1WM5 A;  4N3B A;  5A7D B;  1NA0 A;  1HZ4 A;  3QKY A;  2HO1 A;  4GZ6 A;  5BT1 A;  5AYW D;  2V5F A;  4JL0 A;  3GYZ A;  4BTA A;  1P5Q A;  4NQ0 A;  4I2W A;  4RG6 A;  4YVO A;  5EX3 A;  4I1A A;  4BWR A;  4IN3 B;  4F3V A;  3S7J A;  2MHK A;  5FT9 A;  4G2V A;  3TG5 A;  4AY6 A;  3RO2 A;  3WXX A;  5KJK A;  2LSU A;  3ASG A;  2WQH A;  3QWV A;  5C1D A;  5EX0 A;  2QFC A;  5KJM A;  1YA0 A;  4Y6C A;  5JJ6 A;  1ZBP A;  1E96 B;  5D0O D;  4GCO A;  5G04 C;  5G05 J;  3Q47 B;  4J8E A;  2VSN A;  4I17 A;  3ZN3 A;  5JJT A;  4GYY A;  3QWP A;  4U07 A;  4N2S A;  3E4B A;  1IYG A;  3RO3 A;  4O6F A;  4N3A A;  3RKV A;  5BW8 C;  3KS2 A;  5A6C A;  4LEU A;  2IFU A;  3N71 A;  4UI9 J;  3GZ2 A;  5JJ7 A;  4U0S A;  2VSY A;  1NZN A;  1HXI A;  2KCV A;  4B94 A;  3RJV A;  4AIF A;  1IHG A;  3QWW A;  1B89 A;  2LNI A;  2VGX A;  1QZ2 A;  5BNW A;  4G1T A;  2IF4 A;  4GZ3 A;  3FWV A;  2XGO A;  3MKR A;  2L6J A;  3VTX A;  5CCM A;  4EQF A;  2PQN A;  3RU0 A;  2VGX B;  1ELR A;  2UWJ G;  3LYA A;  1KLX A;  3CKB A;  2WPV A;  1PC2 A;  2OOE A;  4N3C A;  4WNG A;  4N39 A;  4YVQ C;  3LKU A;  5FZS A;  2VYI A;  3CV0 A;  5M72 A;  3SF4 A;  4JA7 A;  4UQX A;  3PE4 A;  4HOT A;  2PQR A;  4WNF A;  3ASF A;  2Y4T A;  5LCW C;  4W9R A;  4CGV A;  5EKQ D;  2DBA A;  2XEV A;  3MA5 A;  4J0U A;  1XNF A;  4KYO B;  5HQ8 A;  4JA9 A;  4U0U A;  1KT0 A;  3CEQ A;  1ZU2 A;  3KD7 A;  4BTB A;  3PE3 A;  3GZ1 A;  2KAT A;  2C2L A;  3CK9 A;  4I9C A;  3ZHE B;  2XGS A;  1WAO 1;  4I9E A;  2FBN A;  4Y6W A;  3S7F A;  2NC9 A;  3QDN A;  3OXG A;  5DIZ A;  5FTP A;  3O48 A;  4AY5 A;  4JHR A;  2VQ2 A;  5ARG A;  4U04 A;  3KAE A;  3BEE A;  4N2Q A;  2VGY A;  3PDN A;  2HR2 A;  3K9I A;  3U3W A;  1A17 A;  3LY7 A;  3R9A B;  3AS8 A;  3UUX A;  5G05 C;  4GPK A;  2AVP A;  4GZ5 A;  3EDT B;  4ABN A;  2C0M A;  5FZR A;  1NA3 A;  4ME2 A;  4CGW A;  3MV3 B;  3NF1 A;  3RIB A;  3ASD A;  5KJL A;  4G23 A;  4GYO A;  3S7D A;  1HH8 A;  3LCA A;  2BUG A;  3U4T A;  2KCL A;  3TAX A;  4AM9 A;  4KBQ A;  3FP3 A;  1KT1 A;  4XI0 A;  4RG9 A;  1FCH A;  4A1S A;  2FF4 A;  3Q5M A;  2KCK A;  5G04 J;  2FEZ A;  3CVQ A;  4N5C A;  4UQY A;  3ZFW A;  2LSV A;  4WUY A;  3S7B A;  2R5S A;  3CK7 A;  2JLB A;  4NRH B;  3ULQ A;  4KXK B;  4XI9 A;  4HOS A;  2Y4U A;  2FI7 A;  2XCB A;  5ARF A;  4GA1 A;  2KC7 A;  4GCN A;  3ZHE A;  3CVL A;  2PL2 A;  3ZPJ A;  1QQE A;  3ZGQ A;  4G25 A;  5KJN A;  3LY8 A;  4HOU A;  4G24 A;  2Q7F A;  2P58 C;  3URZ A;  2I6H A;  4HOQ A;  2FO7 A;  3UPV A;  2HYZ A;  2XPI A;  4J8F A;  3JYS A;  4GA0 A;  3AS5 A;  4BT8 A;  2GW1 A;  2XCC A;  4J8D A;  2E2E A;  2OND A;  4H7X A;  4U0Z A;  2YQ8 A;  1Y8M A;  2J9Q A;  5CCL A;  4YND A;  3TGO A;  4WND A;  3MEK A;  2PZI A;  5D0Q D;  1OUV A;  1W3B A;  3LPZ A;  4GA2 A;  3TG4 A;  3CVN A;  3Q49 B;  4H7Y A;  3HYM B; 
#chains in the Genus database with same CATH topology
 3ESK A;  2XGM A;  3ZEF A;  4HRL A;  3Q4A B;  2EIJ E;  3U64 A;  2XEN A;  4FLH A;  5CMW A;  3ESL A;  3MV2 B;  1HS6 A;  1WDY A;  5LCW J;  3EIQ C;  4UWH A;  2XS1 A;  2C0L A;  3UQ3 A;  3DST A;  3ASH A;  3QC1 A;  5FJY A;  3D9P A;  3AS4 A;  4R7L A;  3D9J A;  4UI9 K;  5CHE E;  5AQ9 A;  5AAO A;  1NL4 A;  2H6H A;  5A7D B;  5BV1 A;  1IHB A;  3T5X A;  4GZ6 A;  5BT1 A;  2GRP B;  5AYW D;  4JC8 A;  4AOF A;  4O1P A;  3GYZ A;  4BTA A;  2WXG A;  4CT4 A;  4RG6 A;  5EX3 A;  4BWR A;  1E8Y A;  4G2V A;  4HI9 A;  1N4R A;  1O5M A;  2KXP C;  3C3Q A;  3QWV A;  1OWL A;  3LXU X;  2P9P G;  1ZBP A;  4JD2 G;  5D0O D;  5ENN A;  3UM3 A;  3O4Z A;  1MJ0 A;  3BU8 A;  4DUI A;  3AU5 A;  5ENO D;  4J8E A;  1HE8 A;  3ASN E;  4GYY A;  3QWP A;  3EHM A;  4U07 A;  4L2Y A;  3T8M A;  1JUQ A;  1K1A A;  2WXI A;  3RKV A;  3J5Q B;  3KS2 A;  3N71 A;  1O1T A;  2XRZ A;  3Q9N C;  2ZU6 B;  3HXE A;  2VSY A;  4TXR A;  3HXB A;  2KCV A;  1NP7 A;  3L13 A;  3RJV A;  1TNU A;  5HS0 A;  1IHG A;  3TXM A;  3FEX A;  2LNI A;  2VGX A;  3SFZ A;  3TXN A;  5T3R A;  2P9U G;  5CBO A;  3ISM C;  2VJ8 A;  1HFA A;  3MKR A;  3UKR G;  2L6J A;  4ACK A;  3RU0 A;  4E6H A;  1ELR A;  3LYA A;  3B95 A;  2J4B A;  1PC2 A;  3PUK A;  4V3I A;  3B7B A;  2L6B A;  1K1B A;  4BES A;  4JW1 A;  4GZD A;  4MBG A;  3ZRH A;  5ENS D;  2ZXW E;  1JWG A;  1N4Q A;  1H6K A;  1MX6 A;  2IY0 C;  2ZGD A;  2ION A;  1V55 E;  4JEU A;  3Q7F A;  1IXV A;  3W9G A;  2GRQ B;  3FTW A;  1DCQ A;  4WNF A;  4XX5 A;  2A4Z A;  3PEU B;  2DVW A;  1N94 A;  5LCW C;  3L82 A;  2CFU A;  3FTY A;  4CGV A;  3CHO A;  3NAW A;  3QNK A;  2A5U A;  3ABM E;  3SGH A;  5EKQ D;  4J0U A;  5FQ7 A;  2M63 A;  2J49 A;  5CER B;  3FH5 A;  3Q78 A;  3CHR A;  4PS8 A;  3G2W A;  1ZU2 A;  5BUZ A;  4BTB A;  1N52 A;  4YDY A;  3UM2 A;  3FTV A;  3CVV A;  2C2L A;  1LD7 A;  3IHV A;  2XGS A;  3UKU G;  1MYO A;  3QDN A;  2ZIS A;  3TWR A;  5EN5 D;  4LUN U;  2ZIR A;  5FQ6 A;  5CMY A;  4WWN A;  2V8S E;  3PH0 C;  5JA4 D;  3BEE A;  3TWV A;  3PDN A;  3U3W A;  4I6J A;  3CR3 A;  3TWU A;  4JB8 P;  4GPK A;  3Q75 A;  3EDT B;  1E8W A;  5FZR A;  3FUH A;  4CGW A;  4HLE A;  2X6I A;  2F0Y A;  4HFG A;  1D8E A;  5AAR A;  3ML8 A;  3B7U X;  3D9O A;  1HH8 A;  3LCA A;  2BUG A;  2QC9 A;  4GZC A;  3DSU A;  4F53 A;  4EBA A;  3RRN B;  4XZ4 A;  5G2N A;  4I6E A;  3FUI A;  2FF4 A;  3P2B A;  2PM7 A;  4U8V D;  3CIA A;  3ZFW A;  2CHZ A;  2DIW A;  4JZY A;  1UN8 A;  3DRA A;  1SA4 A;  1X81 A;  3S7B A;  3CK7 A;  1V54 E;  2CHX A;  3BUA A;  2R03 A;  4NRH B;  3MGB A;  3TL5 A;  4RSY A;  1QYM A;  5ARF A;  3KSL A;  3QAR A;  3ABK E;  4GTQ A;  1KZP A;  2CFZ A;  1QQE A;  2QZA A;  2I1J A;  4DJA A;  3C98 A;  4CRW A;  3ZYL A;  3CST A;  2BED A;  1FT2 A;  1DC2 A;  2XPI A;  3T9K A;  3ML9 A;  2L0I A;  1EYH A;  1EDU A;  2E2E A;  1Z5S C;  3SNX A;  4U0Z A;  2YQ8 A;  3ENE A;  4HLL A;  3W9F A;  2IO3 C;  4LNG A;  4JEH A;  2YIN A;  5JMN D;  4ANV A;  3L54 A;  2IU1 A;  4PDX A;  2WB2 A;  3MKQ A;  4GA2 A;  3TG4 A;  3BQO A;  2DZN A;  3CVN A;  1JCS A;  3JUE A;  2IEJ A;  1N0Q A;  3FFL A;  2LAI A;  3G2S A;  1TN8 A;  4HS2 A;  4F7A A;  3QOU A;  3PRZ A;  3C3R A;  3IHY A;  4APO A;  4GYW A;  4AV7 A;  3VTY A;  4A3T A;  3DBS A;  4UI9 C;  5BXU A;  2WXQ A;  4FA6 A;  3LY9 A;  3NOC D;  4WNE A;  1ELW A;  3G2V A;  3I3N A;  1TN7 A;  1FPP A;  3HIZ A;  4BT9 A;  3NOG D;  1FVH A;  3CVP A;  4I1O B;  2V4H C;  3FY4 A;  5ENR D;  1S64 A;  3E33 A;  1TYQ G;  3HVE A;  3GW4 A;  1WM5 A;  3FU5 A;  2IQC A;  3QKY A;  4F1P A;  4G8L A;  2NYJ A;  4LNU D;  3PZD A;  2V5F A;  4JL0 A;  3IBE A;  1S70 B;  4J8S A;  1P5Q A;  4I2W A;  4I1A A;  4F3V A;  4PS7 A;  3C72 A;  4CYM D;  3ZYK A;  4L1B A;  4HVB A;  5FT9 A;  4AY6 A;  1FT1 A;  3LEW A;  3WG7 E;  2WXR A;  4Z68 A;  3ASG A;  1WG0 A;  5C1D A;  3FU3 A;  2GRM A;  4Y6C A;  1UN9 A;  2LAH A;  3RK6 A;  3PEV B;  3EHQ A;  3X2Q E;  3ULE G;  2VSN A;  1TNB A;  4C0E A;  3FEY A;  1AP7 A;  3FUF A;  5JJT A;  1TR4 A;  1GW6 A;  4IUL A;  4N2S A;  3E4B A;  1QBQ A;  3FUK A;  2V0P A;  3EU9 A;  2A5E A;  2V5Q C;  4FLB A;  4N3A A;  3FU6 A;  4GML A;  3S2A A;  4LEU A;  5JJ7 A;  3GZS A;  4U0S A;  1NZN A;  3LVR E;  4LER A;  4OYS A;  3DSW A;  4AIF A;  3D3M A;  1B89 A;  3RRM B;  3T5V A;  4NIK A;  1QZ2 A;  4HB5 A;  1UG3 A;  1MQS A;  5FQ4 A;  4A55 A;  2XZT G;  3APD A;  3L16 A;  5EYP F;  1FVF A;  4FUL A;  3VTX A;  5H7P A;  3ZXP A;  3TWS A;  2X3M A;  4URK A;  5AJL A;  2VGX B;  5LX8 A;  1BI7 B;  1LF8 A;  2WPV A;  2OOE A;  4N3C A;  1DCE A;  2RKK A;  5BPP A;  4YVQ C;  4CT0 A;  2AXZ A;  1IKN D;  3UX4 A;  5FZS A;  2FUL A;  2VYI A;  1OXJ A;  3FU0 A;  2XRY A;  4BX8 A;  1E90 A;  4HRM B;  5JHA A;  4HOT A;  2JEK A;  3LJ3 A;  3ASF A;  2WQ6 A;  4ANW A;  3HDX A;  4K5B A;  2I2O A;  2XPY A;  5EDS A;  2XZD G;  2LXL A;  3CHQ A;  3C5R A;  1Z3Y A;  2XEV A;  4FHJ A;  5EID A;  4CZ2 D;  3E30 A;  3ZUV B;  1QNF A;  3AJI A;  3KD7 A;  2OV8 A;  3PE3 A;  4EZK A;  3GZ1 A;  3SHF A;  1U2V G;  3CK9 A;  3QB2 A;  4I9C A;  2WQ7 A;  4GMJ A;  2LXM A;  1WAO 1;  4I9E A;  4K03 A;  2OEW A;  4HBD A;  1OT8 A;  3JQ0 A;  4UWL A;  3FTX A;  4Y6W A;  3S7F A;  2WMO A;  4YDE A;  3OXG A;  5HKP A;  4J6I A;  2WXH A;  3UM0 A;  4HI8 A;  4PUC A;  3Q73 A;  3L22 A;  4CDM A;  3VLD A;  5ARG A;  1X5B A;  3FH8 A;  3AG2 E;  4JHJ A;  5C2Y A;  4OAV B;  3K9I A;  1A17 A;  1TNY A;  2R2L A;  5AIJ A;  4HRN A;  3R9A B;  4MLP A;  2AVP A;  1YCS B;  4AVX A;  4ABN A;  1SZA A;  4BFR A;  1Z6T A;  1NA3 A;  4ME2 A;  3ASD A;  4K5A B;  4GYO A;  3UIN C;  3ULY A;  2Y1L E;  4JXT A;  3I4R B;  3IV0 A;  3D9M A;  4BX9 A;  3FTS A;  1Q2Z A;  3DXK G;  4AM9 A;  3KEA A;  3BG1 B;  3FP3 A;  4BSZ B;  2YNQ A;  4RG9 A;  3ZYQ A;  3PVL A;  1JPL A;  3Q5M A;  5G04 J;  2P9K G;  2L9B A;  1K8K G;  3CVQ A;  4N5C A;  3FUL A;  3I4G A;  3RRU A;  2R5S A;  4U7E B;  2JAB A;  4APF A;  3JXJ A;  4ZFH A;  3APF A;  5IY5 E;  2FI7 A;  3UXG A;  3SD5 A;  3UTM A;  4GA1 A;  3NB2 A;  1EPU A;  4I6G A;  4B8A A;  1G3N B;  4N5Q A;  3CVL A;  5AQ7 A;  3ZKJ A;  3RAU A;  4DX2 A;  4B8C B;  4GTS A;  2J4D A;  3PZ2 A;  3MX3 A;  4HOU A;  5AEN A;  3D9L A;  2P58 C;  5HRY A;  2I6H A;  3ZNG A;  4IYP A;  4GAA A;  3AG4 E;  4TXP A;  3UPV A;  4J8F A;  1S0P A;  3VLF A;  3AS5 A;  1E8Z A;  2GW1 A;  4DI3 A;  2H6F A;  3HXD A;  2F8Y A;  3CHS A;  4OVU A;  4BSX A;  2J9Q A;  2KBX A;  3B7S A;  4M7C A;  4IRU A;  3J5P A;  3KEZ A;  3CQC B;  1HF8 A;  3B7R L;  4LRZ A;  1W3B A;  4F1S A;  3LPZ A;  2DWZ A;  2H6I A;  4XE0 A;  1OY3 D;  4TUM A;  3D9K A;  3Q49 B;  1TNZ A;  5B1B E;  2BKG A;  4H7Y A;  2QYU A;  3HYM B;  3D9I A;  1OWM A;  3CKC A;  2UY1 A;  3VLE A;  2AXV A;  3IEG A;  3T8K A;  4XIF A;  3TWX A;  2F37 A;  4I2Z A;  2YHC A;  3L17 A;  4HNA D;  2KZT A;  4WWP A;  3MKQ B;  1WY6 A;  1TJC A;  1YYH A;  4FHK A;  4OVV A;  4FU3 A;  3ZYM A;  1INZ A;  3Q15 A;  5ITZ F;  3SFY A;  1TNO A;  4C48 B;  4K0R A;  4GPM A;  2B0O E;  1UW4 B;  2H6G A;  3OXL A;  4JHK A;  1YMP A;  4CDR A;  4UQZ A;  3U9W A;  3FUD A;  3DXM G;  4RLY A;  3LJN A;  4KZ0 A;  3IXE A;  2OCC E;  2HO1 A;  4GU5 A;  2PNN A;  1MHQ A;  3FH7 A;  1VDY A;  2ILR A;  3TWT A;  2WXJ A;  4YVO A;  4IN3 B;  2AWI A;  3HVE B;  2MHK A;  2WM9 A;  4LSZ E;  5B3S E;  3NZU A;  3TG5 A;  4RQI A;  3RO2 A;  3WXX A;  2LSU A;  4WWO A;  3LVQ E;  2QFC A;  2X6F A;  3P1U A;  5EIB E;  5JJ6 A;  2XEH A;  2BKK B;  2XEE A;  5G04 C;  5G05 J;  2OVF A;  3UIO C;  2IOL A;  2ETA A;  2RD0 A;  2ETC A;  4L23 A;  4GTP A;  4MRU A;  3CVW A;  3IKO B;  3HRA A;  2GRN B;  4I17 A;  1HG5 A;  4I43 A;  1IYG A;  4DLQ A;  3R9M A;  3RO3 A;  3PZ3 A;  5BW8 C;  5A6C A;  2VTB A;  2IFU A;  1OWO A;  4ATZ D;  3GZ2 A;  1HX8 A;  2R17 C;  1N11 A;  4JPS A;  3DEP A;  2EIM E;  1HXI A;  3MJW A;  2CG3 A;  5LFA A;  3QWW A;  2XS8 A;  1JCR A;  2YHE A;  5CEC B;  5E75 A;  1N9A A;  2Y0B G;  3I5P A;  4DX5 D;  3UT8 A;  5BNW A;  3HXC A;  4G1T A;  4FJZ A;  2IF4 A;  3L08 A;  2R05 A;  3FWV A;  4BET A;  2XGO A;  3APC A;  1BLX B;  3CLJ A;  3SO8 A;  5CCM A;  5J90 A;  2IJG X;  2P2C P;  4ACL A;  2RFA A;  2UWJ G;  3U66 A;  4DX6 D;  3CKB A;  4WAF A;  5JHB A;  4BY6 A;  2QYJ A;  5T4Y A;  4B89 A;  4N39 A;  1BU9 A;  4DK5 A;  5KCM A;  2J09 A;  2X38 A;  1LTX A;  3LDZ A;  1UOH A;  3L9T A;  5M72 A;  3FTZ A;  4L2L A;  3SF4 A;  5D2M C;  4JA7 A;  4UQX A;  3PE4 A;  4EHM A;  3PZ1 A;  2PQR A;  4U63 A;  4GTM A;  4K5C A;  2P9L G;  4W9R A;  3HG0 D;  5AN8 A;  2IOS A;  2GGF A;  4Q96 A;  3AG1 E;  4JVS A;  3G2U A;  4GTT A;  5CRV A;  2DBA A;  3MA5 A;  5J08 A;  3E34 A;  4KYO B;  5HQ8 A;  1RW2 A;  4JA9 A;  3PS6 A;  3LS8 A;  5CRU A;  4TUU A;  4XKB A;  3DPY A;  4U0U A;  1SQM A;  1OCZ E;  2J8S D;  3FUN A;  5E76 A;  1RZ4 A;  3JCK C;  4KVO A;  3ZHE B;  1O1S A;  4ILG A;  5FTP A;  3O48 A;  4G11 A;  4PH4 B;  3NQP A;  3NZS A;  2EQX A;  3UMV A;  4U04 A;  4LG6 A;  2J08 A;  3SFX A;  4KT6 B;  3UI2 A;  3FHE A;  3UUX A;  5G05 C;  2VSX E;  4AXH A;  1N0R A;  2HE0 A;  3OTN A;  4U8H A;  4G8K A;  1U3D A;  3RIB A;  3TWQ A;  5FQ8 A;  1PAQ A;  4ILH B;  2V4L A;  2WXO A;  4LNB A;  2WXK A;  3U4T A;  1BPO A;  3TAX A;  3AU4 A;  1KT1 A;  2AXU A;  1N95 A;  5AJD A;  2QY7 A;  3MCX A;  5KBA A;  4XI0 A;  1FCH A;  3FUE A;  4A1S A;  2XPZ A;  3EHR A;  3JUI A;  3ONK A;  4FP7 A;  2KCK A;  2FEZ A;  1UJJ A;  3FUM A;  5BV0 A;  4UQY A;  2LSV A;  1SA5 A;  3PNT B;  4F6R D;  1IQU A;  4ANU A;  3FDH A;  1BD8 A;  4HXI A;  4ZHB A;  4FC8 A;  1Y6I A;  4EZJ A;  3PRE A;  2XCB A;  4BER A;  3ABL E;  4UWK A;  3QAQ A;  2WXF A;  3ZHE A;  3HHM A;  2PL2 A;  1D9S A;  3ZPJ A;  2LO6 A;  3V2X A;  3ZGQ A;  4DRX E;  4KVM A;  2OEV A;  3PUJ A;  1DNP A;  4J7W A;  1OWN A;  2GRO B;  3EHN A;  4UWG A;  3URZ A;  4XEI G;  4KMO A;  3R7R A;  2HYZ A;  2ETB A;  3DSV A;  2DCP A;  4MKT A;  4AJW A;  4CDN A;  4YDO A;  2XCC A;  2NXP A;  3CGH A;  2X6K A;  4Q69 A;  1TJF A;  1K3Z D;  4OAU C;  2HM8 A;  3SQV A;  3TJP A;  4QQI A;  5ANL A;  5CCL A;  4DPR A;  4YND A;  3TGO A;  4GMR A;  3MEK A;  2WXM A;  2WMN A;  1H2V C;  2PZI A;  5D0Q D;  4Q94 A;  1OUV A;  2R02 A;  2AW6 A;  4EBA G;  2GRR B;  5KNG A;  2MOW A;  2DYS E;  1AWC B;  5DBK A;  3OXF A;  4G26 A;  2XHE A;  3CQG B;  5HI7 A;  5EYL A;  5FZQ A;  4D10 C;  2X6J A;  4NAC A;  2Y69 E;  2RG8 A;  3SZ7 A;  4QFV A;  2WXP A;  2UY1 B;  1N4P A;  1ZB1 A;  4A1G A;  4P29 A;  2WXN A;  3G2T A;  4HOR A;  3D9H A;  1H6P A;  4C9B B;  4CCA A;  3HXF A;  2KZT B;  3SBS A;  5KWD A;  4GTV A;  3CK8 A;  1SZ9 A;  3CVX A;  4N3B A;  3UT7 A;  4EPZ A;  1NA0 A;  1HZ4 A;  5EIL A;  3CSF A;  1LD8 A;  2WVI A;  1H2T C;  2R59 A;  2DZO A;  4EEC A;  4O1O A;  2P9N G;  3UIP C;  4NQ0 A;  3S7J A;  3DEO A;  1KPS B;  4B0Z A;  4M3O A;  1DVP A;  5KJK A;  2WQH A;  3DPD A;  5EX0 A;  3SBT B;  5CBN A;  5KJM A;  5LP0 A;  1YA0 A;  1ELK A;  4A3V A;  1E96 B;  2EIN E;  4GCO A;  3QJZ A;  1TEZ A;  1EF1 C;  2AJA A;  3Q47 B;  3Q79 A;  1N4S A;  4EZL A;  2VGE A;  2EIK E;  3ZN3 A;  3ZXS A;  2Y3A A;  1IQR A;  4E85 A;  1SVX A;  3ZVV A;  2BF0 X;  2OVB A;  4O6F A;  5LOZ A;  5FWQ A;  1L5J A;  3UM1 A;  4UI9 J;  4I1M A;  5B1A E;  4B93 B;  5FIN A;  2P9S G;  3JQ1 A;  4B94 A;  3C3O A;  3OAW A;  4U95 D;  1MX2 A;  3EUV A;  1BI8 B;  2VTB B;  2PM6 A;  1OCC E;  3EIJ A;  1TN6 A;  3CHP A;  5T8I A;  5AQA A;  2X6H A;  4GZ3 A;  1HO8 A;  1H19 A;  3PZ4 A;  4GB9 A;  4GTO A;  4L7T A;  4EQF A;  2PQN A;  2GRL A;  2CHW A;  1KLX A;  2P9I G;  4WNG A;  5CEA A;  3FTU A;  3LKU A;  3ONL A;  5ENT D;  2I9C A;  5FIO A;  1HG2 A;  1H2U A;  4C0M A;  4U96 D;  3CV0 A;  1OCO E;  3D9N A;  5BXO A;  2E0I A;  4DX1 A;  3FUJ A;  3AG3 E;  2Y4T A;  3F6Q A;  3R7Q A;  4FAD A;  1A5E A;  3RSE G;  4UUC A;  5A23 A;  5AQB A;  1NFI E;  3TWW A;  1H6O A;  4ATG A;  3V79 K;  1XNF A;  3KSQ A;  2I1K A;  2CG2 A;  3ZIM A;  1KT0 A;  2EIL E;  2MYO A;  4LCT A;  5ENQ D;  2FO1 E;  3CEQ A;  4PS3 A;  2ZGG A;  3EJN A;  2KAT A;  1OWP A;  3MYV A;  3SI5 A;  1JCQ A;  3B13 A;  2FBN A;  4A63 B;  2NC9 A;  1Z3X A;  3L6A A;  4KZC A;  3SY2 A;  5DIZ A;  4AY5 A;  1O1R A;  4NUR A;  4JHR A;  4AEZ C;  2VQ2 A;  3ASO E;  3BG0 B;  3KAE A;  2NSZ A;  3DSS A;  4N2Q A;  4AP2 A;  4ILI A;  2VGY A;  2XQ0 A;  2HR2 A;  1HU3 A;  3LY7 A;  3AS8 A;  4TXQ A;  1XGW A;  4U8Y D;  4GZ5 A;  2VSO E;  3UT4 A;  2C0M A;  3MV3 B;  3NF1 A;  5KJL A;  4G23 A;  1KZO A;  3S7D A;  3MZL B;  1U3C A;  2LUH A;  2KCL A;  4KBQ A;  4FJY A;  3DSX A;  3JXI A;  4HQD A;  1PY1 A;  4DLO A;  1OCR E;  3ZW3 A;  3AAA C;  1JWF A;  4XKC A;  4YDW A;  1MX4 A;  3E37 A;  1D8D A;  3ZU7 B;  2L0T B;  4O60 A;  1E7V A;  5KNH D;  4TRQ A;  4WUY A;  3QK0 A;  3EU5 A;  1NI1 A;  2DYR E;  3DWL G;  2JLB A;  3ULQ A;  4KXK B;  4XI9 A;  4HOS A;  2Y4U A;  3V30 A;  3PNL B;  3B7T A;  3CHM A;  5D66 A;  2KC7 A;  5CED B;  1E8X A;  4GCN A;  1MZC A;  4X8Q A;  1E7U A;  3Q7A A;  4GTR A;  5G55 A;  3CVU A;  2RFM A;  2MRI A;  4G25 A;  4MS6 A;  4UWF A;  5KJN A;  3LY8 A;  4G24 A;  2Q7F A;  4ANX A;  4HOQ A;  2IO2 C;  4BEP A;  2FO7 A;  1N54 A;  3E32 A;  4TV3 A;  5ANR A;  4DX7 D;  3JYS A;  3V31 A;  2WXL A;  3V2O A;  3Q9U C;  4GA0 A;  4J8Y A;  2KM4 A;  4BT8 A;  4J8D A;  2OND A;  3NBN B;  4H7X A;  1Y8M A;  1SW6 A;  2BTD A;  4CEM A;  1S63 A;  4WND A;  5ENP D;  3CVY A;  4DI4 A;  1UJK A;  2F8X K;  4RVB A;  2J07 A;  1H0A A;  2B6C A;  4L9P A; 
#chains in the Genus database with same CATH homology
 3CKC A;  2UY1 A;  3ESK A;  3FFL A;  2MOW A;  2XGM A;  3VLE A;  3ZEF A;  5DBK A;  2AXV A;  3Q4A B;  2LAI A;  3IEG A;  3G2S A;  3OXF A;  4G26 A;  3U64 A;  4HS2 A;  4F7A A;  4FLH A;  4XIF A;  5CMW A;  2XHE A;  3CQG B;  3ESL A;  1HS6 A;  3MV2 B;  3QOU A;  3PRZ A;  3IHY A;  5HI7 A;  5LCW J;  4I2Z A;  3EIQ C;  4APO A;  2YHC A;  3L17 A;  4GYW A;  4AV7 A;  2KZT A;  5FZQ A;  4WWP A;  3MKQ B;  1WY6 A;  3VTY A;  4A3T A;  4D10 C;  1TJC A;  4FHK A;  4UWH A;  3DBS A;  2X6J A;  4OVV A;  4UI9 C;  4NAC A;  2WXQ A;  4FU3 A;  3ZYM A;  4FA6 A;  2RG8 A;  3LY9 A;  3SZ7 A;  4QFV A;  2C0L A;  3UQ3 A;  2WXP A;  1INZ A;  4WNE A;  1ELW A;  2UY1 B;  3G2V A;  3I3N A;  3Q15 A;  3ASH A;  4A1G A;  4P29 A;  2WXN A;  3G2T A;  3HIZ A;  4BT9 A;  3QC1 A;  4HOR A;  5FJY A;  4C9B B;  1FVH A;  3CVP A;  4I1O B;  4K0R A;  3D9P A;  4CCA A;  3AS4 A;  3FY4 A;  1UW4 B;  4R7L A;  3D9J A;  4UI9 K;  3OXL A;  2KZT B;  4JHK A;  5CHE E;  3SBS A;  4CDR A;  4UQZ A;  3HVE A;  3CK8 A;  3GW4 A;  1SZ9 A;  1WM5 A;  3U9W A;  3CVX A;  4N3B A;  3UT7 A;  5A7D B;  4EPZ A;  5BV1 A;  3FUD A;  1NA0 A;  3T5X A;  1HZ4 A;  3FU5 A;  2IQC A;  3QKY A;  4KZ0 A;  3CSF A;  2HO1 A;  4GZ6 A;  4GU5 A;  2WVI A;  1H2T C;  3PZD A;  5BT1 A;  1MHQ A;  2R59 A;  5AYW D;  4JC8 A;  2V5F A;  4AOF A;  3FH7 A;  4JL0 A;  3IBE A;  4EEC A;  3GYZ A;  4BTA A;  1VDY A;  2ILR A;  2WXG A;  4J8S A;  1P5Q A;  2WXJ A;  4NQ0 A;  4CT4 A;  4I2W A;  4RG6 A;  4YVO A;  5EX3 A;  4I1A A;  4BWR A;  4IN3 B;  4F3V A;  4PS7 A;  3S7J A;  2AWI A;  1E8Y A;  3HVE B;  2MHK A;  2WM9 A;  4L1B A;  3ZYK A;  5FT9 A;  4HVB A;  3NZU A;  4G2V A;  3TG5 A;  4B0Z A;  4AY6 A;  4M3O A;  3LEW A;  1DVP A;  2WXR A;  3RO2 A;  3WXX A;  5KJK A;  2LSU A;  3ASG A;  2WQH A;  3QWV A;  4WWO A;  3LVQ E;  5C1D A;  1OWL A;  2QFC A;  2X6F A;  3DPD A;  3FU3 A;  3LXU X;  3P1U A;  5EX0 A;  3SBT B;  5KJM A;  1YA0 A;  5LP0 A;  1ELK A;  2GRM A;  4Y6C A;  4A3V A;  5JJ6 A;  1ZBP A;  1UN9 A;  2LAH A;  1E96 B;  3RK6 A;  3PEV B;  4GCO A;  5D0O D;  3QJZ A;  5ENN A;  5G05 J;  5G04 C;  3O4Z A;  2OVF A;  1TEZ A;  2IOL A;  1EF1 C;  3Q47 B;  3AU5 A;  4J8E A;  2VSN A;  2RD0 A;  4L23 A;  4EZL A;  4MRU A;  1HE8 A;  3CVW A;  3IKO B;  4I17 A;  3FEY A;  4C0E A;  3FUF A;  3ZN3 A;  4GYY A;  3QWP A;  3ZXS A;  3EHM A;  5JJT A;  4U07 A;  2Y3A A;  1GW6 A;  4IUL A;  1IQR A;  1HG5 A;  4E85 A;  3E4B A;  4I43 A;  4N2S A;  3FUK A;  4L2Y A;  2V0P A;  3T8M A;  1IYG A;  1JUQ A;  4DLQ A;  3ZVV A;  3RO3 A;  2BF0 X;  2OVB A;  2WXI A;  4FLB A;  4O6F A;  4N3A A;  5LOZ A;  5FWQ A;  5BW8 C;  3FU6 A;  3RKV A;  1L5J A;  3KS2 A;  4GML A;  3S2A A;  5A6C A;  2VTB A;  4LEU A;  2IFU A;  1OWO A;  3N71 A;  3GZ2 A;  4UI9 J;  3GZS A;  4U0S A;  5JJ7 A;  4I1M A;  2XRZ A;  1HX8 A;  2ZU6 B;  2R17 C;  4JPS A;  2VSY A;  1NZN A;  3JQ1 A;  3LVR E;  4LER A;  1HXI A;  2KCV A;  4B94 A;  1NP7 A;  4OYS A;  3L13 A;  3RJV A;  3MJW A;  4AIF A;  3OAW A;  2CG3 A;  1IHG A;  5LFA A;  3QWW A;  2YHE A;  3D3M A;  3TXM A;  3FEX A;  1B89 A;  2LNI A;  2VGX A;  3RRM B;  3SFZ A;  3T5V A;  5E75 A;  3TXN A;  1QZ2 A;  1UG3 A;  2VTB B;  2PM6 A;  3I5P A;  5T3R A;  3UT8 A;  1MQS A;  5FQ4 A;  3EIJ A;  5BNW A;  3CHP A;  4G1T A;  5T8I A;  4FJZ A;  4A55 A;  2IF4 A;  2X6H A;  3L08 A;  4GZ3 A;  1HO8 A;  3FWV A;  2XGO A;  1H19 A;  1HFA A;  2VJ8 A;  3APD A;  3APC A;  3L16 A;  3MKR A;  1FVF A;  2L6J A;  4FUL A;  3VTX A;  4GB9 A;  3CLJ A;  2X3M A;  5CCM A;  5J90 A;  2IJG X;  4L7T A;  4ACK A;  4EQF A;  2PQN A;  4ACL A;  4URK A;  2GRL A;  3RU0 A;  5AJL A;  2VGX B;  4E6H A;  5LX8 A;  1LF8 A;  1ELR A;  2UWJ G;  2CHW A;  3LYA A;  1KLX A;  3U66 A;  3CKB A;  2J4B A;  4WAF A;  2WPV A;  5JHB A;  1PC2 A;  2OOE A;  3PUK A;  4V3I A;  4N3C A;  4WNG A;  4BY6 A;  3FTU A;  5T4Y A;  4B89 A;  5BPP A;  4N39 A;  4YVQ C;  3LKU A;  4CT0 A;  2AXZ A;  3ONL A;  4DK5 A;  4JW1 A;  3UX4 A;  4GZD A;  5KCM A;  2J09 A;  3ZRH A;  2I9C A;  2X38 A;  5FZS A;  1HG2 A;  3LDZ A;  1H2U A;  2FUL A;  4C0M A;  1JWG A;  2VYI A;  3CV0 A;  1H6K A;  3FU0 A;  5M72 A;  3D9N A;  2XRY A;  4BX8 A;  2E0I A;  3FTZ A;  4L2L A;  3SF4 A;  1E90 A;  4JA7 A;  5JHA A;  2ION A;  4UQX A;  3PE4 A;  3FUJ A;  4JEU A;  4HOT A;  2JEK A;  2PQR A;  4U63 A;  3FTW A;  4WNF A;  3LJ3 A;  4XX5 A;  2A4Z A;  3ASF A;  3PEU B;  2WQ6 A;  4ANW A;  2Y4T A;  5LCW C;  4W9R A;  3R7Q A;  3HDX A;  2CFU A;  4FAD A;  2IOS A;  3FTY A;  2GGF A;  4CGV A;  2I2O A;  3CHO A;  2XPY A;  3QNK A;  5EDS A;  2A5U A;  4Q96 A;  4JVS A;  5EKQ D;  3SGH A;  3G2U A;  3CHQ A;  5A23 A;  1Z3Y A;  2DBA A;  2XEV A;  3MA5 A;  4FHJ A;  4J0U A;  5FQ7 A;  4ATG A;  5J08 A;  1XNF A;  4KYO B;  5HQ8 A;  2M63 A;  4JA9 A;  2J49 A;  3PS6 A;  2I1K A;  3FH5 A;  2CG2 A;  3LS8 A;  4TUU A;  4XKB A;  3ZIM A;  3CHR A;  4U0U A;  1KT0 A;  1SQM A;  4LCT A;  1QNF A;  3CEQ A;  4PS8 A;  3G2W A;  1ZU2 A;  5BUZ A;  3KD7 A;  2OV8 A;  4BTB A;  3FUN A;  1N52 A;  4PS3 A;  3EJN A;  3PE3 A;  4EZK A;  3GZ1 A;  2KAT A;  3FTV A;  5E76 A;  3CVV A;  2C2L A;  3SHF A;  1OWP A;  3MYV A;  3IHV A;  3SI5 A;  3CK9 A;  3QB2 A;  4I9C A;  2WQ7 A;  3JCK C;  4KVO A;  3ZHE B;  4GMJ A;  2XGS A;  1WAO 1;  4I9E A;  4K03 A;  3B13 A;  3JQ0 A;  2FBN A;  4ILG A;  3FTX A;  4UWL A;  4Y6W A;  3S7F A;  2NC9 A;  3QDN A;  1Z3X A;  2WMO A;  3L6A A;  3OXG A;  4KZC A;  5DIZ A;  5FTP A;  3O48 A;  4J6I A;  2WXH A;  4AY5 A;  4G11 A;  4PH4 B;  3NQP A;  4NUR A;  4LUN U;  4PUC A;  4JHR A;  4AEZ C;  3NZS A;  2VQ2 A;  2EQX A;  3L22 A;  5FQ6 A;  4CDM A;  5CMY A;  5ARG A;  1X5B A;  3FH8 A;  3BG0 B;  4WWN A;  3VLD A;  2V8S E;  4U04 A;  3UMV A;  3PH0 C;  3KAE A;  3BEE A;  4JHJ A;  2NSZ A;  5C2Y A;  4N2Q A;  4AP2 A;  4ILI A;  2J08 A;  2VGY A;  2XQ0 A;  3PDN A;  2HR2 A;  3K9I A;  4KT6 B;  3U3W A;  1A17 A;  1HU3 A;  4I6J A;  5AIJ A;  3CR3 A;  3LY7 A;  3R9A B;  3FHE A;  3AS8 A;  3UUX A;  5G05 C;  4GPK A;  1XGW A;  2VSX E;  4AXH A;  4MLP A;  2AVP A;  4GZ5 A;  2VSO E;  3OTN A;  3EDT B;  4AVX A;  4ABN A;  1E8W A;  1SZA A;  3UT4 A;  4U8H A;  2C0M A;  4BFR A;  1Z6T A;  5FZR A;  1NA3 A;  3FUH A;  4ME2 A;  4CGW A;  3MV3 B;  3NF1 A;  3RIB A;  1U3D A;  3ASD A;  5KJL A;  4HLE A;  2X6I A;  1PAQ A;  4G23 A;  5FQ8 A;  4GYO A;  3S7D A;  4ILH B;  3MZL B;  4HFG A;  1U3C A;  4JXT A;  3I4R B;  3IV0 A;  2V4L A;  3ML8 A;  3D9M A;  2WXO A;  4BX9 A;  3B7U X;  3FTS A;  3D9O A;  1HH8 A;  3LCA A;  2BUG A;  2WXK A;  4GZC A;  3U4T A;  1BPO A;  2KCL A;  3TAX A;  4AM9 A;  4F53 A;  3AU4 A;  4KBQ A;  3BG1 B;  3FP3 A;  1KT1 A;  2AXU A;  4FJY A;  4EBA A;  5AJD A;  2QY7 A;  3RRN B;  3MCX A;  4XZ4 A;  2YNQ A;  4XI0 A;  4RG9 A;  1FCH A;  3ZYQ A;  1PY1 A;  3FUE A;  5G2N A;  4DLO A;  4A1S A;  3ZW3 A;  4I6E A;  1JWF A;  3FUI A;  3PVL A;  4XKC A;  2XPZ A;  1JPL A;  2FF4 A;  3JUI A;  3ONK A;  3Q5M A;  2KCK A;  3P2B A;  4FP7 A;  5G04 J;  2PM7 A;  2FEZ A;  1UJJ A;  2L9B A;  3CIA A;  3CVQ A;  3FUM A;  4N5C A;  5BV0 A;  2L0T B;  3FUL A;  4UQY A;  3ZFW A;  3I4G A;  2CHZ A;  1E7V A;  2DIW A;  4JZY A;  1UN8 A;  3RRU A;  2LSV A;  4TRQ A;  4WUY A;  3QK0 A;  3PNT B;  3S7B A;  2R5S A;  3CK7 A;  1IQU A;  4ANU A;  2CHX A;  3FDH A;  4APF A;  2JLB A;  4NRH B;  3MGB A;  4HXI A;  3ULQ A;  3TL5 A;  3APF A;  4KXK B;  4RSY A;  4XI9 A;  2Y4U A;  1Y6I A;  4FC8 A;  3PRE A;  4EZJ A;  4HOS A;  2FI7 A;  2XCB A;  3PNL B;  3B7T A;  3CHM A;  5ARF A;  3SD5 A;  4GA1 A;  3QAR A;  4UWK A;  2KC7 A;  1EPU A;  1E8X A;  4GCN A;  3QAQ A;  4I6G A;  4B8A A;  1E7U A;  2WXF A;  3ZHE A;  3CVL A;  3HHM A;  2PL2 A;  2CFZ A;  5G55 A;  3CVU A;  3ZPJ A;  1QQE A;  2I1J A;  2LO6 A;  3ZGQ A;  4DJA A;  2MRI A;  3C98 A;  4KVM A;  4B8C B;  3PUJ A;  4G25 A;  4MS6 A;  2J4D A;  4UWF A;  5KJN A;  3LY8 A;  3MX3 A;  1DNP A;  4HOU A;  4G24 A;  5AEN A;  2Q7F A;  1OWN A;  3EHN A;  3D9L A;  2P58 C;  4UWG A;  4ANX A;  4CRW A;  3URZ A;  3ZYL A;  2I6H A;  4HOQ A;  3CST A;  4IYP A;  4GAA A;  4KMO A;  2FO7 A;  1N54 A;  3R7R A;  4TV3 A;  5ANR A;  3UPV A;  2HYZ A;  2XPI A;  4J8F A;  3JYS A;  1S0P A;  2WXL A;  2DCP A;  3ML9 A;  4GA0 A;  3VLF A;  3AS5 A;  2KM4 A;  2L0I A;  1E8Z A;  4MKT A;  4BT8 A;  4AJW A;  2GW1 A;  4CDN A;  4DI3 A;  1EYH A;  2XCC A;  2NXP A;  3CGH A;  4J8D A;  2X6K A;  1EDU A;  4Q69 A;  2E2E A;  1TJF A;  2OND A;  2HM8 A;  4H7X A;  3CHS A;  4U0Z A;  3SNX A;  2YQ8 A;  3ENE A;  3TJP A;  1Y8M A;  4OVU A;  5ANL A;  4BSX A;  2J9Q A;  3B7S A;  5CCL A;  4IRU A;  2BTD A;  4CEM A;  4DPR A;  4YND A;  3TGO A;  4JEH A;  2YIN A;  3MEK A;  2WXM A;  4WND A;  3KEZ A;  3CVY A;  2WMN A;  1H2V C;  2PZI A;  3CQC B;  1HF8 A;  5D0Q D;  3B7R L;  4Q94 A;  4ANV A;  1OUV A;  3L54 A;  4DI4 A;  4LRZ A;  1UJK A;  1W3B A;  2IU1 A;  4PDX A;  4F1S A;  2WB2 A;  2AW6 A;  3LPZ A;  3MKQ A;  4GA2 A;  4XE0 A;  3TG4 A;  4EBA G;  4RVB A;  3D9K A;  3CVN A;  2J07 A;  3Q49 B;  1H0A A;  4H7Y A;  3HYM B;  3D9I A;  1OWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...