3CQCB

Nucleoporin nup107/nup133 interaction complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
225
structure length
186
Chain Sequence
SHMLSWLHEINSQELEKAHATLLGLANMETRYFAKKKTLLGLSKLAALASDFSEDMLQEKIEEMAEQERFLLHQETLPEQLLAEKQLNLSAMPVLTAPQLIGLYICEENRRANEYDFKKALDLLEYIDININDLKLEILCKALQRDNWVSKDSIFVKILLPEVKDLLQADEFVLKANYEYYVQGQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional studies of Nup107/Nup133 interaction and its implications for the architecture of the nuclear pore complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Nuclear pore complex protein Nup107
total genus 55
structure length 186
sequence length 225
ec nomenclature
pdb deposition date 2008-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1380 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3cqcB01
1.25.40.700 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3cqcB02
3CQCB 3I4RB 3CQGB
chains in the Genus database with same CATH superfamily
2QGSA 1WG0A 3Q47B 4U63A 2KXPC 3FTZA 2CHNA 3PRZA 1E90A 1EDUA 1OWAA 4N5CA 2PTFA 2R17C 1RZ4A 1Y6IA 1JNRA 3C3OA 3UX4A 4DR5T 3NOGD 1ELWA 3G06A 5FY1A 2A3DA 3KEAA 3EDVA 3UXGA 4JC8A 3DEOA 3QDNA 2HE0A 3U64A 4JI3T 1V9DA 2A9UA 5LFAA 3E4BA 4HOQA 2HM8A 4NIQA 3C72A 5FMNA 2DIWA 4O1OA 3FXDB 3NBXX 3JQ0A 1XMQT 4JHJA 3FU5A 4CT4A 2LSKA 4TWFA 2L9BA 2XGOA 3SRZA 4JI8T 4ILHB 5L3FB 3C98A 3ZN0B 3FTSA 4JW1A 4HQDA 5FXXA 4PNIA 4AKGA 3AS5A 4XX5A 3UKUG 3L22A 2DL1A 4CI1B 1NL4A 4RQIA 3LS8A 4YJ3E 4CN6A 3P50A 5H7PA 2WB2A 1L5JA 3ZNGA 2Q7FA 3K3NA 4HE8A 2WXNA 3CIAA 5KXJA 5LGUB 2DYRE 3Q79A 4HTEA 2OCCE 4PAGA 5KJLA 4IGUA 2XAQB 3D9OA 1BR1A 1KEYA 4K5CA 3UI2A 2SPCA 3C3QA 3PDYA 2LRKA 3ZYLA 3RIFA 1N0QA 2CPTA 2XQAA 1Z8UA 3UFGA 2XAHB 1OXJA 3BK9A 1Y8MA 2CHXA 4U8VD 5AQ9A 3FUHA 2X9HA 2VASA 3DXKG 3LEWA 4BA9A 2LSVA 3RAUA 2XQYA 3TWTA 3NOCD 2WB5A 4KX6A 2ZIRA 4XKCA 4HWIB 3FH7A 1H2VC 3SFXA 1PY1A 5L47A 3G2VA 3LK42 1HU3A 2XASB 2BBHA 1UW4B 4I0UA 4KVOA 1TN6A 3AAAC 2WP9A 3RQUA 4G2VA 3UM3A 1YKHB 5AQRB 3UU6A 3PU3A 3UUBA 2LHNA 3KVBA 4WNFA 4KI0F 4I1AA 2PNNA 3EDTB 4JEUA 3FH8A 4H63V 2WDRA 4CEMA 3UUMA 3CHPA 3HDXA 2J49A 2XEEA 1MMDA 2V4HC 2XS1A 2MOWA 5G04C 4DNDA 2YN6A 3Q9UC 1O5MA 3AG2E 3NWIA 5CMYA 3RRUA 1MX6A 3M3ZB 5KMGP 4K5AB 3ZXSA 4A5XA 3PUKA 3QJZA 5T8IA 2E2AA 4QXBB 3WI3A 4DLQA 5AQOB 3VR9A 5IHYA 4I50E 2L3LA 5L3GB 3I4RB 4NXMT 2WSSV 4QKNA 3S7FA 4PH4B 2V5QC 4EEBA 3ESLA 3UT8A 4P0BA 3WG7E 2VURA 3LK3B 4Q96A 3GZSA 4MKTA 5ADXL 2X9XA 3L13A 4U3CA 5FZQA 3UU5A 3I9WA 2OV8A 1UJJA 4RG9A 1N95A 2ODUA 3ZMZB 4NUVA 4CGWA 3I3NA 4Z8XA 3PZDA 1SHZC 1U3DA 3DSWA 3RO2A 4CN1A 2YHEA 5FINA 2JMKA 3IEEA 4PK4A 5JH7E 3DTOA 2X67A 2BVMA 4DR7T 1UN9A 3C4WA 1M7KA 5EK2A 4JPSA 4PS8A 3G2TA 4PS3A 1QZ2A 5FZSA 5JVDE 5J90A 3FZMB 3CSTA 2AXDS 2VKJA 4JEUB 4H9NC 1E8WA 2DWGA 2X6HA 1UN8A 4WUYA 5B1BE 4X5TA 3SFEA 4DI4A 1S70B 1VRBA 5DQVA 2AXUA 2K3WA 2KZ7B 2CXLA 3C98B 3AVSA 1LF8A 1T98A 2X9WA 3QAQA 1IZNB 3C4XA 3CVLA 2W00A 4ATZD 3L09A 1D8EA 2NXPA 4DO0A 2H89A 4YHJA 2VL8A 2EILE 3KAEA 1WYCA 5LP0A 1FVHA 5JREA 4ACKA 2UWJG 3MEKA 2XQ5A 4P09A 2W0GA 3FB2A 4HFHA 4DJAA 2WZIA 4X20E 3DSSA 3EHQA 4GMJA 5CEAA 2A72A 3AVRA 3RYCE 5EILA 1NZNA 4PUCA 4CDNA 1X9BA 1VCTA 3B7BA 1OEDC 4G26A 5JDGA 4J7WA 3N9MA 4K0KT 2FJEA 4GTOA 4TZ4C 2XQ4A 3JCFA 3AG3E 1AWCB 3JUEA 3HRAA 3AE1A 5G05J 1BR4A 3D9MA 2BG9A 2X6IA 3P4PA 2HN2A 3DBSA 1A17A 4AXHA 1MX4A 4UV9B 3OTOT 2VSNA 2XZDG 2P9BA 5ANLA 4G2AA 3PUWF 2ZXWE 3ZMVB 4XZCA 4EB6E 1E7VA 3B57A 4YSYA 4EQFA 2W2UA 3RYIE 2YKSA 5C2YA 3DJBA 3QWWA 2C2LA 3ETUA 2CFZA 4WNEA 4A1SA 4MBGA 5FXWA 2XSBA 4CDRA 3C51A 3A5XA 3QNUA 1DCEA 2M63A 3B7RL 5BUZA 4LRZA 5CRVA 3RPUA 5LGNB 2JLBA 3VR8A 2QYJA 2F8XK 1NP7A 2VK9A 4XEIG 1OCZE 5AQNB 4BJNA 1IXVA 4PS7A 3TLSA 3L6AA 4G1TA 5ABGA 5LOZA 3CKCA 2JIWA 4PK5A 3D9IA 1MMAA 1YQ4A 4CYMD 3PEVB 5LCWJ 3QOFA 3SF4A 4H9OC 4O4HE 2X6KA 3F6QA 2OEWA 5CHEE 4DPRA 2LSYA 1Z0PA 3ZYQA 2IO2C 3KSLA 2ETBA 1IKND 3KV9A 3MA5A 2M6BA 4JXTA 3FP3A 4AKRB 2CA5A 2XM2A 4ISSA 4BX9A 2PFVA 2X9YA 4BETA 1YMPA 1AP7A 2LT3A 3N2KE 4KXKB 2ES0A 2XJ7A 2GRRB 3Q5DA 2XENA 2MBGA 4IT4A 5LMUT 4TRQA 1KNPA 2GRPB 5JR9A 4DV5T 1DCQA 3FBZA 1D1CA 4AM9A 5HEOA 3P4WA 1H19A 3LBXA 3AE2A 1KZOA 4CN4A 5HEJA 2Y0BG 4FLHA 3RIUC 1IBMT 2LUHA 1BI8B 3U3WA 4OFZA 4ILUA 1N9AA 3ZMTB 4WNDA 3H3MA 1KT1A 4ZZBA 2GRQB 4Y6WA 5D0OD 4PK6A 3HI2A 5HWYA 3J9X1 4NUUA 1JPLA 5HRYA 4H9RC 1S94A 5HCJA 2P58C 4KUMB 3AE8A 4IIJE 1P5QA 4ZI7E 5LP6E 2D2SA 3TLUA 2FULA 3FZHB 5LGTB 3ZJ1A 3U66A 2UU9T 4O2AE 3MYVA 2YDQA 3DEPA 2YU1A 1ZEEA 2HH7A 1OCOE 3K3OA 1WAO1 2CG2A 3EHMA 1RW2A 5FXZA 3UKRG 1I94T 1FPPA 2EHOA 4ZS3A 4C9BB 1SW6A 3I5PA 2E8IA 4IL9A 1MNDA 4IYPA 3V79K 1HNWT 3I0QA 4DV2T 2VTBA 4DR1T 2NWBA 3IBEA 4YXDA 4YTPA 5J1GA 1OT8A 5EK4A 4AQFA 1VOMA 2NTXA 3S7BA 2WXPA 4ZS2A 4B3MT 3KD7A 4JI7T 3AE3A 2XY8B 5HEGA 2H88A 4GTVA 4AIFA 4EBAG 2LXLA 4C0EA 2I6HA 3MGBA 2KINB 4BSZB 3PS6A 3AE9A 3AB3B 4O4LE 4HLLA 3CVWA 2EIJE 3X1DA 3JADA 1W0AA 1EPUA 3CVNA 4DUYT 4UWLA 2XPZA 4DI3A 4WBOA 1KNRA 4DRXE 4DMVA 3RKGA 4J0UA 3PUGA 1O1TA 2Q9QB 5ABFB 3ZFWA 1LVKA 4YSZA 2PM7A 4U2ZA 4YDEA 2YDSA 3PUVF 3UQ7A 3CPZA 3LFMA 3FHEA 4L23A 3LY8A 5HEUA 4I55E 4OAVB 5L4EA 5AARA 4XI9A 5FQ6A 1SZ9A 5D2MC 1BR2A 3I9YA 5G55A 1US7B 2ZM0A 2XUEA 3UT7A 2LM9A 2VGYA 4I17A 3ONKA 2KWHA 3GYZA 1MJ0A 3AA0B 3ASNE 2KZTB 2WXOA 2PG8A 3IKOB 1EF1C 3TJPA 4GKJT 1DU2A 2ETAA 3CK6A 2J4DA 3PE4A 3TXMA 3CHSA 3ZIMA 5T4YA 2WBLA 4DV0T 2VSYA 3ABLE 3CV0A 3JAEA 5KNGA 3A7MA 5DJQC 1KFYA 4P29A 5ANRA 1HNXT 1ELRA 2KATA 4TV9E 3SWHA 4WZXA 3J5PA 3Q75A 3LBXB 3FY4A 2HR2A 4HI8A 4WNGA 4LG6A 2ZGDA 1Z5SC 2DZNA 4BT9A 5G04J 4G8LA 4LF8T 3PH0C 3Q7AA 3ONLA 4A63B 5ENRD 4MALA 2L6BA 4YNDA 2KC7A 4APFA 4GCOA 4F8HA 4ADZA 4F1PA 3Q15A 4ZI3D 5AQUB 2MYSA 4LMLA 2DYSE 2BG9E 2BDEA 4HFBA 4DMWA 5LXTE 2UXCT 3ABME 4RLYA 2P9SG 2YHCA 4TNWA 4UWHA 3DPYA 5LCYA 3C50A 1JNZA 4TNVA 5HXCA 4EIWA 4ILIA 3VLDA 4AJWA 5BT1A 4GPKA 3ZN1B 4GMRA 3QARA 2HPJA 2E0IA 5CCMA 4JV5T 3IV0A 3MJWA 4KP3C 2QA7A 3EABA 3VHLA 4GTRA 4XZ4A 2V1DB 5T3RA 4EBAA 4HFEA 4GZ5A 2C5IT 5HQ8A 3TLWA 1A5EA 4U96D 3P4QA 4JVSA 1GW6A 3NRXA 5AQHB 4ZFHA 3UTKA 5AQLB 1OCRE 2W61A 3AE6A 4LMJA 4B6XA 3J7Yq 2UUCT 3E32A 3TLVA 3FFLA 3E33A 4TUMA 4LMKA 2CE7A 4U95D 5HXSA 1WLXA 3ETVA 2V0PA 2BF0X 3HIZA 3RRNB 4IHJE 1SA4A 2WQ6A 1HO8A 2NTYA 3CVVA 5AQMB 2N9DA 4U0SA 2LE8A 3DSVA 2WU5A 3CSFA 1OWMA 2D9DA 3JUIA 1HX8A 3UQ3A 5J08A 2Y4UA 2WXRA 4DV4T 3R7RA 2WVIA 4FJYA 3EHZA 3L17A 1B7TA 5KX5E 2BUGA 3D0TA 3PZ2A 2NW7A 1O1SA 3EHNA 4P0AA 5HXHA 2HYZA 2P9LG 2WMOA 2XAJB 2M67A 4EYUA 1XNRT 3ASFA 4IULA 1XZYA 3FHNA 2VTBB 2UXBT 2GRLA 4G63A 2IFUA 5HI7A 3CIRA 3ZHEB 4DX2A 5ARFA 3CHQA 3LCAA 4O6FA 4GTTA 5JA4D 5AENA 5EN5D 3HR0A 4DV7T 4QH1A 1MQSA 4HN9A 4URKA 1H6KA 2NP9A 3OAWA 3MA9A 2FBWA 3TWQA 3ZKJA 3MKQA 5AQTB 4GKKT 1CHUA 4UF0B 1T7SA 1UURA 5JRCA 3QUJA 2FJDA 3ZMSB 4GYSA 2BKOA 3ENEA 3Q78A 4IDNA 1BI7B 2ODVA 4XBFB 2IIUA 2BBJA 3PU8A 3MCXA 4PJLA 5CRUA 2JQ9A 4LF9T 1ZU2A 3KVAA 4EXTA 2P2CP 3C64A 5AN8A 4BEPA 3ZGQA 4EZHA 3UINC 3PUJA 1K1BA 3L16A 5JJTA 3RIUA 4F53A 3CKDA 3SHFA 3BEEA 4KZCA 3TAXA 5BW8C 4AI6A 1VCSA 3ZXPA 4EGWA 2F8YA 5EK3A 1FMVA 5LHHB 3LXUX 4L9PA 1N54A 3E08A 3C3RA 2XRZA 2NOXA 2LRLA 3BG0B 4TXQA 4K0UA 1WM5A 2UY1B 3SQVA 3RRCA 3IBPA 3MK7C 4ILCA 2Z6EA 4ZHBA 3HXCA 2EHOB 4X62T 3Q5EA 4YT0A 1OY3D 3SGHA 1ZP0A 1QBQA 4IE0A 2C5JA 2XHEA 2J08A 2VKDA 4KHPT 2VGXB 2H6IA 5HXEA 3GN5A 2M6IA 1N4PA 3L39A 3Q49B 4MFRA 2YK0A 3QB2A 4JD2G 3ZSTA 5ENTD 2DI4A 3TWUA 3MX3A 4HS2A 5J2UE 3EIJA 3ZN3A 4ANVA 5FNVE 4QH5A 4C91A 4ANJA 1U3CA 2QZAA 2L0IA 3URZA 5CMWA 2F4VT 1S63A 2B76A 3ZYKA 1J5ET 3CX8B 1H6PA 3FU0A 2CMRA 3NRYA 1TYQG 1Z6TA 4UI9C 3ZJ2A 4ILAA 2JRKA 4LNUD 3EUVA 3BG1B 3UU8A 2OLTA 3QK6A 3CX6B 2KSRA 1ZHCA 5D0QD 3KSQA 1HTJF 4JI0T 5D66A 3LJNA 4LFAT 2MYOA 3LVQE 2AXZA 3K1SA 4P1NA 3CHOA 3KS2A 4UELA 4AKHA 2R59A 5GONE 4JI5T 5A7DB 1WR0A 5KNHD 2HHHT 1XWMA 3E22E 4CZ2D 2MPKA 1BU9A 4DIDB 2CHOA 2JPFA 2HO1A 4ZI3C 2CEAA 3UU4A 1KK7A 3N9NA 4AY6A 5KDMC 2ETCA 4GTMA 4APOA 3RX6A 2MOZA 2BKNA 4HORA 1LRZA 3N9LA 3FUDA 4O2BE 5AQVB 4IN3B 2E2EA 4LF6T 2YINA 4Y6CA 1QUUA 3BQIA 3RF1A 4IRUA 5J0ZA 4I1OB 3SO8A 3FH5A 3HL6A 4EZLA 3APCA 3O1JA 4ZHQE 3CVRA 4CZZB 5BR8T 4ZOLE 4YVOA 3UM1A 4OX9T 4JA7A 3H3AA 3VU7H 3HA4A 2J07A 2V26A 5AQJB 2VGEA 4U7YA 3NB2A 5LHGB 5FQ8A 4KMOA 4LNGA 1WR6A 2Q9QC 3N5LA 1Q2ZA 3QB5K 4WBNE 5HS0A 3T5XA 5LYJE 4HXIA 3AXJB 1N4QA 2CG3A 2UXNB 5CJ5A 4OHFA 5AQSB 4W9RA 1S35A 2L8KA 3KBTA 2I1JA 3T1YT 4PFOA 3DP7A 2VB6A 2WPVA 2IEJA 5A23A 2J1DG 4HEAA 2WM9A 3PTRB 1OUVA 4G23A 1INZA 3CK9A 3JXIA 3S7DA 1KZPA 2ZU6B 1KT0A 3V2OA 4GIWA 1OEDA 3GMIA 4EOZB 2OA5A 4IDQA 5JHAA 3ANWA 4FP7A 4QH4A 1E8XA 1V54E 2KCVA 5LOVE 5ENPD 5FT9A 5ENNA 2VGXA 2WXGA 3CK7A 3AA1B 3JAFA 1JUQA 5JRCB 2YQ8A 4C0MA 3ZSSA 4DV6T 2CLYB 2C0SA 3FUMA 4JZYA 3I4GA 1KLXA 3SY2A 4RVBA 3RRWA 3LVRE 2KM4A 4H9SE 4EZJA 5AIJA 5EIBE 2WXJA 4L0RA 4U72A 2IW5B 4TWDA 3HVEB 2X3MA 1NA3A 3EAMA 2VJ8A 2XAGB 2K9AA 1XMOT 2X6JA 2PQRA 5ARGA 3ZPJA 2BEDA 2W67A 1IAPA 3MJXA 4ZXLA 4QXCB 5JJ7A 3IHYA 2MRIA 1ZKEA 3RO3A 3X2QE 4NURA 4LFCT 4HWCA 4G8KA 3U4TA 3UU3A 1FEWA 3FEXA 3OTNA 1S0PA 4YY3T 4UV8B 1TNOA 3PURA 3G2WA 5M4YA 4GZCA 4EAHA 4JI1T 3UPVA 2RPAA 2V7IA 4Z91A 2VSOE 3QWVA 1GQEA 3D9JA 4N78D 1NI1A 4DR2T 5ABHA 4WYVA 1YKEB 4AISA 2I2OA 3AG4E 3T1HT 2N1GA 3MKQB 1FMWA 3T9KA 3ZEFB 2UUAT 3JQ1A 5LG3A 5F5WA 3ULYA 1HG5A 4Z68A 4GK0E 2XCCA 2PJQA 4I2ZA 2Y1LE 3UIPC 3CVXA 3HKDE 2BVLA 3RI5A 4HFDA 4J8YA 4IREA 4KVMA 4U0UA 1SVXA 1L0VA 3ZC0A 3ZLIA 2LM2A 3DSTA 3APFA 2NW9A 3APDA 2FBNA 4MHCA 3DRAA 4AOFA 1N4RA 3LG7A 5LJMA 2LAIA 3UT4A 4YHHT 4QXHB 3FUNA 4A3TA 5KJMA 3B7UX 1FIOA 1KPSB 2PM6A 4X8QA 2DVWA 1HH8A 2A5UA 4U7EB 3R9AB 4EECA 2LSIA 5LJNA 3CQXC 4KHZF 3O4ZA 5EKQD 5AQGB 3QOUA 4TUUA 4IE5A 4L1BA 4HLEA 2WXFA 2OVFA 1TJFA 1BPOA 3Q7FA 4DX7D 3PJAJ 5FVKA 5JQGE 3N9OA 4J8SA 2KCLA 2XGMA 4QQIA 2LAHA 4H7YA 3PNLB 2J47A 3K3QC 3P7IA 5C2TA 3NZPA 4C90A 3TXNA 2IAKA 2WQ7A 1N36T 2D0UA 3EU9A 5LMNT 3SBTB 3HKEE 2MTQA 1XDOA 2CRBA 3RIAA 3B95A 1TR4A 2WY2A 3P8CD 4L9IA 4MLPA 3LSVA 1S64A 2FO1E 3HKBE 5KJKA 2DBAA 3DPDA 2QYUA 4GPMA 4LF4T 4X65T 2F0YA 1ZOYA 2WZHA 4IDZA 2XQ8A 3SNXA 4COFA 2LHRA 4U74A 3JC6D 5HWXA 3IF8B 4JLEA 4LCTA 3QKYA 3FZKB 1FT2A 3CK8A 2NYJA 2EINE 1G73A 4BESA 4OK0A 2R05A 4EYYR 3TGOA 5KBAA 2G0UA 3CQCB 4AV7A 2VVNA 2NC9A 1OEDE 4PDXA 4CDMA 3V2XA 3R6NA 3AA7B 5CEDB 1Y64B 2UUBT 5JDHA 1XNQT 1N32T 5AJDA 4DK5A 5AJLA 3NVOA 4HFIA 1TJCA 4BTAA 5FZRA 2XCBA 3NQPA 3E30A 3R7QA 1KNZA 2CWOA 2ZLYA 4ANXA 3SS1A 1HNZT 5FWQA 3JC6C 4TN7B 2VKOA 2JQKA 4OYSA 4TV8E 1TEZA 3ABKE 4ERRA 1UGOA 3RGLA 2X66A 1CUNA 3IHVA 3RIBA 3PUZF 1BR0A 4G25A 2Y69E 4BY6A 1UOHA 1MMGA 1WYBA 2E9XD 5EZYE 1TNBA 3L8RA 3FUIA 3L9TA 3RLFF 3SI5A 3FTUA 4HVBA 2IUBA 2X0LB 5ABEA 1T72A 2V6YA 3KFWX 2IY0C 4JA9A 3SFDA 4I4TE 3UUNA 1W9RA 2DNXA 2LEHA 4YSXA 4B3ST 4GB9A 3BQLA 3UQ4A 3RHWA 2WWVA 5AQKB 3CLJA 2GK9A 2WQHA 4MRUA 2IDOB 1D0YA 4DR4T 4AQGA 4ANUA 5ETWA 3DWLG 5FY7A 5DIZA 2D5UA 2IHR1 2R6GF 4N3AA 2XQ7A 4JUYA 3ZYMA 2QRXA 3VLEA 4XI0A 1UUSA 1YXRA 4U8HA 2GW1A 3EIQC 4E7SA 4X64T 2WXLA 4LEUA 3FTXA 3AECA 5ABFA 3OJAA 4GU5A 4K0RA 4RSYA 4TV3A 1MNEA 3Q2MA 1IHBA 1FJGT 3PZ1A 3U9WA 3D3MA 4IL4A 4BWRA 2X0HA 4B8CB 4WNKA 3V5UA 2P9KG 4UI9K 2MAWA 3Q9DA 3RK6A 3MACA 3U3IA 1TN8A 2BG9B 2YOEA 3PJAA 3TWVA 2H3RA 5L2LA 4EEDA 3T8MA 3G2SA 2ZMAA 1E2AA 2V6XA 3D9HA 2DHRA 3AE5A 5B3SE 2KMFA 3TWXA 3LDZA 4BT8A 3JYSA 4A55A 3RYFE 4GZ6A 4OYKA 1TN7A 4CT0A 4N2QA 4GA1A 5JR9B 4UVBB 2OEVA 5EYPF 4PW8A 2GRNB 2DZOA 4M7CA 2E5VA 2R5SA 2CCQA 3UMVA 3LY9A 5LCWC 3AAEB 3T8OA 4HOSA 3DSXA 2AE9A 4A97A 4B93B 5LX8A 3ZKRA 2X51A 2VWAA 4GA2A 4HFCA 2WAUA 3UIOC 4O4JE 4ACLA 5JDFA 1E1HB 1D1BA 3DXMG 1LKXA 3KBUA 1W3BA 3EI0A 2KNDA 3ABVA 3JXJA 3LY7A 4CXWA 2W66A 1U4QA 1MIYA 3MV2B 1E8ZA 4JI2T 4AVXA 4MS6A 2P9UG 5ENQD 2DWZA 3O1HA 3EVYA 3RH3A 1LVFA 4DV1T 3VKHA 1B89A 3FU3A 3MXZA 1WDYA 5IY5E 2KBXA 3UTMA 3DSUA 4U31A 3ASGA 3H37A 4K5BA 2XQ0A 2EIME 5AYWD 3SBSA 2RA1A 2K24A 4KBMB 2VYIA 3JCKC 5AQIB 2E9XA 5FQ7A 5JDNA 3FTYA 1W09A 1G8XA 2ACZA 1TNZA 3PUSA 3P1UA 1SA5A 5E76A 3SD5A 3C5RA 3O48A 3QWPA 3RU0A 4N2SA 4U8YD 2XAFB 4J8EA 1OWLA 2EHOC 4HB5A 3HVEA 3KINB 1Z3YA 5CECB 3B7SA 3CVPA 4FULA 2IOSA 2DWKA 3PVLA 2XPYA 4AIUA 2LKGA 2A5EA 4U33A 2AJAA 5EIDA 3W9GA 4HRLA 2V5DA 3BQKA 2L9QA 4IDOA 3AEFA 2P9IG 3ZT7A 4CXXA 3J5QB 2H6GA 4CXYA 3L82A 4HWFA 5LHIB 5L3CB 3F57A 4IE6A 4D10C 4GCNA 2LKHA 3UM0A 2RD0A 2IC6A 2NSZA 4RG6A 3VRBA 3OBVE 2EHOD 3ZMUB 4UXNB 2A4ZA 4AKIA 2BKGA 3ML8A 4R7LA 5B1AE 2Y8DA 1HFAA 4B94A 3I0OA 1LD8A 4LUNU 2WXQA 2GRMA 1HCIA 5BXOA 3D9NA 1HF8A 5IWAT 3E34A 3EDUA 2XPKA 1NAFA 2WXHA 3GWHA 2IO3C 2LO6A 2RFMA 1N4SA 2FI7A 3UT5E 5EYLA 2XQ9A 5JMND 2J09A 1IBLT 3ZU7B 1SZAA 2I1KA 2J8SD 3QB5A 1G3NB 2OV9A 3ZUVB 5KWDA 3AEAA 2RP4A 1N52A 1N0RA 4PJNA 1O3XA 2XZEA 3AEBA 3CGHA 1D8DA 2WCAA 2QYWA 4HFVA 2BS2A 2JQHA 1H7CA 2I9CA 2W4XA 2H7VC 1E8YA 5BPPA 4DR6T 4AP2A 3B13A 5G05C 3MZKB 3NKZA 4X66T 3O9XA 3IXEA 3N71A 5L4HA 2HPLA 5HXRA 2XEVA 4ZI2C 1I6ZA 4I43A 3CR3A 4HRMB 5LG4A 3ZPOA 3AA6B 3K8PC 3B7TA 2YNQA 2DLRA 4HBDA 3AU4A 2RFAA 4YTMA 5JDQA 5AQAA 4L5GA 4FHKA 4CGVA 3L08A 4UWGA 4N3CA 3E37A 3TG4A 2VL0A 1J5WA 4HOTA 3PUXF 3TG5A 2JMHA 2ZGGA 3AE4A 4OYJA 3VTYA 4O8SA 5DBKA 1VDYA 1Y01A 4K03A 5L3EB 2EIKE 3ZEFA 4F7AA 2UY1A 3FTWA 4NPPA 3AS4A 2OOEA 3S2AA 4F6RC 3AG1E 5ITZF 5JR9C 2C0MA 4O4IE 5J2TE 4MLKA 4AQFC 1LD7A 1MZCA 3P2BA 4V1Av 2R2LA 3W15B 3K9IA 3HXEA 2XEHA 3QNKA 3Q4AB 5CFBA 2LSJA 4M3OA 2DCFA 2Y48B 2L0TB 4NACA 3CVQA 4HFGA 1WRDA 4TXPA 2WU2A 4BTBA 4AY5A 3AS8A 1IQRA 4ANWA 4DVDA 4V3IA 3MKRA 3KV5A 3ZT6A 5L3DB 4KZ0A 1HG2A 3KV4A 4PJMA 4FADA 2V5FA 3ZRHA 5JJ6A 3IEGA 3ONLC 4GTSA 1QYMA 1FVFA 4EZ4A 1H2UA 3SFZA 4AXPA 4QFVA 4ME2A 4DUZT 3PZ4A 4EPZA 3AJIA 3SOLA 5E0OA 3UULA 1IJ6A 4JYAT 3Q5XA 4GYOA 3E0ZA 1LTXA 4UQZA 1E7UA 2PBIA 4I6EA 5FQ4A 4NIKA 3ZC1A 3WAKA 4FU3A 1ZBPA 5DQWA 5LBMA 1X79A 4I43B 2A2FX 5EX0A 5HYAA 3ASHA 2CFUA 3CVUA 3L3PA 3C4ZA 3V30A 2V7LA 1ZV4X 2UXXB 5DABA 3EUHA 3BU8A 4JHRA 1OEDB 4DBQA 3R9MA 2UXDT 3UUXA 5LB7B 3ANWB 1OWPA 3GZ1A 1SUMB 3WAJA 2D0TA 2V6YB 5HEHA 1WY6A 5ENSD 2C0LA 1MMNA 4YTNA 2CXDA 4G24A 2FF4A 2H6FA 5BXUA 1QNFA 2YEVC 3ULEG 1JWGA 4KMCA 1SE7A 4HI9A 3UFEA 3Q5WA 2ONDA 4L2YA 4N39A 3L54A 2E9XC 2K5BB 4LSZE 3V31A 3FBLA 3ASDA 3HYMB 3RC3A 4U7IA 3PE3A 1OWNA 4WWPA 4X1IE 3AAIA 4Q25A 3FUJA 5G2NA 1QLBA 4Q94A 2NW8A 1JCSA 5LBQB 3TWSA 4BX8A 3RQWA 2N2NA 2CWYA 2IC9A 4UIGA 3OXGA 4KBQA 4CQIA 1U2VG 2Y6XA 1DC2A 2EQXA 3TWRA 1SA0E 3VLFA 3ZHEA 3MV3B 1HXIA 3LKUA 1QQEA 3FWVA 4I1MA 3ULQA 2V8SE 5C8YE 4YDWA 2KLQA 1K8KG 2FUPA 4IE4A 5CB4E 2WMNA 5CBOA 4LNBA 4BERA 2H7OA 1N34T 4AEZC 5CA1E 2QC9A 5E75A 2ILRA 4GZ3A 3GA8A 4PFPA 1AJ3A 3ISMC 2LOPA 5FL0A 3N9PA 1IYGA 1NFIE 2WXMA 4FLBA 2C5KT 1V55E 2W62A 1ELKA 3V5SA 2CM0A 4L2LA 2BS3A 1YQ3A 3S4UA 2CBIA 3LPZA 3CVYA 4N5QA 1FT1A 1YCSB 2VSXE 4DX1A 1J1JA 2KCKA 1XDPA 1DNPA 3ML9A 3OPCA 4JEHB 4E7ZA 3ONJA 5AQPB 2WXIA 1UCUA 3VKGA 5A1LA 5FP3A 3AAAB 2VQET 2IOLA 4GTQA 1U5PA 1TNYA 1D0XA 4TXRA 4GA0A 4I2WA 4J8FA 4L7TA 4A3VA 4BSXA 3NF1A 5JHBA 4UWFA 2X6FA 4LERA 1NWMX 3G2UA 4HWDA 4FI5A 5FYMA 3PEUB 2FEZA 4NQ0A 1XGWA 2VQ2A 4X1YE 2WQYA 1DVPA 2R03A 1KF6A 1HR0T 4FJOA 1N11A 3KEZA 2V7KA 5EX3A 5M72A 3CX7B 2V7JA 2LOSA 4ZI2D 4BFRA 3ZW3A 4I9CA 4UEMA 1JCQA 3GZ2A 3CKBA 2KT9A 5BNWA 3W9FA 3LYAA 4ILBA 4UVAB 4TWHA 2AVPA 1JWFA 1MIVA 4JI4T 4XE0A 1XNFA 2WXKA 3WXXA 1T8BA 4IDPA 4A98A 3PREA 2HN1A 2IJGX 3AEEA 5L3BB 1MX2A 3OXFA 3RKVA 5H6RB 1UX4A 2BS4A 3F31A 4PJJA 4AQYT 5AQFB 4H9QC 4QWNB 3N2OA 4KYOB 2LNIA 2ZM8A 2Y3AA 2B0OE 4JBWF 2BKKB 3OXLA 2QY7A 2CBJA 4U2YA 2J9QA 3O1IA 3AXJA 2JQQA 2XQ6A 2B6CA 5F8PA 4DX5D 1UG3A 3MKDA 1FCHA 3CWZB 3D9PA 4ABNA 4Z90A 4ILGA 1IQUA 2IQCA 5KJNA 4WWOA 2X68A 5IUXA 2J4GA 3A8YC 2IONA 2QVAA 1TNUA 1QSDA 5AAOA 2XZTG 3RRMB 2CLYC 1M62A 1EYHA 2XTLA 4DR3T 1YYHA 4F1SA 3EHRA 1O1RA 1YA0A 3NAWA 4GYWA 2CXFA 2BKPA 2W63A 1K1AA 3NBNB 3PNTB 3SZ7A 4QX7B 4U07A 1EZ3A 5CBNA 5C3JA 4H7XA 1OWOA 5HAXA 3LJ3A 3FU6A 1BD8A 4UWKA 2IF4A 4XAXB 3VRAA 2F37A 2V5CA 1SQMA 4B89A 2GROB 3CQGB 4ASKA 1UX5A 4UQXA 2Y4TA 4GYYA 1NEKA 3BUAA 1HZ4A 4KT6B 3SFYA 3N9QA 5LA6E 4UR9A 4JHKA 3ONXA 5ENOD 3NZSA 4OVUA 3KV6A 4CI3B 3Q5MA 2B1EA 4HKAA 4YDOA 2XM1A 2PQNA 4JB8P 2LSUA 3PZ3A 4GMLA 2LJLA 4G11A 4F6RD 3PUYF 4ATGA 5IYZE 5C1DA 3FZLB 3LJCA 3ZCJA 5JDMA 1IJ5A 5FY0A 5BMVE 2E9XB 4B8AA 3MZLB 2VQFT 3ZCIA 4HRNA 2I0MA 1YD8G 5CCLA 2KXPB 3M65A 2J62A 4J2CA 1IBKT 4LF7T 5H6QB 2WS3A 2E5LT 3TLTA 3ESKA 4CCAA 4EHMA 2WDVA 3QC1A 4GTPA 4DUIA 1D9SA 2P9NG 3RJVA 3TKLB 3QK0A 4I6JA 4YLHA 3RSEG 1N33T 2X0YA 1E96B 3P4SA 2Q9QD 1IHGA 3P4RA 1W0BA 5TAOA 3TWWA 2AW6A 1HS6A 4E6HA 3PDNA 4LFBT 4LF5T 3FTVA 4HNAD 3GN5B 1E7PA 2V4LA 4EZKA 4MBQA 4TUYE 2XRYA 2BTDA 3RYHE 3AE7A 3AEGA 1X81A 2DCPA 5FJYA 4O1PA 1WCRA 2LSGA 4IE7A 4QX8B 2XPIA 4ZZCA 2FO7A 4CI2B 4HOUA 5CGMA 3QC9A 2GGFA 4GYRA 3IA3A 3EJNA 3D9LA 5FTPA 3OYXA 3VTXA 4JEHA 4TX5A 4A56A 3R84B 4HWHA 1OXZA 5HKPA 1BLXB 3FUEA 4OAUC 2IMLA 3N2GE 2AXVA 3RKOA 2QFCA 2XQ3A 1WFDA 2WWUA 3PUQA 2RG8A 2V7MA 3I1AA 1MIWA 5EDSA 1OCCE 1K3ZD 3UUXB 3CHMA 4J8DA 2R02A 5AQBA 1H0AA 2JJ9A 2VKHA 2WDQA 4B3TT 2KZTA 3Q73A 4X1KE 2XS8A 3PUAA 4I9EA 2XGSA 3EU5A 3CEQA 1PAQA 3FUKA 4F3VA 4E85A 3FDHA 3HXBA 1UJKA 3CHRA 3HXDA 3OYZA 1R8IA 4I6GA 3CMLA 4NRHB 3OKQA 5HCMA 5FKYA 4Q69A 1X5BA 2MHKA 2J4BA 4J6IA 1Z3XA 3FZFB 1UK5A 4XKBA 3ZT5A 1D0ZA 3GW4A 4YDYA 3S7JA 5AFUL 4O60A 4NXNT 4QHOA 2IU1A 2PZIA 4WW0A 4OVVA 4FHJA 2Q9QA 5AQQB 3ASOE 3Q9NC 2NR4A 2RKKA 1HS7A 5FL1A 2VVSA 2V8SV 3RC8A 2KWIB 4DV3T 3AU5A 4B0ZA 3NZUA 4GAAA 1HX1B 3T5VA 4A1GA 3T8KA 5FXVA 4BJMA 2L6JA 3F2EA 4DX6D 3ZVVA 5FVLA 4GZDA 4XIFA 3UM2A 2BG9C 5JDLA 4EV6A 2YDRA 2OVBA 4DLOA 1YW0A 4FJZA 5BV1A 3FXEB 5A6CA 1H6OA 5KCMA 3FUFA 3OVUA 4UQYA 3HG0D 5BV0A 3B5MA 5FIOA 2LLYA 3NZQA 2X38A 2JEKA 2XHEB 3HKCE 2CHZA 1HE8A 4YJ2E 4FC8A 2CHWA 1PC2A 4UVCB 2H6HA 2ZISA 4UF0A 4UI9J 1H2TC 1ZB1A 2PL2A 5CA0E 3LDQB 2ZM2A 1NA0A 4U04A 5AQ7A 3O4XE 4YFSA 5LNKA 2JABA 4BAYB 1MYOA 4DBRA 4B3RT 4JI6T 2P9PG 2K48A 2ACXA 4WWNA 1NENA 3D9KA 3PV0F 4M1PA 1JCRA 4FA6A 5F3JA 4N3BA 2ZM6T 5CERB 4GOUA 4JL0A 3HHMA 3TL5A 3U78A 2FJBA 2BZBA 4GK5E 4HGAA 4UUCA 2AWIA 3LK2B 3BQOA 3PE0A 3IHRA 1N94A 3HXFA 3AEDA 3KDSE 4AKLA 5JTGA 3FULA 2XSAA 4ISTA 4ZEYA 4C48B 2YU2A 2FJAA 2LXMA 4WAFA 4CRWA 4H9PC 4H63H 1D1AA 3FEYA 1MHQA 4U0ZA 4YVQC 2I59A
chains in the Genus database with same CATH topology
2QGSA 3Q47B 4U63A 3FTZA 3PRZA 1E90A 1EDUA 1OWAA 4N5CA 2R17C 1Y6IA 3UX4A 1ELWA 5FY1A 2A3DA 3EDVA 4JC8A 3QDNA 3U64A 1V9DA 5LFAA 3E4BA 4HOQA 2HM8A 5FMNA 2DIWA 3FXDB 3NBXX 3JQ0A 4JHJA 3FU5A 4CT4A 2LSKA 2L9BA 2XGOA 3SRZA 4ILHB 5L3FB 3C98A 3ZN0B 3FTSA 4JW1A 5FXXA 4PNIA 4AKGA 3AS5A 4XX5A 3L22A 4CI1B 3LS8A 4YJ3E 2WB2A 1L5JA 2Q7FA 3K3NA 4HE8A 2WXNA 3CIAA 5LGUB 4HTEA 4PAGA 5KJLA 4IGUA 2XAQB 3D9OA 1BR1A 2SPCA 3PDYA 3ZYLA 2XAHB 1Y8MA 3BK9A 2CHXA 3FUHA 2X9HA 2VASA 3LEWA 4BA9A 2LSVA 2XQYA 4XKCA 3FH7A 1H2VC 1PY1A 3G2VA 3LK42 1HU3A 2XASB 1UW4B 4KVOA 4G2VA 1YKHB 3PU3A 2LHNA 3KVBA 4WNFA 4I1AA 3EDTB 4JEUA 3FH8A 4H63V 4CEMA 3UUMA 3CHPA 3HDXA 2J49A 1MMDA 2MOWA 5G04C 4DNDA 3RRUA 5CMYA 3ZXSA 5KMGP 3PUKA 3QJZA 5T8IA 4QXBB 3WI3A 4DLQA 5IHYA 4I50E 2L3LA 5L3GB 3I4RB 2WSSV 4QKNA 3S7FA 4PH4B 3ESLA 3UT8A 4P0BA 3LK3B 4Q96A 3GZSA 4MKTA 5ADXL 2X9XA 3L13A 5FZQA 3I9WA 2OV8A 1UJJA 4RG9A 2ODUA 3ZMZB 4NUVA 4CGWA 3I3NA 4Z8XA 3PZDA 1SHZC 1U3DA 3RO2A 2YHEA 2JMKA 3IEEA 4PK4A 5JH7E 3DTOA 2X67A 2BVMA 1UN9A 3C4WA 4PS8A 5EK2A 4JPSA 3G2TA 4PS3A 1QZ2A 5FZSA 5JVDE 5J90A 3CSTA 2VKJA 4JEUB 4H9NC 1E8WA 2DWGA 2X6HA 1UN8A 4WUYA 4DI4A 1VRBA 5DQVA 2AXUA 3C98B 2KZ7B 2CXLA 3AVSA 1LF8A 1T98A 2X9WA 3QAQA 1IZNB 3C4XA 3CVLA 2W00A 3L09A 2NXPA 4DO0A 4YHJA 2VL8A 3KAEA 1WYCA 5LP0A 1FVHA 5JREA 4ACKA 2UWJG 3MEKA 4P09A 2W0GA 3FB2A 4DJAA 4X20E 4GMJA 2A72A 3AVRA 3RYCE 1NZNA 4PUCA 4CDNA 4G26A 5JDGA 3N9MA 4TZ4C 5G05J 1BR4A 3D9MA 2X6IA 3DBSA 1A17A 4AXHA 4UV9B 2VSNA 5ANLA 2P9BA 4G2AA 3ZMVB 4XZCA 4EB6E 1E7VA 3B57A 4EQFA 3RYIE 5C2YA 3DJBA 3QWWA 2C2LA 3ETUA 2CFZA 4WNEA 4A1SA 5FXWA 4CDRA 3C51A 3A5XA 2M63A 3B7RL 5BUZA 4LRZA 3RPUA 5LGNB 2JLBA 1NP7A 2VK9A 4BJNA 4PS7A 3L6AA 4G1TA 5LOZA 3CKCA 4PK5A 3D9IA 1MMAA 3PEVB 5LCWJ 3SF4A 4H9OC 4O4HE 2X6KA 5CHEE 4DPRA 2LSYA 1Z0PA 3ZYQA 3KV9A 3MA5A 4JXTA 3FP3A 4AKRB 2CA5A 4ISSA 4BX9A 2PFVA 2X9YA 2LT3A 3N2KE 4KXKB 2ES0A 2MBGA 4TRQA 5JR9A 3FBZA 1D1CA 4AM9A 1H19A 3LBXA 4FLHA 3U3WA 4OFZA 4ILUA 3ZMTB 4WNDA 1KT1A 4Y6WA 5D0OD 4PK6A 3HI2A 5HWYA 3J9X1 4NUUA 1JPLA 4H9RC 1S94A 2P58C 4KUMB 4IIJE 1P5QA 4ZI7E 5LP6E 2D2SA 2FULA 5LGTB 3ZJ1A 3U66A 4O2AE 3MYVA 2YU1A 1ZEEA 2HH7A 3K3OA 1WAO1 2CG2A 3EHMA 5FXZA 2EHOA 4ZS3A 4C9BB 3I5PA 2E8IA 1MNDA 4IYPA 3I0QA 2VTBA 2NWBA 3IBEA 5J1GA 5EK4A 4AQFA 1VOMA 2NTXA 3S7BA 2WXPA 4ZS2A 3KD7A 4AIFA 4EBAG 4C0EA 2I6HA 3MGBA 2KINB 3PS6A 3AB3B 4O4LE 3CVWA 1EPUA 3CVNA 4UWLA 2XPZA 4DI3A 4WBOA 4DMVA 4J0UA 3PUGA 2Q9QB 3ZFWA 1LVKA 2PM7A 3CPZA 3LFMA 3FHEA 4L23A 3LY8A 4I55E 4XI9A 5FQ6A 1SZ9A 1BR2A 3I9YA 5G55A 1US7B 2ZM0A 2XUEA 3UT7A 2LM9A 2VGYA 4I17A 3ONKA 2KWHA 3GYZA 3AA0B 2KZTB 2WXOA 2PG8A 3IKOB 1EF1C 3TJPA 2J4DA 3PE4A 3TXMA 3CHSA 3ZIMA 5T4YA 2WBLA 2VSYA 3CV0A 5DJQC 4P29A 5ANRA 1ELRA 2KATA 4TV9E 3SWHA 3FY4A 3LBXB 2HR2A 4WNGA 4BT9A 5G04J 3PH0C 3ONLA 4MALA 4YNDA 2KC7A 4APFA 4GCOA 4ADZA 3Q15A 4ZI3D 2MYSA 2BDEA 4DMWA 5LXTE 2YHCA 4UWHA 5LCYA 3C50A 5HXCA 4EIWA 4ILIA 3VLDA 4AJWA 5BT1A 4GPKA 3ZN1B 3QARA 2HPJA 2E0IA 5CCMA 3IV0A 3MJWA 4KP3C 2QA7A 3VHLA 5T3RA 4XZ4A 2V1DB 4EBAA 4GZ5A 5HQ8A 2C5IT 4JVSA 1GW6A 3NRXA 3UTKA 2W61A 3J7Yq 4B6XA 3FFLA 2CE7A 5HXSA 1WLXA 3ETVA 2V0PA 2BF0X 3HIZA 3RRNB 4IHJE 2WQ6A 1HO8A 2NTYA 3CVVA 2N9DA 4U0SA 2LE8A 3CSFA 1OWMA 3JUIA 1HX8A 3UQ3A 5J08A 2Y4UA 2WXRA 3R7RA 2WVIA 4FJYA 3L17A 1B7TA 5KX5E 2BUGA 3D0TA 2NW7A 3EHNA 4P0AA 5HXHA 2HYZA 2WMOA 2XAJB 2M67A 4EYUA 4IULA 3ASFA 2VTBB 3FHNA 2GRLA 4G63A 2IFUA 5HI7A 3ZHEB 5ARFA 3CHQA 3LCAA 4O6FA 5AENA 3HR0A 1MQSA 4HN9A 4URKA 1H6KA 2NP9A 3OAWA 3MA9A 3MKQA 4UF0B 5JRCA 3QUJA 3ZMSB 4GYSA 3ENEA 2ODVA 4XBFB 3MCXA 3PU8A 4PJLA 1ZU2A 3KVAA 4EXTA 3C64A 3ZGQA 4EZHA 3PUJA 3L16A 5JJTA 4F53A 3CKDA 3SHFA 3BEEA 4KZCA 3TAXA 5BW8C 4AI6A 5EK3A 1FMVA 5LHHB 3LXUX 1N54A 3E08A 2XRZA 2NOXA 3BG0B 4K0UA 1WM5A 2UY1B 3RRCA 3IBPA 3MK7C 2Z6EA 2EHOB 3SGHA 4IE0A 2C5JA 2XHEA 2J08A 2VKDA 2VGXB 5HXEA 3GN5A 3Q49B 4MFRA 2YK0A 3QB2A 2DI4A 3MX3A 4HS2A 5J2UE 3EIJA 3ZN3A 4ANVA 5FNVE 4C91A 4ANJA 1U3CA 2L0IA 3URZA 5CMWA 3ZYKA 3CX8B 3FU0A 2CMRA 3NRYA 1Z6TA 4UI9C 3ZJ2A 2JRKA 3BG1B 3QK6A 3CX6B 1ZHCA 5D0QD 1HTJF 3LVQE 2AXZA 3CHOA 3KS2A 4UELA 4AKHA 2R59A 5GONE 5A7DB 3E22E 2JPFA 2HO1A 4ZI3C 2CEAA 1KK7A 3N9NA 4AY6A 5KDMC 4APOA 3RX6A 2MOZA 4HORA 1LRZA 3N9LA 3FUDA 4O2BE 4IN3B 2E2EA 2YINA 4Y6CA 1QUUA 3BQIA 4IRUA 4I1OB 3FH5A 3HL6A 4EZLA 3APCA 3O1JA 4ZHQE 3CVRA 4CZZB 4ZOLE 4YVOA 4JA7A 3H3AA 3VU7H 3HA4A 2J07A 2V26A 5LHGB 5FQ8A 4KMOA 1WR6A 2Q9QC 3N5LA 4WBNE 3T5XA 5LYJE 4HXIA 2CG3A 2UXNB 4OHFA 4W9RA 1S35A 2L8KA 3KBTA 2I1JA 4PFOA 3DP7A 2VB6A 2WPVA 5A23A 2J1DG 4HEAA 2WM9A 3PTRB 1OUVA 4G23A 1INZA 3CK9A 3S7DA 2ZU6B 1KT0A 4GIWA 3GMIA 4EOZB 2OA5A 5JHAA 3ANWA 4FP7A 1E8XA 5FT9A 2KCVA 5LOVE 5ENNA 2VGXA 2WXGA 3CK7A 3AA1B 1JUQA 5JRCB 2YQ8A 4C0MA 2CLYB 2C0SA 3FUMA 4JZYA 3I4GA 1KLXA 4RVBA 3RRWA 3LVRE 2KM4A 4H9SE 4EZJA 5AIJA 2WXJA 4L0RA 4U72A 2IW5B 3HVEB 2X3MA 1NA3A 2VJ8A 2XAGB 2K9AA 2X6JA 2PQRA 5ARGA 3ZPJA 1IAPA 3MJXA 4QXCB 5JJ7A 3IHYA 2MRIA 1ZKEA 3RO3A 4NURA 3U4TA 1FEWA 3FEXA 3OTNA 1S0PA 4UV8B 3G2WA 3PURA 3UPVA 5M4YA 4GZCA 4EAHA 2V7IA 2VSOE 3QWVA 3D9JA 4N78D 1YKEB 2I2OA 2N1GA 3MKQB 1FMWA 3ZEFB 3JQ1A 1HG5A 4GK0E 2XCCA 2PJQA 4I2ZA 3CVXA 3HKDE 2BVLA 4U0UA 4KVMA 3ZC0A 3ZLIA 3APFA 2NW9A 3APDA 2FBNA 4MHCA 4AOFA 3LG7A 5LJMA 2LAIA 3UT4A 4QXHB 3FUNA 4A3TA 5KJMA 3B7UX 1FIOA 2PM6A 1HH8A 2A5UA 3R9AB 4EECA 2LSIA 5LJNA 3CQXC 3O4ZA 5EKQD 3QOUA 4TUUA 4IE5A 4L1BA 4HLEA 2WXFA 2OVFA 1TJFA 1BPOA 5JQGE 3N9OA 4J8SA 2KCLA 2XGMA 2LAHA 4H7YA 3PNLB 3K3QC 3P7IA 3NZPA 4C90A 3TXNA 2IAKA 2WQ7A 2D0UA 3SBTB 3HKEE 2MTQA 3P8CD 4L9IA 4MLPA 3HKBE 5KJKA 2DBAA 3DPDA 4IDZA 3SNXA 2LHRA 4U74A 3JC6D 5HWXA 3IF8B 4JLEA 4LCTA 3QKYA 3CK8A 1G73A 4OK0A 4EYYR 3TGOA 2G0UA 3CQCB 4AV7A 2NC9A 4PDXA 4CDMA 3R6NA 3AA7B 1Y64B 5JDHA 5AJDA 4DK5A 5AJLA 1TJCA 4BTAA 5FZRA 2XCBA 3NQPA 3R7QA 1KNZA 2CWOA 2ZLYA 4ANXA 3SS1A 5FWQA 3JC6C 4TN7B 2VKOA 4OYSA 4TV8E 1TEZA 4ERRA 2X66A 1CUNA 3IHVA 3RIBA 1BR0A 4G25A 4BY6A 1MMGA 1WYBA 2E9XD 5EZYE 3FUIA 3SI5A 3FTUA 4HVBA 2X0LB 3KFWX 4JA9A 4I4TE 3UUNA 2DNXA 2LEHA 4GB9A 3BQLA 3CLJA 2GK9A 2WQHA 4MRUA 1D0YA 4AQGA 4ANUA 5ETWA 5FY7A 5DIZA 2D5UA 4N3AA 4JUYA 3ZYMA 3VLEA 4XI0A 4U8HA 2GW1A 3EIQC 4E7SA 2WXLA 4LEUA 3FTXA 3OJAA 4GU5A 4K0RA 4RSYA 4TV3A 1MNEA 3Q2MA 3U9WA 3D3MA 4BWRA 4B8CB 4WNKA 3V5UA 4UI9K 3Q9DA 3RK6A 3MACA 3U3IA 2H3RA 5L2LA 3T8MA 3G2SA 2ZMAA 2DHRA 2KMFA 3LDZA 4BT8A 3JYSA 4A55A 3RYFE 4GZ6A 4OYKA 4CT0A 4N2QA 4GA1A 5JR9B 4UVBB 4PW8A 2R5SA 2CCQA 3UMVA 3LY9A 5LCWC 3AAEB 3T8OA 4HOSA 5LX8A 2X51A 2VWAA 4GA2A 2WAUA 4O4JE 4ACLA 5JDFA 1E1HB 1D1BA 1LKXA 3KBUA 1W3BA 2KNDA 3LY7A 4CXWA 1U4QA 1MIYA 3MV2B 1E8ZA 4AVXA 4MS6A 3O1HA 3EVYA 3RH3A 1LVFA 1B89A 3VKHA 3FU3A 3MXZA 3ASGA 3H37A 5AYWD 2XQ0A 3SBSA 2RA1A 2K24A 4KBMB 2VYIA 3JCKC 2E9XA 5FQ7A 5JDNA 3FTYA 3SD5A 1G8XA 3P1UA 3PUSA 5E76A 3QWPA 3O48A 4N2SA 3RU0A 2XAFB 4J8EA 1OWLA 2EHOC 3HVEA 3KINB 1Z3YA 3B7SA 3CVPA 4FULA 2IOSA 2DWKA 3PVLA 2XPYA 3BQKA 2L9QA 4CXXA 4CXYA 5LHIB 5L3CB 3F57A 4IE6A 4D10C 4GCNA 2RD0A 2IC6A 2NSZA 4RG6A 3OBVE 2EHOD 3ZMUB 4UXNB 2A4ZA 4AKIA 3ML8A 4R7LA 2Y8DA 1HFAA 4B94A 3I0OA 4LUNU 2WXQA 2GRMA 1HCIA 3D9NA 1HF8A 3EDUA 2WXHA 1NAFA 3GWHA 2LO6A 2FI7A 3UT5E 2J09A 1SZAA 2I1KA 2RP4A 1N52A 4PJNA 1O3XA 3CGHA 4HFVA 1H7CA 2I9CA 2H7VC 1E8YA 5BPPA 4AP2A 3B13A 5G05C 3MZKB 3O9XA 3N71A 2HPLA 5HXRA 2XEVA 4ZI2C 4I43A 3CR3A 5LG4A 3ZPOA 3AA6B 3K8PC 3B7TA 2YNQA 2DLRA 3AU4A 5JDQA 4L5GA 4FHKA 4CGVA 3L08A 4UWGA 4N3CA 3TG4A 4HOTA 3TG5A 2JMHA 4OYJA 3VTYA 4O8SA 5DBKA 1VDYA 4K03A 5L3EB 3ZEFA 4F7AA 2UY1A 3FTWA 3AS4A 2OOEA 3S2AA 4F6RC 5JR9C 2C0MA 4O4IE 5J2TE 4MLKA 4AQFC 3P2BA 4V1Av 3W15B 3K9IA 3QNKA 3Q4AB 4M3OA 2LSJA 2DCFA 2Y48B 2L0TB 4NACA 3CVQA 4HFGA 1WRDA 4BTBA 4AY5A 3AS8A 1IQRA 4ANWA 4DVDA 4V3IA 3MKRA 3KV5A 5L3DB 4KZ0A 1HG2A 3KV4A 4PJMA 4FADA 2V5FA 3ZRHA 5JJ6A 3IEGA 1FVFA 4EZ4A 1H2UA 3SFZA 4AXPA 4QFVA 4ME2A 4EPZA 3SOLA 5E0OA 3UULA 1IJ6A 3Q5XA 4GYOA 3E0ZA 4UQZA 1E7UA 2PBIA 4I6EA 5FQ4A 3ZC1A 3WAKA 4FU3A 1ZBPA 5DQWA 5LBMA 1X79A 4I43B 2A2FX 5EX0A 5HYAA 3ASHA 2CFUA 3CVUA 3L3PA 3C4ZA 2V7LA 1ZV4X 2UXXB 5DABA 3EUHA 4JHRA 4DBQA 3UUXA 3ANWB 1OWPA 3GZ1A 3WAJA 2D0TA 1WY6A 2C0LA 1MMNA 2CXDA 4G24A 2FF4A 1QNFA 2YEVC 1JWGA 4KMCA 3UFEA 3Q5WA 2ONDA 4L2YA 4N39A 3L54A 2E9XC 2K5BB 3FBLA 3ASDA 3HYMB 3RC3A 3PE3A 1OWNA 4WWPA 4X1IE 3AAIA 3FUJA 5G2NA 4Q94A 2NW8A 5LBQB 4BX8A 2N2NA 2CWYA 2IC9A 4UIGA 3OXGA 4KBQA 4CQIA 2Y6XA 2EQXA 1SA0E 3VLFA 3ZHEA 3MV3B 1HXIA 3LKUA 1QQEA 3FWVA 4I1MA 3ULQA 2V8SE 5C8YE 2KLQA 4IE4A 5CB4E 2WMNA 2H7OA 4AEZC 5CA1E 5E75A 2ILRA 4GZ3A 3GA8A 4PFPA 1AJ3A 2LOPA 3N9PA 1IYGA 2WXMA 4FLBA 2C5KT 2W62A 1ELKA 3V5SA 2CM0A 4L2LA 3S4UA 3CVYA 3LPZA 2VSXE 2KCKA 1DNPA 3ML9A 4JEHB 4E7ZA 2WXIA 1UCUA 3VKGA 5A1LA 5FP3A 3AAAB 2IOLA 1U5PA 1D0XA 4GA0A 4I2WA 4J8FA 4L7TA 4A3VA 4BSXA 3NF1A 5JHBA 4UWFA 2X6FA 4LERA 1NWMX 3G2UA 4FI5A 5FYMA 3PEUB 2FEZA 4NQ0A 1XGWA 2VQ2A 4X1YE 1DVPA 4FJOA 3KEZA 2V7KA 5EX3A 5M72A 3CX7B 2V7JA 2LOSA 4ZI2D 4BFRA 3ZW3A 4I9CA 4UEMA 3GZ2A 3CKBA 2KT9A 5BNWA 3LYAA 4UVAB 2AVPA 1JWFA 1MIVA 4XE0A 1XNFA 2WXKA 3WXXA 3PREA 2IJGX 5L3BB 3OXFA 3RKVA 5H6RB 1UX4A 3F31A 4PJJA 4H9QC 4QWNB 3N2OA 4KYOB 2LNIA 2ZM8A 2Y3AA 3OXLA 2QY7A 2J9QA 3O1IA 2JQQA 5F8PA 1UG3A 3MKDA 1FCHA 3CWZB 3D9PA 4ABNA 4ILGA 1IQUA 2IQCA 5KJNA 4WWOA 2X68A 2IONA 1QSDA 3RRMB 2CLYC 1EYHA 2XTLA 4F1SA 1YA0A 4GYWA 2CXFA 2W63A 3PNTB 3SZ7A 4QX7B 4U07A 1EZ3A 4H7XA 1OWOA 5HAXA 3LJ3A 3FU6A 4UWKA 2IF4A 4XAXB 1SQMA 4B89A 3CQGB 4ASKA 1UX5A 4UQXA 2Y4TA 4GYYA 1HZ4A 4KT6B 3N9QA 5LA6E 4JHKA 3ONXA 3NZSA 4OVUA 3KV6A 4CI3B 3Q5MA 2B1EA 4HKAA 2PQNA 2LSUA 4GMLA 2LJLA 4G11A 4ATGA 5IYZE 5C1DA 3ZCJA 3LJCA 1IJ5A 5FY0A 5BMVE 5JDMA 2E9XB 4B8AA 3MZLB 3ZCIA 1YD8G 5CCLA 2KXPB 3M65A 4J2CA 5H6QB 3ESKA 4CCAA 3QC1A 3RJVA 3TKLB 3QK0A 4I6JA 4YLHA 1E96B 2Q9QD 1IHGA 5TAOA 2AW6A 1HS6A 4E6HA 3PDNA 3FTVA 3GN5B 2V4LA 4EZKA 4MBQA 4TUYE 2XRYA 2BTDA 3RYHE 2DCPA 5FJYA 2LSGA 4IE7A 4QX8B 2XPIA 2FO7A 4CI2B 4HOUA 3QC9A 2GGFA 4GYRA 3EJNA 3VTXA 3D9LA 5FTPA 3OYXA 4JEHA 4TX5A 4A56A 3R84B 1OXZA 3FUEA 3N2GE 2AXVA 3RKOA 2QFCA 2WWUA 3PUQA 2RG8A 2V7MA 3I1AA 1MIWA 5EDSA 3UUXB 3CHMA 4J8DA 1H0AA 2JJ9A 2VKHA 2KZTA 4X1KE 3PUAA 4I9EA 2XGSA 3CEQA 1PAQA 3FUKA 4F3VA 4E85A 3FDHA 3CHRA 1UJKA 3OYZA 4I6GA 3CMLA 4NRHB 3OKQA 4Q69A 1X5BA 2MHKA 2J4BA 4J6IA 1Z3XA 4XKBA 1D0ZA 3GW4A 3S7JA 5AFUL 4QHOA 2IU1A 2PZIA 4WW0A 4OVVA 4FHJA 2Q9QA 1HS7A 3RC8A 2KWIB 3AU5A 4B0ZA 3NZUA 4GAAA 3T5VA 4A1GA 5FXVA 4BJMA 2L6JA 3F2EA 3ZVVA 4GZDA 4XIFA 5JDLA 2OVBA 4DLOA 1YW0A 4FJZA 5BV1A 3FXEB 5A6CA 5KCMA 3FUFA 4UQYA 5BV0A 3NZQA 2X38A 2JEKA 2XHEB 3HKCE 2CHZA 1HE8A 4YJ2E 4FC8A 2CHWA 1PC2A 4UVCB 4UF0A 4UI9J 1H2TC 2PL2A 5CA0E 2ZM2A 1NA0A 4U04A 3O4XE 4YFSA 5LNKA 4BAYB 4DBRA 2K48A 2ACXA 4WWNA 3D9KA 4M1PA 4FA6A 5F3JA 4N3BA 4GOUA 4JL0A 3HHMA 3TL5A 3U78A 2BZBA 4GK5E 4HGAA 2AWIA 3LK2B 3PE0A 3IHRA 3KDSE 3FULA 4AKLA 4ISTA 2YU2A 4CRWA 4WAFA 4H9PC 4H63H 1D1AA 3FEYA 1MHQA 4U0ZA 4YVQC 2I59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQC B;  3I4R B;  3CQG B; 
#chains in the Genus database with same CATH topology
 2QGS A;  1WG0 A;  3Q47 B;  4U63 A;  2KXP C;  3FTZ A;  2CHN A;  3PRZ A;  1E90 A;  1EDU A;  1OWA A;  4N5C A;  2PTF A;  2R17 C;  1RZ4 A;  1Y6I A;  1JNR A;  3C3O A;  3UX4 A;  4DR5 T;  3NOG D;  1ELW A;  3G06 A;  5FY1 A;  2A3D A;  3KEA A;  3EDV A;  3UXG A;  4JC8 A;  3DEO A;  3QDN A;  2HE0 A;  3U64 A;  4JI3 T;  1V9D A;  2A9U A;  5LFA A;  3E4B A;  4HOQ A;  2HM8 A;  4NIQ A;  3C72 A;  5FMN A;  2DIW A;  4O1O A;  3FXD B;  3NBX X;  3JQ0 A;  1XMQ T;  4JHJ A;  3FU5 A;  4CT4 A;  2LSK A;  4TWF A;  2L9B A;  2XGO A;  3SRZ A;  4JI8 T;  4ILH B;  5L3F B;  3C98 A;  3ZN0 B;  3FTS A;  4JW1 A;  4HQD A;  5FXX A;  4PNI A;  4AKG A;  3AS5 A;  4XX5 A;  3UKU G;  3L22 A;  2DL1 A;  4CI1 B;  1NL4 A;  4RQI A;  3LS8 A;  4YJ3 E;  4CN6 A;  3P50 A;  5H7P A;  2WB2 A;  1L5J A;  3ZNG A;  2Q7F A;  3K3N A;  4HE8 A;  2WXN A;  3CIA A;  5KXJ A;  5LGU B;  2DYR E;  3Q79 A;  4HTE A;  2OCC E;  4PAG A;  5KJL A;  4IGU A;  2XAQ B;  3D9O A;  1BR1 A;  1KEY A;  4K5C A;  3UI2 A;  2SPC A;  3C3Q A;  3PDY A;  2LRK A;  3ZYL A;  3RIF A;  1N0Q A;  2CPT A;  2XQA A;  1Z8U A;  3UFG A;  2XAH B;  1OXJ A;  3BK9 A;  1Y8M A;  2CHX A;  4U8V D;  5AQ9 A;  3FUH A;  2X9H A;  2VAS A;  3DXK G;  3LEW A;  4BA9 A;  2LSV A;  3RAU A;  2XQY A;  3TWT A;  3NOC D;  2WB5 A;  4KX6 A;  2ZIR A;  4XKC A;  4HWI B;  3FH7 A;  1H2V C;  3SFX A;  1PY1 A;  5L47 A;  3G2V A;  3LK4 2;  1HU3 A;  2XAS B;  2BBH A;  1UW4 B;  4I0U A;  4KVO A;  1TN6 A;  3AAA C;  2WP9 A;  3RQU A;  4G2V A;  3UM3 A;  1YKH B;  5AQR B;  3UU6 A;  3PU3 A;  3UUB A;  2LHN A;  3KVB A;  4WNF A;  4KI0 F;  4I1A A;  2PNN A;  3EDT B;  4JEU A;  3FH8 A;  4H63 V;  2WDR A;  4CEM A;  3UUM A;  3CHP A;  3HDX A;  2J49 A;  2XEE A;  1MMD A;  2V4H C;  2XS1 A;  2MOW A;  5G04 C;  4DND A;  2YN6 A;  3Q9U C;  1O5M A;  3AG2 E;  3NWI A;  5CMY A;  3RRU A;  1MX6 A;  3M3Z B;  5KMG P;  4K5A B;  3ZXS A;  4A5X A;  3PUK A;  3QJZ A;  5T8I A;  2E2A A;  4QXB B;  3WI3 A;  4DLQ A;  5AQO B;  3VR9 A;  5IHY A;  4I50 E;  2L3L A;  5L3G B;  3I4R B;  4NXM T;  2WSS V;  4QKN A;  3S7F A;  4PH4 B;  2V5Q C;  4EEB A;  3ESL A;  3UT8 A;  4P0B A;  3WG7 E;  2VUR A;  3LK3 B;  4Q96 A;  3GZS A;  4MKT A;  5ADX L;  2X9X A;  3L13 A;  4U3C A;  5FZQ A;  3UU5 A;  3I9W A;  2OV8 A;  1UJJ A;  4RG9 A;  1N95 A;  2ODU A;  3ZMZ B;  4NUV A;  4CGW A;  3I3N A;  4Z8X A;  3PZD A;  1SHZ C;  1U3D A;  3DSW A;  3RO2 A;  4CN1 A;  2YHE A;  5FIN A;  2JMK A;  3IEE A;  4PK4 A;  5JH7 E;  3DTO A;  2X67 A;  2BVM A;  4DR7 T;  1UN9 A;  3C4W A;  1M7K A;  5EK2 A;  4JPS A;  4PS8 A;  3G2T A;  4PS3 A;  1QZ2 A;  5FZS A;  5JVD E;  5J90 A;  3FZM B;  3CST A;  2AXD S;  2VKJ A;  4JEU B;  4H9N C;  1E8W A;  2DWG A;  2X6H A;  1UN8 A;  4WUY A;  5B1B E;  4X5T A;  3SFE A;  4DI4 A;  1S70 B;  1VRB A;  5DQV A;  2AXU A;  2K3W A;  2KZ7 B;  2CXL A;  3C98 B;  3AVS A;  1LF8 A;  1T98 A;  2X9W A;  3QAQ A;  1IZN B;  3C4X A;  3CVL A;  2W00 A;  4ATZ D;  3L09 A;  1D8E A;  2NXP A;  4DO0 A;  2H89 A;  4YHJ A;  2VL8 A;  2EIL E;  3KAE A;  1WYC A;  5LP0 A;  1FVH A;  5JRE A;  4ACK A;  2UWJ G;  3MEK A;  2XQ5 A;  4P09 A;  2W0G A;  3FB2 A;  4HFH A;  4DJA A;  2WZI A;  4X20 E;  3DSS A;  3EHQ A;  4GMJ A;  5CEA A;  2A72 A;  3AVR A;  3RYC E;  5EIL A;  1NZN A;  4PUC A;  4CDN A;  1X9B A;  1VCT A;  3B7B A;  1OED C;  4G26 A;  5JDG A;  4J7W A;  3N9M A;  4K0K T;  2FJE A;  4GTO A;  4TZ4 C;  2XQ4 A;  3JCF A;  3AG3 E;  1AWC B;  3JUE A;  3HRA A;  3AE1 A;  5G05 J;  1BR4 A;  3D9M A;  2BG9 A;  2X6I A;  3P4P A;  2HN2 A;  3DBS A;  1A17 A;  4AXH A;  1MX4 A;  4UV9 B;  3OTO T;  2VSN A;  2XZD G;  2P9B A;  5ANL A;  4G2A A;  3PUW F;  2ZXW E;  3ZMV B;  4XZC A;  4EB6 E;  1E7V A;  3B57 A;  4YSY A;  4EQF A;  2W2U A;  3RYI E;  2YKS A;  5C2Y A;  3DJB A;  3QWW A;  2C2L A;  3ETU A;  2CFZ A;  4WNE A;  4A1S A;  4MBG A;  5FXW A;  2XSB A;  4CDR A;  3C51 A;  3A5X A;  3QNU A;  1DCE A;  2M63 A;  3B7R L;  5BUZ A;  4LRZ A;  5CRV A;  3RPU A;  5LGN B;  2JLB A;  3VR8 A;  2QYJ A;  2F8X K;  1NP7 A;  2VK9 A;  4XEI G;  1OCZ E;  5AQN B;  4BJN A;  1IXV A;  4PS7 A;  3TLS A;  3L6A A;  4G1T A;  5ABG A;  5LOZ A;  3CKC A;  2JIW A;  4PK5 A;  3D9I A;  1MMA A;  1YQ4 A;  4CYM D;  3PEV B;  5LCW J;  3QOF A;  3SF4 A;  4H9O C;  4O4H E;  2X6K A;  3F6Q A;  2OEW A;  5CHE E;  4DPR A;  2LSY A;  1Z0P A;  3ZYQ A;  2IO2 C;  3KSL A;  2ETB A;  1IKN D;  3KV9 A;  3MA5 A;  2M6B A;  4JXT A;  3FP3 A;  4AKR B;  2CA5 A;  2XM2 A;  4ISS A;  4BX9 A;  2PFV A;  2X9Y A;  4BET A;  1YMP A;  1AP7 A;  2LT3 A;  3N2K E;  4KXK B;  2ES0 A;  2XJ7 A;  2GRR B;  3Q5D A;  2XEN A;  2MBG A;  4IT4 A;  5LMU T;  4TRQ A;  1KNP A;  2GRP B;  5JR9 A;  4DV5 T;  1DCQ A;  3FBZ A;  1D1C A;  4AM9 A;  5HEO A;  3P4W A;  1H19 A;  3LBX A;  3AE2 A;  1KZO A;  4CN4 A;  5HEJ A;  2Y0B G;  4FLH A;  3RIU C;  1IBM T;  2LUH A;  1BI8 B;  3U3W A;  4OFZ A;  4ILU A;  1N9A A;  3ZMT B;  4WND A;  3H3M A;  1KT1 A;  4ZZB A;  2GRQ B;  4Y6W A;  5D0O D;  4PK6 A;  3HI2 A;  5HWY A;  3J9X 1;  4NUU A;  1JPL A;  5HRY A;  4H9R C;  1S94 A;  5HCJ A;  2P58 C;  4KUM B;  3AE8 A;  4IIJ E;  1P5Q A;  4ZI7 E;  5LP6 E;  2D2S A;  3TLU A;  2FUL A;  3FZH B;  5LGT B;  3ZJ1 A;  3U66 A;  2UU9 T;  4O2A E;  3MYV A;  2YDQ A;  3DEP A;  2YU1 A;  1ZEE A;  2HH7 A;  1OCO E;  3K3O A;  1WAO 1;  2CG2 A;  3EHM A;  1RW2 A;  5FXZ A;  3UKR G;  1I94 T;  1FPP A;  2EHO A;  4ZS3 A;  4C9B B;  1SW6 A;  3I5P A;  2E8I A;  4IL9 A;  1MND A;  4IYP A;  3V79 K;  1HNW T;  3I0Q A;  4DV2 T;  2VTB A;  4DR1 T;  2NWB A;  3IBE A;  4YXD A;  4YTP A;  5J1G A;  1OT8 A;  5EK4 A;  4AQF A;  1VOM A;  2NTX A;  3S7B A;  2WXP A;  4ZS2 A;  4B3M T;  3KD7 A;  4JI7 T;  3AE3 A;  2XY8 B;  5HEG A;  2H88 A;  4GTV A;  4AIF A;  4EBA G;  2LXL A;  4C0E A;  2I6H A;  3MGB A;  2KIN B;  4BSZ B;  3PS6 A;  3AE9 A;  3AB3 B;  4O4L E;  4HLL A;  3CVW A;  2EIJ E;  3X1D A;  3JAD A;  1W0A A;  1EPU A;  3CVN A;  4DUY T;  4UWL A;  2XPZ A;  4DI3 A;  4WBO A;  1KNR A;  4DRX E;  4DMV A;  3RKG A;  4J0U A;  3PUG A;  1O1T A;  2Q9Q B;  5ABF B;  3ZFW A;  1LVK A;  4YSZ A;  2PM7 A;  4U2Z A;  4YDE A;  2YDS A;  3PUV F;  3UQ7 A;  3CPZ A;  3LFM A;  3FHE A;  4L23 A;  3LY8 A;  5HEU A;  4I55 E;  4OAV B;  5L4E A;  5AAR A;  4XI9 A;  5FQ6 A;  1SZ9 A;  5D2M C;  1BR2 A;  3I9Y A;  5G55 A;  1US7 B;  2ZM0 A;  2XUE A;  3UT7 A;  2LM9 A;  2VGY A;  4I17 A;  3ONK A;  2KWH A;  3GYZ A;  1MJ0 A;  3AA0 B;  3ASN E;  2KZT B;  2WXO A;  2PG8 A;  3IKO B;  1EF1 C;  3TJP A;  4GKJ T;  1DU2 A;  2ETA A;  3CK6 A;  2J4D A;  3PE4 A;  3TXM A;  3CHS A;  3ZIM A;  5T4Y A;  2WBL A;  4DV0 T;  2VSY A;  3ABL E;  3CV0 A;  3JAE A;  5KNG A;  3A7M A;  5DJQ C;  1KFY A;  4P29 A;  5ANR A;  1HNX T;  1ELR A;  2KAT A;  4TV9 E;  3SWH A;  4WZX A;  3J5P A;  3Q75 A;  3LBX B;  3FY4 A;  2HR2 A;  4HI8 A;  4WNG A;  4LG6 A;  2ZGD A;  1Z5S C;  2DZN A;  4BT9 A;  5G04 J;  4G8L A;  4LF8 T;  3PH0 C;  3Q7A A;  3ONL A;  4A63 B;  5ENR D;  4MAL A;  2L6B A;  4YND A;  2KC7 A;  4APF A;  4GCO A;  4F8H A;  4ADZ A;  4F1P A;  3Q15 A;  4ZI3 D;  5AQU B;  2MYS A;  4LML A;  2DYS E;  2BG9 E;  2BDE A;  4HFB A;  4DMW A;  5LXT E;  2UXC T;  3ABM E;  4RLY A;  2P9S G;  2YHC A;  4TNW A;  4UWH A;  3DPY A;  5LCY A;  3C50 A;  1JNZ A;  4TNV A;  5HXC A;  4EIW A;  4ILI A;  3VLD A;  4AJW A;  5BT1 A;  4GPK A;  3ZN1 B;  4GMR A;  3QAR A;  2HPJ A;  2E0I A;  5CCM A;  4JV5 T;  3IV0 A;  3MJW A;  4KP3 C;  2QA7 A;  3EAB A;  3VHL A;  4GTR A;  4XZ4 A;  2V1D B;  5T3R A;  4EBA A;  4HFE A;  4GZ5 A;  2C5I T;  5HQ8 A;  3TLW A;  1A5E A;  4U96 D;  3P4Q A;  4JVS A;  1GW6 A;  3NRX A;  5AQH B;  4ZFH A;  3UTK A;  5AQL B;  1OCR E;  2W61 A;  3AE6 A;  4LMJ A;  4B6X A;  3J7Y q;  2UUC T;  3E32 A;  3TLV A;  3FFL A;  3E33 A;  4TUM A;  4LMK A;  2CE7 A;  4U95 D;  5HXS A;  1WLX A;  3ETV A;  2V0P A;  2BF0 X;  3HIZ A;  3RRN B;  4IHJ E;  1SA4 A;  2WQ6 A;  1HO8 A;  2NTY A;  3CVV A;  5AQM B;  2N9D A;  4U0S A;  2LE8 A;  3DSV A;  2WU5 A;  3CSF A;  1OWM A;  2D9D A;  3JUI A;  1HX8 A;  3UQ3 A;  5J08 A;  2Y4U A;  2WXR A;  4DV4 T;  3R7R A;  2WVI A;  4FJY A;  3EHZ A;  3L17 A;  1B7T A;  5KX5 E;  2BUG A;  3D0T A;  3PZ2 A;  2NW7 A;  1O1S A;  3EHN A;  4P0A A;  5HXH A;  2HYZ A;  2P9L G;  2WMO A;  2XAJ B;  2M67 A;  4EYU A;  1XNR T;  3ASF A;  4IUL A;  1XZY A;  3FHN A;  2VTB B;  2UXB T;  2GRL A;  4G63 A;  2IFU A;  5HI7 A;  3CIR A;  3ZHE B;  4DX2 A;  5ARF A;  3CHQ A;  3LCA A;  4O6F A;  4GTT A;  5JA4 D;  5AEN A;  5EN5 D;  3HR0 A;  4DV7 T;  4QH1 A;  1MQS A;  4HN9 A;  4URK A;  1H6K A;  2NP9 A;  3OAW A;  3MA9 A;  2FBW A;  3TWQ A;  3ZKJ A;  3MKQ A;  5AQT B;  4GKK T;  1CHU A;  4UF0 B;  1T7S A;  1UUR A;  5JRC A;  3QUJ A;  2FJD A;  3ZMS B;  4GYS A;  2BKO A;  3ENE A;  3Q78 A;  4IDN A;  1BI7 B;  2ODV A;  4XBF B;  2IIU A;  2BBJ A;  3PU8 A;  3MCX A;  4PJL A;  5CRU A;  2JQ9 A;  4LF9 T;  1ZU2 A;  3KVA A;  4EXT A;  2P2C P;  3C64 A;  5AN8 A;  4BEP A;  3ZGQ A;  4EZH A;  3UIN C;  3PUJ A;  1K1B A;  3L16 A;  5JJT A;  3RIU A;  4F53 A;  3CKD A;  3SHF A;  3BEE A;  4KZC A;  3TAX A;  5BW8 C;  4AI6 A;  1VCS A;  3ZXP A;  4EGW A;  2F8Y A;  5EK3 A;  1FMV A;  5LHH B;  3LXU X;  4L9P A;  1N54 A;  3E08 A;  3C3R A;  2XRZ A;  2NOX A;  2LRL A;  3BG0 B;  4TXQ A;  4K0U A;  1WM5 A;  2UY1 B;  3SQV A;  3RRC A;  3IBP A;  3MK7 C;  4ILC A;  2Z6E A;  4ZHB A;  3HXC A;  2EHO B;  4X62 T;  3Q5E A;  4YT0 A;  1OY3 D;  3SGH A;  1ZP0 A;  1QBQ A;  4IE0 A;  2C5J A;  2XHE A;  2J08 A;  2VKD A;  4KHP T;  2VGX B;  2H6I A;  5HXE A;  3GN5 A;  2M6I A;  1N4P A;  3L39 A;  3Q49 B;  4MFR A;  2YK0 A;  3QB2 A;  4JD2 G;  3ZST A;  5ENT D;  2DI4 A;  3TWU A;  3MX3 A;  4HS2 A;  5J2U E;  3EIJ A;  3ZN3 A;  4ANV A;  5FNV E;  4QH5 A;  4C91 A;  4ANJ A;  1U3C A;  2QZA A;  2L0I A;  3URZ A;  5CMW A;  2F4V T;  1S63 A;  2B76 A;  3ZYK A;  1J5E T;  3CX8 B;  1H6P A;  3FU0 A;  2CMR A;  3NRY A;  1TYQ G;  1Z6T A;  4UI9 C;  3ZJ2 A;  4ILA A;  2JRK A;  4LNU D;  3EUV A;  3BG1 B;  3UU8 A;  2OLT A;  3QK6 A;  3CX6 B;  2KSR A;  1ZHC A;  5D0Q D;  3KSQ A;  1HTJ F;  4JI0 T;  5D66 A;  3LJN A;  4LFA T;  2MYO A;  3LVQ E;  2AXZ A;  3K1S A;  4P1N A;  3CHO A;  3KS2 A;  4UEL A;  4AKH A;  2R59 A;  5GON E;  4JI5 T;  5A7D B;  1WR0 A;  5KNH D;  2HHH T;  1XWM A;  3E22 E;  4CZ2 D;  2MPK A;  1BU9 A;  4DID B;  2CHO A;  2JPF A;  2HO1 A;  4ZI3 C;  2CEA A;  3UU4 A;  1KK7 A;  3N9N A;  4AY6 A;  5KDM C;  2ETC A;  4GTM A;  4APO A;  3RX6 A;  2MOZ A;  2BKN A;  4HOR A;  1LRZ A;  3N9L A;  3FUD A;  4O2B E;  5AQV B;  4IN3 B;  2E2E A;  4LF6 T;  2YIN A;  4Y6C A;  1QUU A;  3BQI A;  3RF1 A;  4IRU A;  5J0Z A;  4I1O B;  3SO8 A;  3FH5 A;  3HL6 A;  4EZL A;  3APC A;  3O1J A;  4ZHQ E;  3CVR A;  4CZZ B;  5BR8 T;  4ZOL E;  4YVO A;  3UM1 A;  4OX9 T;  4JA7 A;  3H3A A;  3VU7 H;  3HA4 A;  2J07 A;  2V26 A;  5AQJ B;  2VGE A;  4U7Y A;  3NB2 A;  5LHG B;  5FQ8 A;  4KMO A;  4LNG A;  1WR6 A;  2Q9Q C;  3N5L A;  1Q2Z A;  3QB5 K;  4WBN E;  5HS0 A;  3T5X A;  5LYJ E;  4HXI A;  3AXJ B;  1N4Q A;  2CG3 A;  2UXN B;  5CJ5 A;  4OHF A;  5AQS B;  4W9R A;  1S35 A;  2L8K A;  3KBT A;  2I1J A;  3T1Y T;  4PFO A;  3DP7 A;  2VB6 A;  2WPV A;  2IEJ A;  5A23 A;  2J1D G;  4HEA A;  2WM9 A;  3PTR B;  1OUV A;  4G23 A;  1INZ A;  3CK9 A;  3JXI A;  3S7D A;  1KZP A;  2ZU6 B;  1KT0 A;  3V2O A;  4GIW A;  1OED A;  3GMI A;  4EOZ B;  2OA5 A;  4IDQ A;  5JHA A;  3ANW A;  4FP7 A;  4QH4 A;  1E8X A;  1V54 E;  2KCV A;  5LOV E;  5ENP D;  5FT9 A;  5ENN A;  2VGX A;  2WXG A;  3CK7 A;  3AA1 B;  3JAF A;  1JUQ A;  5JRC B;  2YQ8 A;  4C0M A;  3ZSS A;  4DV6 T;  2CLY B;  2C0S A;  3FUM A;  4JZY A;  3I4G A;  1KLX A;  3SY2 A;  4RVB A;  3RRW A;  3LVR E;  2KM4 A;  4H9S E;  4EZJ A;  5AIJ A;  5EIB E;  2WXJ A;  4L0R A;  4U72 A;  2IW5 B;  4TWD A;  3HVE B;  2X3M A;  1NA3 A;  3EAM A;  2VJ8 A;  2XAG B;  2K9A A;  1XMO T;  2X6J A;  2PQR A;  5ARG A;  3ZPJ A;  2BED A;  2W67 A;  1IAP A;  3MJX A;  4ZXL A;  4QXC B;  5JJ7 A;  3IHY A;  2MRI A;  1ZKE A;  3RO3 A;  3X2Q E;  4NUR A;  4LFC T;  4HWC A;  4G8K A;  3U4T A;  3UU3 A;  1FEW A;  3FEX A;  3OTN A;  1S0P A;  4YY3 T;  4UV8 B;  1TNO A;  3PUR A;  3G2W A;  5M4Y A;  4GZC A;  4EAH A;  4JI1 T;  3UPV A;  2RPA A;  2V7I A;  4Z91 A;  2VSO E;  3QWV A;  1GQE A;  3D9J A;  4N78 D;  1NI1 A;  4DR2 T;  5ABH A;  4WYV A;  1YKE B;  4AIS A;  2I2O A;  3AG4 E;  3T1H T;  2N1G A;  3MKQ B;  1FMW A;  3T9K A;  3ZEF B;  2UUA T;  3JQ1 A;  5LG3 A;  5F5W A;  3ULY A;  1HG5 A;  4Z68 A;  4GK0 E;  2XCC A;  2PJQ A;  4I2Z A;  2Y1L E;  3UIP C;  3CVX A;  3HKD E;  2BVL A;  3RI5 A;  4HFD A;  4J8Y A;  4IRE A;  4KVM A;  4U0U A;  1SVX A;  1L0V A;  3ZC0 A;  3ZLI A;  2LM2 A;  3DST A;  3APF A;  2NW9 A;  3APD A;  2FBN A;  4MHC A;  3DRA A;  4AOF A;  1N4R A;  3LG7 A;  5LJM A;  2LAI A;  3UT4 A;  4YHH T;  4QXH B;  3FUN A;  4A3T A;  5KJM A;  3B7U X;  1FIO A;  1KPS B;  2PM6 A;  4X8Q A;  2DVW A;  1HH8 A;  2A5U A;  4U7E B;  3R9A B;  4EEC A;  2LSI A;  5LJN A;  3CQX C;  4KHZ F;  3O4Z A;  5EKQ D;  5AQG B;  3QOU A;  4TUU A;  4IE5 A;  4L1B A;  4HLE A;  2WXF A;  2OVF A;  1TJF A;  1BPO A;  3Q7F A;  4DX7 D;  3PJA J;  5FVK A;  5JQG E;  3N9O A;  4J8S A;  2KCL A;  2XGM A;  4QQI A;  2LAH A;  4H7Y A;  3PNL B;  2J47 A;  3K3Q C;  3P7I A;  5C2T A;  3NZP A;  4C90 A;  3TXN A;  2IAK A;  2WQ7 A;  1N36 T;  2D0U A;  3EU9 A;  5LMN T;  3SBT B;  3HKE E;  2MTQ A;  1XDO A;  2CRB A;  3RIA A;  3B95 A;  1TR4 A;  2WY2 A;  3P8C D;  4L9I A;  4MLP A;  3LSV A;  1S64 A;  2FO1 E;  3HKB E;  5KJK A;  2DBA A;  3DPD A;  2QYU A;  4GPM A;  4LF4 T;  4X65 T;  2F0Y A;  1ZOY A;  2WZH A;  4IDZ A;  2XQ8 A;  3SNX A;  4COF A;  2LHR A;  4U74 A;  3JC6 D;  5HWX A;  3IF8 B;  4JLE A;  4LCT A;  3QKY A;  3FZK B;  1FT2 A;  3CK8 A;  2NYJ A;  2EIN E;  1G73 A;  4BES A;  4OK0 A;  2R05 A;  4EYY R;  3TGO A;  5KBA A;  2G0U A;  3CQC B;  4AV7 A;  2VVN A;  2NC9 A;  1OED E;  4PDX A;  4CDM A;  3V2X A;  3R6N A;  3AA7 B;  5CED B;  1Y64 B;  2UUB T;  5JDH A;  1XNQ T;  1N32 T;  5AJD A;  4DK5 A;  5AJL A;  3NVO A;  4HFI A;  1TJC A;  4BTA A;  5FZR A;  2XCB A;  3NQP A;  3E30 A;  3R7Q A;  1KNZ A;  2CWO A;  2ZLY A;  4ANX A;  3SS1 A;  1HNZ T;  5FWQ A;  3JC6 C;  4TN7 B;  2VKO A;  2JQK A;  4OYS A;  4TV8 E;  1TEZ A;  3ABK E;  4ERR A;  1UGO A;  3RGL A;  2X66 A;  1CUN A;  3IHV A;  3RIB A;  3PUZ F;  1BR0 A;  4G25 A;  2Y69 E;  4BY6 A;  1UOH A;  1MMG A;  1WYB A;  2E9X D;  5EZY E;  1TNB A;  3L8R A;  3FUI A;  3L9T A;  3RLF F;  3SI5 A;  3FTU A;  4HVB A;  2IUB A;  2X0L B;  5ABE A;  1T72 A;  2V6Y A;  3KFW X;  2IY0 C;  4JA9 A;  3SFD A;  4I4T E;  3UUN A;  1W9R A;  2DNX A;  2LEH A;  4YSX A;  4B3S T;  4GB9 A;  3BQL A;  3UQ4 A;  3RHW A;  2WWV A;  5AQK B;  3CLJ A;  2GK9 A;  2WQH A;  4MRU A;  2IDO B;  1D0Y A;  4DR4 T;  4AQG A;  4ANU A;  5ETW A;  3DWL G;  5FY7 A;  5DIZ A;  2D5U A;  2IHR 1;  2R6G F;  4N3A A;  2XQ7 A;  4JUY A;  3ZYM A;  2QRX A;  3VLE A;  4XI0 A;  1UUS A;  1YXR A;  4U8H A;  2GW1 A;  3EIQ C;  4E7S A;  4X64 T;  2WXL A;  4LEU A;  3FTX A;  3AEC A;  5ABF A;  3OJA A;  4GU5 A;  4K0R A;  4RSY A;  4TV3 A;  1MNE A;  3Q2M A;  1IHB A;  1FJG T;  3PZ1 A;  3U9W A;  3D3M A;  4IL4 A;  4BWR A;  2X0H A;  4B8C B;  4WNK A;  3V5U A;  2P9K G;  4UI9 K;  2MAW A;  3Q9D A;  3RK6 A;  3MAC A;  3U3I A;  1TN8 A;  2BG9 B;  2YOE A;  3PJA A;  3TWV A;  2H3R A;  5L2L A;  4EED A;  3T8M A;  3G2S A;  2ZMA A;  1E2A A;  2V6X A;  3D9H A;  2DHR A;  3AE5 A;  5B3S E;  2KMF A;  3TWX A;  3LDZ A;  4BT8 A;  3JYS A;  4A55 A;  3RYF E;  4GZ6 A;  4OYK A;  1TN7 A;  4CT0 A;  4N2Q A;  4GA1 A;  5JR9 B;  4UVB B;  2OEV A;  5EYP F;  4PW8 A;  2GRN B;  2DZO A;  4M7C A;  2E5V A;  2R5S A;  2CCQ A;  3UMV A;  3LY9 A;  5LCW C;  3AAE B;  3T8O A;  4HOS A;  3DSX A;  2AE9 A;  4A97 A;  4B93 B;  5LX8 A;  3ZKR A;  2X51 A;  2VWA A;  4GA2 A;  4HFC A;  2WAU A;  3UIO C;  4O4J E;  4ACL A;  5JDF A;  1E1H B;  1D1B A;  3DXM G;  1LKX A;  3KBU A;  1W3B A;  3EI0 A;  2KND A;  3ABV A;  3JXJ A;  3LY7 A;  4CXW A;  2W66 A;  1U4Q A;  1MIY A;  3MV2 B;  1E8Z A;  4JI2 T;  4AVX A;  4MS6 A;  2P9U G;  5ENQ D;  2DWZ A;  3O1H A;  3EVY A;  3RH3 A;  1LVF A;  4DV1 T;  3VKH A;  1B89 A;  3FU3 A;  3MXZ A;  1WDY A;  5IY5 E;  2KBX A;  3UTM A;  3DSU A;  4U31 A;  3ASG A;  3H37 A;  4K5B A;  2XQ0 A;  2EIM E;  5AYW D;  3SBS A;  2RA1 A;  2K24 A;  4KBM B;  2VYI A;  3JCK C;  5AQI B;  2E9X A;  5FQ7 A;  5JDN A;  3FTY A;  1W09 A;  1G8X A;  2ACZ A;  1TNZ A;  3PUS A;  3P1U A;  1SA5 A;  5E76 A;  3SD5 A;  3C5R A;  3O48 A;  3QWP A;  3RU0 A;  4N2S A;  4U8Y D;  2XAF B;  4J8E A;  1OWL A;  2EHO C;  4HB5 A;  3HVE A;  3KIN B;  1Z3Y A;  5CEC B;  3B7S A;  3CVP A;  4FUL A;  2IOS A;  2DWK A;  3PVL A;  2XPY A;  4AIU A;  2LKG A;  2A5E A;  4U33 A;  2AJA A;  5EID A;  3W9G A;  4HRL A;  2V5D A;  3BQK A;  2L9Q A;  4IDO A;  3AEF A;  2P9I G;  3ZT7 A;  4CXX A;  3J5Q B;  2H6G A;  4CXY A;  3L82 A;  4HWF A;  5LHI B;  5L3C B;  3F57 A;  4IE6 A;  4D10 C;  4GCN A;  2LKH A;  3UM0 A;  2RD0 A;  2IC6 A;  2NSZ A;  4RG6 A;  3VRB A;  3OBV E;  2EHO D;  3ZMU B;  4UXN B;  2A4Z A;  4AKI A;  2BKG A;  3ML8 A;  4R7L A;  5B1A E;  2Y8D A;  1HFA A;  4B94 A;  3I0O A;  1LD8 A;  4LUN U;  2WXQ A;  2GRM A;  1HCI A;  5BXO A;  3D9N A;  1HF8 A;  5IWA T;  3E34 A;  3EDU A;  2XPK A;  1NAF A;  2WXH A;  3GWH A;  2IO3 C;  2LO6 A;  2RFM A;  1N4S A;  2FI7 A;  3UT5 E;  5EYL A;  2XQ9 A;  5JMN D;  2J09 A;  1IBL T;  3ZU7 B;  1SZA A;  2I1K A;  2J8S D;  3QB5 A;  1G3N B;  2OV9 A;  3ZUV B;  5KWD A;  3AEA A;  2RP4 A;  1N52 A;  1N0R A;  4PJN A;  1O3X A;  2XZE A;  3AEB A;  3CGH A;  1D8D A;  2WCA A;  2QYW A;  4HFV A;  2BS2 A;  2JQH A;  1H7C A;  2I9C A;  2W4X A;  2H7V C;  1E8Y A;  5BPP A;  4DR6 T;  4AP2 A;  3B13 A;  5G05 C;  3MZK B;  3NKZ A;  4X66 T;  3O9X A;  3IXE A;  3N71 A;  5L4H A;  2HPL A;  5HXR A;  2XEV A;  4ZI2 C;  1I6Z A;  4I43 A;  3CR3 A;  4HRM B;  5LG4 A;  3ZPO A;  3AA6 B;  3K8P C;  3B7T A;  2YNQ A;  2DLR A;  4HBD A;  3AU4 A;  2RFA A;  4YTM A;  5JDQ A;  5AQA A;  4L5G A;  4FHK A;  4CGV A;  3L08 A;  4UWG A;  4N3C A;  3E37 A;  3TG4 A;  2VL0 A;  1J5W A;  4HOT A;  3PUX F;  3TG5 A;  2JMH A;  2ZGG A;  3AE4 A;  4OYJ A;  3VTY A;  4O8S A;  5DBK A;  1VDY A;  1Y01 A;  4K03 A;  5L3E B;  2EIK E;  3ZEF A;  4F7A A;  2UY1 A;  3FTW A;  4NPP A;  3AS4 A;  2OOE A;  3S2A A;  4F6R C;  3AG1 E;  5ITZ F;  5JR9 C;  2C0M A;  4O4I E;  5J2T E;  4MLK A;  4AQF C;  1LD7 A;  1MZC A;  3P2B A;  4V1A v;  2R2L A;  3W15 B;  3K9I A;  3HXE A;  2XEH A;  3QNK A;  3Q4A B;  5CFB A;  2LSJ A;  4M3O A;  2DCF A;  2Y48 B;  2L0T B;  4NAC A;  3CVQ A;  4HFG A;  1WRD A;  4TXP A;  2WU2 A;  4BTB A;  4AY5 A;  3AS8 A;  1IQR A;  4ANW A;  4DVD A;  4V3I A;  3MKR A;  3KV5 A;  3ZT6 A;  5L3D B;  4KZ0 A;  1HG2 A;  3KV4 A;  4PJM A;  4FAD A;  2V5F A;  3ZRH A;  5JJ6 A;  3IEG A;  3ONL C;  4GTS A;  1QYM A;  1FVF A;  4EZ4 A;  1H2U A;  3SFZ A;  4AXP A;  4QFV A;  4ME2 A;  4DUZ T;  3PZ4 A;  4EPZ A;  3AJI A;  3SOL A;  5E0O A;  3UUL A;  1IJ6 A;  4JYA T;  3Q5X A;  4GYO A;  3E0Z A;  1LTX A;  4UQZ A;  1E7U A;  2PBI A;  4I6E A;  5FQ4 A;  4NIK A;  3ZC1 A;  3WAK A;  4FU3 A;  1ZBP A;  5DQW A;  5LBM A;  1X79 A;  4I43 B;  2A2F X;  5EX0 A;  5HYA A;  3ASH A;  2CFU A;  3CVU A;  3L3P A;  3C4Z A;  3V30 A;  2V7L A;  1ZV4 X;  2UXX B;  5DAB A;  3EUH A;  3BU8 A;  4JHR A;  1OED B;  4DBQ A;  3R9M A;  2UXD T;  3UUX A;  5LB7 B;  3ANW B;  1OWP A;  3GZ1 A;  1SUM B;  3WAJ A;  2D0T A;  2V6Y B;  5HEH A;  1WY6 A;  5ENS D;  2C0L A;  1MMN A;  4YTN A;  2CXD A;  4G24 A;  2FF4 A;  2H6F A;  5BXU A;  1QNF A;  2YEV C;  3ULE G;  1JWG A;  4KMC A;  1SE7 A;  4HI9 A;  3UFE A;  3Q5W A;  2OND A;  4L2Y A;  4N39 A;  3L54 A;  2E9X C;  2K5B B;  4LSZ E;  3V31 A;  3FBL A;  3ASD A;  3HYM B;  3RC3 A;  4U7I A;  3PE3 A;  1OWN A;  4WWP A;  4X1I E;  3AAI A;  4Q25 A;  3FUJ A;  5G2N A;  1QLB A;  4Q94 A;  2NW8 A;  1JCS A;  5LBQ B;  3TWS A;  4BX8 A;  3RQW A;  2N2N A;  2CWY A;  2IC9 A;  4UIG A;  3OXG A;  4KBQ A;  4CQI A;  1U2V G;  2Y6X A;  1DC2 A;  2EQX A;  3TWR A;  1SA0 E;  3VLF A;  3ZHE A;  3MV3 B;  1HXI A;  3LKU A;  1QQE A;  3FWV A;  4I1M A;  3ULQ A;  2V8S E;  5C8Y E;  4YDW A;  2KLQ A;  1K8K G;  2FUP A;  4IE4 A;  5CB4 E;  2WMN A;  5CBO A;  4LNB A;  4BER A;  2H7O A;  1N34 T;  4AEZ C;  5CA1 E;  2QC9 A;  5E75 A;  2ILR A;  4GZ3 A;  3GA8 A;  4PFP A;  1AJ3 A;  3ISM C;  2LOP A;  5FL0 A;  3N9P A;  1IYG A;  1NFI E;  2WXM A;  4FLB A;  2C5K T;  1V55 E;  2W62 A;  1ELK A;  3V5S A;  2CM0 A;  4L2L A;  2BS3 A;  1YQ3 A;  3S4U A;  2CBI A;  3LPZ A;  3CVY A;  4N5Q A;  1FT1 A;  1YCS B;  2VSX E;  4DX1 A;  1J1J A;  2KCK A;  1XDP A;  1DNP A;  3ML9 A;  3OPC A;  4JEH B;  4E7Z A;  3ONJ A;  5AQP B;  2WXI A;  1UCU A;  3VKG A;  5A1L A;  5FP3 A;  3AAA B;  2VQE T;  2IOL A;  4GTQ A;  1U5P A;  1TNY A;  1D0X A;  4TXR A;  4GA0 A;  4I2W A;  4J8F A;  4L7T A;  4A3V A;  4BSX A;  3NF1 A;  5JHB A;  4UWF A;  2X6F A;  4LER A;  1NWM X;  3G2U A;  4HWD A;  4FI5 A;  5FYM A;  3PEU B;  2FEZ A;  4NQ0 A;  1XGW A;  2VQ2 A;  4X1Y E;  2WQY A;  1DVP A;  2R03 A;  1KF6 A;  1HR0 T;  4FJO A;  1N11 A;  3KEZ A;  2V7K A;  5EX3 A;  5M72 A;  3CX7 B;  2V7J A;  2LOS A;  4ZI2 D;  4BFR A;  3ZW3 A;  4I9C A;  4UEM A;  1JCQ A;  3GZ2 A;  3CKB A;  2KT9 A;  5BNW A;  3W9F A;  3LYA A;  4ILB A;  4UVA B;  4TWH A;  2AVP A;  1JWF A;  1MIV A;  4JI4 T;  4XE0 A;  1XNF A;  2WXK A;  3WXX A;  1T8B A;  4IDP A;  4A98 A;  3PRE A;  2HN1 A;  2IJG X;  3AEE A;  5L3B B;  1MX2 A;  3OXF A;  3RKV A;  5H6R B;  1UX4 A;  2BS4 A;  3F31 A;  4PJJ A;  4AQY T;  5AQF B;  4H9Q C;  4QWN B;  3N2O A;  4KYO B;  2LNI A;  2ZM8 A;  2Y3A A;  2B0O E;  4JBW F;  2BKK B;  3OXL A;  2QY7 A;  2CBJ A;  4U2Y A;  2J9Q A;  3O1I A;  3AXJ A;  2JQQ A;  2XQ6 A;  2B6C A;  5F8P A;  4DX5 D;  1UG3 A;  3MKD A;  1FCH A;  3CWZ B;  3D9P A;  4ABN A;  4Z90 A;  4ILG A;  1IQU A;  2IQC A;  5KJN A;  4WWO A;  2X68 A;  5IUX A;  2J4G A;  3A8Y C;  2ION A;  2QVA A;  1TNU A;  1QSD A;  5AAO A;  2XZT G;  3RRM B;  2CLY C;  1M62 A;  1EYH A;  2XTL A;  4DR3 T;  1YYH A;  4F1S A;  3EHR A;  1O1R A;  1YA0 A;  3NAW A;  4GYW A;  2CXF A;  2BKP A;  2W63 A;  1K1A A;  3NBN B;  3PNT B;  3SZ7 A;  4QX7 B;  4U07 A;  1EZ3 A;  5CBN A;  5C3J A;  4H7X A;  1OWO A;  5HAX A;  3LJ3 A;  3FU6 A;  1BD8 A;  4UWK A;  2IF4 A;  4XAX B;  3VRA A;  2F37 A;  2V5C A;  1SQM A;  4B89 A;  2GRO B;  3CQG B;  4ASK A;  1UX5 A;  4UQX A;  2Y4T A;  4GYY A;  1NEK A;  3BUA A;  1HZ4 A;  4KT6 B;  3SFY A;  3N9Q A;  5LA6 E;  4UR9 A;  4JHK A;  3ONX A;  5ENO D;  3NZS A;  4OVU A;  3KV6 A;  4CI3 B;  3Q5M A;  2B1E A;  4HKA A;  4YDO A;  2XM1 A;  2PQN A;  4JB8 P;  2LSU A;  3PZ3 A;  4GML A;  2LJL A;  4G11 A;  4F6R D;  3PUY F;  4ATG A;  5IYZ E;  5C1D A;  3FZL B;  3LJC A;  3ZCJ A;  5JDM A;  1IJ5 A;  5FY0 A;  5BMV E;  2E9X B;  4B8A A;  3MZL B;  2VQF T;  3ZCI A;  4HRN A;  2I0M A;  1YD8 G;  5CCL A;  2KXP B;  3M65 A;  2J62 A;  4J2C A;  1IBK T;  4LF7 T;  5H6Q B;  2WS3 A;  2E5L T;  3TLT A;  3ESK A;  4CCA A;  4EHM A;  2WDV A;  3QC1 A;  4GTP A;  4DUI A;  1D9S A;  2P9N G;  3RJV A;  3TKL B;  3QK0 A;  4I6J A;  4YLH A;  3RSE G;  1N33 T;  2X0Y A;  1E96 B;  3P4S A;  2Q9Q D;  1IHG A;  3P4R A;  1W0B A;  5TAO A;  3TWW A;  2AW6 A;  1HS6 A;  4E6H A;  3PDN A;  4LFB T;  4LF5 T;  3FTV A;  4HNA D;  3GN5 B;  1E7P A;  2V4L A;  4EZK A;  4MBQ A;  4TUY E;  2XRY A;  2BTD A;  3RYH E;  3AE7 A;  3AEG A;  1X81 A;  2DCP A;  5FJY A;  4O1P A;  1WCR A;  2LSG A;  4IE7 A;  4QX8 B;  2XPI A;  4ZZC A;  2FO7 A;  4CI2 B;  4HOU A;  5CGM A;  3QC9 A;  2GGF A;  4GYR A;  3IA3 A;  3EJN A;  3D9L A;  5FTP A;  3OYX A;  3VTX A;  4JEH A;  4TX5 A;  4A56 A;  3R84 B;  4HWH A;  1OXZ A;  5HKP A;  1BLX B;  3FUE A;  4OAU C;  2IML A;  3N2G E;  2AXV A;  3RKO A;  2QFC A;  2XQ3 A;  1WFD A;  2WWU A;  3PUQ A;  2RG8 A;  2V7M A;  3I1A A;  1MIW A;  5EDS A;  1OCC E;  1K3Z D;  3UUX B;  3CHM A;  4J8D A;  2R02 A;  5AQB A;  1H0A A;  2JJ9 A;  2VKH A;  2WDQ A;  4B3T T;  2KZT A;  3Q73 A;  4X1K E;  2XS8 A;  3PUA A;  4I9E A;  2XGS A;  3EU5 A;  3CEQ A;  1PAQ A;  3FUK A;  4F3V A;  4E85 A;  3FDH A;  3HXB A;  1UJK A;  3CHR A;  3HXD A;  3OYZ A;  1R8I A;  4I6G A;  3CML A;  4NRH B;  3OKQ A;  5HCM A;  5FKY A;  4Q69 A;  1X5B A;  2MHK A;  2J4B A;  4J6I A;  1Z3X A;  3FZF B;  1UK5 A;  4XKB A;  3ZT5 A;  1D0Z A;  3GW4 A;  4YDY A;  3S7J A;  5AFU L;  4O60 A;  4NXN T;  4QHO A;  2IU1 A;  2PZI A;  4WW0 A;  4OVV A;  4FHJ A;  2Q9Q A;  5AQQ B;  3ASO E;  3Q9N C;  2NR4 A;  2RKK A;  1HS7 A;  5FL1 A;  2VVS A;  2V8S V;  3RC8 A;  2KWI B;  4DV3 T;  3AU5 A;  4B0Z A;  3NZU A;  4GAA A;  1HX1 B;  3T5V A;  4A1G A;  3T8K A;  5FXV A;  4BJM A;  2L6J A;  3F2E A;  4DX6 D;  3ZVV A;  5FVL A;  4GZD A;  4XIF A;  3UM2 A;  2BG9 C;  5JDL A;  4EV6 A;  2YDR A;  2OVB A;  4DLO A;  1YW0 A;  4FJZ A;  5BV1 A;  3FXE B;  5A6C A;  1H6O A;  5KCM A;  3FUF A;  3OVU A;  4UQY A;  3HG0 D;  5BV0 A;  3B5M A;  5FIO A;  2LLY A;  3NZQ A;  2X38 A;  2JEK A;  2XHE B;  3HKC E;  2CHZ A;  1HE8 A;  4YJ2 E;  4FC8 A;  2CHW A;  1PC2 A;  4UVC B;  2H6H A;  2ZIS A;  4UF0 A;  4UI9 J;  1H2T C;  1ZB1 A;  2PL2 A;  5CA0 E;  3LDQ B;  2ZM2 A;  1NA0 A;  4U04 A;  5AQ7 A;  3O4X E;  4YFS A;  5LNK A;  2JAB A;  4BAY B;  1MYO A;  4DBR A;  4B3R T;  4JI6 T;  2P9P G;  2K48 A;  2ACX A;  4WWN A;  1NEN A;  3D9K A;  3PV0 F;  4M1P A;  1JCR A;  4FA6 A;  5F3J A;  4N3B A;  2ZM6 T;  5CER B;  4GOU A;  4JL0 A;  3HHM A;  3TL5 A;  3U78 A;  2FJB A;  2BZB A;  4GK5 E;  4HGA A;  4UUC A;  2AWI A;  3LK2 B;  3BQO A;  3PE0 A;  3IHR A;  1N94 A;  3HXF A;  3AED A;  3KDS E;  4AKL A;  5JTG A;  3FUL A;  2XSA A;  4IST A;  4ZEY A;  4C48 B;  2YU2 A;  2FJA A;  2LXM A;  4WAF A;  4CRW A;  4H9P C;  4H63 H;  1D1A A;  3FEY A;  1MHQ A;  4U0Z A;  4YVQ C;  2I59 A; 
#chains in the Genus database with same CATH homology
 2QGS A;  3Q47 B;  4U63 A;  3FTZ A;  3PRZ A;  1E90 A;  1EDU A;  1OWA A;  4N5C A;  2R17 C;  1Y6I A;  3UX4 A;  1ELW A;  5FY1 A;  2A3D A;  3EDV A;  4JC8 A;  3QDN A;  3U64 A;  1V9D A;  5LFA A;  3E4B A;  4HOQ A;  2HM8 A;  5FMN A;  2DIW A;  3FXD B;  3NBX X;  3JQ0 A;  4JHJ A;  3FU5 A;  4CT4 A;  2LSK A;  2L9B A;  2XGO A;  3SRZ A;  4ILH B;  5L3F B;  3C98 A;  3ZN0 B;  3FTS A;  4JW1 A;  5FXX A;  4PNI A;  4AKG A;  3AS5 A;  4XX5 A;  3L22 A;  4CI1 B;  3LS8 A;  4YJ3 E;  2WB2 A;  1L5J A;  2Q7F A;  3K3N A;  4HE8 A;  2WXN A;  3CIA A;  5LGU B;  4HTE A;  4PAG A;  5KJL A;  4IGU A;  2XAQ B;  3D9O A;  1BR1 A;  2SPC A;  3PDY A;  3ZYL A;  2XAH B;  1Y8M A;  3BK9 A;  2CHX A;  3FUH A;  2X9H A;  2VAS A;  3LEW A;  4BA9 A;  2LSV A;  2XQY A;  4XKC A;  3FH7 A;  1H2V C;  1PY1 A;  3G2V A;  3LK4 2;  1HU3 A;  2XAS B;  1UW4 B;  4KVO A;  4G2V A;  1YKH B;  3PU3 A;  2LHN A;  3KVB A;  4WNF A;  4I1A A;  3EDT B;  4JEU A;  3FH8 A;  4H63 V;  4CEM A;  3UUM A;  3CHP A;  3HDX A;  2J49 A;  1MMD A;  2MOW A;  5G04 C;  4DND A;  3RRU A;  5CMY A;  3ZXS A;  5KMG P;  3PUK A;  3QJZ A;  5T8I A;  4QXB B;  3WI3 A;  4DLQ A;  5IHY A;  4I50 E;  2L3L A;  5L3G B;  3I4R B;  2WSS V;  4QKN A;  3S7F A;  4PH4 B;  3ESL A;  3UT8 A;  4P0B A;  3LK3 B;  4Q96 A;  3GZS A;  4MKT A;  5ADX L;  2X9X A;  3L13 A;  5FZQ A;  3I9W A;  2OV8 A;  1UJJ A;  4RG9 A;  2ODU A;  3ZMZ B;  4NUV A;  4CGW A;  3I3N A;  4Z8X A;  3PZD A;  1SHZ C;  1U3D A;  3RO2 A;  2YHE A;  2JMK A;  3IEE A;  4PK4 A;  5JH7 E;  3DTO A;  2X67 A;  2BVM A;  1UN9 A;  3C4W A;  4PS8 A;  5EK2 A;  4JPS A;  3G2T A;  4PS3 A;  1QZ2 A;  5FZS A;  5JVD E;  5J90 A;  3CST A;  2VKJ A;  4JEU B;  4H9N C;  1E8W A;  2DWG A;  2X6H A;  1UN8 A;  4WUY A;  4DI4 A;  1VRB A;  5DQV A;  2AXU A;  3C98 B;  2KZ7 B;  2CXL A;  3AVS A;  1LF8 A;  1T98 A;  2X9W A;  3QAQ A;  1IZN B;  3C4X A;  3CVL A;  2W00 A;  3L09 A;  2NXP A;  4DO0 A;  4YHJ A;  2VL8 A;  3KAE A;  1WYC A;  5LP0 A;  1FVH A;  5JRE A;  4ACK A;  2UWJ G;  3MEK A;  4P09 A;  2W0G A;  3FB2 A;  4DJA A;  4X20 E;  4GMJ A;  2A72 A;  3AVR A;  3RYC E;  1NZN A;  4PUC A;  4CDN A;  4G26 A;  5JDG A;  3N9M A;  4TZ4 C;  5G05 J;  1BR4 A;  3D9M A;  2X6I A;  3DBS A;  1A17 A;  4AXH A;  4UV9 B;  2VSN A;  5ANL A;  2P9B A;  4G2A A;  3ZMV B;  4XZC A;  4EB6 E;  1E7V A;  3B57 A;  4EQF A;  3RYI E;  5C2Y A;  3DJB A;  3QWW A;  2C2L A;  3ETU A;  2CFZ A;  4WNE A;  4A1S A;  5FXW A;  4CDR A;  3C51 A;  3A5X A;  2M63 A;  3B7R L;  5BUZ A;  4LRZ A;  3RPU A;  5LGN B;  2JLB A;  1NP7 A;  2VK9 A;  4BJN A;  4PS7 A;  3L6A A;  4G1T A;  5LOZ A;  3CKC A;  4PK5 A;  3D9I A;  1MMA A;  3PEV B;  5LCW J;  3SF4 A;  4H9O C;  4O4H E;  2X6K A;  5CHE E;  4DPR A;  2LSY A;  1Z0P A;  3ZYQ A;  3KV9 A;  3MA5 A;  4JXT A;  3FP3 A;  4AKR B;  2CA5 A;  4ISS A;  4BX9 A;  2PFV A;  2X9Y A;  2LT3 A;  3N2K E;  4KXK B;  2ES0 A;  2MBG A;  4TRQ A;  5JR9 A;  3FBZ A;  1D1C A;  4AM9 A;  1H19 A;  3LBX A;  4FLH A;  3U3W A;  4OFZ A;  4ILU A;  3ZMT B;  4WND A;  1KT1 A;  4Y6W A;  5D0O D;  4PK6 A;  3HI2 A;  5HWY A;  3J9X 1;  4NUU A;  1JPL A;  4H9R C;  1S94 A;  2P58 C;  4KUM B;  4IIJ E;  1P5Q A;  4ZI7 E;  5LP6 E;  2D2S A;  2FUL A;  5LGT B;  3ZJ1 A;  3U66 A;  4O2A E;  3MYV A;  2YU1 A;  1ZEE A;  2HH7 A;  3K3O A;  1WAO 1;  2CG2 A;  3EHM A;  5FXZ A;  2EHO A;  4ZS3 A;  4C9B B;  3I5P A;  2E8I A;  1MND A;  4IYP A;  3I0Q A;  2VTB A;  2NWB A;  3IBE A;  5J1G A;  5EK4 A;  4AQF A;  1VOM A;  2NTX A;  3S7B A;  2WXP A;  4ZS2 A;  3KD7 A;  4AIF A;  4EBA G;  4C0E A;  2I6H A;  3MGB A;  2KIN B;  3PS6 A;  3AB3 B;  4O4L E;  3CVW A;  1EPU A;  3CVN A;  4UWL A;  2XPZ A;  4DI3 A;  4WBO A;  4DMV A;  4J0U A;  3PUG A;  2Q9Q B;  3ZFW A;  1LVK A;  2PM7 A;  3CPZ A;  3LFM A;  3FHE A;  4L23 A;  3LY8 A;  4I55 E;  4XI9 A;  5FQ6 A;  1SZ9 A;  1BR2 A;  3I9Y A;  5G55 A;  1US7 B;  2ZM0 A;  2XUE A;  3UT7 A;  2LM9 A;  2VGY A;  4I17 A;  3ONK A;  2KWH A;  3GYZ A;  3AA0 B;  2KZT B;  2WXO A;  2PG8 A;  3IKO B;  1EF1 C;  3TJP A;  2J4D A;  3PE4 A;  3TXM A;  3CHS A;  3ZIM A;  5T4Y A;  2WBL A;  2VSY A;  3CV0 A;  5DJQ C;  4P29 A;  5ANR A;  1ELR A;  2KAT A;  4TV9 E;  3SWH A;  3FY4 A;  3LBX B;  2HR2 A;  4WNG A;  4BT9 A;  5G04 J;  3PH0 C;  3ONL A;  4MAL A;  4YND A;  2KC7 A;  4APF A;  4GCO A;  4ADZ A;  3Q15 A;  4ZI3 D;  2MYS A;  2BDE A;  4DMW A;  5LXT E;  2YHC A;  4UWH A;  5LCY A;  3C50 A;  5HXC A;  4EIW A;  4ILI A;  3VLD A;  4AJW A;  5BT1 A;  4GPK A;  3ZN1 B;  3QAR A;  2HPJ A;  2E0I A;  5CCM A;  3IV0 A;  3MJW A;  4KP3 C;  2QA7 A;  3VHL A;  5T3R A;  4XZ4 A;  2V1D B;  4EBA A;  4GZ5 A;  5HQ8 A;  2C5I T;  4JVS A;  1GW6 A;  3NRX A;  3UTK A;  2W61 A;  3J7Y q;  4B6X A;  3FFL A;  2CE7 A;  5HXS A;  1WLX A;  3ETV A;  2V0P A;  2BF0 X;  3HIZ A;  3RRN B;  4IHJ E;  2WQ6 A;  1HO8 A;  2NTY A;  3CVV A;  2N9D A;  4U0S A;  2LE8 A;  3CSF A;  1OWM A;  3JUI A;  1HX8 A;  3UQ3 A;  5J08 A;  2Y4U A;  2WXR A;  3R7R A;  2WVI A;  4FJY A;  3L17 A;  1B7T A;  5KX5 E;  2BUG A;  3D0T A;  2NW7 A;  3EHN A;  4P0A A;  5HXH A;  2HYZ A;  2WMO A;  2XAJ B;  2M67 A;  4EYU A;  4IUL A;  3ASF A;  2VTB B;  3FHN A;  2GRL A;  4G63 A;  2IFU A;  5HI7 A;  3ZHE B;  5ARF A;  3CHQ A;  3LCA A;  4O6F A;  5AEN A;  3HR0 A;  1MQS A;  4HN9 A;  4URK A;  1H6K A;  2NP9 A;  3OAW A;  3MA9 A;  3MKQ A;  4UF0 B;  5JRC A;  3QUJ A;  3ZMS B;  4GYS A;  3ENE A;  2ODV A;  4XBF B;  3MCX A;  3PU8 A;  4PJL A;  1ZU2 A;  3KVA A;  4EXT A;  3C64 A;  3ZGQ A;  4EZH A;  3PUJ A;  3L16 A;  5JJT A;  4F53 A;  3CKD A;  3SHF A;  3BEE A;  4KZC A;  3TAX A;  5BW8 C;  4AI6 A;  5EK3 A;  1FMV A;  5LHH B;  3LXU X;  1N54 A;  3E08 A;  2XRZ A;  2NOX A;  3BG0 B;  4K0U A;  1WM5 A;  2UY1 B;  3RRC A;  3IBP A;  3MK7 C;  2Z6E A;  2EHO B;  3SGH A;  4IE0 A;  2C5J A;  2XHE A;  2J08 A;  2VKD A;  2VGX B;  5HXE A;  3GN5 A;  3Q49 B;  4MFR A;  2YK0 A;  3QB2 A;  2DI4 A;  3MX3 A;  4HS2 A;  5J2U E;  3EIJ A;  3ZN3 A;  4ANV A;  5FNV E;  4C91 A;  4ANJ A;  1U3C A;  2L0I A;  3URZ A;  5CMW A;  3ZYK A;  3CX8 B;  3FU0 A;  2CMR A;  3NRY A;  1Z6T A;  4UI9 C;  3ZJ2 A;  2JRK A;  3BG1 B;  3QK6 A;  3CX6 B;  1ZHC A;  5D0Q D;  1HTJ F;  3LVQ E;  2AXZ A;  3CHO A;  3KS2 A;  4UEL A;  4AKH A;  2R59 A;  5GON E;  5A7D B;  3E22 E;  2JPF A;  2HO1 A;  4ZI3 C;  2CEA A;  1KK7 A;  3N9N A;  4AY6 A;  5KDM C;  4APO A;  3RX6 A;  2MOZ A;  4HOR A;  1LRZ A;  3N9L A;  3FUD A;  4O2B E;  4IN3 B;  2E2E A;  2YIN A;  4Y6C A;  1QUU A;  3BQI A;  4IRU A;  4I1O B;  3FH5 A;  3HL6 A;  4EZL A;  3APC A;  3O1J A;  4ZHQ E;  3CVR A;  4CZZ B;  4ZOL E;  4YVO A;  4JA7 A;  3H3A A;  3VU7 H;  3HA4 A;  2J07 A;  2V26 A;  5LHG B;  5FQ8 A;  4KMO A;  1WR6 A;  2Q9Q C;  3N5L A;  4WBN E;  3T5X A;  5LYJ E;  4HXI A;  2CG3 A;  2UXN B;  4OHF A;  4W9R A;  1S35 A;  2L8K A;  3KBT A;  2I1J A;  4PFO A;  3DP7 A;  2VB6 A;  2WPV A;  5A23 A;  2J1D G;  4HEA A;  2WM9 A;  3PTR B;  1OUV A;  4G23 A;  1INZ A;  3CK9 A;  3S7D A;  2ZU6 B;  1KT0 A;  4GIW A;  3GMI A;  4EOZ B;  2OA5 A;  5JHA A;  3ANW A;  4FP7 A;  1E8X A;  5FT9 A;  2KCV A;  5LOV E;  5ENN A;  2VGX A;  2WXG A;  3CK7 A;  3AA1 B;  1JUQ A;  5JRC B;  2YQ8 A;  4C0M A;  2CLY B;  2C0S A;  3FUM A;  4JZY A;  3I4G A;  1KLX A;  4RVB A;  3RRW A;  3LVR E;  2KM4 A;  4H9S E;  4EZJ A;  5AIJ A;  2WXJ A;  4L0R A;  4U72 A;  2IW5 B;  3HVE B;  2X3M A;  1NA3 A;  2VJ8 A;  2XAG B;  2K9A A;  2X6J A;  2PQR A;  5ARG A;  3ZPJ A;  1IAP A;  3MJX A;  4QXC B;  5JJ7 A;  3IHY A;  2MRI A;  1ZKE A;  3RO3 A;  4NUR A;  3U4T A;  1FEW A;  3FEX A;  3OTN A;  1S0P A;  4UV8 B;  3G2W A;  3PUR A;  3UPV A;  5M4Y A;  4GZC A;  4EAH A;  2V7I A;  2VSO E;  3QWV A;  3D9J A;  4N78 D;  1YKE B;  2I2O A;  2N1G A;  3MKQ B;  1FMW A;  3ZEF B;  3JQ1 A;  1HG5 A;  4GK0 E;  2XCC A;  2PJQ A;  4I2Z A;  3CVX A;  3HKD E;  2BVL A;  4U0U A;  4KVM A;  3ZC0 A;  3ZLI A;  3APF A;  2NW9 A;  3APD A;  2FBN A;  4MHC A;  4AOF A;  3LG7 A;  5LJM A;  2LAI A;  3UT4 A;  4QXH B;  3FUN A;  4A3T A;  5KJM A;  3B7U X;  1FIO A;  2PM6 A;  1HH8 A;  2A5U A;  3R9A B;  4EEC A;  2LSI A;  5LJN A;  3CQX C;  3O4Z A;  5EKQ D;  3QOU A;  4TUU A;  4IE5 A;  4L1B A;  4HLE A;  2WXF A;  2OVF A;  1TJF A;  1BPO A;  5JQG E;  3N9O A;  4J8S A;  2KCL A;  2XGM A;  2LAH A;  4H7Y A;  3PNL B;  3K3Q C;  3P7I A;  3NZP A;  4C90 A;  3TXN A;  2IAK A;  2WQ7 A;  2D0U A;  3SBT B;  3HKE E;  2MTQ A;  3P8C D;  4L9I A;  4MLP A;  3HKB E;  5KJK A;  2DBA A;  3DPD A;  4IDZ A;  3SNX A;  2LHR A;  4U74 A;  3JC6 D;  5HWX A;  3IF8 B;  4JLE A;  4LCT A;  3QKY A;  3CK8 A;  1G73 A;  4OK0 A;  4EYY R;  3TGO A;  2G0U A;  3CQC B;  4AV7 A;  2NC9 A;  4PDX A;  4CDM A;  3R6N A;  3AA7 B;  1Y64 B;  5JDH A;  5AJD A;  4DK5 A;  5AJL A;  1TJC A;  4BTA A;  5FZR A;  2XCB A;  3NQP A;  3R7Q A;  1KNZ A;  2CWO A;  2ZLY A;  4ANX A;  3SS1 A;  5FWQ A;  3JC6 C;  4TN7 B;  2VKO A;  4OYS A;  4TV8 E;  1TEZ A;  4ERR A;  2X66 A;  1CUN A;  3IHV A;  3RIB A;  1BR0 A;  4G25 A;  4BY6 A;  1MMG A;  1WYB A;  2E9X D;  5EZY E;  3FUI A;  3SI5 A;  3FTU A;  4HVB A;  2X0L B;  3KFW X;  4JA9 A;  4I4T E;  3UUN A;  2DNX A;  2LEH A;  4GB9 A;  3BQL A;  3CLJ A;  2GK9 A;  2WQH A;  4MRU A;  1D0Y A;  4AQG A;  4ANU A;  5ETW A;  5FY7 A;  5DIZ A;  2D5U A;  4N3A A;  4JUY A;  3ZYM A;  3VLE A;  4XI0 A;  4U8H A;  2GW1 A;  3EIQ C;  4E7S A;  2WXL A;  4LEU A;  3FTX A;  3OJA A;  4GU5 A;  4K0R A;  4RSY A;  4TV3 A;  1MNE A;  3Q2M A;  3U9W A;  3D3M A;  4BWR A;  4B8C B;  4WNK A;  3V5U A;  4UI9 K;  3Q9D A;  3RK6 A;  3MAC A;  3U3I A;  2H3R A;  5L2L A;  3T8M A;  3G2S A;  2ZMA A;  2DHR A;  2KMF A;  3LDZ A;  4BT8 A;  3JYS A;  4A55 A;  3RYF E;  4GZ6 A;  4OYK A;  4CT0 A;  4N2Q A;  4GA1 A;  5JR9 B;  4UVB B;  4PW8 A;  2R5S A;  2CCQ A;  3UMV A;  3LY9 A;  5LCW C;  3AAE B;  3T8O A;  4HOS A;  5LX8 A;  2X51 A;  2VWA A;  4GA2 A;  2WAU A;  4O4J E;  4ACL A;  5JDF A;  1E1H B;  1D1B A;  1LKX A;  3KBU A;  1W3B A;  2KND A;  3LY7 A;  4CXW A;  1U4Q A;  1MIY A;  3MV2 B;  1E8Z A;  4AVX A;  4MS6 A;  3O1H A;  3EVY A;  3RH3 A;  1LVF A;  1B89 A;  3VKH A;  3FU3 A;  3MXZ A;  3ASG A;  3H37 A;  5AYW D;  2XQ0 A;  3SBS A;  2RA1 A;  2K24 A;  4KBM B;  2VYI A;  3JCK C;  2E9X A;  5FQ7 A;  5JDN A;  3FTY A;  3SD5 A;  1G8X A;  3P1U A;  3PUS A;  5E76 A;  3QWP A;  3O48 A;  4N2S A;  3RU0 A;  2XAF B;  4J8E A;  1OWL A;  2EHO C;  3HVE A;  3KIN B;  1Z3Y A;  3B7S A;  3CVP A;  4FUL A;  2IOS A;  2DWK A;  3PVL A;  2XPY A;  3BQK A;  2L9Q A;  4CXX A;  4CXY A;  5LHI B;  5L3C B;  3F57 A;  4IE6 A;  4D10 C;  4GCN A;  2RD0 A;  2IC6 A;  2NSZ A;  4RG6 A;  3OBV E;  2EHO D;  3ZMU B;  4UXN B;  2A4Z A;  4AKI A;  3ML8 A;  4R7L A;  2Y8D A;  1HFA A;  4B94 A;  3I0O A;  4LUN U;  2WXQ A;  2GRM A;  1HCI A;  3D9N A;  1HF8 A;  3EDU A;  2WXH A;  1NAF A;  3GWH A;  2LO6 A;  2FI7 A;  3UT5 E;  2J09 A;  1SZA A;  2I1K A;  2RP4 A;  1N52 A;  4PJN A;  1O3X A;  3CGH A;  4HFV A;  1H7C A;  2I9C A;  2H7V C;  1E8Y A;  5BPP A;  4AP2 A;  3B13 A;  5G05 C;  3MZK B;  3O9X A;  3N71 A;  2HPL A;  5HXR A;  2XEV A;  4ZI2 C;  4I43 A;  3CR3 A;  5LG4 A;  3ZPO A;  3AA6 B;  3K8P C;  3B7T A;  2YNQ A;  2DLR A;  3AU4 A;  5JDQ A;  4L5G A;  4FHK A;  4CGV A;  3L08 A;  4UWG A;  4N3C A;  3TG4 A;  4HOT A;  3TG5 A;  2JMH A;  4OYJ A;  3VTY A;  4O8S A;  5DBK A;  1VDY A;  4K03 A;  5L3E B;  3ZEF A;  4F7A A;  2UY1 A;  3FTW A;  3AS4 A;  2OOE A;  3S2A A;  4F6R C;  5JR9 C;  2C0M A;  4O4I E;  5J2T E;  4MLK A;  4AQF C;  3P2B A;  4V1A v;  3W15 B;  3K9I A;  3QNK A;  3Q4A B;  4M3O A;  2LSJ A;  2DCF A;  2Y48 B;  2L0T B;  4NAC A;  3CVQ A;  4HFG A;  1WRD A;  4BTB A;  4AY5 A;  3AS8 A;  1IQR A;  4ANW A;  4DVD A;  4V3I A;  3MKR A;  3KV5 A;  5L3D B;  4KZ0 A;  1HG2 A;  3KV4 A;  4PJM A;  4FAD A;  2V5F A;  3ZRH A;  5JJ6 A;  3IEG A;  1FVF A;  4EZ4 A;  1H2U A;  3SFZ A;  4AXP A;  4QFV A;  4ME2 A;  4EPZ A;  3SOL A;  5E0O A;  3UUL A;  1IJ6 A;  3Q5X A;  4GYO A;  3E0Z A;  4UQZ A;  1E7U A;  2PBI A;  4I6E A;  5FQ4 A;  3ZC1 A;  3WAK A;  4FU3 A;  1ZBP A;  5DQW A;  5LBM A;  1X79 A;  4I43 B;  2A2F X;  5EX0 A;  5HYA A;  3ASH A;  2CFU A;  3CVU A;  3L3P A;  3C4Z A;  2V7L A;  1ZV4 X;  2UXX B;  5DAB A;  3EUH A;  4JHR A;  4DBQ A;  3UUX A;  3ANW B;  1OWP A;  3GZ1 A;  3WAJ A;  2D0T A;  1WY6 A;  2C0L A;  1MMN A;  2CXD A;  4G24 A;  2FF4 A;  1QNF A;  2YEV C;  1JWG A;  4KMC A;  3UFE A;  3Q5W A;  2OND A;  4L2Y A;  4N39 A;  3L54 A;  2E9X C;  2K5B B;  3FBL A;  3ASD A;  3HYM B;  3RC3 A;  3PE3 A;  1OWN A;  4WWP A;  4X1I E;  3AAI A;  3FUJ A;  5G2N A;  4Q94 A;  2NW8 A;  5LBQ B;  4BX8 A;  2N2N A;  2CWY A;  2IC9 A;  4UIG A;  3OXG A;  4KBQ A;  4CQI A;  2Y6X A;  2EQX A;  1SA0 E;  3VLF A;  3ZHE A;  3MV3 B;  1HXI A;  3LKU A;  1QQE A;  3FWV A;  4I1M A;  3ULQ A;  2V8S E;  5C8Y E;  2KLQ A;  4IE4 A;  5CB4 E;  2WMN A;  2H7O A;  4AEZ C;  5CA1 E;  5E75 A;  2ILR A;  4GZ3 A;  3GA8 A;  4PFP A;  1AJ3 A;  2LOP A;  3N9P A;  1IYG A;  2WXM A;  4FLB A;  2C5K T;  2W62 A;  1ELK A;  3V5S A;  2CM0 A;  4L2L A;  3S4U A;  3CVY A;  3LPZ A;  2VSX E;  2KCK A;  1DNP A;  3ML9 A;  4JEH B;  4E7Z A;  2WXI A;  1UCU A;  3VKG A;  5A1L A;  5FP3 A;  3AAA B;  2IOL A;  1U5P A;  1D0X A;  4GA0 A;  4I2W A;  4J8F A;  4L7T A;  4A3V A;  4BSX A;  3NF1 A;  5JHB A;  4UWF A;  2X6F A;  4LER A;  1NWM X;  3G2U A;  4FI5 A;  5FYM A;  3PEU B;  2FEZ A;  4NQ0 A;  1XGW A;  2VQ2 A;  4X1Y E;  1DVP A;  4FJO A;  3KEZ A;  2V7K A;  5EX3 A;  5M72 A;  3CX7 B;  2V7J A;  2LOS A;  4ZI2 D;  4BFR A;  3ZW3 A;  4I9C A;  4UEM A;  3GZ2 A;  3CKB A;  2KT9 A;  5BNW A;  3LYA A;  4UVA B;  2AVP A;  1JWF A;  1MIV A;  4XE0 A;  1XNF A;  2WXK A;  3WXX A;  3PRE A;  2IJG X;  5L3B B;  3OXF A;  3RKV A;  5H6R B;  1UX4 A;  3F31 A;  4PJJ A;  4H9Q C;  4QWN B;  3N2O A;  4KYO B;  2LNI A;  2ZM8 A;  2Y3A A;  3OXL A;  2QY7 A;  2J9Q A;  3O1I A;  2JQQ A;  5F8P A;  1UG3 A;  3MKD A;  1FCH A;  3CWZ B;  3D9P A;  4ABN A;  4ILG A;  1IQU A;  2IQC A;  5KJN A;  4WWO A;  2X68 A;  2ION A;  1QSD A;  3RRM B;  2CLY C;  1EYH A;  2XTL A;  4F1S A;  1YA0 A;  4GYW A;  2CXF A;  2W63 A;  3PNT B;  3SZ7 A;  4QX7 B;  4U07 A;  1EZ3 A;  4H7X A;  1OWO A;  5HAX A;  3LJ3 A;  3FU6 A;  4UWK A;  2IF4 A;  4XAX B;  1SQM A;  4B89 A;  3CQG B;  4ASK A;  1UX5 A;  4UQX A;  2Y4T A;  4GYY A;  1HZ4 A;  4KT6 B;  3N9Q A;  5LA6 E;  4JHK A;  3ONX A;  3NZS A;  4OVU A;  3KV6 A;  4CI3 B;  3Q5M A;  2B1E A;  4HKA A;  2PQN A;  2LSU A;  4GML A;  2LJL A;  4G11 A;  4ATG A;  5IYZ E;  5C1D A;  3ZCJ A;  3LJC A;  1IJ5 A;  5FY0 A;  5BMV E;  5JDM A;  2E9X B;  4B8A A;  3MZL B;  3ZCI A;  1YD8 G;  5CCL A;  2KXP B;  3M65 A;  4J2C A;  5H6Q B;  3ESK A;  4CCA A;  3QC1 A;  3RJV A;  3TKL B;  3QK0 A;  4I6J A;  4YLH A;  1E96 B;  2Q9Q D;  1IHG A;  5TAO A;  2AW6 A;  1HS6 A;  4E6H A;  3PDN A;  3FTV A;  3GN5 B;  2V4L A;  4EZK A;  4MBQ A;  4TUY E;  2XRY A;  2BTD A;  3RYH E;  2DCP A;  5FJY A;  2LSG A;  4IE7 A;  4QX8 B;  2XPI A;  2FO7 A;  4CI2 B;  4HOU A;  3QC9 A;  2GGF A;  4GYR A;  3EJN A;  3VTX A;  3D9L A;  5FTP A;  3OYX A;  4JEH A;  4TX5 A;  4A56 A;  3R84 B;  1OXZ A;  3FUE A;  3N2G E;  2AXV A;  3RKO A;  2QFC A;  2WWU A;  3PUQ A;  2RG8 A;  2V7M A;  3I1A A;  1MIW A;  5EDS A;  3UUX B;  3CHM A;  4J8D A;  1H0A A;  2JJ9 A;  2VKH A;  2KZT A;  4X1K E;  3PUA A;  4I9E A;  2XGS A;  3CEQ A;  1PAQ A;  3FUK A;  4F3V A;  4E85 A;  3FDH A;  3CHR A;  1UJK A;  3OYZ A;  4I6G A;  3CML A;  4NRH B;  3OKQ A;  4Q69 A;  1X5B A;  2MHK A;  2J4B A;  4J6I A;  1Z3X A;  4XKB A;  1D0Z A;  3GW4 A;  3S7J A;  5AFU L;  4QHO A;  2IU1 A;  2PZI A;  4WW0 A;  4OVV A;  4FHJ A;  2Q9Q A;  1HS7 A;  3RC8 A;  2KWI B;  3AU5 A;  4B0Z A;  3NZU A;  4GAA A;  3T5V A;  4A1G A;  5FXV A;  4BJM A;  2L6J A;  3F2E A;  3ZVV A;  4GZD A;  4XIF A;  5JDL A;  2OVB A;  4DLO A;  1YW0 A;  4FJZ A;  5BV1 A;  3FXE B;  5A6C A;  5KCM A;  3FUF A;  4UQY A;  5BV0 A;  3NZQ A;  2X38 A;  2JEK A;  2XHE B;  3HKC E;  2CHZ A;  1HE8 A;  4YJ2 E;  4FC8 A;  2CHW A;  1PC2 A;  4UVC B;  4UF0 A;  4UI9 J;  1H2T C;  2PL2 A;  5CA0 E;  2ZM2 A;  1NA0 A;  4U04 A;  3O4X E;  4YFS A;  5LNK A;  4BAY B;  4DBR A;  2K48 A;  2ACX A;  4WWN A;  3D9K A;  4M1P A;  4FA6 A;  5F3J A;  4N3B A;  4GOU A;  4JL0 A;  3HHM A;  3TL5 A;  3U78 A;  2BZB A;  4GK5 E;  4HGA A;  2AWI A;  3LK2 B;  3PE0 A;  3IHR A;  3KDS E;  3FUL A;  4AKL A;  4IST A;  2YU2 A;  4CRW A;  4WAF A;  4H9P C;  4H63 H;  1D1A A;  3FEY A;  1MHQ A;  4U0Z A;  4YVQ C;  2I59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...