1V54E

Bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase polypeptide I
publication title The low-spin heme of cytochrome c oxidase as the driving element of the proton-pumping process.
pubmed doi rcsb
total genus 40
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 1v54E00
1V54E 5IY5E 2EINE 5B1BE 3AG3E 2OCCE 1V55E 3AG2E 3ABME 2EIJE 2EILE 3AG4E 3ASOE 3X2QE 5B3SE 1OCCE 3AG1E 2ZXWE 1OCOE 2Y69E 3ABKE 2EIKE 2DYSE 3ASNE 3WG7E 2DYRE 1OCZE 3ABLE 2EIME 1OCRE 5B1AE
chains in the Genus database with same CATH superfamily
1U3CA 3OAWA 2XEEA 4XEIG 2DCPA 5JMND 3TWUA 4A3VA 5J90A 3C98A 2EQXA 2A4ZA 1UJKA 2ETBA 4JPSA 2PL2A 2Y0BG 2I2OA 3LY9A 5B1AE 5ARGA 2IY0C 5HKPA 4NIKA 2KZTB 5BV1A 3AAAC 1UN9A 1P5QA 4XE0A 2VSOE 3I5PA 3X2QE 1U2VG 3UIPC 2WB2A 5G05C 4BERA 4XI0A 4Z68A 3AG3E 2A5UA 3PH0C 3ZEFA 3PDNA 4I17A 2A5EA 1TJCA 3PEVB 4ILGA 4BETA 4NRHB 4HRNA 4BY6A 3PZ3A 4QFVA 2PZIA 3SZ7A 1A5EA 3S7DA 2E0IA 2OV8A 2VGYA 3B7RL 2J08A 1HZ4A 3PEUB 1Z6TA 5AJLA 1N4QA 3GZ2A 3JQ1A 2RFAA 2YHCA 4J8SA 4U04A 4YNDA 2RKKA 4GTMA 3ZYLA 1BI7B 3TAXA 4U0ZA 1N4RA 5D0OD 3FH8A 4LNUD 3PE3A 3KSLA 4KVMA 4HB5A 2C0LA 3Q79A 2WXKA 1PC2A 5FQ4A 5JHAA 1K1BA 3DSXA 4N3CA 3T5VA 5CMYA 4KZ0A 2ZU6B 4EECA 2X6IA 4JA9A 3R7QA 3ASHA 2OEWA 3TWSA 5T8IA 4E6HA 2V8SE 1D8EA 4N2SA 1BD8A 2Y4UA 4HNAD 5JA4D 4DLOA 3ZYMA 3TG4A 4GMJA 4GPMA 3CVYA 3NBNB 2CG2A 4GYWA 4EHMA 3R9AB 5BXUA 1N95A 2IO2C 3D9KA 4XKBA 4F6RD 2C0MA 3HVEA 3O4ZA 2MRIA 3K9IA 4C48B 4DX2A 3FUDA 1FVHA 4DPRA 3EU5A 5HS0A 3JQ0A 4I6JA 4C9BB 3L16A 4AVXA 4JVSA 2PM7A 4UQYA 3B13A 3ULQA 3CVUA 3S7BA 1OT8A 4K03A 4RQIA 5A6CA 4UWGA 4GTRA 1TYQG 1FPPA 2LSUA 1HH8A 3ESLA 4PUCA 2V0PA 4N5CA 1TEZA 2FF4A 3R9MA 4I1MA 2R2LA 5HI7A 2UY1B 2P9UG 2OCCE 5CBNA 3FUMA 4FJYA 3B95A 4KT6B 2DIWA 4KMOA 1ELWA 4OVVA 3RU0A 4RG6A 4J6IA 5BV0A 4GYOA 2KC7A 3MGBA 2IONA 5AQBA 2OOEA 1MJ0A 3D9NA 3AU5A 2VJ8A 2HM8A 4OVUA 4URKA 1Y6IA 4P29A 1HG5A 3URZA 4ILHB 4EPZA 3MKRA 4J8EA 2EIJE 2MHKA 3MV3B 3ZFWA 2IOSA 2FI7A 3EJNA 2AXVA 4G2VA 3PZ2A 2VGEA 2L6BA 2HR2A 4HRLA 2BUGA 3E33A 3PZDA 4GYYA 1N0QA 1NL4A 3IBEA 3VLDA 4AXHA 3D9MA 4EBAG 4LNBA 1OWOA 3FU0A 4TXRA 3DPYA 4GA1A 2IJGX 1SA4A 4GMLA 2I1JA 2RD0A 2CG3A 2KCLA 1PAQA 5CEDB 3G2WA 3UXGA 4GTTA 4FLHA 1JCRA 1NA0A 2R05A 2LAIA 2LSVA 3EHRA 4DJAA 4GZCA 3QKYA 3ZYKA 2XGOA 2UY1A 2HO1A 5G55A 3LVQE 3CR3A 4HXIA 1NFIE 4CGVA 1O1TA 1QBQA 3FTVA 5A23A 5AIJA 3CHSA 1HU3A 1LTXA 5LCWC 5LX8A 3LVRE 1YA0A 4ATZD 2ZGGA 4H7YA 1IHGA 3D9IA 3HXBA 4WNDA 3RRNB 3QB2A 2KCVA 5BXOA 3U9WA 4B0ZA 3T8KA 4WNFA 3VTYA 2KBXA 3SO8A 2C2LA 4A55A 3DPDA 1JWGA 3OXGA 3ASOE 5BW8C 4ANWA 1WAO1 3FU5A 2WXPA 2JABA 4XKCA 2KXPC 4L23A 3L08A 3ESKA 3UKRG 4L7TA 4Q96A 1ZU2A 3SD5A 2H6IA 2L6JA 1Z3XA 3PNLB 4GAAA 1QYMA 2ZXWE 4F1PA 5FTPA 5CECB 1UN8A 1OCZE 2EIME 1DCEA 4BT8A 4AV7A 1FT1A 2KM4A 4HFGA 2FEZA 2XGSA 4KVOA 3KD7A 3PS6A 2NC9A 4KYOB 5FINA 5ARFA 3WG7E 2P2CP 3ZPJA 3DRAA 1DC2A 1YMPA 3CHPA 3CGHA 1N54A 2ZIRA 3Q7FA 4YDYA 3FUKA 3UQ3A 2LNIA 2H6HA 3C5RA 4HOSA 2MOWA 1AP7A 1S63A 4G25A 3CHRA 3OXLA 1TNOA 3JUEA 3EHQA 4BEPA 4GZ3A 3CVXA 3BG1B 5DIZA 4K5BA 1E8ZA 3Q73A 2GRQB 1QZ2A 2GW1A 2NXPA 3TGOA 2BKGA 4HS2A 3AU4A 2AXZA 2J4BA 4YVOA 2OVBA 4I1AA 4JEHA 3U64A 3TJPA 2AXUA 3DXMG 5M72A 3G2SA 5EKQD 4WWNA 5B1BE 5AAOA 3APCA 1V55E 1ELKA 4GTQA 3D9PA 4WAFA 4OYSA 5ENQD 1G3NB 2LAHA 2OVFA 3O48A 3L9TA 3CSTA 4HLLA 4HORA 3SQVA 4FU3A 4I2WA 4GU5A 2HE0A 4ATGA 4Q69A 4GA0A 2EILE 5D66A 1IKND 5CEAA 2ETAA 3PZ1A 4XZ4A 3I3NA 5FZSA 2HYZA 2GGFA 3DBSA 2X6FA 2X6HA 2IOLA 4I43A 1DNPA 3ASDA 2QY7A 3FEYA 4CCAA 3UM2A 2WPVA 2NSZA 3UM3A 4F53A 5KJKA 5EX3A 3E30A 3ASNE 4A1GA 3PE4A 2VTBA 3FUFA 4EBAA 3UX4A 3HXDA 5AQAA 2F0YA 1W3BA 2IO3C 1IYGA 3FUIA 2VQ2A 3MZLB 3FP3A 3PVLA 3U4TA 2UWJG 1UJJA 3IV0A 1VDYA 1SVXA 3ZRHA 1H2TC 4TV3A 5G04J 2EINE 3CK7A 3W9GA 4GB9A 3VLEA 3EHMA 4U8YD 1NP7A 3DSVA 2WQ7A 1PY1A 3UPVA 3CEQA 3T8MA 2QC9A 3ZUVB 4ZHBA 3HRAA 1B89A 2GRNB 4FHKA 4BTBA 4AM9A 2WXIA 4UI9J 1X5BA 3BQOA 3HXCA 3ZNGA 3RJVA 3ZHEB 4GZ6A 1MX2A 3MJWA 3B7SA 4CRWA 1KLXA 3MKQA 4LERA 5E76A 2VSNA 2WQHA 4HI9A 1WM5A 3ABLE 4WWPA 1EDUA 2WXNA 4C0EA 3L82A 5CMWA 5H7PA 3BEEA 3L22A 5B3SE 3QJZA 3AG1E 1E7UA 4UWFA 3HXFA 1S64A 2IEJA 3T5XA 3LY7A 3LS8A 5E75A 3ZXPA 4N39A 1V54E 1KZOA 3UT4A 4CT4A 4F7AA 4IYPA 3LY8A 3V2XA 3FY4A 2KZTA 1TNBA 1EF1C 4B8CB 4I9CA 1RZ4A 5HRYA 3DSUA 2WMOA 3G2TA 5BPPA 4ILIA 1MZCA 4XI9A 1SA5A 1N94A 3UINC 4AY5A 3WXXA 4M7CA 2H6FA 3KS2A 3QARA 3CVQA 3ZGQA 3TXNA 1MX6A 3Q78A 4HQDA 2XS8A 2GRPB 2BF0X 4G11A 3UM1A 1E90A 5KCMA 5JJTA 2XPYA 3ZIMA 3Q5MA 4APFA 3JUIA 1S70B 1EYHA 3NQPA 2V5FA 3NB2A 5EYLA 5ENNA 2WVIA 4AOFA 3I4GA 1QQEA 2DVWA 2FO7A 3V79K 3ZN3A 2LXLA 5CCMA 2XHEA 1INZA 2FULA 4TXQA 1OWNA 4RLYA 4ACKA 3Q9UC 3ZHEA 1H6OA 2OEVA 4J8YA 3DSTA 4KBQA 2RFMA 3L17A 3CKCA 3C3RA 1IXVA 4O1OA 1K1AA 4ANXA 3LPZA 4UUCA 2P9KG 3B7UX 4DLQA 4NURA 2PNNA 5CBOA 2PQRA 4YDOA 3FTUA 2P9LG 2RG8A 4EZKA 2LUHA 4U0UA 1TNZA 4IRUA 4QQIA 3D9OA 4YVQC 3CK8A 4BT9A 1N4SA 4DX1A 3HXEA 4LCTA 2VSXE 4GA2A 4B89A 3FUJA 3ZW3A 4GMRA 2JEKA 2WMNA 3CIAA 4O60A 2X6JA 1MX4A 2P58C 3TWVA 3FTZA 3IKOB 3HDXA 1K8KG 4U8VD 3JYSA 3CQCB 4U0SA 3E37A 1N0RA 2CFZA 2VGXB 5J08A 3Q47B 3MCXA 3SGHA 1UG3A 4EZJA 1OWLA 3TXMA 4EQFA 1N11A 2J4DA 3RK6A 1HE8A 4TUMA 4LSZE 2XEVA 2DYRE 3SFZA 2J9QA 4G23A 3UKUG 4JHJA 1HO8A 4AIFA 3NAWA 4BWRA 4HOQA 4UI9K 4JZYA 2IFUA 4PS8A 4OAVB 1NZNA 4ABNA 2R17C 2I6HA 2BTDA 3SF4A 4JHRA 3BU8A 4JD2G 5T3RA 3LEWA 2J09A 3QWWA 3LDZA 2XCCA 4J8FA 2PM6A 5EILA 5KJNA 2IF4A 3SNXA 1K3ZD 4TRQA 1BPOA 5KJMA 4U95D 5ENPD 1NI1A 1YCSB 4XX5A 1E8WA 5ANLA 2J8SD 4HRMB 3T9KA 4ME2A 3BG0B 2P9SG 3DEOA 4I1OB 4D10C 1OCRE 1TNYA 2XCBA 4I6EA 4N3AA 4JC8A 3BUAA 3LJNA 5ENSD 3FEXA 3L13A 4UWLA 4MS6A 4CDRA 2MYOA 3B7BA 2DYSE 3DEPA 4FLBA 4G26A 5AENA 5LCWJ 3FUNA 4J8DA 5EYPF 1LD7A 3NZSA 3P2BA 5ENRD 1JPLA 3C72A 3ULYA 3ZU7B 3G2UA 3RSEG 4PS7A 4AJWA 3ONLA 3APDA 5KNHD 3SHFA 1U3DA 2XZTG 4U7EB 2P9NG 2JLBA 4J7WA 4ACLA 1S0PA 3OXFA 2B6CA 3J5QB 3NOCD 4EZLA 2XPZA 3Q75A 1O1RA 2YINA 3QC1A 3UTMA 2EIKE 3NZUA 4FJZA 3RAUA 1OXJA 1FVFA 5FIOA 4HOUA 4CGWA 2LO6A 1Z3YA 2CHXA 5KBAA 3SBTB 4K5AB 5FT9A 3MA5A 4BSXA 2WXHA 4FC8A 1Q2ZA 2FO1E 1XNFA 3U3WA 3EHNA 3AS8A 3JCKC 1DVPA 2V4HC 3C3OA 1FT2A 3S2AA 3FFLA 3LJ3A 2WXJA 4F1SA 5C2YA 2XRYA 3EIJA 1GW6A 5KNGA 3FWVA 3FTYA 3FTXA 4JXTA 3TWWA 1NA3A 4BFRA 5ENOD 1KPSB 4F3VA 3KSQA 1BI8B 3FDHA 4BSZB 3ZYQA 3GW4A 4WNGA 3GZSA 3JXJA 2YHEA 3V30A 3FTSA 5D2MC 4AP2A 3RO2A 4LRZA 3LKUA 5LFAA 2X38A 4U96D 2WQ6A 3Q4AB 1A17A 4JEUA 2VYIA 3PUJA 4GCNA 4G1TA 4R7LA 1KT0A 4JA7A 2DWZA 3SBSA 3ML9A 2WXLA 4Y6CA 4YDEA 4GTOA 1TN6A 4BX8A 3QWVA 4N3BA 2QZAA 1H2UA 4FP7A 4ANUA 2F8YA 4M3OA 4G24A 4LG6A 3GYZA 4B8AA 4L9PA 5FQ8A 5D0QD 3FH7A 3OTNA 1JUQA 1UW4B 4CEMA 4G8KA 3U66A 3AJIA 1SQMA 2PQNA 4DX7D 3D3MA 4B93B 4U63A 5JJ7A 2V4LA 2ONDA 2XRZA 4DX5D 3HVEB 4JHKA 5G04C 1TN8A 3F6QA 3TWXA 3N71A 2QFCA 4KXKB 4RSYA 3ONKA 1N9AA 4UQZA 3R7RA 4RG9A 4WUYA 2LXMA 1MYOA 4L1BA 2BKKB 5G05J 3QK0A 3MEKA 1Y8MA 3KAEA 4FULA 1HX8A 5LOZA 3P1UA 4APOA 1RW2A 1SZAA 4DK5A 3TWRA 2NYJA 4UI9C 3CVVA 1HG2A 4PDXA 1N4PA 2WXRA 2R59A 5G2NA 2X3MA 1JCSA 3TWTA 3AS5A 3CHMA 4CDMA 3UIOC 3S7JA 3CKBA 3JXIA 2DZOA 5AYWD 3QWPA 3PRZA 5KWDA 2R03A 4TXPA 1OY3D 1ZBPA 2X6KA 4B94A 1HF8A 4O6FA 3L6AA 3AG2E 4U8HA 3ULEG 3E34A 1WY6A 2P9IG 3UT7A 3G2VA 4MBGA 4DI4A 3Q15A 1N52A 4XIFA 2H6GA 3D9JA 3IHYA 4GZ5A 4ZFHA 4JW1A 2WM9A 3UI2A 2QYJA 1BU9A 3SFYA 3J5PA 2ZISA 1HS6A 3CLJA 1TR4A 5ENTD 2WXQA 2GRMA 2L0TB 1OCCE 5DBKA 4JB8P 1H19A 2M63A 3HHMA 4BX9A 1MQSA 4J0UA 4A63B 3TL5A 5CRUA 1IHBA 1EPUA 2IQCA 4GCOA 1HFAA 3S7FA 3QNKA 3C3QA 1H2VC 2GRRB 5JJ6A 1OCOE 2I9CA 3MYVA 4GPKA 4UWHA 2XEHA 3DWLG 2ILRA 3PNTB 3PUKA 5AQ7A 4CYMD 4L2LA 4YDWA 3B7TA 3QAQA 2ZGDA 4ANVA 2Y1LE 4X8QA 1ELRA 4NACA 2AWIA 3SI5A 4FHJA 3I4RB 5EIDA 3CVWA 3TWQA 1H6KA 3DXKG 2F37A 4KZCA 3EDTB 3ASGA 3L54A 5CERB 1OWPA 1IQUA 3EUVA 4GTPA 3VTXA 2WXOA 2FBNA 3APFA 4CDNA 3D9LA 1TJFA 3HYMB 4K5CA 4C0MA 1MHQA 4WWOA 1TNUA 2XZDG 1IQRA 2Y4TA 3IXEA 3ABKE 2KCKA 1WG0A 5AARA 5T4YA 4U07A 4UQXA 5FZQA 3KEAA 1UOHA 2V5QC 4DI3A 4LUNU 5CCLA 1H0AA 1O1SA 2L9BA 3CHOA 3LYAA 5JHBA 5A7DB 3V31A 3ML8A 3E4BA 4HOTA 2BEDA 4AY6A 4GTSA 1L5JA 4W9RA 2R5SA 3FTWA 4Y6WA 2WXMA 4A1SA 5EDSA 2XS1A 4A3TA 2J49A 4GTVA 5CRVA 3NF1A 3CHQA 4DRXE 4CZ2D 5BUZA 2J07A 3DSSA 1KT1A 1XGWA 4WNEA 1OWMA 2B0OE 3SFXA 4IN3B 3FH5A 2AW6A 3CVPA 3DSWA 5FQ6A 5FQ7A 2WXFA 5AN8A 2YQ8A 2F8XK 5BT1A 4I6GA 3VLFA 3UT8A 5HQ8A 5EN5D 4JL0A 5IY5E 1JWFA 3ISMC 5ANRA 2GROB 3RKVA 4K0RA 4H7XA 2CHWA 3EU9A 3ZVVA 1AWCB 3FUHA 2GRLA 2E2EA 5EX0A 4MRUA 3PZ4A 4HBDA 3UM0A 3CSFA 2YNQA 5C1DA 1SW6A 2Y3AA 3ZKJA 2IU1A 1E8YA 2CFUA 1WDYA 2QYUA 2VSYA 2CHZA 4HI8A 3W9FA 3HG0D 4UWKA 1FCHA 4AEZC 3MV2B 2KATA 1D9SA 3IHVA 1E96B 3CV0A 4DUIA 3CVNA 3E32A 2XQ0A 3LXUX 1QNFA 3D9HA 4O1PA 2VGXA 3FULA 1TN7A 3UMVA 1O5MA 4OAUC 3CK9A 4RVBA 5LP0A 4L2YA 3Q49B 4MLPA 4G8LA 2P9PG 1Z5SC 3V2OA 5FWQA 4FA6A 3RO3A 4HLEA 3FU6A 4LEUA 4IULA 3SY2A 1LF8A 1SZ9A 3KEZA 3ASFA 1LD8A 3RRMB 3Q7AA 3QDNA 2R02A 5ITZF 1DCQA 4PH4B 3ENEA 4N2QA 1D8DA 2XENA 4Q94A 2Q7FA 3LCAA 2Y69E 4FADA 1HXIA 1YYHA 3CQGB 1KZPA 2VTBB 3UUXA 3NOGD 4TUUA 4BTAA 2L0IA 4GZDA 2DBAA 3RRUA 4NQ0A 3GZ1A 1ZB1A 4N5QA 1E8XA 4HVBA 3TG5A 2ETCA 3HIZA 2DZNA 1X81A 5BNWA 5AQ9A 3FHEA 1JCQA 2I1KA 3MX3A 3AS4A 3CVLA 4MKTA 5AJDA 3QOUA 3AG4E 2AJAA 3ZXSA 4BESA 5EIBE 4I9EA 4E85A 4DX6D 3EIQC 4LNGA 4PS3A 2XGMA 3FUEA 5KJLA 2XPIA 2AVPA 3ABME 4I2ZA 3IEGA 3Q9NC 5FZRA 1OUVA 4V3IA 5CHEE 3PREA 5FJYA 4CT0A 1H6PA 2WXGA 1BLXB 1E7VA 3MKQB 3FU3A 3RIBA
chains in the Genus database with same CATH topology
1V54E 5IY5E 2EINE 5B1BE 3AG3E 2OCCE 1V55E 3AG2E 3ABME 2EIJE 2EILE 3AG4E 3ASOE 3X2QE 5B3SE 1OCCE 3AG1E 2ZXWE 1OCOE 2Y69E 3ABKE 2EIKE 2DYSE 3ASNE 3WG7E 2DYRE 1OCZE 3ABLE 2EIME 1OCRE 5B1AE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V54 E;  5IY5 E;  2EIN E;  5B1B E;  3AG3 E;  2OCC E;  1V55 E;  3AG2 E;  3ABM E;  2EIJ E;  2EIL E;  3AG4 E;  3ASO E;  3X2Q E;  5B3S E;  1OCC E;  3AG1 E;  2ZXW E;  1OCO E;  2Y69 E;  3ABK E;  2EIK E;  2DYS E;  3ASN E;  3WG7 E;  2DYR E;  1OCZ E;  3ABL E;  2EIM E;  1OCR E;  5B1A E; 
#chains in the Genus database with same CATH topology
 1U3C A;  3OAW A;  2XEE A;  4XEI G;  2DCP A;  5JMN D;  3TWU A;  4A3V A;  5J90 A;  3C98 A;  2EQX A;  2A4Z A;  1UJK A;  2ETB A;  4JPS A;  2PL2 A;  2Y0B G;  2I2O A;  3LY9 A;  5B1A E;  5ARG A;  2IY0 C;  5HKP A;  4NIK A;  2KZT B;  5BV1 A;  3AAA C;  1UN9 A;  1P5Q A;  4XE0 A;  2VSO E;  3I5P A;  3X2Q E;  1U2V G;  3UIP C;  2WB2 A;  5G05 C;  4BER A;  4XI0 A;  4Z68 A;  3AG3 E;  2A5U A;  3PH0 C;  3ZEF A;  3PDN A;  4I17 A;  2A5E A;  1TJC A;  3PEV B;  4ILG A;  4BET A;  4NRH B;  4HRN A;  4BY6 A;  3PZ3 A;  4QFV A;  2PZI A;  3SZ7 A;  1A5E A;  3S7D A;  2E0I A;  2OV8 A;  2VGY A;  3B7R L;  2J08 A;  1HZ4 A;  3PEU B;  1Z6T A;  5AJL A;  1N4Q A;  3GZ2 A;  3JQ1 A;  2RFA A;  2YHC A;  4J8S A;  4U04 A;  4YND A;  2RKK A;  4GTM A;  3ZYL A;  1BI7 B;  3TAX A;  4U0Z A;  1N4R A;  5D0O D;  3FH8 A;  4LNU D;  3PE3 A;  3KSL A;  4KVM A;  4HB5 A;  2C0L A;  3Q79 A;  2WXK A;  1PC2 A;  5FQ4 A;  5JHA A;  1K1B A;  3DSX A;  4N3C A;  3T5V A;  5CMY A;  4KZ0 A;  2ZU6 B;  4EEC A;  2X6I A;  4JA9 A;  3R7Q A;  3ASH A;  2OEW A;  3TWS A;  5T8I A;  4E6H A;  2V8S E;  1D8E A;  4N2S A;  1BD8 A;  2Y4U A;  4HNA D;  5JA4 D;  4DLO A;  3ZYM A;  3TG4 A;  4GMJ A;  4GPM A;  3CVY A;  3NBN B;  2CG2 A;  4GYW A;  4EHM A;  3R9A B;  5BXU A;  1N95 A;  2IO2 C;  3D9K A;  4XKB A;  4F6R D;  2C0M A;  3HVE A;  3O4Z A;  2MRI A;  3K9I A;  4C48 B;  4DX2 A;  3FUD A;  1FVH A;  4DPR A;  3EU5 A;  5HS0 A;  3JQ0 A;  4I6J A;  4C9B B;  3L16 A;  4AVX A;  4JVS A;  2PM7 A;  4UQY A;  3B13 A;  3ULQ A;  3CVU A;  3S7B A;  1OT8 A;  4K03 A;  4RQI A;  5A6C A;  4UWG A;  4GTR A;  1TYQ G;  1FPP A;  2LSU A;  1HH8 A;  3ESL A;  4PUC A;  2V0P A;  4N5C A;  1TEZ A;  2FF4 A;  3R9M A;  4I1M A;  2R2L A;  5HI7 A;  2UY1 B;  2P9U G;  2OCC E;  5CBN A;  3FUM A;  4FJY A;  3B95 A;  4KT6 B;  2DIW A;  4KMO A;  1ELW A;  4OVV A;  3RU0 A;  4RG6 A;  4J6I A;  5BV0 A;  4GYO A;  2KC7 A;  3MGB A;  2ION A;  5AQB A;  2OOE A;  1MJ0 A;  3D9N A;  3AU5 A;  2VJ8 A;  2HM8 A;  4OVU A;  4URK A;  1Y6I A;  4P29 A;  1HG5 A;  3URZ A;  4ILH B;  4EPZ A;  3MKR A;  4J8E A;  2EIJ E;  2MHK A;  3MV3 B;  3ZFW A;  2IOS A;  2FI7 A;  3EJN A;  2AXV A;  4G2V A;  3PZ2 A;  2VGE A;  2L6B A;  2HR2 A;  4HRL A;  2BUG A;  3E33 A;  3PZD A;  4GYY A;  1N0Q A;  1NL4 A;  3IBE A;  3VLD A;  4AXH A;  3D9M A;  4EBA G;  4LNB A;  1OWO A;  3FU0 A;  4TXR A;  3DPY A;  4GA1 A;  2IJG X;  1SA4 A;  4GML A;  2I1J A;  2RD0 A;  2CG3 A;  2KCL A;  1PAQ A;  5CED B;  3G2W A;  3UXG A;  4GTT A;  4FLH A;  1JCR A;  1NA0 A;  2R05 A;  2LAI A;  2LSV A;  3EHR A;  4DJA A;  4GZC A;  3QKY A;  3ZYK A;  2XGO A;  2UY1 A;  2HO1 A;  5G55 A;  3LVQ E;  3CR3 A;  4HXI A;  1NFI E;  4CGV A;  1O1T A;  1QBQ A;  3FTV A;  5A23 A;  5AIJ A;  3CHS A;  1HU3 A;  1LTX A;  5LCW C;  5LX8 A;  3LVR E;  1YA0 A;  4ATZ D;  2ZGG A;  4H7Y A;  1IHG A;  3D9I A;  3HXB A;  4WND A;  3RRN B;  3QB2 A;  2KCV A;  5BXO A;  3U9W A;  4B0Z A;  3T8K A;  4WNF A;  3VTY A;  2KBX A;  3SO8 A;  2C2L A;  4A55 A;  3DPD A;  1JWG A;  3OXG A;  3ASO E;  5BW8 C;  4ANW A;  1WAO 1;  3FU5 A;  2WXP A;  2JAB A;  4XKC A;  2KXP C;  4L23 A;  3L08 A;  3ESK A;  3UKR G;  4L7T A;  4Q96 A;  1ZU2 A;  3SD5 A;  2H6I A;  2L6J A;  1Z3X A;  3PNL B;  4GAA A;  1QYM A;  2ZXW E;  4F1P A;  5FTP A;  5CEC B;  1UN8 A;  1OCZ E;  2EIM E;  1DCE A;  4BT8 A;  4AV7 A;  1FT1 A;  2KM4 A;  4HFG A;  2FEZ A;  2XGS A;  4KVO A;  3KD7 A;  3PS6 A;  2NC9 A;  4KYO B;  5FIN A;  5ARF A;  3WG7 E;  2P2C P;  3ZPJ A;  3DRA A;  1DC2 A;  1YMP A;  3CHP A;  3CGH A;  1N54 A;  2ZIR A;  3Q7F A;  4YDY A;  3FUK A;  3UQ3 A;  2LNI A;  2H6H A;  3C5R A;  4HOS A;  2MOW A;  1AP7 A;  1S63 A;  4G25 A;  3CHR A;  3OXL A;  1TNO A;  3JUE A;  3EHQ A;  4BEP A;  4GZ3 A;  3CVX A;  3BG1 B;  5DIZ A;  4K5B A;  1E8Z A;  3Q73 A;  2GRQ B;  1QZ2 A;  2GW1 A;  2NXP A;  3TGO A;  2BKG A;  4HS2 A;  3AU4 A;  2AXZ A;  2J4B A;  4YVO A;  2OVB A;  4I1A A;  4JEH A;  3U64 A;  3TJP A;  2AXU A;  3DXM G;  5M72 A;  3G2S A;  5EKQ D;  4WWN A;  5B1B E;  5AAO A;  3APC A;  1V55 E;  1ELK A;  4GTQ A;  3D9P A;  4WAF A;  4OYS A;  5ENQ D;  1G3N B;  2LAH A;  2OVF A;  3O48 A;  3L9T A;  3CST A;  4HLL A;  4HOR A;  3SQV A;  4FU3 A;  4I2W A;  4GU5 A;  2HE0 A;  4ATG A;  4Q69 A;  4GA0 A;  2EIL E;  5D66 A;  1IKN D;  5CEA A;  2ETA A;  3PZ1 A;  4XZ4 A;  3I3N A;  5FZS A;  2HYZ A;  2GGF A;  3DBS A;  2X6F A;  2X6H A;  2IOL A;  4I43 A;  1DNP A;  3ASD A;  2QY7 A;  3FEY A;  4CCA A;  3UM2 A;  2WPV A;  2NSZ A;  3UM3 A;  4F53 A;  5KJK A;  5EX3 A;  3E30 A;  3ASN E;  4A1G A;  3PE4 A;  2VTB A;  3FUF A;  4EBA A;  3UX4 A;  3HXD A;  5AQA A;  2F0Y A;  1W3B A;  2IO3 C;  1IYG A;  3FUI A;  2VQ2 A;  3MZL B;  3FP3 A;  3PVL A;  3U4T A;  2UWJ G;  1UJJ A;  3IV0 A;  1VDY A;  1SVX A;  3ZRH A;  1H2T C;  4TV3 A;  5G04 J;  2EIN E;  3CK7 A;  3W9G A;  4GB9 A;  3VLE A;  3EHM A;  4U8Y D;  1NP7 A;  3DSV A;  2WQ7 A;  1PY1 A;  3UPV A;  3CEQ A;  3T8M A;  2QC9 A;  3ZUV B;  4ZHB A;  3HRA A;  1B89 A;  2GRN B;  4FHK A;  4BTB A;  4AM9 A;  2WXI A;  4UI9 J;  1X5B A;  3BQO A;  3HXC A;  3ZNG A;  3RJV A;  3ZHE B;  4GZ6 A;  1MX2 A;  3MJW A;  3B7S A;  4CRW A;  1KLX A;  3MKQ A;  4LER A;  5E76 A;  2VSN A;  2WQH A;  4HI9 A;  1WM5 A;  3ABL E;  4WWP A;  1EDU A;  2WXN A;  4C0E A;  3L82 A;  5CMW A;  5H7P A;  3BEE A;  3L22 A;  5B3S E;  3QJZ A;  3AG1 E;  1E7U A;  4UWF A;  3HXF A;  1S64 A;  2IEJ A;  3T5X A;  3LY7 A;  3LS8 A;  5E75 A;  3ZXP A;  4N39 A;  1V54 E;  1KZO A;  3UT4 A;  4CT4 A;  4F7A A;  4IYP A;  3LY8 A;  3V2X A;  3FY4 A;  2KZT A;  1TNB A;  1EF1 C;  4B8C B;  4I9C A;  1RZ4 A;  5HRY A;  3DSU A;  2WMO A;  3G2T A;  5BPP A;  4ILI A;  1MZC A;  4XI9 A;  1SA5 A;  1N94 A;  3UIN C;  4AY5 A;  3WXX A;  4M7C A;  2H6F A;  3KS2 A;  3QAR A;  3CVQ A;  3ZGQ A;  3TXN A;  1MX6 A;  3Q78 A;  4HQD A;  2XS8 A;  2GRP B;  2BF0 X;  4G11 A;  3UM1 A;  1E90 A;  5KCM A;  5JJT A;  2XPY A;  3ZIM A;  3Q5M A;  4APF A;  3JUI A;  1S70 B;  1EYH A;  3NQP A;  2V5F A;  3NB2 A;  5EYL A;  5ENN A;  2WVI A;  4AOF A;  3I4G A;  1QQE A;  2DVW A;  2FO7 A;  3V79 K;  3ZN3 A;  2LXL A;  5CCM A;  2XHE A;  1INZ A;  2FUL A;  4TXQ A;  1OWN A;  4RLY A;  4ACK A;  3Q9U C;  3ZHE A;  1H6O A;  2OEV A;  4J8Y A;  3DST A;  4KBQ A;  2RFM A;  3L17 A;  3CKC A;  3C3R A;  1IXV A;  4O1O A;  1K1A A;  4ANX A;  3LPZ A;  4UUC A;  2P9K G;  3B7U X;  4DLQ A;  4NUR A;  2PNN A;  5CBO A;  2PQR A;  4YDO A;  3FTU A;  2P9L G;  2RG8 A;  4EZK A;  2LUH A;  4U0U A;  1TNZ A;  4IRU A;  4QQI A;  3D9O A;  4YVQ C;  3CK8 A;  4BT9 A;  1N4S A;  4DX1 A;  3HXE A;  4LCT A;  2VSX E;  4GA2 A;  4B89 A;  3FUJ A;  3ZW3 A;  4GMR A;  2JEK A;  2WMN A;  3CIA A;  4O60 A;  2X6J A;  1MX4 A;  2P58 C;  3TWV A;  3FTZ A;  3IKO B;  3HDX A;  1K8K G;  4U8V D;  3JYS A;  3CQC B;  4U0S A;  3E37 A;  1N0R A;  2CFZ A;  2VGX B;  5J08 A;  3Q47 B;  3MCX A;  3SGH A;  1UG3 A;  4EZJ A;  1OWL A;  3TXM A;  4EQF A;  1N11 A;  2J4D A;  3RK6 A;  1HE8 A;  4TUM A;  4LSZ E;  2XEV A;  2DYR E;  3SFZ A;  2J9Q A;  4G23 A;  3UKU G;  4JHJ A;  1HO8 A;  4AIF A;  3NAW A;  4BWR A;  4HOQ A;  4UI9 K;  4JZY A;  2IFU A;  4PS8 A;  4OAV B;  1NZN A;  4ABN A;  2R17 C;  2I6H A;  2BTD A;  3SF4 A;  4JHR A;  3BU8 A;  4JD2 G;  5T3R A;  3LEW A;  2J09 A;  3QWW A;  3LDZ A;  2XCC A;  4J8F A;  2PM6 A;  5EIL A;  5KJN A;  2IF4 A;  3SNX A;  1K3Z D;  4TRQ A;  1BPO A;  5KJM A;  4U95 D;  5ENP D;  1NI1 A;  1YCS B;  4XX5 A;  1E8W A;  5ANL A;  2J8S D;  4HRM B;  3T9K A;  4ME2 A;  3BG0 B;  2P9S G;  3DEO A;  4I1O B;  4D10 C;  1OCR E;  1TNY A;  2XCB A;  4I6E A;  4N3A A;  4JC8 A;  3BUA A;  3LJN A;  5ENS D;  3FEX A;  3L13 A;  4UWL A;  4MS6 A;  4CDR A;  2MYO A;  3B7B A;  2DYS E;  3DEP A;  4FLB A;  4G26 A;  5AEN A;  5LCW J;  3FUN A;  4J8D A;  5EYP F;  1LD7 A;  3NZS A;  3P2B A;  5ENR D;  1JPL A;  3C72 A;  3ULY A;  3ZU7 B;  3G2U A;  3RSE G;  4PS7 A;  4AJW A;  3ONL A;  3APD A;  5KNH D;  3SHF A;  1U3D A;  2XZT G;  4U7E B;  2P9N G;  2JLB A;  4J7W A;  4ACL A;  1S0P A;  3OXF A;  2B6C A;  3J5Q B;  3NOC D;  4EZL A;  2XPZ A;  3Q75 A;  1O1R A;  2YIN A;  3QC1 A;  3UTM A;  2EIK E;  3NZU A;  4FJZ A;  3RAU A;  1OXJ A;  1FVF A;  5FIO A;  4HOU A;  4CGW A;  2LO6 A;  1Z3Y A;  2CHX A;  5KBA A;  3SBT B;  4K5A B;  5FT9 A;  3MA5 A;  4BSX A;  2WXH A;  4FC8 A;  1Q2Z A;  2FO1 E;  1XNF A;  3U3W A;  3EHN A;  3AS8 A;  3JCK C;  1DVP A;  2V4H C;  3C3O A;  1FT2 A;  3S2A A;  3FFL A;  3LJ3 A;  2WXJ A;  4F1S A;  5C2Y A;  2XRY A;  3EIJ A;  1GW6 A;  5KNG A;  3FWV A;  3FTY A;  3FTX A;  4JXT A;  3TWW A;  1NA3 A;  4BFR A;  5ENO D;  1KPS B;  4F3V A;  3KSQ A;  1BI8 B;  3FDH A;  4BSZ B;  3ZYQ A;  3GW4 A;  4WNG A;  3GZS A;  3JXJ A;  2YHE A;  3V30 A;  3FTS A;  5D2M C;  4AP2 A;  3RO2 A;  4LRZ A;  3LKU A;  5LFA A;  2X38 A;  4U96 D;  2WQ6 A;  3Q4A B;  1A17 A;  4JEU A;  2VYI A;  3PUJ A;  4GCN A;  4G1T A;  4R7L A;  1KT0 A;  4JA7 A;  2DWZ A;  3SBS A;  3ML9 A;  2WXL A;  4Y6C A;  4YDE A;  4GTO A;  1TN6 A;  4BX8 A;  3QWV A;  4N3B A;  2QZA A;  1H2U A;  4FP7 A;  4ANU A;  2F8Y A;  4M3O A;  4G24 A;  4LG6 A;  3GYZ A;  4B8A A;  4L9P A;  5FQ8 A;  5D0Q D;  3FH7 A;  3OTN A;  1JUQ A;  1UW4 B;  4CEM A;  4G8K A;  3U66 A;  3AJI A;  1SQM A;  2PQN A;  4DX7 D;  3D3M A;  4B93 B;  4U63 A;  5JJ7 A;  2V4L A;  2OND A;  2XRZ A;  4DX5 D;  3HVE B;  4JHK A;  5G04 C;  1TN8 A;  3F6Q A;  3TWX A;  3N71 A;  2QFC A;  4KXK B;  4RSY A;  3ONK A;  1N9A A;  4UQZ A;  3R7R A;  4RG9 A;  4WUY A;  2LXM A;  1MYO A;  4L1B A;  2BKK B;  5G05 J;  3QK0 A;  3MEK A;  1Y8M A;  3KAE A;  4FUL A;  1HX8 A;  5LOZ A;  3P1U A;  4APO A;  1RW2 A;  1SZA A;  4DK5 A;  3TWR A;  2NYJ A;  4UI9 C;  3CVV A;  1HG2 A;  4PDX A;  1N4P A;  2WXR A;  2R59 A;  5G2N A;  2X3M A;  1JCS A;  3TWT A;  3AS5 A;  3CHM A;  4CDM A;  3UIO C;  3S7J A;  3CKB A;  3JXI A;  2DZO A;  5AYW D;  3QWP A;  3PRZ A;  5KWD A;  2R03 A;  4TXP A;  1OY3 D;  1ZBP A;  2X6K A;  4B94 A;  1HF8 A;  4O6F A;  3L6A A;  3AG2 E;  4U8H A;  3ULE G;  3E34 A;  1WY6 A;  2P9I G;  3UT7 A;  3G2V A;  4MBG A;  4DI4 A;  3Q15 A;  1N52 A;  4XIF A;  2H6G A;  3D9J A;  3IHY A;  4GZ5 A;  4ZFH A;  4JW1 A;  2WM9 A;  3UI2 A;  2QYJ A;  1BU9 A;  3SFY A;  3J5P A;  2ZIS A;  1HS6 A;  3CLJ A;  1TR4 A;  5ENT D;  2WXQ A;  2GRM A;  2L0T B;  1OCC E;  5DBK A;  4JB8 P;  1H19 A;  2M63 A;  3HHM A;  4BX9 A;  1MQS A;  4J0U A;  4A63 B;  3TL5 A;  5CRU A;  1IHB A;  1EPU A;  2IQC A;  4GCO A;  1HFA A;  3S7F A;  3QNK A;  3C3Q A;  1H2V C;  2GRR B;  5JJ6 A;  1OCO E;  2I9C A;  3MYV A;  4GPK A;  4UWH A;  2XEH A;  3DWL G;  2ILR A;  3PNT B;  3PUK A;  5AQ7 A;  4CYM D;  4L2L A;  4YDW A;  3B7T A;  3QAQ A;  2ZGD A;  4ANV A;  2Y1L E;  4X8Q A;  1ELR A;  4NAC A;  2AWI A;  3SI5 A;  4FHJ A;  3I4R B;  5EID A;  3CVW A;  3TWQ A;  1H6K A;  3DXK G;  2F37 A;  4KZC A;  3EDT B;  3ASG A;  3L54 A;  5CER B;  1OWP A;  1IQU A;  3EUV A;  4GTP A;  3VTX A;  2WXO A;  2FBN A;  3APF A;  4CDN A;  3D9L A;  1TJF A;  3HYM B;  4K5C A;  4C0M A;  1MHQ A;  4WWO A;  1TNU A;  2XZD G;  1IQR A;  2Y4T A;  3IXE A;  3ABK E;  2KCK A;  1WG0 A;  5AAR A;  5T4Y A;  4U07 A;  4UQX A;  5FZQ A;  3KEA A;  1UOH A;  2V5Q C;  4DI3 A;  4LUN U;  5CCL A;  1H0A A;  1O1S A;  2L9B A;  3CHO A;  3LYA A;  5JHB A;  5A7D B;  3V31 A;  3ML8 A;  3E4B A;  4HOT A;  2BED A;  4AY6 A;  4GTS A;  1L5J A;  4W9R A;  2R5S A;  3FTW A;  4Y6W A;  2WXM A;  4A1S A;  5EDS A;  2XS1 A;  4A3T A;  2J49 A;  4GTV A;  5CRV A;  3NF1 A;  3CHQ A;  4DRX E;  4CZ2 D;  5BUZ A;  2J07 A;  3DSS A;  1KT1 A;  1XGW A;  4WNE A;  1OWM A;  2B0O E;  3SFX A;  4IN3 B;  3FH5 A;  2AW6 A;  3CVP A;  3DSW A;  5FQ6 A;  5FQ7 A;  2WXF A;  5AN8 A;  2YQ8 A;  2F8X K;  5BT1 A;  4I6G A;  3VLF A;  3UT8 A;  5HQ8 A;  5EN5 D;  4JL0 A;  5IY5 E;  1JWF A;  3ISM C;  5ANR A;  2GRO B;  3RKV A;  4K0R A;  4H7X A;  2CHW A;  3EU9 A;  3ZVV A;  1AWC B;  3FUH A;  2GRL A;  2E2E A;  5EX0 A;  4MRU A;  3PZ4 A;  4HBD A;  3UM0 A;  3CSF A;  2YNQ A;  5C1D A;  1SW6 A;  2Y3A A;  3ZKJ A;  2IU1 A;  1E8Y A;  2CFU A;  1WDY A;  2QYU A;  2VSY A;  2CHZ A;  4HI8 A;  3W9F A;  3HG0 D;  4UWK A;  1FCH A;  4AEZ C;  3MV2 B;  2KAT A;  1D9S A;  3IHV A;  1E96 B;  3CV0 A;  4DUI A;  3CVN A;  3E32 A;  2XQ0 A;  3LXU X;  1QNF A;  3D9H A;  4O1P A;  2VGX A;  3FUL A;  1TN7 A;  3UMV A;  1O5M A;  4OAU C;  3CK9 A;  4RVB A;  5LP0 A;  4L2Y A;  3Q49 B;  4MLP A;  4G8L A;  2P9P G;  1Z5S C;  3V2O A;  5FWQ A;  4FA6 A;  3RO3 A;  4HLE A;  3FU6 A;  4LEU A;  4IUL A;  3SY2 A;  1LF8 A;  1SZ9 A;  3KEZ A;  3ASF A;  1LD8 A;  3RRM B;  3Q7A A;  3QDN A;  2R02 A;  5ITZ F;  1DCQ A;  4PH4 B;  3ENE A;  4N2Q A;  1D8D A;  2XEN A;  4Q94 A;  2Q7F A;  3LCA A;  2Y69 E;  4FAD A;  1HXI A;  1YYH A;  3CQG B;  1KZP A;  2VTB B;  3UUX A;  3NOG D;  4TUU A;  4BTA A;  2L0I A;  4GZD A;  2DBA A;  3RRU A;  4NQ0 A;  3GZ1 A;  1ZB1 A;  4N5Q A;  1E8X A;  4HVB A;  3TG5 A;  2ETC A;  3HIZ A;  2DZN A;  1X81 A;  5BNW A;  5AQ9 A;  3FHE A;  1JCQ A;  2I1K A;  3MX3 A;  3AS4 A;  3CVL A;  4MKT A;  5AJD A;  3QOU A;  3AG4 E;  2AJA A;  3ZXS A;  4BES A;  5EIB E;  4I9E A;  4E85 A;  4DX6 D;  3EIQ C;  4LNG A;  4PS3 A;  2XGM A;  3FUE A;  5KJL A;  2XPI A;  2AVP A;  3ABM E;  4I2Z A;  3IEG A;  3Q9N C;  5FZR A;  1OUV A;  4V3I A;  5CHE E;  3PRE A;  5FJY A;  4CT0 A;  1H6P A;  2WXG A;  1BLX B;  1E7V A;  3MKQ B;  3FU3 A;  3RIB A; 
#chains in the Genus database with same CATH homology
 1V54 E;  5IY5 E;  2EIN E;  5B1B E;  3AG3 E;  2OCC E;  1V55 E;  3AG2 E;  3ABM E;  2EIJ E;  2EIL E;  3AG4 E;  3ASO E;  3X2Q E;  5B3S E;  1OCC E;  3AG1 E;  2ZXW E;  1OCO E;  2Y69 E;  3ABK E;  2EIK E;  2DYS E;  3ASN E;  3WG7 E;  2DYR E;  1OCZ E;  3ABL E;  2EIM E;  1OCR E;  5B1A E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...