1V54E

Bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
105
structure length
105
Chain Sequence
b'HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase polypeptide I
publication title The low-spin heme of cytochrome c oxidase as the driving element of the proton-pumping process.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 40
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 1v54E00
3AG4E 3ABME 1V55E 5B1BE 3WG7E 3AG3E 5B1AE 1OCZE 3ABLE 1V54E 1OCCE 1OCOE 2ZXWE 2DYSE 3AG1E 3ASOE 2Y69E 2EIJE 5IY5E 3X2QE 2EILE 2DYRE 2OCCE 2EIME 3AG2E 2EINE 3ASNE 1OCRE 2EIKE 5B3SE 3ABKE
chains in the Genus database with same CATH superfamily
5CECB 3SY2A 1BD8A 3PE4A 3OXGA 2LSVA 3CHMA 3U4TA 5G04C 4TRQA 3ZYKA 3TWTA 1E8XA 1S0PA 4UI9J 5BV1A 1IXVA 3MV3B 4I9EA 4FA6A 3B7TA 2RFMA 3UKUG 2J08A 3G2UA 3TWRA 1IQUA 3FTYA 1DC2A 5M72A 4MRUA 3Q7AA 1O1RA 1X81A 3FU5A 4IYPA 4DI3A 3CKBA 3QJZA 2R2LA 4HS2A 1NZNA 5J08A 1KT1A 3VLDA 2RG8A 5CCMA 2WVIA 2BTDA 3APFA 5FTPA 2QYUA 3MKQB 3R9AB 1Z3XA 2DCPA 2QZAA 4W9RA 1B89A 4IN3B 3IHYA 2CFZA 3KEAA 3RJVA 3S7FA 3QWVA 2I1KA 4DX2A 4I17A 1N4PA 3D9NA 3FTWA 3APCA 5KNGA 4B0ZA 2MYOA 2XQ0A 3FUJA 5JA4D 4HBDA 3JQ1A 2X6IA 4TXQA 5KWDA 1O5MA 4UWFA 3DEPA 4X8QA 5JHBA 2XZTG 4DK5A 3U64A 4F1PA 4K03A 3ZYMA 4GTOA 3NZSA 3R7RA 3Q73A 5LCWC 2ZIRA 3T9KA 4CGWA 3FWVA 4GMJA 4WNEA 5AJLA 1HO8A 3CR3A 1TJFA 3RRUA 4GA2A 2CHZA 2ZGGA 3HRAA 4JXTA 3LXUX 4UWHA 1MX6A 5D0QD 3CVNA 2XEHA 3BUAA 5BUZA 4GZCA 4AVXA 4BTAA 4ATGA 3FH7A 4LSZE 2HR2A 2XGOA 2WXGA 3CVXA 2YQ8A 3RRNB 4DLQA 4XKBA 4GPMA 3T5XA 4B93B 1IHGA 4KZCA 1HF8A 3R9MA 4CRWA 4B89A 1WAO1 1HG2A 3FUDA 4C0EA 3MYVA 4F3VA 4XE0A 3NOCD 4ILHB 2VGEA 4XI9A 5A7DB 4N3BA 2GRNB 3EU5A 1OT8A 3E32A 2OEVA 4CT0A 2FEZA 3MEKA 4DX7D 1NP7A 5FIOA 2XRYA 1X5BA 3HHMA 4M7CA 1BU9A 4I1AA 2F8XK 2Y4TA 3HIZA 4BX8A 1TNYA 4O1PA 4TXPA 5CMYA 1SA4A 2V8SE 1H2UA 4L23A 2PM7A 2LAHA 3SI5A 3EHMA 4RG6A 2VSYA 3O48A 4TXRA 3GYZA 2EIJE 3X2QE 4XIFA 3PZ1A 3MA5A 3E4BA 1JCQA 5G2NA 4N5QA 1SW6A 3CHOA 3LVQE 1DNPA 4LEUA 3RRMB 1QYMA 4C0MA 3AAAC 4J8FA 4HRLA 1HE8A 4DJAA 4C48B 4FULA 4HOSA 3T8KA 2BUGA 1HX8A 2IY0C 1W3BA 3EJNA 4FJYA 3EU9A 2IOLA 4U8VD 5FZRA 2VQ2A 4YDWA 5G04J 3OAWA 4WWOA 1D9SA 4QFVA 3NBNB 4EBAA 4UQZA 3ASHA 5DIZA 3SFXA 3RSEG 1H6OA 3FTSA 5G05C 2CHWA 5C2YA 4N5CA 4XEIG 4Q94A 3ZRHA 1OWMA 3ZYQA 1OWOA 4GU5A 4L2YA 3Q9UC 5KJMA 1EDUA 4A3TA 3F6QA 4JC8A 5BXOA 3FFLA 4G23A 3UXGA 4KT6B 3SF4A 4N2SA 3MZLB 3Q49B 4NIKA 1HFAA 4J8YA 4YDEA 1MX4A 5B3SE 3FUNA 1ELWA 1WDYA 5B1AE 1E8YA 5AAOA 1V54E 4EHMA 2RKKA 3UTMA 2VTBA 2EIME 4GAAA 3ZPJA 2A5UA 3PREA 1MYOA 4HQDA 3VLFA 3J5QB 3SHFA 3QOUA 5HQ8A 2LSUA 5KNHD 4FLHA 3UM1A 2DYSE 1NL4A 3SZ7A 1KT0A 3FP3A 1TNBA 1XNFA 1N0RA 5BV0A 2WXIA 2WXNA 2WMNA 2HO1A 3BG0B 3VTXA 5FZSA 1N94A 1TJCA 4L9PA 5AENA 3HXDA 3ISMC 3P1UA 2AWIA 2V0PA 3CQCB 3HXCA 3MGBA 4BX9A 5LCWJ 4AEZC 4V3IA 5T8IA 2VSNA 3ESKA 3TWSA 1Z6TA 1INZA 5AQ7A 1ZBPA 1LTXA 3PH0C 3UKRG 4GTSA 3DRAA 3MJWA 5AN8A 1LD8A 1U3DA 4GZ6A 3J5PA 3L13A 5FQ6A 3UT7A 3JXIA 3TXMA 3B7BA 2BKKB 2F0YA 3CV0A 4ACLA 2AW6A 5ENTD 4PS3A 1D8DA 3ULEG 5D0OD 3QAQA 4F7AA 3ULQA 2PL2A 3FUIA 2J4DA 3NQPA 3MCXA 2GGFA 3AS5A 1AWCB 4ME2A 4AJWA 3ZUVB 3MX3A 2VSXE 1OCCE 3QB2A 1OCOE 3T5VA 4KVOA 2JEKA 5BNWA 3TXNA 3DPDA 2IF4A 3C3OA 4A63B 2KCVA 2IEJA 3PZ2A 4G11A 2GW1A 4F6RD 3ZU7B 1S70B 4CYMD 1TN7A 3C3QA 1FPPA 3B7RL 3R7QA 2IO3C 1Y8MA 2DYRE 2J9QA 2J49A 1E7VA 3HXBA 3V2OA 4QQIA 4HXIA 4AY5A 1A17A 2FULA 2Y1LE 4M3OA 5B1BE 3E33A 3OXLA 2JLBA 3L22A 2GRQB 3N71A 3D9MA 3TWXA 1BI7B 4RVBA 2XS1A 1KLXA 3D9HA 4TV3A 3NAWA 2V4HC 2L6JA 3ML9A 3L54A 4ANXA 2YHEA 1QBQA 2V5QC 2HE0A 4EPZA 2XHEA 3B13A 4GA1A 4K5AB 5H7PA 5C1DA 2ETAA 2C0MA 3L6AA 3DSWA 3ZEFA 3K9IA 1A5EA 4L2LA 4Z68A 2FO7A 4P29A 5HRYA 5G05J 4E85A 4CDNA 3O4ZA 2XGSA 3S7DA 5EIDA 3D9LA 1JCSA 3LS8A 3ONKA 3D9OA 3UM2A 3FUEA 3TG5A 4GTVA 2QY7A 4U0ZA 4I43A 3HVEA 4U0UA 4BSZB 4LUNU 2V5FA 3CVUA 1SZAA 1FVFA 5E76A 3FTVA 4KXKB 4RQIA 3UPVA 2KZTB 1H6PA 3SGHA 3UX4A 3TWQA 4YVQC 3UQ3A 1TNZA 3DSXA 4I6GA 3TWVA 4NQ0A 2LO6A 3CVWA 4K5CA 4HNAD 3ZGQA 3BU8A 5CHEE 3Q75A 3APDA 1WY6A 4NACA 2P9PG 2XS8A 3CVLA 1E8WA 1K8KG 1UJJA 4BESA 2Q7FA 2WXQA 4CDRA 3PS6A 3ZVVA 2VGXB 4PS8A 4APFA 3CVYA 5CEAA 3CVPA 5AARA 1K3ZD 2LXMA 3NOGD 4XKCA 1V55E 3DBSA 3PEVB 4DX6D 3W9GA 3AG2E 4J8SA 3ZYLA 3JCKC 2KZTA 4YDYA 5CMWA 5ANLA 3MKRA 2BKGA 2QFCA 1Z5SC 2X6HA 4JHJA 4YNDA 3WG7E 3DSSA 4TUMA 3PNTB 2LXLA 3DPYA 1Q2ZA 3ASDA 2FI7A 2WB2A 2QYJA 1UOHA 1WG0A 4ANWA 4ATZD 2DIWA 2X6FA 4ACKA 4PDXA 3NF1A 1N95A 3L17A 2ZU6B 4HLLA 2ONDA 2OCCE 2F37A 2IU1A 3RIBA 3SD5A 2VGXA 3RK6A 1N4QA 5JJ6A 1N4RA 4U7EB 2R02A 2XPZA 2P9IG 2Y0BG 1QNFA 1IYGA 4I2ZA 3PE3A 3CQGB 4GA0A 4HFGA 2I9CA 3CVVA 5FZQA 4CCAA 4HVBA 1H0AA 3V30A 5AJDA 4WAFA 4DI4A 1H2VC 3BQOA 4N2QA 3PZ4A 3I4RB 3T8MA 1SVXA 1K1BA 4O6FA 3ZW3A 2UY1B 3FUKA 2RD0A 4FLBA 3BG1B 3KAEA 5KCMA 4A55A 4J7WA 2A4ZA 4OAUC 1LD7A 5JJTA 4WNDA 2WXFA 2ILRA 5JHAA 1NFIE 5FJYA 2VTBB 4KBQA 5ANRA 5AQBA 1EYHA 2L0IA 5LFAA 5EYPF 4G8KA 1G3NB 4C9BB 5KJLA 3HG0D 5A6CA 3ABME 2DVWA 4AIFA 4WWNA 4DLOA 1OCZE 1N54A 1OXJA 4TUUA 3B95A 2ETCA 3TJPA 1TN8A 3C3RA 1NI1A 4YDOA 2XGMA 2R5SA 4JL0A 2NSZA 5BT1A 1TR4A 4MBGA 2CFUA 2P9UG 1PAQA 1N0QA 4B8AA 4FJZA 2CG2A 3ENEA 4ANVA 2YHCA 2WQHA 1ZU2A 2UY1A 3FEYA 3FH5A 3L08A 3D9IA 4A3VA 3CEQA 3CK9A 4GMLA 4KYOB 3ASGA 3FEXA 1UG3A 2DBAA 4JPSA 5A23A 4XX5A 4CDMA 3JUEA 2R17C 3FTXA 3P2BA 5EKQD 1FCHA 1EF1C 4ANUA 1DCEA 3I4GA 3LJ3A 4PS7A 1DVPA 3S7JA 5D66A 4H7YA 1HS6A 1H2TC 3UIOC 5ARFA 1QZ2A 3HDXA 1BLXB 2X38A 3ZKJA 2WXLA 4IULA 3KD7A 5FT9A 3ZIMA 1ELRA 3LY9A 4OVUA 4LCTA 5ENNA 5LOZA 4BEPA 4Q96A 2AXVA 3FU6A 3LVRE 3AG3E 2J4BA 1HU3A 3G2TA 4GMRA 3FH8A 3FY4A 5IY5E 4DX5D 1K1AA 4LNUD 3EIQC 4EQFA 2BEDA 3RKVA 4GYWA 3WXXA 2V4LA 5CBOA 2KXPC 5CBNA 3SBTB 3D9PA 1MQSA 5ENRD 2L9BA 2IFUA 2IOSA 3IEGA 2R59A 2J8SD 4MKTA 3CGHA 5BXUA 1LF8A 1ZB1A 3PVLA 4I1MA 4BSXA 4NRHB 4LNBA 5BW8C 4JHKA 1D8EA 1IKND 2KM4A 4UQYA 3RAUA 3L82A 4GZDA 4HRMB 1TEZA 3JUIA 3ZXSA 3FU3A 4G2VA 1HXIA 4G8LA 3S2AA 1OWLA 4NURA 2CG3A 3E34A 4MS6A 5EN5D 2IONA 3TAXA 3Q4AB 1KZOA 4G25A 4HRNA 5KJKA 3G2SA 2LNIA 5FWQA 2XCCA 1VDYA 3ZXPA 3W9FA 2P58C 4LNGA 3CHRA 4I6EA 1O1TA 1WM5A 4GTRA 2WXKA 2M63A 1MJ0A 4I6JA 5D2MC 3ZHEB 2C2LA 3QARA 4DUIA 3D9KA 2NXPA 4B8CB 3U3WA 5CERB 1OCRE 1SQMA 3G2VA 2FBNA 3AJIA 1OY3D 4GTTA 4BWRA 1SZ9A 3JXJA 3Q78A 1TNUA 3HVEB 1UN8A 3Q47B 1TNOA 4URKA 4GTPA 3L9TA 5ENOD 3SFYA 5HI7A 3Q9NC 3OXFA 4FU3A 3ABKE 5CEDB 1Z3YA 4OVVA 2JABA 2P9LG 4U95D 3C5RA 4CT4A 3JYSA 5KBAA 3PUJA 3ZN3A 1RZ4A 1O1SA 4D10C 3EHRA 2Y3AA 2ZGDA 3FHEA 3QKYA 2AVPA 2FF4A 3UINC 4JW1A 2XEVA 5EYLA 1HH8A 3FTUA 4WNGA 4Y6WA 3EDTB 3AS8A 4AV7A 2OEWA 3V79K 5HS0A 2GRPB 3VTYA 3ZHEA 1DCQA 4LRZA 4BY6A 4UWKA 1FT1A 3FTZA 5AQ9A 4OAVB 4U0SA 3PZDA 4HLEA 3HXFA 3DEOA 5AYWD 3AG4E 2WXMA 1AP7A 4ABNA 1S63A 2VGYA 3BEEA 3AG1E 3GZSA 2P2CP 5CRVA 1EPUA 1RW2A 2I6HA 3RO2A 4CEMA 1U3CA 3L16A 2PNNA 2VYIA 2P9SG 2DZNA 1TYQG 3QWWA 4U8HA 4GB9A 2J09A 4ILIA 3ASOE 3I3NA 3CSFA 4IRUA 1UN9A 2GRLA 4FHKA 2HYZA 2KBXA 4EZKA 2MOWA 5EILA 3C98A 2WXRA 3UUXA 2H6FA 1IQRA 4L1BA 1L5JA 2R05A 3E30A 2RFAA 3DSVA 4O1OA 3FDHA 2WM9A 4JHRA 2GRRB 3E37A 2X6KA 3SO8A 4DPRA 2CHXA 5CCLA 3IXEA 3TWUA 3SFZA 4CZ2D 3G2WA 3CK8A 3C72A 4KMOA 1GW6A 3UIPC 4J8EA 1NA0A 4APOA 2WPVA 5FQ7A 4AY6A 2P9NG 2XPYA 3DWLG 4UI9K 4BETA 5ENPD 2DZOA 1E96B 5FQ4A 4F1SA 1E7UA 2A5EA 3QK0A 1ELKA 1PY1A 3TG4A 3EHQA 2VJ8A 4F53A 1MZCA 4BTBA 2WXPA 5T4YA 1U2VG 3Q7FA 2AXZA 3MKQA 2AXUA 3FUHA 4E6HA 1OWPA 2H6GA 4B94A 3EIJA 4U96D 2XZDG 4A1SA 3QC1A 2LUHA 4AM9A 4WUYA 4PUCA 4WWPA 2Y69E 4HB5A 2H6HA 2EINE 2FO1E 4EZLA 4JD2G 2WXHA 3QWPA 5T3RA 5JJ7A 4A1GA 2X3MA 3PUKA 3OTNA 2IO2C 4GTQA 3ASFA 3TWWA 5E75A 3URZA 5J90A 3S7BA 3CK7A 3EHNA 2GROB 5EX0A 1YYHA 4GTMA 3LPZA 4KZ0A 1JCRA 5HKPA 4J0UA 5EX3A 2PZIA 3KEZA 1YMPA 1MX2A 4JB8P 1S64A 2EIKE 2XPIA 3EUVA 3HYMB 3IHVA 1OUVA 1E90A 1HZ4A 3ABLE 1N11A 4JVSA 5JMND 1NA3A 2XCBA 4UWGA 2EQXA 4RG9A 3ML8A 3SBSA 4MLPA 4G26A 4OYSA 4KVMA 2E0IA 3D9JA 5LX8A 3QDNA 3PEUB 3LJNA 4JEUA 4UUCA 2PM6A 1FT2A 4I2WA 4U63A 2ETBA 5BPPA 4XI0A 2I2OA 1KZPA 5LP0A 3UI2A 3GZ1A 1YCSB 2KATA 1FVHA 3AS4A 4AP2A 3CSTA 1HG5A 2C0LA 3CHSA 3U66A 2J07A 4H7XA 3ESLA 3LDZA 1MHQA 2B6CA 2WMOA 2ZISA 3KS2A 4K5BA 2MRIA 4HOQA 4I9CA 1E8ZA 4DX1A 4UI9C 2L0TB 2X6JA 2KC7A 4FP7A 4HOUA 2P9KG 4XZ4A 3ONLA 2L6BA 3CHQA 3ZNGA 4G24A 2YINA 2NYJA 5ENQD 3FUMA 3QNKA 4U07A 5FQ8A 4HORA 2MHKA 3PZ3A 1Y6IA 2HM8A 4HI8A 2LAIA 1BPOA 3GZ2A 5DBKA 3AU5A 2R03A 3NB2A 4N39A 4YVOA 3UM0A 1OWNA 3Q79A 3RU0A 1YA0A 3JQ0A 1KPSB 3IKOB 1BI8B 4JA7A 4LG6A 1JPLA 2OV8A 4ILGA 2IQCA 4ZFHA 4U04A 4CGVA 2B0OE 5AIJA 2E2EA 5KJNA 4L7TA 3LY8A 4EBAG 1PC2A 3PNLB 4EECA 5CRUA 4Y6CA 3LCAA 2IJGX 3DSTA 3B7UX 3PRZA 1SA5A 5EDSA 5FINA 3SQVA 3UT8A 1JWGA 2I1JA 2WXJA 3ASNE 3FULA 1P5QA 4HI9A 1UW4B 1IHBA 2XEEA 2KCKA 4GYOA 3MV2B 3CLJA 2Y4UA 3FU0A 4N3CA 1N4SA 2QC9A 3VLEA 4GPKA 3CVQA 2F8YA 4G1TA 2WQ7A 3U9WA 5AQAA 3TL5A 3KSQA 4GYYA 3TGOA 4FADA 4AOFA 4GCOA 3DSUA 2BF0X 4O60A 4JEHA 4HOTA 5G55A 1N52A 1TN6A 2VSOE 2OVBA 2OVFA 4GZ3A 4J6IA 2WQ6A 4BT8A 3ULYA 2NC9A 3CKCA 1H6KA 1XGWA 1N9AA 3SNXA 3LY7A 2XENA 4AXHA 3FUFA 5EIBE 5ARGA 3CIAA 3HXEA 3AU4A 2WXOA 4RLYA 2GRMA 4GCNA 2PQNA 4N3AA 5ITZF 3UT4A 3ZFWA 4DRXE 4UWLA 3IBEA 2DWZA 3V2XA 4Q69A 4GZ5A 3LYAA 3UMVA 4R7LA 3CHPA 3KSLA 1H19A 2UWJG 2XRZA 4U8YD 3DXMG 3Q15A 4UQXA 3D3MA 4FHJA 4LERA 5ENSD 4J8DA 3Q5MA 2EILE 3RO3A 3B7SA 4JA9A 3IV0A 1QQEA 3DXKG 3V31A 1UJKA 4JZYA 1JWFA 3UM3A 4ZHBA 4I1OB 2AJAA 3PDNA 4BFRA 3GW4A 3LEWA 2H6IA 4BT9A 1JUQA 2ZXWE 2KCLA 3I5PA 2OOEA 3NZUA 4PH4B 4EZJA 4RSYA 4BERA 4FC8A 2PQRA 2YNQA 4WNFA 4K0RA 3LKUA
chains in the Genus database with same CATH topology
3AG4E 3ABME 1V55E 5B1BE 3WG7E 3AG3E 5B1AE 1OCZE 3ABLE 1V54E 1OCCE 1OCOE 2ZXWE 2DYSE 3AG1E 3ASOE 2Y69E 2EIJE 5IY5E 3X2QE 2EILE 2DYRE 2OCCE 2EIME 3AG2E 2EINE 3ASNE 1OCRE 2EIKE 5B3SE 3ABKE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AG4 E;  3ABM E;  1V55 E;  5B1B E;  3WG7 E;  3AG3 E;  5B1A E;  1OCZ E;  3ABL E;  1V54 E;  1OCC E;  1OCO E;  2ZXW E;  2DYS E;  3AG1 E;  3ASO E;  2Y69 E;  2EIJ E;  5IY5 E;  3X2Q E;  2EIL E;  2DYR E;  2OCC E;  2EIM E;  3AG2 E;  2EIN E;  3ASN E;  1OCR E;  2EIK E;  5B3S E;  3ABK E; 
#chains in the Genus database with same CATH topology
 5CEC B;  3SY2 A;  1BD8 A;  3PE4 A;  3OXG A;  2LSV A;  3CHM A;  3U4T A;  5G04 C;  4TRQ A;  3ZYK A;  3TWT A;  1E8X A;  1S0P A;  4UI9 J;  5BV1 A;  1IXV A;  3MV3 B;  4I9E A;  4FA6 A;  3B7T A;  2RFM A;  3UKU G;  2J08 A;  3G2U A;  3TWR A;  1IQU A;  3FTY A;  1DC2 A;  5M72 A;  4MRU A;  3Q7A A;  1O1R A;  1X81 A;  3FU5 A;  4IYP A;  4DI3 A;  3CKB A;  3QJZ A;  2R2L A;  4HS2 A;  1NZN A;  5J08 A;  1KT1 A;  3VLD A;  2RG8 A;  5CCM A;  2WVI A;  2BTD A;  3APF A;  5FTP A;  2QYU A;  3MKQ B;  3R9A B;  1Z3X A;  2DCP A;  2QZA A;  4W9R A;  1B89 A;  4IN3 B;  3IHY A;  2CFZ A;  3KEA A;  3RJV A;  3S7F A;  3QWV A;  2I1K A;  4DX2 A;  4I17 A;  1N4P A;  3D9N A;  3FTW A;  3APC A;  5KNG A;  4B0Z A;  2MYO A;  2XQ0 A;  3FUJ A;  5JA4 D;  4HBD A;  3JQ1 A;  2X6I A;  4TXQ A;  5KWD A;  1O5M A;  4UWF A;  3DEP A;  4X8Q A;  5JHB A;  2XZT G;  4DK5 A;  3U64 A;  4F1P A;  4K03 A;  3ZYM A;  4GTO A;  3NZS A;  3R7R A;  3Q73 A;  5LCW C;  2ZIR A;  3T9K A;  4CGW A;  3FWV A;  4GMJ A;  4WNE A;  5AJL A;  1HO8 A;  3CR3 A;  1TJF A;  3RRU A;  4GA2 A;  2CHZ A;  2ZGG A;  3HRA A;  4JXT A;  3LXU X;  4UWH A;  1MX6 A;  5D0Q D;  3CVN A;  2XEH A;  3BUA A;  5BUZ A;  4GZC A;  4AVX A;  4BTA A;  4ATG A;  3FH7 A;  4LSZ E;  2HR2 A;  2XGO A;  2WXG A;  3CVX A;  2YQ8 A;  3RRN B;  4DLQ A;  4XKB A;  4GPM A;  3T5X A;  4B93 B;  1IHG A;  4KZC A;  1HF8 A;  3R9M A;  4CRW A;  4B89 A;  1WAO 1;  1HG2 A;  3FUD A;  4C0E A;  3MYV A;  4F3V A;  4XE0 A;  3NOC D;  4ILH B;  2VGE A;  4XI9 A;  5A7D B;  4N3B A;  2GRN B;  3EU5 A;  1OT8 A;  3E32 A;  2OEV A;  4CT0 A;  2FEZ A;  3MEK A;  4DX7 D;  1NP7 A;  5FIO A;  2XRY A;  1X5B A;  3HHM A;  4M7C A;  1BU9 A;  4I1A A;  2F8X K;  2Y4T A;  3HIZ A;  4BX8 A;  1TNY A;  4O1P A;  4TXP A;  5CMY A;  1SA4 A;  2V8S E;  1H2U A;  4L23 A;  2PM7 A;  2LAH A;  3SI5 A;  3EHM A;  4RG6 A;  2VSY A;  3O48 A;  4TXR A;  3GYZ A;  2EIJ E;  3X2Q E;  4XIF A;  3PZ1 A;  3MA5 A;  3E4B A;  1JCQ A;  5G2N A;  4N5Q A;  1SW6 A;  3CHO A;  3LVQ E;  1DNP A;  4LEU A;  3RRM B;  1QYM A;  4C0M A;  3AAA C;  4J8F A;  4HRL A;  1HE8 A;  4DJA A;  4C48 B;  4FUL A;  4HOS A;  3T8K A;  2BUG A;  1HX8 A;  2IY0 C;  1W3B A;  3EJN A;  4FJY A;  3EU9 A;  2IOL A;  4U8V D;  5FZR A;  2VQ2 A;  4YDW A;  5G04 J;  3OAW A;  4WWO A;  1D9S A;  4QFV A;  3NBN B;  4EBA A;  4UQZ A;  3ASH A;  5DIZ A;  3SFX A;  3RSE G;  1H6O A;  3FTS A;  5G05 C;  2CHW A;  5C2Y A;  4N5C A;  4XEI G;  4Q94 A;  3ZRH A;  1OWM A;  3ZYQ A;  1OWO A;  4GU5 A;  4L2Y A;  3Q9U C;  5KJM A;  1EDU A;  4A3T A;  3F6Q A;  4JC8 A;  5BXO A;  3FFL A;  4G23 A;  3UXG A;  4KT6 B;  3SF4 A;  4N2S A;  3MZL B;  3Q49 B;  4NIK A;  1HFA A;  4J8Y A;  4YDE A;  1MX4 A;  5B3S E;  3FUN A;  1ELW A;  1WDY A;  5B1A E;  1E8Y A;  5AAO A;  1V54 E;  4EHM A;  2RKK A;  3UTM A;  2VTB A;  2EIM E;  4GAA A;  3ZPJ A;  2A5U A;  3PRE A;  1MYO A;  4HQD A;  3VLF A;  3J5Q B;  3SHF A;  3QOU A;  5HQ8 A;  2LSU A;  5KNH D;  4FLH A;  3UM1 A;  2DYS E;  1NL4 A;  3SZ7 A;  1KT0 A;  3FP3 A;  1TNB A;  1XNF A;  1N0R A;  5BV0 A;  2WXI A;  2WXN A;  2WMN A;  2HO1 A;  3BG0 B;  3VTX A;  5FZS A;  1N94 A;  1TJC A;  4L9P A;  5AEN A;  3HXD A;  3ISM C;  3P1U A;  2AWI A;  2V0P A;  3CQC B;  3HXC A;  3MGB A;  4BX9 A;  5LCW J;  4AEZ C;  4V3I A;  5T8I A;  2VSN A;  3ESK A;  3TWS A;  1Z6T A;  1INZ A;  5AQ7 A;  1ZBP A;  1LTX A;  3PH0 C;  3UKR G;  4GTS A;  3DRA A;  3MJW A;  5AN8 A;  1LD8 A;  1U3D A;  4GZ6 A;  3J5P A;  3L13 A;  5FQ6 A;  3UT7 A;  3JXI A;  3TXM A;  3B7B A;  2BKK B;  2F0Y A;  3CV0 A;  4ACL A;  2AW6 A;  5ENT D;  4PS3 A;  1D8D A;  3ULE G;  5D0O D;  3QAQ A;  4F7A A;  3ULQ A;  2PL2 A;  3FUI A;  2J4D A;  3NQP A;  3MCX A;  2GGF A;  3AS5 A;  1AWC B;  4ME2 A;  4AJW A;  3ZUV B;  3MX3 A;  2VSX E;  1OCC E;  3QB2 A;  1OCO E;  3T5V A;  4KVO A;  2JEK A;  5BNW A;  3TXN A;  3DPD A;  2IF4 A;  3C3O A;  4A63 B;  2KCV A;  2IEJ A;  3PZ2 A;  4G11 A;  2GW1 A;  4F6R D;  3ZU7 B;  1S70 B;  4CYM D;  1TN7 A;  3C3Q A;  1FPP A;  3B7R L;  3R7Q A;  2IO3 C;  1Y8M A;  2DYR E;  2J9Q A;  2J49 A;  1E7V A;  3HXB A;  3V2O A;  4QQI A;  4HXI A;  4AY5 A;  1A17 A;  2FUL A;  2Y1L E;  4M3O A;  5B1B E;  3E33 A;  3OXL A;  2JLB A;  3L22 A;  2GRQ B;  3N71 A;  3D9M A;  3TWX A;  1BI7 B;  4RVB A;  2XS1 A;  1KLX A;  3D9H A;  4TV3 A;  3NAW A;  2V4H C;  2L6J A;  3ML9 A;  3L54 A;  4ANX A;  2YHE A;  1QBQ A;  2V5Q C;  2HE0 A;  4EPZ A;  2XHE A;  3B13 A;  4GA1 A;  4K5A B;  5H7P A;  5C1D A;  2ETA A;  2C0M A;  3L6A A;  3DSW A;  3ZEF A;  3K9I A;  1A5E A;  4L2L A;  4Z68 A;  2FO7 A;  4P29 A;  5HRY A;  5G05 J;  4E85 A;  4CDN A;  3O4Z A;  2XGS A;  3S7D A;  5EID A;  3D9L A;  1JCS A;  3LS8 A;  3ONK A;  3D9O A;  3UM2 A;  3FUE A;  3TG5 A;  4GTV A;  2QY7 A;  4U0Z A;  4I43 A;  3HVE A;  4U0U A;  4BSZ B;  4LUN U;  2V5F A;  3CVU A;  1SZA A;  1FVF A;  5E76 A;  3FTV A;  4KXK B;  4RQI A;  3UPV A;  2KZT B;  1H6P A;  3SGH A;  3UX4 A;  3TWQ A;  4YVQ C;  3UQ3 A;  1TNZ A;  3DSX A;  4I6G A;  3TWV A;  4NQ0 A;  2LO6 A;  3CVW A;  4K5C A;  4HNA D;  3ZGQ A;  3BU8 A;  5CHE E;  3Q75 A;  3APD A;  1WY6 A;  4NAC A;  2P9P G;  2XS8 A;  3CVL A;  1E8W A;  1K8K G;  1UJJ A;  4BES A;  2Q7F A;  2WXQ A;  4CDR A;  3PS6 A;  3ZVV A;  2VGX B;  4PS8 A;  4APF A;  3CVY A;  5CEA A;  3CVP A;  5AAR A;  1K3Z D;  2LXM A;  3NOG D;  4XKC A;  1V55 E;  3DBS A;  3PEV B;  4DX6 D;  3W9G A;  3AG2 E;  4J8S A;  3ZYL A;  3JCK C;  2KZT A;  4YDY A;  5CMW A;  5ANL A;  3MKR A;  2BKG A;  2QFC A;  1Z5S C;  2X6H A;  4JHJ A;  4YND A;  3WG7 E;  3DSS A;  4TUM A;  3PNT B;  2LXL A;  3DPY A;  1Q2Z A;  3ASD A;  2FI7 A;  2WB2 A;  2QYJ A;  1UOH A;  1WG0 A;  4ANW A;  4ATZ D;  2DIW A;  2X6F A;  4ACK A;  4PDX A;  3NF1 A;  1N95 A;  3L17 A;  2ZU6 B;  4HLL A;  2OND A;  2OCC E;  2F37 A;  2IU1 A;  3RIB A;  3SD5 A;  2VGX A;  3RK6 A;  1N4Q A;  5JJ6 A;  1N4R A;  4U7E B;  2R02 A;  2XPZ A;  2P9I G;  2Y0B G;  1QNF A;  1IYG A;  4I2Z A;  3PE3 A;  3CQG B;  4GA0 A;  4HFG A;  2I9C A;  3CVV A;  5FZQ A;  4CCA A;  4HVB A;  1H0A A;  3V30 A;  5AJD A;  4WAF A;  4DI4 A;  1H2V C;  3BQO A;  4N2Q A;  3PZ4 A;  3I4R B;  3T8M A;  1SVX A;  1K1B A;  4O6F A;  3ZW3 A;  2UY1 B;  3FUK A;  2RD0 A;  4FLB A;  3BG1 B;  3KAE A;  5KCM A;  4A55 A;  4J7W A;  2A4Z A;  4OAU C;  1LD7 A;  5JJT A;  4WND A;  2WXF A;  2ILR A;  5JHA A;  1NFI E;  5FJY A;  2VTB B;  4KBQ A;  5ANR A;  5AQB A;  1EYH A;  2L0I A;  5LFA A;  5EYP F;  4G8K A;  1G3N B;  4C9B B;  5KJL A;  3HG0 D;  5A6C A;  3ABM E;  2DVW A;  4AIF A;  4WWN A;  4DLO A;  1OCZ E;  1N54 A;  1OXJ A;  4TUU A;  3B95 A;  2ETC A;  3TJP A;  1TN8 A;  3C3R A;  1NI1 A;  4YDO A;  2XGM A;  2R5S A;  4JL0 A;  2NSZ A;  5BT1 A;  1TR4 A;  4MBG A;  2CFU A;  2P9U G;  1PAQ A;  1N0Q A;  4B8A A;  4FJZ A;  2CG2 A;  3ENE A;  4ANV A;  2YHC A;  2WQH A;  1ZU2 A;  2UY1 A;  3FEY A;  3FH5 A;  3L08 A;  3D9I A;  4A3V A;  3CEQ A;  3CK9 A;  4GML A;  4KYO B;  3ASG A;  3FEX A;  1UG3 A;  2DBA A;  4JPS A;  5A23 A;  4XX5 A;  4CDM A;  3JUE A;  2R17 C;  3FTX A;  3P2B A;  5EKQ D;  1FCH A;  1EF1 C;  4ANU A;  1DCE A;  3I4G A;  3LJ3 A;  4PS7 A;  1DVP A;  3S7J A;  5D66 A;  4H7Y A;  1HS6 A;  1H2T C;  3UIO C;  5ARF A;  1QZ2 A;  3HDX A;  1BLX B;  2X38 A;  3ZKJ A;  2WXL A;  4IUL A;  3KD7 A;  5FT9 A;  3ZIM A;  1ELR A;  3LY9 A;  4OVU A;  4LCT A;  5ENN A;  5LOZ A;  4BEP A;  4Q96 A;  2AXV A;  3FU6 A;  3LVR E;  3AG3 E;  2J4B A;  1HU3 A;  3G2T A;  4GMR A;  3FH8 A;  3FY4 A;  5IY5 E;  4DX5 D;  1K1A A;  4LNU D;  3EIQ C;  4EQF A;  2BED A;  3RKV A;  4GYW A;  3WXX A;  2V4L A;  5CBO A;  2KXP C;  5CBN A;  3SBT B;  3D9P A;  1MQS A;  5ENR D;  2L9B A;  2IFU A;  2IOS A;  3IEG A;  2R59 A;  2J8S D;  4MKT A;  3CGH A;  5BXU A;  1LF8 A;  1ZB1 A;  3PVL A;  4I1M A;  4BSX A;  4NRH B;  4LNB A;  5BW8 C;  4JHK A;  1D8E A;  1IKN D;  2KM4 A;  4UQY A;  3RAU A;  3L82 A;  4GZD A;  4HRM B;  1TEZ A;  3JUI A;  3ZXS A;  3FU3 A;  4G2V A;  1HXI A;  4G8L A;  3S2A A;  1OWL A;  4NUR A;  2CG3 A;  3E34 A;  4MS6 A;  5EN5 D;  2ION A;  3TAX A;  3Q4A B;  1KZO A;  4G25 A;  4HRN A;  5KJK A;  3G2S A;  2LNI A;  5FWQ A;  2XCC A;  1VDY A;  3ZXP A;  3W9F A;  2P58 C;  4LNG A;  3CHR A;  4I6E A;  1O1T A;  1WM5 A;  4GTR A;  2WXK A;  2M63 A;  1MJ0 A;  4I6J A;  5D2M C;  3ZHE B;  2C2L A;  3QAR A;  4DUI A;  3D9K A;  2NXP A;  4B8C B;  3U3W A;  5CER B;  1OCR E;  1SQM A;  3G2V A;  2FBN A;  3AJI A;  1OY3 D;  4GTT A;  4BWR A;  1SZ9 A;  3JXJ A;  3Q78 A;  1TNU A;  3HVE B;  1UN8 A;  3Q47 B;  1TNO A;  4URK A;  4GTP A;  3L9T A;  5ENO D;  3SFY A;  5HI7 A;  3Q9N C;  3OXF A;  4FU3 A;  3ABK E;  5CED B;  1Z3Y A;  4OVV A;  2JAB A;  2P9L G;  4U95 D;  3C5R A;  4CT4 A;  3JYS A;  5KBA A;  3PUJ A;  3ZN3 A;  1RZ4 A;  1O1S A;  4D10 C;  3EHR A;  2Y3A A;  2ZGD A;  3FHE A;  3QKY A;  2AVP A;  2FF4 A;  3UIN C;  4JW1 A;  2XEV A;  5EYL A;  1HH8 A;  3FTU A;  4WNG A;  4Y6W A;  3EDT B;  3AS8 A;  4AV7 A;  2OEW A;  3V79 K;  5HS0 A;  2GRP B;  3VTY A;  3ZHE A;  1DCQ A;  4LRZ A;  4BY6 A;  4UWK A;  1FT1 A;  3FTZ A;  5AQ9 A;  4OAV B;  4U0S A;  3PZD A;  4HLE A;  3HXF A;  3DEO A;  5AYW D;  3AG4 E;  2WXM A;  1AP7 A;  4ABN A;  1S63 A;  2VGY A;  3BEE A;  3AG1 E;  3GZS A;  2P2C P;  5CRV A;  1EPU A;  1RW2 A;  2I6H A;  3RO2 A;  4CEM A;  1U3C A;  3L16 A;  2PNN A;  2VYI A;  2P9S G;  2DZN A;  1TYQ G;  3QWW A;  4U8H A;  4GB9 A;  2J09 A;  4ILI A;  3ASO E;  3I3N A;  3CSF A;  4IRU A;  1UN9 A;  2GRL A;  4FHK A;  2HYZ A;  2KBX A;  4EZK A;  2MOW A;  5EIL A;  3C98 A;  2WXR A;  3UUX A;  2H6F A;  1IQR A;  4L1B A;  1L5J A;  2R05 A;  3E30 A;  2RFA A;  3DSV A;  4O1O A;  3FDH A;  2WM9 A;  4JHR A;  2GRR B;  3E37 A;  2X6K A;  3SO8 A;  4DPR A;  2CHX A;  5CCL A;  3IXE A;  3TWU A;  3SFZ A;  4CZ2 D;  3G2W A;  3CK8 A;  3C72 A;  4KMO A;  1GW6 A;  3UIP C;  4J8E A;  1NA0 A;  4APO A;  2WPV A;  5FQ7 A;  4AY6 A;  2P9N G;  2XPY A;  3DWL G;  4UI9 K;  4BET A;  5ENP D;  2DZO A;  1E96 B;  5FQ4 A;  4F1S A;  1E7U A;  2A5E A;  3QK0 A;  1ELK A;  1PY1 A;  3TG4 A;  3EHQ A;  2VJ8 A;  4F53 A;  1MZC A;  4BTB A;  2WXP A;  5T4Y A;  1U2V G;  3Q7F A;  2AXZ A;  3MKQ A;  2AXU A;  3FUH A;  4E6H A;  1OWP A;  2H6G A;  4B94 A;  3EIJ A;  4U96 D;  2XZD G;  4A1S A;  3QC1 A;  2LUH A;  4AM9 A;  4WUY A;  4PUC A;  4WWP A;  2Y69 E;  4HB5 A;  2H6H A;  2EIN E;  2FO1 E;  4EZL A;  4JD2 G;  2WXH A;  3QWP A;  5T3R A;  5JJ7 A;  4A1G A;  2X3M A;  3PUK A;  3OTN A;  2IO2 C;  4GTQ A;  3ASF A;  3TWW A;  5E75 A;  3URZ A;  5J90 A;  3S7B A;  3CK7 A;  3EHN A;  2GRO B;  5EX0 A;  1YYH A;  4GTM A;  3LPZ A;  4KZ0 A;  1JCR A;  5HKP A;  4J0U A;  5EX3 A;  2PZI A;  3KEZ A;  1YMP A;  1MX2 A;  4JB8 P;  1S64 A;  2EIK E;  2XPI A;  3EUV A;  3HYM B;  3IHV A;  1OUV A;  1E90 A;  1HZ4 A;  3ABL E;  1N11 A;  4JVS A;  5JMN D;  1NA3 A;  2XCB A;  4UWG A;  2EQX A;  4RG9 A;  3ML8 A;  3SBS A;  4MLP A;  4G26 A;  4OYS A;  4KVM A;  2E0I A;  3D9J A;  5LX8 A;  3QDN A;  3PEU B;  3LJN A;  4JEU A;  4UUC A;  2PM6 A;  1FT2 A;  4I2W A;  4U63 A;  2ETB A;  5BPP A;  4XI0 A;  2I2O A;  1KZP A;  5LP0 A;  3UI2 A;  3GZ1 A;  1YCS B;  2KAT A;  1FVH A;  3AS4 A;  4AP2 A;  3CST A;  1HG5 A;  2C0L A;  3CHS A;  3U66 A;  2J07 A;  4H7X A;  3ESL A;  3LDZ A;  1MHQ A;  2B6C A;  2WMO A;  2ZIS A;  3KS2 A;  4K5B A;  2MRI A;  4HOQ A;  4I9C A;  1E8Z A;  4DX1 A;  4UI9 C;  2L0T B;  2X6J A;  2KC7 A;  4FP7 A;  4HOU A;  2P9K G;  4XZ4 A;  3ONL A;  2L6B A;  3CHQ A;  3ZNG A;  4G24 A;  2YIN A;  2NYJ A;  5ENQ D;  3FUM A;  3QNK A;  4U07 A;  5FQ8 A;  4HOR A;  2MHK A;  3PZ3 A;  1Y6I A;  2HM8 A;  4HI8 A;  2LAI A;  1BPO A;  3GZ2 A;  5DBK A;  3AU5 A;  2R03 A;  3NB2 A;  4N39 A;  4YVO A;  3UM0 A;  1OWN A;  3Q79 A;  3RU0 A;  1YA0 A;  3JQ0 A;  1KPS B;  3IKO B;  1BI8 B;  4JA7 A;  4LG6 A;  1JPL A;  2OV8 A;  4ILG A;  2IQC A;  4ZFH A;  4U04 A;  4CGV A;  2B0O E;  5AIJ A;  2E2E A;  5KJN A;  4L7T A;  3LY8 A;  4EBA G;  1PC2 A;  3PNL B;  4EEC A;  5CRU A;  4Y6C A;  3LCA A;  2IJG X;  3DST A;  3B7U X;  3PRZ A;  1SA5 A;  5EDS A;  5FIN A;  3SQV A;  3UT8 A;  1JWG A;  2I1J A;  2WXJ A;  3ASN E;  3FUL A;  1P5Q A;  4HI9 A;  1UW4 B;  1IHB A;  2XEE A;  2KCK A;  4GYO A;  3MV2 B;  3CLJ A;  2Y4U A;  3FU0 A;  4N3C A;  1N4S A;  2QC9 A;  3VLE A;  4GPK A;  3CVQ A;  2F8Y A;  4G1T A;  2WQ7 A;  3U9W A;  5AQA A;  3TL5 A;  3KSQ A;  4GYY A;  3TGO A;  4FAD A;  4AOF A;  4GCO A;  3DSU A;  2BF0 X;  4O60 A;  4JEH A;  4HOT A;  5G55 A;  1N52 A;  1TN6 A;  2VSO E;  2OVB A;  2OVF A;  4GZ3 A;  4J6I A;  2WQ6 A;  4BT8 A;  3ULY A;  2NC9 A;  3CKC A;  1H6K A;  1XGW A;  1N9A A;  3SNX A;  3LY7 A;  2XEN A;  4AXH A;  3FUF A;  5EIB E;  5ARG A;  3CIA A;  3HXE A;  3AU4 A;  2WXO A;  4RLY A;  2GRM A;  4GCN A;  2PQN A;  4N3A A;  5ITZ F;  3UT4 A;  3ZFW A;  4DRX E;  4UWL A;  3IBE A;  2DWZ A;  3V2X A;  4Q69 A;  4GZ5 A;  3LYA A;  3UMV A;  4R7L A;  3CHP A;  3KSL A;  1H19 A;  2UWJ G;  2XRZ A;  4U8Y D;  3DXM G;  3Q15 A;  4UQX A;  3D3M A;  4FHJ A;  4LER A;  5ENS D;  4J8D A;  3Q5M A;  2EIL E;  3RO3 A;  3B7S A;  4JA9 A;  3IV0 A;  1QQE A;  3DXK G;  3V31 A;  1UJK A;  4JZY A;  1JWF A;  3UM3 A;  4ZHB A;  4I1O B;  2AJA A;  3PDN A;  4BFR A;  3GW4 A;  3LEW A;  2H6I A;  4BT9 A;  1JUQ A;  2ZXW E;  2KCL A;  3I5P A;  2OOE A;  3NZU A;  4PH4 B;  4EZJ A;  4RSY A;  4BER A;  4FC8 A;  2PQR A;  2YNQ A;  4WNF A;  4K0R A;  3LKU A; 
#chains in the Genus database with same CATH homology
 3AG4 E;  3ABM E;  1V55 E;  5B1B E;  3WG7 E;  3AG3 E;  5B1A E;  1OCZ E;  3ABL E;  1V54 E;  1OCC E;  1OCO E;  2ZXW E;  2DYS E;  3AG1 E;  3ASO E;  2Y69 E;  2EIJ E;  5IY5 E;  3X2Q E;  2EIL E;  2DYR E;  2OCC E;  2EIM E;  3AG2 E;  2EIN E;  3ASN E;  1OCR E;  2EIK E;  5B3S E;  3ABK E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...