3CQCB

Nucleoporin nup107/nup133 interaction complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
225
structure length
186
Chain Sequence
SHMLSWLHEINSQELEKAHATLLGLANMETRYFAKKKTLLGLSKLAALASDFSEDMLQEKIEEMAEQERFLLHQETLPEQLLAEKQLNLSAMPVLTAPQLIGLYICEENRRANEYDFKKALDLLEYIDININDLKLEILCKALQRDNWVSKDSIFVKILLPEVKDLLQADEFVLKANYEYYVQGQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional studies of Nup107/Nup133 interaction and its implications for the architecture of the nuclear pore complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Nuclear pore complex protein Nup107
total genus 55
structure length 186
sequence length 225
ec nomenclature
pdb deposition date 2008-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1380 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3cqcB01
1.25.40.700 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3cqcB02
3CQGB 3CQCB 3I4RB
chains in the Genus database with same CATH superfamily
3DXKG 3UT5E 1WYBA 3RC8A 4WYVA 3RKGA 3ESKA 2V7MA 4QWNB 3AS5A 3PUWF 3QK0A 5AQ9A 2XQ0A 2WQ6A 4LERA 5G55A 3JQ1A 1FVFA 4HTEA 4LMKA 3AE2A 5FT9A 4EZLA 1H6PA 1Y6IA 3CQXC 1HNXT 1OXJA 5CHEE 4YT0A 1U2VG 3FUJA 3LS8A 1ELWA 1WY6A 4CDNA 3AECA 4YDYA 2RFAA 4EZ4A 2WB2A 1OWAA 1NI1A 3EJNA 5AQRB 3CHPA 4HOUA 4GTRA 4IRUA 1OWMA 5L4EA 1B7TA 3LFMA 3GZ2A 4D10C 3UXGA 3RYFE 2IMLA 3TLUA 2XEHA 4JUYA 3LK2B 3ESLA 2XAJB 4IE0A 4A1GA 1EDUA 4URKA 4HFBA 2UXCT 4XX5A 4UQXA 3NKZA 4HNAD 3LXUX 2ODVA 3F2EA 3LDZA 3HDXA 1XNQT 4YJ2E 1WG0A 4XI0A 4ISTA 5FJYA 5G04C 5TAOA 1WLXA 4UQZA 1ZKEA 2LLYA 4A97A 4F8HA 2GRQB 3AA7B 1N11A 4GYOA 1BD8A 3Q7AA 3SFDA 3N9NA 2XM1A 4PFPA 2K9AA 4H63H 1WYCA 3E34A 3G2VA 2XJ7A 5EK3A 1FT2A 3RGLA 4A3VA 3QAQA 5KWDA 3FZLB 3IHRA 2CPTA 4YSXA 4CYMD 3VTYA 3HKEE 4GKJT 5EN5D 2E5LT 3EIQC 4X1IE 3ETVA 4ZI3C 4NIQA 2WU2A 1FCHA 4BJMA 2JMHA 3R7RA 3T8OA 5AJLA 1HZ4A 2OVBA 5AQMB 3WAJA 3TWUA 5CMWA 1G3NB 5C2TA 3KFWX 2EQXA 1UX5A 3Q49B 3MJWA 3URZA 2WZHA 4TWFA 2XQYA 2LRLA 2XSAA 4UUCA 2CLYC 2XPZA 5AQBA 3EDTB 4XKBA 2MAWA 5CEDB 5ENOD 3CHMA 3TLTA 3TGOA 3I9WA 2A5UA 1MIWA 3UFEA 1TNUA 4FJYA 4ZI3D 1Z3XA 3ZYLA 5FL0A 1ZU2A 2XZDG 3FH8A 3UT8A 2YU1A 3MEKA 1JWGA 2WXOA 3N9LA 1WR0A 2IUBA 1TNOA 3L39A 4HI8A 4EPZA 3ZT5A 3SNXA 3MACA 3HXDA 4CN6A 3HA4A 2V26A 3E0ZA 3PREA 4KBQA 1NA3A 4U04A 1L0VA 4X62T 3ZYKA 5JREA 4MRUA 4GA0A 4JEUB 1IQRA 4OYKA 4JBWF 4LF7T 5FXZA 2CHXA 3BQOA 3GZSA 2R59A 3PE3A 2F37A 2LHRA 1J5ET 5B1AE 2AXUA 2E5VA 3NQPA 3JAFA 3CMLA 5CGMA 2XZTG 5LP6E 4YLHA 4TUUA 4HWDA 4TWDA 2J08A 1D0XA 4U31A 4EZJA 4MHCA 4BETA 2WXIA 5FQ7A 1NZNA 2LSKA 3MZKB 3U78A 2AXVA 2ZLYA 4DK5A 4TNWA 1N4SA 3OTOT 3EUHA 3LVQE 5FIOA 3LKUA 2WWVA 2ONDA 4Q69A 1N36T 3ONLA 5BPPA 4H7YA 4JA7A 1OWOA 2PQRA 2BEDA 4EV6A 1S64A 4BTAA 5T4YA 4A55A 3FDHA 4JHJA 4JI8T 5BXOA 5ABGA 2ZM8A 2NW8A 5LGUB 1D9SA 5HS0A 3VHLA 4GCOA 4COFA 5AFUL 3RYCE 2LM2A 4Q96A 2X0YA 4Z68A 3NF1A 3GN5B 2EIJE 4J8EA 4L2YA 2DZNA 2Q7FA 1QBQA 3ZEFB 1H7CA 2C5KT 3WI3A 2P9LG 2ILRA 3QKYA 2BS3A 4BT8A 3ZUVB 4KI0F 3ZPOA 3Q5WA 2GRLA 4HWIB 2Y1LE 3N9MA 1XMOT 4MLKA 5H6RB 4K0KT 3HL6A 4L2LA 5AQNB 4TUYE 4BAYB 5JH7E 4NXMT 4U63A 3LK3B 2CM0A 2WWUA 2N1GA 3E22E 2CHZA 2QFCA 1OCZE 2XENA 3DPYA 4CT4A 4DUZT 4KZCA 2ZGGA 4FA6A 1YXRA 2QYJA 3MXZA 3P4RA 2WXLA 2HO1A 2WXGA 2QYUA 1AJ3A 4AQYT 4XBFB 5ITZF 4QXHB 2QY7A 4HBDA 2GRMA 3E4BA 4Q25A 3ZPJA 3RX6A 4NURA 4NXNT 2VWAA 4DRXE 1W0AA 2W4XA 3K3NA 3PNTB 5LGNB 4PJMA 4WNKA 1OEDB 2BBJA 2VGYA 3AU4A 4GTPA 3CIAA 2J47A 2LSJA 4YSYA 4OFZA 3LEWA 2GRRB 4F1SA 2R5SA 4I6JA 2UU9T 1S0PA 2BG9A 2C5JA 3QARA 4AKLA 1QSDA 4BSZB 3PDYA 3PU8A 1YW0A 2H89A 3FTSA 4GZDA 3JC6D 4KVOA 2JIWA 4X64T 3QJZA 5LOVE 1D8DA 3DXMG 4ZS3A 3LBXA 1VCTA 1H2UA 4KP3C 3D9OA 3OTNA 4I9CA 5FKYA 4JI5T 2NW9A 4TV8E 3CVVA 1HS7A 2FJDA 5A7DB 4B8CB 3RYIE 3Q75A 3ZSSA 1E1HB 4HN9A 1BR2A 5FQ4A 2D0TA 2XHEA 4DMVA 4OYSA 1WM5A 3QDNA 2A3DA 5LHGB 3U9WA 2CBJA 2DWGA 4GZ3A 1D0YA 5LB7B 3JUEA 4A56A 2PBIA 4OYJA 3PNLB 2XASB 4C9BB 3N5LA 3HKDE 1E7UA 2PZIA 3FP3A 4HOQA 4WW0A 3AVRA 3C3OA 2Y6XA 4FLHA 4JXTA 4ZI7E 4ANJA 3FHEA 3PU3A 3HI2A 4CXXA 4KUMB 3UUXB 2X9XA 3AG4E 2JABA 4GMRA 4JW1A 4JB8P 1AP7A 4N78D 4FHJA 2Y8DA 4TXPA 3GYZA 1OY3D 4HI9A 2AXDS 4F6RC 3ZKRA 2X51A 3ZMUB 1PY1A 3ONJA 4DR4T 2X6FA 3AA0B 3ISMC 3ABVA 3R7QA 3NZSA 1YYHA 4A63B 2A2FX 3OVUA 4V1Av 2LHNA 3ZCJA 2CXFA 3AE1A 5AQFB 2X67A 3FH7A 3GZ1A 3APCA 5FNVE 4I9EA 5ANLA 3Q5DA 5IWAT 4N3BA 3LY8A 3ASDA 5ENSD 2KNDA 1MX2A 5CCLA 4P0AA 2P9BA 4ANUA 2VKHA 4PS3A 4L0RA 4IL4A 3AU5A 1N9AA 3QC9A 3PUVF 1E8YA 5FTPA 5A6CA 5CBOA 4XIFA 4ATGA 2XQ5A 3SFEA 4B89A 4TXQA 2E9XA 2IF4A 1DCQA 2H7OA 2MOZA 1QZ2A 3UPVA 2KBXA 5HQ8A 4N3AA 3LJCA 4J0UA 4J6IA 2MYOA 5FZQA 1Y8MA 1IBLT 3OYZA 3L6AA 3P2BA 1MMGA 2CA5A 3KAEA 2I59A 3O1JA 4TV3A 4U0UA 4GMLA 3PRZA 4EBAA 3ULQA 4RQIA 4HQDA 4WWNA 4PJLA 3DSUA 4UI9J 4OX9T 3PUSA 3TWTA 2YK0A 4C48B 2LOSA 5EILA 2JRKA 2X6JA 2JQHA 5HEJA 2E9XB 4JPSA 2V7JA 5JRCA 2YHEA 1OUVA 3RQUA 3GW4A 3F6QA 2FO7A 3EHMA 5L4HA 2PNNA 3DRAA 3E30A 1HX8A 2W00A 4PH4B 5BT1A 4L23A 1IJ5A 4AOFA 5JDNA 3MA5A 4DV7T 1TNBA 5BMVE 4L7TA 5KJKA 1HG5A 4TNVA 2VGEA 3FU3A 5AQKB 3O4ZA 2UWJG 1YCSB 4M1PA 5CMYA 4IDQA 5J08A 2CWOA 1I94T 2XRYA 4CEMA 5HXCA 4TV9E 2IO3C 5ENQD 1D1AA 3PUAA 5KDMC 2XPYA 4G63A 4L9PA 1BU9A 4GTTA 2IEJA 5LX8A 4IYPA 3T1HT 5AQSB 1MHQA 3CSTA 3KBUA 2XQ3A 4DX1A 1SZAA 5LYJE 2HYZA 4G11A 3APDA 3C3RA 4J8DA 2RA1A 4IDZA 3SHFA 2XEVA 1DCEA 2LM9A 3SFYA 3MCXA 2DI4A 1H2TC 4NQ0A 2XAFB 3ASOE 5F3JA 5FWQA 3SO8A 2R02A 4YTNA 4PJNA 4PJJA 5LMUT 2LAHA 3MKRA 1MQSA 3WXXA 5GONE 2DYSE 1OEDE 3FUEA 5C8YE 2CWYA 2N9DA 3LY7A 4X8QA 2UXDT 3PEUB 2GRNB 2L9BA 3O48A 4EECA 1SE7A 3T8KA 2F0YA 2AWIA 4U7IA 1CUNA 4EIWA 3ZT7A 5B3SE 4HOSA 5AQQB 2D9DA 3C98B 4HWHA 3FTZA 3B95A 3N2GE 1A5EA 3QNKA 3C4ZA 3CR3A 3OXGA 1KLXA 4ZI2C 2DWKA 1E90A 1TN8A 3QOUA 3RO2A 4CZ2D 4TXRA 5FY1A 1XGWA 3RLFF 2LAIA 2LSIA 1HO8A 3B7RL 2X38A 3IKOB 5ENPD 1HE8A 4AKHA 3LVRE 5CCMA 2F8XK 4N5CA 3VTXA 2XZEA 4BY6A 3RPUA 2V7LA 2GRPB 3FUIA 1WFDA 3O4XE 4IN3B 2JMKA 2KZ7B 3R6NA 2RG8A 2QA7A 4KXKB 4DX7D 2CHWA 4MKTA 4HFEA 1UUSA 2CFUA 1W0BA 1Y64B 2EHOA 4JLEA 3FFLA 2DLRA 5LXTE 4H9OC 3UUBA 3ETUA 1E2AA 5C3JA 3ZNGA 3ZXSA 1LRZA 3PUXF 4CXYA 5LNKA 3FB2A 3P7IA 1DU2A 3ZN0B 2V6XA 4TRQA 3AEGA 2K5BB 4QFVA 2YKSA 3ZKJA 4BTBA 3FTVA 3UIOC 2ZM2A 3PTRB 3RIUC 4GZ5A 5LCYA 2CG3A 5JR9B 3RI5A 2XGSA 5KBAA 2PFVA 2DVWA 3NAWA 4DR3T 3KDSE 2D2SA 3FBZA 2VSYA 4JC8A 3EDUA 4AQFC 2LT3A 4DI4A 3PJAA 2V5CA 2OA5A 4X5TA 2UUBT 3Q5MA 4DV0T 5HXSA 4EEDA 2EHOB 3ABKE 4NUUA 1YKHB 3LY9A 1ZEEA 4ZZBA 4IE7A 2J9QA 1LF8A 3AE5A 3OJAA 4PK4A 4MBGA 4HGAA 5FXVA 5KCMA 5EIBE 2KWIB 2W2UA 2X9HA 1T8BA 3SRZA 4EEBA 2XQ4A 3UINC 2A5EA 3CKCA 3EU9A 3ZN3A 4XI9A 4DX2A 4U2ZA 4LMLA 2WBLA 4PFOA 3K3QC 1RZ4A 3IHVA 2XAHB 4U7EB 1MNDA 4QXCB 1N94A 4GIWA 4UVBB 3KD7A 2GK9A 3JAEA 3ASNE 3BUAA 1BR4A 1IZNB 4HWFA 4IT4A 1SVXA 5CRVA 4LNUD 3LBXB 3DSXA 4HORA 1N34T 4X65T 2W63A 3AE6A 1IAPA 4DV5T 2QC9A 4I50E 4FP7A 3SFZA 3A5XA 4WAFA 4YDWA 3CK9A 3X1DA 3OPCA 2BVMA 4U0ZA 4DBQA 4N2QA 3LG7A 3DBSA 1OEDC 3CQCB 1OCCE 2NC9A 5BV0A 3HXEA 3V5SA 2YINA 4QH4A 2FJAA 4UXNB 2ETBA 3APFA 3QUJA 3Q9DA 3MYVA 4PUCA 4K0UA 3UT4A 3QB5A 3MK7C 4LFCT 4UV8B 1N32T 3Q79A 3RYHE 5HRYA 3P4WA 2VVSA 3Q5EA 4FULA 2J4BA 3B7SA 4QKNA 2V7IA 1FPPA 3KS2A 2OLTA 4BA9A 4JI1T 2ZMAA 5FVLA 1KT1A 1TJFA 4PDXA 4HFHA 3F31A 5IY5E 1LD8A 2Z6EA 3OBVE 3OXFA 1LVKA 3G2WA 3KVBA 2L3LA 5AQIB 2J09A 2ZM6T 5A23A 3ZMVB 2BTDA 3FUFA 4GOUA 1S35A 5KJMA 4LSZE 2KCKA 5FY0A 5T8IA 4BEPA 5CEAA 5ABFB 4GAAA 5CECB 3ASHA 4EGWA 3UI2A 2YQ8A 2HPLA 1N52A 4UI9C 5ENRD 1KZPA 4A1SA 2X68A 1HXIA 2V8SE 5BW8C 2E2EA 4O2AE 5C1DA 3P8CD 2CXLA 2YHCA 4I1OB 3CLJA 1V54E 4JI7T 4EBAG 3TWSA 3QWPA 4JEHA 3AAEB 2IY0C 4GYRA 5BR8T 2KXPC 3K8PC 4U07A 1HS6A 4E7ZA 2L6BA 3P4PA 4O6FA 1N0RA 3AEEA 1CHUA 4UVAB 4JA9A 3TWRA 2WXFA 2WXHA 3L22A 1V9DA 2R17C 3CPZA 4CQIA 4CCAA 2HN1A 5ETWA 2UY1A 3HIZA 5HEUA 3V5UA 2E8IA 4DUIA 3V31A 3UTMA 2P9UG 2SPCA 3FWVA 1MZCA 4J7WA 2L9QA 1HF8A 1EYHA 2AW6A 3P50A 3VLDA 5FXXA 2IC6A 2A72A 2BS4A 2P9NG 2IIUA 3VLEA 3TJPA 4JEHB 4C90A 2BVLA 4MLPA 4DO0A 3ENEA 3ANWA 2B6CA 4PK5A 3NOGD 3JADA 1SZ9A 1FEWA 2V4LA 4I1MA 5JRCB 2WB5A 3UU5A 2ETCA 4IL9A 4A98A 4UI9K 5LBMA 3ZW3A 4O60A 3S4UA 1UX4A 3D9JA 4APOA 2FJBA 3AA6B 4AY6A 2LNIA 4N3CA 1G8XA 3N2OA 4GPMA 1O1RA 3ZLIA 4JHKA 2BKNA 3AE4A 3QWVA 4GA1A 1R8IA 4BT9A 5J2TE 3CVWA 2CMRA 4A3TA 1U3DA 1US7B 2L0IA 2DIWA 5JHBA 1T7SA 1U4QA 3ANWB 2Q9QC 4TN7B 2KT9A 2V7KA 3U66A 4OVVA 2LUHA 2R2LA 4EXTA 3MA9A 4ILGA 1H6KA 3DSWA 5LCWC 2HE0A 4GKKT 2ACZA 4JV5T 3UM1A 3UIPC 4RG6A 2L0TB 4RSYA 5LJMA 3KV4A 3UU4A 3TXNA 3ML8A 1IHGA 2E2AA 4WNEA 3AXJA 2VQ2A 3L9TA 5KNHD 4QHOA 3PZ3A 1NA0A 4LF4T 1NL4A 3QK6A 3E37A 1TJCA 5HXEA 3CK8A 4CDRA 3ZXPA 2KLQA 5JJTA 3ONLC 4Z8XA 2K48A 4QH5A 4KX6A 5EIDA 3ZYMA 1QLBA 5E75A 3H3MA 2KATA 4EZKA 3RH3A 1IKND 2LXMA 4AJWA 3FUMA 3CGHA 4TUMA 4IULA 2NTYA 3B57A 3ONKA 5J90A 2ZXWE 2J07A 1KNZA 4LF6T 4J8SA 2WCAA 2B1EA 4U2YA 4DR1T 3IXEA 1JCRA 1XZYA 5LJNA 2VJ8A 2YN6A 3M65A 4CGVA 3RC3A 4JD2G 1KZOA 5HWYA 3SZ7A 2CHNA 3D9NA 3L3PA 3ZJ1A 3EABA 4XE0A 3C4XA 4GTSA 4G2AA 1HTJF 4U3CA 2V5FA 2OEWA 3EDVA 4C0EA 3DEPA 3Q15A 5AARA 3CVUA 3S7BA 2KMFA 5CERB 4UWHA 2H3RA 4IDNA 4FHKA 2OVFA 3EHQA 4IDOA 3ZHEA 3N9PA 3T9KA 5ENNA 3A7MA 4JI2T 2XQ9A 3CVRA 2WDQA 2QZAA 3ZRHA 2J1DG 5JDHA 2X6HA 2LSGA 3ONXA 4I43B 2VKDA 4TZ4C 3D9MA 3M3ZB 2NTXA 3SOLA 1FT1A 5AQLB 2IC9A 4B0ZA 2KZTB 1K8KG 4LNBA 4LFBT 2JQ9A 4BESA 1W3BA 4AQFA 2LO6A 1WR6A 5DQWA 2EINE 5LP0A 1LD7A 4ERRA 5LBQB 4F7AA 3J7Yq 2M6IA 4F3VA 2WAUA 2LRKA 3RIUA 2X66A 3PZ2A 2WZIA 3AS8A 4DLOA 4JVSA 3T1YT 4UQYA 4LF9T 2XAQB 3PS6A 2WDVA 4NPPA 1ZOYA 3IF8B 4HFGA 5EKQD 5JR9C 3KINB 4DR7T 5ADXL 2YOEA 4I43A 2J4GA 2ETAA 3R84B 2QVAA 4JL0A 3MGBA 5C2YA 4ZXLA 4J8YA 4AKIA 3FHNA 2YEVC 3KSLA 2RP4A 1EZ3A 2I1KA 1H19A 2X6KA 1V55E 2DBAA 3SWHA 3PV0F 2H7VC 4UWFA 1BR1A 4UWLA 3LYAA 4B93B 3MZLB 2WQHA 3PUYF 2IHR1 5HEHA 1NENA 2V5QC 4K0RA 3CVPA 2YU2A 3ZEFA 2XQ7A 3NZPA 1YQ4A 5AAOA 4RLYA 1NAFA 4DV4T 1HX1B 2CHOA 2J62A 3Q4AB 4ME2A 1RW2A 4I0UA 1TNYA 4XZ4A 2KC7A 3PUZF 3PZDA 5CA0E 1SW6A 5LGTB 3DPDA 2AVPA 2HH7A 1JCQA 3CHRA 2EIME 3CVYA 1GQEA 3CIRA 2OV9A 3SD5A 4L5GA 1OEDA 5AQUB 2XAGB 4JYAT 4WNFA 4CI2B 3UKRG 2WU5A 2QRXA 4E6HA 4KZ0A 2XY8B 3Q78A 4P09A 3W9FA 4DX5D 2QGSA 2VVNA 5AQHB 2I2OA 2RFMA 4EQFA 3NWIA 2JLBA 3RAUA 1S94A 2WY2A 2PM6A 4Z90A 5HEGA 3EI0A 4ISSA 2VASA 1TN7A 5EYPF 3E08A 5JTGA 4O1OA 1MX4A 3OAWA 4WNGA 3EVYA 1NWMX 3GA8A 2UXBT 1JPLA 1OWNA 1Z6TA 4EAHA 1IBMT 4DI3A 1J1JA 4G8KA 4NUVA 3AG3E 1D0ZA 4KBMB 1OCRE 4G2VA 4GTOA 4YFSA 1MNEA 2J8SD 1B89A 5EZYE 4LF8T 1Z5SC 5ARFA 4B8AA 3MKDA 1O5MA 5ANRA 3C50A 4AM9A 1OXZA 3N9OA 3ZCIA 3EIJA 3SBTB 1O3XA 3IHYA 3HHMA 3FUHA 2VGXB 3QWWA 4UWGA 3TG4A 4R7LA 4Y6WA 4O4IE 3CQGB 4HRLA 3RRUA 3EHRA 4U95D 1N4QA 4ZFHA 3PEVB 3TKLB 2NW7A 2BUGA 1YKEB 3KVAA 3FUKA 4P1NA 5LHIB 1E96B 2ZU6B 4ZEYA 3DTOA 3NZQA 4GZ6A 1HNWT 3NBNB 3ZC0A 1NFIE 4ABNA 3KBTA 5LOZA 5HKPA 2WQ7A 4HE8A 3S7DA 4OVUA 5AIJA 3LK42 5LMNT 3OXLA 2MPKA 3D0TA 3FUNA 4FC8A 2X3MA 3BEEA 1QQEA 3SFXA 3DJBA 4LF5T 2H6HA 2IQCA 4LFAT 1KT0A 4HVBA 3AA1B 3Q5XA 2BG9B 2FBWA 2VKOA 4LEUA 4U7YA 3TAXA 4FJZA 2DL1A 3HG0D 1ZBPA 4I2ZA 2YDSA 4MALA 3SBSA 2AJAA 2FEZA 4H9PC 3I9YA 3W9GA 2K3WA 4GTMA 4V3IA 3E33A 4L1BA 1IBKT 4XKCA 3QB5K 3LSVA 4IE4A 2F8YA 3AG2E 3R9AB 3WAKA 4B3RT 5DIZA 4J2CA 1MYOA 4C0MA 5FYMA 4AV7A 2MBGA 4PAGA 3DSVA 3DSTA 4ZS2A 5L3BB 4HKAA 5FVKA 5F5WA 3BU8A 3AXJB 1VOMA 2L8KA 1LTXA 5FMNA 1PAQA 4F6RD 1K1BA 4ILAA 2UY1B 1E8ZA 3MKQB 4W9RA 1K3ZD 3ZT6A 5CA1E 3BG1B 2D0UA 4GMJA 3TWVA 1X81A 2CBIA 4I2WA 3HYMB 5BV1A 2WXRA 4K03A 2DWZA 4DJAA 4DR6T 3CX6B 4IE5A 3AEDA 5JDLA 2CRBA 4DV3T 5L3EB 3HVEB 3JQ0A 3VR9A 3W15B 5BUZA 2XCBA 4AY5A 4WWOA 1SUMB 4EHMA 1NEKA 2PQNA 2G0UA 2P58C 4H7XA 3RU0A 4QH1A 1O1TA 2MTQA 2XQ8A 2W62A 2H6GA 2R05A 5ABHA 2EIKE 2UXNB 3TLWA 4G24A 3QOFA 1HNZT 4IIJE 2CFZA 4ADZA 3AEBA 2PTFA 4ILUA 3UUMA 2M67A 3KSQA 3RO3A 3ZFWA 2JJ9A 4U72A 2NXPA 2C2LA 5EX0A 4IREA 2V6YB 5IYZE 2C0MA 3L17A 3AAAC 1KF6A 3VU7H 5DABA 4YVQC 4F53A 2VSOE 2DYRE 3G2SA 3Q2MA 4DVDA 2F4VT 5FZSA 3K3OA 1UCUA 4XZCA 2P9PG 3FTXA 2NP9A 5CRUA 4AQGA 4P29A 3UQ3A 5H6QB 3L13A 2Q9QD 1N33T 2JQKA 4H63V 2RKKA 3KEZA 5T3RA 3NOCD 4GPKA 1DVPA 2MRIA 2JQQA 5KMGP 1ELKA 4HFIA 1HU3A 5FINA 4UV9B 1UN9A 2K24A 4KVMA 2DNXA 2IW5B 3H37A 2HPJA 1T98A 3FTUA 3UT7A 2VQFT 4DR2T 4JI4T 4AXPA 2LSVA 4PS8A 1HFAA 4N2SA 5HEOA 4JI0T 5E0OA 1YMPA 1UURA 2XGOA 3SI5A 5LCWJ 3MV3B 2FJEA 3AE8A 4BSXA 4ANWA 3I4RB 1U3CA 1H6OA 3CVLA 2DCPA 2CG2A 1Z3YA 2PL2A 1P5QA 4DV6T 2XEEA 3DP7A 3V2XA 3SGHA 1IYGA 4UWKA 1FMWA 3U3IA 3Q7FA 3CKDA 5AN8A 3UX4A 3KV6A 5L2LA 1SA5A 3JCKC 4PS7A 4NACA 1FVHA 2WXJA 4KT6B 3Q9NC 3L8RA 4IHJE 3L08A 2H6IA 4CI3B 4WZXA 2WXPA 3CK7A 3PVLA 4ZZCA 2WPVA 5CB4E 3NB2A 2BF0X 3FEYA 2LKHA 3IEGA 3ZGQA 4BX8A 1BI8B 3GMIA 2VB6A 4G26A 2WP9A 4E7SA 3O1HA 1YA0A 3RRNB 2HR2A 1N54A 2IONA 2WXQA 4ANXA 1MJ0A 3VLFA 3JCFA 1M7KA 4GK0E 1ELRA 3EHZA 5JDFA 5KX5E 2KZTA 3D9PA 3P4QA 4EOZB 4OAUC 4TX5A 4G1TA 1XWMA 5AQAA 2EHOC 4YTMA 4DLQA 4UR9A 5HXHA 3EUVA 5CJ5A 4KMOA 4LG6A 3B7UX 3IBEA 3EU5A 4YDEA 5BXUA 3UU6A 4C91A 3I1AA 4AKRB 2VSXE 2Q9QA 3RQWA 2IJGX 4APFA 1O1SA 2YDRA 4NIKA 3B7BA 4FU3A 5JA4D 4FI5A 4HFDA 1SA4A 2IOSA 1QUUA 2I1JA 4O1PA 1UK5A 2JPFA 1VDYA 5L3GB 3ABME 1ZV4X 4I4TE 2ZGDA 4A5XA 3RRMB 2KCLA 5KNGA 4HFVA 3WG7E 4JI6T 2FF4A 2C5IT 3PURA 3HKCE 2YDQA 4UELA 2DHRA 1OT8A 5HCMA 2HM8A 5JHAA 1E7VA 2WVIA 4DBRA 1N95A 4YNDA 2IDOB 2VSNA 4DMWA 5A1LA 4GZCA 3VR8A 2XCCA 2WDRA 3CX8B 4HB5A 4HWCA 4L9IA 1HG2A 3VRAA 3AG1E 4AKGA 3S7JA 3UUXA 3ZMZB 1EPUA 4HS2A 1WRDA 3ABLE 3X2QE 1LKXA 3PH0C 1KNRA 3R9MA 4HRMB 4YHJA 4DV1T 2UUCT 4AVXA 2W0GA 4QXBB 3AEAA 1N0QA 3TWQA 2VKJA 3D9IA 5JMND 2OV8A 3FTYA 5JR9A 4UF0B 4EB6E 3EHNA 1MMNA 2OEVA 3OYXA 1OWPA 3JXIA 4UVCB 2J49A 4LMJA 1MX6A 1TN6A 4WNDA 3GWHA 5CBNA 1IHBA 3TG5A 4HLEA 4KMCA 4GTVA 5E76A 3FZKB 3UM3A 2J4DA 2LSUA 5D0QD 1IJ6A 3JC6C 2M63A 3HRAA 2XQ6A 2KINB 2EILE 5J1GA 1YQ3A 5HXRA 3T5VA 3ZVVA 1W9RA 2AXZA 4DR5T 2KM4A 3I5PA 4DPRA 3SQVA 1JNRA 2DCFA 2VURA 2VYIA 3LPZA 3LJ3A 4GCNA 3PUQA 3CHOA 4LUNU 3FXEB 3TWXA 4QX8B 4JZYA 1JCSA 4RVBA 3LJNA 5HYAA 3I3NA 2WXNA 3C3QA 4ZHQE 3ML9A 4K5CA 1QNFA 5AQVB 2MOWA 3A8YC 2M6BA 1TEZA 5LG4A 5KJLA 2AE9A 3HXCA 3Q9UC 4BX9A 3B13A 2VGXA 2X0HA 3S7FA 4N5QA 2WM9A 5L3DB 3SF4A 4MFRA 3PE4A 5HWXA 1SQMA 3CVQA 1UN8A 3D3MA 4N39A 2WMOA 4I6EA 2DZOA 5B1BE 4H9NC 3NBXX 4I6GA 4AISA 3NRYA 1KPSB 1HR0T 1IQUA 1GW6A 2H6FA 4ZOLE 1UW4B 2VTBA 1BR0A 3N9QA 1XDPA 4DV2T 1FIOA 5EK2A 3ASFA 5D0OD 2XPIA 3UKUG 3U64A 2FI7A 3DWLG 5LHHB 2CE7A 2WS3A 3RF1A 1E7PA 1Z0PA 3JYSA 3C5RA 5M72A 5BNWA 5AQPB 3PE0A 5DBKA 4GA2A 2X9WA 2B76A 4GK5E 2XGMA 3P1UA 3FTWA 5HCJA 2P9SG 3AE9A 3KV9A 3L16A 3Q73A 4DUYT 1L5JA 3JUIA 1KNPA 2WMNA 4Q94A 2IO2C 1VRBA 4ILCA 1XMQT 4H9RC 3G06A 1HH8A 2C0LA 1U5PA 3CEQA 4CZZB 3CHSA 4EZHA 3BQIA 2UUAT 3HR0A 4UEMA 3AE7A 2W67A 2V5DA 5AQTB 2BS2A 5KJNA 5JDGA 2IAKA 3RHWA 3LCAA 4U8YD 4G25A 1Q2ZA 5FZRA 3J5QB 2V6YA 2BKPA 4ASKA 2B0OE 3ZN1B 3RRWA 4KHZF 3RIAA 2H88A 4B3MT 3MKQA 2XM2A 3KV5A 1WAO1 3AS4A 2PG8A 2V0PA 3Q47B 5HI7A 3TLSA 3T8MA 2GROB 4JI3T 3UU8A 4ATZD 1BLXB 2XTLA 2XSBA 2X0LB 3UM0A 2FULA 1MIVA 4YHHT 3AVSA 2R03A 4IGUA 3CKBA 4YXDA 2CCQA 1MIYA 2XS8A 4KYOB 4FJOA 3C98A 3HVEA 4KHPT 3RIFA 5L3CB 3UMVA 3IBPA 2BKKB 4DNDA 5ABEA 4HFCA 4B94A 3UFGA 2NSZA 2XPKA 3AEFA 3MX3A 4ILIA 3FY4A 5J2UE 3DSSA 4LRZA 5G05J 4AI6A 4O4JE 2KWHA 3EAMA 3TLVA 2Y4TA 1X79A 2V8SV 2Y48B 2Y4UA 5G2NA 5EDSA 3IA3A 4K5BA 2GGFA 3ZYQA 4OK0A 3HXFA 1XNFA 1K1AA 3L54A 3RKVA 4PW8A 1UOHA 4WBOA 4K5AB 5G05C 3SY2A 3KEAA 5JQGE 4X20E 3UU3A 2EHOD 1I6ZA 4DIDB 2W66A 2V4HC 5H7PA 4B3ST 2NOXA 3DEOA 5LA6E 2BKGA 3B5MA 5F8PA 4NRHB 4WUYA 2WXMA 3RRCA 3AAAB 3RJVA 2XQAA 2CLYB 3ZMSB 3FZMB 5AQJB 3NVOA 4YSZA 2ZISA 3TL5A 4ACLA 3CX7B 1W09A 4F1PA 1MMAA 1OWLA 3I0OA 4GTQA 3G2UA 5JDMA 5JDQA 4U0SA 1YD8G 4I17A 1LVFA 4O8SA 3ULEG 3U3WA 3D9LA 2XS1A 4AEZC 2VL0A 1X5BA 3V79K 1KEYA 3MV2B 2NWBA 4X1KE 1PC2A 2W61A 4X66T 2WSSV 4B3TT 5D2MC 4J8FA 1E8XA 3G2TA 3IEEA 2OOEA 2I6HA 2I9CA 4YY3T 4I1AA 2LJLA 3FU6A 3CVNA 3JXJA 3C64A 2NYJA 5JVDE 5LFAA 1SA0E 3UQ4A 2VQET 3D9KA 2FUPA 1E8WA 1FJGT 4RG9A 2C0SA 3S2AA 1FMVA 2KCVA 4M7CA 3VKGA 1AWCB 4WWPA 4GU5A 4FADA 3UTKA 4BJNA 2ZM0A 3O1IA 4CI1B 2LE8A 4ILBA 4GB9A 4IDPA 2PM7A 3I0QA 3HKBE 4BERA 5L47A 2A4ZA 3B7TA 3FU5A 5FXWA 1ZP0A 3AE3A 4PK6A 4EYYR 2HN2A 2X9YA 4H9SE 3O9XA 3D9HA 3CV0A 2V1DB 5J0ZA 3FEXA 1D8EA 3ZU7B 4DX6D 4AP2A 3RKOA 3ZIMA 4AIFA 3ZSTA 3U4TA 2IU1A 1EF1C 2BBHA 2BKOA 3NZUA 3PJAJ 2FBNA 5G04J 2KXPB 3FULA 3GN5A 5ARGA 1N4RA 4O4HE 2CEAA 5AENA 2PJQA 3FZFB 3FUDA 2I0MA 1QYMA 4QX7B 4IE6A 3ASGA 2XRZA 3LDQB 1TNZA 5D66A 5KXJA 4YJ3E 3CWZB 2IOLA 5IHYA 2VK9A 3C51A 1D1BA 2L6JA 4LNGA 4ILHB 4CXWA 4CRWA 5LG3A 3AJIA 2KSRA 4AIUA 3J5PA 3HXBA 4WBNE 5FL1A 3FXDB 1HCIA 2N2NA 4H9QC 2XUEA 4JEUA 2QYWA 2P9KG 2Y3AA 1JWFA 5IUXA 2Q9QB 3RK6A 2LSYA 3K1SA 1D1CA 2E9XD 5EX3A 5FQ6A 3QC1A 2E0IA 2MHKA 4OAVB 5AQGB 1TYQG 1JUQA 4ZHBA 4Z91A 2ES0A 2BZBA 3VRBA 1N4PA 4O4LE 2LEHA 4HLLA 1KFYA 3PUGA 4Y6CA 3ZHEB 4HOTA 3V30A 4E85A 5FY7A 4X1YE 3H3AA 3CVXA 4CT0A 4FLBA 1UG3A 2E9XC 4EYUA 1T72A 3L09A 4U8VD 3E32A 1BPOA 3F57A 4CN1A 2CXDA 5DQVA 4BWRA 4HXIA 4CN4A 4I55E 2UXXB 4P0BA 2LXLA 5L3FB 2D5UA 4O2BE 1OCOE 3CHQA 4HEAA 2NR4A 2LKGA 1UJKA 2ZIRA 1TR4A 4OHFA 3TXMA 3FU0A 3TWWA 4ANVA 1H0AA 5EK4A 3V2OA 3N2KE 3ULYA 1IXVA 3PZ4A 4GYYA 4TWHA 5FQ8A 1S70B 4G23A 3UM2A 2RPAA 1A17A 4YDOA 3ZMTB 3T5XA 1M62A 4MS6A 4QQIA 3BQKA 1Z8UA 1S63A 4JHRA 3FH5A 2YNQA 1G73A 3MJXA 3J9X1 3ZJ2A 2OCCE 4XEIG 3L82A 3UUNA 1WDYA 2GW1A 2FO1E 1Y01A 1XDOA 1NP7A 5AQOB 3PUKA 3NRXA 2IFUA 3CK6A 4MBQA 4U74A 3SS1A 1JNZA 3RIBA 3FZHB 4ACKA 5AYWD 4UF0A 2X6IA 2RD0A 3I4GA 5DJQC 4XAXB 5ABFA 3AB3B 1UGOA 2LOPA 3UULA 4CDMA 3CSFA 5ENTD 3PDNA 3PZ1A 2Y69E 2R6GF 3K9IA 5JJ6A 5FP3A 2A9UA 3QNUA 4GYWA 1XNRT 5M4YA 1X9BA 3AAIA 3N71A 1BI7B 3QB2A 2WQYA 3P4SA 4PNIA 1J5WA 1DC2A 4AXHA 5EYLA 1ZHCA 2ACXA 4CGWA 1WCRA 1ZB1A 2JEKA 4G8LA 2XHEB 1KK7A 4U8HA 4ZI2D 1MMDA 3PUJA 2MYSA 4HRNA 1DNPA 2P9IG 5CFBA 2BDEA 1UJJA 2BG9E 4B6XA 3BK9A 2HHHT 3RSEG 1SHZC 2BG9C 1H2VC 1INZA 3UQ7A 2ODUA 1VCSA 4GYSA 3VKHA 2Y0BG 4YVOA 3C72A 5JJ7A 5AQ7A 3FBLA 2VTBB 5HAXA 4LCTA 3OKQA 3BG0B 3IV0A 5AJDA 3C4WA 2VL8A 4M3OA 4U33A 4UIGA 2P2CP 4U96D 3ZC1A 3BQLA 4BFRA 4YTPA 2WXKA
chains in the Genus database with same CATH topology
3UT5E 1WYBA 3RC8A 3ESKA 2V7MA 4QWNB 3AS5A 3QK0A 2XQ0A 2WQ6A 4LERA 5G55A 3JQ1A 1FVFA 4HTEA 5FT9A 4EZLA 1Y6IA 3CQXC 5CHEE 3FUJA 3LS8A 1ELWA 1WY6A 4CDNA 4EZ4A 2WB2A 1OWAA 3EJNA 3CHPA 4HOUA 4IRUA 1OWMA 1B7TA 3LFMA 3GZ2A 4D10C 3RYFE 4JUYA 3LK2B 3ESLA 2XAJB 4IE0A 4A1GA 1EDUA 4URKA 4XX5A 4UQXA 3LXUX 2ODVA 3F2EA 3LDZA 3HDXA 4YJ2E 4XI0A 4ISTA 5FJYA 5G04C 5TAOA 1WLXA 4UQZA 1ZKEA 3AA7B 4GYOA 3N9NA 4PFPA 2K9AA 4H63H 1WYCA 3G2VA 5EK3A 4A3VA 3QAQA 3IHRA 3VTYA 3HKEE 3EIQC 4X1IE 3ETVA 4ZI3C 1FCHA 4BJMA 2JMHA 3R7RA 3T8OA 5AJLA 1HZ4A 2OVBA 3WAJA 5CMWA 3KFWX 2EQXA 1UX5A 3Q49B 3MJWA 3URZA 2XQYA 2CLYC 2XPZA 3EDTB 4XKBA 3CHMA 3TGOA 3I9WA 2A5UA 1MIWA 3UFEA 4FJYA 4ZI3D 1Z3XA 3ZYLA 1ZU2A 3FH8A 3UT8A 2YU1A 3MEKA 1JWGA 2WXOA 3N9LA 4EPZA 3SNXA 3MACA 3HA4A 2V26A 3E0ZA 3PREA 4KBQA 1NA3A 4U04A 3ZYKA 5JREA 4MRUA 4GA0A 4JEUB 1IQRA 4OYKA 5FXZA 2CHXA 3GZSA 3PE3A 2R59A 2LHRA 2AXUA 3NQPA 3CMLA 5LP6E 4YLHA 4TUUA 2J08A 1D0XA 4EZJA 4MHCA 2WXIA 5FQ7A 1NZNA 2LSKA 3MZKB 3U78A 2AXVA 2ZLYA 4DK5A 3EUHA 3LVQE 3LKUA 2ONDA 4Q69A 3ONLA 5BPPA 4H7YA 4JA7A 1OWOA 2PQRA 4BTAA 5T4YA 4A55A 3FDHA 4JHJA 2ZM8A 2NW8A 5LGUB 3VHLA 4GCOA 5AFUL 3RYCE 4Q96A 3NF1A 3GN5B 4J8EA 4L2YA 2Q7FA 3ZEFB 1H7CA 2C5KT 3WI3A 2ILRA 3QKYA 4BT8A 3ZPOA 3Q5WA 2GRLA 3N9MA 4MLKA 5H6RB 3HL6A 4L2LA 4TUYE 4BAYB 5JH7E 4U63A 3LK3B 2CM0A 2WWUA 2QFCA 2N1GA 3E22E 2CHZA 4CT4A 4KZCA 4FA6A 3MXZA 2WXLA 2HO1A 2WXGA 1AJ3A 4XBFB 4QXHB 2QY7A 2GRMA 3E4BA 3ZPJA 3RX6A 4NURA 2VWAA 3PNTB 3K3NA 4PJMA 5LGNB 4WNKA 2VGYA 3AU4A 3CIAA 2LSJA 4OFZA 3LEWA 4F1SA 2R5SA 4I6JA 1S0PA 2C5JA 3QARA 4AKLA 1QSDA 3PDYA 3PU8A 1YW0A 3FTSA 4GZDA 3JC6D 4KVOA 3QJZA 5LOVE 4ZS3A 3LBXA 4KP3C 1H2UA 3D9OA 3OTNA 4I9CA 2NW9A 4TV8E 3CVVA 1HS7A 5A7DB 4B8CB 3RYIE 1E1HB 4HN9A 1BR2A 5FQ4A 2D0TA 2XHEA 4DMVA 4OYSA 1WM5A 3QDNA 2A3DA 5LHGB 3U9WA 2DWGA 4GZ3A 1D0YA 4A56A 2PBIA 4OYJA 3PNLB 2XASB 4C9BB 3N5LA 3HKDE 1E7UA 2PZIA 3FP3A 4HOQA 4WW0A 3AVRA 2Y6XA 4FLHA 4JXTA 4ZI7E 4ANJA 3FHEA 3PU3A 3HI2A 4CXXA 4KUMB 3UUXB 2X9XA 4JW1A 4N78D 4FHJA 2Y8DA 3GYZA 4F6RC 2X51A 3ZMUB 1PY1A 2X6FA 3AA0B 3R7QA 3NZSA 2A2FX 4V1Av 2LHNA 3ZCJA 2CXFA 2X67A 3FH7A 3GZ1A 3APCA 5FNVE 4I9EA 5ANLA 4N3BA 3LY8A 3ASDA 2KNDA 5CCLA 4P0AA 2P9BA 4ANUA 2VKHA 4PS3A 4L0RA 3AU5A 3QC9A 5FTPA 1E8YA 5A6CA 4XIFA 4ATGA 4B89A 2E9XA 2IF4A 2H7OA 2MOZA 1QZ2A 3UPVA 5HQ8A 4N3AA 3LJCA 4J0UA 4J6IA 5FZQA 1Y8MA 3OYZA 3L6AA 3P2BA 1MMGA 2CA5A 3KAEA 2I59A 3O1JA 4TV3A 4U0UA 4GMLA 3PRZA 4EBAA 3ULQA 4WWNA 4PJLA 4UI9J 3PUSA 2YK0A 2LOSA 2JRKA 2X6JA 2E9XB 4JPSA 2V7JA 5JRCA 2YHEA 1OUVA 3GW4A 2FO7A 3EHMA 1HX8A 2W00A 4PH4B 5BT1A 4L23A 1IJ5A 4AOFA 5JDNA 3MA5A 5KJKA 5BMVE 4L7TA 1HG5A 3FU3A 3O4ZA 2UWJG 4M1PA 5CMYA 5J08A 2CWOA 2XRYA 4CEMA 5HXCA 4TV9E 1D1AA 3PUAA 5KDMC 2XPYA 4G63A 5LX8A 4IYPA 1MHQA 3CSTA 3KBUA 1SZAA 2HYZA 5LYJE 4G11A 3APDA 4J8DA 2RA1A 4IDZA 3SHFA 2XEVA 2LM9A 3MCXA 2DI4A 1H2TC 4NQ0A 2XAFB 5F3JA 5FWQA 4PJNA 4PJJA 2LAHA 3MKRA 1MQSA 3WXXA 5GONE 3FUEA 5C8YE 2CWYA 2N9DA 3LY7A 3PEUB 2L9BA 3O48A 4EECA 2AWIA 1CUNA 4EIWA 4HOSA 3C98B 3FTZA 3N2GE 3QNKA 3C4ZA 3CR3A 3OXGA 1KLXA 4ZI2C 2DWKA 1E90A 3QOUA 3RO2A 5FY1A 1XGWA 2LAIA 2LSIA 1HO8A 3B7RL 2X38A 3IKOB 1HE8A 4AKHA 3LVRE 5CCMA 4N5CA 3VTXA 4BY6A 3RPUA 2V7LA 3FUIA 3O4XE 4IN3B 2JMKA 2KZ7B 3R6NA 2RG8A 2QA7A 4KXKB 2CHWA 4MKTA 2CFUA 1Y64B 2EHOA 4JLEA 3FFLA 2DLRA 5LXTE 4H9OC 3ZXSA 3ETUA 1LRZA 4CXYA 5LNKA 3FB2A 3P7IA 3ZN0B 4TRQA 2K5BB 4QFVA 4BTBA 3FTVA 2ZM2A 3PTRB 4GZ5A 5LCYA 2CG3A 5JR9B 2XGSA 2PFVA 3KDSE 2D2SA 3FBZA 2VSYA 4JC8A 3EDUA 4AQFC 2LT3A 4DI4A 2OA5A 3Q5MA 5HXSA 2EHOB 4NUUA 1YKHB 3LY9A 1ZEEA 4IE7A 2J9QA 1LF8A 3OJAA 4PK4A 4HGAA 5FXVA 5KCMA 2KWIB 2X9HA 3SRZA 3CKCA 3ZN3A 4XI9A 2WBLA 4PFOA 3K3QC 3IHVA 2XAHB 1MNDA 4QXCB 4GIWA 4UVBB 3KD7A 2GK9A 1BR4A 1IZNB 3LBXB 4HORA 2W63A 1IAPA 4I50E 4FP7A 3SFZA 3A5XA 4WAFA 3CK9A 2BVMA 4U0ZA 4DBQA 4N2QA 3LG7A 3DBSA 3CQCB 2NC9A 5BV0A 3V5SA 2YINA 4UXNB 3APFA 3QUJA 3Q9DA 3MYVA 4PUCA 4K0UA 3UT4A 3MK7C 4UV8B 3RYHE 4FULA 2J4BA 3B7SA 4QKNA 2V7IA 3KS2A 4BA9A 2ZMAA 1KT1A 1TJFA 4PDXA 3F31A 2Z6EA 3OBVE 3OXFA 1LVKA 3G2WA 3KVBA 2L3LA 2J09A 5A23A 3ZMVB 2BTDA 3FUFA 4GOUA 1S35A 5KJMA 2KCKA 5FY0A 5T8IA 4GAAA 3ASHA 2YQ8A 2HPLA 1N52A 4UI9C 4A1SA 2X68A 1HXIA 2V8SE 5BW8C 2E2EA 4O2AE 5C1DA 3P8CD 2CXLA 2YHCA 4I1OB 3CLJA 4EBAG 3QWPA 4JEHA 3AAEB 4GYRA 3K8PC 4U07A 1HS6A 4E7ZA 4O6FA 4UVAB 4JA9A 2WXFA 2WXHA 3L22A 2R17C 1V9DA 3CPZA 4CQIA 4CCAA 5ETWA 2UY1A 3HIZA 3V5UA 2E8IA 2SPCA 3FWVA 2L9QA 1HF8A 1EYHA 2AW6A 3VLDA 5FXXA 2IC6A 2A72A 3VLEA 3TJPA 4JEHB 4C90A 2BVLA 4MLPA 4DO0A 3ENEA 3ANWA 4PK5A 1SZ9A 1FEWA 2V4LA 4I1MA 5JRCB 4UI9K 5LBMA 3ZW3A 3S4UA 1UX4A 3D9JA 4APOA 4AY6A 3AA6B 2LNIA 4N3CA 1G8XA 3N2OA 3ZLIA 4JHKA 3QWVA 4GA1A 4BT9A 5J2TE 3CVWA 2CMRA 4A3TA 1U3DA 1US7B 2L0IA 2DIWA 5JHBA 1U4QA 3ANWB 2Q9QC 4TN7B 2KT9A 2V7KA 3U66A 4OVVA 4EXTA 3MA9A 4ILGA 1H6KA 5LCWC 4RG6A 2L0TB 4RSYA 5LJMA 3KV4A 3TXNA 3ML8A 1IHGA 4WNEA 2VQ2A 4QHOA 1NA0A 3QK6A 1TJCA 5HXEA 3CK8A 4CDRA 2KLQA 5JJTA 4Z8XA 2K48A 3ZYMA 5E75A 2KATA 4EZKA 3RH3A 4AJWA 3FUMA 3CGHA 4IULA 2NTYA 3B57A 3ONKA 5J90A 2J07A 1KNZA 4J8SA 2B1EA 5LJNA 2VJ8A 3M65A 4CGVA 3RC3A 5HWYA 3SZ7A 3D9NA 3L3PA 3ZJ1A 4XE0A 3C4XA 4G2AA 1HTJF 2V5FA 3EDVA 4C0EA 3Q15A 3CVUA 3S7BA 2KMFA 4UWHA 2H3RA 4FHKA 2OVFA 3ZHEA 3N9PA 5ENNA 3CVRA 3ZRHA 2J1DG 5JDHA 2X6HA 2LSGA 3ONXA 4I43B 2VKDA 4TZ4C 3D9MA 2NTXA 3SOLA 2IC9A 4B0ZA 2KZTB 1W3BA 4AQFA 2LO6A 1WR6A 5DQWA 5LP0A 4ERRA 5LBQB 4F7AA 3J7Yq 4F3VA 2WAUA 2X66A 4DLOA 3AS8A 4JVSA 4UQYA 2XAQB 3PS6A 3IF8B 4HFGA 5EKQD 5JR9C 3KINB 5ADXL 4I43A 3R84B 4JL0A 3MGBA 5C2YA 4AKIA 3FHNA 2YEVC 2RP4A 1EZ3A 2I1KA 1H19A 2X6KA 2DBAA 3SWHA 2H7VC 4UWFA 1BR1A 4UWLA 3LYAA 3MZLB 2WQHA 4K0RA 3CVPA 2YU2A 3ZEFA 3NZPA 1NAFA 3Q4AB 4ME2A 4XZ4A 2KC7A 3PZDA 5CA0E 5LGTB 3DPDA 2AVPA 2HH7A 3CHRA 3CVYA 3SD5A 4L5GA 2XAGB 4WNFA 4CI2B 4E6HA 4KZ0A 4P09A 2QGSA 2I2OA 4EQFA 2JLBA 1S94A 2PM6A 4ISSA 2VASA 3E08A 3OAWA 4WNGA 3EVYA 1NWMX 3GA8A 1JPLA 1OWNA 1Z6TA 4EAHA 4DI3A 4NUVA 1D0ZA 4KBMB 4G2VA 4YFSA 1MNEA 1B89A 5EZYE 5ARFA 4B8AA 3MKDA 5ANRA 3C50A 4AM9A 1OXZA 3N9OA 3ZCIA 3EIJA 3SBTB 1O3XA 3IHYA 3HHMA 3FUHA 2VGXB 3QWWA 4UWGA 3TG4A 4R7LA 4Y6WA 4O4IE 3CQGB 3RRUA 3PEVB 3TKLB 2NW7A 2BUGA 1YKEB 3KVAA 3FUKA 5LHIB 1E96B 2ZU6B 3DTOA 3NZQA 4GZ6A 3ZC0A 4ABNA 3KBTA 5LOZA 2WQ7A 4HE8A 3S7DA 4OVUA 5AIJA 3LK42 3OXLA 3D0TA 3FUNA 4FC8A 2X3MA 3BEEA 1QQEA 3DJBA 2IQCA 1KT0A 4HVBA 3AA1B 3Q5XA 2VKOA 4LEUA 3TAXA 4FJZA 1ZBPA 4I2ZA 4MALA 3SBSA 2FEZA 4H9PC 3I9YA 4V3IA 4L1BA 4XKCA 4IE4A 3R9AB 3WAKA 5DIZA 4J2CA 4C0MA 5FYMA 4AV7A 2MBGA 4PAGA 4ZS2A 5L3BB 4HKAA 1VOMA 2L8KA 5FMNA 1PAQA 2UY1B 1E8ZA 3MKQB 4W9RA 5CA1E 3BG1B 2D0UA 4GMJA 4I2WA 3HYMB 5BV1A 2WXRA 4K03A 4DJAA 3CX6B 4IE5A 5JDLA 5L3EB 3HVEB 3JQ0A 3W15B 5BUZA 2XCBA 4AY5A 4WWOA 2PQNA 2G0UA 2P58C 4H7XA 3RU0A 2MTQA 2W62A 2UXNB 4G24A 4IIJE 2CFZA 4ADZA 4ILUA 3UUMA 2M67A 3RO3A 3ZFWA 2JJ9A 4U72A 2NXPA 2C2LA 5EX0A 2C0MA 5IYZE 3L17A 3VU7H 5DABA 4YVQC 4F53A 2VSOE 3G2SA 3Q2MA 4DVDA 5FZSA 3K3OA 1UCUA 4XZCA 3FTXA 2NP9A 4AQGA 4P29A 3UQ3A 5H6QB 3L13A 2Q9QD 3KEZA 4H63V 5T3RA 4GPKA 1DVPA 2MRIA 2JQQA 5KMGP 1ELKA 1HU3A 4UV9B 1UN9A 2K24A 4KVMA 2DNXA 2IW5B 3H37A 2HPJA 1T98A 3FTUA 3UT7A 4AXPA 2LSVA 4PS8A 1HFAA 4N2SA 5E0OA 2XGOA 3SI5A 5LCWJ 3MV3B 4BSXA 4ANWA 3I4RB 1U3CA 3CVLA 2DCPA 2CG2A 1Z3YA 2PL2A 1P5QA 3DP7A 3SGHA 1IYGA 4UWKA 1FMWA 3U3IA 3UX4A 3CKDA 3KV6A 5L2LA 3JCKC 4PS7A 4NACA 1FVHA 2WXJA 4KT6B 4IHJE 3L08A 4CI3B 2WXPA 3CK7A 3PVLA 2WPVA 5CB4E 2BF0X 3FEYA 3IEGA 3ZGQA 4BX8A 3GMIA 2VB6A 4G26A 4E7SA 3O1HA 1YA0A 3RRNB 2HR2A 1N54A 2IONA 2WXQA 4ANXA 3VLFA 4GK0E 1ELRA 2KZTA 5JDFA 5KX5E 3D9PA 4EOZB 4TX5A 4G1TA 2EHOC 4DLQA 5HXHA 4KMOA 3B7UX 3IBEA 4C91A 3I1AA 4AKRB 2VSXE 2Q9QA 2IJGX 4APFA 4FU3A 4FI5A 2IOSA 1QUUA 2I1JA 2JPFA 1VDYA 5L3GB 1ZV4X 4I4TE 3RRMB 2KCLA 4HFVA 2FF4A 2C5IT 3PURA 3HKCE 4UELA 2DHRA 2HM8A 5JHAA 1E7VA 2WVIA 4DBRA 4YNDA 2VSNA 4DMWA 5A1LA 4GZCA 2XCCA 3CX8B 4L9IA 1HG2A 3S7JA 4AKGA 3UUXA 3ZMZB 1EPUA 4HS2A 1WRDA 1LKXA 3PH0C 4YHJA 4AVXA 2W0GA 4QXBB 2VKJA 3D9IA 2OV8A 3FTYA 5JR9A 4UF0B 4EB6E 3EHNA 1MMNA 3OYXA 1OWPA 4UVCB 2J49A 4WNDA 3GWHA 3TG5A 4HLEA 4KMCA 5E76A 2J4DA 2LSUA 5D0QD 1IJ6A 3JC6C 2M63A 2KINB 5J1GA 5HXRA 3T5VA 3ZVVA 2AXZA 2KM4A 3I5PA 4DPRA 2DCFA 2VYIA 3LPZA 3LJ3A 4GCNA 3PUQA 3CHOA 4LUNU 3FXEB 4QX8B 4JZYA 4RVBA 5HYAA 3I3NA 2WXNA 4ZHQE 3ML9A 1QNFA 2MOWA 1TEZA 5LG4A 5KJLA 4BX9A 3B13A 2VGXA 3S7FA 2WM9A 5L3DB 3SF4A 4MFRA 3PE4A 5HWXA 1SQMA 3CVQA 1UN8A 3D3MA 4N39A 2WMOA 4I6EA 4H9NC 3NBXX 4I6GA 3NRYA 1IQUA 1GW6A 4ZOLE 1UW4B 2VTBA 1BR0A 3N9QA 1FIOA 5EK2A 3ASFA 5D0OD 2XPIA 3U64A 2FI7A 5LHHB 2CE7A 1Z0PA 3JYSA 5M72A 5BNWA 3PE0A 5DBKA 4GA2A 2X9WA 4GK5E 2XGMA 3P1UA 3FTWA 3KV9A 3L16A 1L5JA 3JUIA 2WMNA 4Q94A 1VRBA 4H9RC 1HH8A 2C0LA 1U5PA 3CEQA 4CZZB 3CHSA 4EZHA 3BQIA 3HR0A 4UEMA 5KJNA 5JDGA 2IAKA 3LCAA 4G25A 5FZRA 4ASKA 3ZN1B 3RRWA 3MKQA 3KV5A 1WAO1 3AS4A 2PG8A 2V0PA 3Q47B 5HI7A 3T8MA 2XTLA 2X0LB 2FULA 1MIVA 3AVSA 4IGUA 3CKBA 2CCQA 1MIYA 4KYOB 4FJOA 3C98A 3HVEA 3UMVA 5L3CB 3IBPA 4DNDA 4B94A 2NSZA 3MX3A 4ILIA 3FY4A 5J2UE 4LRZA 5G05J 4AI6A 4O4JE 2KWHA 2Y4TA 1X79A 5G2NA 2Y48B 2Y4UA 5EDSA 2GGFA 3ZYQA 4OK0A 1XNFA 3L54A 3RKVA 4PW8A 4WBOA 5G05C 5JQGE 4X20E 2EHOD 2NOXA 5LA6E 5F8PA 4NRHB 4WUYA 2WXMA 3RRCA 3AAAB 3RJVA 2CLYB 3ZMSB 4ACLA 3TL5A 3CX7B 1MMAA 1OWLA 3I0OA 3G2UA 5JDMA 5JDQA 4U0SA 1YD8G 4I17A 1LVFA 4O8SA 3U3WA 3D9LA 4AEZC 1X5BA 3MV2B 2NWBA 4X1KE 1PC2A 2W61A 2WSSV 4J8FA 1E8XA 3G2TA 3IEEA 2OOEA 2I6HA 2I9CA 4I1AA 2LJLA 3FU6A 3CVNA 3C64A 5LFAA 5JVDE 1SA0E 3D9KA 1E8WA 4RG9A 2C0SA 3S2AA 1FMVA 2KCVA 3VKGA 4WWPA 4GU5A 4FADA 3UTKA 4BJNA 2ZM0A 3O1IA 4CI1B 2LE8A 4GB9A 2PM7A 3I0QA 3HKBE 2A4ZA 3B7TA 3FU5A 5FXWA 4PK6A 4EYYR 2X9YA 4H9SE 3O9XA 3CV0A 2V1DB 3FEXA 4AP2A 3RKOA 3ZIMA 4AIFA 3U4TA 2IU1A 1EF1C 3NZUA 2FBNA 5G04J 2KXPB 3FULA 3GN5A 5ARGA 4O4HE 2CEAA 5AENA 2PJQA 3FUDA 4QX7B 4IE6A 3ASGA 2XRZA 4YJ3E 3CWZB 2IOLA 5IHYA 2VK9A 3C51A 1D1BA 2L6JA 4ILHB 4CXWA 4CRWA 4WBNE 3FXDB 1HCIA 2N2NA 4H9QC 2XUEA 4JEUA 2Y3AA 1JWFA 2Q9QB 3RK6A 2LSYA 1D1CA 2E9XD 5EX3A 5FQ6A 3QC1A 2E0IA 2MHKA 1JUQA 2ES0A 2BZBA 4O4LE 2LEHA 3PUGA 4Y6CA 3ZHEB 4HOTA 4E85A 5FY7A 4X1YE 3H3AA 3CVXA 4CT0A 4FLBA 1UG3A 2E9XC 4EYUA 3L09A 1BPOA 3F57A 2CXDA 5DQVA 4BWRA 4HXIA 4I55E 2UXXB 4P0BA 5L3FB 2D5UA 4O2BE 3CHQA 4HEAA 1UJKA 4OHFA 3TXMA 3FU0A 4ANVA 1H0AA 5EK4A 3N2KE 4GYYA 5FQ8A 4G23A 1A17A 3ZMTB 3T5XA 4MS6A 3BQKA 4JHRA 3FH5A 2YNQA 1G73A 3MJXA 3J9X1 3ZJ2A 3UUNA 2GW1A 1NP7A 3PUKA 3NRXA 2IFUA 4MBQA 4U74A 3SS1A 3RIBA 4ACKA 5AYWD 4UF0A 2X6IA 2RD0A 3I4GA 5DJQC 4XAXB 3AB3B 2LOPA 3UULA 4CDMA 3CSFA 3PDNA 3K9IA 5JJ6A 5FP3A 4GYWA 5M4YA 3AAIA 3N71A 3QB2A 4PNIA 4AXHA 1ZHCA 2ACXA 4CGWA 2JEKA 2XHEB 1KK7A 4U8HA 4ZI2D 1MMDA 3PUJA 2MYSA 1DNPA 2BDEA 1UJJA 4B6XA 3BK9A 1SHZC 1H2VC 1INZA 2ODUA 4GYSA 3VKHA 4YVOA 5JJ7A 3FBLA 2VTBB 5HAXA 4LCTA 3OKQA 3BG0B 3IV0A 5AJDA 3C4WA 2VL8A 4M3OA 4UIGA 3ZC1A 3BQLA 4BFRA 2WXKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQG B;  3CQC B;  3I4R B; 
#chains in the Genus database with same CATH topology
 3DXK G;  3UT5 E;  1WYB A;  3RC8 A;  4WYV A;  3RKG A;  3ESK A;  2V7M A;  4QWN B;  3AS5 A;  3PUW F;  3QK0 A;  5AQ9 A;  2XQ0 A;  2WQ6 A;  4LER A;  5G55 A;  3JQ1 A;  1FVF A;  4HTE A;  4LMK A;  3AE2 A;  5FT9 A;  4EZL A;  1H6P A;  1Y6I A;  3CQX C;  1HNX T;  1OXJ A;  5CHE E;  4YT0 A;  1U2V G;  3FUJ A;  3LS8 A;  1ELW A;  1WY6 A;  4CDN A;  3AEC A;  4YDY A;  2RFA A;  4EZ4 A;  2WB2 A;  1OWA A;  1NI1 A;  3EJN A;  5AQR B;  3CHP A;  4HOU A;  4GTR A;  4IRU A;  1OWM A;  5L4E A;  1B7T A;  3LFM A;  3GZ2 A;  4D10 C;  3UXG A;  3RYF E;  2IML A;  3TLU A;  2XEH A;  4JUY A;  3LK2 B;  3ESL A;  2XAJ B;  4IE0 A;  4A1G A;  1EDU A;  4URK A;  4HFB A;  2UXC T;  4XX5 A;  4UQX A;  3NKZ A;  4HNA D;  3LXU X;  2ODV A;  3F2E A;  3LDZ A;  3HDX A;  1XNQ T;  4YJ2 E;  1WG0 A;  4XI0 A;  4IST A;  5FJY A;  5G04 C;  5TAO A;  1WLX A;  4UQZ A;  1ZKE A;  2LLY A;  4A97 A;  4F8H A;  2GRQ B;  3AA7 B;  1N11 A;  4GYO A;  1BD8 A;  3Q7A A;  3SFD A;  3N9N A;  2XM1 A;  4PFP A;  2K9A A;  4H63 H;  1WYC A;  3E34 A;  3G2V A;  2XJ7 A;  5EK3 A;  1FT2 A;  3RGL A;  4A3V A;  3QAQ A;  5KWD A;  3FZL B;  3IHR A;  2CPT A;  4YSX A;  4CYM D;  3VTY A;  3HKE E;  4GKJ T;  5EN5 D;  2E5L T;  3EIQ C;  4X1I E;  3ETV A;  4ZI3 C;  4NIQ A;  2WU2 A;  1FCH A;  4BJM A;  2JMH A;  3R7R A;  3T8O A;  5AJL A;  1HZ4 A;  2OVB A;  5AQM B;  3WAJ A;  3TWU A;  5CMW A;  1G3N B;  5C2T A;  3KFW X;  2EQX A;  1UX5 A;  3Q49 B;  3MJW A;  3URZ A;  2WZH A;  4TWF A;  2XQY A;  2LRL A;  2XSA A;  4UUC A;  2CLY C;  2XPZ A;  5AQB A;  3EDT B;  4XKB A;  2MAW A;  5CED B;  5ENO D;  3CHM A;  3TLT A;  3TGO A;  3I9W A;  2A5U A;  1MIW A;  3UFE A;  1TNU A;  4FJY A;  4ZI3 D;  1Z3X A;  3ZYL A;  5FL0 A;  1ZU2 A;  2XZD G;  3FH8 A;  3UT8 A;  2YU1 A;  3MEK A;  1JWG A;  2WXO A;  3N9L A;  1WR0 A;  2IUB A;  1TNO A;  3L39 A;  4HI8 A;  4EPZ A;  3ZT5 A;  3SNX A;  3MAC A;  3HXD A;  4CN6 A;  3HA4 A;  2V26 A;  3E0Z A;  3PRE A;  4KBQ A;  1NA3 A;  4U04 A;  1L0V A;  4X62 T;  3ZYK A;  5JRE A;  4MRU A;  4GA0 A;  4JEU B;  1IQR A;  4OYK A;  4JBW F;  4LF7 T;  5FXZ A;  2CHX A;  3BQO A;  3GZS A;  2R59 A;  3PE3 A;  2F37 A;  2LHR A;  1J5E T;  5B1A E;  2AXU A;  2E5V A;  3NQP A;  3JAF A;  3CML A;  5CGM A;  2XZT G;  5LP6 E;  4YLH A;  4TUU A;  4HWD A;  4TWD A;  2J08 A;  1D0X A;  4U31 A;  4EZJ A;  4MHC A;  4BET A;  2WXI A;  5FQ7 A;  1NZN A;  2LSK A;  3MZK B;  3U78 A;  2AXV A;  2ZLY A;  4DK5 A;  4TNW A;  1N4S A;  3OTO T;  3EUH A;  3LVQ E;  5FIO A;  3LKU A;  2WWV A;  2OND A;  4Q69 A;  1N36 T;  3ONL A;  5BPP A;  4H7Y A;  4JA7 A;  1OWO A;  2PQR A;  2BED A;  4EV6 A;  1S64 A;  4BTA A;  5T4Y A;  4A55 A;  3FDH A;  4JHJ A;  4JI8 T;  5BXO A;  5ABG A;  2ZM8 A;  2NW8 A;  5LGU B;  1D9S A;  5HS0 A;  3VHL A;  4GCO A;  4COF A;  5AFU L;  3RYC E;  2LM2 A;  4Q96 A;  2X0Y A;  4Z68 A;  3NF1 A;  3GN5 B;  2EIJ E;  4J8E A;  4L2Y A;  2DZN A;  2Q7F A;  1QBQ A;  3ZEF B;  1H7C A;  2C5K T;  3WI3 A;  2P9L G;  2ILR A;  3QKY A;  2BS3 A;  4BT8 A;  3ZUV B;  4KI0 F;  3ZPO A;  3Q5W A;  2GRL A;  4HWI B;  2Y1L E;  3N9M A;  1XMO T;  4MLK A;  5H6R B;  4K0K T;  3HL6 A;  4L2L A;  5AQN B;  4TUY E;  4BAY B;  5JH7 E;  4NXM T;  4U63 A;  3LK3 B;  2CM0 A;  2WWU A;  2N1G A;  3E22 E;  2CHZ A;  2QFC A;  1OCZ E;  2XEN A;  3DPY A;  4CT4 A;  4DUZ T;  4KZC A;  2ZGG A;  4FA6 A;  1YXR A;  2QYJ A;  3MXZ A;  3P4R A;  2WXL A;  2HO1 A;  2WXG A;  2QYU A;  1AJ3 A;  4AQY T;  4XBF B;  5ITZ F;  4QXH B;  2QY7 A;  4HBD A;  2GRM A;  3E4B A;  4Q25 A;  3ZPJ A;  3RX6 A;  4NUR A;  4NXN T;  2VWA A;  4DRX E;  1W0A A;  2W4X A;  3K3N A;  3PNT B;  5LGN B;  4PJM A;  4WNK A;  1OED B;  2BBJ A;  2VGY A;  3AU4 A;  4GTP A;  3CIA A;  2J47 A;  2LSJ A;  4YSY A;  4OFZ A;  3LEW A;  2GRR B;  4F1S A;  2R5S A;  4I6J A;  2UU9 T;  1S0P A;  2BG9 A;  2C5J A;  3QAR A;  4AKL A;  1QSD A;  4BSZ B;  3PDY A;  3PU8 A;  1YW0 A;  2H89 A;  3FTS A;  4GZD A;  3JC6 D;  4KVO A;  2JIW A;  4X64 T;  3QJZ A;  5LOV E;  1D8D A;  3DXM G;  4ZS3 A;  3LBX A;  1VCT A;  1H2U A;  4KP3 C;  3D9O A;  3OTN A;  4I9C A;  5FKY A;  4JI5 T;  2NW9 A;  4TV8 E;  3CVV A;  1HS7 A;  2FJD A;  5A7D B;  4B8C B;  3RYI E;  3Q75 A;  3ZSS A;  1E1H B;  4HN9 A;  1BR2 A;  5FQ4 A;  2D0T A;  2XHE A;  4DMV A;  4OYS A;  1WM5 A;  3QDN A;  2A3D A;  5LHG B;  3U9W A;  2CBJ A;  2DWG A;  4GZ3 A;  1D0Y A;  5LB7 B;  3JUE A;  4A56 A;  2PBI A;  4OYJ A;  3PNL B;  2XAS B;  4C9B B;  3N5L A;  3HKD E;  1E7U A;  2PZI A;  3FP3 A;  4HOQ A;  4WW0 A;  3AVR A;  3C3O A;  2Y6X A;  4FLH A;  4JXT A;  4ZI7 E;  4ANJ A;  3FHE A;  3PU3 A;  3HI2 A;  4CXX A;  4KUM B;  3UUX B;  2X9X A;  3AG4 E;  2JAB A;  4GMR A;  4JW1 A;  4JB8 P;  1AP7 A;  4N78 D;  4FHJ A;  2Y8D A;  4TXP A;  3GYZ A;  1OY3 D;  4HI9 A;  2AXD S;  4F6R C;  3ZKR A;  2X51 A;  3ZMU B;  1PY1 A;  3ONJ A;  4DR4 T;  2X6F A;  3AA0 B;  3ISM C;  3ABV A;  3R7Q A;  3NZS A;  1YYH A;  4A63 B;  2A2F X;  3OVU A;  4V1A v;  2LHN A;  3ZCJ A;  2CXF A;  3AE1 A;  5AQF B;  2X67 A;  3FH7 A;  3GZ1 A;  3APC A;  5FNV E;  4I9E A;  5ANL A;  3Q5D A;  5IWA T;  4N3B A;  3LY8 A;  3ASD A;  5ENS D;  2KND A;  1MX2 A;  5CCL A;  4P0A A;  2P9B A;  4ANU A;  2VKH A;  4PS3 A;  4L0R A;  4IL4 A;  3AU5 A;  1N9A A;  3QC9 A;  3PUV F;  1E8Y A;  5FTP A;  5A6C A;  5CBO A;  4XIF A;  4ATG A;  2XQ5 A;  3SFE A;  4B89 A;  4TXQ A;  2E9X A;  2IF4 A;  1DCQ A;  2H7O A;  2MOZ A;  1QZ2 A;  3UPV A;  2KBX A;  5HQ8 A;  4N3A A;  3LJC A;  4J0U A;  4J6I A;  2MYO A;  5FZQ A;  1Y8M A;  1IBL T;  3OYZ A;  3L6A A;  3P2B A;  1MMG A;  2CA5 A;  3KAE A;  2I59 A;  3O1J A;  4TV3 A;  4U0U A;  4GML A;  3PRZ A;  4EBA A;  3ULQ A;  4RQI A;  4HQD A;  4WWN A;  4PJL A;  3DSU A;  4UI9 J;  4OX9 T;  3PUS A;  3TWT A;  2YK0 A;  4C48 B;  2LOS A;  5EIL A;  2JRK A;  2X6J A;  2JQH A;  5HEJ A;  2E9X B;  4JPS A;  2V7J A;  5JRC A;  2YHE A;  1OUV A;  3RQU A;  3GW4 A;  3F6Q A;  2FO7 A;  3EHM A;  5L4H A;  2PNN A;  3DRA A;  3E30 A;  1HX8 A;  2W00 A;  4PH4 B;  5BT1 A;  4L23 A;  1IJ5 A;  4AOF A;  5JDN A;  3MA5 A;  4DV7 T;  1TNB A;  5BMV E;  4L7T A;  5KJK A;  1HG5 A;  4TNV A;  2VGE A;  3FU3 A;  5AQK B;  3O4Z A;  2UWJ G;  1YCS B;  4M1P A;  5CMY A;  4IDQ A;  5J08 A;  2CWO A;  1I94 T;  2XRY A;  4CEM A;  5HXC A;  4TV9 E;  2IO3 C;  5ENQ D;  1D1A A;  3PUA A;  5KDM C;  2XPY A;  4G63 A;  4L9P A;  1BU9 A;  4GTT A;  2IEJ A;  5LX8 A;  4IYP A;  3T1H T;  5AQS B;  1MHQ A;  3CST A;  3KBU A;  2XQ3 A;  4DX1 A;  1SZA A;  5LYJ E;  2HYZ A;  4G11 A;  3APD A;  3C3R A;  4J8D A;  2RA1 A;  4IDZ A;  3SHF A;  2XEV A;  1DCE A;  2LM9 A;  3SFY A;  3MCX A;  2DI4 A;  1H2T C;  4NQ0 A;  2XAF B;  3ASO E;  5F3J A;  5FWQ A;  3SO8 A;  2R02 A;  4YTN A;  4PJN A;  4PJJ A;  5LMU T;  2LAH A;  3MKR A;  1MQS A;  3WXX A;  5GON E;  2DYS E;  1OED E;  3FUE A;  5C8Y E;  2CWY A;  2N9D A;  3LY7 A;  4X8Q A;  2UXD T;  3PEU B;  2GRN B;  2L9B A;  3O48 A;  4EEC A;  1SE7 A;  3T8K A;  2F0Y A;  2AWI A;  4U7I A;  1CUN A;  4EIW A;  3ZT7 A;  5B3S E;  4HOS A;  5AQQ B;  2D9D A;  3C98 B;  4HWH A;  3FTZ A;  3B95 A;  3N2G E;  1A5E A;  3QNK A;  3C4Z A;  3CR3 A;  3OXG A;  1KLX A;  4ZI2 C;  2DWK A;  1E90 A;  1TN8 A;  3QOU A;  3RO2 A;  4CZ2 D;  4TXR A;  5FY1 A;  1XGW A;  3RLF F;  2LAI A;  2LSI A;  1HO8 A;  3B7R L;  2X38 A;  3IKO B;  5ENP D;  1HE8 A;  4AKH A;  3LVR E;  5CCM A;  2F8X K;  4N5C A;  3VTX A;  2XZE A;  4BY6 A;  3RPU A;  2V7L A;  2GRP B;  3FUI A;  1WFD A;  3O4X E;  4IN3 B;  2JMK A;  2KZ7 B;  3R6N A;  2RG8 A;  2QA7 A;  4KXK B;  4DX7 D;  2CHW A;  4MKT A;  4HFE A;  1UUS A;  2CFU A;  1W0B A;  1Y64 B;  2EHO A;  4JLE A;  3FFL A;  2DLR A;  5LXT E;  4H9O C;  3UUB A;  3ETU A;  1E2A A;  5C3J A;  3ZNG A;  3ZXS A;  1LRZ A;  3PUX F;  4CXY A;  5LNK A;  3FB2 A;  3P7I A;  1DU2 A;  3ZN0 B;  2V6X A;  4TRQ A;  3AEG A;  2K5B B;  4QFV A;  2YKS A;  3ZKJ A;  4BTB A;  3FTV A;  3UIO C;  2ZM2 A;  3PTR B;  3RIU C;  4GZ5 A;  5LCY A;  2CG3 A;  5JR9 B;  3RI5 A;  2XGS A;  5KBA A;  2PFV A;  2DVW A;  3NAW A;  4DR3 T;  3KDS E;  2D2S A;  3FBZ A;  2VSY A;  4JC8 A;  3EDU A;  4AQF C;  2LT3 A;  4DI4 A;  3PJA A;  2V5C A;  2OA5 A;  4X5T A;  2UUB T;  3Q5M A;  4DV0 T;  5HXS A;  4EED A;  2EHO B;  3ABK E;  4NUU A;  1YKH B;  3LY9 A;  1ZEE A;  4ZZB A;  4IE7 A;  2J9Q A;  1LF8 A;  3AE5 A;  3OJA A;  4PK4 A;  4MBG A;  4HGA A;  5FXV A;  5KCM A;  5EIB E;  2KWI B;  2W2U A;  2X9H A;  1T8B A;  3SRZ A;  4EEB A;  2XQ4 A;  3UIN C;  2A5E A;  3CKC A;  3EU9 A;  3ZN3 A;  4XI9 A;  4DX2 A;  4U2Z A;  4LML A;  2WBL A;  4PFO A;  3K3Q C;  1RZ4 A;  3IHV A;  2XAH B;  4U7E B;  1MND A;  4QXC B;  1N94 A;  4GIW A;  4UVB B;  3KD7 A;  2GK9 A;  3JAE A;  3ASN E;  3BUA A;  1BR4 A;  1IZN B;  4HWF A;  4IT4 A;  1SVX A;  5CRV A;  4LNU D;  3LBX B;  3DSX A;  4HOR A;  1N34 T;  4X65 T;  2W63 A;  3AE6 A;  1IAP A;  4DV5 T;  2QC9 A;  4I50 E;  4FP7 A;  3SFZ A;  3A5X A;  4WAF A;  4YDW A;  3CK9 A;  3X1D A;  3OPC A;  2BVM A;  4U0Z A;  4DBQ A;  4N2Q A;  3LG7 A;  3DBS A;  1OED C;  3CQC B;  1OCC E;  2NC9 A;  5BV0 A;  3HXE A;  3V5S A;  2YIN A;  4QH4 A;  2FJA A;  4UXN B;  2ETB A;  3APF A;  3QUJ A;  3Q9D A;  3MYV A;  4PUC A;  4K0U A;  3UT4 A;  3QB5 A;  3MK7 C;  4LFC T;  4UV8 B;  1N32 T;  3Q79 A;  3RYH E;  5HRY A;  3P4W A;  2VVS A;  3Q5E A;  4FUL A;  2J4B A;  3B7S A;  4QKN A;  2V7I A;  1FPP A;  3KS2 A;  2OLT A;  4BA9 A;  4JI1 T;  2ZMA A;  5FVL A;  1KT1 A;  1TJF A;  4PDX A;  4HFH A;  3F31 A;  5IY5 E;  1LD8 A;  2Z6E A;  3OBV E;  3OXF A;  1LVK A;  3G2W A;  3KVB A;  2L3L A;  5AQI B;  2J09 A;  2ZM6 T;  5A23 A;  3ZMV B;  2BTD A;  3FUF A;  4GOU A;  1S35 A;  5KJM A;  4LSZ E;  2KCK A;  5FY0 A;  5T8I A;  4BEP A;  5CEA A;  5ABF B;  4GAA A;  5CEC B;  3ASH A;  4EGW A;  3UI2 A;  2YQ8 A;  2HPL A;  1N52 A;  4UI9 C;  5ENR D;  1KZP A;  4A1S A;  2X68 A;  1HXI A;  2V8S E;  5BW8 C;  2E2E A;  4O2A E;  5C1D A;  3P8C D;  2CXL A;  2YHC A;  4I1O B;  3CLJ A;  1V54 E;  4JI7 T;  4EBA G;  3TWS A;  3QWP A;  4JEH A;  3AAE B;  2IY0 C;  4GYR A;  5BR8 T;  2KXP C;  3K8P C;  4U07 A;  1HS6 A;  4E7Z A;  2L6B A;  3P4P A;  4O6F A;  1N0R A;  3AEE A;  1CHU A;  4UVA B;  4JA9 A;  3TWR A;  2WXF A;  2WXH A;  3L22 A;  1V9D A;  2R17 C;  3CPZ A;  4CQI A;  4CCA A;  2HN1 A;  5ETW A;  2UY1 A;  3HIZ A;  5HEU A;  3V5U A;  2E8I A;  4DUI A;  3V31 A;  3UTM A;  2P9U G;  2SPC A;  3FWV A;  1MZC A;  4J7W A;  2L9Q A;  1HF8 A;  1EYH A;  2AW6 A;  3P50 A;  3VLD A;  5FXX A;  2IC6 A;  2A72 A;  2BS4 A;  2P9N G;  2IIU A;  3VLE A;  3TJP A;  4JEH B;  4C90 A;  2BVL A;  4MLP A;  4DO0 A;  3ENE A;  3ANW A;  2B6C A;  4PK5 A;  3NOG D;  3JAD A;  1SZ9 A;  1FEW A;  2V4L A;  4I1M A;  5JRC B;  2WB5 A;  3UU5 A;  2ETC A;  4IL9 A;  4A98 A;  4UI9 K;  5LBM A;  3ZW3 A;  4O60 A;  3S4U A;  1UX4 A;  3D9J A;  4APO A;  2FJB A;  3AA6 B;  4AY6 A;  2LNI A;  4N3C A;  1G8X A;  3N2O A;  4GPM A;  1O1R A;  3ZLI A;  4JHK A;  2BKN A;  3AE4 A;  3QWV A;  4GA1 A;  1R8I A;  4BT9 A;  5J2T E;  3CVW A;  2CMR A;  4A3T A;  1U3D A;  1US7 B;  2L0I A;  2DIW A;  5JHB A;  1T7S A;  1U4Q A;  3ANW B;  2Q9Q C;  4TN7 B;  2KT9 A;  2V7K A;  3U66 A;  4OVV A;  2LUH A;  2R2L A;  4EXT A;  3MA9 A;  4ILG A;  1H6K A;  3DSW A;  5LCW C;  2HE0 A;  4GKK T;  2ACZ A;  4JV5 T;  3UM1 A;  3UIP C;  4RG6 A;  2L0T B;  4RSY A;  5LJM A;  3KV4 A;  3UU4 A;  3TXN A;  3ML8 A;  1IHG A;  2E2A A;  4WNE A;  3AXJ A;  2VQ2 A;  3L9T A;  5KNH D;  4QHO A;  3PZ3 A;  1NA0 A;  4LF4 T;  1NL4 A;  3QK6 A;  3E37 A;  1TJC A;  5HXE A;  3CK8 A;  4CDR A;  3ZXP A;  2KLQ A;  5JJT A;  3ONL C;  4Z8X A;  2K48 A;  4QH5 A;  4KX6 A;  5EID A;  3ZYM A;  1QLB A;  5E75 A;  3H3M A;  2KAT A;  4EZK A;  3RH3 A;  1IKN D;  2LXM A;  4AJW A;  3FUM A;  3CGH A;  4TUM A;  4IUL A;  2NTY A;  3B57 A;  3ONK A;  5J90 A;  2ZXW E;  2J07 A;  1KNZ A;  4LF6 T;  4J8S A;  2WCA A;  2B1E A;  4U2Y A;  4DR1 T;  3IXE A;  1JCR A;  1XZY A;  5LJN A;  2VJ8 A;  2YN6 A;  3M65 A;  4CGV A;  3RC3 A;  4JD2 G;  1KZO A;  5HWY A;  3SZ7 A;  2CHN A;  3D9N A;  3L3P A;  3ZJ1 A;  3EAB A;  4XE0 A;  3C4X A;  4GTS A;  4G2A A;  1HTJ F;  4U3C A;  2V5F A;  2OEW A;  3EDV A;  4C0E A;  3DEP A;  3Q15 A;  5AAR A;  3CVU A;  3S7B A;  2KMF A;  5CER B;  4UWH A;  2H3R A;  4IDN A;  4FHK A;  2OVF A;  3EHQ A;  4IDO A;  3ZHE A;  3N9P A;  3T9K A;  5ENN A;  3A7M A;  4JI2 T;  2XQ9 A;  3CVR A;  2WDQ A;  2QZA A;  3ZRH A;  2J1D G;  5JDH A;  2X6H A;  2LSG A;  3ONX A;  4I43 B;  2VKD A;  4TZ4 C;  3D9M A;  3M3Z B;  2NTX A;  3SOL A;  1FT1 A;  5AQL B;  2IC9 A;  4B0Z A;  2KZT B;  1K8K G;  4LNB A;  4LFB T;  2JQ9 A;  4BES A;  1W3B A;  4AQF A;  2LO6 A;  1WR6 A;  5DQW A;  2EIN E;  5LP0 A;  1LD7 A;  4ERR A;  5LBQ B;  4F7A A;  3J7Y q;  2M6I A;  4F3V A;  2WAU A;  2LRK A;  3RIU A;  2X66 A;  3PZ2 A;  2WZI A;  3AS8 A;  4DLO A;  4JVS A;  3T1Y T;  4UQY A;  4LF9 T;  2XAQ B;  3PS6 A;  2WDV A;  4NPP A;  1ZOY A;  3IF8 B;  4HFG A;  5EKQ D;  5JR9 C;  3KIN B;  4DR7 T;  5ADX L;  2YOE A;  4I43 A;  2J4G A;  2ETA A;  3R84 B;  2QVA A;  4JL0 A;  3MGB A;  5C2Y A;  4ZXL A;  4J8Y A;  4AKI A;  3FHN A;  2YEV C;  3KSL A;  2RP4 A;  1EZ3 A;  2I1K A;  1H19 A;  2X6K A;  1V55 E;  2DBA A;  3SWH A;  3PV0 F;  2H7V C;  4UWF A;  1BR1 A;  4UWL A;  3LYA A;  4B93 B;  3MZL B;  2WQH A;  3PUY F;  2IHR 1;  5HEH A;  1NEN A;  2V5Q C;  4K0R A;  3CVP A;  2YU2 A;  3ZEF A;  2XQ7 A;  3NZP A;  1YQ4 A;  5AAO A;  4RLY A;  1NAF A;  4DV4 T;  1HX1 B;  2CHO A;  2J62 A;  3Q4A B;  4ME2 A;  1RW2 A;  4I0U A;  1TNY A;  4XZ4 A;  2KC7 A;  3PUZ F;  3PZD A;  5CA0 E;  1SW6 A;  5LGT B;  3DPD A;  2AVP A;  2HH7 A;  1JCQ A;  3CHR A;  2EIM E;  3CVY A;  1GQE A;  3CIR A;  2OV9 A;  3SD5 A;  4L5G A;  1OED A;  5AQU B;  2XAG B;  4JYA T;  4WNF A;  4CI2 B;  3UKR G;  2WU5 A;  2QRX A;  4E6H A;  4KZ0 A;  2XY8 B;  3Q78 A;  4P09 A;  3W9F A;  4DX5 D;  2QGS A;  2VVN A;  5AQH B;  2I2O A;  2RFM A;  4EQF A;  3NWI A;  2JLB A;  3RAU A;  1S94 A;  2WY2 A;  2PM6 A;  4Z90 A;  5HEG A;  3EI0 A;  4ISS A;  2VAS A;  1TN7 A;  5EYP F;  3E08 A;  5JTG A;  4O1O A;  1MX4 A;  3OAW A;  4WNG A;  3EVY A;  1NWM X;  3GA8 A;  2UXB T;  1JPL A;  1OWN A;  1Z6T A;  4EAH A;  1IBM T;  4DI3 A;  1J1J A;  4G8K A;  4NUV A;  3AG3 E;  1D0Z A;  4KBM B;  1OCR E;  4G2V A;  4GTO A;  4YFS A;  1MNE A;  2J8S D;  1B89 A;  5EZY E;  4LF8 T;  1Z5S C;  5ARF A;  4B8A A;  3MKD A;  1O5M A;  5ANR A;  3C50 A;  4AM9 A;  1OXZ A;  3N9O A;  3ZCI A;  3EIJ A;  3SBT B;  1O3X A;  3IHY A;  3HHM A;  3FUH A;  2VGX B;  3QWW A;  4UWG A;  3TG4 A;  4R7L A;  4Y6W A;  4O4I E;  3CQG B;  4HRL A;  3RRU A;  3EHR A;  4U95 D;  1N4Q A;  4ZFH A;  3PEV B;  3TKL B;  2NW7 A;  2BUG A;  1YKE B;  3KVA A;  3FUK A;  4P1N A;  5LHI B;  1E96 B;  2ZU6 B;  4ZEY A;  3DTO A;  3NZQ A;  4GZ6 A;  1HNW T;  3NBN B;  3ZC0 A;  1NFI E;  4ABN A;  3KBT A;  5LOZ A;  5HKP A;  2WQ7 A;  4HE8 A;  3S7D A;  4OVU A;  5AIJ A;  3LK4 2;  5LMN T;  3OXL A;  2MPK A;  3D0T A;  3FUN A;  4FC8 A;  2X3M A;  3BEE A;  1QQE A;  3SFX A;  3DJB A;  4LF5 T;  2H6H A;  2IQC A;  4LFA T;  1KT0 A;  4HVB A;  3AA1 B;  3Q5X A;  2BG9 B;  2FBW A;  2VKO A;  4LEU A;  4U7Y A;  3TAX A;  4FJZ A;  2DL1 A;  3HG0 D;  1ZBP A;  4I2Z A;  2YDS A;  4MAL A;  3SBS A;  2AJA A;  2FEZ A;  4H9P C;  3I9Y A;  3W9G A;  2K3W A;  4GTM A;  4V3I A;  3E33 A;  4L1B A;  1IBK T;  4XKC A;  3QB5 K;  3LSV A;  4IE4 A;  2F8Y A;  3AG2 E;  3R9A B;  3WAK A;  4B3R T;  5DIZ A;  4J2C A;  1MYO A;  4C0M A;  5FYM A;  4AV7 A;  2MBG A;  4PAG A;  3DSV A;  3DST A;  4ZS2 A;  5L3B B;  4HKA A;  5FVK A;  5F5W A;  3BU8 A;  3AXJ B;  1VOM A;  2L8K A;  1LTX A;  5FMN A;  1PAQ A;  4F6R D;  1K1B A;  4ILA A;  2UY1 B;  1E8Z A;  3MKQ B;  4W9R A;  1K3Z D;  3ZT6 A;  5CA1 E;  3BG1 B;  2D0U A;  4GMJ A;  3TWV A;  1X81 A;  2CBI A;  4I2W A;  3HYM B;  5BV1 A;  2WXR A;  4K03 A;  2DWZ A;  4DJA A;  4DR6 T;  3CX6 B;  4IE5 A;  3AED A;  5JDL A;  2CRB A;  4DV3 T;  5L3E B;  3HVE B;  3JQ0 A;  3VR9 A;  3W15 B;  5BUZ A;  2XCB A;  4AY5 A;  4WWO A;  1SUM B;  4EHM A;  1NEK A;  2PQN A;  2G0U A;  2P58 C;  4H7X A;  3RU0 A;  4QH1 A;  1O1T A;  2MTQ A;  2XQ8 A;  2W62 A;  2H6G A;  2R05 A;  5ABH A;  2EIK E;  2UXN B;  3TLW A;  4G24 A;  3QOF A;  1HNZ T;  4IIJ E;  2CFZ A;  4ADZ A;  3AEB A;  2PTF A;  4ILU A;  3UUM A;  2M67 A;  3KSQ A;  3RO3 A;  3ZFW A;  2JJ9 A;  4U72 A;  2NXP A;  2C2L A;  5EX0 A;  4IRE A;  2V6Y B;  5IYZ E;  2C0M A;  3L17 A;  3AAA C;  1KF6 A;  3VU7 H;  5DAB A;  4YVQ C;  4F53 A;  2VSO E;  2DYR E;  3G2S A;  3Q2M A;  4DVD A;  2F4V T;  5FZS A;  3K3O A;  1UCU A;  4XZC A;  2P9P G;  3FTX A;  2NP9 A;  5CRU A;  4AQG A;  4P29 A;  3UQ3 A;  5H6Q B;  3L13 A;  2Q9Q D;  1N33 T;  2JQK A;  4H63 V;  2RKK A;  3KEZ A;  5T3R A;  3NOC D;  4GPK A;  1DVP A;  2MRI A;  2JQQ A;  5KMG P;  1ELK A;  4HFI A;  1HU3 A;  5FIN A;  4UV9 B;  1UN9 A;  2K24 A;  4KVM A;  2DNX A;  2IW5 B;  3H37 A;  2HPJ A;  1T98 A;  3FTU A;  3UT7 A;  2VQF T;  4DR2 T;  4JI4 T;  4AXP A;  2LSV A;  4PS8 A;  1HFA A;  4N2S A;  5HEO A;  4JI0 T;  5E0O A;  1YMP A;  1UUR A;  2XGO A;  3SI5 A;  5LCW J;  3MV3 B;  2FJE A;  3AE8 A;  4BSX A;  4ANW A;  3I4R B;  1U3C A;  1H6O A;  3CVL A;  2DCP A;  2CG2 A;  1Z3Y A;  2PL2 A;  1P5Q A;  4DV6 T;  2XEE A;  3DP7 A;  3V2X A;  3SGH A;  1IYG A;  4UWK A;  1FMW A;  3U3I A;  3Q7F A;  3CKD A;  5AN8 A;  3UX4 A;  3KV6 A;  5L2L A;  1SA5 A;  3JCK C;  4PS7 A;  4NAC A;  1FVH A;  2WXJ A;  4KT6 B;  3Q9N C;  3L8R A;  4IHJ E;  3L08 A;  2H6I A;  4CI3 B;  4WZX A;  2WXP A;  3CK7 A;  3PVL A;  4ZZC A;  2WPV A;  5CB4 E;  3NB2 A;  2BF0 X;  3FEY A;  2LKH A;  3IEG A;  3ZGQ A;  4BX8 A;  1BI8 B;  3GMI A;  2VB6 A;  4G26 A;  2WP9 A;  4E7S A;  3O1H A;  1YA0 A;  3RRN B;  2HR2 A;  1N54 A;  2ION A;  2WXQ A;  4ANX A;  1MJ0 A;  3VLF A;  3JCF A;  1M7K A;  4GK0 E;  1ELR A;  3EHZ A;  5JDF A;  5KX5 E;  2KZT A;  3D9P A;  3P4Q A;  4EOZ B;  4OAU C;  4TX5 A;  4G1T A;  1XWM A;  5AQA A;  2EHO C;  4YTM A;  4DLQ A;  4UR9 A;  5HXH A;  3EUV A;  5CJ5 A;  4KMO A;  4LG6 A;  3B7U X;  3IBE A;  3EU5 A;  4YDE A;  5BXU A;  3UU6 A;  4C91 A;  3I1A A;  4AKR B;  2VSX E;  2Q9Q A;  3RQW A;  2IJG X;  4APF A;  1O1S A;  2YDR A;  4NIK A;  3B7B A;  4FU3 A;  5JA4 D;  4FI5 A;  4HFD A;  1SA4 A;  2IOS A;  1QUU A;  2I1J A;  4O1P A;  1UK5 A;  2JPF A;  1VDY A;  5L3G B;  3ABM E;  1ZV4 X;  4I4T E;  2ZGD A;  4A5X A;  3RRM B;  2KCL A;  5KNG A;  4HFV A;  3WG7 E;  4JI6 T;  2FF4 A;  2C5I T;  3PUR A;  3HKC E;  2YDQ A;  4UEL A;  2DHR A;  1OT8 A;  5HCM A;  2HM8 A;  5JHA A;  1E7V A;  2WVI A;  4DBR A;  1N95 A;  4YND A;  2IDO B;  2VSN A;  4DMW A;  5A1L A;  4GZC A;  3VR8 A;  2XCC A;  2WDR A;  3CX8 B;  4HB5 A;  4HWC A;  4L9I A;  1HG2 A;  3VRA A;  3AG1 E;  4AKG A;  3S7J A;  3UUX A;  3ZMZ B;  1EPU A;  4HS2 A;  1WRD A;  3ABL E;  3X2Q E;  1LKX A;  3PH0 C;  1KNR A;  3R9M A;  4HRM B;  4YHJ A;  4DV1 T;  2UUC T;  4AVX A;  2W0G A;  4QXB B;  3AEA A;  1N0Q A;  3TWQ A;  2VKJ A;  3D9I A;  5JMN D;  2OV8 A;  3FTY A;  5JR9 A;  4UF0 B;  4EB6 E;  3EHN A;  1MMN A;  2OEV A;  3OYX A;  1OWP A;  3JXI A;  4UVC B;  2J49 A;  4LMJ A;  1MX6 A;  1TN6 A;  4WND A;  3GWH A;  5CBN A;  1IHB A;  3TG5 A;  4HLE A;  4KMC A;  4GTV A;  5E76 A;  3FZK B;  3UM3 A;  2J4D A;  2LSU A;  5D0Q D;  1IJ6 A;  3JC6 C;  2M63 A;  3HRA A;  2XQ6 A;  2KIN B;  2EIL E;  5J1G A;  1YQ3 A;  5HXR A;  3T5V A;  3ZVV A;  1W9R A;  2AXZ A;  4DR5 T;  2KM4 A;  3I5P A;  4DPR A;  3SQV A;  1JNR A;  2DCF A;  2VUR A;  2VYI A;  3LPZ A;  3LJ3 A;  4GCN A;  3PUQ A;  3CHO A;  4LUN U;  3FXE B;  3TWX A;  4QX8 B;  4JZY A;  1JCS A;  4RVB A;  3LJN A;  5HYA A;  3I3N A;  2WXN A;  3C3Q A;  4ZHQ E;  3ML9 A;  4K5C A;  1QNF A;  5AQV B;  2MOW A;  3A8Y C;  2M6B A;  1TEZ A;  5LG4 A;  5KJL A;  2AE9 A;  3HXC A;  3Q9U C;  4BX9 A;  3B13 A;  2VGX A;  2X0H A;  3S7F A;  4N5Q A;  2WM9 A;  5L3D B;  3SF4 A;  4MFR A;  3PE4 A;  5HWX A;  1SQM A;  3CVQ A;  1UN8 A;  3D3M A;  4N39 A;  2WMO A;  4I6E A;  2DZO A;  5B1B E;  4H9N C;  3NBX X;  4I6G A;  4AIS A;  3NRY A;  1KPS B;  1HR0 T;  1IQU A;  1GW6 A;  2H6F A;  4ZOL E;  1UW4 B;  2VTB A;  1BR0 A;  3N9Q A;  1XDP A;  4DV2 T;  1FIO A;  5EK2 A;  3ASF A;  5D0O D;  2XPI A;  3UKU G;  3U64 A;  2FI7 A;  3DWL G;  5LHH B;  2CE7 A;  2WS3 A;  3RF1 A;  1E7P A;  1Z0P A;  3JYS A;  3C5R A;  5M72 A;  5BNW A;  5AQP B;  3PE0 A;  5DBK A;  4GA2 A;  2X9W A;  2B76 A;  4GK5 E;  2XGM A;  3P1U A;  3FTW A;  5HCJ A;  2P9S G;  3AE9 A;  3KV9 A;  3L16 A;  3Q73 A;  4DUY T;  1L5J A;  3JUI A;  1KNP A;  2WMN A;  4Q94 A;  2IO2 C;  1VRB A;  4ILC A;  1XMQ T;  4H9R C;  3G06 A;  1HH8 A;  2C0L A;  1U5P A;  3CEQ A;  4CZZ B;  3CHS A;  4EZH A;  3BQI A;  2UUA T;  3HR0 A;  4UEM A;  3AE7 A;  2W67 A;  2V5D A;  5AQT B;  2BS2 A;  5KJN A;  5JDG A;  2IAK A;  3RHW A;  3LCA A;  4U8Y D;  4G25 A;  1Q2Z A;  5FZR A;  3J5Q B;  2V6Y A;  2BKP A;  4ASK A;  2B0O E;  3ZN1 B;  3RRW A;  4KHZ F;  3RIA A;  2H88 A;  4B3M T;  3MKQ A;  2XM2 A;  3KV5 A;  1WAO 1;  3AS4 A;  2PG8 A;  2V0P A;  3Q47 B;  5HI7 A;  3TLS A;  3T8M A;  2GRO B;  4JI3 T;  3UU8 A;  4ATZ D;  1BLX B;  2XTL A;  2XSB A;  2X0L B;  3UM0 A;  2FUL A;  1MIV A;  4YHH T;  3AVS A;  2R03 A;  4IGU A;  3CKB A;  4YXD A;  2CCQ A;  1MIY A;  2XS8 A;  4KYO B;  4FJO A;  3C98 A;  3HVE A;  4KHP T;  3RIF A;  5L3C B;  3UMV A;  3IBP A;  2BKK B;  4DND A;  5ABE A;  4HFC A;  4B94 A;  3UFG A;  2NSZ A;  2XPK A;  3AEF A;  3MX3 A;  4ILI A;  3FY4 A;  5J2U E;  3DSS A;  4LRZ A;  5G05 J;  4AI6 A;  4O4J E;  2KWH A;  3EAM A;  3TLV A;  2Y4T A;  1X79 A;  2V8S V;  2Y48 B;  2Y4U A;  5G2N A;  5EDS A;  3IA3 A;  4K5B A;  2GGF A;  3ZYQ A;  4OK0 A;  3HXF A;  1XNF A;  1K1A A;  3L54 A;  3RKV A;  4PW8 A;  1UOH A;  4WBO A;  4K5A B;  5G05 C;  3SY2 A;  3KEA A;  5JQG E;  4X20 E;  3UU3 A;  2EHO D;  1I6Z A;  4DID B;  2W66 A;  2V4H C;  5H7P A;  4B3S T;  2NOX A;  3DEO A;  5LA6 E;  2BKG A;  3B5M A;  5F8P A;  4NRH B;  4WUY A;  2WXM A;  3RRC A;  3AAA B;  3RJV A;  2XQA A;  2CLY B;  3ZMS B;  3FZM B;  5AQJ B;  3NVO A;  4YSZ A;  2ZIS A;  3TL5 A;  4ACL A;  3CX7 B;  1W09 A;  4F1P A;  1MMA A;  1OWL A;  3I0O A;  4GTQ A;  3G2U A;  5JDM A;  5JDQ A;  4U0S A;  1YD8 G;  4I17 A;  1LVF A;  4O8S A;  3ULE G;  3U3W A;  3D9L A;  2XS1 A;  4AEZ C;  2VL0 A;  1X5B A;  3V79 K;  1KEY A;  3MV2 B;  2NWB A;  4X1K E;  1PC2 A;  2W61 A;  4X66 T;  2WSS V;  4B3T T;  5D2M C;  4J8F A;  1E8X A;  3G2T A;  3IEE A;  2OOE A;  2I6H A;  2I9C A;  4YY3 T;  4I1A A;  2LJL A;  3FU6 A;  3CVN A;  3JXJ A;  3C64 A;  2NYJ A;  5JVD E;  5LFA A;  1SA0 E;  3UQ4 A;  2VQE T;  3D9K A;  2FUP A;  1E8W A;  1FJG T;  4RG9 A;  2C0S A;  3S2A A;  1FMV A;  2KCV A;  4M7C A;  3VKG A;  1AWC B;  4WWP A;  4GU5 A;  4FAD A;  3UTK A;  4BJN A;  2ZM0 A;  3O1I A;  4CI1 B;  2LE8 A;  4ILB A;  4GB9 A;  4IDP A;  2PM7 A;  3I0Q A;  3HKB E;  4BER A;  5L47 A;  2A4Z A;  3B7T A;  3FU5 A;  5FXW A;  1ZP0 A;  3AE3 A;  4PK6 A;  4EYY R;  2HN2 A;  2X9Y A;  4H9S E;  3O9X A;  3D9H A;  3CV0 A;  2V1D B;  5J0Z A;  3FEX A;  1D8E A;  3ZU7 B;  4DX6 D;  4AP2 A;  3RKO A;  3ZIM A;  4AIF A;  3ZST A;  3U4T A;  2IU1 A;  1EF1 C;  2BBH A;  2BKO A;  3NZU A;  3PJA J;  2FBN A;  5G04 J;  2KXP B;  3FUL A;  3GN5 A;  5ARG A;  1N4R A;  4O4H E;  2CEA A;  5AEN A;  2PJQ A;  3FZF B;  3FUD A;  2I0M A;  1QYM A;  4QX7 B;  4IE6 A;  3ASG A;  2XRZ A;  3LDQ B;  1TNZ A;  5D66 A;  5KXJ A;  4YJ3 E;  3CWZ B;  2IOL A;  5IHY A;  2VK9 A;  3C51 A;  1D1B A;  2L6J A;  4LNG A;  4ILH B;  4CXW A;  4CRW A;  5LG3 A;  3AJI A;  2KSR A;  4AIU A;  3J5P A;  3HXB A;  4WBN E;  5FL1 A;  3FXD B;  1HCI A;  2N2N A;  4H9Q C;  2XUE A;  4JEU A;  2QYW A;  2P9K G;  2Y3A A;  1JWF A;  5IUX A;  2Q9Q B;  3RK6 A;  2LSY A;  3K1S A;  1D1C A;  2E9X D;  5EX3 A;  5FQ6 A;  3QC1 A;  2E0I A;  2MHK A;  4OAV B;  5AQG B;  1TYQ G;  1JUQ A;  4ZHB A;  4Z91 A;  2ES0 A;  2BZB A;  3VRB A;  1N4P A;  4O4L E;  2LEH A;  4HLL A;  1KFY A;  3PUG A;  4Y6C A;  3ZHE B;  4HOT A;  3V30 A;  4E85 A;  5FY7 A;  4X1Y E;  3H3A A;  3CVX A;  4CT0 A;  4FLB A;  1UG3 A;  2E9X C;  4EYU A;  1T72 A;  3L09 A;  4U8V D;  3E32 A;  1BPO A;  3F57 A;  4CN1 A;  2CXD A;  5DQV A;  4BWR A;  4HXI A;  4CN4 A;  4I55 E;  2UXX B;  4P0B A;  2LXL A;  5L3F B;  2D5U A;  4O2B E;  1OCO E;  3CHQ A;  4HEA A;  2NR4 A;  2LKG A;  1UJK A;  2ZIR A;  1TR4 A;  4OHF A;  3TXM A;  3FU0 A;  3TWW A;  4ANV A;  1H0A A;  5EK4 A;  3V2O A;  3N2K E;  3ULY A;  1IXV A;  3PZ4 A;  4GYY A;  4TWH A;  5FQ8 A;  1S70 B;  4G23 A;  3UM2 A;  2RPA A;  1A17 A;  4YDO A;  3ZMT B;  3T5X A;  1M62 A;  4MS6 A;  4QQI A;  3BQK A;  1Z8U A;  1S63 A;  4JHR A;  3FH5 A;  2YNQ A;  1G73 A;  3MJX A;  3J9X 1;  3ZJ2 A;  2OCC E;  4XEI G;  3L82 A;  3UUN A;  1WDY A;  2GW1 A;  2FO1 E;  1Y01 A;  1XDO A;  1NP7 A;  5AQO B;  3PUK A;  3NRX A;  2IFU A;  3CK6 A;  4MBQ A;  4U74 A;  3SS1 A;  1JNZ A;  3RIB A;  3FZH B;  4ACK A;  5AYW D;  4UF0 A;  2X6I A;  2RD0 A;  3I4G A;  5DJQ C;  4XAX B;  5ABF A;  3AB3 B;  1UGO A;  2LOP A;  3UUL A;  4CDM A;  3CSF A;  5ENT D;  3PDN A;  3PZ1 A;  2Y69 E;  2R6G F;  3K9I A;  5JJ6 A;  5FP3 A;  2A9U A;  3QNU A;  4GYW A;  1XNR T;  5M4Y A;  1X9B A;  3AAI A;  3N71 A;  1BI7 B;  3QB2 A;  2WQY A;  3P4S A;  4PNI A;  1J5W A;  1DC2 A;  4AXH A;  5EYL A;  1ZHC A;  2ACX A;  4CGW A;  1WCR A;  1ZB1 A;  2JEK A;  4G8L A;  2XHE B;  1KK7 A;  4U8H A;  4ZI2 D;  1MMD A;  3PUJ A;  2MYS A;  4HRN A;  1DNP A;  2P9I G;  5CFB A;  2BDE A;  1UJJ A;  2BG9 E;  4B6X A;  3BK9 A;  2HHH T;  3RSE G;  1SHZ C;  2BG9 C;  1H2V C;  1INZ A;  3UQ7 A;  2ODU A;  1VCS A;  4GYS A;  3VKH A;  2Y0B G;  4YVO A;  3C72 A;  5JJ7 A;  5AQ7 A;  3FBL A;  2VTB B;  5HAX A;  4LCT A;  3OKQ A;  3BG0 B;  3IV0 A;  5AJD A;  3C4W A;  2VL8 A;  4M3O A;  4U33 A;  4UIG A;  2P2C P;  4U96 D;  3ZC1 A;  3BQL A;  4BFR A;  4YTP A;  2WXK A; 
#chains in the Genus database with same CATH homology
 3UT5 E;  1WYB A;  3RC8 A;  3ESK A;  2V7M A;  4QWN B;  3AS5 A;  3QK0 A;  2XQ0 A;  2WQ6 A;  4LER A;  5G55 A;  3JQ1 A;  1FVF A;  4HTE A;  5FT9 A;  4EZL A;  1Y6I A;  3CQX C;  5CHE E;  3FUJ A;  3LS8 A;  1ELW A;  1WY6 A;  4CDN A;  4EZ4 A;  2WB2 A;  1OWA A;  3EJN A;  3CHP A;  4HOU A;  4IRU A;  1OWM A;  1B7T A;  3LFM A;  3GZ2 A;  4D10 C;  3RYF E;  4JUY A;  3LK2 B;  3ESL A;  2XAJ B;  4IE0 A;  4A1G A;  1EDU A;  4URK A;  4XX5 A;  4UQX A;  3LXU X;  2ODV A;  3F2E A;  3LDZ A;  3HDX A;  4YJ2 E;  4XI0 A;  4IST A;  5FJY A;  5G04 C;  5TAO A;  1WLX A;  4UQZ A;  1ZKE A;  3AA7 B;  4GYO A;  3N9N A;  4PFP A;  2K9A A;  4H63 H;  1WYC A;  3G2V A;  5EK3 A;  4A3V A;  3QAQ A;  3IHR A;  3VTY A;  3HKE E;  3EIQ C;  4X1I E;  3ETV A;  4ZI3 C;  1FCH A;  4BJM A;  2JMH A;  3R7R A;  3T8O A;  5AJL A;  1HZ4 A;  2OVB A;  3WAJ A;  5CMW A;  3KFW X;  2EQX A;  1UX5 A;  3Q49 B;  3MJW A;  3URZ A;  2XQY A;  2CLY C;  2XPZ A;  3EDT B;  4XKB A;  3CHM A;  3TGO A;  3I9W A;  2A5U A;  1MIW A;  3UFE A;  4FJY A;  4ZI3 D;  1Z3X A;  3ZYL A;  1ZU2 A;  3FH8 A;  3UT8 A;  2YU1 A;  3MEK A;  1JWG A;  2WXO A;  3N9L A;  4EPZ A;  3SNX A;  3MAC A;  3HA4 A;  2V26 A;  3E0Z A;  3PRE A;  4KBQ A;  1NA3 A;  4U04 A;  3ZYK A;  5JRE A;  4MRU A;  4GA0 A;  4JEU B;  1IQR A;  4OYK A;  5FXZ A;  2CHX A;  3GZS A;  3PE3 A;  2R59 A;  2LHR A;  2AXU A;  3NQP A;  3CML A;  5LP6 E;  4YLH A;  4TUU A;  2J08 A;  1D0X A;  4EZJ A;  4MHC A;  2WXI A;  5FQ7 A;  1NZN A;  2LSK A;  3MZK B;  3U78 A;  2AXV A;  2ZLY A;  4DK5 A;  3EUH A;  3LVQ E;  3LKU A;  2OND A;  4Q69 A;  3ONL A;  5BPP A;  4H7Y A;  4JA7 A;  1OWO A;  2PQR A;  4BTA A;  5T4Y A;  4A55 A;  3FDH A;  4JHJ A;  2ZM8 A;  2NW8 A;  5LGU B;  3VHL A;  4GCO A;  5AFU L;  3RYC E;  4Q96 A;  3NF1 A;  3GN5 B;  4J8E A;  4L2Y A;  2Q7F A;  3ZEF B;  1H7C A;  2C5K T;  3WI3 A;  2ILR A;  3QKY A;  4BT8 A;  3ZPO A;  3Q5W A;  2GRL A;  3N9M A;  4MLK A;  5H6R B;  3HL6 A;  4L2L A;  4TUY E;  4BAY B;  5JH7 E;  4U63 A;  3LK3 B;  2CM0 A;  2WWU A;  2QFC A;  2N1G A;  3E22 E;  2CHZ A;  4CT4 A;  4KZC A;  4FA6 A;  3MXZ A;  2WXL A;  2HO1 A;  2WXG A;  1AJ3 A;  4XBF B;  4QXH B;  2QY7 A;  2GRM A;  3E4B A;  3ZPJ A;  3RX6 A;  4NUR A;  2VWA A;  3PNT B;  3K3N A;  4PJM A;  5LGN B;  4WNK A;  2VGY A;  3AU4 A;  3CIA A;  2LSJ A;  4OFZ A;  3LEW A;  4F1S A;  2R5S A;  4I6J A;  1S0P A;  2C5J A;  3QAR A;  4AKL A;  1QSD A;  3PDY A;  3PU8 A;  1YW0 A;  3FTS A;  4GZD A;  3JC6 D;  4KVO A;  3QJZ A;  5LOV E;  4ZS3 A;  3LBX A;  4KP3 C;  1H2U A;  3D9O A;  3OTN A;  4I9C A;  2NW9 A;  4TV8 E;  3CVV A;  1HS7 A;  5A7D B;  4B8C B;  3RYI E;  1E1H B;  4HN9 A;  1BR2 A;  5FQ4 A;  2D0T A;  2XHE A;  4DMV A;  4OYS A;  1WM5 A;  3QDN A;  2A3D A;  5LHG B;  3U9W A;  2DWG A;  4GZ3 A;  1D0Y A;  4A56 A;  2PBI A;  4OYJ A;  3PNL B;  2XAS B;  4C9B B;  3N5L A;  3HKD E;  1E7U A;  2PZI A;  3FP3 A;  4HOQ A;  4WW0 A;  3AVR A;  2Y6X A;  4FLH A;  4JXT A;  4ZI7 E;  4ANJ A;  3FHE A;  3PU3 A;  3HI2 A;  4CXX A;  4KUM B;  3UUX B;  2X9X A;  4JW1 A;  4N78 D;  4FHJ A;  2Y8D A;  3GYZ A;  4F6R C;  2X51 A;  3ZMU B;  1PY1 A;  2X6F A;  3AA0 B;  3R7Q A;  3NZS A;  2A2F X;  4V1A v;  2LHN A;  3ZCJ A;  2CXF A;  2X67 A;  3FH7 A;  3GZ1 A;  3APC A;  5FNV E;  4I9E A;  5ANL A;  4N3B A;  3LY8 A;  3ASD A;  2KND A;  5CCL A;  4P0A A;  2P9B A;  4ANU A;  2VKH A;  4PS3 A;  4L0R A;  3AU5 A;  3QC9 A;  5FTP A;  1E8Y A;  5A6C A;  4XIF A;  4ATG A;  4B89 A;  2E9X A;  2IF4 A;  2H7O A;  2MOZ A;  1QZ2 A;  3UPV A;  5HQ8 A;  4N3A A;  3LJC A;  4J0U A;  4J6I A;  5FZQ A;  1Y8M A;  3OYZ A;  3L6A A;  3P2B A;  1MMG A;  2CA5 A;  3KAE A;  2I59 A;  3O1J A;  4TV3 A;  4U0U A;  4GML A;  3PRZ A;  4EBA A;  3ULQ A;  4WWN A;  4PJL A;  4UI9 J;  3PUS A;  2YK0 A;  2LOS A;  2JRK A;  2X6J A;  2E9X B;  4JPS A;  2V7J A;  5JRC A;  2YHE A;  1OUV A;  3GW4 A;  2FO7 A;  3EHM A;  1HX8 A;  2W00 A;  4PH4 B;  5BT1 A;  4L23 A;  1IJ5 A;  4AOF A;  5JDN A;  3MA5 A;  5KJK A;  5BMV E;  4L7T A;  1HG5 A;  3FU3 A;  3O4Z A;  2UWJ G;  4M1P A;  5CMY A;  5J08 A;  2CWO A;  2XRY A;  4CEM A;  5HXC A;  4TV9 E;  1D1A A;  3PUA A;  5KDM C;  2XPY A;  4G63 A;  5LX8 A;  4IYP A;  1MHQ A;  3CST A;  3KBU A;  1SZA A;  2HYZ A;  5LYJ E;  4G11 A;  3APD A;  4J8D A;  2RA1 A;  4IDZ A;  3SHF A;  2XEV A;  2LM9 A;  3MCX A;  2DI4 A;  1H2T C;  4NQ0 A;  2XAF B;  5F3J A;  5FWQ A;  4PJN A;  4PJJ A;  2LAH A;  3MKR A;  1MQS A;  3WXX A;  5GON E;  3FUE A;  5C8Y E;  2CWY A;  2N9D A;  3LY7 A;  3PEU B;  2L9B A;  3O48 A;  4EEC A;  2AWI A;  1CUN A;  4EIW A;  4HOS A;  3C98 B;  3FTZ A;  3N2G E;  3QNK A;  3C4Z A;  3CR3 A;  3OXG A;  1KLX A;  4ZI2 C;  2DWK A;  1E90 A;  3QOU A;  3RO2 A;  5FY1 A;  1XGW A;  2LAI A;  2LSI A;  1HO8 A;  3B7R L;  2X38 A;  3IKO B;  1HE8 A;  4AKH A;  3LVR E;  5CCM A;  4N5C A;  3VTX A;  4BY6 A;  3RPU A;  2V7L A;  3FUI A;  3O4X E;  4IN3 B;  2JMK A;  2KZ7 B;  3R6N A;  2RG8 A;  2QA7 A;  4KXK B;  2CHW A;  4MKT A;  2CFU A;  1Y64 B;  2EHO A;  4JLE A;  3FFL A;  2DLR A;  5LXT E;  4H9O C;  3ZXS A;  3ETU A;  1LRZ A;  4CXY A;  5LNK A;  3FB2 A;  3P7I A;  3ZN0 B;  4TRQ A;  2K5B B;  4QFV A;  4BTB A;  3FTV A;  2ZM2 A;  3PTR B;  4GZ5 A;  5LCY A;  2CG3 A;  5JR9 B;  2XGS A;  2PFV A;  3KDS E;  2D2S A;  3FBZ A;  2VSY A;  4JC8 A;  3EDU A;  4AQF C;  2LT3 A;  4DI4 A;  2OA5 A;  3Q5M A;  5HXS A;  2EHO B;  4NUU A;  1YKH B;  3LY9 A;  1ZEE A;  4IE7 A;  2J9Q A;  1LF8 A;  3OJA A;  4PK4 A;  4HGA A;  5FXV A;  5KCM A;  2KWI B;  2X9H A;  3SRZ A;  3CKC A;  3ZN3 A;  4XI9 A;  2WBL A;  4PFO A;  3K3Q C;  3IHV A;  2XAH B;  1MND A;  4QXC B;  4GIW A;  4UVB B;  3KD7 A;  2GK9 A;  1BR4 A;  1IZN B;  3LBX B;  4HOR A;  2W63 A;  1IAP A;  4I50 E;  4FP7 A;  3SFZ A;  3A5X A;  4WAF A;  3CK9 A;  2BVM A;  4U0Z A;  4DBQ A;  4N2Q A;  3LG7 A;  3DBS A;  3CQC B;  2NC9 A;  5BV0 A;  3V5S A;  2YIN A;  4UXN B;  3APF A;  3QUJ A;  3Q9D A;  3MYV A;  4PUC A;  4K0U A;  3UT4 A;  3MK7 C;  4UV8 B;  3RYH E;  4FUL A;  2J4B A;  3B7S A;  4QKN A;  2V7I A;  3KS2 A;  4BA9 A;  2ZMA A;  1KT1 A;  1TJF A;  4PDX A;  3F31 A;  2Z6E A;  3OBV E;  3OXF A;  1LVK A;  3G2W A;  3KVB A;  2L3L A;  2J09 A;  5A23 A;  3ZMV B;  2BTD A;  3FUF A;  4GOU A;  1S35 A;  5KJM A;  2KCK A;  5FY0 A;  5T8I A;  4GAA A;  3ASH A;  2YQ8 A;  2HPL A;  1N52 A;  4UI9 C;  4A1S A;  2X68 A;  1HXI A;  2V8S E;  5BW8 C;  2E2E A;  4O2A E;  5C1D A;  3P8C D;  2CXL A;  2YHC A;  4I1O B;  3CLJ A;  4EBA G;  3QWP A;  4JEH A;  3AAE B;  4GYR A;  3K8P C;  4U07 A;  1HS6 A;  4E7Z A;  4O6F A;  4UVA B;  4JA9 A;  2WXF A;  2WXH A;  3L22 A;  2R17 C;  1V9D A;  3CPZ A;  4CQI A;  4CCA A;  5ETW A;  2UY1 A;  3HIZ A;  3V5U A;  2E8I A;  2SPC A;  3FWV A;  2L9Q A;  1HF8 A;  1EYH A;  2AW6 A;  3VLD A;  5FXX A;  2IC6 A;  2A72 A;  3VLE A;  3TJP A;  4JEH B;  4C90 A;  2BVL A;  4MLP A;  4DO0 A;  3ENE A;  3ANW A;  4PK5 A;  1SZ9 A;  1FEW A;  2V4L A;  4I1M A;  5JRC B;  4UI9 K;  5LBM A;  3ZW3 A;  3S4U A;  1UX4 A;  3D9J A;  4APO A;  4AY6 A;  3AA6 B;  2LNI A;  4N3C A;  1G8X A;  3N2O A;  3ZLI A;  4JHK A;  3QWV A;  4GA1 A;  4BT9 A;  5J2T E;  3CVW A;  2CMR A;  4A3T A;  1U3D A;  1US7 B;  2L0I A;  2DIW A;  5JHB A;  1U4Q A;  3ANW B;  2Q9Q C;  4TN7 B;  2KT9 A;  2V7K A;  3U66 A;  4OVV A;  4EXT A;  3MA9 A;  4ILG A;  1H6K A;  5LCW C;  4RG6 A;  2L0T B;  4RSY A;  5LJM A;  3KV4 A;  3TXN A;  3ML8 A;  1IHG A;  4WNE A;  2VQ2 A;  4QHO A;  1NA0 A;  3QK6 A;  1TJC A;  5HXE A;  3CK8 A;  4CDR A;  2KLQ A;  5JJT A;  4Z8X A;  2K48 A;  3ZYM A;  5E75 A;  2KAT A;  4EZK A;  3RH3 A;  4AJW A;  3FUM A;  3CGH A;  4IUL A;  2NTY A;  3B57 A;  3ONK A;  5J90 A;  2J07 A;  1KNZ A;  4J8S A;  2B1E A;  5LJN A;  2VJ8 A;  3M65 A;  4CGV A;  3RC3 A;  5HWY A;  3SZ7 A;  3D9N A;  3L3P A;  3ZJ1 A;  4XE0 A;  3C4X A;  4G2A A;  1HTJ F;  2V5F A;  3EDV A;  4C0E A;  3Q15 A;  3CVU A;  3S7B A;  2KMF A;  4UWH A;  2H3R A;  4FHK A;  2OVF A;  3ZHE A;  3N9P A;  5ENN A;  3CVR A;  3ZRH A;  2J1D G;  5JDH A;  2X6H A;  2LSG A;  3ONX A;  4I43 B;  2VKD A;  4TZ4 C;  3D9M A;  2NTX A;  3SOL A;  2IC9 A;  4B0Z A;  2KZT B;  1W3B A;  4AQF A;  2LO6 A;  1WR6 A;  5DQW A;  5LP0 A;  4ERR A;  5LBQ B;  4F7A A;  3J7Y q;  4F3V A;  2WAU A;  2X66 A;  4DLO A;  3AS8 A;  4JVS A;  4UQY A;  2XAQ B;  3PS6 A;  3IF8 B;  4HFG A;  5EKQ D;  5JR9 C;  3KIN B;  5ADX L;  4I43 A;  3R84 B;  4JL0 A;  3MGB A;  5C2Y A;  4AKI A;  3FHN A;  2YEV C;  2RP4 A;  1EZ3 A;  2I1K A;  1H19 A;  2X6K A;  2DBA A;  3SWH A;  2H7V C;  4UWF A;  1BR1 A;  4UWL A;  3LYA A;  3MZL B;  2WQH A;  4K0R A;  3CVP A;  2YU2 A;  3ZEF A;  3NZP A;  1NAF A;  3Q4A B;  4ME2 A;  4XZ4 A;  2KC7 A;  3PZD A;  5CA0 E;  5LGT B;  3DPD A;  2AVP A;  2HH7 A;  3CHR A;  3CVY A;  3SD5 A;  4L5G A;  2XAG B;  4WNF A;  4CI2 B;  4E6H A;  4KZ0 A;  4P09 A;  2QGS A;  2I2O A;  4EQF A;  2JLB A;  1S94 A;  2PM6 A;  4ISS A;  2VAS A;  3E08 A;  3OAW A;  4WNG A;  3EVY A;  1NWM X;  3GA8 A;  1JPL A;  1OWN A;  1Z6T A;  4EAH A;  4DI3 A;  4NUV A;  1D0Z A;  4KBM B;  4G2V A;  4YFS A;  1MNE A;  1B89 A;  5EZY E;  5ARF A;  4B8A A;  3MKD A;  5ANR A;  3C50 A;  4AM9 A;  1OXZ A;  3N9O A;  3ZCI A;  3EIJ A;  3SBT B;  1O3X A;  3IHY A;  3HHM A;  3FUH A;  2VGX B;  3QWW A;  4UWG A;  3TG4 A;  4R7L A;  4Y6W A;  4O4I E;  3CQG B;  3RRU A;  3PEV B;  3TKL B;  2NW7 A;  2BUG A;  1YKE B;  3KVA A;  3FUK A;  5LHI B;  1E96 B;  2ZU6 B;  3DTO A;  3NZQ A;  4GZ6 A;  3ZC0 A;  4ABN A;  3KBT A;  5LOZ A;  2WQ7 A;  4HE8 A;  3S7D A;  4OVU A;  5AIJ A;  3LK4 2;  3OXL A;  3D0T A;  3FUN A;  4FC8 A;  2X3M A;  3BEE A;  1QQE A;  3DJB A;  2IQC A;  1KT0 A;  4HVB A;  3AA1 B;  3Q5X A;  2VKO A;  4LEU A;  3TAX A;  4FJZ A;  1ZBP A;  4I2Z A;  4MAL A;  3SBS A;  2FEZ A;  4H9P C;  3I9Y A;  4V3I A;  4L1B A;  4XKC A;  4IE4 A;  3R9A B;  3WAK A;  5DIZ A;  4J2C A;  4C0M A;  5FYM A;  4AV7 A;  2MBG A;  4PAG A;  4ZS2 A;  5L3B B;  4HKA A;  1VOM A;  2L8K A;  5FMN A;  1PAQ A;  2UY1 B;  1E8Z A;  3MKQ B;  4W9R A;  5CA1 E;  3BG1 B;  2D0U A;  4GMJ A;  4I2W A;  3HYM B;  5BV1 A;  2WXR A;  4K03 A;  4DJA A;  3CX6 B;  4IE5 A;  5JDL A;  5L3E B;  3HVE B;  3JQ0 A;  3W15 B;  5BUZ A;  2XCB A;  4AY5 A;  4WWO A;  2PQN A;  2G0U A;  2P58 C;  4H7X A;  3RU0 A;  2MTQ A;  2W62 A;  2UXN B;  4G24 A;  4IIJ E;  2CFZ A;  4ADZ A;  4ILU A;  3UUM A;  2M67 A;  3RO3 A;  3ZFW A;  2JJ9 A;  4U72 A;  2NXP A;  2C2L A;  5EX0 A;  2C0M A;  5IYZ E;  3L17 A;  3VU7 H;  5DAB A;  4YVQ C;  4F53 A;  2VSO E;  3G2S A;  3Q2M A;  4DVD A;  5FZS A;  3K3O A;  1UCU A;  4XZC A;  3FTX A;  2NP9 A;  4AQG A;  4P29 A;  3UQ3 A;  5H6Q B;  3L13 A;  2Q9Q D;  3KEZ A;  4H63 V;  5T3R A;  4GPK A;  1DVP A;  2MRI A;  2JQQ A;  5KMG P;  1ELK A;  1HU3 A;  4UV9 B;  1UN9 A;  2K24 A;  4KVM A;  2DNX A;  2IW5 B;  3H37 A;  2HPJ A;  1T98 A;  3FTU A;  3UT7 A;  4AXP A;  2LSV A;  4PS8 A;  1HFA A;  4N2S A;  5E0O A;  2XGO A;  3SI5 A;  5LCW J;  3MV3 B;  4BSX A;  4ANW A;  3I4R B;  1U3C A;  3CVL A;  2DCP A;  2CG2 A;  1Z3Y A;  2PL2 A;  1P5Q A;  3DP7 A;  3SGH A;  1IYG A;  4UWK A;  1FMW A;  3U3I A;  3UX4 A;  3CKD A;  3KV6 A;  5L2L A;  3JCK C;  4PS7 A;  4NAC A;  1FVH A;  2WXJ A;  4KT6 B;  4IHJ E;  3L08 A;  4CI3 B;  2WXP A;  3CK7 A;  3PVL A;  2WPV A;  5CB4 E;  2BF0 X;  3FEY A;  3IEG A;  3ZGQ A;  4BX8 A;  3GMI A;  2VB6 A;  4G26 A;  4E7S A;  3O1H A;  1YA0 A;  3RRN B;  2HR2 A;  1N54 A;  2ION A;  2WXQ A;  4ANX A;  3VLF A;  4GK0 E;  1ELR A;  2KZT A;  5JDF A;  5KX5 E;  3D9P A;  4EOZ B;  4TX5 A;  4G1T A;  2EHO C;  4DLQ A;  5HXH A;  4KMO A;  3B7U X;  3IBE A;  4C91 A;  3I1A A;  4AKR B;  2VSX E;  2Q9Q A;  2IJG X;  4APF A;  4FU3 A;  4FI5 A;  2IOS A;  1QUU A;  2I1J A;  2JPF A;  1VDY A;  5L3G B;  1ZV4 X;  4I4T E;  3RRM B;  2KCL A;  4HFV A;  2FF4 A;  2C5I T;  3PUR A;  3HKC E;  4UEL A;  2DHR A;  2HM8 A;  5JHA A;  1E7V A;  2WVI A;  4DBR A;  4YND A;  2VSN A;  4DMW A;  5A1L A;  4GZC A;  2XCC A;  3CX8 B;  4L9I A;  1HG2 A;  3S7J A;  4AKG A;  3UUX A;  3ZMZ B;  1EPU A;  4HS2 A;  1WRD A;  1LKX A;  3PH0 C;  4YHJ A;  4AVX A;  2W0G A;  4QXB B;  2VKJ A;  3D9I A;  2OV8 A;  3FTY A;  5JR9 A;  4UF0 B;  4EB6 E;  3EHN A;  1MMN A;  3OYX A;  1OWP A;  4UVC B;  2J49 A;  4WND A;  3GWH A;  3TG5 A;  4HLE A;  4KMC A;  5E76 A;  2J4D A;  2LSU A;  5D0Q D;  1IJ6 A;  3JC6 C;  2M63 A;  2KIN B;  5J1G A;  5HXR A;  3T5V A;  3ZVV A;  2AXZ A;  2KM4 A;  3I5P A;  4DPR A;  2DCF A;  2VYI A;  3LPZ A;  3LJ3 A;  4GCN A;  3PUQ A;  3CHO A;  4LUN U;  3FXE B;  4QX8 B;  4JZY A;  4RVB A;  5HYA A;  3I3N A;  2WXN A;  4ZHQ E;  3ML9 A;  1QNF A;  2MOW A;  1TEZ A;  5LG4 A;  5KJL A;  4BX9 A;  3B13 A;  2VGX A;  3S7F A;  2WM9 A;  5L3D B;  3SF4 A;  4MFR A;  3PE4 A;  5HWX A;  1SQM A;  3CVQ A;  1UN8 A;  3D3M A;  4N39 A;  2WMO A;  4I6E A;  4H9N C;  3NBX X;  4I6G A;  3NRY A;  1IQU A;  1GW6 A;  4ZOL E;  1UW4 B;  2VTB A;  1BR0 A;  3N9Q A;  1FIO A;  5EK2 A;  3ASF A;  5D0O D;  2XPI A;  3U64 A;  2FI7 A;  5LHH B;  2CE7 A;  1Z0P A;  3JYS A;  5M72 A;  5BNW A;  3PE0 A;  5DBK A;  4GA2 A;  2X9W A;  4GK5 E;  2XGM A;  3P1U A;  3FTW A;  3KV9 A;  3L16 A;  1L5J A;  3JUI A;  2WMN A;  4Q94 A;  1VRB A;  4H9R C;  1HH8 A;  2C0L A;  1U5P A;  3CEQ A;  4CZZ B;  3CHS A;  4EZH A;  3BQI A;  3HR0 A;  4UEM A;  5KJN A;  5JDG A;  2IAK A;  3LCA A;  4G25 A;  5FZR A;  4ASK A;  3ZN1 B;  3RRW A;  3MKQ A;  3KV5 A;  1WAO 1;  3AS4 A;  2PG8 A;  2V0P A;  3Q47 B;  5HI7 A;  3T8M A;  2XTL A;  2X0L B;  2FUL A;  1MIV A;  3AVS A;  4IGU A;  3CKB A;  2CCQ A;  1MIY A;  4KYO B;  4FJO A;  3C98 A;  3HVE A;  3UMV A;  5L3C B;  3IBP A;  4DND A;  4B94 A;  2NSZ A;  3MX3 A;  4ILI A;  3FY4 A;  5J2U E;  4LRZ A;  5G05 J;  4AI6 A;  4O4J E;  2KWH A;  2Y4T A;  1X79 A;  5G2N A;  2Y48 B;  2Y4U A;  5EDS A;  2GGF A;  3ZYQ A;  4OK0 A;  1XNF A;  3L54 A;  3RKV A;  4PW8 A;  4WBO A;  5G05 C;  5JQG E;  4X20 E;  2EHO D;  2NOX A;  5LA6 E;  5F8P A;  4NRH B;  4WUY A;  2WXM A;  3RRC A;  3AAA B;  3RJV A;  2CLY B;  3ZMS B;  4ACL A;  3TL5 A;  3CX7 B;  1MMA A;  1OWL A;  3I0O A;  3G2U A;  5JDM A;  5JDQ A;  4U0S A;  1YD8 G;  4I17 A;  1LVF A;  4O8S A;  3U3W A;  3D9L A;  4AEZ C;  1X5B A;  3MV2 B;  2NWB A;  4X1K E;  1PC2 A;  2W61 A;  2WSS V;  4J8F A;  1E8X A;  3G2T A;  3IEE A;  2OOE A;  2I6H A;  2I9C A;  4I1A A;  2LJL A;  3FU6 A;  3CVN A;  3C64 A;  5LFA A;  5JVD E;  1SA0 E;  3D9K A;  1E8W A;  4RG9 A;  2C0S A;  3S2A A;  1FMV A;  2KCV A;  3VKG A;  4WWP A;  4GU5 A;  4FAD A;  3UTK A;  4BJN A;  2ZM0 A;  3O1I A;  4CI1 B;  2LE8 A;  4GB9 A;  2PM7 A;  3I0Q A;  3HKB E;  2A4Z A;  3B7T A;  3FU5 A;  5FXW A;  4PK6 A;  4EYY R;  2X9Y A;  4H9S E;  3O9X A;  3CV0 A;  2V1D B;  3FEX A;  4AP2 A;  3RKO A;  3ZIM A;  4AIF A;  3U4T A;  2IU1 A;  1EF1 C;  3NZU A;  2FBN A;  5G04 J;  2KXP B;  3FUL A;  3GN5 A;  5ARG A;  4O4H E;  2CEA A;  5AEN A;  2PJQ A;  3FUD A;  4QX7 B;  4IE6 A;  3ASG A;  2XRZ A;  4YJ3 E;  3CWZ B;  2IOL A;  5IHY A;  2VK9 A;  3C51 A;  1D1B A;  2L6J A;  4ILH B;  4CXW A;  4CRW A;  4WBN E;  3FXD B;  1HCI A;  2N2N A;  4H9Q C;  2XUE A;  4JEU A;  2Y3A A;  1JWF A;  2Q9Q B;  3RK6 A;  2LSY A;  1D1C A;  2E9X D;  5EX3 A;  5FQ6 A;  3QC1 A;  2E0I A;  2MHK A;  1JUQ A;  2ES0 A;  2BZB A;  4O4L E;  2LEH A;  3PUG A;  4Y6C A;  3ZHE B;  4HOT A;  4E85 A;  5FY7 A;  4X1Y E;  3H3A A;  3CVX A;  4CT0 A;  4FLB A;  1UG3 A;  2E9X C;  4EYU A;  3L09 A;  1BPO A;  3F57 A;  2CXD A;  5DQV A;  4BWR A;  4HXI A;  4I55 E;  2UXX B;  4P0B A;  5L3F B;  2D5U A;  4O2B E;  3CHQ A;  4HEA A;  1UJK A;  4OHF A;  3TXM A;  3FU0 A;  4ANV A;  1H0A A;  5EK4 A;  3N2K E;  4GYY A;  5FQ8 A;  4G23 A;  1A17 A;  3ZMT B;  3T5X A;  4MS6 A;  3BQK A;  4JHR A;  3FH5 A;  2YNQ A;  1G73 A;  3MJX A;  3J9X 1;  3ZJ2 A;  3UUN A;  2GW1 A;  1NP7 A;  3PUK A;  3NRX A;  2IFU A;  4MBQ A;  4U74 A;  3SS1 A;  3RIB A;  4ACK A;  5AYW D;  4UF0 A;  2X6I A;  2RD0 A;  3I4G A;  5DJQ C;  4XAX B;  3AB3 B;  2LOP A;  3UUL A;  4CDM A;  3CSF A;  3PDN A;  3K9I A;  5JJ6 A;  5FP3 A;  4GYW A;  5M4Y A;  3AAI A;  3N71 A;  3QB2 A;  4PNI A;  4AXH A;  1ZHC A;  2ACX A;  4CGW A;  2JEK A;  2XHE B;  1KK7 A;  4U8H A;  4ZI2 D;  1MMD A;  3PUJ A;  2MYS A;  1DNP A;  2BDE A;  1UJJ A;  4B6X A;  3BK9 A;  1SHZ C;  1H2V C;  1INZ A;  2ODU A;  4GYS A;  3VKH A;  4YVO A;  5JJ7 A;  3FBL A;  2VTB B;  5HAX A;  4LCT A;  3OKQ A;  3BG0 B;  3IV0 A;  5AJD A;  3C4W A;  2VL8 A;  4M3O A;  4UIG A;  3ZC1 A;  3BQL A;  4BFR A;  2WXK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...