2QFCA

Crystal structure of bacillus thuringiensis plcr complexed with papr
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
284
structure length
284
Chain Sequence
b'AEKLGSEIKKIRVLRGLTQKQLSENICHQSEVSRIESGAVYPSMDILQGIAAKLQIPIIHFYEVLIYSDIERKKQFKDQVIMLCKQKRYKEIYNKVWNELKKEEYHPEFQQFLQWQYYVAAYVLKKVDYEYCILELKKLLNQQLTGIDVYQNLYIENAIANIYAENGYLKKGIDLFEQILKQLEALHDNEEFDVKVRYNHAKALYLDSRYEESLYQVNKAIEISCRINSMALIGQLYYQRGECLRKLEYEEAEIEDAYKKASFFFDILEMHAYKEALVNKISRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PlcR protein
publication title Structure of PlcR: Insights into virulence regulation and evolution of quorum sensing in Gram-positive bacteria
pubmed doi rcsb
source organism Bacillus thuringiensis serovar israelensis atcc 35646
molecule tags Transcription regulation
total genus 117
structure length 284
sequence length 284
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF18768 HTH_Bact Helix-turn-helix bacterial domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2qfcA00
2VYIA 2YHCA 5FZRA 5BW8C 1KT0A 5JJ7A 5CCMA 3QWVA 2Q7FA 2XGMA 5KJMA 5FT9A 1ZU2A 3S7FA 2J9QA 3ASDA 4UQYA 4JA9A 3KD7A 3O48A 2FO7A 2R5SA 3TAXA 3UPVA 3FP3A 2Y4UA 2L6JA 2VGXA 4H7YA 4RG9A 5JJ6A 4I9EA 4RG6A 5CCLA 1ZBPA 3HYMB 5G05J 3ZHEA 4HOQA 3SF4A 4KYOB 3ZPJA 3AS5A 2UY1A 4HOUA 4HOSA 4IN3B 3KAEA 2PL2A 3ZGQA 2LNIA 3CK8A 4JA7A 2FI7A 2XEVA 4N5CA 3GZ1A 4XIFA 4GYOA 5EKQD 4GCNA 2I6HA 1WAO1 2FEZA 4WNDA 2GW1A 3OXLA 3QWPA 5AYWD 4A1SA 3IEGA 5LCWJ 2LSVA 3CVPA 4YNDA 5CHEE 4XI9A 3Q5MA 4H7XA 1HXIA 4AY6A 3CVLA 3CVNA 5BNWA 4APOA 3EDTB 2JLBA 3BEEA 3QKYA 4UI9C 4N3AA 2UWJG 4AY5A 2KATA 5G04C 2XCBA 2VGXB 4CGWA 3OXGA 3WXXA 3AS4A 2PZIA 1YA0A 2P58C 3ZN3A 3FWVA 3VTXA 5D0QD 4HORA 5EX3A 3S7JA 1E96B 4G2VA 3VTYA 3CKBA 2VSYA 3RU0A 4F3VA 4N2QA 1HH8A 3QDNA 4G1TA 5HI7A 4WUYA 4I9CA 4GYYA 3QWWA 2Y4TA 4GYWA 4U0UA 1A17A 4U0ZA 4I1AA 4JL0A 3PDNA 3UUXA 5BT1A 1PC2A 3FFLA 3U3WA 2XGSA 1NA0A 4LEUA 3LY7A 4J8FA 4NRHB 3RJVA 1KLXA 3S7BA 1W3BA 4BT8A 4U04A 3RKVA 2LSUA 4GPKA 1P5QA 2OOEA 3Q4AB 4I2WA 2KCLA 5EX0A 4UQXA 5G05C 5ARGA 1Y8MA 3CK7A 4CGVA 2FBNA 4N3BA 4YVOA 4J8DA 3ULQA 4UI9K 2HYZA 3Q49B 5M72A 4BTAA 3U4TA 3LY9A 4WNFA 2C0LA 3MV3B 4YVQC 2VQ2A 4NQ0A 2MHKA 3AS8A 3MKRA 3R9AB 1NA3A 1QQEA 3MEKA 2C0MA 2VGYA 3CEQA 3CVQA 4UI9J 4CDRA 1HZ4A 2XCCA 4ABNA 5G04J 3NF1A 5DIZA 3CK9A 3JYSA 4UQZA 3ZHEB 3RIBA 2VSNA 2UY1B 4J8EA 3MV2B 3TG4A 4KBQA 5C1DA 2IF4A 4WNEA 5KJKA 3N71A 2AVPA 2C2LA 4J0UA 3GZ2A 3LY8A 4EQFA 5JJTA 2XPIA 3TGOA 4BTBA 2NC9A 5D0OD 4GA0A 2XGOA 5DBKA 3Q15A 2QFCA 3UQ3A 5A6CA 4AIFA 1XNFA 2HR2A 4Y6WA 2BUGA 3LYAA 5FTPA 3GYZA 4O6FA 3QOUA 2WQHA 2KCKA 3ZFWA 4I17A 1FCHA 1ELRA 5HQ8A 2WPVA 4BWRA 1B89A 3TG5A 5FZSA 3CV0A 5KJNA 2FF4A 4N3CA 4I2ZA 4ME2A 4U07A 1IYGA 2KC7A 2IFUA 2ONDA 3PE3A 2DBAA 4BT9A 3ASHA 3Q47B 4KXKB 3LPZA 4GZ6A 1IHGA 4G23A 3KS2A 3LKUA 3ASFA 4Y6CA 3MA5A 1QZ2A 3LCAA 4N39A 4WNGA 4U0SA 5FZQA 4G26A 1OUVA 5A7DB 4B94A 3GW4A 1ELWA 2V5FA 2E2EA 5LCWC 4GCOA 3ASGA 1KT1A 4G25A 4GA2A 3E4BA 4HOTA 3K9IA 4GA1A 4G24A 4W9RA 3SZ7A 1WM5A 4N2SA 3RO2A 2PQRA 3PE4A 3S7DA 2HO1A 4JHRA 4GZ3A 4XI0A 4AM9A 2PQNA 3RO3A 5KJLA 3URZA 3ESKA 2KCVA 1TJCA 2YQ8A 5FJYA 5ARFA 1NZNA 4GZ5A 3CKCA 3OXFA
chains in the Genus database with same CATH superfamily
1K1BA 1H6OA 2VYIA 4PS8A 2YHCA 1QYMA 4MBGA 3TWRA 2DYSE 1KT0A 2PM7A 2PM6A 4APFA 1YCSB 4CDMA 2R03A 2NSZA 2AW6A 4B8AA 1ZU2A 1OT8A 2EILE 4HLEA 3ASDA 1DCEA 1OWMA 2FO7A 3RRNB 2R5SA 3TAXA 4XKBA 1HU3A 2VGXA 4H7YA 1V55E 2M63A 2QYUA 5CCLA 3CVWA 3QNKA 2R02A 3ZHEA 3FEXA 1SZ9A 4G11A 3CHMA 4A3VA 4ZHBA 3E33A 4HOSA 3QK0A 5LFAA 2FI7A 1DCQA 1KZPA 3R7QA 3NOCD 4OYSA 3HVEB 2I1JA 4LERA 3L16A 1QNFA 4GCNA 2I6HA 4R7LA 4WNDA 3NAWA 2H6IA 3IEGA 5G2NA 4FLBA 4XI9A 4H7XA 4FJYA 1N4RA 4AOFA 2CG3A 2DYRE 1X81A 3CLJA 3I3NA 1SQMA 4UI9C 4FA6A 2P9LG 1SZAA 4P29A 3E37A 2PZIA 4GTVA 4DX5D 3ZN3A 3VTXA 4HORA 1Y6IA 5AN8A 3TWTA 3MX3A 1BPOA 3CKBA 3RU0A 4F3VA 1HH8A 4BETA 2LAHA 3UI2A 1TNOA 4WUYA 3ZYLA 4GYYA 2ZU6B 1K3ZD 2KZTB 4DUIA 2Y3AA 3FUFA 3ULYA 1A5EA 3G2VA 1A17A 4U0ZA 3UT7A 2B0OE 4K0RA 3AU4A 1E8XA 2I9CA 4EECA 5BXUA 3FFLA 2X3MA 4J8FA 3FTVA 2IONA 1IHBA 1KLXA 2CHWA 2IO3C 5CBNA 3UM2A 4U04A 3MKQB 3LDZA 3G2WA 1N0QA 4GMJA 1P5QA 3HRAA 4EBAA 3ONKA 4ANVA 5AQ9A 3ESLA 5ENQD 3D9NA 2RD0A 2CG2A 4LCTA 5T4YA 4CGVA 3FU6A 3RK6A 3BU8A 4J8DA 4LUNU 4U7EB 4K03A 1WY6A 2HYZA 3BG1B 4NACA 5M72A 5LP0A 3IV0A 2CHZA 4WNFA 4TXRA 3J5QB 2YINA 1JWGA 4PS7A 2IEJA 3NBNB 3X2QE 1INZA 3AS8A 4DLQA 4CYMD 5EILA 3Q9NC 3MEKA 1FT2A 2VGYA 3FUDA 3FTSA 2ETAA 4TUMA 3CVYA 2EINE 2LXMA 2J4BA 1N94A 1BD8A 1OWOA 3ZU7B 5EN5D 3CK9A 3FU0A 3DSVA 4EZKA 2L6BA 2P9SG 2WXIA 4BX9A 3D9JA 2IF4A 2AVPA 3UXGA 2GGFA 3GZ2A 4J6IA 1HFAA 3LY8A 4CT0A 5LOZA 2ETBA 1N4QA 5HS0A 4BTBA 5JJTA 4HXIA 4JXTA 2Y69E 1H2VC 3ML9A 3HIZA 4BSZB 1H2UA 4PDXA 1ZB1A 3UIOC 2VJ8A 2GRNB 4HB5A 1N52A 1RW2A 2WQHA 4JEUA 5CECB 4GB9A 4C9BB 1UG3A 2VTBB 3HXEA 1B89A 3E32A 2WXFA 3SD5A 4BX8A 2FF4A 4LNBA 3W9FA 4I2ZA 4U07A 3PVLA 1DVPA 4ILGA 1TN7A 2ONDA 4BT9A 3CVVA 4GZ6A 3KS2A 3UINC 1E8YA 3ASFA 3KEAA 2KZTA 2WQ7A 3TWWA 1TNUA 2Y0BG 5FZQA 1OY3D 2GROB 2WMOA 4GTOA 2GRRB 4JVSA 5A7DB 3ZXPA 4GCOA 3G2TA 5CEDB 4G25A 5EDSA 1X5BA 3ML8A 3JUIA 3D9OA 4G24A 4KZCA 4FADA 3CHPA 3SZ7A 4U8YD 1E7UA 1OCCE 1EF1C 2X6JA 2DWZA 3MKQA 3RO2A 1Z6TA 2EIJE 3MJWA 4HLLA 5AAOA 3S2AA 3D9MA 5KWDA 5CERB 1SW6A 4XI0A 4Q94A 5E75A 3ESKA 1TJCA 2YQ8A 2AXUA 1JCRA 4GZ5A 1LF8A 4UWFA 1FPPA 4BERA 1D9SA 2X38A 4U8HA 5BW8C 5BPPA 5JJ7A 2B6CA 3V31A 4ACLA 3QWVA 4DX7D 1OCZE 4UWLA 3I5PA 1TEZA 5D66A 4RQIA 5KJMA 1IQRA 5FT9A 4EZJA 4CT4A 3IXEA 3FULA 4UQYA 5HRYA 3J5PA 3NZUA 3TXNA 2XENA 4JA9A 3KD7A 4DK5A 4MRUA 3UPVA 2Y4UA 3PZ4A 4XZ4A 1N4PA 4LRZA 4RG6A 3DRAA 4J7WA 4A63B 3Q7FA 3HG0D 2R05A 1PY1A 3SF4A 4KYOB 2WXLA 4G8LA 5T8IA 3PNLB 1OXJA 3KAEA 2PL2A 3B7UX 2LUHA 3ULEG 1HF8A 1D8DA 3UT4A 3GZ1A 4GYOA 2P9KG 3RAUA 1WAO1 3QARA 4TXPA 5ANRA 3C5RA 4L1BA 3ZW3A 3QWPA 5AYWD 5AQ7A 1HG2A 4A1SA 3ZNGA 3PRZA 4CDNA 3HXCA 3Q5MA 1HXIA 2XPZA 3ZEFA 2J08A 3CVLA 5KNHD 3CVNA 2VTBA 2UWJG 1JCSA 2KATA 3AS4A 4HRNA 1N54A 1YA0A 4YDYA 3U9WA 2P58C 3IHYA 2ZIRA 3JQ1A 3S7JA 1E96B 1BU9A 4ANWA 2VSYA 1HO8A 3QDNA 2IOLA 2X6HA 5HI7A 1UW4B 3SI5A 1AP7A 3DXMG 2Y4TA 3UX4A 2QYJA 4MLPA 1NL4A 3PDNA 3FUKA 5JA4D 3UUXA 1TN6A 1PC2A 3FUEA 4F1PA 2P9IG 3L82A 1OWLA 1AWCB 2XGSA 1U3CA 1Z3XA 1GW6A 5ENOD 5CMWA 3C3QA 2NXPA 1S0PA 3SY2A 4NRHB 3RJVA 1S70B 3FEYA 3C3OA 3S7BA 2I1KA 3DSSA 2WB2A 3PZ3A 3RKVA 3CVUA 4GPKA 5EYLA 3Q4AB 3D9HA 2KM4A 3MYVA 1TYQG 2X6IA 3DSUA 3CQGB 2QZAA 2IY0C 5BUZA 3E30A 1YMPA 4GTMA 3VLEA 5ARGA 1Y8MA 3ISMC 2BTDA 1FVFA 4I1MA 1H19A 1QBQA 1H6PA 4N3BA 5B3SE 1L5JA 3ZXSA 3EHMA 3DSXA 4JZYA 4A3TA 2WM9A 4UI9K 3TL5A 2J49A 3QB2A 4XX5A 3CHRA 3T9KA 5KCMA 4BTAA 2F8XK 3EIQC 3I4GA 5AQBA 3EU5A 2HM8A 2C0LA 3MV3B 4A1GA 1JWFA 2OVBA 2MHKA 3JUEA 5ITZF 3MKRA 3EHRA 2C0MA 3CEQA 5D2MC 3CVQA 4CDRA 1N95A 1HZ4A 4FU3A 4HBDA 4JHKA 1NFIE 3CVXA 5G04J 3W9GA 3ABLE 3FUNA 3RIBA 3ZYMA 1SA4A 4GTQA 2UY1B 2P9PG 2XEEA 4J8EA 1N11A 1WDYA 5KJKA 4J0UA 2H6FA 4QFVA 1O1TA 4TXQA 2AJAA 1MZCA 4EQFA 2H6GA 2AXZA 2NC9A 4WAFA 4OAUC 2DZOA 5D0OD 1KPSB 3DEPA 2XGOA 3O4ZA 5DBKA 3GZSA 1UJKA 3L13A 2QFCA 2J09A 3UQ3A 1HS6A 5ENSD 4AIFA 4HRLA 2HE0A 2BUGA 4LSZE 3FTYA 4F53A 3PZ2A 4O6FA 4V3IA 3QOUA 4NURA 2KCKA 3ZFWA 5B1AE 1Q2ZA 2VSXE 4BWRA 3AU5A 4K5BA 2MOWA 4HI9A 2DVWA 2QC9A 4GAAA 2DBAA 1JCQA 3TWVA 4GZCA 1MX2A 2YHEA 3Q75A 1UN9A 3FTWA 2XQ0A 2XZDG 1EDUA 3APFA 4N39A 4WNGA 3PZDA 2BF0X 3P2BA 3GW4A 1UOHA 4XEIG 5AQAA 3OAWA 5CBOA 2R17C 4Q69A 4XKCA 2A4ZA 3CHQA 4O60A 4M7CA 3AAAC 4W9RA 4HVBA 2VGEA 3BG0B 4A55A 2WMNA 4F7AA 5CMYA 4UUCA 1WM5A 4N2SA 2V4LA 4UWKA 5ENTD 2WXRA 3PE4A 3EIJA 1PAQA 4GZ3A 5BXOA 3FU3A 5KJLA 3HVEA 1BI8B 4GMRA 5FJYA 3V30A 1U2VG 1NZNA 3APCA 4YVQC 3OXFA 3AG1E 4DJAA 2WXMA 2EIME 3UMVA 1VDYA 2PNNA 2XGMA 4LNGA 3NQPA 5FQ7A 4JC8A 5IY5E 3S7FA 1IXVA 4D10C 4ANUA 4EPZA 3O48A 5FQ6A 2WVIA 4JEHA 2DCPA 3FP3A 2L6JA 3UT8A 2J07A 4I9EA 4UWHA 1HX8A 1NP7A 3FHEA 1TNZA 1ZBPA 4B93B 4HOQA 5ENPD 3U66A 2UY1A 1H0AA 3B7SA 1S64A 3MGBA 2JABA 2F37A 3JXJA 2LNIA 3CK8A 4JA7A 4E6HA 5AENA 3CSFA 3ABKE 3DWLG 3L08A 1E7VA 4JB8P 4CCAA 3ZVVA 2KXPC 4I6EA 4WWOA 4Z68A 1K1AA 4I43A 3OXLA 4IYPA 4O1PA 4URKA 2A5UA 2WXJA 1JPLA 1TNBA 2X6KA 3PUKA 4TUUA 4CEMA 2LSVA 4YNDA 5CHEE 3T8MA 1S63A 4APOA 3QKYA 4N3AA 3B7TA 2ZGGA 5G04C 3KSLA 2VGXB 4CGWA 3OXGA 3WXXA 4KVOA 4YDOA 3R7RA 2XRYA 4DI4A 1N4SA 2FULA 1IKND 3FWVA 4L7TA 2ETCA 4N2QA 4KZ0A 4G1TA 3AG4E 2LXLA 4ATZD 4GYWA 4EHMA 2P2CP 3WG7E 3UKUG 2ZGDA 4L9PA 4GTTA 1TJFA 3PEUB 5B1BE 4K5AB 4AVXA 1E90A 4LEUA 5HKPA 3LY7A 4J8YA 3TJPA 4FHKA 1W3BA 4BT8A 2J8SD 3R9MA 4I2WA 2L0IA 4AV7A 4X8QA 4UQXA 5G05C 2OEWA 3DBSA 3TWSA 5ENRD 3FUMA 4U8VD 3D9IA 2V4HC 3ASNE 4YVOA 3TWXA 3L22A 2GRQB 3ZYKA 2XRZA 3HXBA 3LY9A 4CRWA 4GTPA 3Q73A 4DRXE 4TRQA 1RZ4A 3FUIA 5AARA 4BFRA 2VQ2A 4HI8A 4NQ0A 2XHEA 3CGHA 1NA3A 4DI3A 1QQEA 3PUJA 5FIOA 3SBSA 4DX6D 2V8SE 4OAVB 2XCCA 5CRUA 4ABNA 2WXKA 4PS3A 3NF1A 4GZDA 1E8ZA 3EU9A 2VSNA 3PEVB 4ILHB 3FY4A 1Z3YA 3DXKG 3MV2B 3TG4A 4GU5A 4KBQA 5C1DA 3KEZA 3Q9UC 1H6KA 4WNEA 3N71A 2C2LA 3SNXA 3T8KA 1MJ0A 3EJNA 3EHNA 3L9TA 1HE8A 4HFGA 1EYHA 3TGOA 3V79K 4LNUD 4DLOA 1V54E 3SFZA 3TXMA 3AG3E 3TWQA 3E34A 1OWNA 2I2OA 5BV0A 5A6CA 1BI7B 3HDXA 1XNFA 3SBTB 4DX2A 4U95D 3LYAA 3MZLB 3DPYA 5FTPA 1ELKA 1DC2A 5FQ4A 2Y1LE 3AJIA 2BKGA 1KZOA 1ELRA 5HQ8A 4RSYA 1Z5SC 3CIAA 5FZSA 2KBXA 3FTXA 5AIJA 4BY6A 2L0TB 4DX1A 3T5XA 3HXDA 4ME2A 1FT1A 1OCOE 4KVMA 3Q7AA 1IYGA 2OVFA 2IQCA 2IFUA 3LS8A 3HXFA 4L23A 4C48B 4JPSA 5KBAA 2XZTG 2DZNA 3ASHA 4KXKB 3LPZA 4ZFHA 3QJZA 1IHGA 3LKUA 4B89A 4Y6CA 3MA5A 1D8EA 4FHJA 4K5CA 2V5QC 3V2OA 1OUVA 3BUAA 3LVQE 5H7PA 3SHFA 2GRLA 4B94A 3QC1A 2V5FA 2H6HA 1DNPA 3L6AA 3SFYA 4UWGA 3E4BA 3LVRE 3FTUA 4I6JA 2YNQA 4L2LA 5T3RA 2IU1A 3BQOA 4HRMB 4RLYA 4WWPA 3D9LA 3APDA 3RRUA 3S7DA 4U63A 5EIDA 3IBEA 1MHQA 4GTRA 2PQNA 3F6QA 1O1RA 3CHOA 5ARFA 2VSOE 5E76A 2RG8A 3C98A 4M3OA 3CKCA 2OEVA 5FZRA 2X6FA 3AG2E 3D3MA 5CCMA 4F1SA 2E0IA 2Q7FA 5LX8A 5J90A 5FINA 3C3RA 2J9QA 3FUJA 4DPRA 5EIBE 3LJ3A 3CQCB 4MS6A 2AWIA 1LD7A 4RG9A 5KNGA 5JJ6A 4PH4B 3ZKJA 4GTSA 3HYMB 5G05J 2XS8A 3Q78A 3ZPJA 4G8KA 2RFAA 3AS5A 4U96D 4HOUA 4ANXA 4IN3B 3V2XA 2IJGX 3ZGQA 3P1UA 3UTMA 1H2TC 3UKRG 3ZYQA 2XEVA 4N5CA 4XIFA 3B95A 5EKQD 1O1SA 2FEZA 4L2YA 1FVHA 2GW1A 1TNYA 4RVBA 3ZUVB 5JHBA 3L54A 1IQUA 5LCWJ 1N9AA 2A5EA 3CVPA 2XEHA 4FJZA 4AY6A 2CFZA 1LTXA 5CRVA 3DEOA 1SA5A 4O1OA 5BNWA 2R59A 3EDTB 2JLBA 3BEEA 3ABME 4FP7A 4AY5A 1MQSA 2NYJA 2ZISA 3UM3A 4HQDA 3LXUX 4XE0A 3EHQA 2XCBA 2LAIA 2P9NG 4AEZC 5D0QD 3FH5A 3U64A 5EX3A 2J4DA 4G2VA 3VTYA 2MRIA 1E8WA 2WXNA 3IKOB 2F8YA 4AJWA 2WXQA 3ENEA 4B8CB 2FO1E 4BSXA 3FDHA 4KMOA 1UN8A 4I9CA 2WXHA 1BLXB 3QWWA 4U0UA 3DSTA 2BKKB 4I1AA 2OV8A 4JL0A 3ONLA 4WWNA 4FLHA 4QQIA 4YDEA 5BT1A 5J08A 3B7BA 3U3WA 1NA0A 1YYHA 1UJJA 3EUVA 4BEPA 3KSQA 3ZRHA 3SFXA 3HHMA 2P9UG 2IOSA 3I4RB 5CEAA 2LSUA 4E85A 3ASOE 4OVUA 2OOEA 4MKTA 2KCLA 5EX0A 1O5MA 3QAQA 5C2YA 4JW1A 4ATGA 4GMLA 4KT6B 3CK7A 1N0RA 4FULA 2OCCE 2FBNA 4AP2A 3ULQA 3UM0A 1SVXA 1EPUA 1LD8A 2WQ6A 3Q49B 3G2SA 3U4TA 4F6RD 2MYOA 4LG6A 1JUQA 3SQVA 3TWUA 4TV3A 4NIKA 4PUCA 4C0EA 3Q79A 3FUHA 3R9AB 4B0ZA 2XPYA 3NOGD 3LEWA 5AJDA 2JEKA 3CR3A 3VLFA 4UI9J 4HS2A 3B7RL 3OTNA 4ILIA 3IHVA 5DIZA 4FC8A 3L17A 3JYSA 3CSTA 3NB2A 4UQZA 3ZHEB 1G3NB 2V0PA 4JHJA 2DIWA 1HG5A 3RSEG 2BEDA 3B13A 4YDWA 4EBAG 3SGHA 2XPIA 2QY7A 3SO8A 2GRMA 3VLDA 5G55A 3D9PA 3C72A 4AXHA 3DSWA 4C0MA 5A23A 4GA0A 3ZIMA 3Q15A 5FQ8A 1OWPA 2HR2A 4Y6WA 3JXIA 4I1OB 3JQ0A 2CFUA 3DPDA 3GYZA 3RRMB 3PREA 1U3DA 2WXGA 3FH8A 4I17A 1FCHA 2RFMA 4JD2G 2WPVA 3TG5A 5JHAA 3CV0A 5KJNA 2XS1A 3FTZA 5EYPF 4N3CA 1MYOA 5AJLA 2AXVA 3UM1A 2KC7A 3PE3A 2LO6A 5FWQA 3NZSA 4EZLA 3Q47B 5ANLA 1K8KG 1MX4A 3MCXA 2L9BA 4G23A 1WG0A 4I6GA 3LJNA 1QZ2A 4GPMA 4IULA 3LCAA 2RKKA 4U0SA 4CZ2D 4G26A 2GRPB 3D9KA 2EQXA 2WXPA 1ELWA 2R2LA 2E2EA 5LCWC 1TN8A 3G2UA 3ASGA 3PS6A 3JCKC 1KT1A 2F0YA 4GA2A 1MX6A 2IO2C 2WXOA 4ACKA 3PNTB 4HOTA 3K9IA 3CHSA 4GA1A 4J8SA 3FH7A 4N5QA 1TR4A 1OCRE 5JMND 2PQRA 3PZ1A 4Q96A 3UIPC 4BESA 2CHXA 2ILRA 4HNAD 3T5VA 2HO1A 2ZXWE 4JHRA 1NI1A 5BV1A 4IRUA 2EIKE 4AM9A 3PH0C 5ENNA 3RO3A 3URZA 1XGWA 2KCVA 3FU5A 4OVVA
chains in the Genus database with same CATH topology
4DJAA 2VYIA 4PS8A 2WXMA 2YHCA 2X38A 5FZRA 2X6FA 4U8HA 5BW8C 3D3MA 5BPPA 1KT0A 2PM7A 3UMVA 5JJ7A 5CCMA 2PM6A 4F1SA 4APFA 2E0IA 4ACLA 1VDYA 3QWVA 2Q7FA 4CDMA 4UWLA 2NSZA 2AW6A 3I5PA 2XGMA 5LX8A 5J90A 4B8AA 1TEZA 5KJMA 1IQRA 3NQPA 5FT9A 1ZU2A 5FQ7A 4JC8A 4EZJA 3S7FA 2J9QA 4D10C 4CT4A 4HLEA 3FULA 3FUJA 3ASDA 4UQYA 3NZUA 3TXNA 4JA9A 4ANUA 4EPZA 1OWMA 3KD7A 4DPRA 4DK5A 3O48A 2FO7A 3LJ3A 3CQCB 5FQ6A 4MRUA 3RRNB 2R5SA 2WVIA 3TAXA 4XKBA 3UPVA 4JEHA 2DCPA 4MS6A 3FP3A 2Y4UA 2L6JA 1HU3A 3UT8A 2J07A 2VGXA 2AWIA 4H7YA 4XZ4A 4RG9A 2M63A 4I9EA 4PH4B 1HX8A 4UWHA 1NP7A 5JJ6A 3FHEA 4LRZA 4RG6A 5CCLA 3CVWA 3QNKA 1ZBPA 3HYMB 5G05J 3ZHEA 3FEXA 1PY1A 1SZ9A 4HOQA 3U66A 3SF4A 4KYOB 4G11A 3CHMA 3ZPJA 4A3VA 3AS5A 2UY1A 1H0AA 3B7SA 4HOUA 4ANXA 4HOSA 2WXLA 5T8IA 3PNLB 3MGBA 3QK0A 4IN3B 2IJGX 3KAEA 2PL2A 3B7UX 3ZGQA 2LNIA 3CK8A 3P1UA 5LFAA 4JA7A 4E6HA 1H2TC 5AENA 2FI7A 3R7QA 3CSFA 3ZYQA 1HF8A 2XEVA 4OYSA 3HVEB 3L08A 2I1JA 1E7VA 4LERA 4CCAA 3UT4A 4N5CA 3L16A 3GZ1A 1QNFA 4XIFA 4GYOA 3ZVVA 5EKQD 4I6EA 4GCNA 2I6HA 4R7LA 1WAO1 2FEZA 4WNDA 4WWOA 3QARA 4L2YA 5ANRA 4I43A 1FVHA 2GW1A 4L1BA 3OXLA 4RVBA 4IYPA 3QWPA 5AYWD 3ZW3A 1HG2A 4A1SA 4URKA 2A5UA 1IQUA 2WXJA 3L54A 1JPLA 5JHBA 3IEGA 2X6KA 3PRZA 5LCWJ 3PUKA 4TUUA 5G2NA 4CEMA 2LSVA 4FLBA 4CDNA 3CVPA 4YNDA 5CHEE 4XI9A 3Q5MA 4H7XA 1HXIA 4FJZA 4AY6A 2XPZA 4FJYA 3ZEFA 4AOFA 2CFZA 2CG3A 2J08A 3CVLA 3T8MA 3CVNA 3CLJA 5BNWA 2R59A 4APOA 3EDTB 2JLBA 2VTBA 3BEEA 3I3NA 1SQMA 3QKYA 4UI9C 4N3AA 2UWJG 4FA6A 4FP7A 4AY5A 1MQSA 3B7TA 2KATA 1SZAA 4P29A 5G04C 4XE0A 3LXUX 2XCBA 2VGXB 4CGWA 3OXGA 3WXXA 3AS4A 4KVOA 3R7RA 2PZIA 2XRYA 4DI4A 1N54A 1YA0A 2LAIA 3U9WA 4FADA 2P58C 2FULA 4AEZC 3ZN3A 3FWVA 3IHYA 3VTXA 5D0QD 4HORA 3FH5A 3JQ1A 5EX3A 2J4DA 1Y6IA 1E96B 4L7TA 3S7JA 4G2VA 3U64A 3VTYA 2MRIA 4ANWA 3MX3A 1BPOA 1E8WA 2VSYA 3CKBA 1HO8A 3RU0A 4F3VA 4N2QA 2WXNA 1HH8A 3QDNA 3IKOB 4AJWA 2IOLA 2LAHA 4KZ0A 4G1TA 2X6HA 2WXQA 3ENEA 5HI7A 4B8CB 4BSXA 1UW4B 3FDHA 4KMOA 4WUYA 1UN8A 4I9CA 3ZYLA 3SI5A 2WXHA 4GYYA 2ZU6B 2KZTB 2Y3AA 3QWWA 3FUFA 2Y4TA 4GYWA 3UX4A 4U0UA 3G2VA 1A17A 4MLPA 4U0ZA 4I1AA 3UT7A 2OV8A 4JL0A 3PDNA 3ONLA 4K0RA 4FLHA 3FUKA 4WWNA 3UUXA 3AU4A 1E8XA 2I9CA 1TJFA 3PEUB 4EECA 5BT1A 1PC2A 3FUEA 5J08A 3FFLA 1OWLA 4AVXA 2XGSA 3U3WA 1U3CA 1Z3XA 1NA0A 1GW6A 5CMWA 2X3MA 1UJJA 1E90A 2NXPA 1S0PA 4LEUA 3LY7A 4J8FA 4NRHB 3RJVA 3FTVA 3ZRHA 2IONA 3FEYA 3HHMA 1KLXA 2CHWA 3S7BA 2IOSA 3TJPA 2I1KA 4FHKA 1W3BA 4BT8A 2WB2A 3I4RB 4U04A 3MKQB 3LDZA 3RKVA 3G2WA 2LSUA 4GMJA 4E85A 3CVUA 4GPKA 1P5QA 4OVUA 2OOEA 3Q4AB 4MKTA 4I2WA 2KM4A 2L0IA 3MYVA 4AV7A 2KCLA 2X6IA 5EX0A 3CQGB 5BUZA 3QAQA 4UQXA 5G05C 5C2YA 4JW1A 4ATGA 4EBAA 3DBSA 3ONKA 4ANVA 4GMLA 3FUMA 3ESLA 3VLEA 5ARGA 3D9NA 4KT6B 1Y8MA 2RD0A 2CG2A 3CK7A 4LCTA 2BTDA 1FVFA 4I1MA 4FULA 3D9IA 1H19A 5T4YA 4CGVA 2FBNA 4N3BA 1L5JA 3ZXSA 4YVOA 4AP2A 3FU6A 3RK6A 3EHMA 4J8DA 4LUNU 3ULQA 4JZYA 4A3TA 1EPUA 2WM9A 3L22A 4K03A 4UI9K 3TL5A 2WQ6A 1WY6A 2HYZA 3BG1B 2J49A 3Q49B 3QB2A 4XX5A 3CHRA 4NACA 5M72A 5LP0A 3ZYKA 3G2SA 5KCMA 4BTAA 3U4TA 3IV0A 2CHZA 3EIQC 3I4GA 2XRZA 3LY9A 4CRWA 4WNFA 2HM8A 2C0LA 2YINA 1JWGA 4PS7A 3FUIA 4TRQA 1JUQA 3MV3B 4YVQC 4BFRA 2VQ2A 4TV3A 4NQ0A 4A1GA 2XHEA 1INZA 1JWFA 4PUCA 4C0EA 2OVBA 2MHKA 3AS8A 4DLQA 3FUHA 3CGHA 3MKRA 3R9AB 4B0ZA 2XPYA 1NA3A 4DI3A 1QQEA 3MEKA 2C0MA 3PUJA 2VGYA 3CEQA 3LEWA 3FUDA 3SBSA 5AJDA 3FTSA 2JEKA 3CVYA 3CR3A 3VLFA 3CVQA 2V8SE 4UI9J 4HS2A 4CDRA 2J4BA 1HZ4A 3B7RL 2XCCA 3OTNA 4ILIA 4FU3A 1OWOA 4JHKA 3IHVA 4ABNA 2WXKA 4PS3A 5G04J 3CVXA 3NF1A 4GZDA 5DIZA 3CK9A 4FC8A 1E8ZA 3FU0A 3FUNA 3L17A 3JYSA 3CSTA 4UQZA 3ZHEB 3RIBA 2VSNA 3PEVB 3ZYMA 4EZKA 4ILHB 2UY1B 2WXIA 3FY4A 4BX9A 1Z3YA 3D9JA 4J8EA 3MV2B 2V0PA 4JHJA 2DIWA 3TG4A 4GU5A 4KBQA 5C1DA 3KEZA 1HG5A 2IF4A 1H6KA 3B13A 4WNEA 4EBAG 3N71A 2AVPA 2C2LA 4J0UA 3SNXA 5KJKA 2GGFA 3GZ2A 4J6IA 1HFAA 4QFVA 3EJNA 3EHNA 3LY8A 3SGHA 1HE8A 4CT0A 5LOZA 4EQFA 5JJTA 2XPIA 1EYHA 4HFGA 4BTBA 3TGOA 2QY7A 4HXIA 4DLOA 2AXZA 2GRMA 4JXTA 5G55A 3D9PA 3VLDA 3SFZA 2NC9A 4WAFA 3TXMA 5D0OD 4AXHA 1H2VC 3ML9A 4C0MA 5A23A 4GA0A 3ZIMA 2XGOA 3O4ZA 5DBKA 3HIZA 1OWNA 3GZSA 1UJKA 2I2OA 3L13A 3Q15A 2QFCA 5BV0A 1H2UA 2J09A 4PDXA 3UQ3A 5A6CA 5FQ8A 4HVBA 3HDXA 1HS6A 4AIFA 1OWPA 1XNFA 2HR2A 4Y6WA 3SBTB 2BUGA 4I1OB 3JQ0A 2CFUA 3FTYA 3LYAA 3MZLB 5FTPA 2VJ8A 4F53A 1ELKA 3DPDA 3GYZA 5FQ4A 1N52A 4O6FA 3RRMB 4V3IA 3QOUA 3PREA 1U3DA 2WQHA 4NURA 2KCKA 3ZFWA 2WXGA 4JEUA 3FH8A 4I17A 1FCHA 1ELRA 4GB9A 4C9BB 5HQ8A 2VSXE 1UG3A 4RSYA 2WPVA 2VTBB 4BWRA 3AU5A 3CIAA 1B89A 2WXFA 3SD5A 4BX8A 3TG5A 5FZSA 3CV0A 5JHAA 5KJNA 2FF4A 3FTXA 5AIJA 4BY6A 2L0TB 3FTZA 3T5XA 4N3CA 4I2ZA 4ME2A 2MOWA 4KVMA 4U07A 3PVLA 5AJLA 2AXVA 1IYGA 1DVPA 2OVFA 2IQCA 2KC7A 2IFUA 4ILGA 2ONDA 3LS8A 4GAAA 3PE3A 4JPSA 4L23A 2LO6A 2DBAA 5FWQA 3NZSA 4BT9A 4EZLA 3ASHA 3Q47B 4GZCA 3LPZA 4KXKB 3CVVA 3QJZA 4GZ6A 1IHGA 5ANLA 3MCXA 2L9BA 3KS2A 4G23A 2YHEA 3LKUA 1E8YA 3ASFA 4I6GA 4B89A 4Y6CA 3MA5A 1UN9A 3FTWA 2KZTA 2WQ7A 2XQ0A 1QZ2A 4FHJA 4IULA 1EDUA 3APFA 3LCAA 4N39A 4WNGA 3PZDA 4U0SA 5FZQA 4G26A 2WMOA 1OUVA 3D9KA 3LVQE 2BF0X 2EQXA 3P2BA 4JVSA 5A7DB 2GRLA 3SHFA 4B94A 3QC1A 3GW4A 2WXPA 1ELWA 2V5FA 1DNPA 2E2EA 5LCWC 3L6AA 3G2UA 4GCOA 3G2TA 3ASGA 3PS6A 4UWGA 3JCKC 1KT1A 3OAWA 4G25A 2R17C 1X5BA 4Q69A 5EDSA 4XKCA 4GA2A 2A4ZA 3E4BA 3CHQA 3ML8A 3JUIA 3LVRE 2WXOA 3FTUA 3PNTB 4ACKA 4HOTA 3K9IA 3CHSA 4GA1A 4I6JA 3D9OA 2YNQA 4G24A 4J8SA 4L2LA 4KZCA 3CHPA 3FH7A 2IU1A 3BG0B 2WMNA 4W9RA 5T3RA 4A55A 4F7AA 3SZ7A 5CMYA 1E7UA 1WM5A 1EF1C 2X6JA 4N2SA 2V4LA 4UWKA 3MKQA 3RO2A 1Z6TA 3MJWA 2PQRA 4Q96A 4WWPA 2WXRA 3D9LA 3PE4A 3APDA 3RRUA 3S7DA 4U63A 2CHXA 2ILRA 3EIJA 3S2AA 3T5VA 3IBEA 2HO1A 4JHRA 1MHQA 3D9MA 5BV1A 4IRUA 1PAQA 4GZ3A 4XI0A 4AM9A 3PH0C 4Q94A 2PQNA 3FU3A 5ENNA 3RO3A 5KJLA 5E75A 3HVEA 3URZA 1XGWA 3ESKA 2KCVA 1TJCA 2YQ8A 3CHOA 3FU5A 5FJYA 5ARFA 1NZNA 2AXUA 2VSOE 2RG8A 3APCA 3C98A 4GZ5A 4M3OA 4OVVA 1LF8A 5E76A 4UWFA 3CKCA 3OXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VYI A;  2YHC A;  5FZR A;  5BW8 C;  1KT0 A;  5JJ7 A;  5CCM A;  3QWV A;  2Q7F A;  2XGM A;  5KJM A;  5FT9 A;  1ZU2 A;  3S7F A;  2J9Q A;  3ASD A;  4UQY A;  4JA9 A;  3KD7 A;  3O48 A;  2FO7 A;  2R5S A;  3TAX A;  3UPV A;  3FP3 A;  2Y4U A;  2L6J A;  2VGX A;  4H7Y A;  4RG9 A;  5JJ6 A;  4I9E A;  4RG6 A;  5CCL A;  1ZBP A;  3HYM B;  5G05 J;  3ZHE A;  4HOQ A;  3SF4 A;  4KYO B;  3ZPJ A;  3AS5 A;  2UY1 A;  4HOU A;  4HOS A;  4IN3 B;  3KAE A;  2PL2 A;  3ZGQ A;  2LNI A;  3CK8 A;  4JA7 A;  2FI7 A;  2XEV A;  4N5C A;  3GZ1 A;  4XIF A;  4GYO A;  5EKQ D;  4GCN A;  2I6H A;  1WAO 1;  2FEZ A;  4WND A;  2GW1 A;  3OXL A;  3QWP A;  5AYW D;  4A1S A;  3IEG A;  5LCW J;  2LSV A;  3CVP A;  4YND A;  5CHE E;  4XI9 A;  3Q5M A;  4H7X A;  1HXI A;  4AY6 A;  3CVL A;  3CVN A;  5BNW A;  4APO A;  3EDT B;  2JLB A;  3BEE A;  3QKY A;  4UI9 C;  4N3A A;  2UWJ G;  4AY5 A;  2KAT A;  5G04 C;  2XCB A;  2VGX B;  4CGW A;  3OXG A;  3WXX A;  3AS4 A;  2PZI A;  1YA0 A;  2P58 C;  3ZN3 A;  3FWV A;  3VTX A;  5D0Q D;  4HOR A;  5EX3 A;  3S7J A;  1E96 B;  4G2V A;  3VTY A;  3CKB A;  2VSY A;  3RU0 A;  4F3V A;  4N2Q A;  1HH8 A;  3QDN A;  4G1T A;  5HI7 A;  4WUY A;  4I9C A;  4GYY A;  3QWW A;  2Y4T A;  4GYW A;  4U0U A;  1A17 A;  4U0Z A;  4I1A A;  4JL0 A;  3PDN A;  3UUX A;  5BT1 A;  1PC2 A;  3FFL A;  3U3W A;  2XGS A;  1NA0 A;  4LEU A;  3LY7 A;  4J8F A;  4NRH B;  3RJV A;  1KLX A;  3S7B A;  1W3B A;  4BT8 A;  4U04 A;  3RKV A;  2LSU A;  4GPK A;  1P5Q A;  2OOE A;  3Q4A B;  4I2W A;  2KCL A;  5EX0 A;  4UQX A;  5G05 C;  5ARG A;  1Y8M A;  3CK7 A;  4CGV A;  2FBN A;  4N3B A;  4YVO A;  4J8D A;  3ULQ A;  4UI9 K;  2HYZ A;  3Q49 B;  5M72 A;  4BTA A;  3U4T A;  3LY9 A;  4WNF A;  2C0L A;  3MV3 B;  4YVQ C;  2VQ2 A;  4NQ0 A;  2MHK A;  3AS8 A;  3MKR A;  3R9A B;  1NA3 A;  1QQE A;  3MEK A;  2C0M A;  2VGY A;  3CEQ A;  3CVQ A;  4UI9 J;  4CDR A;  1HZ4 A;  2XCC A;  4ABN A;  5G04 J;  3NF1 A;  5DIZ A;  3CK9 A;  3JYS A;  4UQZ A;  3ZHE B;  3RIB A;  2VSN A;  2UY1 B;  4J8E A;  3MV2 B;  3TG4 A;  4KBQ A;  5C1D A;  2IF4 A;  4WNE A;  5KJK A;  3N71 A;  2AVP A;  2C2L A;  4J0U A;  3GZ2 A;  3LY8 A;  4EQF A;  5JJT A;  2XPI A;  3TGO A;  4BTB A;  2NC9 A;  5D0O D;  4GA0 A;  2XGO A;  5DBK A;  3Q15 A;  2QFC A;  3UQ3 A;  5A6C A;  4AIF A;  1XNF A;  2HR2 A;  4Y6W A;  2BUG A;  3LYA A;  5FTP A;  3GYZ A;  4O6F A;  3QOU A;  2WQH A;  2KCK A;  3ZFW A;  4I17 A;  1FCH A;  1ELR A;  5HQ8 A;  2WPV A;  4BWR A;  1B89 A;  3TG5 A;  5FZS A;  3CV0 A;  5KJN A;  2FF4 A;  4N3C A;  4I2Z A;  4ME2 A;  4U07 A;  1IYG A;  2KC7 A;  2IFU A;  2OND A;  3PE3 A;  2DBA A;  4BT9 A;  3ASH A;  3Q47 B;  4KXK B;  3LPZ A;  4GZ6 A;  1IHG A;  4G23 A;  3KS2 A;  3LKU A;  3ASF A;  4Y6C A;  3MA5 A;  1QZ2 A;  3LCA A;  4N39 A;  4WNG A;  4U0S A;  5FZQ A;  4G26 A;  1OUV A;  5A7D B;  4B94 A;  3GW4 A;  1ELW A;  2V5F A;  2E2E A;  5LCW C;  4GCO A;  3ASG A;  1KT1 A;  4G25 A;  4GA2 A;  3E4B A;  4HOT A;  3K9I A;  4GA1 A;  4G24 A;  4W9R A;  3SZ7 A;  1WM5 A;  4N2S A;  3RO2 A;  2PQR A;  3PE4 A;  3S7D A;  2HO1 A;  4JHR A;  4GZ3 A;  4XI0 A;  4AM9 A;  2PQN A;  3RO3 A;  5KJL A;  3URZ A;  3ESK A;  2KCV A;  1TJC A;  2YQ8 A;  5FJY A;  5ARF A;  1NZN A;  4GZ5 A;  3CKC A;  3OXF A; 
#chains in the Genus database with same CATH topology
 1K1B A;  1H6O A;  2VYI A;  4PS8 A;  2YHC A;  1QYM A;  4MBG A;  3TWR A;  2DYS E;  1KT0 A;  2PM7 A;  2PM6 A;  4APF A;  1YCS B;  4CDM A;  2R03 A;  2NSZ A;  2AW6 A;  4B8A A;  1ZU2 A;  1OT8 A;  2EIL E;  4HLE A;  3ASD A;  1DCE A;  1OWM A;  2FO7 A;  3RRN B;  2R5S A;  3TAX A;  4XKB A;  1HU3 A;  2VGX A;  4H7Y A;  1V55 E;  2M63 A;  2QYU A;  5CCL A;  3CVW A;  3QNK A;  2R02 A;  3ZHE A;  3FEX A;  1SZ9 A;  4G11 A;  3CHM A;  4A3V A;  4ZHB A;  3E33 A;  4HOS A;  3QK0 A;  5LFA A;  2FI7 A;  1DCQ A;  1KZP A;  3R7Q A;  3NOC D;  4OYS A;  3HVE B;  2I1J A;  4LER A;  3L16 A;  1QNF A;  4GCN A;  2I6H A;  4R7L A;  4WND A;  3NAW A;  2H6I A;  3IEG A;  5G2N A;  4FLB A;  4XI9 A;  4H7X A;  4FJY A;  1N4R A;  4AOF A;  2CG3 A;  2DYR E;  1X81 A;  3CLJ A;  3I3N A;  1SQM A;  4UI9 C;  4FA6 A;  2P9L G;  1SZA A;  4P29 A;  3E37 A;  2PZI A;  4GTV A;  4DX5 D;  3ZN3 A;  3VTX A;  4HOR A;  1Y6I A;  5AN8 A;  3TWT A;  3MX3 A;  1BPO A;  3CKB A;  3RU0 A;  4F3V A;  1HH8 A;  4BET A;  2LAH A;  3UI2 A;  1TNO A;  4WUY A;  3ZYL A;  4GYY A;  2ZU6 B;  1K3Z D;  2KZT B;  4DUI A;  2Y3A A;  3FUF A;  3ULY A;  1A5E A;  3G2V A;  1A17 A;  4U0Z A;  3UT7 A;  2B0O E;  4K0R A;  3AU4 A;  1E8X A;  2I9C A;  4EEC A;  5BXU A;  3FFL A;  2X3M A;  4J8F A;  3FTV A;  2ION A;  1IHB A;  1KLX A;  2CHW A;  2IO3 C;  5CBN A;  3UM2 A;  4U04 A;  3MKQ B;  3LDZ A;  3G2W A;  1N0Q A;  4GMJ A;  1P5Q A;  3HRA A;  4EBA A;  3ONK A;  4ANV A;  5AQ9 A;  3ESL A;  5ENQ D;  3D9N A;  2RD0 A;  2CG2 A;  4LCT A;  5T4Y A;  4CGV A;  3FU6 A;  3RK6 A;  3BU8 A;  4J8D A;  4LUN U;  4U7E B;  4K03 A;  1WY6 A;  2HYZ A;  3BG1 B;  4NAC A;  5M72 A;  5LP0 A;  3IV0 A;  2CHZ A;  4WNF A;  4TXR A;  3J5Q B;  2YIN A;  1JWG A;  4PS7 A;  2IEJ A;  3NBN B;  3X2Q E;  1INZ A;  3AS8 A;  4DLQ A;  4CYM D;  5EIL A;  3Q9N C;  3MEK A;  1FT2 A;  2VGY A;  3FUD A;  3FTS A;  2ETA A;  4TUM A;  3CVY A;  2EIN E;  2LXM A;  2J4B A;  1N94 A;  1BD8 A;  1OWO A;  3ZU7 B;  5EN5 D;  3CK9 A;  3FU0 A;  3DSV A;  4EZK A;  2L6B A;  2P9S G;  2WXI A;  4BX9 A;  3D9J A;  2IF4 A;  2AVP A;  3UXG A;  2GGF A;  3GZ2 A;  4J6I A;  1HFA A;  3LY8 A;  4CT0 A;  5LOZ A;  2ETB A;  1N4Q A;  5HS0 A;  4BTB A;  5JJT A;  4HXI A;  4JXT A;  2Y69 E;  1H2V C;  3ML9 A;  3HIZ A;  4BSZ B;  1H2U A;  4PDX A;  1ZB1 A;  3UIO C;  2VJ8 A;  2GRN B;  4HB5 A;  1N52 A;  1RW2 A;  2WQH A;  4JEU A;  5CEC B;  4GB9 A;  4C9B B;  1UG3 A;  2VTB B;  3HXE A;  1B89 A;  3E32 A;  2WXF A;  3SD5 A;  4BX8 A;  2FF4 A;  4LNB A;  3W9F A;  4I2Z A;  4U07 A;  3PVL A;  1DVP A;  4ILG A;  1TN7 A;  2OND A;  4BT9 A;  3CVV A;  4GZ6 A;  3KS2 A;  3UIN C;  1E8Y A;  3ASF A;  3KEA A;  2KZT A;  2WQ7 A;  3TWW A;  1TNU A;  2Y0B G;  5FZQ A;  1OY3 D;  2GRO B;  2WMO A;  4GTO A;  2GRR B;  4JVS A;  5A7D B;  3ZXP A;  4GCO A;  3G2T A;  5CED B;  4G25 A;  5EDS A;  1X5B A;  3ML8 A;  3JUI A;  3D9O A;  4G24 A;  4KZC A;  4FAD A;  3CHP A;  3SZ7 A;  4U8Y D;  1E7U A;  1OCC E;  1EF1 C;  2X6J A;  2DWZ A;  3MKQ A;  3RO2 A;  1Z6T A;  2EIJ E;  3MJW A;  4HLL A;  5AAO A;  3S2A A;  3D9M A;  5KWD A;  5CER B;  1SW6 A;  4XI0 A;  4Q94 A;  5E75 A;  3ESK A;  1TJC A;  2YQ8 A;  2AXU A;  1JCR A;  4GZ5 A;  1LF8 A;  4UWF A;  1FPP A;  4BER A;  1D9S A;  2X38 A;  4U8H A;  5BW8 C;  5BPP A;  5JJ7 A;  2B6C A;  3V31 A;  4ACL A;  3QWV A;  4DX7 D;  1OCZ E;  4UWL A;  3I5P A;  1TEZ A;  5D66 A;  4RQI A;  5KJM A;  1IQR A;  5FT9 A;  4EZJ A;  4CT4 A;  3IXE A;  3FUL A;  4UQY A;  5HRY A;  3J5P A;  3NZU A;  3TXN A;  2XEN A;  4JA9 A;  3KD7 A;  4DK5 A;  4MRU A;  3UPV A;  2Y4U A;  3PZ4 A;  4XZ4 A;  1N4P A;  4LRZ A;  4RG6 A;  3DRA A;  4J7W A;  4A63 B;  3Q7F A;  3HG0 D;  2R05 A;  1PY1 A;  3SF4 A;  4KYO B;  2WXL A;  4G8L A;  5T8I A;  3PNL B;  1OXJ A;  3KAE A;  2PL2 A;  3B7U X;  2LUH A;  3ULE G;  1HF8 A;  1D8D A;  3UT4 A;  3GZ1 A;  4GYO A;  2P9K G;  3RAU A;  1WAO 1;  3QAR A;  4TXP A;  5ANR A;  3C5R A;  4L1B A;  3ZW3 A;  3QWP A;  5AYW D;  5AQ7 A;  1HG2 A;  4A1S A;  3ZNG A;  3PRZ A;  4CDN A;  3HXC A;  3Q5M A;  1HXI A;  2XPZ A;  3ZEF A;  2J08 A;  3CVL A;  5KNH D;  3CVN A;  2VTB A;  2UWJ G;  1JCS A;  2KAT A;  3AS4 A;  4HRN A;  1N54 A;  1YA0 A;  4YDY A;  3U9W A;  2P58 C;  3IHY A;  2ZIR A;  3JQ1 A;  3S7J A;  1E96 B;  1BU9 A;  4ANW A;  2VSY A;  1HO8 A;  3QDN A;  2IOL A;  2X6H A;  5HI7 A;  1UW4 B;  3SI5 A;  1AP7 A;  3DXM G;  2Y4T A;  3UX4 A;  2QYJ A;  4MLP A;  1NL4 A;  3PDN A;  3FUK A;  5JA4 D;  3UUX A;  1TN6 A;  1PC2 A;  3FUE A;  4F1P A;  2P9I G;  3L82 A;  1OWL A;  1AWC B;  2XGS A;  1U3C A;  1Z3X A;  1GW6 A;  5ENO D;  5CMW A;  3C3Q A;  2NXP A;  1S0P A;  3SY2 A;  4NRH B;  3RJV A;  1S70 B;  3FEY A;  3C3O A;  3S7B A;  2I1K A;  3DSS A;  2WB2 A;  3PZ3 A;  3RKV A;  3CVU A;  4GPK A;  5EYL A;  3Q4A B;  3D9H A;  2KM4 A;  3MYV A;  1TYQ G;  2X6I A;  3DSU A;  3CQG B;  2QZA A;  2IY0 C;  5BUZ A;  3E30 A;  1YMP A;  4GTM A;  3VLE A;  5ARG A;  1Y8M A;  3ISM C;  2BTD A;  1FVF A;  4I1M A;  1H19 A;  1QBQ A;  1H6P A;  4N3B A;  5B3S E;  1L5J A;  3ZXS A;  3EHM A;  3DSX A;  4JZY A;  4A3T A;  2WM9 A;  4UI9 K;  3TL5 A;  2J49 A;  3QB2 A;  4XX5 A;  3CHR A;  3T9K A;  5KCM A;  4BTA A;  2F8X K;  3EIQ C;  3I4G A;  5AQB A;  3EU5 A;  2HM8 A;  2C0L A;  3MV3 B;  4A1G A;  1JWF A;  2OVB A;  2MHK A;  3JUE A;  5ITZ F;  3MKR A;  3EHR A;  2C0M A;  3CEQ A;  5D2M C;  3CVQ A;  4CDR A;  1N95 A;  1HZ4 A;  4FU3 A;  4HBD A;  4JHK A;  1NFI E;  3CVX A;  5G04 J;  3W9G A;  3ABL E;  3FUN A;  3RIB A;  3ZYM A;  1SA4 A;  4GTQ A;  2UY1 B;  2P9P G;  2XEE A;  4J8E A;  1N11 A;  1WDY A;  5KJK A;  4J0U A;  2H6F A;  4QFV A;  1O1T A;  4TXQ A;  2AJA A;  1MZC A;  4EQF A;  2H6G A;  2AXZ A;  2NC9 A;  4WAF A;  4OAU C;  2DZO A;  5D0O D;  1KPS B;  3DEP A;  2XGO A;  3O4Z A;  5DBK A;  3GZS A;  1UJK A;  3L13 A;  2QFC A;  2J09 A;  3UQ3 A;  1HS6 A;  5ENS D;  4AIF A;  4HRL A;  2HE0 A;  2BUG A;  4LSZ E;  3FTY A;  4F53 A;  3PZ2 A;  4O6F A;  4V3I A;  3QOU A;  4NUR A;  2KCK A;  3ZFW A;  5B1A E;  1Q2Z A;  2VSX E;  4BWR A;  3AU5 A;  4K5B A;  2MOW A;  4HI9 A;  2DVW A;  2QC9 A;  4GAA A;  2DBA A;  1JCQ A;  3TWV A;  4GZC A;  1MX2 A;  2YHE A;  3Q75 A;  1UN9 A;  3FTW A;  2XQ0 A;  2XZD G;  1EDU A;  3APF A;  4N39 A;  4WNG A;  3PZD A;  2BF0 X;  3P2B A;  3GW4 A;  1UOH A;  4XEI G;  5AQA A;  3OAW A;  5CBO A;  2R17 C;  4Q69 A;  4XKC A;  2A4Z A;  3CHQ A;  4O60 A;  4M7C A;  3AAA C;  4W9R A;  4HVB A;  2VGE A;  3BG0 B;  4A55 A;  2WMN A;  4F7A A;  5CMY A;  4UUC A;  1WM5 A;  4N2S A;  2V4L A;  4UWK A;  5ENT D;  2WXR A;  3PE4 A;  3EIJ A;  1PAQ A;  4GZ3 A;  5BXO A;  3FU3 A;  5KJL A;  3HVE A;  1BI8 B;  4GMR A;  5FJY A;  3V30 A;  1U2V G;  1NZN A;  3APC A;  4YVQ C;  3OXF A;  3AG1 E;  4DJA A;  2WXM A;  2EIM E;  3UMV A;  1VDY A;  2PNN A;  2XGM A;  4LNG A;  3NQP A;  5FQ7 A;  4JC8 A;  5IY5 E;  3S7F A;  1IXV A;  4D10 C;  4ANU A;  4EPZ A;  3O48 A;  5FQ6 A;  2WVI A;  4JEH A;  2DCP A;  3FP3 A;  2L6J A;  3UT8 A;  2J07 A;  4I9E A;  4UWH A;  1HX8 A;  1NP7 A;  3FHE A;  1TNZ A;  1ZBP A;  4B93 B;  4HOQ A;  5ENP D;  3U66 A;  2UY1 A;  1H0A A;  3B7S A;  1S64 A;  3MGB A;  2JAB A;  2F37 A;  3JXJ A;  2LNI A;  3CK8 A;  4JA7 A;  4E6H A;  5AEN A;  3CSF A;  3ABK E;  3DWL G;  3L08 A;  1E7V A;  4JB8 P;  4CCA A;  3ZVV A;  2KXP C;  4I6E A;  4WWO A;  4Z68 A;  1K1A A;  4I43 A;  3OXL A;  4IYP A;  4O1P A;  4URK A;  2A5U A;  2WXJ A;  1JPL A;  1TNB A;  2X6K A;  3PUK A;  4TUU A;  4CEM A;  2LSV A;  4YND A;  5CHE E;  3T8M A;  1S63 A;  4APO A;  3QKY A;  4N3A A;  3B7T A;  2ZGG A;  5G04 C;  3KSL A;  2VGX B;  4CGW A;  3OXG A;  3WXX A;  4KVO A;  4YDO A;  3R7R A;  2XRY A;  4DI4 A;  1N4S A;  2FUL A;  1IKN D;  3FWV A;  4L7T A;  2ETC A;  4N2Q A;  4KZ0 A;  4G1T A;  3AG4 E;  2LXL A;  4ATZ D;  4GYW A;  4EHM A;  2P2C P;  3WG7 E;  3UKU G;  2ZGD A;  4L9P A;  4GTT A;  1TJF A;  3PEU B;  5B1B E;  4K5A B;  4AVX A;  1E90 A;  4LEU A;  5HKP A;  3LY7 A;  4J8Y A;  3TJP A;  4FHK A;  1W3B A;  4BT8 A;  2J8S D;  3R9M A;  4I2W A;  2L0I A;  4AV7 A;  4X8Q A;  4UQX A;  5G05 C;  2OEW A;  3DBS A;  3TWS A;  5ENR D;  3FUM A;  4U8V D;  3D9I A;  2V4H C;  3ASN E;  4YVO A;  3TWX A;  3L22 A;  2GRQ B;  3ZYK A;  2XRZ A;  3HXB A;  3LY9 A;  4CRW A;  4GTP A;  3Q73 A;  4DRX E;  4TRQ A;  1RZ4 A;  3FUI A;  5AAR A;  4BFR A;  2VQ2 A;  4HI8 A;  4NQ0 A;  2XHE A;  3CGH A;  1NA3 A;  4DI3 A;  1QQE A;  3PUJ A;  5FIO A;  3SBS A;  4DX6 D;  2V8S E;  4OAV B;  2XCC A;  5CRU A;  4ABN A;  2WXK A;  4PS3 A;  3NF1 A;  4GZD A;  1E8Z A;  3EU9 A;  2VSN A;  3PEV B;  4ILH B;  3FY4 A;  1Z3Y A;  3DXK G;  3MV2 B;  3TG4 A;  4GU5 A;  4KBQ A;  5C1D A;  3KEZ A;  3Q9U C;  1H6K A;  4WNE A;  3N71 A;  2C2L A;  3SNX A;  3T8K A;  1MJ0 A;  3EJN A;  3EHN A;  3L9T A;  1HE8 A;  4HFG A;  1EYH A;  3TGO A;  3V79 K;  4LNU D;  4DLO A;  1V54 E;  3SFZ A;  3TXM A;  3AG3 E;  3TWQ A;  3E34 A;  1OWN A;  2I2O A;  5BV0 A;  5A6C A;  1BI7 B;  3HDX A;  1XNF A;  3SBT B;  4DX2 A;  4U95 D;  3LYA A;  3MZL B;  3DPY A;  5FTP A;  1ELK A;  1DC2 A;  5FQ4 A;  2Y1L E;  3AJI A;  2BKG A;  1KZO A;  1ELR A;  5HQ8 A;  4RSY A;  1Z5S C;  3CIA A;  5FZS A;  2KBX A;  3FTX A;  5AIJ A;  4BY6 A;  2L0T B;  4DX1 A;  3T5X A;  3HXD A;  4ME2 A;  1FT1 A;  1OCO E;  4KVM A;  3Q7A A;  1IYG A;  2OVF A;  2IQC A;  2IFU A;  3LS8 A;  3HXF A;  4L23 A;  4C48 B;  4JPS A;  5KBA A;  2XZT G;  2DZN A;  3ASH A;  4KXK B;  3LPZ A;  4ZFH A;  3QJZ A;  1IHG A;  3LKU A;  4B89 A;  4Y6C A;  3MA5 A;  1D8E A;  4FHJ A;  4K5C A;  2V5Q C;  3V2O A;  1OUV A;  3BUA A;  3LVQ E;  5H7P A;  3SHF A;  2GRL A;  4B94 A;  3QC1 A;  2V5F A;  2H6H A;  1DNP A;  3L6A A;  3SFY A;  4UWG A;  3E4B A;  3LVR E;  3FTU A;  4I6J A;  2YNQ A;  4L2L A;  5T3R A;  2IU1 A;  3BQO A;  4HRM B;  4RLY A;  4WWP A;  3D9L A;  3APD A;  3RRU A;  3S7D A;  4U63 A;  5EID A;  3IBE A;  1MHQ A;  4GTR A;  2PQN A;  3F6Q A;  1O1R A;  3CHO A;  5ARF A;  2VSO E;  5E76 A;  2RG8 A;  3C98 A;  4M3O A;  3CKC A;  2OEV A;  5FZR A;  2X6F A;  3AG2 E;  3D3M A;  5CCM A;  4F1S A;  2E0I A;  2Q7F A;  5LX8 A;  5J90 A;  5FIN A;  3C3R A;  2J9Q A;  3FUJ A;  4DPR A;  5EIB E;  3LJ3 A;  3CQC B;  4MS6 A;  2AWI A;  1LD7 A;  4RG9 A;  5KNG A;  5JJ6 A;  4PH4 B;  3ZKJ A;  4GTS A;  3HYM B;  5G05 J;  2XS8 A;  3Q78 A;  3ZPJ A;  4G8K A;  2RFA A;  3AS5 A;  4U96 D;  4HOU A;  4ANX A;  4IN3 B;  3V2X A;  2IJG X;  3ZGQ A;  3P1U A;  3UTM A;  1H2T C;  3UKR G;  3ZYQ A;  2XEV A;  4N5C A;  4XIF A;  3B95 A;  5EKQ D;  1O1S A;  2FEZ A;  4L2Y A;  1FVH A;  2GW1 A;  1TNY A;  4RVB A;  3ZUV B;  5JHB A;  3L54 A;  1IQU A;  5LCW J;  1N9A A;  2A5E A;  3CVP A;  2XEH A;  4FJZ A;  4AY6 A;  2CFZ A;  1LTX A;  5CRV A;  3DEO A;  1SA5 A;  4O1O A;  5BNW A;  2R59 A;  3EDT B;  2JLB A;  3BEE A;  3ABM E;  4FP7 A;  4AY5 A;  1MQS A;  2NYJ A;  2ZIS A;  3UM3 A;  4HQD A;  3LXU X;  4XE0 A;  3EHQ A;  2XCB A;  2LAI A;  2P9N G;  4AEZ C;  5D0Q D;  3FH5 A;  3U64 A;  5EX3 A;  2J4D A;  4G2V A;  3VTY A;  2MRI A;  1E8W A;  2WXN A;  3IKO B;  2F8Y A;  4AJW A;  2WXQ A;  3ENE A;  4B8C B;  2FO1 E;  4BSX A;  3FDH A;  4KMO A;  1UN8 A;  4I9C A;  2WXH A;  1BLX B;  3QWW A;  4U0U A;  3DST A;  2BKK B;  4I1A A;  2OV8 A;  4JL0 A;  3ONL A;  4WWN A;  4FLH A;  4QQI A;  4YDE A;  5BT1 A;  5J08 A;  3B7B A;  3U3W A;  1NA0 A;  1YYH A;  1UJJ A;  3EUV A;  4BEP A;  3KSQ A;  3ZRH A;  3SFX A;  3HHM A;  2P9U G;  2IOS A;  3I4R B;  5CEA A;  2LSU A;  4E85 A;  3ASO E;  4OVU A;  2OOE A;  4MKT A;  2KCL A;  5EX0 A;  1O5M A;  3QAQ A;  5C2Y A;  4JW1 A;  4ATG A;  4GML A;  4KT6 B;  3CK7 A;  1N0R A;  4FUL A;  2OCC E;  2FBN A;  4AP2 A;  3ULQ A;  3UM0 A;  1SVX A;  1EPU A;  1LD8 A;  2WQ6 A;  3Q49 B;  3G2S A;  3U4T A;  4F6R D;  2MYO A;  4LG6 A;  1JUQ A;  3SQV A;  3TWU A;  4TV3 A;  4NIK A;  4PUC A;  4C0E A;  3Q79 A;  3FUH A;  3R9A B;  4B0Z A;  2XPY A;  3NOG D;  3LEW A;  5AJD A;  2JEK A;  3CR3 A;  3VLF A;  4UI9 J;  4HS2 A;  3B7R L;  3OTN A;  4ILI A;  3IHV A;  5DIZ A;  4FC8 A;  3L17 A;  3JYS A;  3CST A;  3NB2 A;  4UQZ A;  3ZHE B;  1G3N B;  2V0P A;  4JHJ A;  2DIW A;  1HG5 A;  3RSE G;  2BED A;  3B13 A;  4YDW A;  4EBA G;  3SGH A;  2XPI A;  2QY7 A;  3SO8 A;  2GRM A;  3VLD A;  5G55 A;  3D9P A;  3C72 A;  4AXH A;  3DSW A;  4C0M A;  5A23 A;  4GA0 A;  3ZIM A;  3Q15 A;  5FQ8 A;  1OWP A;  2HR2 A;  4Y6W A;  3JXI A;  4I1O B;  3JQ0 A;  2CFU A;  3DPD A;  3GYZ A;  3RRM B;  3PRE A;  1U3D A;  2WXG A;  3FH8 A;  4I17 A;  1FCH A;  2RFM A;  4JD2 G;  2WPV A;  3TG5 A;  5JHA A;  3CV0 A;  5KJN A;  2XS1 A;  3FTZ A;  5EYP F;  4N3C A;  1MYO A;  5AJL A;  2AXV A;  3UM1 A;  2KC7 A;  3PE3 A;  2LO6 A;  5FWQ A;  3NZS A;  4EZL A;  3Q47 B;  5ANL A;  1K8K G;  1MX4 A;  3MCX A;  2L9B A;  4G23 A;  1WG0 A;  4I6G A;  3LJN A;  1QZ2 A;  4GPM A;  4IUL A;  3LCA A;  2RKK A;  4U0S A;  4CZ2 D;  4G26 A;  2GRP B;  3D9K A;  2EQX A;  2WXP A;  1ELW A;  2R2L A;  2E2E A;  5LCW C;  1TN8 A;  3G2U A;  3ASG A;  3PS6 A;  3JCK C;  1KT1 A;  2F0Y A;  4GA2 A;  1MX6 A;  2IO2 C;  2WXO A;  4ACK A;  3PNT B;  4HOT A;  3K9I A;  3CHS A;  4GA1 A;  4J8S A;  3FH7 A;  4N5Q A;  1TR4 A;  1OCR E;  5JMN D;  2PQR A;  3PZ1 A;  4Q96 A;  3UIP C;  4BES A;  2CHX A;  2ILR A;  4HNA D;  3T5V A;  2HO1 A;  2ZXW E;  4JHR A;  1NI1 A;  5BV1 A;  4IRU A;  2EIK E;  4AM9 A;  3PH0 C;  5ENN A;  3RO3 A;  3URZ A;  1XGW A;  2KCV A;  3FU5 A;  4OVV A; 
#chains in the Genus database with same CATH homology
 4DJA A;  2VYI A;  4PS8 A;  2WXM A;  2YHC A;  2X38 A;  5FZR A;  2X6F A;  4U8H A;  5BW8 C;  3D3M A;  5BPP A;  1KT0 A;  2PM7 A;  3UMV A;  5JJ7 A;  5CCM A;  2PM6 A;  4F1S A;  4APF A;  2E0I A;  4ACL A;  1VDY A;  3QWV A;  2Q7F A;  4CDM A;  4UWL A;  2NSZ A;  2AW6 A;  3I5P A;  2XGM A;  5LX8 A;  5J90 A;  4B8A A;  1TEZ A;  5KJM A;  1IQR A;  3NQP A;  5FT9 A;  1ZU2 A;  5FQ7 A;  4JC8 A;  4EZJ A;  3S7F A;  2J9Q A;  4D10 C;  4CT4 A;  4HLE A;  3FUL A;  3FUJ A;  3ASD A;  4UQY A;  3NZU A;  3TXN A;  4JA9 A;  4ANU A;  4EPZ A;  1OWM A;  3KD7 A;  4DPR A;  4DK5 A;  3O48 A;  2FO7 A;  3LJ3 A;  3CQC B;  5FQ6 A;  4MRU A;  3RRN B;  2R5S A;  2WVI A;  3TAX A;  4XKB A;  3UPV A;  4JEH A;  2DCP A;  4MS6 A;  3FP3 A;  2Y4U A;  2L6J A;  1HU3 A;  3UT8 A;  2J07 A;  2VGX A;  2AWI A;  4H7Y A;  4XZ4 A;  4RG9 A;  2M63 A;  4I9E A;  4PH4 B;  1HX8 A;  4UWH A;  1NP7 A;  5JJ6 A;  3FHE A;  4LRZ A;  4RG6 A;  5CCL A;  3CVW A;  3QNK A;  1ZBP A;  3HYM B;  5G05 J;  3ZHE A;  3FEX A;  1PY1 A;  1SZ9 A;  4HOQ A;  3U66 A;  3SF4 A;  4KYO B;  4G11 A;  3CHM A;  3ZPJ A;  4A3V A;  3AS5 A;  2UY1 A;  1H0A A;  3B7S A;  4HOU A;  4ANX A;  4HOS A;  2WXL A;  5T8I A;  3PNL B;  3MGB A;  3QK0 A;  4IN3 B;  2IJG X;  3KAE A;  2PL2 A;  3B7U X;  3ZGQ A;  2LNI A;  3CK8 A;  3P1U A;  5LFA A;  4JA7 A;  4E6H A;  1H2T C;  5AEN A;  2FI7 A;  3R7Q A;  3CSF A;  3ZYQ A;  1HF8 A;  2XEV A;  4OYS A;  3HVE B;  3L08 A;  2I1J A;  1E7V A;  4LER A;  4CCA A;  3UT4 A;  4N5C A;  3L16 A;  3GZ1 A;  1QNF A;  4XIF A;  4GYO A;  3ZVV A;  5EKQ D;  4I6E A;  4GCN A;  2I6H A;  4R7L A;  1WAO 1;  2FEZ A;  4WND A;  4WWO A;  3QAR A;  4L2Y A;  5ANR A;  4I43 A;  1FVH A;  2GW1 A;  4L1B A;  3OXL A;  4RVB A;  4IYP A;  3QWP A;  5AYW D;  3ZW3 A;  1HG2 A;  4A1S A;  4URK A;  2A5U A;  1IQU A;  2WXJ A;  3L54 A;  1JPL A;  5JHB A;  3IEG A;  2X6K A;  3PRZ A;  5LCW J;  3PUK A;  4TUU A;  5G2N A;  4CEM A;  2LSV A;  4FLB A;  4CDN A;  3CVP A;  4YND A;  5CHE E;  4XI9 A;  3Q5M A;  4H7X A;  1HXI A;  4FJZ A;  4AY6 A;  2XPZ A;  4FJY A;  3ZEF A;  4AOF A;  2CFZ A;  2CG3 A;  2J08 A;  3CVL A;  3T8M A;  3CVN A;  3CLJ A;  5BNW A;  2R59 A;  4APO A;  3EDT B;  2JLB A;  2VTB A;  3BEE A;  3I3N A;  1SQM A;  3QKY A;  4UI9 C;  4N3A A;  2UWJ G;  4FA6 A;  4FP7 A;  4AY5 A;  1MQS A;  3B7T A;  2KAT A;  1SZA A;  4P29 A;  5G04 C;  4XE0 A;  3LXU X;  2XCB A;  2VGX B;  4CGW A;  3OXG A;  3WXX A;  3AS4 A;  4KVO A;  3R7R A;  2PZI A;  2XRY A;  4DI4 A;  1N54 A;  1YA0 A;  2LAI A;  3U9W A;  4FAD A;  2P58 C;  2FUL A;  4AEZ C;  3ZN3 A;  3FWV A;  3IHY A;  3VTX A;  5D0Q D;  4HOR A;  3FH5 A;  3JQ1 A;  5EX3 A;  2J4D A;  1Y6I A;  1E96 B;  4L7T A;  3S7J A;  4G2V A;  3U64 A;  3VTY A;  2MRI A;  4ANW A;  3MX3 A;  1BPO A;  1E8W A;  2VSY A;  3CKB A;  1HO8 A;  3RU0 A;  4F3V A;  4N2Q A;  2WXN A;  1HH8 A;  3QDN A;  3IKO B;  4AJW A;  2IOL A;  2LAH A;  4KZ0 A;  4G1T A;  2X6H A;  2WXQ A;  3ENE A;  5HI7 A;  4B8C B;  4BSX A;  1UW4 B;  3FDH A;  4KMO A;  4WUY A;  1UN8 A;  4I9C A;  3ZYL A;  3SI5 A;  2WXH A;  4GYY A;  2ZU6 B;  2KZT B;  2Y3A A;  3QWW A;  3FUF A;  2Y4T A;  4GYW A;  3UX4 A;  4U0U A;  3G2V A;  1A17 A;  4MLP A;  4U0Z A;  4I1A A;  3UT7 A;  2OV8 A;  4JL0 A;  3PDN A;  3ONL A;  4K0R A;  4FLH A;  3FUK A;  4WWN A;  3UUX A;  3AU4 A;  1E8X A;  2I9C A;  1TJF A;  3PEU B;  4EEC A;  5BT1 A;  1PC2 A;  3FUE A;  5J08 A;  3FFL A;  1OWL A;  4AVX A;  2XGS A;  3U3W A;  1U3C A;  1Z3X A;  1NA0 A;  1GW6 A;  5CMW A;  2X3M A;  1UJJ A;  1E90 A;  2NXP A;  1S0P A;  4LEU A;  3LY7 A;  4J8F A;  4NRH B;  3RJV A;  3FTV A;  3ZRH A;  2ION A;  3FEY A;  3HHM A;  1KLX A;  2CHW A;  3S7B A;  2IOS A;  3TJP A;  2I1K A;  4FHK A;  1W3B A;  4BT8 A;  2WB2 A;  3I4R B;  4U04 A;  3MKQ B;  3LDZ A;  3RKV A;  3G2W A;  2LSU A;  4GMJ A;  4E85 A;  3CVU A;  4GPK A;  1P5Q A;  4OVU A;  2OOE A;  3Q4A B;  4MKT A;  4I2W A;  2KM4 A;  2L0I A;  3MYV A;  4AV7 A;  2KCL A;  2X6I A;  5EX0 A;  3CQG B;  5BUZ A;  3QAQ A;  4UQX A;  5G05 C;  5C2Y A;  4JW1 A;  4ATG A;  4EBA A;  3DBS A;  3ONK A;  4ANV A;  4GML A;  3FUM A;  3ESL A;  3VLE A;  5ARG A;  3D9N A;  4KT6 B;  1Y8M A;  2RD0 A;  2CG2 A;  3CK7 A;  4LCT A;  2BTD A;  1FVF A;  4I1M A;  4FUL A;  3D9I A;  1H19 A;  5T4Y A;  4CGV A;  2FBN A;  4N3B A;  1L5J A;  3ZXS A;  4YVO A;  4AP2 A;  3FU6 A;  3RK6 A;  3EHM A;  4J8D A;  4LUN U;  3ULQ A;  4JZY A;  4A3T A;  1EPU A;  2WM9 A;  3L22 A;  4K03 A;  4UI9 K;  3TL5 A;  2WQ6 A;  1WY6 A;  2HYZ A;  3BG1 B;  2J49 A;  3Q49 B;  3QB2 A;  4XX5 A;  3CHR A;  4NAC A;  5M72 A;  5LP0 A;  3ZYK A;  3G2S A;  5KCM A;  4BTA A;  3U4T A;  3IV0 A;  2CHZ A;  3EIQ C;  3I4G A;  2XRZ A;  3LY9 A;  4CRW A;  4WNF A;  2HM8 A;  2C0L A;  2YIN A;  1JWG A;  4PS7 A;  3FUI A;  4TRQ A;  1JUQ A;  3MV3 B;  4YVQ C;  4BFR A;  2VQ2 A;  4TV3 A;  4NQ0 A;  4A1G A;  2XHE A;  1INZ A;  1JWF A;  4PUC A;  4C0E A;  2OVB A;  2MHK A;  3AS8 A;  4DLQ A;  3FUH A;  3CGH A;  3MKR A;  3R9A B;  4B0Z A;  2XPY A;  1NA3 A;  4DI3 A;  1QQE A;  3MEK A;  2C0M A;  3PUJ A;  2VGY A;  3CEQ A;  3LEW A;  3FUD A;  3SBS A;  5AJD A;  3FTS A;  2JEK A;  3CVY A;  3CR3 A;  3VLF A;  3CVQ A;  2V8S E;  4UI9 J;  4HS2 A;  4CDR A;  2J4B A;  1HZ4 A;  3B7R L;  2XCC A;  3OTN A;  4ILI A;  4FU3 A;  1OWO A;  4JHK A;  3IHV A;  4ABN A;  2WXK A;  4PS3 A;  5G04 J;  3CVX A;  3NF1 A;  4GZD A;  5DIZ A;  3CK9 A;  4FC8 A;  1E8Z A;  3FU0 A;  3FUN A;  3L17 A;  3JYS A;  3CST A;  4UQZ A;  3ZHE B;  3RIB A;  2VSN A;  3PEV B;  3ZYM A;  4EZK A;  4ILH B;  2UY1 B;  2WXI A;  3FY4 A;  4BX9 A;  1Z3Y A;  3D9J A;  4J8E A;  3MV2 B;  2V0P A;  4JHJ A;  2DIW A;  3TG4 A;  4GU5 A;  4KBQ A;  5C1D A;  3KEZ A;  1HG5 A;  2IF4 A;  1H6K A;  3B13 A;  4WNE A;  4EBA G;  3N71 A;  2AVP A;  2C2L A;  4J0U A;  3SNX A;  5KJK A;  2GGF A;  3GZ2 A;  4J6I A;  1HFA A;  4QFV A;  3EJN A;  3EHN A;  3LY8 A;  3SGH A;  1HE8 A;  4CT0 A;  5LOZ A;  4EQF A;  5JJT A;  2XPI A;  1EYH A;  4HFG A;  4BTB A;  3TGO A;  2QY7 A;  4HXI A;  4DLO A;  2AXZ A;  2GRM A;  4JXT A;  5G55 A;  3D9P A;  3VLD A;  3SFZ A;  2NC9 A;  4WAF A;  3TXM A;  5D0O D;  4AXH A;  1H2V C;  3ML9 A;  4C0M A;  5A23 A;  4GA0 A;  3ZIM A;  2XGO A;  3O4Z A;  5DBK A;  3HIZ A;  1OWN A;  3GZS A;  1UJK A;  2I2O A;  3L13 A;  3Q15 A;  2QFC A;  5BV0 A;  1H2U A;  2J09 A;  4PDX A;  3UQ3 A;  5A6C A;  5FQ8 A;  4HVB A;  3HDX A;  1HS6 A;  4AIF A;  1OWP A;  1XNF A;  2HR2 A;  4Y6W A;  3SBT B;  2BUG A;  4I1O B;  3JQ0 A;  2CFU A;  3FTY A;  3LYA A;  3MZL B;  5FTP A;  2VJ8 A;  4F53 A;  1ELK A;  3DPD A;  3GYZ A;  5FQ4 A;  1N52 A;  4O6F A;  3RRM B;  4V3I A;  3QOU A;  3PRE A;  1U3D A;  2WQH A;  4NUR A;  2KCK A;  3ZFW A;  2WXG A;  4JEU A;  3FH8 A;  4I17 A;  1FCH A;  1ELR A;  4GB9 A;  4C9B B;  5HQ8 A;  2VSX E;  1UG3 A;  4RSY A;  2WPV A;  2VTB B;  4BWR A;  3AU5 A;  3CIA A;  1B89 A;  2WXF A;  3SD5 A;  4BX8 A;  3TG5 A;  5FZS A;  3CV0 A;  5JHA A;  5KJN A;  2FF4 A;  3FTX A;  5AIJ A;  4BY6 A;  2L0T B;  3FTZ A;  3T5X A;  4N3C A;  4I2Z A;  4ME2 A;  2MOW A;  4KVM A;  4U07 A;  3PVL A;  5AJL A;  2AXV A;  1IYG A;  1DVP A;  2OVF A;  2IQC A;  2KC7 A;  2IFU A;  4ILG A;  2OND A;  3LS8 A;  4GAA A;  3PE3 A;  4JPS A;  4L23 A;  2LO6 A;  2DBA A;  5FWQ A;  3NZS A;  4BT9 A;  4EZL A;  3ASH A;  3Q47 B;  4GZC A;  3LPZ A;  4KXK B;  3CVV A;  3QJZ A;  4GZ6 A;  1IHG A;  5ANL A;  3MCX A;  2L9B A;  3KS2 A;  4G23 A;  2YHE A;  3LKU A;  1E8Y A;  3ASF A;  4I6G A;  4B89 A;  4Y6C A;  3MA5 A;  1UN9 A;  3FTW A;  2KZT A;  2WQ7 A;  2XQ0 A;  1QZ2 A;  4FHJ A;  4IUL A;  1EDU A;  3APF A;  3LCA A;  4N39 A;  4WNG A;  3PZD A;  4U0S A;  5FZQ A;  4G26 A;  2WMO A;  1OUV A;  3D9K A;  3LVQ E;  2BF0 X;  2EQX A;  3P2B A;  4JVS A;  5A7D B;  2GRL A;  3SHF A;  4B94 A;  3QC1 A;  3GW4 A;  2WXP A;  1ELW A;  2V5F A;  1DNP A;  2E2E A;  5LCW C;  3L6A A;  3G2U A;  4GCO A;  3G2T A;  3ASG A;  3PS6 A;  4UWG A;  3JCK C;  1KT1 A;  3OAW A;  4G25 A;  2R17 C;  1X5B A;  4Q69 A;  5EDS A;  4XKC A;  4GA2 A;  2A4Z A;  3E4B A;  3CHQ A;  3ML8 A;  3JUI A;  3LVR E;  2WXO A;  3FTU A;  3PNT B;  4ACK A;  4HOT A;  3K9I A;  3CHS A;  4GA1 A;  4I6J A;  3D9O A;  2YNQ A;  4G24 A;  4J8S A;  4L2L A;  4KZC A;  3CHP A;  3FH7 A;  2IU1 A;  3BG0 B;  2WMN A;  4W9R A;  5T3R A;  4A55 A;  4F7A A;  3SZ7 A;  5CMY A;  1E7U A;  1WM5 A;  1EF1 C;  2X6J A;  4N2S A;  2V4L A;  4UWK A;  3MKQ A;  3RO2 A;  1Z6T A;  3MJW A;  2PQR A;  4Q96 A;  4WWP A;  2WXR A;  3D9L A;  3PE4 A;  3APD A;  3RRU A;  3S7D A;  4U63 A;  2CHX A;  2ILR A;  3EIJ A;  3S2A A;  3T5V A;  3IBE A;  2HO1 A;  4JHR A;  1MHQ A;  3D9M A;  5BV1 A;  4IRU A;  1PAQ A;  4GZ3 A;  4XI0 A;  4AM9 A;  3PH0 C;  4Q94 A;  2PQN A;  3FU3 A;  5ENN A;  3RO3 A;  5KJL A;  5E75 A;  3HVE A;  3URZ A;  1XGW A;  3ESK A;  2KCV A;  1TJC A;  2YQ8 A;  3CHO A;  3FU5 A;  5FJY A;  5ARF A;  1NZN A;  2AXU A;  2VSO E;  2RG8 A;  3APC A;  3C98 A;  4GZ5 A;  4M3O A;  4OVV A;  1LF8 A;  5E76 A;  4UWF A;  3CKC A;  3OXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...