1V54E

Bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase polypeptide I
publication title The low-spin heme of cytochrome c oxidase as the driving element of the proton-pumping process.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 40
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 1v54E00
3AG2E 3AG3E 2DYRE 2EILE 3ABME 1V54E 3X2QE 1OCRE 2EIME 1OCCE 3ASNE 2OCCE 5B1AE 2EIKE 3AG4E 5IY5E 2DYSE 1OCOE 3AG1E 3ABKE 3WG7E 2EIJE 5B1BE 1V55E 5B3SE 3ABLE 2EINE 2ZXWE 1OCZE 3ASOE 2Y69E
chains in the Genus database with same CATH superfamily
2R5SA 2IOSA 2HO1A 4GB9A 2HR2A 2KBXA 3ABME 3MJWA 3FUHA 4M7CA 5BPPA 1N4RA 1N4QA 4A1SA 4P29A 2R03A 2XCCA 2J4DA 1IXVA 4PS3A 3ASHA 4GYOA 4HVBA 3ONLA 2ILRA 4HB5A 2GRLA 4JXTA 3AU5A 4AP2A 2DZNA 3SO8A 2BF0X 3PZ2A 5JJTA 3L54A 1FCHA 2AXVA 2PQNA 1HO8A 4XEIG 4BFRA 3CKBA 4GCOA 4YDWA 3JXJA 4F1SA 2VJ8A 4J7WA 1DVPA 3U64A 4K5BA 1OCOE 5ANRA 4OYSA 4LNBA 3VLEA 4KYOB 5FQ4A 2F8XK 4I6EA 1N4PA 5EKQD 3FUJA 4KBQA 4ACKA 3CHSA 4AY6A 3CVWA 4UI9J 4K5CA 3CLJA 3T8KA 4F53A 4I9CA 3Q9NC 1YYHA 4HNAD 4K0RA 3CGHA 4O6FA 3AS5A 3ML9A 2A5EA 2OEWA 2QYUA 1MQSA 2JEKA 3VLDA 1QBQA 2IO3C 1IQRA 3E4BA 1Z6TA 2UY1A 2F8YA 5M72A 2ZISA 1XNFA 2KC7A 3PZDA 2I6HA 3CQCB 2Q7FA 5CERB 2FO7A 3PH0C 2CG2A 3TAXA 4WNGA 1N54A 3TWUA 3G2WA 4J0UA 1TJCA 3FH7A 3ZYMA 1OCZE 3DSSA 3ZNGA 5KJNA 2XPYA 2FULA 4AXHA 2VGEA 3ESLA 4BT8A 3D9MA 1K1AA 3DSXA 4A3TA 5D66A 3SNXA 2KZTB 2ETAA 4EQFA 3CK9A 3B13A 5CCLA 3E33A 3BUAA 2E2EA 2FI7A 3LXUX 4WNDA 3P1UA 1FT2A 5JA4D 2BEDA 2KCLA 3PZ3A 1H6OA 1SZ9A 2MYOA 2L6BA 4OAUC 4DX7D 2WVIA 4N5QA 3HIZA 5AIJA 4EZLA 2ZGGA 1WDYA 3PZ4A 1D8EA 1H2UA 4L1BA 2V4LA 3ISMC 4HQDA 1HF8A 4U96D 3QKYA 4APFA 3UKRG 2C0MA 3L6AA 4U07A 4I43A 4FJYA 1HG5A 3V31A 3PE3A 3W9FA 4XE0A 3KSLA 4GPKA 3B7BA 1A5EA 4NIKA 1QNFA 4JA7A 4DJAA 5ENPD 2DWZA 2YINA 2MOWA 3CVLA 3U66A 4BEPA 3OXLA 4CDNA 1WG0A 4YVQC 3CK7A 3G2UA 4U8VD 2WM9A 4AVXA 1JCSA 3L9TA 1SVXA 4AEZC 2F0YA 2CHXA 3Q4AB 4JB8P 1UG3A 5LCWJ 5T4YA 3FWVA 1ELWA 4HOTA 3MEKA 4Q69A 2PQRA 1S63A 1ZU2A 4M3OA 4U0SA 2AXUA 3EIJA 2RFMA 3HHMA 4NACA 4J8FA 4GAAA 3TWRA 3QWWA 5A7DB 1JCQA 3ASFA 1HH8A 2WXOA 5G2NA 2ZXWE 4FC8A 3S7DA 5C2YA 2PM6A 3Q7AA 1OWLA 2Y0BG 1TEZA 3LJNA 2P9UG 4G26A 3L22A 3B7TA 2CFZA 3NAWA 4U7EB 4LEUA 4PH4B 3CR3A 2MRIA 1UN8A 1NL4A 5JMND 4BY6A 5BUZA 3MYVA 3MZLB 2J49A 4BTBA 3MCXA 1H6KA 4RG9A 3I3NA 2HM8A 5G05C 4AIFA 3RSEG 1IQUA 3UKUG 4G8KA 3O4ZA 1NZNA 5BV0A 4I9EA 3NOGD 4WNFA 5ARGA 5DIZA 4HFGA 3NQPA 2PNNA 3G2VA 4HOSA 3QDNA 2R02A 4GTTA 4UQXA 3UINC 3FUDA 2IFUA 4I6JA 4ILHB 3FTZA 1W3BA 5LP0A 1HS6A 2AW6A 4HLEA 1N4SA 3UM0A 3JXIA 3SI5A 4FHKA 4IULA 1H2TC 3UI2A 1V54E 3KS2A 2LXLA 2Y3AA 1RZ4A 4LERA 1Q2ZA 5B1AE 1N11A 3UT7A 4LNUD 4YVOA 5KCMA 2WXHA 2R59A 5CBNA 2FO1E 1NI1A 4QQIA 4V3IA 4WUYA 4UWLA 1OXJA 1ELRA 4U0ZA 4DK5A 3UIOC 4NQ0A 3TL5A 3PUJA 4WNEA 3PEUB 1K1BA 5CRUA 1A17A 1OWPA 3S2AA 3W9GA 1O1TA 3QOUA 1PY1A 2LNIA 4GZDA 4J8YA 4F3VA 3UUXA 2XCBA 5D0OD 4DI4A 4KVOA 4AM9A 2VGXB 3KAEA 3HVEA 2WMOA 2OEVA 3DXKG 1SQMA 4GTQA 4ANWA 4IRUA 3CEQA 4B94A 3FY4A 3NZSA 3CVUA 3DPDA 1Z3XA 5EIBE 3ZN3A 1TN7A 4YDOA 2J9QA 4B0ZA 1EPUA 3SD5A 2E0IA 2L0TB 5EX0A 5KNGA 3ZFWA 3ZRHA 4A63B 2XGOA 4N3CA 2HE0A 3AU4A 3FU6A 2DIWA 1KLXA 3SBTB 4O1OA 3AS8A 4TRQA 4ILIA 3MV3B 4I2WA 3AAAC 1K8KG 2ZU6B 3NF1A 3J5PA 4GA0A 3GZ1A 4FULA 3SY2A 4HBDA 2L6JA 3NOCD 1BLXB 2VTBB 2NSZA 4TXPA 2WXKA 3VTXA 5B3SE 1OY3D 1TN6A 3ASOE 5AJLA 3SBSA 3TWVA 3ZEFA 3EJNA 3QARA 1IKND 2RD0A 3MKRA 3MA5A 1AP7A 2QY7A 3ULYA 4KVMA 4NRHB 2GRMA 3FP3A 3DWLG 4IYPA 4DX1A 4KXKB 3S7BA 4Q94A 4IN3B 3J5QB 3HYMB 4YDYA 3R7RA 3PUKA 4GTSA 1AWCB 3WG7E 2VSYA 4W9RA 5BNWA 5AN8A 1N9AA 4EPZA 4H7XA 2WXQA 1N94A 4U04A 2DYRE 3ZHEA 3FDHA 4GTOA 3S7JA 4DX5D 4E6HA 2NYJA 2H6IA 5BT1A 3FUFA 5ENNA 2IU1A 4HOUA 2JABA 4JD2G 1FVHA 3LPZA 5FINA 3IV0A 1D9SA 2EILE 2B6CA 2RG8A 4FHJA 5EX3A 2EIME 3RO2A 4AOFA 2QC9A 2XHEA 4JA9A 4UWFA 2V4HC 5EYPF 2WB2A 2XENA 4JHJA 4J6IA 2LAHA 5EIDA 4EZJA 4A1GA 3ASDA 1TYQG 2B0OE 4XZ4A 4GTRA 3D9IA 2QYJA 4ATGA 4A55A 4O1PA 5BXOA 5J08A 1TR4A 3Q15A 4E85A 2IOLA 3RRUA 3MKQA 4TXQA 3CKCA 1INZA 1HG2A 2GGFA 3PREA 3Q7FA 2LXMA 5CBOA 3Q49B 3TWXA 2PZIA 2OCCE 2DCPA 2H6HA 4TUMA 5KJKA 3ULQA 4BESA 2Y4UA 3PNTB 1NA0A 2UY1B 2GRPB 3L16A 1H19A 4ILGA 2XQ0A 5EYLA 4CGWA 3CVPA 2WXMA 5AARA 3E30A 4G11A 4PS8A 2VSOE 4G8LA 3CK8A 4XIFA 1HXIA 4WAFA 1IYGA 4F7AA 1ZBPA 1N52A 2XGSA 1E90A 1E8WA 5BV1A 5FIOA 1MZCA 4C48B 3FUIA 4FJZA 3BEEA 3S7FA 4AY5A 2WQ6A 2EIKE 4U63A 2X6HA 1PAQA 4JL0A 4OAVB 3BU8A 4UI9K 4WWNA 2LUHA 3RIBA 3U3WA 4JW1A 3EUVA 2VQ2A 2BKKB 2L9BA 3DEOA 1KPSB 3CVQA 5KJMA 5E75A 5FQ6A 2V8SE 1OCRE 3BQOA 3R9AB 5EN5D 5AQ9A 4ZHBA 4GTVA 3CHPA 3RRNB 3CIAA 2V5QC 3IBEA 2WQHA 3DSWA 3GZSA 4FU3A 3SGHA 4UUCA 3ONKA 1UOHA 5G05J 3NZUA 4G1TA 1E7UA 1MX6A 4GMLA 4ANVA 3G2TA 4R7LA 4JHRA 3Q78A 2P9NG 2XEHA 4WWPA 2R17C 4I1OB 4HRMB 3LVQE 4ME2A 2XRZA 2KCKA 1UN9A 1Z5SC 4EBAG 3LS8A 4TXRA 4DUIA 1WY6A 4CCAA 4CYMD 4EZKA 4RSYA 2WXLA 3LY8A 5JHAA 3LCAA 1NA3A 3R9MA 5ENTD 3ULEG 4LCTA 1DCQA 5KWDA 1TNBA 3TWSA 5JHBA 4MRUA 2WXFA 3KD7A 4CZ2D 3UIPC 4D10C 2QZAA 4ABNA 4JEHA 3IHYA 2X3MA 4G2VA 3PNLB 3SQVA 2VSNA 4LUNU 3SFZA 1N0QA 1UJJA 1HX8A 4J8SA 4BWRA 1ZB1A 3D9NA 3HRAA 4GMJA 3L08A 4GPMA 4EBAA 1EYHA 3ZYLA 1OWNA 3UM3A 4FA6A 4U0UA 4A3VA 4GZ5A 4JZYA 3UTMA 2J09A 3ENEA 3GZ2A 3X2QE 4ACLA 2H6GA 3E34A 5T3RA 4C0EA 2WXGA 2OVFA 5H7PA 3FFLA 4GTMA 3C98A 5FJYA 2IF4A 3B95A 3QWPA 3RAUA 2BTDA 5FT9A 4BTAA 3EDTB 5EDSA 2NC9A 3G2SA 3TWWA 3D9PA 2CG3A 3QC1A 2XGMA 5LOZA 4GTPA 2AJAA 4F6RD 3D9HA 2WXJA 3Q5MA 4DRXE 4Q96A 4KT6B 2DBAA 1TNYA 1V55E 3D9OA 1FT1A 2ETCA 1HZ4A 1ELKA 4Y6WA 2MHKA 2CHWA 3CVYA 4AV7A 3FHEA 1OWMA 2YHCA 5KJLA 3HXDA 3QJZA 5B1BE 5T8IA 3FTXA 4I1AA 4TV3A 3EU5A 3EHMA 1BD8A 3OTNA 2J8SD 1HFAA 4PUCA 1Y6IA 4UQYA 2R2LA 4JC8A 2P2CP 2FBNA 3K9IA 3I5PA 3IKOB 5AQBA 3Q79A 2OOEA 1S0PA 3KSQA 5AENA 1KZOA 4PS7A 1RW2A 2GW1A 4UWGA 2J08A 5J90A 1L5JA 3EIQC 2X6IA 4L23A 5CEAA 2YNQA 4CT0A 2V5FA 4AJWA 2XZTG 3Q9UC 4GCNA 5G55A 2WQ7A 3IXEA 2PM7A 1BU9A 4N39A 5LFAA 4C9BB 1LF8A 4FLHA 2WXPA 3DPYA 4GMRA 1OCCE 3FTWA 2VTBA 4MLPA 2XS1A 4FADA 1PC2A 3C5RA 3HVEB 4U95D 3LVRE 3EU9A 3WXXA 2X38A 1E8YA 2WXRA 5CMWA 5AYWD 1Z3YA 1WAO1 4GU5A 2BUGA 1BI8B 4KZCA 4N3AA 4LG6A 4OVVA 3JQ1A 4XKCA 4L7TA 2R05A 3SF4A 1JCRA 3D3MA 5KBAA 1N95A 5HI7A 2AVPA 5G04C 3OAWA 2JLBA 4GA1A 2GRQB 2V0PA 3AJIA 4FP7A 1SZAA 3FUKA 4HLLA 4XKBA 5FQ7A 5JJ7A 3LJ3A 4JHKA 4XI0A 1VDYA 2I2OA 3U4TA 3QB2A 1NFIE 1O1SA 3HXBA 3PE4A 5DBKA 4F1PA 4DX6D 4BSXA 2OV8A 3HDXA 1QYMA 2P9LG 3CHMA 1TNUA 2ZIRA 3LYAA 1KZPA 3V30A 1LTXA 4G25A 1TNOA 3SHFA 3MX3A 5CEDB 2PL2A 5CMYA 5ENRD 2FF4A 2VYIA 3DSTA 5ARFA 2IONA 2XS8A 2FEZA 1IHGA 4LNGA 4JPSA 3U9WA 2Y4TA 5AAOA 3CQGB 5D2MC 4HI9A 1KT0A 1E8ZA 2IQCA 3BG1B 2P58C 3TGOA 4EHMA 3CHRA 4MS6A 2J4BA 4BT9A 2CHZA 2Y69E 3FH5A 1GW6A 3HXEA 3SFXA 3ZXSA 3FEXA 2GRRB 3UPVA 1TNZA 2AWIA 3SZ7A 3UXGA 2A5UA 3ZHEB 2KZTA 3ZXPA 4HI8A 4X8QA 2LSUA 3TWQA 3FUMA 3CSTA 1JWGA 2CFUA 4N5CA 1UW4B 2XEVA 5HS0A 4U8HA 3UX4A 3ZYQA 4MBGA 1YA0A 2RFAA 2HYZA 3Q75A 2VSXE 4CGVA 1Y8MA 5JJ6A 4BETA 3SFYA 3PDNA 1D8DA 1FVFA 4KZ0A 3LDZA 3KEZA 5EILA 4HS2A 2XPIA 3B7UX 1U2VG 5FZRA 1LD8A 1DCEA 5KNHD 3FU5A 4GYWA 3JCKC 4JVSA 2XEEA 5ITZF 3UM1A 4PDXA 3C3RA 1BI7B 1X81A 3UMVA 3V79K 1QQEA 3KEAA 2KATA 4J8EA 3MV2B 5E76A 5CHEE 4YNDA 4BX8A 3AG1E 4RLYA 3TWTA 1YMPA 4HRLA 2LAIA 3FTUA 4UI9C 4CRWA 3FH8A 3V2XA 3I4GA 4K5AB 3MKQB 4Z68A 1EF1C 1OT8A 3V2OA 4N2QA 1MYOA 3D9LA 1JUQA 4N3BA 3HG0D 3TXNA 1KT1A 2A4ZA 1HU3A 4J8DA 4GYYA 2XZDG 4LRZA 3Q47B 4UWHA 3UT4A 5AJDA 2Y1LE 1NP7A 4CT4A 3OXGA 1U3DA 5ANLA 3RO3A 3I4RB 2KXPC 4Y6CA 3CSFA 3UM2A 3E32A 4DLOA 4ZFHA 5D0QD 4URKA 4C0MA 3QWVA 5ENSD 3B7RL 3APDA 3Q73A 2F37A 2M63A 3RK6A 3ASGA 4CDMA 3AG2E 3CHQA 4XX5A 5FZQA 3QAQA 4RG6A 4YDEA 1E8XA 3FULA 1X5BA 2P9KG 3D9JA 3ESKA 5FQ8A 3DEPA 4QFVA 2WPVA 5AQAA 5HRYA 4G24A 3FUEA 4RQIA 4L2LA 3R7QA 3BG0B 3TJPA 3ZPJA 1JWFA 3GYZA 3L82A 4BX9A 2C0LA 4ANUA 4CDRA 3MGBA 3FTSA 4NURA 2ZGDA 3C72A 1H6PA 3LEWA 4GZ3A 1MX2A 1OWOA 2I9CA 5CRVA 2RKKA 3JQ0A 1MJ0A 1S64A 3EHRA 3APFA 3IEGA 3DXMG 4TUUA 2WXIA 3LY7A 2P9SG 3NBNB 4CEMA 4MKTA 1P5QA 4HXIA 4DX2A 1E7VA 3FTVA 1G3NB 3CHOA 4N2SA 3CV0A 4L9PA 1B89A 3RRMB 4DI3A 2DZOA 3ZUVB 5LX8A 2L0IA 3C3OA 2YQ8A 2BKGA 2IO2C 2H6FA 3C3QA 2LSVA 4BERA 5HQ8A 3OXFA 3ASNE 4I2ZA 3DSVA 5FTPA 3RKVA 5IY5E 2YHEA 3AS4A 4GA2A 3PS6A 1TN8A 4ANXA 1E96B 2XPZA 3PRZA 3P2BA 2EINE 5A6CA 1IHBA 2IY0C 1JPLA 3JUEA 4BSZB 4DLQA 3FTYA 4B89A 3DBSA 1SA4A 4HRNA 2IJGX 2P9IG 3ZIMA 3JYSA 3ML8A 4B93B 4HORA 4WWOA 3TG5A 2EIJE 1K3ZD 4HOQA 3T5XA 5FWQA 4APOA 3DRAA 3ABLE 4UWKA 1UJKA 5LCWC 2X6KA 2GRNB 2AXZA 1U3CA 3HXFA 4G23A 2QFCA 2I1KA 3URZA 1H2VC 5CECB 3ZGQA 1N0RA 4I1MA 3TXMA 4O60A 3N71A 1XGWA 3HXCA 5CCMA 2KCVA 5HKPA 3LKUA 2X6FA 4XI9A 4RVBA 3AG3E 2I1JA 2VGXA 1DNPA 3JUIA 2VGYA 2GROB 3RJVA 3ZYKA 3NB2A 3CVXA 1YCSB 3QK0A 3D9KA 5A23A 4EECA 4B8AA 1H0AA 3L17A 4KMOA 3FUNA 3APCA 3UQ3A 3FU0A 2LO6A 4GZ6A 3DSUA 2DVWA 2J07A 3B7SA 3ZW3A 5ENOD 3CVNA 5FZSA 3T5VA 4UQZA 3FU3A 3UT8A 3PEVB 1S70B 1HE8A 4GZCA 3FEYA 5G04J 1DC2A 5AQ7A 2IEJA 3CVVA 3TG4A 3PZ1A 4LSZE 4FLBA 1SA5A 2OVBA 3L13A 2X6JA 3ABKE 2UWJG 3IHVA 3VTYA 2EQXA 1BPOA 4U8YD 3T9KA 1MHQA 4I6GA 4B8CB 3EHNA 2WMNA 4DPRA 4I17A 1TJFA 2C2LA 2XRYA 5ENQD 3PVLA 2DYSE 1OUVA 2P9PG 4L2YA 2ETBA 4ATZD 5C1DA 3EHQA 1WM5A 3F6QA 4H7YA 2ONDA 3E37A 3VLFA 1LD7A 1QZ2A 1O5MA 3RU0A 4OVUA 1O1RA 1SW6A 1EDUA 3QNKA 1MX4A 3AG4E 3ZVVA 3ZU7B 3GW4A 4JEUA 5BXUA 2KM4A 3LY9A 4K03A 2WXNA 3T8MA 3ZKJA 5BW8C 3O48A 1FPPA 2NXPA
chains in the Genus database with same CATH topology
3AG2E 3AG3E 2DYRE 2EILE 3ABME 1V54E 3X2QE 1OCRE 2EIME 1OCCE 3ASNE 2OCCE 5B1AE 2EIKE 3AG4E 5IY5E 2DYSE 1OCOE 3AG1E 3ABKE 3WG7E 2EIJE 5B1BE 1V55E 5B3SE 3ABLE 2EINE 2ZXWE 1OCZE 3ASOE 2Y69E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AG2 E;  3AG3 E;  2DYR E;  2EIL E;  3ABM E;  1V54 E;  3X2Q E;  1OCR E;  2EIM E;  1OCC E;  3ASN E;  2OCC E;  5B1A E;  2EIK E;  3AG4 E;  5IY5 E;  2DYS E;  1OCO E;  3AG1 E;  3ABK E;  3WG7 E;  2EIJ E;  5B1B E;  1V55 E;  5B3S E;  3ABL E;  2EIN E;  2ZXW E;  1OCZ E;  3ASO E;  2Y69 E; 
#chains in the Genus database with same CATH topology
 2R5S A;  2IOS A;  2HO1 A;  4GB9 A;  2HR2 A;  2KBX A;  3ABM E;  3MJW A;  3FUH A;  4M7C A;  5BPP A;  1N4R A;  1N4Q A;  4A1S A;  4P29 A;  2R03 A;  2XCC A;  2J4D A;  1IXV A;  4PS3 A;  3ASH A;  4GYO A;  4HVB A;  3ONL A;  2ILR A;  4HB5 A;  2GRL A;  4JXT A;  3AU5 A;  4AP2 A;  2DZN A;  3SO8 A;  2BF0 X;  3PZ2 A;  5JJT A;  3L54 A;  1FCH A;  2AXV A;  2PQN A;  1HO8 A;  4XEI G;  4BFR A;  3CKB A;  4GCO A;  4YDW A;  3JXJ A;  4F1S A;  2VJ8 A;  4J7W A;  1DVP A;  3U64 A;  4K5B A;  1OCO E;  5ANR A;  4OYS A;  4LNB A;  3VLE A;  4KYO B;  5FQ4 A;  2F8X K;  4I6E A;  1N4P A;  5EKQ D;  3FUJ A;  4KBQ A;  4ACK A;  3CHS A;  4AY6 A;  3CVW A;  4UI9 J;  4K5C A;  3CLJ A;  3T8K A;  4F53 A;  4I9C A;  3Q9N C;  1YYH A;  4HNA D;  4K0R A;  3CGH A;  4O6F A;  3AS5 A;  3ML9 A;  2A5E A;  2OEW A;  2QYU A;  1MQS A;  2JEK A;  3VLD A;  1QBQ A;  2IO3 C;  1IQR A;  3E4B A;  1Z6T A;  2UY1 A;  2F8Y A;  5M72 A;  2ZIS A;  1XNF A;  2KC7 A;  3PZD A;  2I6H A;  3CQC B;  2Q7F A;  5CER B;  2FO7 A;  3PH0 C;  2CG2 A;  3TAX A;  4WNG A;  1N54 A;  3TWU A;  3G2W A;  4J0U A;  1TJC A;  3FH7 A;  3ZYM A;  1OCZ E;  3DSS A;  3ZNG A;  5KJN A;  2XPY A;  2FUL A;  4AXH A;  2VGE A;  3ESL A;  4BT8 A;  3D9M A;  1K1A A;  3DSX A;  4A3T A;  5D66 A;  3SNX A;  2KZT B;  2ETA A;  4EQF A;  3CK9 A;  3B13 A;  5CCL A;  3E33 A;  3BUA A;  2E2E A;  2FI7 A;  3LXU X;  4WND A;  3P1U A;  1FT2 A;  5JA4 D;  2BED A;  2KCL A;  3PZ3 A;  1H6O A;  1SZ9 A;  2MYO A;  2L6B A;  4OAU C;  4DX7 D;  2WVI A;  4N5Q A;  3HIZ A;  5AIJ A;  4EZL A;  2ZGG A;  1WDY A;  3PZ4 A;  1D8E A;  1H2U A;  4L1B A;  2V4L A;  3ISM C;  4HQD A;  1HF8 A;  4U96 D;  3QKY A;  4APF A;  3UKR G;  2C0M A;  3L6A A;  4U07 A;  4I43 A;  4FJY A;  1HG5 A;  3V31 A;  3PE3 A;  3W9F A;  4XE0 A;  3KSL A;  4GPK A;  3B7B A;  1A5E A;  4NIK A;  1QNF A;  4JA7 A;  4DJA A;  5ENP D;  2DWZ A;  2YIN A;  2MOW A;  3CVL A;  3U66 A;  4BEP A;  3OXL A;  4CDN A;  1WG0 A;  4YVQ C;  3CK7 A;  3G2U A;  4U8V D;  2WM9 A;  4AVX A;  1JCS A;  3L9T A;  1SVX A;  4AEZ C;  2F0Y A;  2CHX A;  3Q4A B;  4JB8 P;  1UG3 A;  5LCW J;  5T4Y A;  3FWV A;  1ELW A;  4HOT A;  3MEK A;  4Q69 A;  2PQR A;  1S63 A;  1ZU2 A;  4M3O A;  4U0S A;  2AXU A;  3EIJ A;  2RFM A;  3HHM A;  4NAC A;  4J8F A;  4GAA A;  3TWR A;  3QWW A;  5A7D B;  1JCQ A;  3ASF A;  1HH8 A;  2WXO A;  5G2N A;  2ZXW E;  4FC8 A;  3S7D A;  5C2Y A;  2PM6 A;  3Q7A A;  1OWL A;  2Y0B G;  1TEZ A;  3LJN A;  2P9U G;  4G26 A;  3L22 A;  3B7T A;  2CFZ A;  3NAW A;  4U7E B;  4LEU A;  4PH4 B;  3CR3 A;  2MRI A;  1UN8 A;  1NL4 A;  5JMN D;  4BY6 A;  5BUZ A;  3MYV A;  3MZL B;  2J49 A;  4BTB A;  3MCX A;  1H6K A;  4RG9 A;  3I3N A;  2HM8 A;  5G05 C;  4AIF A;  3RSE G;  1IQU A;  3UKU G;  4G8K A;  3O4Z A;  1NZN A;  5BV0 A;  4I9E A;  3NOG D;  4WNF A;  5ARG A;  5DIZ A;  4HFG A;  3NQP A;  2PNN A;  3G2V A;  4HOS A;  3QDN A;  2R02 A;  4GTT A;  4UQX A;  3UIN C;  3FUD A;  2IFU A;  4I6J A;  4ILH B;  3FTZ A;  1W3B A;  5LP0 A;  1HS6 A;  2AW6 A;  4HLE A;  1N4S A;  3UM0 A;  3JXI A;  3SI5 A;  4FHK A;  4IUL A;  1H2T C;  3UI2 A;  1V54 E;  3KS2 A;  2LXL A;  2Y3A A;  1RZ4 A;  4LER A;  1Q2Z A;  5B1A E;  1N11 A;  3UT7 A;  4LNU D;  4YVO A;  5KCM A;  2WXH A;  2R59 A;  5CBN A;  2FO1 E;  1NI1 A;  4QQI A;  4V3I A;  4WUY A;  4UWL A;  1OXJ A;  1ELR A;  4U0Z A;  4DK5 A;  3UIO C;  4NQ0 A;  3TL5 A;  3PUJ A;  4WNE A;  3PEU B;  1K1B A;  5CRU A;  1A17 A;  1OWP A;  3S2A A;  3W9G A;  1O1T A;  3QOU A;  1PY1 A;  2LNI A;  4GZD A;  4J8Y A;  4F3V A;  3UUX A;  2XCB A;  5D0O D;  4DI4 A;  4KVO A;  4AM9 A;  2VGX B;  3KAE A;  3HVE A;  2WMO A;  2OEV A;  3DXK G;  1SQM A;  4GTQ A;  4ANW A;  4IRU A;  3CEQ A;  4B94 A;  3FY4 A;  3NZS A;  3CVU A;  3DPD A;  1Z3X A;  5EIB E;  3ZN3 A;  1TN7 A;  4YDO A;  2J9Q A;  4B0Z A;  1EPU A;  3SD5 A;  2E0I A;  2L0T B;  5EX0 A;  5KNG A;  3ZFW A;  3ZRH A;  4A63 B;  2XGO A;  4N3C A;  2HE0 A;  3AU4 A;  3FU6 A;  2DIW A;  1KLX A;  3SBT B;  4O1O A;  3AS8 A;  4TRQ A;  4ILI A;  3MV3 B;  4I2W A;  3AAA C;  1K8K G;  2ZU6 B;  3NF1 A;  3J5P A;  4GA0 A;  3GZ1 A;  4FUL A;  3SY2 A;  4HBD A;  2L6J A;  3NOC D;  1BLX B;  2VTB B;  2NSZ A;  4TXP A;  2WXK A;  3VTX A;  5B3S E;  1OY3 D;  1TN6 A;  3ASO E;  5AJL A;  3SBS A;  3TWV A;  3ZEF A;  3EJN A;  3QAR A;  1IKN D;  2RD0 A;  3MKR A;  3MA5 A;  1AP7 A;  2QY7 A;  3ULY A;  4KVM A;  4NRH B;  2GRM A;  3FP3 A;  3DWL G;  4IYP A;  4DX1 A;  4KXK B;  3S7B A;  4Q94 A;  4IN3 B;  3J5Q B;  3HYM B;  4YDY A;  3R7R A;  3PUK A;  4GTS A;  1AWC B;  3WG7 E;  2VSY A;  4W9R A;  5BNW A;  5AN8 A;  1N9A A;  4EPZ A;  4H7X A;  2WXQ A;  1N94 A;  4U04 A;  2DYR E;  3ZHE A;  3FDH A;  4GTO A;  3S7J A;  4DX5 D;  4E6H A;  2NYJ A;  2H6I A;  5BT1 A;  3FUF A;  5ENN A;  2IU1 A;  4HOU A;  2JAB A;  4JD2 G;  1FVH A;  3LPZ A;  5FIN A;  3IV0 A;  1D9S A;  2EIL E;  2B6C A;  2RG8 A;  4FHJ A;  5EX3 A;  2EIM E;  3RO2 A;  4AOF A;  2QC9 A;  2XHE A;  4JA9 A;  4UWF A;  2V4H C;  5EYP F;  2WB2 A;  2XEN A;  4JHJ A;  4J6I A;  2LAH A;  5EID A;  4EZJ A;  4A1G A;  3ASD A;  1TYQ G;  2B0O E;  4XZ4 A;  4GTR A;  3D9I A;  2QYJ A;  4ATG A;  4A55 A;  4O1P A;  5BXO A;  5J08 A;  1TR4 A;  3Q15 A;  4E85 A;  2IOL A;  3RRU A;  3MKQ A;  4TXQ A;  3CKC A;  1INZ A;  1HG2 A;  2GGF A;  3PRE A;  3Q7F A;  2LXM A;  5CBO A;  3Q49 B;  3TWX A;  2PZI A;  2OCC E;  2DCP A;  2H6H A;  4TUM A;  5KJK A;  3ULQ A;  4BES A;  2Y4U A;  3PNT B;  1NA0 A;  2UY1 B;  2GRP B;  3L16 A;  1H19 A;  4ILG A;  2XQ0 A;  5EYL A;  4CGW A;  3CVP A;  2WXM A;  5AAR A;  3E30 A;  4G11 A;  4PS8 A;  2VSO E;  4G8L A;  3CK8 A;  4XIF A;  1HXI A;  4WAF A;  1IYG A;  4F7A A;  1ZBP A;  1N52 A;  2XGS A;  1E90 A;  1E8W A;  5BV1 A;  5FIO A;  1MZC A;  4C48 B;  3FUI A;  4FJZ A;  3BEE A;  3S7F A;  4AY5 A;  2WQ6 A;  2EIK E;  4U63 A;  2X6H A;  1PAQ A;  4JL0 A;  4OAV B;  3BU8 A;  4UI9 K;  4WWN A;  2LUH A;  3RIB A;  3U3W A;  4JW1 A;  3EUV A;  2VQ2 A;  2BKK B;  2L9B A;  3DEO A;  1KPS B;  3CVQ A;  5KJM A;  5E75 A;  5FQ6 A;  2V8S E;  1OCR E;  3BQO A;  3R9A B;  5EN5 D;  5AQ9 A;  4ZHB A;  4GTV A;  3CHP A;  3RRN B;  3CIA A;  2V5Q C;  3IBE A;  2WQH A;  3DSW A;  3GZS A;  4FU3 A;  3SGH A;  4UUC A;  3ONK A;  1UOH A;  5G05 J;  3NZU A;  4G1T A;  1E7U A;  1MX6 A;  4GML A;  4ANV A;  3G2T A;  4R7L A;  4JHR A;  3Q78 A;  2P9N G;  2XEH A;  4WWP A;  2R17 C;  4I1O B;  4HRM B;  3LVQ E;  4ME2 A;  2XRZ A;  2KCK A;  1UN9 A;  1Z5S C;  4EBA G;  3LS8 A;  4TXR A;  4DUI A;  1WY6 A;  4CCA A;  4CYM D;  4EZK A;  4RSY A;  2WXL A;  3LY8 A;  5JHA A;  3LCA A;  1NA3 A;  3R9M A;  5ENT D;  3ULE G;  4LCT A;  1DCQ A;  5KWD A;  1TNB A;  3TWS A;  5JHB A;  4MRU A;  2WXF A;  3KD7 A;  4CZ2 D;  3UIP C;  4D10 C;  2QZA A;  4ABN A;  4JEH A;  3IHY A;  2X3M A;  4G2V A;  3PNL B;  3SQV A;  2VSN A;  4LUN U;  3SFZ A;  1N0Q A;  1UJJ A;  1HX8 A;  4J8S A;  4BWR A;  1ZB1 A;  3D9N A;  3HRA A;  4GMJ A;  3L08 A;  4GPM A;  4EBA A;  1EYH A;  3ZYL A;  1OWN A;  3UM3 A;  4FA6 A;  4U0U A;  4A3V A;  4GZ5 A;  4JZY A;  3UTM A;  2J09 A;  3ENE A;  3GZ2 A;  3X2Q E;  4ACL A;  2H6G A;  3E34 A;  5T3R A;  4C0E A;  2WXG A;  2OVF A;  5H7P A;  3FFL A;  4GTM A;  3C98 A;  5FJY A;  2IF4 A;  3B95 A;  3QWP A;  3RAU A;  2BTD A;  5FT9 A;  4BTA A;  3EDT B;  5EDS A;  2NC9 A;  3G2S A;  3TWW A;  3D9P A;  2CG3 A;  3QC1 A;  2XGM A;  5LOZ A;  4GTP A;  2AJA A;  4F6R D;  3D9H A;  2WXJ A;  3Q5M A;  4DRX E;  4Q96 A;  4KT6 B;  2DBA A;  1TNY A;  1V55 E;  3D9O A;  1FT1 A;  2ETC A;  1HZ4 A;  1ELK A;  4Y6W A;  2MHK A;  2CHW A;  3CVY A;  4AV7 A;  3FHE A;  1OWM A;  2YHC A;  5KJL A;  3HXD A;  3QJZ A;  5B1B E;  5T8I A;  3FTX A;  4I1A A;  4TV3 A;  3EU5 A;  3EHM A;  1BD8 A;  3OTN A;  2J8S D;  1HFA A;  4PUC A;  1Y6I A;  4UQY A;  2R2L A;  4JC8 A;  2P2C P;  2FBN A;  3K9I A;  3I5P A;  3IKO B;  5AQB A;  3Q79 A;  2OOE A;  1S0P A;  3KSQ A;  5AEN A;  1KZO A;  4PS7 A;  1RW2 A;  2GW1 A;  4UWG A;  2J08 A;  5J90 A;  1L5J A;  3EIQ C;  2X6I A;  4L23 A;  5CEA A;  2YNQ A;  4CT0 A;  2V5F A;  4AJW A;  2XZT G;  3Q9U C;  4GCN A;  5G55 A;  2WQ7 A;  3IXE A;  2PM7 A;  1BU9 A;  4N39 A;  5LFA A;  4C9B B;  1LF8 A;  4FLH A;  2WXP A;  3DPY A;  4GMR A;  1OCC E;  3FTW A;  2VTB A;  4MLP A;  2XS1 A;  4FAD A;  1PC2 A;  3C5R A;  3HVE B;  4U95 D;  3LVR E;  3EU9 A;  3WXX A;  2X38 A;  1E8Y A;  2WXR A;  5CMW A;  5AYW D;  1Z3Y A;  1WAO 1;  4GU5 A;  2BUG A;  1BI8 B;  4KZC A;  4N3A A;  4LG6 A;  4OVV A;  3JQ1 A;  4XKC A;  4L7T A;  2R05 A;  3SF4 A;  1JCR A;  3D3M A;  5KBA A;  1N95 A;  5HI7 A;  2AVP A;  5G04 C;  3OAW A;  2JLB A;  4GA1 A;  2GRQ B;  2V0P A;  3AJI A;  4FP7 A;  1SZA A;  3FUK A;  4HLL A;  4XKB A;  5FQ7 A;  5JJ7 A;  3LJ3 A;  4JHK A;  4XI0 A;  1VDY A;  2I2O A;  3U4T A;  3QB2 A;  1NFI E;  1O1S A;  3HXB A;  3PE4 A;  5DBK A;  4F1P A;  4DX6 D;  4BSX A;  2OV8 A;  3HDX A;  1QYM A;  2P9L G;  3CHM A;  1TNU A;  2ZIR A;  3LYA A;  1KZP A;  3V30 A;  1LTX A;  4G25 A;  1TNO A;  3SHF A;  3MX3 A;  5CED B;  2PL2 A;  5CMY A;  5ENR D;  2FF4 A;  2VYI A;  3DST A;  5ARF A;  2ION A;  2XS8 A;  2FEZ A;  1IHG A;  4LNG A;  4JPS A;  3U9W A;  2Y4T A;  5AAO A;  3CQG B;  5D2M C;  4HI9 A;  1KT0 A;  1E8Z A;  2IQC A;  3BG1 B;  2P58 C;  3TGO A;  4EHM A;  3CHR A;  4MS6 A;  2J4B A;  4BT9 A;  2CHZ A;  2Y69 E;  3FH5 A;  1GW6 A;  3HXE A;  3SFX A;  3ZXS A;  3FEX A;  2GRR B;  3UPV A;  1TNZ A;  2AWI A;  3SZ7 A;  3UXG A;  2A5U A;  3ZHE B;  2KZT A;  3ZXP A;  4HI8 A;  4X8Q A;  2LSU A;  3TWQ A;  3FUM A;  3CST A;  1JWG A;  2CFU A;  4N5C A;  1UW4 B;  2XEV A;  5HS0 A;  4U8H A;  3UX4 A;  3ZYQ A;  4MBG A;  1YA0 A;  2RFA A;  2HYZ A;  3Q75 A;  2VSX E;  4CGV A;  1Y8M A;  5JJ6 A;  4BET A;  3SFY A;  3PDN A;  1D8D A;  1FVF A;  4KZ0 A;  3LDZ A;  3KEZ A;  5EIL A;  4HS2 A;  2XPI A;  3B7U X;  1U2V G;  5FZR A;  1LD8 A;  1DCE A;  5KNH D;  3FU5 A;  4GYW A;  3JCK C;  4JVS A;  2XEE A;  5ITZ F;  3UM1 A;  4PDX A;  3C3R A;  1BI7 B;  1X81 A;  3UMV A;  3V79 K;  1QQE A;  3KEA A;  2KAT A;  4J8E A;  3MV2 B;  5E76 A;  5CHE E;  4YND A;  4BX8 A;  3AG1 E;  4RLY A;  3TWT A;  1YMP A;  4HRL A;  2LAI A;  3FTU A;  4UI9 C;  4CRW A;  3FH8 A;  3V2X A;  3I4G A;  4K5A B;  3MKQ B;  4Z68 A;  1EF1 C;  1OT8 A;  3V2O A;  4N2Q A;  1MYO A;  3D9L A;  1JUQ A;  4N3B A;  3HG0 D;  3TXN A;  1KT1 A;  2A4Z A;  1HU3 A;  4J8D A;  4GYY A;  2XZD G;  4LRZ A;  3Q47 B;  4UWH A;  3UT4 A;  5AJD A;  2Y1L E;  1NP7 A;  4CT4 A;  3OXG A;  1U3D A;  5ANL A;  3RO3 A;  3I4R B;  2KXP C;  4Y6C A;  3CSF A;  3UM2 A;  3E32 A;  4DLO A;  4ZFH A;  5D0Q D;  4URK A;  4C0M A;  3QWV A;  5ENS D;  3B7R L;  3APD A;  3Q73 A;  2F37 A;  2M63 A;  3RK6 A;  3ASG A;  4CDM A;  3AG2 E;  3CHQ A;  4XX5 A;  5FZQ A;  3QAQ A;  4RG6 A;  4YDE A;  1E8X A;  3FUL A;  1X5B A;  2P9K G;  3D9J A;  3ESK A;  5FQ8 A;  3DEP A;  4QFV A;  2WPV A;  5AQA A;  5HRY A;  4G24 A;  3FUE A;  4RQI A;  4L2L A;  3R7Q A;  3BG0 B;  3TJP A;  3ZPJ A;  1JWF A;  3GYZ A;  3L82 A;  4BX9 A;  2C0L A;  4ANU A;  4CDR A;  3MGB A;  3FTS A;  4NUR A;  2ZGD A;  3C72 A;  1H6P A;  3LEW A;  4GZ3 A;  1MX2 A;  1OWO A;  2I9C A;  5CRV A;  2RKK A;  3JQ0 A;  1MJ0 A;  1S64 A;  3EHR A;  3APF A;  3IEG A;  3DXM G;  4TUU A;  2WXI A;  3LY7 A;  2P9S G;  3NBN B;  4CEM A;  4MKT A;  1P5Q A;  4HXI A;  4DX2 A;  1E7V A;  3FTV A;  1G3N B;  3CHO A;  4N2S A;  3CV0 A;  4L9P A;  1B89 A;  3RRM B;  4DI3 A;  2DZO A;  3ZUV B;  5LX8 A;  2L0I A;  3C3O A;  2YQ8 A;  2BKG A;  2IO2 C;  2H6F A;  3C3Q A;  2LSV A;  4BER A;  5HQ8 A;  3OXF A;  3ASN E;  4I2Z A;  3DSV A;  5FTP A;  3RKV A;  5IY5 E;  2YHE A;  3AS4 A;  4GA2 A;  3PS6 A;  1TN8 A;  4ANX A;  1E96 B;  2XPZ A;  3PRZ A;  3P2B A;  2EIN E;  5A6C A;  1IHB A;  2IY0 C;  1JPL A;  3JUE A;  4BSZ B;  4DLQ A;  3FTY A;  4B89 A;  3DBS A;  1SA4 A;  4HRN A;  2IJG X;  2P9I G;  3ZIM A;  3JYS A;  3ML8 A;  4B93 B;  4HOR A;  4WWO A;  3TG5 A;  2EIJ E;  1K3Z D;  4HOQ A;  3T5X A;  5FWQ A;  4APO A;  3DRA A;  3ABL E;  4UWK A;  1UJK A;  5LCW C;  2X6K A;  2GRN B;  2AXZ A;  1U3C A;  3HXF A;  4G23 A;  2QFC A;  2I1K A;  3URZ A;  1H2V C;  5CEC B;  3ZGQ A;  1N0R A;  4I1M A;  3TXM A;  4O60 A;  3N71 A;  1XGW A;  3HXC A;  5CCM A;  2KCV A;  5HKP A;  3LKU A;  2X6F A;  4XI9 A;  4RVB A;  3AG3 E;  2I1J A;  2VGX A;  1DNP A;  3JUI A;  2VGY A;  2GRO B;  3RJV A;  3ZYK A;  3NB2 A;  3CVX A;  1YCS B;  3QK0 A;  3D9K A;  5A23 A;  4EEC A;  4B8A A;  1H0A A;  3L17 A;  4KMO A;  3FUN A;  3APC A;  3UQ3 A;  3FU0 A;  2LO6 A;  4GZ6 A;  3DSU A;  2DVW A;  2J07 A;  3B7S A;  3ZW3 A;  5ENO D;  3CVN A;  5FZS A;  3T5V A;  4UQZ A;  3FU3 A;  3UT8 A;  3PEV B;  1S70 B;  1HE8 A;  4GZC A;  3FEY A;  5G04 J;  1DC2 A;  5AQ7 A;  2IEJ A;  3CVV A;  3TG4 A;  3PZ1 A;  4LSZ E;  4FLB A;  1SA5 A;  2OVB A;  3L13 A;  2X6J A;  3ABK E;  2UWJ G;  3IHV A;  3VTY A;  2EQX A;  1BPO A;  4U8Y D;  3T9K A;  1MHQ A;  4I6G A;  4B8C B;  3EHN A;  2WMN A;  4DPR A;  4I17 A;  1TJF A;  2C2L A;  2XRY A;  5ENQ D;  3PVL A;  2DYS E;  1OUV A;  2P9P G;  4L2Y A;  2ETB A;  4ATZ D;  5C1D A;  3EHQ A;  1WM5 A;  3F6Q A;  4H7Y A;  2OND A;  3E37 A;  3VLF A;  1LD7 A;  1QZ2 A;  1O5M A;  3RU0 A;  4OVU A;  1O1R A;  1SW6 A;  1EDU A;  3QNK A;  1MX4 A;  3AG4 E;  3ZVV A;  3ZU7 B;  3GW4 A;  4JEU A;  5BXU A;  2KM4 A;  3LY9 A;  4K03 A;  2WXN A;  3T8M A;  3ZKJ A;  5BW8 C;  3O48 A;  1FPP A;  2NXP A; 
#chains in the Genus database with same CATH homology
 3AG2 E;  3AG3 E;  2DYR E;  2EIL E;  3ABM E;  1V54 E;  3X2Q E;  1OCR E;  2EIM E;  1OCC E;  3ASN E;  2OCC E;  5B1A E;  2EIK E;  3AG4 E;  5IY5 E;  2DYS E;  1OCO E;  3AG1 E;  3ABK E;  3WG7 E;  2EIJ E;  5B1B E;  1V55 E;  5B3S E;  3ABL E;  2EIN E;  2ZXW E;  1OCZ E;  3ASO E;  2Y69 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...