2QFCA

Crystal structure of bacillus thuringiensis plcr complexed with papr
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
284
structure length
284
Chain Sequence
AEKLGSEIKKIRVLRGLTQKQLSENICHQSEVSRIESGAVYPSMDILQGIAAKLQIPIIHFYEVLIYSDIERKKQFKDQVIMLCKQKRYKEIYNKVWNELKKEEYHPEFQQFLQWQYYVAAYVLKKVDYEYCILELKKLLNQQLTGIDVYQNLYIENAIANIYAENGYLKKGIDLFEQILKQLEALHDNEEFDVKVRYNHAKALYLDSRYEESLYQVNKAIEISCRINSMALIGQLYYQRGECLRKLEYEEAEIEDAYKKASFFFDILEMHAYKEALVNKISRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of PlcR: Insights into virulence regulation and evolution of quorum sensing in Gram-positive bacteria
pubmed doi rcsb
source organism Bacillus thuringiensis serovar israelensis atcc 35646
molecule tags Transcription regulation
molecule keywords PlcR protein
total genus 117
structure length 284
sequence length 284
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF18768 HTH_Bact Helix-turn-helix bacterial domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2qfcA00
3UQ3A 4Y6CA 4GCOA 4GYWA 4XIFA 2KCKA 2VQ2A 3GZ2A 3SF4A 3TG4A 4N2SA 2VGXA 5A6CA 5D0QD 3U4TA 2L6JA 4J0UA 4JA7A 3Q5MA 5G05J 4J8EA 3ZHEA 4AM9A 4U04A 5CCLA 3KS2A 1E96B 2C2LA 4A1SA 2KCLA 3HYMB 4UQZA 2WPVA 4YVOA 4HOSA 2AVPA 4IN3B 1HZ4A 2XGMA 4I17A 3TG5A 3Q49B 3U3WA 4G23A 3BEEA 4GYYA 1P5QA 4GA1A 3VTYA 2PQNA 4GPKA 2PL2A 5G04C 3WXXA 5EKQD 3RIBA 2FI7A 2PQRA 4ME2A 4NQ0A 1ELRA 3RO2A 4CGWA 1QZ2A 4G2VA 4U0UA 4AY5A 2IFUA 3GZ1A 4GYOA 2UY1B 5BNWA 4Y6WA 2FBNA 3RJVA 3MV3B 4H7YA 4APOA 2VYIA 1NA3A 3GYZA 1XNFA 3Q4AB 4J8FA 3CVQA 5FZQA 2R5SA 5LCWC 3FFLA 4GA2A 4RG9A 3CVPA 4WNGA 2J9QA 2ONDA 3CVLA 5D0OD 2LSVA 3MKRA 3O48A 4RG6A 4U0SA 2UWJG 2Y4TA 4UQYA 3CK7A 4JA9A 4U0ZA 4BWRA 4I9EA 4HOUA 2V5FA 3ASHA 1FCHA 2VSYA 1IHGA 2E2EA 2FEZA 4YNDA 1ELWA 2XCCA 4BT8A 3UPVA 3ULQA 2LSUA 5DBKA 3RO3A 4O6FA 2VGYA 2XGSA 4GZ3A 3QKYA 2XEVA 3ASDA 3CVNA 4ABNA 3QWWA 1HXIA 2QFCA 3CK9A 5C1DA 4KXKB 4XI0A 5JJ7A 3QDNA 2BUGA 3NF1A 3S7FA 4F3VA 4HOQA 3LPZA 4HORA 3FP3A 3LKUA 4YVQC 4N39A 2JLBA 4EQFA 4B94A 1TJCA 4GZ5A 1NA0A 3LCAA 4I9CA 5CHEE 3KAEA 2YQ8A 3CKBA 1PC2A 2C0LA 3PE4A 4JHRA 1ZBPA 1KLXA 1WAO1 3MV2B 3LYAA 4U07A 2VSNA 2Y4UA 4UI9K 2GW1A 4WNEA 4J8DA 5BT1A 5CCMA 5HQ8A 5BW8C 2IF4A 3Q15A 2VGXB 2HR2A 4XI9A 4BT9A 1B89A 3CV0A 3TAXA 3VTXA 3OXFA 5M72A 5FJYA 3K9IA 5KJNA 1NZNA 4UQXA 3JYSA 4UI9J 4WNFA 4G25A 2P58C 4G26A 5FT9A 5FZSA 4KYOB 3QWVA 4G1TA 3UUXA 2FF4A 3ASGA 2PZIA 3ESKA 3Q47B 4CDRA 4N2QA 3KD7A 3LY7A 3ZHEB 2WQHA 5ARGA 4BTBA 4LEUA 4N3AA 5FZRA 1ZU2A 1KT0A 4JL0A 3QWPA 2C0MA 2KATA 3ZN3A 1YA0A 2HYZA 5JJTA 3AS4A 3OXLA 4AIFA 5LCWJ 3AS5A 3MA5A 1HH8A 3N71A 4I2WA 4KBQA 4N5CA 3S7BA 4UI9C 4N3BA 5EX0A 2UY1A 2NC9A 4H7XA 4I2ZA 3RU0A 1W3BA 5G04J 4BTAA 2FO7A 1WM5A 2Q7FA 3CEQA 3CK8A 3FWVA 3LY9A 5FTPA 3TGOA 1IYGA 5DIZA 2YHCA 3PDNA 4CGVA 5KJMA 4HOTA 3AS8A 1KT1A 2KCVA 4GA0A 5ARFA 2I6HA 2MHKA 5JJ6A 2XPIA 2DBAA 3ZFWA 3QOUA 4AY6A 5EX3A 2LNIA 3EDTB 4W9RA 4G24A 5HI7A 5KJKA 5G05C 4N3CA 3LY8A 5KJLA 4GZ6A 3IEGA 5A7DB 3OXGA 3SZ7A 3PE3A 4I1AA 3CKCA 3S7DA 1OUVA 4WNDA 2OOEA 3E4BA 4WUYA 1A17A 5AYWD 2KC7A 2XCBA 3RKVA 3R9AB 3S7JA 3ZGQA 3ZPJA 3URZA 3MEKA 1QQEA 1Y8MA 2HO1A 4NRHB 3GW4A 4GCNA 2XGOA 3ASFA
chains in the Genus database with same CATH superfamily
3HXCA 2BEDA 3HVEB 4HOSA 3NAWA 4NURA 2PL2A 3EHQA 4AEZC 2P9IG 2VYIA 2IOSA 4GMRA 5ENQD 2V5FA 2XCCA 2GRPB 2XEVA 3OAWA 3MKQB 2WXNA 3QWWA 2QFCA 2RKKA 4XI0A 3NF1A 1V55E 4DPRA 1N4PA 4N39A 5ENNA 4EQFA 1TJCA 5D66A 1HX8A 5H7PA 1NI1A 3HXEA 4K5AB 3E37A 5FZSA 2X6JA 2WXGA 3B7SA 3D9PA 2FF4A 4CDRA 1OY3D 3T8KA 1JWGA 1YA0A 2HYZA 2R05A 3AS5A 1H0AA 2J07A 3VLFA 3N71A 2IU1A 1TN8A 2IONA 4JB8P 4I2ZA 3ML9A 1WM5A 2R17C 2YINA 3CK8A 2BF0X 3D9HA 1HFAA 3AS8A 1KT1A 4GA0A 1V54E 3ZEFA 1VDYA 2XHEA 1TEZA 5AQBA 2H6HA 3S7DA 3TJPA 1A17A 3MYVA 5D2MC 2AXZA 2X3MA 2WXKA 5LFAA 1O1SA 4Y6CA 3TG4A 3U4TA 3UM2A 2ZGGA 4EECA 1N52A 2KXPC 2WB2A 3EUVA 2DZOA 4G23A 3R7QA 2F8XK 1OCRE 3W9FA 4AY5A 3GZ1A 4GYOA 3RJVA 1XNFA 3CVQA 3IBEA 2CFUA 3SFZA 3G2TA 2XS1A 3L9TA 4BT8A 3CVUA 1BD8A 2VGYA 2XGSA 5ENOD 4ABNA 1LF8A 4KXKB 1MX4A 2BUGA 4F3VA 2J4BA 4KMOA 2Y3AA 3O4ZA 2H6FA 3ZU7B 5BW8C 3JXIA 3Q15A 2H6GA 4ZFHA 3MZLB 2VTBA 3TXNA 5JHAA 2GRMA 5FT9A 3CHQA 1MX6A 3NQPA 3T5VA 5ARGA 3ENEA 3ZIMA 1KT0A 4IULA 3EIQC 5JJTA 3MA5A 3HXBA 5JA4D 2KM4A 3FUJA 4FJYA 3S7BA 4MKTA 1TJFA 2X6FA 2WQ7A 2I9CA 3DXMG 2R2LA 5B3SE 1HU3A 4K5CA 4TV3A 1K8KG 1E8YA 5KJLA 3PE3A 4CYMD 3RKVA 3R9AB 3ZGQA 2HE0A 4NRHB 3ASFA 2CHWA 5KBAA 3FU3A 5AN8A 4J8EA 4U04A 1YMPA 3HYMB 4I17A 3U3WA 3Q49B 4GYYA 1P5QA 1YYHA 4Z68A 5G04C 4NQ0A 3PZDA 3QJZA 1JCSA 2ONDA 2ZU6B 3LXUX 2Y4TA 5HRYA 4M7CA 4I9EA 1FCHA 4TXRA 2XENA 3PVLA 4GMLA 4OVUA 1FPPA 5EN5D 3BG0B 4HI9A 4YVQC 2MRIA 3PE4A 4BFRA 2RD0A 1EYHA 5ENTD 2YNQA 1MQSA 2VGXB 3FUKA 5KJNA 1X81A 4GB9A 4KYOB 4DX5D 1OCCE 4N2QA 1IQRA 2WQHA 1LD7A 2XPYA 4JL0A 4F1PA 3SQVA 3TWRA 3S2AA 4BSXA 2L9BA 4I2WA 3FUFA 5HS0A 3B13A 3PEVB 4V3IA 5AJDA 4JEHA 5BV0A 3GZSA 4HB5A 5EX3A 4GZ6A 3HVEA 1QYMA 2DVWA 4B89A 4JPSA 3PREA 5HQ8A 4XIFA 2KCKA 2L6JA 4J0UA 4JA7A 4KZ0A 3IHVA 2LAIA 2XGMA 3B7RL 2FI7A 2PQRA 2DYRE 3ZKJA 2WXIA 3MV3B 3FTUA 1UW4B 1N9AA 2JEKA 2LSVA 3CHOA 4J7WA 3L54A 2WXJA 4PH4B 4WWOA 2NYJA 4Q69A 1SQMA 4ANWA 1NFIE 4CRWA 4PS7A 4FADA 5C1DA 4BSZB 4UWLA 3CLJA 4PS3A 4JHJA 4OAVB 3PUJA 3ZYKA 1OWOA 4I6EA 4CT0A 3KSQA 2YQ8A 3PZ1A 2VSNA 2Y4UA 4J8DA 2RG8A 5CECB 2WM9A 2P58C 4G25A 4G26A 3QAQA 3ML8A 2MOWA 4MS6A 3DSTA 2AXUA 2DIWA 1HH8A 1TNOA 4LSZE 2OEWA 1BLXB 4N5CA 1TNYA 1JUQA 2X6KA 3CEQA 4A63B 3RRNB 5ARFA 2L6BA 1O5MA 4EPZA 4JHKA 3FTXA 4N3CA 1INZA 2XZTG 1Y6IA 3E4BA 5ANLA 3ZPJA 3NOCD 4XKBA 2LO6A 4BY6A 4PS8A 4K03A 3JUIA 5J90A 2WXOA 4GTMA 3TWVA 5D0OD 1SVXA 4HNAD 3B95A 4DX6D 4EZLA 3AG1E 2P9NG 2VSYA 2EIME 4AP2A 3T9KA 3ASDA 3QDNA 5AIJA 3S7FA 3ESLA 3CVYA 1FVFA 3ONKA 1SZAA 2AW6A 2R02A 2IF4A 4IYPA 3RK6A 1UG3A 1NZNA 4UQXA 1BU9A 3RSEG 2PZIA 1N4SA 3KD7A 4C0EA 3CVWA 2ZXWE 1Z3YA 2WXQA 3L13A 4UWFA 3NBNB 4E6HA 4FA6A 3LY9A 2I6HA 2MHKA 4FHJA 3FUIA 5T4YA 3G2UA 2ETAA 3C3OA 3FU0A 4ANXA 3FUHA 1HG5A 3HXFA 1S0PA 4GCNA 3FH7A 5T8IA 1K1AA 2WXRA 3Q5MA 1HE8A 4ANVA 3UKRG 3FUMA 3R7RA 3CSTA 4GA1A 1WY6A 4ME2A 3RO2A 3RRMB 3HIZA 2A5EA 3I5PA 3RRUA 2UWJG 3HG0D 3FTZA 2P2CP 3QB2A 1E8WA 3CR3A 2VJ8A 1UOHA 3CVNA 1AP7A 2B0OE 4CT4A 3DSXA 4LNBA 1E8XA 3E34A 1TNBA 2X6HA 2GW1A 4X8QA 3ONLA 3L16A 2GRLA 3CV0A 2OEVA 4DI3A 3PZ2A 1H6OA 1N4QA 3Q47B 3AAAC 4YDWA 4ATZD 3SBSA 1JPLA 3ABME 4BEPA 2KBXA 4JEUA 4KBQA 5CEDB 2UY1A 3NB2A 5AJLA 4EBAG 2H6IA 3FEXA 5KJMA 2XPIA 2LNIA 3ISMC 4U63A 4UUCA 4JXTA 3FUNA 3IEGA 4F7AA 4NIKA 3D9NA 3HXDA 2XCBA 2QY7A 4AVXA 2V8SE 4GCOA 4GTRA 4ANUA 2PM6A 4A1GA 4A55A 3J5PA 1OWLA 2C2LA 3D9LA 3TWWA 2WMOA 3SBTB 2PQNA 4MLPA 4UWGA 2Y69E 2ILRA 3EHRA 3UIPC 2FBNA 2GGFA 3Q4AB 2XEEA 5FZQA 4HS2A 3DSUA 2OVBA 4L9PA 4C48B 3PZ4A 3AU5A 2RFAA 2MYOA 1HF8A 3Q9UC 5FWQA 4L1BA 4EBAA 1MYOA 2OVFA 4YDEA 4MBGA 4HOQA 2JLBA 3FULA 4G11A 1TN6A 5CHEE 4JD2G 3RU0A 1TNZA 2DZNA 2EIJE 1YCSB 3TWXA 2IY0C 4F53A 3QARA 4HRNA 3IHYA 3DXKG 4LG6A 5CBOA 1U3CA 3JYSA 3EHNA 3ZHEB 2KATA 3ABLE 2AXVA 1A5EA 2YHEA 2NC9A 3TGOA 4DX1A 3LVRE 2XRYA 3L82A 2L0TB 5JJ6A 4AY6A 3U9WA 2A5UA 2IO2C 3Q9NC 5ANRA 4O60A 1TNUA 3D9JA 4N2SA 3SF4A 1D9SA 2F0YA 2VGXA 5A6CA 1HG2A 2XQ0A 3ZRHA 5C2YA 2F8YA 2QYUA 3ZYQA 3FTVA 4QFVA 3TWUA 4KZCA 3RIBA 3JCKC 4Y6WA 3P1UA 1H2VC 2DCPA 1OWMA 1S63A 2P9LG 3Q7AA 4AXHA 4DI4A 1OCZE 3V31A 1PY1A 1ELWA 4XKCA 3MCXA 5T3RA 5EIBE 3JUEA 5JJ7A 1D8EA 3FU5A 2I2OA 4FHKA 3LPZA 4CEMA 4CCAA 4L2LA 1S64A 2KZTB 4J8SA 4UI9K 5CCMA 3NZSA 3SNXA 3SFYA 5FJYA 2GROB 2BKKB 4G1TA 1O1RA 3ASGA 1BI7B 4E85A 4CDMA 3EHMA 1N54A 1W3BA 3TWTA 1IYGA 1MHQA 4RQIA 1KZOA 1DCQA 5DIZA 3C72A 3PDNA 3KEAA 3JQ0A 3P2BA 3CQGB 3T8MA 2CG3A 3FU6A 3PNTB 3V2XA 3SO8A 3FH5A 2XEHA 3SGHA 3MEKA 1AWCB 1SZ9A 3CGHA 4J6IA 3UKUG 3ZYMA 3FTWA 3PH0C 3ZHEA 4AM9A 5HKPA 5AARA 3FUDA 1E7UA 4HFGA 1SA5A 3DSWA 5B1AE 1PAQA 2J9QA 4HQDA 2M63A 3O48A 3ABKE 2EINE 1N94A 1H19A 3CK7A 3PNLB 3UM1A 3FTSA 1OXJA 5FQ6A 5IY5E 2GRNB 1UJKA 3ZVVA 4YNDA 3UPVA 2V4HC 1ZB1A 3FEYA 4BX9A 3APCA 4YDOA 2P9PG 1PC2A 3U66A 3MV2B 5FQ8A 4BT9A 5FINA 4LCTA 3V2OA 1QBQA 3L22A 3NZUA 3UUXA 4HLEA 3AG4E 4RLYA 3APFA 4U8HA 3AS4A 3G2VA 3TWSA 4F1SA 2YHCA 4ILHB 3I4RB 3D3MA 1NL4A 1N95A 3PS6A 3Q79A 4I1AA 2L0IA 1OUVA 1WDYA 5KNGA 3UM0A 3BG1B 3NOGD 3UQ3A 4OAUC 5CMWA 5G05J 5CCLA 4AJWA 4WAFA 1HZ4A 4EZJA 1EPUA 3DEOA 4WWNA 3UX4A 2WMNA 4CGWA 3AJIA 3MKQA 3G2WA 3SFXA 2J09A 2LUHA 4L2YA 4U0SA 1K3ZD 3FUEA 1LD8A 2CHXA 5EILA 4FLBA 2WXMA 3B7TA 1RZ4A 3DWLG 3UT4A 1K1BA 2E2EA 4TRQA 5FQ4A 4EHMA 5ITZF 5CEAA 4HORA 1IXVA 3T5XA 3QK0A 4C9BB 4A3TA 5LX8A 3EU9A 2FO1E 3X2QE 1BPOA 5BT1A 2XRZA 4LRZA 5FIOA 5M72A 4GMJA 4U8VD 2V4LA 4F6RD 3DPYA 1N0RA 3QWPA 2C0MA 4DJAA 2CG2A 5A23A 5CMYA 1JCRA 5BNWA 4H7XA 2RFMA 1O1TA 4YDYA 4DLOA 2WXFA 3R9MA 2PNNA 1IQUA 4WUYA 2LAHA 4ACKA 3URZA 3E32A 4GZDA 2DYSE 3C3QA 2VSOE 3GZ2A 4AV7A 5BXOA 4BETA 3CVXA 5ENPD 4I6GA 1NP7A 2BTDA 4IN3B 4M3OA 3TG5A 2I1JA 5ENSD 3G2SA 2UY1B 1S70B 1OWPA 2EIKE 4RG9A 5BV1A 4HLLA 4K0RA 4UQYA 4U0ZA 4BWRA 5BXUA 1IKND 1U2VG 4J8YA 3DPDA 2LSUA 3SHFA 2AJAA 3CHMA 3V30A 2LXLA 3L6AA 3DEPA 2IQCA 3PUKA 1EF1C 3FP3A 4I43A 3W9GA 1MX2A 4GZ5A 4U95D 4ZHBA 2PM7A 4U07A 3LYAA 3TWQA 3AG3E 3PEUB 1H2TC 4KVOA 3UT7A 2EQXA 4BTBA 3AG2E 1N0QA 4G8LA 3FDHA 3PRZA 2CHZA 5G04J 1H6PA 2XS8A 1Q2ZA 3LEWA 1D8DA 4CZ2D 3OXGA 3SZ7A 3PZ3A 4DX7D 2P9KG 5KCMA 5CBNA 3KSLA 5CRUA 4UWHA 2VQ2A 4FU3A 2KCLA 1QNFA 4YVOA 4HRMB 3BEEA 2F37A 3LVQE 1QZ2A 1Z5SC 1SA4A 4WWPA 4H7YA 3FFLA 2QZAA 3MKRA 5J08A 4I6JA 3FTYA 4JA9A 1FT1A 1IHGA 4GZ3A 1GW6A 3BQOA 3APDA 5B1BE 3UIOC 4LERA 2B6CA 2ETBA 4URKA 3LCAA 4DRXE 3OTNA 5AYWD 4NACA 4U7EB 4TUUA 1WAO1 2V5QC 2R03A 2X6IA 3VTXA 1UN9A 1N4RA 1UN8A 3ZYLA 4APFA 1TYQG 3VLDA 4HXIA 3I4GA 3OXLA 5EX0A 2BKGA 2KCVA 4MRUA 3DBSA 3Q78A 3UXGA 2Y1LE 4GAAA 4O1PA 3E33A 4GTPA 1MJ0A 5AAOA 4JC8A 3DSSA 5BUZA 1H2UA 1E96B 4A1SA 1Z3XA 4UQZA 1FVHA 5AQ9A 3RAUA 4OYSA 4U0UA 4BERA 4FC8A 3GYZA 4WNGA 4PUCA 3LJNA 4RG6A 2NXPA 3IKOB 5KNHD 2ZISA 2J49A 4HOUA 3FY4A 3QKYA 4O1OA 4B8AA 1HXIA 4UWKA 4RVBA 5AENA 2I1KA 4XE0A 4ATGA 4JHRA 4DUIA 3BUAA 3UT8A 2DWZA 3K9IA 3LDZA 2ETCA 3ZNGA 3ULEG 1KZPA 3VLEA 4N3AA 3CIAA 3JXJA 3FHEA 1WG0A 3SY2A 4N3BA 3V79K 4N5QA 3ZXPA 4CGVA 5EYPF 4C0MA 1G3NB 3CHPA 4GTOA 2IOLA 2AWIA 5G05C 4BX8A 4L7TA 3LY8A 5A7DB 2P9UG 4TXPA 4GPMA 3CKCA 2QYJA 4IRUA 3EJNA 2HO1A 3GW4A 1SW6A 1DNPA 3CHRA 3ULYA 5ENRD 2VGEA 1IHBA 1DVPA 2P9SG 4B93B 3QNKA 3D9OA 1LTXA 5FQ7A 3J5QB 4ILGA 3CVLA 2Y0BG 4JVSA 3WG7E 2R59A 5KWDA 4KT6B 4GTTA 1OWNA 1OT8A 2OCCE 1U3DA 3CVVA 3CSFA 2QC9A 3Q7FA 3ZW3A 2J08A 3U64A 3CHSA 3F6QA 1NA0A 4FULA 3CKBA 2C0LA 1ZBPA 2FULA 3LJ3A 4FP7A 1TR4A 1TN7A 2HR2A 2V0PA 4JW1A 2EILE 4TXQA 4UI9J 4B8CB 4HRLA 3ESKA 3CQCB 1FT2A 4A3VA 4LEUA 5FZRA 1ZU2A 4Q94A 2XZDG 2VTBB 4UI9C 4BTAA 4FJZA 3FWVA 1JCQA 3D9IA 2GRQB 2KZTA 4P29A 4HOTA 3ZFWA 1E7VA 4W9RA 3EDTB 5HI7A 1JWFA 1BI8B 3UTMA 3B7BA 2KC7A 5AQ7A 1QQEA 4OVVA 3MGBA 3B7UX 4HVBA 5CRVA 1L5JA 5D0QD 3D9KA 4PDXA 4ILIA 3UI2A 1DCEA 4K5BA 3HRAA 2WPVA 5LOZA 2AVPA 5EKQD 4G2VA 2IEJA 3MX3A 5G2NA 5JMND 4APOA 5CERB 4J8FA 5LCWC 2R5SA 1N11A 4GA2A 3CVPA 4Q96A 2WVIA 5E75A 4GZCA 4U8YD 2WXHA 2ZGDA 4U96D 4L23A 2FEZA 3ULQA 5DBKA 3LS8A 1X5BA 4I1MA 3DSVA 4HBDA 3DRAA 2WXPA 1E90A 3LKUA 3UM3A 3SD5A 4GTVA 3KAEA 1E8ZA 4TUMA 4B0ZA 1UJJA 1HS6A 1OCOE 4XI9A 1B89A 3C98A 3MJWA 4LUNU 5G55A 3QWVA 3ZXSA 3TXMA 4BESA 4LNUD 3JQ1A 4GTQA 1KPSB 3ZN3A 4D10C 5LCWJ 3C3RA 2J8SD 3ASOE 2LXMA 2IO3C 3KEZA 2Q7FA 5FTPA 2J4DA 4GTSA 4CDNA 4RSYA 3HDXA 2GRRB 1XGWA 4FLHA 5KJKA 3FH8A 4WNDA 3ASNE 4GYWA 3UINC 3L17A 3KS2A 4KVMA 4HI8A 1DC2A 2XPZA 3VTYA 2WXLA 4GPKA 3WXXA 3D9MA 1ELRA 2IFUA 5AQAA 5EIDA 1ELKA 1NA3A 5JHBA 2X38A 1HO8A 2HM8A 3ASHA 4XX5A 3L08A 5E76A 3RO3A 4O6FA 3E30A 3EIJA 2WQ6A 3EU5A 3CK9A 4QQIA 4R7LA 4DK5A 2CFZA 4DX2A 4LNGA 4EZKA 2VSXE 4B94A 4I9CA 4G8KA 5LP0A 3QC1A 1KLXA 4XEIG 4WNEA 3IV0A 1EDUA 3TAXA 3OXFA 4JZYA 4WNFA 5BPPA 3BU8A 2JABA 3I3NA 4AOFA 3LY7A 5EDSA 3ZUVB 3C5RA 4I1OB 3UMVA 4ACLA 4AIFA 2ZIRA 1Z6TA 3Q73A 3TL5A 2FO7A 1MZCA 2NSZA 2IJGX 4XZ4A 2A4ZA 1RW2A 2DBAA 2E0IA 4GU5A 3QOUA 2OV8A 4G24A 3AU4A 3SI5A 3IXEA 5EYLA 2OOEA 1H6KA 3Q75A 4DLQA 3S7JA 3HHMA 1Y8MA 2XGOA
chains in the Genus database with same CATH topology
1SZ9A 3CGHA 4J6IA 4XKBA 2LO6A 3HVEB 3ZYMA 3FTWA 4JC8A 3PH0C 3ZHEA 4AM9A 4BY6A 5BUZA 4PS8A 1H2UA 1E96B 4A1SA 4K03A 1Z3XA 3FUDA 4UQZA 1FVHA 4HOSA 4NURA 1E7UA 4HFGA 4OYSA 2PL2A 3JUIA 4U0UA 4AEZC 4FC8A 2VYIA 3GYZA 5J90A 2WXOA 2IOSA 4WNGA 5D0OD 1PAQA 2J9QA 4PUCA 2M63A 4RG6A 3O48A 2NXPA 1H19A 3IKOB 3CK7A 3PNLB 4EZLA 3FTSA 5FQ6A 2J49A 4HOUA 1UJKA 2V5FA 3ZVVA 2VSYA 4YNDA 2XCCA 3UPVA 3FY4A 4AP2A 3QKYA 2XEVA 3ASDA 3OAWA 3MKQB 2WXNA 3QWWA 4B8AA 1HXIA 4UWKA 2QFCA 4RVBA 4XI0A 3FEYA 3QDNA 3NF1A 4BX9A 5AENA 3S7FA 5AIJA 2I1KA 4DPRA 3APCA 3ESLA 4N39A 5ENNA 4EQFA 1TJCA 3CVYA 1FVFA 3ONKA 1HX8A 1PC2A 4XE0A 4JHRA 4ATGA 1SZAA 3MV2B 5FQ8A 3U66A 2AW6A 4BT9A 2IF4A 4IYPA 4LCTA 3RK6A 3UT8A 1UG3A 3K9IA 3LDZA 1NZNA 4UQXA 5FZSA 2X6JA 2WXGA 3B7SA 3L22A 3NZUA 3UUXA 3D9PA 4HLEA 2FF4A 4CDRA 2PZIA 3KD7A 4C0EA 3CVWA 3VLEA 4N3AA 1JWGA 3CIAA 3APFA 4U8HA 3FHEA 1YA0A 2HYZA 3AS4A 3AS5A 1H0AA 2J07A 1Z3YA 2WXQA 3L13A 3N71A 4UWFA 3VLFA 2IU1A 3G2VA 2IONA 4E6HA 4N3BA 4I2ZA 4FA6A 4F1SA 3ML9A 3LY9A 1WM5A 2R17C 2YINA 3CK8A 2BF0X 2YHCA 4CGVA 1HFAA 3AS8A 4ILHB 1KT1A 4GA0A 4C0MA 2I6HA 2MHKA 3ZEFA 4FHJA 1VDYA 3FUIA 3I4RB 3CHPA 5T4YA 2XHEA 2IOLA 1TEZA 2AWIA 3D3MA 5G05C 3G2UA 4BX8A 4L7TA 3LY8A 5A7DB 3PS6A 3FU0A 4I1AA 3CKCA 2L0IA 3S7DA 1OUVA 3TJPA 4ANXA 3FUHA 1HG5A 1A17A 3MYVA 4IRUA 3EJNA 1S0PA 2AXZA 2X3MA 2HO1A 3GW4A 4GCNA 3BG1B 2WXKA 3FH7A 1DNPA 3CHRA 3UQ3A 5LFAA 4Y6CA 5T8IA 3TG4A 5CMWA 2WXRA 3U4TA 3Q5MA 5G05J 5CCLA 1HE8A 4ANVA 4EECA 1N52A 4AJWA 1DVPA 4WAFA 3FUMA 2WB2A 1HZ4A 4EZJA 3R7RA 4G23A 3CSTA 3R7QA 4GA1A 1EPUA 3QNKA 1WY6A 4WWNA 3D9OA 4ME2A 3UX4A 3RO2A 2WMNA 3RRMB 4CGWA 4AY5A 3GZ1A 4GYOA 3HIZA 3RJVA 5FQ7A 3MKQA 3G2WA 1XNFA 2J09A 3CVQA 4ILGA 3IBEA 2CFUA 4L2YA 3CVLA 3I5PA 4U0SA 3RRUA 4JVSA 3FUEA 3SFZA 2CHXA 3G2TA 2UWJG 3FTZA 2R59A 4FLBA 2WXMA 3B7TA 3QB2A 4KT6B 3UT4A 1E8WA 1OWNA 2E2EA 3CR3A 2VJ8A 4BT8A 3CVUA 1U3DA 3CVVA 3CSFA 2VGYA 2XGSA 4TRQA 3ZW3A 5FQ4A 3CVNA 4ABNA 1LF8A 2J08A 4CT4A 3U64A 4KXKB 2BUGA 4F3VA 3CHSA 2J4BA 4KMOA 4HORA 1E8XA 2Y3AA 3O4ZA 3T5XA 3QK0A 4C9BB 4A3TA 1NA0A 5LX8A 4FULA 3CKBA 2C0LA 2X6HA 1ZBPA 2FULA 3LJ3A 4FP7A 2GW1A 1BPOA 5BT1A 5BW8C 3ONLA 3Q15A 2HR2A 2V0PA 2GRLA 3L16A 4JW1A 3CV0A 4LRZA 2XRZA 3MZLB 2VTBA 5M72A 4GMJA 3TXNA 5JHAA 2GRMA 5FT9A 4UI9J 4DI3A 2V4LA 3CHQA 4B8CB 3ESKA 3Q47B 3CQCB 3NQPA 4A3VA 3T5VA 5ARGA 4LEUA 5FZRA 1ZU2A 1KT0A 3ENEA 3QWPA 1JPLA 4IULA 4Q94A 2C0MA 3EIQC 3SBSA 3ZIMA 4DJAA 5JJTA 2CG2A 3MA5A 5A23A 2KM4A 3FUJA 5CMYA 4JEUA 4FJYA 4KBQA 2VTBB 3S7BA 4MKTA 4UI9C 5BNWA 1TJFA 2UY1A 4H7XA 4BTAA 4FJZA 2X6FA 3FWVA 5AJLA 4EBAG 2WQ7A 3D9IA 3FEXA 2I9CA 5KJMA 2KZTA 4P29A 4HOTA 4DLOA 2XPIA 2WXFA 3ZFWA 1E7VA 1HU3A 2LNIA 3EDTB 4U63A 4TV3A 4W9RA 5HI7A 4JXTA 1E8YA 1JWFA 3FUNA 5KJLA 3IEGA 4F7AA 3PE3A 1IQUA 3D9NA 4WUYA 2KC7A 2XCBA 2LAHA 3RKVA 3R9AB 3ZGQA 4ACKA 2QY7A 3URZA 1QQEA 4NRHB 4OVVA 4AVXA 4GZDA 3ASFA 3MGBA 2CHWA 2V8SE 3B7UX 4GCOA 4HVBA 2VSOE 3GZ2A 4AV7A 1L5JA 2PM6A 3FU3A 4ANUA 5D0QD 3D9KA 4PDXA 4ILIA 4A1GA 4A55A 4J8EA 3CVXA 4I6GA 4U04A 1OWLA 2C2LA 3HYMB 2WPVA 1NP7A 2BTDA 3D9LA 5LOZA 2AVPA 4IN3B 2WMOA 4M3OA 4I17A 3U3WA 3TG5A 3Q49B 2I1JA 1P5QA 4GYYA 3SBTB 2PQNA 4MLPA 5G04C 4UWGA 5EKQD 2ILRA 4NQ0A 4G2VA 3MX3A 3PZDA 3G2SA 2UY1B 5G2NA 1OWPA 2FBNA 2GGFA 4APOA 3QJZA 3Q4AB 4J8FA 5FZQA 5LCWC 2R5SA 4GA2A 4RG9A 3CVPA 5BV1A 2ONDA 4HS2A 4K0RA 2ZU6B 3LXUX 4Q96A 2WVIA 2Y4TA 4UQYA 5E75A 2OVBA 4GZCA 4U0ZA 4BWRA 3AU5A 2WXHA 4I9EA 4L23A 1FCHA 2FEZA 3DPDA 3PVLA 4GMLA 1HF8A 4OVUA 2LSUA 5DBKA 3ULQA 5FWQA 3SHFA 3LS8A 1X5BA 3CHMA 4I1MA 4L1BA 4EBAA 3L6AA 2OVFA 2IQCA 3PUKA 1EF1C 3BG0B 4HOQA 3FP3A 4I43A 2WXPA 1E90A 3LKUA 4YVQC 2JLBA 3FULA 3SD5A 4GZ5A 4G11A 2MRIA 5CHEE 3KAEA 3PE4A 3RU0A 1E8ZA 1UJJA 4B0ZA 4BFRA 2RD0A 2PM7A 4U07A 3LYAA 1EYHA 1HS6A 2YNQA 4F53A 3QARA 3PEUB 1MQSA 3IHYA 2VGXB 3FUKA 4XI9A 1B89A 3C98A 3MJWA 1H2TC 1U3CA 4LUNU 5KJNA 3JYSA 4GB9A 5G55A 4KYOB 3QWVA 3ZXSA 3EHNA 3TXMA 4N2QA 3ZHEB 1IQRA 4KVOA 2WQHA 3UT7A 2EQXA 3JQ1A 4BTBA 2XPYA 4JL0A 2KATA 3ZN3A 4D10C 5LCWJ 2AXVA 3FDHA 3S2AA 2L9BA 4I2WA 4BSXA 3FUFA 3PRZA 2YHEA 3B13A 3PEVB 2CHZA 2NC9A 4V3IA 3KEZA 5G04J 5AJDA 2Q7FA 3TGOA 5FTPA 4JEHA 5BV0A 2J4DA 3GZSA 3LVRE 2XRYA 2L0TB 5JJ6A 4CDNA 4RSYA 3LEWA 4AY6A 5EX3A 3HDXA 1XGWA 4FLHA 5KJKA 3FH8A 4GZ6A 3U9WA 3OXGA 3SZ7A 2A5UA 4WNDA 3HVEA 4B89A 4JPSA 3PREA 5KCMA 5ANRA 5HQ8A 3D9JA 4UWHA 4GYWA 4XIFA 2KCKA 2VQ2A 3SF4A 4N2SA 2VGXA 5A6CA 1HG2A 2L6JA 4FU3A 4JA7A 4J0UA 2XQ0A 3L17A 3KS2A 5C2YA 4KZ0A 3IHVA 3ZRHA 2KCLA 1QNFA 4KVMA 3ZYQA 4YVOA 2LAIA 3FTVA 4QFVA 2XGMA 2XPZA 3BEEA 3VTYA 2WXLA 4GPKA 3WXXA 3B7RL 4KZCA 3D9MA 2FI7A 2PQRA 3LVQE 3RIBA 1ELRA 1QZ2A 2IFUA 3JCKC 4WWPA 1ELKA 4Y6WA 2WXIA 3MV3B 4H7YA 3FTUA 1NA3A 3P1UA 1H2VC 1UW4B 2DCPA 3FFLA 5JHBA 2JEKA 2LSVA 3CHOA 1OWMA 3MKRA 5J08A 4I6JA 3FTYA 3L54A 2X38A 4JA9A 4AXHA 2WXJA 4PH4B 1HO8A 2HM8A 4DI4A 3ASHA 4WWOA 4XX5A 1IHGA 1PY1A 4Q69A 1ELWA 3L08A 5E76A 1SQMA 3RO3A 4XKCA 4O6FA 3MCXA 5T3RA 4GZ3A 4ANWA 1GW6A 3APDA 3EIJA 4CRWA 2WQ6A 4PS7A 4FADA 3CK9A 4LERA 5C1DA 4UWLA 3CLJA 4PS3A 4R7LA 4JHJA 5JJ7A 3PUJA 2CFZA 3FU5A 3ZYKA 1OWOA 4DK5A 2I2OA 4FHKA 3LPZA 4I6EA 4CT0A 4CEMA 4URKA 4CCAA 4L2LA 4EZKA 2VSXE 4B94A 4I9CA 3LCAA 3OTNA 2YQ8A 4TUUA 4NACA 5AYWD 5LP0A 2KZTB 3QC1A 1KLXA 1WAO1 4J8SA 2VSNA 2Y4UA 4UI9K 4WNEA 4J8DA 3IV0A 3NZSA 5CCMA 1EDUA 3SNXA 2X6IA 3TAXA 3VTXA 3OXFA 2RG8A 5FJYA 4JZYA 1UN9A 1UN8A 4WNFA 3ZYLA 2WM9A 2P58C 4G25A 4G26A 4APFA 5BPPA 3QAQA 4G1TA 3ML8A 3I3NA 2MOWA 3ASGA 4MS6A 4AOFA 3VLDA 3LY7A 5EDSA 2AXUA 4HXIA 3I4GA 4E85A 2DIWA 4I1OB 3UMVA 3OXLA 4ACLA 4AIFA 4CDMA 1HH8A 1Z6TA 3EHMA 1N54A 4N5CA 5EX0A 3TL5A 1W3BA 2FO7A 1JUQA 2X6KA 1MHQA 3CEQA 1IYGA 2NSZA 3PDNA 5DIZA 3RRNB 2IJGX 2KCVA 4MRUA 5ARFA 4XZ4A 2A4ZA 2DBAA 2E0IA 4GU5A 3JQ0A 3P2BA 2OV8A 3DBSA 3QOUA 4EPZA 4G24A 4JHKA 3AU4A 3SI5A 3CQGB 3FTXA 4N3CA 2CG3A 3FU6A 3PNTB 3T8MA 1INZA 3FH5A 4GAAA 1Y6IA 2OOEA 3E4BA 1H6KA 4DLQA 5ANLA 3S7JA 3SGHA 3ZPJA 3MEKA 3HHMA 1Y8MA 2XGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UQ3 A;  4Y6C A;  4GCO A;  4GYW A;  4XIF A;  2KCK A;  2VQ2 A;  3GZ2 A;  3SF4 A;  3TG4 A;  4N2S A;  2VGX A;  5A6C A;  5D0Q D;  3U4T A;  2L6J A;  4J0U A;  4JA7 A;  3Q5M A;  5G05 J;  4J8E A;  3ZHE A;  4AM9 A;  4U04 A;  5CCL A;  3KS2 A;  1E96 B;  2C2L A;  4A1S A;  2KCL A;  3HYM B;  4UQZ A;  2WPV A;  4YVO A;  4HOS A;  2AVP A;  4IN3 B;  1HZ4 A;  2XGM A;  4I17 A;  3TG5 A;  3Q49 B;  3U3W A;  4G23 A;  3BEE A;  4GYY A;  1P5Q A;  4GA1 A;  3VTY A;  2PQN A;  4GPK A;  2PL2 A;  5G04 C;  3WXX A;  5EKQ D;  3RIB A;  2FI7 A;  2PQR A;  4ME2 A;  4NQ0 A;  1ELR A;  3RO2 A;  4CGW A;  1QZ2 A;  4G2V A;  4U0U A;  4AY5 A;  2IFU A;  3GZ1 A;  4GYO A;  2UY1 B;  5BNW A;  4Y6W A;  2FBN A;  3RJV A;  3MV3 B;  4H7Y A;  4APO A;  2VYI A;  1NA3 A;  3GYZ A;  1XNF A;  3Q4A B;  4J8F A;  3CVQ A;  5FZQ A;  2R5S A;  5LCW C;  3FFL A;  4GA2 A;  4RG9 A;  3CVP A;  4WNG A;  2J9Q A;  2OND A;  3CVL A;  5D0O D;  2LSV A;  3MKR A;  3O48 A;  4RG6 A;  4U0S A;  2UWJ G;  2Y4T A;  4UQY A;  3CK7 A;  4JA9 A;  4U0Z A;  4BWR A;  4I9E A;  4HOU A;  2V5F A;  3ASH A;  1FCH A;  2VSY A;  1IHG A;  2E2E A;  2FEZ A;  4YND A;  1ELW A;  2XCC A;  4BT8 A;  3UPV A;  3ULQ A;  2LSU A;  5DBK A;  3RO3 A;  4O6F A;  2VGY A;  2XGS A;  4GZ3 A;  3QKY A;  2XEV A;  3ASD A;  3CVN A;  4ABN A;  3QWW A;  1HXI A;  2QFC A;  3CK9 A;  5C1D A;  4KXK B;  4XI0 A;  5JJ7 A;  3QDN A;  2BUG A;  3NF1 A;  3S7F A;  4F3V A;  4HOQ A;  3LPZ A;  4HOR A;  3FP3 A;  3LKU A;  4YVQ C;  4N39 A;  2JLB A;  4EQF A;  4B94 A;  1TJC A;  4GZ5 A;  1NA0 A;  3LCA A;  4I9C A;  5CHE E;  3KAE A;  2YQ8 A;  3CKB A;  1PC2 A;  2C0L A;  3PE4 A;  4JHR A;  1ZBP A;  1KLX A;  1WAO 1;  3MV2 B;  3LYA A;  4U07 A;  2VSN A;  2Y4U A;  4UI9 K;  2GW1 A;  4WNE A;  4J8D A;  5BT1 A;  5CCM A;  5HQ8 A;  5BW8 C;  2IF4 A;  3Q15 A;  2VGX B;  2HR2 A;  4XI9 A;  4BT9 A;  1B89 A;  3CV0 A;  3TAX A;  3VTX A;  3OXF A;  5M72 A;  5FJY A;  3K9I A;  5KJN A;  1NZN A;  4UQX A;  3JYS A;  4UI9 J;  4WNF A;  4G25 A;  2P58 C;  4G26 A;  5FT9 A;  5FZS A;  4KYO B;  3QWV A;  4G1T A;  3UUX A;  2FF4 A;  3ASG A;  2PZI A;  3ESK A;  3Q47 B;  4CDR A;  4N2Q A;  3KD7 A;  3LY7 A;  3ZHE B;  2WQH A;  5ARG A;  4BTB A;  4LEU A;  4N3A A;  5FZR A;  1ZU2 A;  1KT0 A;  4JL0 A;  3QWP A;  2C0M A;  2KAT A;  3ZN3 A;  1YA0 A;  2HYZ A;  5JJT A;  3AS4 A;  3OXL A;  4AIF A;  5LCW J;  3AS5 A;  3MA5 A;  1HH8 A;  3N71 A;  4I2W A;  4KBQ A;  4N5C A;  3S7B A;  4UI9 C;  4N3B A;  5EX0 A;  2UY1 A;  2NC9 A;  4H7X A;  4I2Z A;  3RU0 A;  1W3B A;  5G04 J;  4BTA A;  2FO7 A;  1WM5 A;  2Q7F A;  3CEQ A;  3CK8 A;  3FWV A;  3LY9 A;  5FTP A;  3TGO A;  1IYG A;  5DIZ A;  2YHC A;  3PDN A;  4CGV A;  5KJM A;  4HOT A;  3AS8 A;  1KT1 A;  2KCV A;  4GA0 A;  5ARF A;  2I6H A;  2MHK A;  5JJ6 A;  2XPI A;  2DBA A;  3ZFW A;  3QOU A;  4AY6 A;  5EX3 A;  2LNI A;  3EDT B;  4W9R A;  4G24 A;  5HI7 A;  5KJK A;  5G05 C;  4N3C A;  3LY8 A;  5KJL A;  4GZ6 A;  3IEG A;  5A7D B;  3OXG A;  3SZ7 A;  3PE3 A;  4I1A A;  3CKC A;  3S7D A;  1OUV A;  4WND A;  2OOE A;  3E4B A;  4WUY A;  1A17 A;  5AYW D;  2KC7 A;  2XCB A;  3RKV A;  3R9A B;  3S7J A;  3ZGQ A;  3ZPJ A;  3URZ A;  3MEK A;  1QQE A;  1Y8M A;  2HO1 A;  4NRH B;  3GW4 A;  4GCN A;  2XGO A;  3ASF A; 
#chains in the Genus database with same CATH topology
 3HXC A;  2BED A;  3HVE B;  4HOS A;  3NAW A;  4NUR A;  2PL2 A;  3EHQ A;  4AEZ C;  2P9I G;  2VYI A;  2IOS A;  4GMR A;  5ENQ D;  2V5F A;  2XCC A;  2GRP B;  2XEV A;  3OAW A;  3MKQ B;  2WXN A;  3QWW A;  2QFC A;  2RKK A;  4XI0 A;  3NF1 A;  1V55 E;  4DPR A;  1N4P A;  4N39 A;  5ENN A;  4EQF A;  1TJC A;  5D66 A;  1HX8 A;  5H7P A;  1NI1 A;  3HXE A;  4K5A B;  3E37 A;  5FZS A;  2X6J A;  2WXG A;  3B7S A;  3D9P A;  2FF4 A;  4CDR A;  1OY3 D;  3T8K A;  1JWG A;  1YA0 A;  2HYZ A;  2R05 A;  3AS5 A;  1H0A A;  2J07 A;  3VLF A;  3N71 A;  2IU1 A;  1TN8 A;  2ION A;  4JB8 P;  4I2Z A;  3ML9 A;  1WM5 A;  2R17 C;  2YIN A;  3CK8 A;  2BF0 X;  3D9H A;  1HFA A;  3AS8 A;  1KT1 A;  4GA0 A;  1V54 E;  3ZEF A;  1VDY A;  2XHE A;  1TEZ A;  5AQB A;  2H6H A;  3S7D A;  3TJP A;  1A17 A;  3MYV A;  5D2M C;  2AXZ A;  2X3M A;  2WXK A;  5LFA A;  1O1S A;  4Y6C A;  3TG4 A;  3U4T A;  3UM2 A;  2ZGG A;  4EEC A;  1N52 A;  2KXP C;  2WB2 A;  3EUV A;  2DZO A;  4G23 A;  3R7Q A;  2F8X K;  1OCR E;  3W9F A;  4AY5 A;  3GZ1 A;  4GYO A;  3RJV A;  1XNF A;  3CVQ A;  3IBE A;  2CFU A;  3SFZ A;  3G2T A;  2XS1 A;  3L9T A;  4BT8 A;  3CVU A;  1BD8 A;  2VGY A;  2XGS A;  5ENO D;  4ABN A;  1LF8 A;  4KXK B;  1MX4 A;  2BUG A;  4F3V A;  2J4B A;  4KMO A;  2Y3A A;  3O4Z A;  2H6F A;  3ZU7 B;  5BW8 C;  3JXI A;  3Q15 A;  2H6G A;  4ZFH A;  3MZL B;  2VTB A;  3TXN A;  5JHA A;  2GRM A;  5FT9 A;  3CHQ A;  1MX6 A;  3NQP A;  3T5V A;  5ARG A;  3ENE A;  3ZIM A;  1KT0 A;  4IUL A;  3EIQ C;  5JJT A;  3MA5 A;  3HXB A;  5JA4 D;  2KM4 A;  3FUJ A;  4FJY A;  3S7B A;  4MKT A;  1TJF A;  2X6F A;  2WQ7 A;  2I9C A;  3DXM G;  2R2L A;  5B3S E;  1HU3 A;  4K5C A;  4TV3 A;  1K8K G;  1E8Y A;  5KJL A;  3PE3 A;  4CYM D;  3RKV A;  3R9A B;  3ZGQ A;  2HE0 A;  4NRH B;  3ASF A;  2CHW A;  5KBA A;  3FU3 A;  5AN8 A;  4J8E A;  4U04 A;  1YMP A;  3HYM B;  4I17 A;  3U3W A;  3Q49 B;  4GYY A;  1P5Q A;  1YYH A;  4Z68 A;  5G04 C;  4NQ0 A;  3PZD A;  3QJZ A;  1JCS A;  2OND A;  2ZU6 B;  3LXU X;  2Y4T A;  5HRY A;  4M7C A;  4I9E A;  1FCH A;  4TXR A;  2XEN A;  3PVL A;  4GML A;  4OVU A;  1FPP A;  5EN5 D;  3BG0 B;  4HI9 A;  4YVQ C;  2MRI A;  3PE4 A;  4BFR A;  2RD0 A;  1EYH A;  5ENT D;  2YNQ A;  1MQS A;  2VGX B;  3FUK A;  5KJN A;  1X81 A;  4GB9 A;  4KYO B;  4DX5 D;  1OCC E;  4N2Q A;  1IQR A;  2WQH A;  1LD7 A;  2XPY A;  4JL0 A;  4F1P A;  3SQV A;  3TWR A;  3S2A A;  4BSX A;  2L9B A;  4I2W A;  3FUF A;  5HS0 A;  3B13 A;  3PEV B;  4V3I A;  5AJD A;  4JEH A;  5BV0 A;  3GZS A;  4HB5 A;  5EX3 A;  4GZ6 A;  3HVE A;  1QYM A;  2DVW A;  4B89 A;  4JPS A;  3PRE A;  5HQ8 A;  4XIF A;  2KCK A;  2L6J A;  4J0U A;  4JA7 A;  4KZ0 A;  3IHV A;  2LAI A;  2XGM A;  3B7R L;  2FI7 A;  2PQR A;  2DYR E;  3ZKJ A;  2WXI A;  3MV3 B;  3FTU A;  1UW4 B;  1N9A A;  2JEK A;  2LSV A;  3CHO A;  4J7W A;  3L54 A;  2WXJ A;  4PH4 B;  4WWO A;  2NYJ A;  4Q69 A;  1SQM A;  4ANW A;  1NFI E;  4CRW A;  4PS7 A;  4FAD A;  5C1D A;  4BSZ B;  4UWL A;  3CLJ A;  4PS3 A;  4JHJ A;  4OAV B;  3PUJ A;  3ZYK A;  1OWO A;  4I6E A;  4CT0 A;  3KSQ A;  2YQ8 A;  3PZ1 A;  2VSN A;  2Y4U A;  4J8D A;  2RG8 A;  5CEC B;  2WM9 A;  2P58 C;  4G25 A;  4G26 A;  3QAQ A;  3ML8 A;  2MOW A;  4MS6 A;  3DST A;  2AXU A;  2DIW A;  1HH8 A;  1TNO A;  4LSZ E;  2OEW A;  1BLX B;  4N5C A;  1TNY A;  1JUQ A;  2X6K A;  3CEQ A;  4A63 B;  3RRN B;  5ARF A;  2L6B A;  1O5M A;  4EPZ A;  4JHK A;  3FTX A;  4N3C A;  1INZ A;  2XZT G;  1Y6I A;  3E4B A;  5ANL A;  3ZPJ A;  3NOC D;  4XKB A;  2LO6 A;  4BY6 A;  4PS8 A;  4K03 A;  3JUI A;  5J90 A;  2WXO A;  4GTM A;  3TWV A;  5D0O D;  1SVX A;  4HNA D;  3B95 A;  4DX6 D;  4EZL A;  3AG1 E;  2P9N G;  2VSY A;  2EIM E;  4AP2 A;  3T9K A;  3ASD A;  3QDN A;  5AIJ A;  3S7F A;  3ESL A;  3CVY A;  1FVF A;  3ONK A;  1SZA A;  2AW6 A;  2R02 A;  2IF4 A;  4IYP A;  3RK6 A;  1UG3 A;  1NZN A;  4UQX A;  1BU9 A;  3RSE G;  2PZI A;  1N4S A;  3KD7 A;  4C0E A;  3CVW A;  2ZXW E;  1Z3Y A;  2WXQ A;  3L13 A;  4UWF A;  3NBN B;  4E6H A;  4FA6 A;  3LY9 A;  2I6H A;  2MHK A;  4FHJ A;  3FUI A;  5T4Y A;  3G2U A;  2ETA A;  3C3O A;  3FU0 A;  4ANX A;  3FUH A;  1HG5 A;  3HXF A;  1S0P A;  4GCN A;  3FH7 A;  5T8I A;  1K1A A;  2WXR A;  3Q5M A;  1HE8 A;  4ANV A;  3UKR G;  3FUM A;  3R7R A;  3CST A;  4GA1 A;  1WY6 A;  4ME2 A;  3RO2 A;  3RRM B;  3HIZ A;  2A5E A;  3I5P A;  3RRU A;  2UWJ G;  3HG0 D;  3FTZ A;  2P2C P;  3QB2 A;  1E8W A;  3CR3 A;  2VJ8 A;  1UOH A;  3CVN A;  1AP7 A;  2B0O E;  4CT4 A;  3DSX A;  4LNB A;  1E8X A;  3E34 A;  1TNB A;  2X6H A;  2GW1 A;  4X8Q A;  3ONL A;  3L16 A;  2GRL A;  3CV0 A;  2OEV A;  4DI3 A;  3PZ2 A;  1H6O A;  1N4Q A;  3Q47 B;  3AAA C;  4YDW A;  4ATZ D;  3SBS A;  1JPL A;  3ABM E;  4BEP A;  2KBX A;  4JEU A;  4KBQ A;  5CED B;  2UY1 A;  3NB2 A;  5AJL A;  4EBA G;  2H6I A;  3FEX A;  5KJM A;  2XPI A;  2LNI A;  3ISM C;  4U63 A;  4UUC A;  4JXT A;  3FUN A;  3IEG A;  4F7A A;  4NIK A;  3D9N A;  3HXD A;  2XCB A;  2QY7 A;  4AVX A;  2V8S E;  4GCO A;  4GTR A;  4ANU A;  2PM6 A;  4A1G A;  4A55 A;  3J5P A;  1OWL A;  2C2L A;  3D9L A;  3TWW A;  2WMO A;  3SBT B;  2PQN A;  4MLP A;  4UWG A;  2Y69 E;  2ILR A;  3EHR A;  3UIP C;  2FBN A;  2GGF A;  3Q4A B;  2XEE A;  5FZQ A;  4HS2 A;  3DSU A;  2OVB A;  4L9P A;  4C48 B;  3PZ4 A;  3AU5 A;  2RFA A;  2MYO A;  1HF8 A;  3Q9U C;  5FWQ A;  4L1B A;  4EBA A;  1MYO A;  2OVF A;  4YDE A;  4MBG A;  4HOQ A;  2JLB A;  3FUL A;  4G11 A;  1TN6 A;  5CHE E;  4JD2 G;  3RU0 A;  1TNZ A;  2DZN A;  2EIJ E;  1YCS B;  3TWX A;  2IY0 C;  4F53 A;  3QAR A;  4HRN A;  3IHY A;  3DXK G;  4LG6 A;  5CBO A;  1U3C A;  3JYS A;  3EHN A;  3ZHE B;  2KAT A;  3ABL E;  2AXV A;  1A5E A;  2YHE A;  2NC9 A;  3TGO A;  4DX1 A;  3LVR E;  2XRY A;  3L82 A;  2L0T B;  5JJ6 A;  4AY6 A;  3U9W A;  2A5U A;  2IO2 C;  3Q9N C;  5ANR A;  4O60 A;  1TNU A;  3D9J A;  4N2S A;  3SF4 A;  1D9S A;  2F0Y A;  2VGX A;  5A6C A;  1HG2 A;  2XQ0 A;  3ZRH A;  5C2Y A;  2F8Y A;  2QYU A;  3ZYQ A;  3FTV A;  4QFV A;  3TWU A;  4KZC A;  3RIB A;  3JCK C;  4Y6W A;  3P1U A;  1H2V C;  2DCP A;  1OWM A;  1S63 A;  2P9L G;  3Q7A A;  4AXH A;  4DI4 A;  1OCZ E;  3V31 A;  1PY1 A;  1ELW A;  4XKC A;  3MCX A;  5T3R A;  5EIB E;  3JUE A;  5JJ7 A;  1D8E A;  3FU5 A;  2I2O A;  4FHK A;  3LPZ A;  4CEM A;  4CCA A;  4L2L A;  1S64 A;  2KZT B;  4J8S A;  4UI9 K;  5CCM A;  3NZS A;  3SNX A;  3SFY A;  5FJY A;  2GRO B;  2BKK B;  4G1T A;  1O1R A;  3ASG A;  1BI7 B;  4E85 A;  4CDM A;  3EHM A;  1N54 A;  1W3B A;  3TWT A;  1IYG A;  1MHQ A;  4RQI A;  1KZO A;  1DCQ A;  5DIZ A;  3C72 A;  3PDN A;  3KEA A;  3JQ0 A;  3P2B A;  3CQG B;  3T8M A;  2CG3 A;  3FU6 A;  3PNT B;  3V2X A;  3SO8 A;  3FH5 A;  2XEH A;  3SGH A;  3MEK A;  1AWC B;  1SZ9 A;  3CGH A;  4J6I A;  3UKU G;  3ZYM A;  3FTW A;  3PH0 C;  3ZHE A;  4AM9 A;  5HKP A;  5AAR A;  3FUD A;  1E7U A;  4HFG A;  1SA5 A;  3DSW A;  5B1A E;  1PAQ A;  2J9Q A;  4HQD A;  2M63 A;  3O48 A;  3ABK E;  2EIN E;  1N94 A;  1H19 A;  3CK7 A;  3PNL B;  3UM1 A;  3FTS A;  1OXJ A;  5FQ6 A;  5IY5 E;  2GRN B;  1UJK A;  3ZVV A;  4YND A;  3UPV A;  2V4H C;  1ZB1 A;  3FEY A;  4BX9 A;  3APC A;  4YDO A;  2P9P G;  1PC2 A;  3U66 A;  3MV2 B;  5FQ8 A;  4BT9 A;  5FIN A;  4LCT A;  3V2O A;  1QBQ A;  3L22 A;  3NZU A;  3UUX A;  4HLE A;  3AG4 E;  4RLY A;  3APF A;  4U8H A;  3AS4 A;  3G2V A;  3TWS A;  4F1S A;  2YHC A;  4ILH B;  3I4R B;  3D3M A;  1NL4 A;  1N95 A;  3PS6 A;  3Q79 A;  4I1A A;  2L0I A;  1OUV A;  1WDY A;  5KNG A;  3UM0 A;  3BG1 B;  3NOG D;  3UQ3 A;  4OAU C;  5CMW A;  5G05 J;  5CCL A;  4AJW A;  4WAF A;  1HZ4 A;  4EZJ A;  1EPU A;  3DEO A;  4WWN A;  3UX4 A;  2WMN A;  4CGW A;  3AJI A;  3MKQ A;  3G2W A;  3SFX A;  2J09 A;  2LUH A;  4L2Y A;  4U0S A;  1K3Z D;  3FUE A;  1LD8 A;  2CHX A;  5EIL A;  4FLB A;  2WXM A;  3B7T A;  1RZ4 A;  3DWL G;  3UT4 A;  1K1B A;  2E2E A;  4TRQ A;  5FQ4 A;  4EHM A;  5ITZ F;  5CEA A;  4HOR A;  1IXV A;  3T5X A;  3QK0 A;  4C9B B;  4A3T A;  5LX8 A;  3EU9 A;  2FO1 E;  3X2Q E;  1BPO A;  5BT1 A;  2XRZ A;  4LRZ A;  5FIO A;  5M72 A;  4GMJ A;  4U8V D;  2V4L A;  4F6R D;  3DPY A;  1N0R A;  3QWP A;  2C0M A;  4DJA A;  2CG2 A;  5A23 A;  5CMY A;  1JCR A;  5BNW A;  4H7X A;  2RFM A;  1O1T A;  4YDY A;  4DLO A;  2WXF A;  3R9M A;  2PNN A;  1IQU A;  4WUY A;  2LAH A;  4ACK A;  3URZ A;  3E32 A;  4GZD A;  2DYS E;  3C3Q A;  2VSO E;  3GZ2 A;  4AV7 A;  5BXO A;  4BET A;  3CVX A;  5ENP D;  4I6G A;  1NP7 A;  2BTD A;  4IN3 B;  4M3O A;  3TG5 A;  2I1J A;  5ENS D;  3G2S A;  2UY1 B;  1S70 B;  1OWP A;  2EIK E;  4RG9 A;  5BV1 A;  4HLL A;  4K0R A;  4UQY A;  4U0Z A;  4BWR A;  5BXU A;  1IKN D;  1U2V G;  4J8Y A;  3DPD A;  2LSU A;  3SHF A;  2AJA A;  3CHM A;  3V30 A;  2LXL A;  3L6A A;  3DEP A;  2IQC A;  3PUK A;  1EF1 C;  3FP3 A;  4I43 A;  3W9G A;  1MX2 A;  4GZ5 A;  4U95 D;  4ZHB A;  2PM7 A;  4U07 A;  3LYA A;  3TWQ A;  3AG3 E;  3PEU B;  1H2T C;  4KVO A;  3UT7 A;  2EQX A;  4BTB A;  3AG2 E;  1N0Q A;  4G8L A;  3FDH A;  3PRZ A;  2CHZ A;  5G04 J;  1H6P A;  2XS8 A;  1Q2Z A;  3LEW A;  1D8D A;  4CZ2 D;  3OXG A;  3SZ7 A;  3PZ3 A;  4DX7 D;  2P9K G;  5KCM A;  5CBN A;  3KSL A;  5CRU A;  4UWH A;  2VQ2 A;  4FU3 A;  2KCL A;  1QNF A;  4YVO A;  4HRM B;  3BEE A;  2F37 A;  3LVQ E;  1QZ2 A;  1Z5S C;  1SA4 A;  4WWP A;  4H7Y A;  3FFL A;  2QZA A;  3MKR A;  5J08 A;  4I6J A;  3FTY A;  4JA9 A;  1FT1 A;  1IHG A;  4GZ3 A;  1GW6 A;  3BQO A;  3APD A;  5B1B E;  3UIO C;  4LER A;  2B6C A;  2ETB A;  4URK A;  3LCA A;  4DRX E;  3OTN A;  5AYW D;  4NAC A;  4U7E B;  4TUU A;  1WAO 1;  2V5Q C;  2R03 A;  2X6I A;  3VTX A;  1UN9 A;  1N4R A;  1UN8 A;  3ZYL A;  4APF A;  1TYQ G;  3VLD A;  4HXI A;  3I4G A;  3OXL A;  5EX0 A;  2BKG A;  2KCV A;  4MRU A;  3DBS A;  3Q78 A;  3UXG A;  2Y1L E;  4GAA A;  4O1P A;  3E33 A;  4GTP A;  1MJ0 A;  5AAO A;  4JC8 A;  3DSS A;  5BUZ A;  1H2U A;  1E96 B;  4A1S A;  1Z3X A;  4UQZ A;  1FVH A;  5AQ9 A;  3RAU A;  4OYS A;  4U0U A;  4BER A;  4FC8 A;  3GYZ A;  4WNG A;  4PUC A;  3LJN A;  4RG6 A;  2NXP A;  3IKO B;  5KNH D;  2ZIS A;  2J49 A;  4HOU A;  3FY4 A;  3QKY A;  4O1O A;  4B8A A;  1HXI A;  4UWK A;  4RVB A;  5AEN A;  2I1K A;  4XE0 A;  4ATG A;  4JHR A;  4DUI A;  3BUA A;  3UT8 A;  2DWZ A;  3K9I A;  3LDZ A;  2ETC A;  3ZNG A;  3ULE G;  1KZP A;  3VLE A;  4N3A A;  3CIA A;  3JXJ A;  3FHE A;  1WG0 A;  3SY2 A;  4N3B A;  3V79 K;  4N5Q A;  3ZXP A;  4CGV A;  5EYP F;  4C0M A;  1G3N B;  3CHP A;  4GTO A;  2IOL A;  2AWI A;  5G05 C;  4BX8 A;  4L7T A;  3LY8 A;  5A7D B;  2P9U G;  4TXP A;  4GPM A;  3CKC A;  2QYJ A;  4IRU A;  3EJN A;  2HO1 A;  3GW4 A;  1SW6 A;  1DNP A;  3CHR A;  3ULY A;  5ENR D;  2VGE A;  1IHB A;  1DVP A;  2P9S G;  4B93 B;  3QNK A;  3D9O A;  1LTX A;  5FQ7 A;  3J5Q B;  4ILG A;  3CVL A;  2Y0B G;  4JVS A;  3WG7 E;  2R59 A;  5KWD A;  4KT6 B;  4GTT A;  1OWN A;  1OT8 A;  2OCC E;  1U3D A;  3CVV A;  3CSF A;  2QC9 A;  3Q7F A;  3ZW3 A;  2J08 A;  3U64 A;  3CHS A;  3F6Q A;  1NA0 A;  4FUL A;  3CKB A;  2C0L A;  1ZBP A;  2FUL A;  3LJ3 A;  4FP7 A;  1TR4 A;  1TN7 A;  2HR2 A;  2V0P A;  4JW1 A;  2EIL E;  4TXQ A;  4UI9 J;  4B8C B;  4HRL A;  3ESK A;  3CQC B;  1FT2 A;  4A3V A;  4LEU A;  5FZR A;  1ZU2 A;  4Q94 A;  2XZD G;  2VTB B;  4UI9 C;  4BTA A;  4FJZ A;  3FWV A;  1JCQ A;  3D9I A;  2GRQ B;  2KZT A;  4P29 A;  4HOT A;  3ZFW A;  1E7V A;  4W9R A;  3EDT B;  5HI7 A;  1JWF A;  1BI8 B;  3UTM A;  3B7B A;  2KC7 A;  5AQ7 A;  1QQE A;  4OVV A;  3MGB A;  3B7U X;  4HVB A;  5CRV A;  1L5J A;  5D0Q D;  3D9K A;  4PDX A;  4ILI A;  3UI2 A;  1DCE A;  4K5B A;  3HRA A;  2WPV A;  5LOZ A;  2AVP A;  5EKQ D;  4G2V A;  2IEJ A;  3MX3 A;  5G2N A;  5JMN D;  4APO A;  5CER B;  4J8F A;  5LCW C;  2R5S A;  1N11 A;  4GA2 A;  3CVP A;  4Q96 A;  2WVI A;  5E75 A;  4GZC A;  4U8Y D;  2WXH A;  2ZGD A;  4U96 D;  4L23 A;  2FEZ A;  3ULQ A;  5DBK A;  3LS8 A;  1X5B A;  4I1M A;  3DSV A;  4HBD A;  3DRA A;  2WXP A;  1E90 A;  3LKU A;  3UM3 A;  3SD5 A;  4GTV A;  3KAE A;  1E8Z A;  4TUM A;  4B0Z A;  1UJJ A;  1HS6 A;  1OCO E;  4XI9 A;  1B89 A;  3C98 A;  3MJW A;  4LUN U;  5G55 A;  3QWV A;  3ZXS A;  3TXM A;  4BES A;  4LNU D;  3JQ1 A;  4GTQ A;  1KPS B;  3ZN3 A;  4D10 C;  5LCW J;  3C3R A;  2J8S D;  3ASO E;  2LXM A;  2IO3 C;  3KEZ A;  2Q7F A;  5FTP A;  2J4D A;  4GTS A;  4CDN A;  4RSY A;  3HDX A;  2GRR B;  1XGW A;  4FLH A;  5KJK A;  3FH8 A;  4WND A;  3ASN E;  4GYW A;  3UIN C;  3L17 A;  3KS2 A;  4KVM A;  4HI8 A;  1DC2 A;  2XPZ A;  3VTY A;  2WXL A;  4GPK A;  3WXX A;  3D9M A;  1ELR A;  2IFU A;  5AQA A;  5EID A;  1ELK A;  1NA3 A;  5JHB A;  2X38 A;  1HO8 A;  2HM8 A;  3ASH A;  4XX5 A;  3L08 A;  5E76 A;  3RO3 A;  4O6F A;  3E30 A;  3EIJ A;  2WQ6 A;  3EU5 A;  3CK9 A;  4QQI A;  4R7L A;  4DK5 A;  2CFZ A;  4DX2 A;  4LNG A;  4EZK A;  2VSX E;  4B94 A;  4I9C A;  4G8K A;  5LP0 A;  3QC1 A;  1KLX A;  4XEI G;  4WNE A;  3IV0 A;  1EDU A;  3TAX A;  3OXF A;  4JZY A;  4WNF A;  5BPP A;  3BU8 A;  2JAB A;  3I3N A;  4AOF A;  3LY7 A;  5EDS A;  3ZUV B;  3C5R A;  4I1O B;  3UMV A;  4ACL A;  4AIF A;  2ZIR A;  1Z6T A;  3Q73 A;  3TL5 A;  2FO7 A;  1MZC A;  2NSZ A;  2IJG X;  4XZ4 A;  2A4Z A;  1RW2 A;  2DBA A;  2E0I A;  4GU5 A;  3QOU A;  2OV8 A;  4G24 A;  3AU4 A;  3SI5 A;  3IXE A;  5EYL A;  2OOE A;  1H6K A;  3Q75 A;  4DLQ A;  3S7J A;  3HHM A;  1Y8M A;  2XGO A; 
#chains in the Genus database with same CATH homology
 1SZ9 A;  3CGH A;  4J6I A;  4XKB A;  2LO6 A;  3HVE B;  3ZYM A;  3FTW A;  4JC8 A;  3PH0 C;  3ZHE A;  4AM9 A;  4BY6 A;  5BUZ A;  4PS8 A;  1H2U A;  1E96 B;  4A1S A;  4K03 A;  1Z3X A;  3FUD A;  4UQZ A;  1FVH A;  4HOS A;  4NUR A;  1E7U A;  4HFG A;  4OYS A;  2PL2 A;  3JUI A;  4U0U A;  4AEZ C;  4FC8 A;  2VYI A;  3GYZ A;  5J90 A;  2WXO A;  2IOS A;  4WNG A;  5D0O D;  1PAQ A;  2J9Q A;  4PUC A;  2M63 A;  4RG6 A;  3O48 A;  2NXP A;  1H19 A;  3IKO B;  3CK7 A;  3PNL B;  4EZL A;  3FTS A;  5FQ6 A;  2J49 A;  4HOU A;  1UJK A;  2V5F A;  3ZVV A;  2VSY A;  4YND A;  2XCC A;  3UPV A;  3FY4 A;  4AP2 A;  3QKY A;  2XEV A;  3ASD A;  3OAW A;  3MKQ B;  2WXN A;  3QWW A;  4B8A A;  1HXI A;  4UWK A;  2QFC A;  4RVB A;  4XI0 A;  3FEY A;  3QDN A;  3NF1 A;  4BX9 A;  5AEN A;  3S7F A;  5AIJ A;  2I1K A;  4DPR A;  3APC A;  3ESL A;  4N39 A;  5ENN A;  4EQF A;  1TJC A;  3CVY A;  1FVF A;  3ONK A;  1HX8 A;  1PC2 A;  4XE0 A;  4JHR A;  4ATG A;  1SZA A;  3MV2 B;  5FQ8 A;  3U66 A;  2AW6 A;  4BT9 A;  2IF4 A;  4IYP A;  4LCT A;  3RK6 A;  3UT8 A;  1UG3 A;  3K9I A;  3LDZ A;  1NZN A;  4UQX A;  5FZS A;  2X6J A;  2WXG A;  3B7S A;  3L22 A;  3NZU A;  3UUX A;  3D9P A;  4HLE A;  2FF4 A;  4CDR A;  2PZI A;  3KD7 A;  4C0E A;  3CVW A;  3VLE A;  4N3A A;  1JWG A;  3CIA A;  3APF A;  4U8H A;  3FHE A;  1YA0 A;  2HYZ A;  3AS4 A;  3AS5 A;  1H0A A;  2J07 A;  1Z3Y A;  2WXQ A;  3L13 A;  3N71 A;  4UWF A;  3VLF A;  2IU1 A;  3G2V A;  2ION A;  4E6H A;  4N3B A;  4I2Z A;  4FA6 A;  4F1S A;  3ML9 A;  3LY9 A;  1WM5 A;  2R17 C;  2YIN A;  3CK8 A;  2BF0 X;  2YHC A;  4CGV A;  1HFA A;  3AS8 A;  4ILH B;  1KT1 A;  4GA0 A;  4C0M A;  2I6H A;  2MHK A;  3ZEF A;  4FHJ A;  1VDY A;  3FUI A;  3I4R B;  3CHP A;  5T4Y A;  2XHE A;  2IOL A;  1TEZ A;  2AWI A;  3D3M A;  5G05 C;  3G2U A;  4BX8 A;  4L7T A;  3LY8 A;  5A7D B;  3PS6 A;  3FU0 A;  4I1A A;  3CKC A;  2L0I A;  3S7D A;  1OUV A;  3TJP A;  4ANX A;  3FUH A;  1HG5 A;  1A17 A;  3MYV A;  4IRU A;  3EJN A;  1S0P A;  2AXZ A;  2X3M A;  2HO1 A;  3GW4 A;  4GCN A;  3BG1 B;  2WXK A;  3FH7 A;  1DNP A;  3CHR A;  3UQ3 A;  5LFA A;  4Y6C A;  5T8I A;  3TG4 A;  5CMW A;  2WXR A;  3U4T A;  3Q5M A;  5G05 J;  5CCL A;  1HE8 A;  4ANV A;  4EEC A;  1N52 A;  4AJW A;  1DVP A;  4WAF A;  3FUM A;  2WB2 A;  1HZ4 A;  4EZJ A;  3R7R A;  4G23 A;  3CST A;  3R7Q A;  4GA1 A;  1EPU A;  3QNK A;  1WY6 A;  4WWN A;  3D9O A;  4ME2 A;  3UX4 A;  3RO2 A;  2WMN A;  3RRM B;  4CGW A;  4AY5 A;  3GZ1 A;  4GYO A;  3HIZ A;  3RJV A;  5FQ7 A;  3MKQ A;  3G2W A;  1XNF A;  2J09 A;  3CVQ A;  4ILG A;  3IBE A;  2CFU A;  4L2Y A;  3CVL A;  3I5P A;  4U0S A;  3RRU A;  4JVS A;  3FUE A;  3SFZ A;  2CHX A;  3G2T A;  2UWJ G;  3FTZ A;  2R59 A;  4FLB A;  2WXM A;  3B7T A;  3QB2 A;  4KT6 B;  3UT4 A;  1E8W A;  1OWN A;  2E2E A;  3CR3 A;  2VJ8 A;  4BT8 A;  3CVU A;  1U3D A;  3CVV A;  3CSF A;  2VGY A;  2XGS A;  4TRQ A;  3ZW3 A;  5FQ4 A;  3CVN A;  4ABN A;  1LF8 A;  2J08 A;  4CT4 A;  3U64 A;  4KXK B;  2BUG A;  4F3V A;  3CHS A;  2J4B A;  4KMO A;  4HOR A;  1E8X A;  2Y3A A;  3O4Z A;  3T5X A;  3QK0 A;  4C9B B;  4A3T A;  1NA0 A;  5LX8 A;  4FUL A;  3CKB A;  2C0L A;  2X6H A;  1ZBP A;  2FUL A;  3LJ3 A;  4FP7 A;  2GW1 A;  1BPO A;  5BT1 A;  5BW8 C;  3ONL A;  3Q15 A;  2HR2 A;  2V0P A;  2GRL A;  3L16 A;  4JW1 A;  3CV0 A;  4LRZ A;  2XRZ A;  3MZL B;  2VTB A;  5M72 A;  4GMJ A;  3TXN A;  5JHA A;  2GRM A;  5FT9 A;  4UI9 J;  4DI3 A;  2V4L A;  3CHQ A;  4B8C B;  3ESK A;  3Q47 B;  3CQC B;  3NQP A;  4A3V A;  3T5V A;  5ARG A;  4LEU A;  5FZR A;  1ZU2 A;  1KT0 A;  3ENE A;  3QWP A;  1JPL A;  4IUL A;  4Q94 A;  2C0M A;  3EIQ C;  3SBS A;  3ZIM A;  4DJA A;  5JJT A;  2CG2 A;  3MA5 A;  5A23 A;  2KM4 A;  3FUJ A;  5CMY A;  4JEU A;  4FJY A;  4KBQ A;  2VTB B;  3S7B A;  4MKT A;  4UI9 C;  5BNW A;  1TJF A;  2UY1 A;  4H7X A;  4BTA A;  4FJZ A;  2X6F A;  3FWV A;  5AJL A;  4EBA G;  2WQ7 A;  3D9I A;  3FEX A;  2I9C A;  5KJM A;  2KZT A;  4P29 A;  4HOT A;  4DLO A;  2XPI A;  2WXF A;  3ZFW A;  1E7V A;  1HU3 A;  2LNI A;  3EDT B;  4U63 A;  4TV3 A;  4W9R A;  5HI7 A;  4JXT A;  1E8Y A;  1JWF A;  3FUN A;  5KJL A;  3IEG A;  4F7A A;  3PE3 A;  1IQU A;  3D9N A;  4WUY A;  2KC7 A;  2XCB A;  2LAH A;  3RKV A;  3R9A B;  3ZGQ A;  4ACK A;  2QY7 A;  3URZ A;  1QQE A;  4NRH B;  4OVV A;  4AVX A;  4GZD A;  3ASF A;  3MGB A;  2CHW A;  2V8S E;  3B7U X;  4GCO A;  4HVB A;  2VSO E;  3GZ2 A;  4AV7 A;  1L5J A;  2PM6 A;  3FU3 A;  4ANU A;  5D0Q D;  3D9K A;  4PDX A;  4ILI A;  4A1G A;  4A55 A;  4J8E A;  3CVX A;  4I6G A;  4U04 A;  1OWL A;  2C2L A;  3HYM B;  2WPV A;  1NP7 A;  2BTD A;  3D9L A;  5LOZ A;  2AVP A;  4IN3 B;  2WMO A;  4M3O A;  4I17 A;  3U3W A;  3TG5 A;  3Q49 B;  2I1J A;  1P5Q A;  4GYY A;  3SBT B;  2PQN A;  4MLP A;  5G04 C;  4UWG A;  5EKQ D;  2ILR A;  4NQ0 A;  4G2V A;  3MX3 A;  3PZD A;  3G2S A;  2UY1 B;  5G2N A;  1OWP A;  2FBN A;  2GGF A;  4APO A;  3QJZ A;  3Q4A B;  4J8F A;  5FZQ A;  5LCW C;  2R5S A;  4GA2 A;  4RG9 A;  3CVP A;  5BV1 A;  2OND A;  4HS2 A;  4K0R A;  2ZU6 B;  3LXU X;  4Q96 A;  2WVI A;  2Y4T A;  4UQY A;  5E75 A;  2OVB A;  4GZC A;  4U0Z A;  4BWR A;  3AU5 A;  2WXH A;  4I9E A;  4L23 A;  1FCH A;  2FEZ A;  3DPD A;  3PVL A;  4GML A;  1HF8 A;  4OVU A;  2LSU A;  5DBK A;  3ULQ A;  5FWQ A;  3SHF A;  3LS8 A;  1X5B A;  3CHM A;  4I1M A;  4L1B A;  4EBA A;  3L6A A;  2OVF A;  2IQC A;  3PUK A;  1EF1 C;  3BG0 B;  4HOQ A;  3FP3 A;  4I43 A;  2WXP A;  1E90 A;  3LKU A;  4YVQ C;  2JLB A;  3FUL A;  3SD5 A;  4GZ5 A;  4G11 A;  2MRI A;  5CHE E;  3KAE A;  3PE4 A;  3RU0 A;  1E8Z A;  1UJJ A;  4B0Z A;  4BFR A;  2RD0 A;  2PM7 A;  4U07 A;  3LYA A;  1EYH A;  1HS6 A;  2YNQ A;  4F53 A;  3QAR A;  3PEU B;  1MQS A;  3IHY A;  2VGX B;  3FUK A;  4XI9 A;  1B89 A;  3C98 A;  3MJW A;  1H2T C;  1U3C A;  4LUN U;  5KJN A;  3JYS A;  4GB9 A;  5G55 A;  4KYO B;  3QWV A;  3ZXS A;  3EHN A;  3TXM A;  4N2Q A;  3ZHE B;  1IQR A;  4KVO A;  2WQH A;  3UT7 A;  2EQX A;  3JQ1 A;  4BTB A;  2XPY A;  4JL0 A;  2KAT A;  3ZN3 A;  4D10 C;  5LCW J;  2AXV A;  3FDH A;  3S2A A;  2L9B A;  4I2W A;  4BSX A;  3FUF A;  3PRZ A;  2YHE A;  3B13 A;  3PEV B;  2CHZ A;  2NC9 A;  4V3I A;  3KEZ A;  5G04 J;  5AJD A;  2Q7F A;  3TGO A;  5FTP A;  4JEH A;  5BV0 A;  2J4D A;  3GZS A;  3LVR E;  2XRY A;  2L0T B;  5JJ6 A;  4CDN A;  4RSY A;  3LEW A;  4AY6 A;  5EX3 A;  3HDX A;  1XGW A;  4FLH A;  5KJK A;  3FH8 A;  4GZ6 A;  3U9W A;  3OXG A;  3SZ7 A;  2A5U A;  4WND A;  3HVE A;  4B89 A;  4JPS A;  3PRE A;  5KCM A;  5ANR A;  5HQ8 A;  3D9J A;  4UWH A;  4GYW A;  4XIF A;  2KCK A;  2VQ2 A;  3SF4 A;  4N2S A;  2VGX A;  5A6C A;  1HG2 A;  2L6J A;  4FU3 A;  4JA7 A;  4J0U A;  2XQ0 A;  3L17 A;  3KS2 A;  5C2Y A;  4KZ0 A;  3IHV A;  3ZRH A;  2KCL A;  1QNF A;  4KVM A;  3ZYQ A;  4YVO A;  2LAI A;  3FTV A;  4QFV A;  2XGM A;  2XPZ A;  3BEE A;  3VTY A;  2WXL A;  4GPK A;  3WXX A;  3B7R L;  4KZC A;  3D9M A;  2FI7 A;  2PQR A;  3LVQ E;  3RIB A;  1ELR A;  1QZ2 A;  2IFU A;  3JCK C;  4WWP A;  1ELK A;  4Y6W A;  2WXI A;  3MV3 B;  4H7Y A;  3FTU A;  1NA3 A;  3P1U A;  1H2V C;  1UW4 B;  2DCP A;  3FFL A;  5JHB A;  2JEK A;  2LSV A;  3CHO A;  1OWM A;  3MKR A;  5J08 A;  4I6J A;  3FTY A;  3L54 A;  2X38 A;  4JA9 A;  4AXH A;  2WXJ A;  4PH4 B;  1HO8 A;  2HM8 A;  4DI4 A;  3ASH A;  4WWO A;  4XX5 A;  1IHG A;  1PY1 A;  4Q69 A;  1ELW A;  3L08 A;  5E76 A;  1SQM A;  3RO3 A;  4XKC A;  4O6F A;  3MCX A;  5T3R A;  4GZ3 A;  4ANW A;  1GW6 A;  3APD A;  3EIJ A;  4CRW A;  2WQ6 A;  4PS7 A;  4FAD A;  3CK9 A;  4LER A;  5C1D A;  4UWL A;  3CLJ A;  4PS3 A;  4R7L A;  4JHJ A;  5JJ7 A;  3PUJ A;  2CFZ A;  3FU5 A;  3ZYK A;  1OWO A;  4DK5 A;  2I2O A;  4FHK A;  3LPZ A;  4I6E A;  4CT0 A;  4CEM A;  4URK A;  4CCA A;  4L2L A;  4EZK A;  2VSX E;  4B94 A;  4I9C A;  3LCA A;  3OTN A;  2YQ8 A;  4TUU A;  4NAC A;  5AYW D;  5LP0 A;  2KZT B;  3QC1 A;  1KLX A;  1WAO 1;  4J8S A;  2VSN A;  2Y4U A;  4UI9 K;  4WNE A;  4J8D A;  3IV0 A;  3NZS A;  5CCM A;  1EDU A;  3SNX A;  2X6I A;  3TAX A;  3VTX A;  3OXF A;  2RG8 A;  5FJY A;  4JZY A;  1UN9 A;  1UN8 A;  4WNF A;  3ZYL A;  2WM9 A;  2P58 C;  4G25 A;  4G26 A;  4APF A;  5BPP A;  3QAQ A;  4G1T A;  3ML8 A;  3I3N A;  2MOW A;  3ASG A;  4MS6 A;  4AOF A;  3VLD A;  3LY7 A;  5EDS A;  2AXU A;  4HXI A;  3I4G A;  4E85 A;  2DIW A;  4I1O B;  3UMV A;  3OXL A;  4ACL A;  4AIF A;  4CDM A;  1HH8 A;  1Z6T A;  3EHM A;  1N54 A;  4N5C A;  5EX0 A;  3TL5 A;  1W3B A;  2FO7 A;  1JUQ A;  2X6K A;  1MHQ A;  3CEQ A;  1IYG A;  2NSZ A;  3PDN A;  5DIZ A;  3RRN B;  2IJG X;  2KCV A;  4MRU A;  5ARF A;  4XZ4 A;  2A4Z A;  2DBA A;  2E0I A;  4GU5 A;  3JQ0 A;  3P2B A;  2OV8 A;  3DBS A;  3QOU A;  4EPZ A;  4G24 A;  4JHK A;  3AU4 A;  3SI5 A;  3CQG B;  3FTX A;  4N3C A;  2CG3 A;  3FU6 A;  3PNT B;  3T8M A;  1INZ A;  3FH5 A;  4GAA A;  1Y6I A;  2OOE A;  3E4B A;  1H6K A;  4DLQ A;  5ANL A;  3S7J A;  3SGH A;  3ZPJ A;  3MEK A;  3HHM A;  1Y8M A;  2XGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...