3CQCB

Nucleoporin nup107/nup133 interaction complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
225
structure length
186
Chain Sequence
SHMLSWLHEINSQELEKAHATLLGLANMETRYFAKKKTLLGLSKLAALASDFSEDMLQEKIEEMAEQERFLLHQETLPEQLLAEKQLNLSAMPVLTAPQLIGLYICEENRRANEYDFKKALDLLEYIDININDLKLEILCKALQRDNWVSKDSIFVKILLPEVKDLLQADEFVLKANYEYYVQGQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nuclear pore complex protein Nup107
publication title Structural and functional studies of Nup107/Nup133 interaction and its implications for the architecture of the nuclear pore complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 55
structure length 186
sequence length 225
ec nomenclature
pdb deposition date 2008-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1380 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3cqcB01
1.25.40.700 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3cqcB02
3CQCB 3I4RB 3CQGB
chains in the Genus database with same CATH superfamily
4I43B 2XQAA 4M7CA 3PUZF 3EVYA 2MOZA 2WM9A 2XHEA 5ARGA 3M3ZB 5AQVB 3FTVA 2JQ9A 4WNKA 4XI9A 2QA7A 3ONKA 3UPVA 3IXEA 4XKCA 1NA0A 5FP3A 4I1OB 5KMGP 2GROB 2OOEA 4AIFA 3PTRB 2DWZA 2IEJA 4HLEA 1LD8A 4F1PA 2IDOB 4CI3B 3ZW3A 3E37A 3KV5A 3NRXA 2LSGA 2GRMA 5JA4D 5CJ5A 1A17A 4WBNE 3RIFA 3AU4A 4A63B 2B76A 3GZSA 4EAHA 2WBLA 3ZYKA 3UUNA 4IE7A 4U0ZA 3U4TA 4JI3T 4U07A 3V31A 4DUIA 3MKQB 4ZI7E 4FULA 1SE7A 1HNWT 4DX6D 3CWZB 4BSXA 1WRDA 3ONLC 1EZ3A 3X1DA 1WM5A 2DHRA 4PNIA 2VGXA 2FJBA 4FLHA 5G05C 2XRZA 2XZDG 5JDFA 5AJLA 2V7KA 4MS6A 4UVAB 2WXPA 3MZKB 3DSSA 5CA0E 3UUXA 3PV0F 2MRIA 3BU8A 2XUEA 3RRWA 1KFYA 5CRVA 2A72A 2P9BA 4TZ4C 4U95D 4U74A 1VDYA 2A4ZA 3QOUA 5JDLA 3ML9A 3ZLIA 2NSZA 5H7PA 4IDNA 3N2GE 1I6ZA 4UELA 3J9X1 4EV6A 2XQ3A 2L6JA 5FWQA 2YDQA 3MEKA 3UMVA 1US7B 1KT0A 2EHOD 4LFCT 4CDRA 4WUYA 3PZDA 4A56A 4ANXA 3PUQA 3T8KA 2NW8A 2B1EA 4YHJA 4IE5A 4GPMA 4BTAA 5LJNA 2K48A 3ETUA 5FZSA 1JUQA 2ES0A 2I2OA 4HLLA 5L3FB 3UUBA 2WXQA 5EILA 5GONE 4FJOA 2XGSA 1HS6A 1FT1A 1KEYA 5L4HA 2J49A 2H6FA 1B7TA 2V5FA 2WMOA 1XMQT 3AAIA 2WXJA 3QC1A 4DMWA 3P7IA 3CKCA 2KZTA 3KV6A 5FT9A 3WAJA 4CEMA 2X0HA 2Z6EA 3UKRG 3CPZA 4NXMT 3D9PA 4A1SA 5AQJB 2KLQA 4BSZB 3C4WA 3C4XA 5C1DA 5JDNA 4GZ5A 4MBQA 5FNVE 1HR0T 2GRQB 3R7RA 5HEHA 3RLFF 4I50E 2I9CA 3UQ7A 4LMJA 4Y6CA 5ITZF 3Q5XA 2OVFA 5CERB 3S7FA 2PFVA 5CFBA 5CMYA 4ZZCA 4YFSA 5D0OD 4C0EA 3EDVA 3OYXA 3UULA 2DCPA 3CSFA 1Z8UA 4IIJE 3EIQC 3DSWA 1E8WA 1FEWA 2F4VT 3SFXA 1R8IA 3TXNA 4J8SA 5ENNA 2C5IT 3SFZA 2CMRA 1IHBA 1FPPA 1WY6A 4ZI3C 3RRCA 1FJGT 3RX6A 3CMLA 3K3QC 1EYHA 1YW0A 5HRYA 4QX7B 4JI4T 2ETCA 1MNEA 2BVLA 4PH4B 4PK5A 3KEAA 1VCTA 2XSAA 2L8KA 1LD7A 3SZ7A 1DC2A 5H6QB 3RHWA 4DR2T 3RYCE 5HXEA 2XQ8A 4ATGA 1TJFA 1L0VA 4YT0A 5EKQD 2WB2A 2KXPC 2P9LG 3ZNGA 2VQ2A 1XNRT 4KT6B 4NIKA 3G2VA 4TXQA 2DVWA 2VASA 3FZKB 4XAXB 5J0ZA 1PAQA 3SOLA 2B6CA 2BBJA 3AVSA 1QNFA 2E0IA 3UT8A 4CT4A 2W4XA 4DV4T 3I9YA 1V55E 3CHMA 4HI8A 4BJMA 1OWOA 3AG4E 4U8HA 2L9BA 4HWIB 3RC8A 1V54E 4COFA 1RW2A 5AENA 5AJDA 5B1AE 2WXMA 4ILHB 1OCCE 4CGVA 4PK6A 3CEQA 4AQGA 3LEWA 4K03A 2AJAA 3LBXB 4KXKB 4LRZA 2D0TA 1IAPA 3CIRA 1MNDA 3ABME 3RAUA 4YDYA 4QKNA 3PZ2A 2VTBB 4BA9A 1YXRA 2PJQA 2IC9A 4R7LA 4CT0A 1N0QA 4X1IE 3D9IA 1N11A 2P9KG 3WG7E 2UY1A 4W9RA 4MHCA 2E9XD 3DTOA 2IC6A 2ZISA 5F5WA 3N9QA 4DLOA 5FKYA 4EZLA 4ZI2C 3NRYA 5FQ4A 4P1NA 3TAXA 3ESKA 5J90A 3TLUA 5AQSB 2ZGDA 1KZOA 5CBOA 3AA1B 3L82A 3T9KA 2LLYA 4ACLA 1H7CA 4KVMA 4X65T 2FO1E 4N3CA 5AYWD 4C91A 1O5MA 4GMLA 4IHJE 3ZFWA 4QX8B 3ZN1B 2EIJE 4D10C 2PBIA 4HFCA 3ZMTB 4J8FA 4J0UA 1GW6A 4JEHB 2HO1A 2W0GA 3L3PA 2XAGB 4K0KT 5L4EA 4K5BA 3EJNA 4P0AA 3E34A 2W00A 5AQPB 3KAEA 3T8MA 2WB5A 3HA4A 3N9OA 4I9CA 4GTQA 1TN7A 1ZHCA 4A98A 3CIAA 2PNNA 2VYIA 3C4ZA 3RIUC 3R9MA 5E76A 3NZQA 1SW6A 2XAFB 2WXOA 3FXEB 2FF4A 2L0IA 1UJJA 3SHFA 4IDQA 5CHEE 3E33A 3T5VA 1UG3A 2BKOA 2MYSA 5ABFB 1H6PA 3DEPA 4PJJA 4IGUA 1H0AA 4AJWA 1NI1A 3AAEB 3U3WA 4LUNU 3MX3A 3R84B 5C8YE 4DNDA 4EZHA 2J4DA 4KHPT 4G23A 2EHOB 2LKHA 1YQ4A 4DLQA 3AXJB 1HX1B 4V1Av 4N5CA 3ASFA 3SY2A 1QUUA 2E2AA 3VU7H 3ZMVB 5HCJA 5HQ8A 3RO2A 3PDNA 2VL8A 3Q15A 4XI0A 2VJ8A 4B6XA 5HXHA 2VQET 4OFZA 4IREA 5JDHA 3V2XA 3V5UA 2JABA 4AKLA 4XX5A 2NXPA 5LHIB 3Q4AB 1SHZC 1JPLA 4BT8A 2DCFA 3CVLA 2BZBA 4JV5T 4HWCA 4GTOA 5CMWA 1EPUA 4MBGA 1E8ZA 5AQUB 2XS8A 1YMPA 4DO0A 3JCKC 2QC9A 3JUEA 3FUJA 4YDEA 3NWIA 5JDMA 4O2BE 4BERA 3ZKRA 2BG9A 2Y4UA 3QJZA 2YDRA 4GA1A 3ZPOA 4LNUD 4F1SA 4HFIA 3FUKA 3NZSA 5G55A 3H37A 1HG5A 3BQKA 3X2QE 4JI5T 3UIOC 4ZHBA 5LMUT 5LXTE 5FVKA 2X6JA 4UF0B 5HEJA 4JA7A 4LNBA 2WS3A 3JXIA 2CRBA 4U8YD 5C2TA 5EK3A 3ZYQA 3EABA 5JJ7A 4P0BA 3LDQB 5IUXA 2F8YA 2W61A 2V4HC 3SBSA 4AM9A 5D2MC 4G2VA 3ISMC 4QFVA 2LM9A 2V7LA 4KZCA 3UM1A 3G2WA 4GTTA 1P5QA 1MMAA 2J4BA 2VKDA 2V5CA 4WBOA 4J2CA 4KBQA 3IF8B 4MLKA 4ZZBA 4HQDA 2Y3AA 3MA9A 3LJNA 4HB5A 3FHEA 3J5QB 1KNRA 3ZC1A 4UI9J 1J5ET 4GTMA 2V7JA 4HORA 1ELRA 2FBWA 1HNZT 5T8IA 2NW9A 3UINC 2MAWA 1N4PA 1WYBA 1OUVA 1OEDA 4B8AA 4FC8A 2XENA 2MPKA 4JI1T 4N2QA 1LKXA 4DR5T 2LKGA 5C3JA 5J2TE 2JRKA 2CFZA 2X9XA 5ANRA 3DBSA 2CLYC 4N5QA 4HN9A 3WI3A 4U7IA 1QQEA 3PU8A 2P9NG 4DMVA 4YLHA 4ANVA 5A7DB 1N4SA 5CEDB 3RKVA 4JD2G 4F6RC 4LEUA 3QB5K 3FEYA 1HE8A 2GGFA 1Y6IA 3S7DA 3ZT5A 1M62A 4CZ2D 3E30A 2NP9A 3FUMA 4UIGA 4ILCA 3FZHB 3HXEA 1XDOA 5ETWA 2CE7A 3UT4A 3V30A 2ODVA 4QXHB 1T98A 5EIBE 1O3XA 2J4GA 5AQ7A 2V6YB 1XWMA 4JW1A 3VHLA 1H6KA 4E85A 2OV9A 4UI9C 2BF0X 5FZQA 4ACKA 3QK6A 5IY5E 4GYYA 3CKBA 1KLXA 2KCVA 3I4GA 1N54A 2UXNB 5FJYA 4KX6A 1BPOA 2BS3A 3CVRA 2LAHA 3C3QA 4DPRA 3Q5MA 1E2AA 3P4WA 4KP3C 1PC2A 3D9NA 5AQNB 3L17A 5BW8C 4WYVA 1HNXT 1FMWA 1ZP0A 4TRQA 3JC6C 2VL0A 3Q75A 2WPVA 1YKHB 2YNQA 1LRZA 3FH7A 4CXYA 3AEDA 1JCQA 3N2KE 3O1JA 5LHHB 1BI7B 2Q9QA 1TNOA 3W9FA 5LP0A 5A1LA 3ZEFB 3LG7A 4IT4A 2VVNA 3PREA 5CBNA 2ONDA 1OWNA 4X20E 5KCMA 4AQFA 4GA2A 5M4YA 2VURA 2R2LA 3ABKE 4TNWA 4G26A 3B5MA 4F8HA 2CG2A 2EIME 3KBTA 2NWBA 4L2YA 2FJEA 5KJNA 1Y8MA 1TR4A 3JYSA 1IKND 3KINB 2LJLA 4ZEYA 2A5EA 1HCIA 3ABVA 2P9IG 2XY8B 2DWKA 4GZDA 4PUCA 4LERA 4Q96A 2VK9A 4N3BA 3VTXA 5FY1A 3HVEB 3FH5A 3PRZA 1D1BA 1E1HB 4IE4A 4HRLA 2L3LA 1NFIE 4EHMA 4WWNA 5LG4A 2V8SE 2VB6A 1W9RA 3AAAC 1W09A 4NACA 2X6IA 3UIPC 2EINE 2HM8A 3L09A 3N71A 4GCOA 3FBZA 3K8PC 2NTXA 1VCSA 4ILUA 1TYQG 4WNGA 2XS1A 4LG6A 5BUZA 2AE9A 4I2ZA 3ZMZB 1ZV4X 2AXVA 3KBUA 4U63A 2CHXA 2KBXA 3ZSTA 3FULA 1YYHA 4J6IA 4JLEA 2DL1A 4HKAA 2P9PG 1EF1C 4NIQA 4Z68A 3HKDE 3H3MA 5KJLA 2QYUA 4JI0T 4OAVB 2X9HA 3P4RA 3JXJA 4JBWF 4GK5E 4X64T 4EECA 3GA8A 4G2AA 1NENA 3ZXPA 4AP2A 4QH4A 5HYAA 2KT9A 2XQ5A 4IL4A 2XQ9A 5FQ8A 4WZXA 3DEOA 2LOSA 3RYHE 5L47A 2HPJA 4A55A 4YXDA 3Q7FA 3HDXA 3ZPJA 2J9QA 4CXXA 4JI6T 1MX4A 2CXDA 1LVKA 4DJAA 1IQRA 1WLXA 3UXGA 3CX7B 5FXVA 4FJYA 2WCAA 4H9NC 2V4LA 4B93B 3ZJ1A 4O2AE 1H6OA 3ANWB 2WMNA 3TL5A 4ILIA 2J08A 3HXBA 5IWAT 3FU0A 3LK42 4OYJA 3QB2A 4QXCB 3QARA 2LXMA 3PVLA 1W0AA 2XPZA 4HWHA 4WNFA 1NA3A 2JMKA 5EK4A 3RRUA 4LNGA 4RVBA 4JVSA 2NOXA 4UVBB 5L3DB 2WSSV 3A8YC 2K5BB 3AG1E 4ZHQE 4AI6A 4U7EB 3AEFA 4DUZT 3PE4A 3IHRA 3OPCA 3EU9A 5CEAA 3R7QA 4ADZA 4OX9T 4ZOLE 3N9NA 3CVUA 1INZA 1ZU2A 3C64A 4KMOA 3ZMSB 2DLRA 3OBVE 1D0YA 5ADXL 1JCRA 1LF8A 4DRXE 4UR9A 1V9DA 2IOLA 3KSLA 3ULYA 3J5PA 4Z91A 5L2LA 2H89A 3SI5A 2UXCT 3H3AA 3PUYF 2OV8A 3AJIA 1UUSA 2QRXA 2UXDT 1Z0PA 4IDZA 1HS7A 4GTRA 3O1IA 3ZRHA 4YHHT 3FFLA 5FZRA 3NVOA 4LF5T 2XZTG 5EN5D 4CCAA 1DU2A 2WDVA 1MMDA 3FDHA 1JCSA 3L9TA 2QFCA 2LOPA 4UQZA 3AU5A 3BG0B 1YKEB 5BT1A 4AIUA 1SZ9A 2X68A 4X66T 3GZ1A 2WU2A 2XAQB 4AQYT 1KNPA 1YA0A 1MJ0A 2PM6A 3RH3A 4EEDA 1ELKA 3CK7A 4EIWA 4YSZA 5AQQB 3AE9A 4A3VA 1AWCB 3ETVA 1UN8A 3PUKA 1WR0A 2X67A 2L9QA 2XQ7A 1XMOT 3EHQA 3JAFA 3B7RL 4GYWA 4UXNB 5LGNB 4UWGA 1MIWA 4BAYB 4KUMB 3ASGA 4FU3A 3ZN3A 1XZYA 1G73A 4TV9E 3ZVVA 4CZZB 5HEGA 1XGWA 4ABNA 4AOFA 3LFMA 4HTEA 4I0UA 1EDUA 5BR8T 4DV2T 3AB3B 2VWAA 2XQ4A 3HXDA 2H88A 4B89A 2XEHA 5ENPD 3ULQA 3IEGA 2CG3A 3LVRE 3KFWX 2CLYB 1N4RA 5C2YA 3QB5A 3KDSE 3FZLB 3ZT6A 2XTLA 5FMNA 2RA1A 3TWQA 4ERRA 3O4XE 4HNAD 3DWLG 2RFMA 4UUCA 2BBHA 4CI1B 2JJ9A 2PL2A 4L9PA 2XQ6A 4ISSA 4B3MT 4JEHA 2YU1A 3UT5E 1OXJA 4Q25A 4GB9A 2BG9C 5AQIB 1E7VA 4M3OA 4P29A 2CXFA 1N34T 3GW4A 2I59A 1XDPA 2XCBA 5BPPA 5G2NA 1E96B 3JAEA 3E4BA 3I1AA 4KVOA 2VGXB 1KF6A 4BJNA 3GMIA 4WNDA 3G2TA 2PTFA 1SZAA 3ZYLA 4I6EA 3NKZA 3UUXB 2D9DA 2X66A 2OEWA 1HO8A 2IF4A 3TWTA 4X1YE 2LSUA 4I6GA 3SF4A 4JI2T 1WR6A 5JRCB 1SA0E 2EHOA 4GOUA 4U33A 5EK2A 3AXJA 5LOVE 4AKRB 4BETA 2ODUA 3P4PA 3ZUVB 3FTZA 4GK0E 2X0LB 1E8YA 1U3CA 4CXWA 1NP7A 2GW1A 4A3TA 3LJ3A 4DX2A 3FTYA 3IHVA 3PJAA 4KYOB 3NF1A 4GMRA 3AA6B 2XM2A 3CV0A 5JHBA 4WW0A 4Z8XA 4AY5A 1OEDC 2J09A 2Y1LE 4K0UA 3S2AA 3V2OA 3JQ1A 2F37A 3MJXA 3B7BA 1Z5SC 4IDOA 1NZNA 3F57A 1HH8A 4UQYA 5L3BB 1WG0A 2CHZA 2IOSA 3PS6A 3TWRA 2BKNA 5HXRA 5AIJA 4K5CA 4MRUA 1FIOA 5D0QD 5B3SE 2ZM8A 3Q7AA 4BESA 2FBNA 4JUYA 3VLDA 4CN6A 4CDMA 2Y69E 4JEUA 3LY7A 4CN1A 2EQXA 5ANLA 4ZI3D 4U2YA 3CVXA 2M6BA 2WP9A 4TUUA 5HWYA 3Q73A 2D5UA 4HOSA 1MIYA 2JLBA 1OEDE 4X1KE 3PURA 3TLVA 5JDQA 3AAAB 3D0TA 4BT9A 4AKHA 4O4JE 3NB2A 4A5XA 5HWXA 4YNDA 5AQTB 3RPUA 3I0OA 2V7IA 3WXXA 2DBAA 3LSVA 5LHGB 3E0ZA 4EYUA 3FY4A 4XBFB 1MHQA 1U4QA 4UV9B 2E5VA 4DR7T 3FZMB 4IDPA 3WAKA 2WXGA 3DSUA 3PZ1A 5BXOA 2R17C 3I9WA 3CVWA 2XPIA 4HOQA 2X6HA 4BX8A 3HG0D 5JDGA 3R6NA 2KMFA 3OXLA 5DBKA 1U2VG 3Q78A 2YINA 4G11A 3AE8A 2JEKA 1FMVA 4N78D 4C90A 3CVYA 1SQMA 1ZB1A 1X79A 3APCA 3CHRA 2JMHA 3BK9A 3FTXA 4HOTA 4ATZD 1D0ZA 4MALA 1LVFA 5DQWA 2XQ0A 3W15B 3K9IA 2XQYA 2XAJB 4TX5A 5F3JA 1H2VC 2IONA 3ZXSA 4H9RC 3Q9NC 4GPKA 2WAUA 3L13A 3VRBA 1HU3A 4J8YA 3L16A 3N9PA 1NWMX 2Q9QC 3Q5EA 5FL1A 1B89A 1S35A 3E22E 4RSYA 1HZ4A 3Q9DA 4ILBA 4GKJT 3UI2A 2E5LT 3QWPA 3SFYA 4EB6E 1WAO1 3AE7A 2K3WA 3RYIE 4AQFC 1Q2ZA 2OVBA 2ACZA 3B13A 4HRNA 2W2UA 1D8EA 2LRKA 3LVQE 2RG8A 5AQGB 5JMND 4CQIA 3ZYMA 2RFAA 4ZI2D 3VKHA 3RK6A 5LGTB 3AA7B 3LDZA 4YVQC 3FEXA 3Q49B 4AY6A 5CCMA 2WZHA 4JI8T 4CRWA 3AE4A 3URZA 4H9SE 3ZU7B 5BV1A 4KMCA 3QNKA 2CWYA 5FQ6A 3DSTA 3PNTB 2M67A 4O6FA 3FUEA 1FCHA 2LSJA 2E9XA 3CQXC 4G8LA 3B7SA 1HG2A 5HAXA 2HH7A 4OYKA 1HXIA 2WQHA 2ZM6T 3EDUA 2IW5B 2KWHA 3PUXF 5D66A 1BR4A 3QWVA 1PY1A 5AQFB 4KZ0A 4L2LA 3AE2A 3LK2B 4APFA 5ENTD 5FL0A 3F2EA 2X0YA 4AISA 4UI9K 1OWAA 5FXZA 3QAQA 3T8OA 4UWFA 5CCLA 4HGAA 2KWIB 4AKIA 3C98A 5KXJA 2VKOA 3B57A 2ZM2A 3HKCE 3PUWF 4LFAT 3TXMA 3BG1B 2XGOA 4DBQA 2QGSA 3ONXA 4BY6A 1GQEA 4FHJA 2VSYA 1X9BA 4E6HA 1UCUA 4O4IE 2VKJA 3OKQA 1ZKEA 4OHFA 1MX6A 4J7WA 4MKTA 4U96D 4FA6A 5JHAA 4P09A 2OEVA 3EU5A 5JH7E 4RLYA 3TWSA 1QSDA 1W3BA 1DCEA 3ZEFA 4I2WA 2W63A 1XNQT 2AWIA 3GWHA 5KWDA 3UFGA 2LHRA 2GRLA 4IL9A 4H9PC 2JPFA 1OWPA 2BKKB 4J8EA 5AQAA 3KV9A 1UX4A 2AXDS 3NQPA 3LXUX 1T72A 3ML8A 3ZIMA 4TV8E 2HPLA 2ZXWE 4EYYR 4HFEA 2KM4A 1N33T 2IY0C 1QZ2A 5LCYA 3OAWA 3C51A 3GN5A 2B0OE 3UU4A 4NXNT 3A5XA 3CR3A 2P9UG 4NPPA 3IV0A 3MV3B 2EILE 3FBLA 2ZIRA 5ABHA 2KATA 1BI8B 2YQ8A 4ZS2A 5L3GB 4EEBA 2PQNA 2W66A 3TGOA 3OXFA 3AEEA 3D9LA 4B3RT 1JNZA 1TNUA 4C0MA 5J2UE 3UQ3A 3T1HT 3PNLB 4Q94A 1OWMA 1YCSB 2PG8A 4YVOA 5M72A 5LBQB 4FADA 3L6AA 4DX5D 4XZCA 1WCRA 3HXFA 2LM2A 1HF8A 4H7XA 2QVAA 3ASNE 5FQ7A 2BDEA 3CVVA 3AA0B 3VR8A 2YHEA 5KNGA 1FVFA 1OCZE 3OYZA 3KS2A 2IQCA 4PAGA 3EHMA 2DWGA 2KSRA 3FU6A 2A3DA 2MHKA 3UX4A 3RO3A 3CQGB 2I0MA 5LG3A 3I4RB 3DJBA 3I0QA 3ZJ2A 1K1AA 2VVSA 4X8QA 4RG6A 2IHR1 1KK7A 3OJAA 1JNRA 4DI4A 2KXPB 4K5AB 3MXZA 5JR9A 4FP7A 2Q7FA 5CA1E 2DNXA 5E75A 5CECB 4CGWA 1UX5A 2EIKE 2FJDA 2LAIA 1H2TC 2P2CP 4I43A 3SQVA 2WXHA 1IJ6A 4CDNA 5A6CA 4RG9A 4BWRA 4U7YA 2R59A 4GTPA 4B94A 3AEGA 3GYZA 4JPSA 1BD8A 1D8DA 3SNXA 4JA9A 2V7MA 5DJQC 1O1SA 5JJTA 3TG5A 3K3OA 1DCQA 3UQ4A 3CHSA 1E7PA 4XZ4A 5CGMA 4ME2A 2V1DB 3PZ3A 3HRAA 2A5UA 5AQHB 2V26A 3KVBA 4DV6T 2ZMAA 1QBQA 2R02A 2WXIA 4PFOA 2SPCA 2H7OA 2HN1A 3EAMA 3IEEA 2FUPA 5J1GA 2Y8DA 3Q9UC 2M63A 4F6RD 4M1PA 3UU6A 2V0PA 2F0YA 5AQOB 4OVVA 4I4TE 3HYMB 5HI7A 3MKQA 1OEDB 2C5KT 1Y01A 2RP4A 2HYZA 3DXMG 4HFGA 1MQSA 4PS8A 5LP6E 4L7TA 3MKRA 3EHNA 1O1RA 1TNYA 5KNHD 2N2NA 2Y6XA 4TWHA 3RJVA 5LX8A 3RQUA 1N52A 5IHYA 2BUGA 3OTNA 4EPZA 2IAKA 3G2SA 2FEZA 2WXNA 2R6GF 4GKKT 3FUFA 1QLBA 3U66A 3N2OA 4FHKA 2LEHA 3QNUA 2HE0A 2WU5A 3PJAJ 5HXCA 3D3MA 5FIOA 3L08A 3G2UA 2GRPB 3SFDA 3QUJA 3L8RA 4TUMA 2DYSE 2BEDA 3ASDA 3FTWA 3UFEA 2LSIA 5ENOD 3SO8A 2CA5A 2DI4A 2V8SV 2UXBT 4NRHB 1Z3XA 2WWVA 4GZ3A 3JC6D 4WWPA 5ARFA 4UVCB 4DX1A 4GYRA 3G06A 5H6RB 1FT2A 1H19A 4OAUC 3A7MA 3GZ2A 3EHZA 5J08A 3CKDA 5LGUB 3MKDA 5HKPA 2BS4A 5FYMA 1ZOYA 2BS2A 3NBXX 4YSXA 5KDMC 2V6XA 4DX7D 3PH0C 1SVXA 3K1SA 3MACA 1D0XA 4QH1A 4HWFA 2EHOC 3ZHEB 1K3ZD 1K1BA 5DIZA 2RKKA 3L54A 3PE3A 4HWDA 1UK5A 4PDXA 1JWFA 3JUIA 4Y6WA 2MTQA 4GYSA 5AQMB 4YJ3E 1L5JA 3M65A 2YOEA 4XKBA 4G24A 4EZJA 2R03A 5BV0A 2P9SG 3KEZA 2DZOA 3CK6A 3CSTA 3D9OA 3LKUA 2W67A 3APDA 2WXRA 2KNDA 4CN4A 5G04J 2KINB 4XIFA 2CHNA 4PJNA 4UWKA 2A9UA 5L3CB 1JWGA 2VSXE 3TWVA 2IMLA 4JHRA 3EUVA 4DV5T 4X62T 2JQKA 3VTYA 2HR2A 3ZSSA 4LFBT 4TWDA 2H3RA 3PUJA 2WQ7A 2UUCT 3V79K 3ESLA 3C3RA 3FXDB 2J1DG 2M6IA 5BXUA 3R9AB 2X38A 4EXTA 2IFUA 1BR2A 3EI0A 2Y48B 5EZYE 2ZLYA 1DVPA 4GCNA 2QYWA 3AE6A 4NUVA 4FJZA 5AAOA 3UU3A 4G8KA 2XAHB 4FI5A 3BQIA 3LY8A 3AEBA 4DI3A 3J7Yq 3D9KA 4U3CA 2JQQA 3S7JA 3ABLE 3RKGA 1CUNA 4DR4T 5KJMA 4EBAA 4O4HE 3N5LA 3UUMA 4GZCA 2ACXA 5JRCA 5G04C 3C3OA 4O1OA 5FTPA 5AQLB 5TAOA 4CI2B 1NL4A 3MYVA 5AARA 4G63A 2ZU6B 4DV3T 1W0BA 1UJKA 4GIWA 5DQVA 1VRBA 2GK9A 2P58C 3LBXA 4IE6A 2WQYA 4K0RA 2GRRB 2RPAA 2F8XK 5T4YA 1TNBA 4LCTA 2VTBA 2GRNB 3I5PA 3NZPA 5CRUA 1N0RA 4B8CB 2VSOE 3BEEA 3ZMUB 3HR0A 4QH5A 1AJ3A 3F6QA 3BQLA 3UM2A 2AXZA 2WXKA 3IHYA 4JHJA 2LRLA 4TN7B 4F3VA 4HI9A 2X9YA 3LS8A 4U04A 2XHEB 2WWUA 2J62A 1KNZA 4CYMD 2KZ7B 3O1HA 1OCRE 2XPYA 2AW6A 1SA5A 3F31A 1RZ4A 3CHOA 4E7SA 3VRAA 2VSNA 4I55E 5EX0A 2WY2A 3P50A 4O8SA 4TUYE 4H9QC 3T1YT 3DSVA 2JIWA 4HXIA 4NQ0A 3RC3A 3U3IA 3EIJA 2KC7A 3SFEA 2K9AA 4LMLA 1U5PA 3ASOE 2WDRA 1MX2A 4N3AA 3P8CD 5ENSD 3IBEA 2RD0A 3RRNB 3LJCA 1ZEEA 2E9XC 3PUVF 4Z90A 1TEZA 2XGMA 5FXWA 2YK0A 4YSYA 2WDQA 3PU3A 4JYAT 3FP3A 4H63V 2E8IA 5EX3A 4GZ6A 3D9MA 3RGLA 2MYOA 3FH8A 3LY9A 1HFAA 2WQ6A 4LSZE 4ISTA 1IHGA 1KPSB 3CVNA 2R05A 2JQHA 2W62A 3RU0A 2XEVA 3OXGA 2IO2C 5ABFA 1IBMT 3FUNA 3EDTB 3C5RA 3DP7A 3CQCB 3K3NA 3IBPA 3SRZA 3U78A 3P2BA 5FVLA 2WVIA 5B1BE 2BG9E 5AQRB 4F53A 4GMJA 4IYPA 1J1JA 2C0MA 2BKGA 1OT8A 5BNWA 4HFBA 1I94T 4EZKA 3Q2MA 2AVPA 4DIDB 3JQ0A 3O9XA 4ZXLA 1BLXB 4WAFA 3UM3A 3AE3A 4DR6T 3T5XA 4QXBB 4QWNB 3AS5A 5FXXA 5FY7A 1IBKT 1M7KA 1ZBPA 2LSYA 1U3DA 2CBJA 3B7UX 4N2SA 4BEPA 3FTUA 2X6FA 4HE8A 1KZPA 1D1AA 3RF1A 1X5BA 2MBGA 2YDSA 4EQFA 2X9WA 4DVDA 5IYZE 3FTSA 3CGHA 2FULA 2KZTB 3UTMA 1MZCA 3ULEG 3AS4A 3U64A 2XZEA 1J5WA 4AKGA 2D2SA 4XEIG 1FVHA 3RKOA 5LJMA 1IXVA 4I17A 1ELWA 3AEAA 3LK3B 1IJ5A 2FO7A 4JZYA 3AE5A 2ETBA 5ENRD 5FY0A 5JQGE 4BTBA 4RQIA 4NUUA 2XPKA 3FUHA 4WWOA 3VLFA 5T3RA 3ONLA 1UURA 3ZT7A 3N9LA 4UF0A 3NZUA 3CK9A 3QDNA 4U0SA 4V3IA 3DSXA 2J47A 4L1BA 3TWWA 3ZN0B 4HVBA 1XNFA 1IBLT 1T8BA 1E90A 3C72A 1Y64B 3PEUB 2IIUA 2IJGX 1QYMA 2L0TB 3TLSA 4G1TA 4X5TA 3L39A 1OY3D 3FHNA 3TG4A 1G8XA 4EBAG 4PFPA 1DNPA 3TWUA 3P4QA 4HFHA 2LT3A 3DXKG 5LB7B 4GU5A 5F8PA 4DBRA 5AQBA 4XE0A 4JC8A 3FZFB 3FU5A 3MA5A 3PE0A 3Q47B 3UU8A 5JR9C 3OVUA 4Q69A 3DPYA 2NC9A 1WDYA 5FINA 3VKGA 4DK5A 4C9BB 4TXRA 4KI0F 1TN8A 4JXTA 4B3TT 4ZS3A 2PZIA 2LSVA 2CPTA 3CHPA 4HFDA 2NR4A 3LYAA 3AECA 2DYRE 3MV2B 3SBTB 3LCAA 1UOHA 2PQRA 4HBDA 2AXUA 3PZ4A 4YY3T 2QY7A 4TV3A 3AE1A 3HI2A 3KV4A 1BR0A 4TWFA 4LF6T 1S70B 4I1MA 4ASKA 2V5QC 1N95A 1N94A 1S0PA 1Z3YA 4HEAA 2XEEA 1E8XA 3FUDA 4DR1T 4L5GA 3RRMB 4H9OC 1N4QA 2V5DA 3EUHA 4I6JA 4A97A 1G3NB 2H7VC 4YDOA 1S64A 4AVXA 1OCOE 3P1UA 1O1TA 2Y4TA 3O4ZA 2UY1B 3UU5A 4JB8P 2V6YA 5L3EB 3CVQA 3FUIA 3ZGQA 5JJ6A 1TN6A 3CX6B 1T7SA 3EHRA 3TJPA 3AG2E 5LNKA 1A5EA 4EOZB 4UEMA 1MMGA 2BKPA 3RQWA 2CBIA 3B7TA 5AQKB 4AV7A 4U72A 2L6BA 4ILAA 4JEUB 5AN8A 2NYJA 4YTMA 4DV7T 2VKHA 2LHNA 3JADA 3BUAA 2UU9T 2XJ7A 1NAFA 1H2UA 2LUHA 3JCFA 4I1AA 2MOWA 4QHOA 3ZC0A 2CCQA 2CHWA 3U9WA 3HHMA 2Y0BG 2C0SA 4OVUA 3TLWA 2YKSA 4ZFHA 4LF4T 5HCMA 1S94A 3TWXA 3W9GA 1OXZA 2NTYA 3C50A 2WZIA 1SA4A 2Q9QD 4B0ZA 4WNEA 4JI7T 4KBMB 3D9HA 1MMNA 2ILRA 4GTSA 3ONJA 4UWLA 4GTVA 4A1GA 4EGWA 4URKA 3CLJA 3I3NA 5ENQD 2WXFA 2YEVC 4O4LE 3CK8A 3MZLB 1AP7A 3HIZA 3CVPA 3TKLB 5EYPF 2A2FX 1WFDA 2CWOA 4GYOA 3HVEA 5HEUA 1LTXA 3AG3E 3RSEG 2IUBA 1S63A 3NAWA 2H6IA 4HFVA 4LF8T 4ILGA 5JTGA 5HEOA 2C2LA 5LOZA 2G0UA 2QZAA 1NEKA 4TNVA 2OA5A 1KT1A 4APOA 2ZGGA 3ASHA 2OCCE 3MK7C 4AEZC 5LCWJ 4MLPA 4IN3B 3Q5WA 3E32A 4NURA 4PW8A 1Z6TA 4E7ZA 3DPDA 4BFRA 3ENEA 4PS3A 3QOFA 2CEAA 1E7UA 5DABA 5KX5E 4HOUA 4JL0A 3NOCD 1OWLA 4DUYT 4UQXA 2HHHT 5JVDE 5JREA 1N36T 2J8SD 5A23A 3SS1A 4OYSA 1VOMA 3APFA 2J07A 4ANUA 3KD7A 2VGYA 2CXLA 3RIBA 2DZNA 5EDSA 2BVMA 1HX8A 4H63H 2XASB 4N39A 4U0UA 4G25A 2E9XB 3MCXA 3PUSA 5AFUL 4LF9T 2E2EA 2BG9B 1TJCA 5ABEA 1CHUA 1TNZA 2X3MA 1BU9A 3TLTA 4U2ZA 3CX8B 3RYFE 4HS2A 2UUBT 1IYGA 5EIDA 2IU1A 3UTKA 3IA3A 2KCLA 3RIAA 4IULA 3SD5A 5LFAA 3RIUA 5KJKA 3V5SA 2OLTA 2VQFT 3NOGD 2YN6A 2UWJG 3QK0A 2LNIA 4IE0A 3E08A 4KHZF 3Q79A 3PDYA 1UGOA 2YHCA 2D0UA 3ANWA 3C98B 4PJLA 2XCCA 4PS7A 5LCWC 4DV1T 3BQOA 3L22A 3ZHEA 4PJMA 4U31A 4O60A 4QQIA 2PM7A 3SGHA 3ZKJA 3PEVB 2I1JA 2FJAA 2CHOA 3FWVA 3KVAA 3P4SA 4LMKA 2H6HA 3RI5A 4L9IA 3QKYA 3D9JA 1D9SA 3OTOT 3QWWA 4GA0A 4O1PA 5LA6E 4I9EA 4IRUA 3O48A 4JHKA 1D1CA 5LMNT 4DR3T 1UN9A 4DV0T 5EYLA 1K8KG 4ANJA 3HKEE 3ZCIA 4B3ST 5CB4E 4YJ2E 2C0LA 3VLEA 2C5JA 1UW4B 3MGBA 3FU3A 3VR9A 2N9DA 4GAAA 2LO6A 3GN5B 4C48B 2UUAT 5HXSA 3DRAA 2KCKA 3SWHA 4MFRA 2NW7A 2WXLA 4F7AA 1IZNB 5BMVE 2XM1A 3Q5DA 2X51A 1HTJF 4TXPA 4L23A 2YU2A 2H6GA 4EZ4A 4YDWA 2XSBA 2XRYA 3KSQA 4HRMB 3FB2A 3UKUG 4J8DA 2N1GA 3QC9A 1X81A 4H7YA 1SUMB 3AS8A 1YD8G 4UWHA 2LSKA 3PUAA 3ZCJA 2I6HA 2ETAA 4OK0A 4U8VD 5E0OA 3S4UA 2FI7A 1IQUA 2K24A 2CM0A 2UXXB 3HL6A 2BTDA 1WYCA 2ZM0A 5ABGA 4AXPA 2X6KA 4L0RA 3S7BA 5KBAA 1MIVA 2I1KA 2IO3C 3B95A 3PUGA 2DIWA 5AQ9A 1N32T 2LXLA 3CHQA 2HN2A 5HS0A 1N9AA 3UT7A 4YTNA 4FLBA 3IKOB 4AXHA 3NBNB 3HKBE 3UM0A 3HXCA 2VGEA 2LE8A 4ANWA 4PK4A 3MJWA 2QYJA 2R5SA 4UV8B 1YQ3A 3N9MA 4BX9A 5LYJE 3LPZA 5G05J 5JR9B 4LF7T 4YTPA 1BR1A 3AVRA 5LBMA 2CFUA 2Q9QB 1MYOA
chains in the Genus database with same CATH topology
4I43B 3EVYA 2MOZA 2WM9A 2XHEA 5ARGA 3FTVA 4WNKA 4XI9A 2QA7A 3ONKA 3UPVA 4XKCA 1NA0A 5FP3A 4I1OB 5KMGP 2OOEA 4AIFA 3PTRB 4HLEA 4CI3B 3ZW3A 3KV5A 3NRXA 2LSGA 2GRMA 1A17A 4WBNE 3AU4A 3GZSA 4EAHA 2WBLA 3ZYKA 3UUNA 4IE7A 4U0ZA 3U4TA 4U07A 3MKQB 4ZI7E 4FULA 3CWZB 4BSXA 1WRDA 1EZ3A 1WM5A 2DHRA 4PNIA 2VGXA 4FLHA 5G05C 2XRZA 5AJLA 5JDFA 2V7KA 4MS6A 4UVAB 2WXPA 3MZKB 5CA0E 3UUXA 2MRIA 2XUEA 3RRWA 2A72A 2P9BA 4TZ4C 4U74A 1VDYA 2A4ZA 3QOUA 5JDLA 3ML9A 3ZLIA 2NSZA 3N2GE 4UELA 3J9X1 2L6JA 5FWQA 3MEKA 3UMVA 1US7B 1KT0A 2EHOD 4CDRA 4WUYA 3PZDA 4A56A 4ANXA 3PUQA 2NW8A 2B1EA 4YHJA 4IE5A 4BTAA 5LJNA 2K48A 3ETUA 5FZSA 1JUQA 2ES0A 2I2OA 5L3FB 2WXQA 5GONE 4FJOA 2XGSA 1HS6A 2J49A 1B7TA 2V5FA 2WMOA 3QC1A 3AAIA 2WXJA 4DMWA 3P7IA 3CKCA 2KZTA 3KV6A 5FT9A 3WAJA 4CEMA 2Z6EA 3CPZA 3D9PA 4A1SA 2KLQA 3C4WA 3C4XA 5C1DA 5JDNA 4GZ5A 4MBQA 5FNVE 3R7RA 4I50E 2I9CA 4Y6CA 3Q5XA 2OVFA 3S7FA 2PFVA 5CMYA 4YFSA 5D0OD 4C0EA 3EDVA 3OYXA 3UULA 2DCPA 3CSFA 4IIJE 3EIQC 1E8WA 1FEWA 3TXNA 4J8SA 5ENNA 2C5IT 3SFZA 2CMRA 1WY6A 4ZI3C 3RRCA 3RX6A 3CMLA 3K3QC 1EYHA 1YW0A 4QX7B 4PH4B 1MNEA 2BVLA 4PK5A 2L8KA 3SZ7A 5H6QB 3RYCE 5HXEA 4ATGA 1TJFA 5EKQD 2WB2A 2VQ2A 4KT6B 3G2VA 2VASA 4XAXB 1PAQA 3SOLA 3AVSA 1QNFA 2E0IA 3UT8A 4CT4A 3I9YA 3CHMA 4BJMA 1OWOA 4U8HA 2L9BA 3RC8A 5AENA 5AJDA 2WXMA 4ILHB 4CGVA 4PK6A 3CEQA 4AQGA 3LEWA 4K03A 3LBXB 4KXKB 4LRZA 2D0TA 1IAPA 1MNDA 4QKNA 2VTBB 4BA9A 2PJQA 2IC9A 4R7LA 4CT0A 4X1IE 3D9IA 2UY1A 4W9RA 4MHCA 2E9XD 3DTOA 2IC6A 3N9QA 4DLOA 4EZLA 4ZI2C 3NRYA 5FQ4A 3TAXA 3ESKA 5J90A 3AA1B 4ACLA 1H7CA 4KVMA 4N3CA 5AYWD 4C91A 4GMLA 4IHJE 3ZFWA 4QX8B 3ZN1B 4D10C 2PBIA 3ZMTB 4J8FA 4J0UA 1GW6A 4JEHB 2HO1A 2W0GA 3L3PA 2XAGB 3EJNA 4P0AA 2W00A 3KAEA 3T8MA 3HA4A 3N9OA 4I9CA 1ZHCA 3CIAA 2VYIA 3C4ZA 5E76A 3NZQA 2XAFB 2WXOA 3FXEB 2FF4A 2L0IA 1UJJA 3SHFA 5CHEE 3T5VA 1UG3A 2MYSA 4PJJA 4IGUA 1H0AA 4AJWA 3AAEB 3U3WA 4LUNU 3MX3A 3R84B 5C8YE 4DNDA 4EZHA 2J4DA 4G23A 2EHOB 4DLQA 4V1Av 4N5CA 3ASFA 1QUUA 3VU7H 3ZMVB 5HQ8A 3RO2A 3PDNA 2VL8A 3Q15A 4XI0A 2VJ8A 4B6XA 5HXHA 4OFZA 5JDHA 3V5UA 4AKLA 4XX5A 2NXPA 5LHIB 3Q4AB 1SHZC 1JPLA 4BT8A 2DCFA 3CVLA 2BZBA 5CMWA 1EPUA 1E8ZA 4DO0A 3JCKC 3FUJA 5JDMA 4O2BE 2Y4UA 3QJZA 4GA1A 3ZPOA 4F1SA 3FUKA 3NZSA 5G55A 3H37A 1HG5A 3BQKA 5LXTE 2X6JA 4UF0B 4JA7A 5EK3A 3ZYQA 5JJ7A 4P0BA 2W61A 3SBSA 4AM9A 4G2VA 4QFVA 2LM9A 2V7LA 4KZCA 3G2WA 1P5QA 1MMAA 2J4BA 2VKDA 4KBQA 4WBOA 4J2CA 3IF8B 4MLKA 2Y3AA 3MA9A 3FHEA 3ZC1A 4UI9J 2V7JA 4HORA 1ELRA 5T8IA 2NW9A 1WYBA 1OUVA 4B8AA 4FC8A 4N2QA 1LKXA 5J2TE 2JRKA 2CFZA 2X9XA 5ANRA 3DBSA 2CLYC 4HN9A 3WI3A 1QQEA 3PU8A 4DMVA 4YLHA 4ANVA 5A7DB 3RKVA 4F6RC 4LEUA 3FEYA 1HE8A 2GGFA 1Y6IA 3S7DA 2NP9A 3FUMA 4UIGA 5ETWA 2CE7A 3UT4A 2ODVA 4QXHB 1T98A 1O3XA 4JW1A 3VHLA 1H6KA 4E85A 4UI9C 2BF0X 5FZQA 4ACKA 3QK6A 4GYYA 3CKBA 1KLXA 2KCVA 3I4GA 1N54A 2UXNB 5FJYA 1BPOA 3CVRA 2LAHA 4DPRA 3Q5MA 4KP3C 1PC2A 3D9NA 3L17A 5BW8C 1FMWA 4TRQA 3JC6C 2WPVA 1YKHB 2YNQA 1LRZA 3FH7A 4CXYA 3N2KE 3O1JA 5LHHB 2Q9QA 5LP0A 5A1LA 3ZEFB 3LG7A 3PREA 2ONDA 1OWNA 4X20E 5KCMA 4AQFA 4GA2A 5M4YA 4G26A 2CG2A 3KBTA 2NWBA 4L2YA 5KJNA 1Y8MA 3JYSA 3KINB 2LJLA 1HCIA 4GZDA 2DWKA 4PUCA 4LERA 4Q96A 2VK9A 4N3BA 3VTXA 5FY1A 3HVEB 3FH5A 3PRZA 1D1BA 1E1HB 4IE4A 2L3LA 4WWNA 5LG4A 2V8SE 2VB6A 4NACA 2X6IA 2HM8A 3L09A 3N71A 4GCOA 3FBZA 3K8PC 2NTXA 4ILUA 4WNGA 5BUZA 4I2ZA 3ZMZB 1ZV4X 2AXVA 3KBUA 4U63A 2CHXA 3FULA 4J6IA 4JLEA 4HKAA 1EF1C 3HKDE 5KJLA 2X9HA 4GK5E 4EECA 3GA8A 4G2AA 4AP2A 5HYAA 2KT9A 5FQ8A 2LOSA 3RYHE 2HPJA 4A55A 3HDXA 3ZPJA 2J9QA 4CXXA 2CXDA 1LVKA 4DJAA 1IQRA 1WLXA 3CX7B 5FXVA 4FJYA 4H9NC 2V4LA 3ZJ1A 4O2AE 3ANWB 2WMNA 3TL5A 4ILIA 2J08A 3FU0A 3LK42 4OYJA 3QB2A 4QXCB 3QARA 3PVLA 2XPZA 4WNFA 1NA3A 2JMKA 5EK4A 3RRUA 4RVBA 4JVSA 2NOXA 4UVBB 5L3DB 2WSSV 2K5BB 4ZHQE 4AI6A 3PE4A 3IHRA 3R7QA 4ADZA 4ZOLE 3N9NA 3CVUA 1INZA 1ZU2A 3C64A 4KMOA 3ZMSB 2DLRA 3OBVE 1D0YA 5ADXL 1LF8A 1V9DA 2IOLA 5L2LA 3SI5A 3H3AA 2OV8A 1Z0PA 4IDZA 1HS7A 3O1IA 3ZRHA 3FFLA 5FZRA 4CCAA 1MMDA 3FDHA 2QFCA 2LOPA 4UQZA 3AU5A 3BG0B 1YKEB 5BT1A 1SZ9A 2X68A 3GZ1A 2XAQB 1YA0A 2PM6A 3RH3A 1ELKA 3CK7A 4EIWA 4A3VA 3ETVA 1UN8A 3PUKA 2X67A 2L9QA 3B7RL 4GYWA 4UXNB 5LGNB 4UWGA 1MIWA 4BAYB 4KUMB 3ASGA 4FU3A 3ZN3A 1G73A 4TV9E 3ZVVA 4CZZB 1XGWA 4ABNA 4AOFA 3LFMA 4HTEA 1EDUA 3AB3B 2VWAA 4B89A 3ULQA 3IEGA 2CG3A 3LVRE 3KFWX 2CLYB 5C2YA 3KDSE 2XTLA 5FMNA 2RA1A 4ERRA 3O4XE 4CI1B 2JJ9A 2PL2A 4ISSA 4JEHA 2YU1A 3UT5E 4GB9A 1E7VA 4M3OA 4P29A 2CXFA 3GW4A 2I59A 2XCBA 5BPPA 5G2NA 1E96B 3E4BA 3I1AA 4KVOA 2VGXB 4BJNA 3GMIA 4WNDA 3G2TA 1SZAA 3ZYLA 4I6EA 3UUXB 2X66A 1HO8A 2IF4A 4X1YE 2LSUA 4I6GA 3SF4A 1WR6A 5JRCB 1SA0E 2EHOA 4GOUA 5EK2A 5LOVE 4AKRB 2ODUA 3FTZA 4GK0E 2X0LB 1E8YA 1U3CA 4CXWA 1NP7A 2GW1A 4A3TA 3LJ3A 3FTYA 3IHVA 4KYOB 3NF1A 3AA6B 3CV0A 5JHBA 4WW0A 4Z8XA 4AY5A 2J09A 4K0UA 3S2AA 3JQ1A 3MJXA 1NZNA 3F57A 1HH8A 4UQYA 5L3BB 2CHZA 2IOSA 3PS6A 5HXRA 5AIJA 4MRUA 1FIOA 5D0QD 2ZM8A 2FBNA 4JUYA 3VLDA 4CDMA 4JEUA 3LY7A 2EQXA 5ANLA 4ZI3D 3CVXA 4TUUA 5HWYA 2D5UA 4HOSA 1MIYA 2JLBA 4X1KE 3PURA 5JDQA 3AAAB 3D0TA 4BT9A 4AKHA 4O4JE 5HWXA 4YNDA 3RPUA 3I0OA 2V7IA 3WXXA 2DBAA 3FY4A 5LHGB 3E0ZA 4EYUA 4XBFB 1MHQA 1U4QA 4UV9B 3WAKA 2WXGA 2R17C 3I9WA 3CVWA 2XPIA 4HOQA 2X6HA 4BX8A 5JDGA 3R6NA 2KMFA 3OXLA 5DBKA 2YINA 4G11A 2JEKA 1FMVA 4N78D 4C90A 3CVYA 1SQMA 3APCA 1X79A 3CHRA 4HOTA 2JMHA 3BK9A 3FTXA 1D0ZA 4MALA 1LVFA 5DQWA 2XQ0A 3W15B 3K9IA 2XQYA 2XAJB 4TX5A 5F3JA 1H2VC 2IONA 3ZXSA 4H9RC 4GPKA 2WAUA 3L13A 1HU3A 3L16A 3N9PA 1NWMX 2Q9QC 1B89A 1S35A 3E22E 4RSYA 1HZ4A 3Q9DA 3QWPA 4EB6E 1WAO1 3RYIE 4AQFC 2OVBA 3B13A 3LVQE 2RG8A 4CQIA 3ZYMA 4ZI2D 3VKHA 3RK6A 5LGTB 3AA7B 3LDZA 4YVQC 3FEXA 3Q49B 4AY6A 5CCMA 4CRWA 3URZA 4H9SE 5BV1A 4KMCA 3QNKA 2CWYA 5FQ6A 3PNTB 2M67A 4O6FA 3FUEA 1FCHA 2LSJA 2E9XA 3CQXC 3B7SA 1HG2A 5HAXA 2HH7A 4OYKA 1HXIA 2WQHA 3EDUA 2IW5B 2KWHA 1BR4A 3QWVA 1PY1A 4KZ0A 4L2LA 3LK2B 4APFA 3F2EA 4UI9K 1OWAA 5FXZA 3QAQA 3T8OA 4UWFA 5CCLA 4HGAA 2KWIB 4AKIA 3C98A 2VKOA 3B57A 2ZM2A 3HKCE 3TXMA 3BG1B 2XGOA 4DBQA 2QGSA 3ONXA 4BY6A 4FHJA 2VSYA 4E6HA 1UCUA 4O4IE 2VKJA 3OKQA 1ZKEA 4OHFA 4MKTA 4FA6A 5JHAA 4P09A 5JH7E 1QSDA 1W3BA 3ZEFA 4I2WA 2W63A 2AWIA 3GWHA 2LHRA 2GRLA 4H9PC 2JPFA 1OWPA 4J8EA 3KV9A 1UX4A 3NQPA 3LXUX 3ML8A 3ZIMA 4TV8E 2HPLA 4EYYR 2KM4A 1QZ2A 5LCYA 3OAWA 3C51A 3GN5A 3A5XA 3CR3A 3IV0A 3MV3B 3FBLA 2KATA 2YQ8A 4ZS2A 5L3GB 2PQNA 3TGOA 3OXFA 3D9LA 4C0MA 5J2UE 3UQ3A 3PNLB 4Q94A 1OWMA 2PG8A 4YVOA 5M72A 5LBQB 4FADA 3L6AA 4XZCA 1HF8A 4H7XA 5FQ7A 2BDEA 3CVVA 3AA0B 2YHEA 1FVFA 3OYZA 3KS2A 2IQCA 4PAGA 3EHMA 2DWGA 3FU6A 2A3DA 2MHKA 3UX4A 3RO3A 3CQGB 3I4RB 3DJBA 3I0QA 3ZJ2A 4RG6A 1KK7A 3OJAA 4DI4A 2KXPB 3MXZA 5JR9A 4FP7A 2Q7FA 5CA1E 2DNXA 5E75A 4CGWA 1UX5A 2LAIA 1H2TC 4I43A 2WXHA 1IJ6A 4CDNA 5A6CA 4RG9A 4BWRA 2R59A 4B94A 4JPSA 3GYZA 3SNXA 4JA9A 2V7MA 5DJQC 5JJTA 3TG5A 3K3OA 3CHSA 4XZ4A 4ME2A 2V1DB 2A5UA 2V26A 3KVBA 2ZMAA 2WXIA 4PFOA 2SPCA 2H7OA 3IEEA 5J1GA 2Y8DA 2M63A 4M1PA 2V0PA 4OVVA 4I4TE 3HYMB 5HI7A 3MKQA 2C5KT 2RP4A 2HYZA 4HFGA 1MQSA 4PS8A 5LP6E 4L7TA 3MKRA 3EHNA 2N2NA 2Y6XA 3RJVA 5LX8A 1N52A 5IHYA 2BUGA 3OTNA 4EPZA 2IAKA 3G2SA 2FEZA 2WXNA 3FUFA 3U66A 3N2OA 4FHKA 2LEHA 5HXCA 3D3MA 3L08A 3G2UA 3QUJA 3ASDA 3FTWA 3UFEA 2LSIA 2CA5A 2DI4A 4NRHB 1Z3XA 4GZ3A 3JC6D 4WWPA 5ARFA 4UVCB 4GYRA 5H6RB 1H19A 3GZ2A 5J08A 3CKDA 5LGUB 3MKDA 5FYMA 3NBXX 5KDMC 3PH0C 3MACA 1D0XA 2EHOC 3ZHEB 5DIZA 3L54A 3PE3A 4PDXA 1JWFA 3JUIA 4Y6WA 2MTQA 4GYSA 1L5JA 4YJ3E 3M65A 4XKBA 4G24A 4EZJA 5BV0A 3KEZA 3CSTA 3D9OA 3LKUA 3APDA 2WXRA 2KNDA 5G04J 2KINB 4XIFA 4PJNA 4UWKA 5L3CB 1JWGA 2VSXE 4JHRA 3VTYA 2HR2A 2H3RA 3PUJA 2WQ7A 3ESLA 3FXDB 2J1DG 3R9AB 2X38A 4EXTA 2IFUA 1BR2A 2Y48B 5EZYE 2ZLYA 1DVPA 4GCNA 4NUVA 4FJZA 2XAHB 4FI5A 3BQIA 3LY8A 4DI3A 3J7Yq 3D9KA 3S7JA 2JQQA 1CUNA 5KJMA 4EBAA 4O4HE 3N5LA 3UUMA 4GZCA 2ACXA 5JRCA 5G04C 5FTPA 5TAOA 4CI2B 3MYVA 4G63A 2ZU6B 1UJKA 4GIWA 1VRBA 5DQVA 2GK9A 2P58C 3LBXA 4IE6A 4K0RA 5T4YA 4LCTA 2VTBA 3I5PA 3NZPA 4B8CB 2VSOE 3BEEA 3HR0A 3ZMUB 1AJ3A 3BQLA 2AXZA 2WXKA 3IHYA 4JHJA 4TN7B 4F3VA 2X9YA 3LS8A 4U04A 2XHEB 2WWUA 1KNZA 2KZ7B 3O1HA 2XPYA 2AW6A 3F31A 3CHOA 4E7SA 2VSNA 4I55E 5EX0A 4TUYE 4O8SA 4H9QC 4HXIA 4NQ0A 3RC3A 3U3IA 3EIJA 2KC7A 2K9AA 1U5PA 4N3AA 3P8CD 3IBEA 2RD0A 3RRNB 3LJCA 1ZEEA 2E9XC 1TEZA 2XGMA 5FXWA 2YK0A 3PU3A 3FP3A 4H63V 2E8IA 5EX3A 4GZ6A 3D9MA 3FH8A 3LY9A 1HFAA 2WQ6A 4ISTA 1IHGA 3CVNA 2W62A 3RU0A 2XEVA 3OXGA 3FUNA 3EDTB 3DP7A 3CQCB 3K3NA 3IBPA 3SRZA 3U78A 3P2BA 2WVIA 4F53A 4GMJA 4IYPA 2C0MA 5BNWA 4EZKA 3Q2MA 2AVPA 3JQ0A 3O9XA 4WAFA 3T5XA 4QXBB 4QWNB 3AS5A 5FXXA 5FY7A 1ZBPA 2LSYA 1U3DA 3B7UX 4N2SA 3FTUA 2X6FA 4HE8A 1D1AA 1X5BA 2MBGA 4EQFA 2X9WA 4DVDA 5IYZE 3FTSA 3CGHA 2FULA 2KZTB 3AS4A 3U64A 4AKGA 2D2SA 1FVHA 3RKOA 5LJMA 4I17A 1ELWA 3LK3B 1IJ5A 2FO7A 4JZYA 5FY0A 5JQGE 4BTBA 4NUUA 3VLFA 3FUHA 4WWOA 5T3RA 3ONLA 3N9LA 4UF0A 3NZUA 3CK9A 3QDNA 4U0SA 4V3IA 4L1BA 3ZN0B 4HVBA 1XNFA 1E90A 1Y64B 3PEUB 2IJGX 2L0TB 4G1TA 3TG4A 3FHNA 1G8XA 4EBAG 4PFPA 1DNPA 2LT3A 4GU5A 5F8PA 4DBRA 4XE0A 4JC8A 3FU5A 3MA5A 3PE0A 3Q47B 5JR9C 4Q69A 2NC9A 3VKGA 4DK5A 4C9BB 4JXTA 4ZS3A 2PZIA 2LSVA 3CHPA 3LYAA 3MV2B 3SBTB 3LCAA 2PQRA 2AXUA 2QY7A 4TV3A 3HI2A 3KV4A 1BR0A 4I1MA 4ASKA 1S0PA 1Z3YA 4HEAA 1E8XA 3FUDA 4L5GA 3RRMB 4H9OC 3EUHA 4I6JA 2H7VC 4AVXA 3P1UA 2Y4TA 3O4ZA 2UY1B 5L3EB 3CVQA 3FUIA 3ZGQA 5JJ6A 3CX6B 3TJPA 5LNKA 4EOZB 4UEMA 1MMGA 3B7TA 4AV7A 4U72A 4JEUB 2VKHA 2LHNA 1NAFA 1H2UA 4I1AA 2MOWA 4QHOA 3ZC0A 2CCQA 2CHWA 3U9WA 3HHMA 2C0SA 4OVUA 1S94A 1OXZA 2NTYA 3C50A 2Q9QD 4B0ZA 4WNEA 4KBMB 1MMNA 2ILRA 4UWLA 4A1GA 4URKA 3CLJA 3I3NA 2WXFA 2YEVC 4O4LE 3CK8A 3MZLB 3HIZA 3CVPA 3TKLB 2A2FX 2CWOA 4GYOA 3HVEA 4HFVA 4ILGA 2C2LA 5LOZA 2G0UA 1KT1A 2OA5A 4APOA 3ASHA 3MK7C 4AEZC 5LCWJ 4MLPA 4IN3B 3Q5WA 4NURA 4PW8A 1Z6TA 4E7ZA 3DPDA 4BFRA 3ENEA 4PS3A 2CEAA 1E7UA 5DABA 5KX5E 4HOUA 4JL0A 1OWLA 4UQXA 5JVDE 5JREA 5A23A 3SS1A 4OYSA 1VOMA 3APFA 2J07A 4ANUA 3KD7A 2VGYA 2CXLA 3RIBA 5EDSA 2BVMA 1HX8A 4H63H 2XASB 4N39A 4U0UA 4G25A 2E9XB 3MCXA 3PUSA 5AFUL 2E2EA 1TJCA 2X3MA 3CX8B 3RYFE 4HS2A 1IYGA 2IU1A 3UTKA 2KCLA 4IULA 3SD5A 5LFAA 5KJKA 3V5SA 2UWJG 3QK0A 2LNIA 4IE0A 3E08A 3PDYA 2YHCA 2D0UA 3ANWA 3C98B 4PJLA 2XCCA 4PS7A 5LCWC 3L22A 3ZHEA 4PJMA 2PM7A 3SGHA 3PEVB 2I1JA 3FWVA 3KVAA 3QKYA 4L9IA 3D9JA 3QWWA 4GA0A 5LA6E 4I9EA 4IRUA 3O48A 4JHKA 1D1CA 1UN9A 4ANJA 3HKEE 3ZCIA 5CB4E 4YJ2E 2C0LA 3VLEA 2C5JA 1UW4B 3MGBA 3FU3A 2N9DA 4GAAA 2LO6A 3GN5B 5HXSA 2KCKA 3SWHA 4MFRA 2NW7A 2WXLA 4F7AA 1IZNB 5BMVE 2X51A 1HTJF 4L23A 2YU2A 4EZ4A 2XRYA 3FB2A 4J8DA 2N1GA 3QC9A 4H7YA 3AS8A 1YD8G 4UWHA 2LSKA 3PUAA 3ZCJA 2I6HA 4OK0A 5E0OA 3S4UA 2FI7A 1IQUA 2K24A 2CM0A 2UXXB 3HL6A 2BTDA 1WYCA 2ZM0A 2X6KA 4AXPA 4L0RA 3S7BA 1MIVA 2I1KA 3PUGA 2DIWA 3CHQA 3UT7A 4FLBA 3IKOB 4AXHA 3HKBE 2LE8A 4ANWA 4PK4A 3MJWA 2R5SA 4UV8B 3N9MA 4BX9A 5LYJE 3LPZA 5G05J 5JR9B 1BR1A 3AVRA 5LBMA 2CFUA 2Q9QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQC B;  3I4R B;  3CQG B; 
#chains in the Genus database with same CATH topology
 4I43 B;  2XQA A;  4M7C A;  3PUZ F;  3EVY A;  2MOZ A;  2WM9 A;  2XHE A;  5ARG A;  3M3Z B;  5AQV B;  3FTV A;  2JQ9 A;  4WNK A;  4XI9 A;  2QA7 A;  3ONK A;  3UPV A;  3IXE A;  4XKC A;  1NA0 A;  5FP3 A;  4I1O B;  5KMG P;  2GRO B;  2OOE A;  4AIF A;  3PTR B;  2DWZ A;  2IEJ A;  4HLE A;  1LD8 A;  4F1P A;  2IDO B;  4CI3 B;  3ZW3 A;  3E37 A;  3KV5 A;  3NRX A;  2LSG A;  2GRM A;  5JA4 D;  5CJ5 A;  1A17 A;  4WBN E;  3RIF A;  3AU4 A;  4A63 B;  2B76 A;  3GZS A;  4EAH A;  2WBL A;  3ZYK A;  3UUN A;  4IE7 A;  4U0Z A;  3U4T A;  4JI3 T;  4U07 A;  3V31 A;  4DUI A;  3MKQ B;  4ZI7 E;  4FUL A;  1SE7 A;  1HNW T;  4DX6 D;  3CWZ B;  4BSX A;  1WRD A;  3ONL C;  1EZ3 A;  3X1D A;  1WM5 A;  2DHR A;  4PNI A;  2VGX A;  2FJB A;  4FLH A;  5G05 C;  2XRZ A;  2XZD G;  5JDF A;  5AJL A;  2V7K A;  4MS6 A;  4UVA B;  2WXP A;  3MZK B;  3DSS A;  5CA0 E;  3UUX A;  3PV0 F;  2MRI A;  3BU8 A;  2XUE A;  3RRW A;  1KFY A;  5CRV A;  2A72 A;  2P9B A;  4TZ4 C;  4U95 D;  4U74 A;  1VDY A;  2A4Z A;  3QOU A;  5JDL A;  3ML9 A;  3ZLI A;  2NSZ A;  5H7P A;  4IDN A;  3N2G E;  1I6Z A;  4UEL A;  3J9X 1;  4EV6 A;  2XQ3 A;  2L6J A;  5FWQ A;  2YDQ A;  3MEK A;  3UMV A;  1US7 B;  1KT0 A;  2EHO D;  4LFC T;  4CDR A;  4WUY A;  3PZD A;  4A56 A;  4ANX A;  3PUQ A;  3T8K A;  2NW8 A;  2B1E A;  4YHJ A;  4IE5 A;  4GPM A;  4BTA A;  5LJN A;  2K48 A;  3ETU A;  5FZS A;  1JUQ A;  2ES0 A;  2I2O A;  4HLL A;  5L3F B;  3UUB A;  2WXQ A;  5EIL A;  5GON E;  4FJO A;  2XGS A;  1HS6 A;  1FT1 A;  1KEY A;  5L4H A;  2J49 A;  2H6F A;  1B7T A;  2V5F A;  2WMO A;  1XMQ T;  3AAI A;  2WXJ A;  3QC1 A;  4DMW A;  3P7I A;  3CKC A;  2KZT A;  3KV6 A;  5FT9 A;  3WAJ A;  4CEM A;  2X0H A;  2Z6E A;  3UKR G;  3CPZ A;  4NXM T;  3D9P A;  4A1S A;  5AQJ B;  2KLQ A;  4BSZ B;  3C4W A;  3C4X A;  5C1D A;  5JDN A;  4GZ5 A;  4MBQ A;  5FNV E;  1HR0 T;  2GRQ B;  3R7R A;  5HEH A;  3RLF F;  4I50 E;  2I9C A;  3UQ7 A;  4LMJ A;  4Y6C A;  5ITZ F;  3Q5X A;  2OVF A;  5CER B;  3S7F A;  2PFV A;  5CFB A;  5CMY A;  4ZZC A;  4YFS A;  5D0O D;  4C0E A;  3EDV A;  3OYX A;  3UUL A;  2DCP A;  3CSF A;  1Z8U A;  4IIJ E;  3EIQ C;  3DSW A;  1E8W A;  1FEW A;  2F4V T;  3SFX A;  1R8I A;  3TXN A;  4J8S A;  5ENN A;  2C5I T;  3SFZ A;  2CMR A;  1IHB A;  1FPP A;  1WY6 A;  4ZI3 C;  3RRC A;  1FJG T;  3RX6 A;  3CML A;  3K3Q C;  1EYH A;  1YW0 A;  5HRY A;  4QX7 B;  4JI4 T;  2ETC A;  1MNE A;  2BVL A;  4PH4 B;  4PK5 A;  3KEA A;  1VCT A;  2XSA A;  2L8K A;  1LD7 A;  3SZ7 A;  1DC2 A;  5H6Q B;  3RHW A;  4DR2 T;  3RYC E;  5HXE A;  2XQ8 A;  4ATG A;  1TJF A;  1L0V A;  4YT0 A;  5EKQ D;  2WB2 A;  2KXP C;  2P9L G;  3ZNG A;  2VQ2 A;  1XNR T;  4KT6 B;  4NIK A;  3G2V A;  4TXQ A;  2DVW A;  2VAS A;  3FZK B;  4XAX B;  5J0Z A;  1PAQ A;  3SOL A;  2B6C A;  2BBJ A;  3AVS A;  1QNF A;  2E0I A;  3UT8 A;  4CT4 A;  2W4X A;  4DV4 T;  3I9Y A;  1V55 E;  3CHM A;  4HI8 A;  4BJM A;  1OWO A;  3AG4 E;  4U8H A;  2L9B A;  4HWI B;  3RC8 A;  1V54 E;  4COF A;  1RW2 A;  5AEN A;  5AJD A;  5B1A E;  2WXM A;  4ILH B;  1OCC E;  4CGV A;  4PK6 A;  3CEQ A;  4AQG A;  3LEW A;  4K03 A;  2AJA A;  3LBX B;  4KXK B;  4LRZ A;  2D0T A;  1IAP A;  3CIR A;  1MND A;  3ABM E;  3RAU A;  4YDY A;  4QKN A;  3PZ2 A;  2VTB B;  4BA9 A;  1YXR A;  2PJQ A;  2IC9 A;  4R7L A;  4CT0 A;  1N0Q A;  4X1I E;  3D9I A;  1N11 A;  2P9K G;  3WG7 E;  2UY1 A;  4W9R A;  4MHC A;  2E9X D;  3DTO A;  2IC6 A;  2ZIS A;  5F5W A;  3N9Q A;  4DLO A;  5FKY A;  4EZL A;  4ZI2 C;  3NRY A;  5FQ4 A;  4P1N A;  3TAX A;  3ESK A;  5J90 A;  3TLU A;  5AQS B;  2ZGD A;  1KZO A;  5CBO A;  3AA1 B;  3L82 A;  3T9K A;  2LLY A;  4ACL A;  1H7C A;  4KVM A;  4X65 T;  2FO1 E;  4N3C A;  5AYW D;  4C91 A;  1O5M A;  4GML A;  4IHJ E;  3ZFW A;  4QX8 B;  3ZN1 B;  2EIJ E;  4D10 C;  2PBI A;  4HFC A;  3ZMT B;  4J8F A;  4J0U A;  1GW6 A;  4JEH B;  2HO1 A;  2W0G A;  3L3P A;  2XAG B;  4K0K T;  5L4E A;  4K5B A;  3EJN A;  4P0A A;  3E34 A;  2W00 A;  5AQP B;  3KAE A;  3T8M A;  2WB5 A;  3HA4 A;  3N9O A;  4I9C A;  4GTQ A;  1TN7 A;  1ZHC A;  4A98 A;  3CIA A;  2PNN A;  2VYI A;  3C4Z A;  3RIU C;  3R9M A;  5E76 A;  3NZQ A;  1SW6 A;  2XAF B;  2WXO A;  3FXE B;  2FF4 A;  2L0I A;  1UJJ A;  3SHF A;  4IDQ A;  5CHE E;  3E33 A;  3T5V A;  1UG3 A;  2BKO A;  2MYS A;  5ABF B;  1H6P A;  3DEP A;  4PJJ A;  4IGU A;  1H0A A;  4AJW A;  1NI1 A;  3AAE B;  3U3W A;  4LUN U;  3MX3 A;  3R84 B;  5C8Y E;  4DND A;  4EZH A;  2J4D A;  4KHP T;  4G23 A;  2EHO B;  2LKH A;  1YQ4 A;  4DLQ A;  3AXJ B;  1HX1 B;  4V1A v;  4N5C A;  3ASF A;  3SY2 A;  1QUU A;  2E2A A;  3VU7 H;  3ZMV B;  5HCJ A;  5HQ8 A;  3RO2 A;  3PDN A;  2VL8 A;  3Q15 A;  4XI0 A;  2VJ8 A;  4B6X A;  5HXH A;  2VQE T;  4OFZ A;  4IRE A;  5JDH A;  3V2X A;  3V5U A;  2JAB A;  4AKL A;  4XX5 A;  2NXP A;  5LHI B;  3Q4A B;  1SHZ C;  1JPL A;  4BT8 A;  2DCF A;  3CVL A;  2BZB A;  4JV5 T;  4HWC A;  4GTO A;  5CMW A;  1EPU A;  4MBG A;  1E8Z A;  5AQU B;  2XS8 A;  1YMP A;  4DO0 A;  3JCK C;  2QC9 A;  3JUE A;  3FUJ A;  4YDE A;  3NWI A;  5JDM A;  4O2B E;  4BER A;  3ZKR A;  2BG9 A;  2Y4U A;  3QJZ A;  2YDR A;  4GA1 A;  3ZPO A;  4LNU D;  4F1S A;  4HFI A;  3FUK A;  3NZS A;  5G55 A;  3H37 A;  1HG5 A;  3BQK A;  3X2Q E;  4JI5 T;  3UIO C;  4ZHB A;  5LMU T;  5LXT E;  5FVK A;  2X6J A;  4UF0 B;  5HEJ A;  4JA7 A;  4LNB A;  2WS3 A;  3JXI A;  2CRB A;  4U8Y D;  5C2T A;  5EK3 A;  3ZYQ A;  3EAB A;  5JJ7 A;  4P0B A;  3LDQ B;  5IUX A;  2F8Y A;  2W61 A;  2V4H C;  3SBS A;  4AM9 A;  5D2M C;  4G2V A;  3ISM C;  4QFV A;  2LM9 A;  2V7L A;  4KZC A;  3UM1 A;  3G2W A;  4GTT A;  1P5Q A;  1MMA A;  2J4B A;  2VKD A;  2V5C A;  4WBO A;  4J2C A;  4KBQ A;  3IF8 B;  4MLK A;  4ZZB A;  4HQD A;  2Y3A A;  3MA9 A;  3LJN A;  4HB5 A;  3FHE A;  3J5Q B;  1KNR A;  3ZC1 A;  4UI9 J;  1J5E T;  4GTM A;  2V7J A;  4HOR A;  1ELR A;  2FBW A;  1HNZ T;  5T8I A;  2NW9 A;  3UIN C;  2MAW A;  1N4P A;  1WYB A;  1OUV A;  1OED A;  4B8A A;  4FC8 A;  2XEN A;  2MPK A;  4JI1 T;  4N2Q A;  1LKX A;  4DR5 T;  2LKG A;  5C3J A;  5J2T E;  2JRK A;  2CFZ A;  2X9X A;  5ANR A;  3DBS A;  2CLY C;  4N5Q A;  4HN9 A;  3WI3 A;  4U7I A;  1QQE A;  3PU8 A;  2P9N G;  4DMV A;  4YLH A;  4ANV A;  5A7D B;  1N4S A;  5CED B;  3RKV A;  4JD2 G;  4F6R C;  4LEU A;  3QB5 K;  3FEY A;  1HE8 A;  2GGF A;  1Y6I A;  3S7D A;  3ZT5 A;  1M62 A;  4CZ2 D;  3E30 A;  2NP9 A;  3FUM A;  4UIG A;  4ILC A;  3FZH B;  3HXE A;  1XDO A;  5ETW A;  2CE7 A;  3UT4 A;  3V30 A;  2ODV A;  4QXH B;  1T98 A;  5EIB E;  1O3X A;  2J4G A;  5AQ7 A;  2V6Y B;  1XWM A;  4JW1 A;  3VHL A;  1H6K A;  4E85 A;  2OV9 A;  4UI9 C;  2BF0 X;  5FZQ A;  4ACK A;  3QK6 A;  5IY5 E;  4GYY A;  3CKB A;  1KLX A;  2KCV A;  3I4G A;  1N54 A;  2UXN B;  5FJY A;  4KX6 A;  1BPO A;  2BS3 A;  3CVR A;  2LAH A;  3C3Q A;  4DPR A;  3Q5M A;  1E2A A;  3P4W A;  4KP3 C;  1PC2 A;  3D9N A;  5AQN B;  3L17 A;  5BW8 C;  4WYV A;  1HNX T;  1FMW A;  1ZP0 A;  4TRQ A;  3JC6 C;  2VL0 A;  3Q75 A;  2WPV A;  1YKH B;  2YNQ A;  1LRZ A;  3FH7 A;  4CXY A;  3AED A;  1JCQ A;  3N2K E;  3O1J A;  5LHH B;  1BI7 B;  2Q9Q A;  1TNO A;  3W9F A;  5LP0 A;  5A1L A;  3ZEF B;  3LG7 A;  4IT4 A;  2VVN A;  3PRE A;  5CBN A;  2OND A;  1OWN A;  4X20 E;  5KCM A;  4AQF A;  4GA2 A;  5M4Y A;  2VUR A;  2R2L A;  3ABK E;  4TNW A;  4G26 A;  3B5M A;  4F8H A;  2CG2 A;  2EIM E;  3KBT A;  2NWB A;  4L2Y A;  2FJE A;  5KJN A;  1Y8M A;  1TR4 A;  3JYS A;  1IKN D;  3KIN B;  2LJL A;  4ZEY A;  2A5E A;  1HCI A;  3ABV A;  2P9I G;  2XY8 B;  2DWK A;  4GZD A;  4PUC A;  4LER A;  4Q96 A;  2VK9 A;  4N3B A;  3VTX A;  5FY1 A;  3HVE B;  3FH5 A;  3PRZ A;  1D1B A;  1E1H B;  4IE4 A;  4HRL A;  2L3L A;  1NFI E;  4EHM A;  4WWN A;  5LG4 A;  2V8S E;  2VB6 A;  1W9R A;  3AAA C;  1W09 A;  4NAC A;  2X6I A;  3UIP C;  2EIN E;  2HM8 A;  3L09 A;  3N71 A;  4GCO A;  3FBZ A;  3K8P C;  2NTX A;  1VCS A;  4ILU A;  1TYQ G;  4WNG A;  2XS1 A;  4LG6 A;  5BUZ A;  2AE9 A;  4I2Z A;  3ZMZ B;  1ZV4 X;  2AXV A;  3KBU A;  4U63 A;  2CHX A;  2KBX A;  3ZST A;  3FUL A;  1YYH A;  4J6I A;  4JLE A;  2DL1 A;  4HKA A;  2P9P G;  1EF1 C;  4NIQ A;  4Z68 A;  3HKD E;  3H3M A;  5KJL A;  2QYU A;  4JI0 T;  4OAV B;  2X9H A;  3P4R A;  3JXJ A;  4JBW F;  4GK5 E;  4X64 T;  4EEC A;  3GA8 A;  4G2A A;  1NEN A;  3ZXP A;  4AP2 A;  4QH4 A;  5HYA A;  2KT9 A;  2XQ5 A;  4IL4 A;  2XQ9 A;  5FQ8 A;  4WZX A;  3DEO A;  2LOS A;  3RYH E;  5L47 A;  2HPJ A;  4A55 A;  4YXD A;  3Q7F A;  3HDX A;  3ZPJ A;  2J9Q A;  4CXX A;  4JI6 T;  1MX4 A;  2CXD A;  1LVK A;  4DJA A;  1IQR A;  1WLX A;  3UXG A;  3CX7 B;  5FXV A;  4FJY A;  2WCA A;  4H9N C;  2V4L A;  4B93 B;  3ZJ1 A;  4O2A E;  1H6O A;  3ANW B;  2WMN A;  3TL5 A;  4ILI A;  2J08 A;  3HXB A;  5IWA T;  3FU0 A;  3LK4 2;  4OYJ A;  3QB2 A;  4QXC B;  3QAR A;  2LXM A;  3PVL A;  1W0A A;  2XPZ A;  4HWH A;  4WNF A;  1NA3 A;  2JMK A;  5EK4 A;  3RRU A;  4LNG A;  4RVB A;  4JVS A;  2NOX A;  4UVB B;  5L3D B;  2WSS V;  3A8Y C;  2K5B B;  3AG1 E;  4ZHQ E;  4AI6 A;  4U7E B;  3AEF A;  4DUZ T;  3PE4 A;  3IHR A;  3OPC A;  3EU9 A;  5CEA A;  3R7Q A;  4ADZ A;  4OX9 T;  4ZOL E;  3N9N A;  3CVU A;  1INZ A;  1ZU2 A;  3C64 A;  4KMO A;  3ZMS B;  2DLR A;  3OBV E;  1D0Y A;  5ADX L;  1JCR A;  1LF8 A;  4DRX E;  4UR9 A;  1V9D A;  2IOL A;  3KSL A;  3ULY A;  3J5P A;  4Z91 A;  5L2L A;  2H89 A;  3SI5 A;  2UXC T;  3H3A A;  3PUY F;  2OV8 A;  3AJI A;  1UUS A;  2QRX A;  2UXD T;  1Z0P A;  4IDZ A;  1HS7 A;  4GTR A;  3O1I A;  3ZRH A;  4YHH T;  3FFL A;  5FZR A;  3NVO A;  4LF5 T;  2XZT G;  5EN5 D;  4CCA A;  1DU2 A;  2WDV A;  1MMD A;  3FDH A;  1JCS A;  3L9T A;  2QFC A;  2LOP A;  4UQZ A;  3AU5 A;  3BG0 B;  1YKE B;  5BT1 A;  4AIU A;  1SZ9 A;  2X68 A;  4X66 T;  3GZ1 A;  2WU2 A;  2XAQ B;  4AQY T;  1KNP A;  1YA0 A;  1MJ0 A;  2PM6 A;  3RH3 A;  4EED A;  1ELK A;  3CK7 A;  4EIW A;  4YSZ A;  5AQQ B;  3AE9 A;  4A3V A;  1AWC B;  3ETV A;  1UN8 A;  3PUK A;  1WR0 A;  2X67 A;  2L9Q A;  2XQ7 A;  1XMO T;  3EHQ A;  3JAF A;  3B7R L;  4GYW A;  4UXN B;  5LGN B;  4UWG A;  1MIW A;  4BAY B;  4KUM B;  3ASG A;  4FU3 A;  3ZN3 A;  1XZY A;  1G73 A;  4TV9 E;  3ZVV A;  4CZZ B;  5HEG A;  1XGW A;  4ABN A;  4AOF A;  3LFM A;  4HTE A;  4I0U A;  1EDU A;  5BR8 T;  4DV2 T;  3AB3 B;  2VWA A;  2XQ4 A;  3HXD A;  2H88 A;  4B89 A;  2XEH A;  5ENP D;  3ULQ A;  3IEG A;  2CG3 A;  3LVR E;  3KFW X;  2CLY B;  1N4R A;  5C2Y A;  3QB5 A;  3KDS E;  3FZL B;  3ZT6 A;  2XTL A;  5FMN A;  2RA1 A;  3TWQ A;  4ERR A;  3O4X E;  4HNA D;  3DWL G;  2RFM A;  4UUC A;  2BBH A;  4CI1 B;  2JJ9 A;  2PL2 A;  4L9P A;  2XQ6 A;  4ISS A;  4B3M T;  4JEH A;  2YU1 A;  3UT5 E;  1OXJ A;  4Q25 A;  4GB9 A;  2BG9 C;  5AQI B;  1E7V A;  4M3O A;  4P29 A;  2CXF A;  1N34 T;  3GW4 A;  2I59 A;  1XDP A;  2XCB A;  5BPP A;  5G2N A;  1E96 B;  3JAE A;  3E4B A;  3I1A A;  4KVO A;  2VGX B;  1KF6 A;  4BJN A;  3GMI A;  4WND A;  3G2T A;  2PTF A;  1SZA A;  3ZYL A;  4I6E A;  3NKZ A;  3UUX B;  2D9D A;  2X66 A;  2OEW A;  1HO8 A;  2IF4 A;  3TWT A;  4X1Y E;  2LSU A;  4I6G A;  3SF4 A;  4JI2 T;  1WR6 A;  5JRC B;  1SA0 E;  2EHO A;  4GOU A;  4U33 A;  5EK2 A;  3AXJ A;  5LOV E;  4AKR B;  4BET A;  2ODU A;  3P4P A;  3ZUV B;  3FTZ A;  4GK0 E;  2X0L B;  1E8Y A;  1U3C A;  4CXW A;  1NP7 A;  2GW1 A;  4A3T A;  3LJ3 A;  4DX2 A;  3FTY A;  3IHV A;  3PJA A;  4KYO B;  3NF1 A;  4GMR A;  3AA6 B;  2XM2 A;  3CV0 A;  5JHB A;  4WW0 A;  4Z8X A;  4AY5 A;  1OED C;  2J09 A;  2Y1L E;  4K0U A;  3S2A A;  3V2O A;  3JQ1 A;  2F37 A;  3MJX A;  3B7B A;  1Z5S C;  4IDO A;  1NZN A;  3F57 A;  1HH8 A;  4UQY A;  5L3B B;  1WG0 A;  2CHZ A;  2IOS A;  3PS6 A;  3TWR A;  2BKN A;  5HXR A;  5AIJ A;  4K5C A;  4MRU A;  1FIO A;  5D0Q D;  5B3S E;  2ZM8 A;  3Q7A A;  4BES A;  2FBN A;  4JUY A;  3VLD A;  4CN6 A;  4CDM A;  2Y69 E;  4JEU A;  3LY7 A;  4CN1 A;  2EQX A;  5ANL A;  4ZI3 D;  4U2Y A;  3CVX A;  2M6B A;  2WP9 A;  4TUU A;  5HWY A;  3Q73 A;  2D5U A;  4HOS A;  1MIY A;  2JLB A;  1OED E;  4X1K E;  3PUR A;  3TLV A;  5JDQ A;  3AAA B;  3D0T A;  4BT9 A;  4AKH A;  4O4J E;  3NB2 A;  4A5X A;  5HWX A;  4YND A;  5AQT B;  3RPU A;  3I0O A;  2V7I A;  3WXX A;  2DBA A;  3LSV A;  5LHG B;  3E0Z A;  4EYU A;  3FY4 A;  4XBF B;  1MHQ A;  1U4Q A;  4UV9 B;  2E5V A;  4DR7 T;  3FZM B;  4IDP A;  3WAK A;  2WXG A;  3DSU A;  3PZ1 A;  5BXO A;  2R17 C;  3I9W A;  3CVW A;  2XPI A;  4HOQ A;  2X6H A;  4BX8 A;  3HG0 D;  5JDG A;  3R6N A;  2KMF A;  3OXL A;  5DBK A;  1U2V G;  3Q78 A;  2YIN A;  4G11 A;  3AE8 A;  2JEK A;  1FMV A;  4N78 D;  4C90 A;  3CVY A;  1SQM A;  1ZB1 A;  1X79 A;  3APC A;  3CHR A;  2JMH A;  3BK9 A;  3FTX A;  4HOT A;  4ATZ D;  1D0Z A;  4MAL A;  1LVF A;  5DQW A;  2XQ0 A;  3W15 B;  3K9I A;  2XQY A;  2XAJ B;  4TX5 A;  5F3J A;  1H2V C;  2ION A;  3ZXS A;  4H9R C;  3Q9N C;  4GPK A;  2WAU A;  3L13 A;  3VRB A;  1HU3 A;  4J8Y A;  3L16 A;  3N9P A;  1NWM X;  2Q9Q C;  3Q5E A;  5FL1 A;  1B89 A;  1S35 A;  3E22 E;  4RSY A;  1HZ4 A;  3Q9D A;  4ILB A;  4GKJ T;  3UI2 A;  2E5L T;  3QWP A;  3SFY A;  4EB6 E;  1WAO 1;  3AE7 A;  2K3W A;  3RYI E;  4AQF C;  1Q2Z A;  2OVB A;  2ACZ A;  3B13 A;  4HRN A;  2W2U A;  1D8E A;  2LRK A;  3LVQ E;  2RG8 A;  5AQG B;  5JMN D;  4CQI A;  3ZYM A;  2RFA A;  4ZI2 D;  3VKH A;  3RK6 A;  5LGT B;  3AA7 B;  3LDZ A;  4YVQ C;  3FEX A;  3Q49 B;  4AY6 A;  5CCM A;  2WZH A;  4JI8 T;  4CRW A;  3AE4 A;  3URZ A;  4H9S E;  3ZU7 B;  5BV1 A;  4KMC A;  3QNK A;  2CWY A;  5FQ6 A;  3DST A;  3PNT B;  2M67 A;  4O6F A;  3FUE A;  1FCH A;  2LSJ A;  2E9X A;  3CQX C;  4G8L A;  3B7S A;  1HG2 A;  5HAX A;  2HH7 A;  4OYK A;  1HXI A;  2WQH A;  2ZM6 T;  3EDU A;  2IW5 B;  2KWH A;  3PUX F;  5D66 A;  1BR4 A;  3QWV A;  1PY1 A;  5AQF B;  4KZ0 A;  4L2L A;  3AE2 A;  3LK2 B;  4APF A;  5ENT D;  5FL0 A;  3F2E A;  2X0Y A;  4AIS A;  4UI9 K;  1OWA A;  5FXZ A;  3QAQ A;  3T8O A;  4UWF A;  5CCL A;  4HGA A;  2KWI B;  4AKI A;  3C98 A;  5KXJ A;  2VKO A;  3B57 A;  2ZM2 A;  3HKC E;  3PUW F;  4LFA T;  3TXM A;  3BG1 B;  2XGO A;  4DBQ A;  2QGS A;  3ONX A;  4BY6 A;  1GQE A;  4FHJ A;  2VSY A;  1X9B A;  4E6H A;  1UCU A;  4O4I E;  2VKJ A;  3OKQ A;  1ZKE A;  4OHF A;  1MX6 A;  4J7W A;  4MKT A;  4U96 D;  4FA6 A;  5JHA A;  4P09 A;  2OEV A;  3EU5 A;  5JH7 E;  4RLY A;  3TWS A;  1QSD A;  1W3B A;  1DCE A;  3ZEF A;  4I2W A;  2W63 A;  1XNQ T;  2AWI A;  3GWH A;  5KWD A;  3UFG A;  2LHR A;  2GRL A;  4IL9 A;  4H9P C;  2JPF A;  1OWP A;  2BKK B;  4J8E A;  5AQA A;  3KV9 A;  1UX4 A;  2AXD S;  3NQP A;  3LXU X;  1T72 A;  3ML8 A;  3ZIM A;  4TV8 E;  2HPL A;  2ZXW E;  4EYY R;  4HFE A;  2KM4 A;  1N33 T;  2IY0 C;  1QZ2 A;  5LCY A;  3OAW A;  3C51 A;  3GN5 A;  2B0O E;  3UU4 A;  4NXN T;  3A5X A;  3CR3 A;  2P9U G;  4NPP A;  3IV0 A;  3MV3 B;  2EIL E;  3FBL A;  2ZIR A;  5ABH A;  2KAT A;  1BI8 B;  2YQ8 A;  4ZS2 A;  5L3G B;  4EEB A;  2PQN A;  2W66 A;  3TGO A;  3OXF A;  3AEE A;  3D9L A;  4B3R T;  1JNZ A;  1TNU A;  4C0M A;  5J2U E;  3UQ3 A;  3T1H T;  3PNL B;  4Q94 A;  1OWM A;  1YCS B;  2PG8 A;  4YVO A;  5M72 A;  5LBQ B;  4FAD A;  3L6A A;  4DX5 D;  4XZC A;  1WCR A;  3HXF A;  2LM2 A;  1HF8 A;  4H7X A;  2QVA A;  3ASN E;  5FQ7 A;  2BDE A;  3CVV A;  3AA0 B;  3VR8 A;  2YHE A;  5KNG A;  1FVF A;  1OCZ E;  3OYZ A;  3KS2 A;  2IQC A;  4PAG A;  3EHM A;  2DWG A;  2KSR A;  3FU6 A;  2A3D A;  2MHK A;  3UX4 A;  3RO3 A;  3CQG B;  2I0M A;  5LG3 A;  3I4R B;  3DJB A;  3I0Q A;  3ZJ2 A;  1K1A A;  2VVS A;  4X8Q A;  4RG6 A;  2IHR 1;  1KK7 A;  3OJA A;  1JNR A;  4DI4 A;  2KXP B;  4K5A B;  3MXZ A;  5JR9 A;  4FP7 A;  2Q7F A;  5CA1 E;  2DNX A;  5E75 A;  5CEC B;  4CGW A;  1UX5 A;  2EIK E;  2FJD A;  2LAI A;  1H2T C;  2P2C P;  4I43 A;  3SQV A;  2WXH A;  1IJ6 A;  4CDN A;  5A6C A;  4RG9 A;  4BWR A;  4U7Y A;  2R59 A;  4GTP A;  4B94 A;  3AEG A;  3GYZ A;  4JPS A;  1BD8 A;  1D8D A;  3SNX A;  4JA9 A;  2V7M A;  5DJQ C;  1O1S A;  5JJT A;  3TG5 A;  3K3O A;  1DCQ A;  3UQ4 A;  3CHS A;  1E7P A;  4XZ4 A;  5CGM A;  4ME2 A;  2V1D B;  3PZ3 A;  3HRA A;  2A5U A;  5AQH B;  2V26 A;  3KVB A;  4DV6 T;  2ZMA A;  1QBQ A;  2R02 A;  2WXI A;  4PFO A;  2SPC A;  2H7O A;  2HN1 A;  3EAM A;  3IEE A;  2FUP A;  5J1G A;  2Y8D A;  3Q9U C;  2M63 A;  4F6R D;  4M1P A;  3UU6 A;  2V0P A;  2F0Y A;  5AQO B;  4OVV A;  4I4T E;  3HYM B;  5HI7 A;  3MKQ A;  1OED B;  2C5K T;  1Y01 A;  2RP4 A;  2HYZ A;  3DXM G;  4HFG A;  1MQS A;  4PS8 A;  5LP6 E;  4L7T A;  3MKR A;  3EHN A;  1O1R A;  1TNY A;  5KNH D;  2N2N A;  2Y6X A;  4TWH A;  3RJV A;  5LX8 A;  3RQU A;  1N52 A;  5IHY A;  2BUG A;  3OTN A;  4EPZ A;  2IAK A;  3G2S A;  2FEZ A;  2WXN A;  2R6G F;  4GKK T;  3FUF A;  1QLB A;  3U66 A;  3N2O A;  4FHK A;  2LEH A;  3QNU A;  2HE0 A;  2WU5 A;  3PJA J;  5HXC A;  3D3M A;  5FIO A;  3L08 A;  3G2U A;  2GRP B;  3SFD A;  3QUJ A;  3L8R A;  4TUM A;  2DYS E;  2BED A;  3ASD A;  3FTW A;  3UFE A;  2LSI A;  5ENO D;  3SO8 A;  2CA5 A;  2DI4 A;  2V8S V;  2UXB T;  4NRH B;  1Z3X A;  2WWV A;  4GZ3 A;  3JC6 D;  4WWP A;  5ARF A;  4UVC B;  4DX1 A;  4GYR A;  3G06 A;  5H6R B;  1FT2 A;  1H19 A;  4OAU C;  3A7M A;  3GZ2 A;  3EHZ A;  5J08 A;  3CKD A;  5LGU B;  3MKD A;  5HKP A;  2BS4 A;  5FYM A;  1ZOY A;  2BS2 A;  3NBX X;  4YSX A;  5KDM C;  2V6X A;  4DX7 D;  3PH0 C;  1SVX A;  3K1S A;  3MAC A;  1D0X A;  4QH1 A;  4HWF A;  2EHO C;  3ZHE B;  1K3Z D;  1K1B A;  5DIZ A;  2RKK A;  3L54 A;  3PE3 A;  4HWD A;  1UK5 A;  4PDX A;  1JWF A;  3JUI A;  4Y6W A;  2MTQ A;  4GYS A;  5AQM B;  4YJ3 E;  1L5J A;  3M65 A;  2YOE A;  4XKB A;  4G24 A;  4EZJ A;  2R03 A;  5BV0 A;  2P9S G;  3KEZ A;  2DZO A;  3CK6 A;  3CST A;  3D9O A;  3LKU A;  2W67 A;  3APD A;  2WXR A;  2KND A;  4CN4 A;  5G04 J;  2KIN B;  4XIF A;  2CHN A;  4PJN A;  4UWK A;  2A9U A;  5L3C B;  1JWG A;  2VSX E;  3TWV A;  2IML A;  4JHR A;  3EUV A;  4DV5 T;  4X62 T;  2JQK A;  3VTY A;  2HR2 A;  3ZSS A;  4LFB T;  4TWD A;  2H3R A;  3PUJ A;  2WQ7 A;  2UUC T;  3V79 K;  3ESL A;  3C3R A;  3FXD B;  2J1D G;  2M6I A;  5BXU A;  3R9A B;  2X38 A;  4EXT A;  2IFU A;  1BR2 A;  3EI0 A;  2Y48 B;  5EZY E;  2ZLY A;  1DVP A;  4GCN A;  2QYW A;  3AE6 A;  4NUV A;  4FJZ A;  5AAO A;  3UU3 A;  4G8K A;  2XAH B;  4FI5 A;  3BQI A;  3LY8 A;  3AEB A;  4DI3 A;  3J7Y q;  3D9K A;  4U3C A;  2JQQ A;  3S7J A;  3ABL E;  3RKG A;  1CUN A;  4DR4 T;  5KJM A;  4EBA A;  4O4H E;  3N5L A;  3UUM A;  4GZC A;  2ACX A;  5JRC A;  5G04 C;  3C3O A;  4O1O A;  5FTP A;  5AQL B;  5TAO A;  4CI2 B;  1NL4 A;  3MYV A;  5AAR A;  4G63 A;  2ZU6 B;  4DV3 T;  1W0B A;  1UJK A;  4GIW A;  5DQV A;  1VRB A;  2GK9 A;  2P58 C;  3LBX A;  4IE6 A;  2WQY A;  4K0R A;  2GRR B;  2RPA A;  2F8X K;  5T4Y A;  1TNB A;  4LCT A;  2VTB A;  2GRN B;  3I5P A;  3NZP A;  5CRU A;  1N0R A;  4B8C B;  2VSO E;  3BEE A;  3ZMU B;  3HR0 A;  4QH5 A;  1AJ3 A;  3F6Q A;  3BQL A;  3UM2 A;  2AXZ A;  2WXK A;  3IHY A;  4JHJ A;  2LRL A;  4TN7 B;  4F3V A;  4HI9 A;  2X9Y A;  3LS8 A;  4U04 A;  2XHE B;  2WWU A;  2J62 A;  1KNZ A;  4CYM D;  2KZ7 B;  3O1H A;  1OCR E;  2XPY A;  2AW6 A;  1SA5 A;  3F31 A;  1RZ4 A;  3CHO A;  4E7S A;  3VRA A;  2VSN A;  4I55 E;  5EX0 A;  2WY2 A;  3P50 A;  4O8S A;  4TUY E;  4H9Q C;  3T1Y T;  3DSV A;  2JIW A;  4HXI A;  4NQ0 A;  3RC3 A;  3U3I A;  3EIJ A;  2KC7 A;  3SFE A;  2K9A A;  4LML A;  1U5P A;  3ASO E;  2WDR A;  1MX2 A;  4N3A A;  3P8C D;  5ENS D;  3IBE A;  2RD0 A;  3RRN B;  3LJC A;  1ZEE A;  2E9X C;  3PUV F;  4Z90 A;  1TEZ A;  2XGM A;  5FXW A;  2YK0 A;  4YSY A;  2WDQ A;  3PU3 A;  4JYA T;  3FP3 A;  4H63 V;  2E8I A;  5EX3 A;  4GZ6 A;  3D9M A;  3RGL A;  2MYO A;  3FH8 A;  3LY9 A;  1HFA A;  2WQ6 A;  4LSZ E;  4IST A;  1IHG A;  1KPS B;  3CVN A;  2R05 A;  2JQH A;  2W62 A;  3RU0 A;  2XEV A;  3OXG A;  2IO2 C;  5ABF A;  1IBM T;  3FUN A;  3EDT B;  3C5R A;  3DP7 A;  3CQC B;  3K3N A;  3IBP A;  3SRZ A;  3U78 A;  3P2B A;  5FVL A;  2WVI A;  5B1B E;  2BG9 E;  5AQR B;  4F53 A;  4GMJ A;  4IYP A;  1J1J A;  2C0M A;  2BKG A;  1OT8 A;  5BNW A;  4HFB A;  1I94 T;  4EZK A;  3Q2M A;  2AVP A;  4DID B;  3JQ0 A;  3O9X A;  4ZXL A;  1BLX B;  4WAF A;  3UM3 A;  3AE3 A;  4DR6 T;  3T5X A;  4QXB B;  4QWN B;  3AS5 A;  5FXX A;  5FY7 A;  1IBK T;  1M7K A;  1ZBP A;  2LSY A;  1U3D A;  2CBJ A;  3B7U X;  4N2S A;  4BEP A;  3FTU A;  2X6F A;  4HE8 A;  1KZP A;  1D1A A;  3RF1 A;  1X5B A;  2MBG A;  2YDS A;  4EQF A;  2X9W A;  4DVD A;  5IYZ E;  3FTS A;  3CGH A;  2FUL A;  2KZT B;  3UTM A;  1MZC A;  3ULE G;  3AS4 A;  3U64 A;  2XZE A;  1J5W A;  4AKG A;  2D2S A;  4XEI G;  1FVH A;  3RKO A;  5LJM A;  1IXV A;  4I17 A;  1ELW A;  3AEA A;  3LK3 B;  1IJ5 A;  2FO7 A;  4JZY A;  3AE5 A;  2ETB A;  5ENR D;  5FY0 A;  5JQG E;  4BTB A;  4RQI A;  4NUU A;  2XPK A;  3FUH A;  4WWO A;  3VLF A;  5T3R A;  3ONL A;  1UUR A;  3ZT7 A;  3N9L A;  4UF0 A;  3NZU A;  3CK9 A;  3QDN A;  4U0S A;  4V3I A;  3DSX A;  2J47 A;  4L1B A;  3TWW A;  3ZN0 B;  4HVB A;  1XNF A;  1IBL T;  1T8B A;  1E90 A;  3C72 A;  1Y64 B;  3PEU B;  2IIU A;  2IJG X;  1QYM A;  2L0T B;  3TLS A;  4G1T A;  4X5T A;  3L39 A;  1OY3 D;  3FHN A;  3TG4 A;  1G8X A;  4EBA G;  4PFP A;  1DNP A;  3TWU A;  3P4Q A;  4HFH A;  2LT3 A;  3DXK G;  5LB7 B;  4GU5 A;  5F8P A;  4DBR A;  5AQB A;  4XE0 A;  4JC8 A;  3FZF B;  3FU5 A;  3MA5 A;  3PE0 A;  3Q47 B;  3UU8 A;  5JR9 C;  3OVU A;  4Q69 A;  3DPY A;  2NC9 A;  1WDY A;  5FIN A;  3VKG A;  4DK5 A;  4C9B B;  4TXR A;  4KI0 F;  1TN8 A;  4JXT A;  4B3T T;  4ZS3 A;  2PZI A;  2LSV A;  2CPT A;  3CHP A;  4HFD A;  2NR4 A;  3LYA A;  3AEC A;  2DYR E;  3MV2 B;  3SBT B;  3LCA A;  1UOH A;  2PQR A;  4HBD A;  2AXU A;  3PZ4 A;  4YY3 T;  2QY7 A;  4TV3 A;  3AE1 A;  3HI2 A;  3KV4 A;  1BR0 A;  4TWF A;  4LF6 T;  1S70 B;  4I1M A;  4ASK A;  2V5Q C;  1N95 A;  1N94 A;  1S0P A;  1Z3Y A;  4HEA A;  2XEE A;  1E8X A;  3FUD A;  4DR1 T;  4L5G A;  3RRM B;  4H9O C;  1N4Q A;  2V5D A;  3EUH A;  4I6J A;  4A97 A;  1G3N B;  2H7V C;  4YDO A;  1S64 A;  4AVX A;  1OCO E;  3P1U A;  1O1T A;  2Y4T A;  3O4Z A;  2UY1 B;  3UU5 A;  4JB8 P;  2V6Y A;  5L3E B;  3CVQ A;  3FUI A;  3ZGQ A;  5JJ6 A;  1TN6 A;  3CX6 B;  1T7S A;  3EHR A;  3TJP A;  3AG2 E;  5LNK A;  1A5E A;  4EOZ B;  4UEM A;  1MMG A;  2BKP A;  3RQW A;  2CBI A;  3B7T A;  5AQK B;  4AV7 A;  4U72 A;  2L6B A;  4ILA A;  4JEU B;  5AN8 A;  2NYJ A;  4YTM A;  4DV7 T;  2VKH A;  2LHN A;  3JAD A;  3BUA A;  2UU9 T;  2XJ7 A;  1NAF A;  1H2U A;  2LUH A;  3JCF A;  4I1A A;  2MOW A;  4QHO A;  3ZC0 A;  2CCQ A;  2CHW A;  3U9W A;  3HHM A;  2Y0B G;  2C0S A;  4OVU A;  3TLW A;  2YKS A;  4ZFH A;  4LF4 T;  5HCM A;  1S94 A;  3TWX A;  3W9G A;  1OXZ A;  2NTY A;  3C50 A;  2WZI A;  1SA4 A;  2Q9Q D;  4B0Z A;  4WNE A;  4JI7 T;  4KBM B;  3D9H A;  1MMN A;  2ILR A;  4GTS A;  3ONJ A;  4UWL A;  4GTV A;  4A1G A;  4EGW A;  4URK A;  3CLJ A;  3I3N A;  5ENQ D;  2WXF A;  2YEV C;  4O4L E;  3CK8 A;  3MZL B;  1AP7 A;  3HIZ A;  3CVP A;  3TKL B;  5EYP F;  2A2F X;  1WFD A;  2CWO A;  4GYO A;  3HVE A;  5HEU A;  1LTX A;  3AG3 E;  3RSE G;  2IUB A;  1S63 A;  3NAW A;  2H6I A;  4HFV A;  4LF8 T;  4ILG A;  5JTG A;  5HEO A;  2C2L A;  5LOZ A;  2G0U A;  2QZA A;  1NEK A;  4TNV A;  2OA5 A;  1KT1 A;  4APO A;  2ZGG A;  3ASH A;  2OCC E;  3MK7 C;  4AEZ C;  5LCW J;  4MLP A;  4IN3 B;  3Q5W A;  3E32 A;  4NUR A;  4PW8 A;  1Z6T A;  4E7Z A;  3DPD A;  4BFR A;  3ENE A;  4PS3 A;  3QOF A;  2CEA A;  1E7U A;  5DAB A;  5KX5 E;  4HOU A;  4JL0 A;  3NOC D;  1OWL A;  4DUY T;  4UQX A;  2HHH T;  5JVD E;  5JRE A;  1N36 T;  2J8S D;  5A23 A;  3SS1 A;  4OYS A;  1VOM A;  3APF A;  2J07 A;  4ANU A;  3KD7 A;  2VGY A;  2CXL A;  3RIB A;  2DZN A;  5EDS A;  2BVM A;  1HX8 A;  4H63 H;  2XAS B;  4N39 A;  4U0U A;  4G25 A;  2E9X B;  3MCX A;  3PUS A;  5AFU L;  4LF9 T;  2E2E A;  2BG9 B;  1TJC A;  5ABE A;  1CHU A;  1TNZ A;  2X3M A;  1BU9 A;  3TLT A;  4U2Z A;  3CX8 B;  3RYF E;  4HS2 A;  2UUB T;  1IYG A;  5EID A;  2IU1 A;  3UTK A;  3IA3 A;  2KCL A;  3RIA A;  4IUL A;  3SD5 A;  5LFA A;  3RIU A;  5KJK A;  3V5S A;  2OLT A;  2VQF T;  3NOG D;  2YN6 A;  2UWJ G;  3QK0 A;  2LNI A;  4IE0 A;  3E08 A;  4KHZ F;  3Q79 A;  3PDY A;  1UGO A;  2YHC A;  2D0U A;  3ANW A;  3C98 B;  4PJL A;  2XCC A;  4PS7 A;  5LCW C;  4DV1 T;  3BQO A;  3L22 A;  3ZHE A;  4PJM A;  4U31 A;  4O60 A;  4QQI A;  2PM7 A;  3SGH A;  3ZKJ A;  3PEV B;  2I1J A;  2FJA A;  2CHO A;  3FWV A;  3KVA A;  3P4S A;  4LMK A;  2H6H A;  3RI5 A;  4L9I A;  3QKY A;  3D9J A;  1D9S A;  3OTO T;  3QWW A;  4GA0 A;  4O1P A;  5LA6 E;  4I9E A;  4IRU A;  3O48 A;  4JHK A;  1D1C A;  5LMN T;  4DR3 T;  1UN9 A;  4DV0 T;  5EYL A;  1K8K G;  4ANJ A;  3HKE E;  3ZCI A;  4B3S T;  5CB4 E;  4YJ2 E;  2C0L A;  3VLE A;  2C5J A;  1UW4 B;  3MGB A;  3FU3 A;  3VR9 A;  2N9D A;  4GAA A;  2LO6 A;  3GN5 B;  4C48 B;  2UUA T;  5HXS A;  3DRA A;  2KCK A;  3SWH A;  4MFR A;  2NW7 A;  2WXL A;  4F7A A;  1IZN B;  5BMV E;  2XM1 A;  3Q5D A;  2X51 A;  1HTJ F;  4TXP A;  4L23 A;  2YU2 A;  2H6G A;  4EZ4 A;  4YDW A;  2XSB A;  2XRY A;  3KSQ A;  4HRM B;  3FB2 A;  3UKU G;  4J8D A;  2N1G A;  3QC9 A;  1X81 A;  4H7Y A;  1SUM B;  3AS8 A;  1YD8 G;  4UWH A;  2LSK A;  3PUA A;  3ZCJ A;  2I6H A;  2ETA A;  4OK0 A;  4U8V D;  5E0O A;  3S4U A;  2FI7 A;  1IQU A;  2K24 A;  2CM0 A;  2UXX B;  3HL6 A;  2BTD A;  1WYC A;  2ZM0 A;  5ABG A;  4AXP A;  2X6K A;  4L0R A;  3S7B A;  5KBA A;  1MIV A;  2I1K A;  2IO3 C;  3B95 A;  3PUG A;  2DIW A;  5AQ9 A;  1N32 T;  2LXL A;  3CHQ A;  2HN2 A;  5HS0 A;  1N9A A;  3UT7 A;  4YTN A;  4FLB A;  3IKO B;  4AXH A;  3NBN B;  3HKB E;  3UM0 A;  3HXC A;  2VGE A;  2LE8 A;  4ANW A;  4PK4 A;  3MJW A;  2QYJ A;  2R5S A;  4UV8 B;  1YQ3 A;  3N9M A;  4BX9 A;  5LYJ E;  3LPZ A;  5G05 J;  5JR9 B;  4LF7 T;  4YTP A;  1BR1 A;  3AVR A;  5LBM A;  2CFU A;  2Q9Q B;  1MYO A; 
#chains in the Genus database with same CATH homology
 4I43 B;  3EVY A;  2MOZ A;  2WM9 A;  2XHE A;  5ARG A;  3FTV A;  4WNK A;  4XI9 A;  2QA7 A;  3ONK A;  3UPV A;  4XKC A;  1NA0 A;  5FP3 A;  4I1O B;  5KMG P;  2OOE A;  4AIF A;  3PTR B;  4HLE A;  4CI3 B;  3ZW3 A;  3KV5 A;  3NRX A;  2LSG A;  2GRM A;  1A17 A;  4WBN E;  3AU4 A;  3GZS A;  4EAH A;  2WBL A;  3ZYK A;  3UUN A;  4IE7 A;  4U0Z A;  3U4T A;  4U07 A;  3MKQ B;  4ZI7 E;  4FUL A;  3CWZ B;  4BSX A;  1WRD A;  1EZ3 A;  1WM5 A;  2DHR A;  4PNI A;  2VGX A;  4FLH A;  5G05 C;  2XRZ A;  5AJL A;  5JDF A;  2V7K A;  4MS6 A;  4UVA B;  2WXP A;  3MZK B;  5CA0 E;  3UUX A;  2MRI A;  2XUE A;  3RRW A;  2A72 A;  2P9B A;  4TZ4 C;  4U74 A;  1VDY A;  2A4Z A;  3QOU A;  5JDL A;  3ML9 A;  3ZLI A;  2NSZ A;  3N2G E;  4UEL A;  3J9X 1;  2L6J A;  5FWQ A;  3MEK A;  3UMV A;  1US7 B;  1KT0 A;  2EHO D;  4CDR A;  4WUY A;  3PZD A;  4A56 A;  4ANX A;  3PUQ A;  2NW8 A;  2B1E A;  4YHJ A;  4IE5 A;  4BTA A;  5LJN A;  2K48 A;  3ETU A;  5FZS A;  1JUQ A;  2ES0 A;  2I2O A;  5L3F B;  2WXQ A;  5GON E;  4FJO A;  2XGS A;  1HS6 A;  2J49 A;  1B7T A;  2V5F A;  2WMO A;  3QC1 A;  3AAI A;  2WXJ A;  4DMW A;  3P7I A;  3CKC A;  2KZT A;  3KV6 A;  5FT9 A;  3WAJ A;  4CEM A;  2Z6E A;  3CPZ A;  3D9P A;  4A1S A;  2KLQ A;  3C4W A;  3C4X A;  5C1D A;  5JDN A;  4GZ5 A;  4MBQ A;  5FNV E;  3R7R A;  4I50 E;  2I9C A;  4Y6C A;  3Q5X A;  2OVF A;  3S7F A;  2PFV A;  5CMY A;  4YFS A;  5D0O D;  4C0E A;  3EDV A;  3OYX A;  3UUL A;  2DCP A;  3CSF A;  4IIJ E;  3EIQ C;  1E8W A;  1FEW A;  3TXN A;  4J8S A;  5ENN A;  2C5I T;  3SFZ A;  2CMR A;  1WY6 A;  4ZI3 C;  3RRC A;  3RX6 A;  3CML A;  3K3Q C;  1EYH A;  1YW0 A;  4QX7 B;  4PH4 B;  1MNE A;  2BVL A;  4PK5 A;  2L8K A;  3SZ7 A;  5H6Q B;  3RYC E;  5HXE A;  4ATG A;  1TJF A;  5EKQ D;  2WB2 A;  2VQ2 A;  4KT6 B;  3G2V A;  2VAS A;  4XAX B;  1PAQ A;  3SOL A;  3AVS A;  1QNF A;  2E0I A;  3UT8 A;  4CT4 A;  3I9Y A;  3CHM A;  4BJM A;  1OWO A;  4U8H A;  2L9B A;  3RC8 A;  5AEN A;  5AJD A;  2WXM A;  4ILH B;  4CGV A;  4PK6 A;  3CEQ A;  4AQG A;  3LEW A;  4K03 A;  3LBX B;  4KXK B;  4LRZ A;  2D0T A;  1IAP A;  1MND A;  4QKN A;  2VTB B;  4BA9 A;  2PJQ A;  2IC9 A;  4R7L A;  4CT0 A;  4X1I E;  3D9I A;  2UY1 A;  4W9R A;  4MHC A;  2E9X D;  3DTO A;  2IC6 A;  3N9Q A;  4DLO A;  4EZL A;  4ZI2 C;  3NRY A;  5FQ4 A;  3TAX A;  3ESK A;  5J90 A;  3AA1 B;  4ACL A;  1H7C A;  4KVM A;  4N3C A;  5AYW D;  4C91 A;  4GML A;  4IHJ E;  3ZFW A;  4QX8 B;  3ZN1 B;  4D10 C;  2PBI A;  3ZMT B;  4J8F A;  4J0U A;  1GW6 A;  4JEH B;  2HO1 A;  2W0G A;  3L3P A;  2XAG B;  3EJN A;  4P0A A;  2W00 A;  3KAE A;  3T8M A;  3HA4 A;  3N9O A;  4I9C A;  1ZHC A;  3CIA A;  2VYI A;  3C4Z A;  5E76 A;  3NZQ A;  2XAF B;  2WXO A;  3FXE B;  2FF4 A;  2L0I A;  1UJJ A;  3SHF A;  5CHE E;  3T5V A;  1UG3 A;  2MYS A;  4PJJ A;  4IGU A;  1H0A A;  4AJW A;  3AAE B;  3U3W A;  4LUN U;  3MX3 A;  3R84 B;  5C8Y E;  4DND A;  4EZH A;  2J4D A;  4G23 A;  2EHO B;  4DLQ A;  4V1A v;  4N5C A;  3ASF A;  1QUU A;  3VU7 H;  3ZMV B;  5HQ8 A;  3RO2 A;  3PDN A;  2VL8 A;  3Q15 A;  4XI0 A;  2VJ8 A;  4B6X A;  5HXH A;  4OFZ A;  5JDH A;  3V5U A;  4AKL A;  4XX5 A;  2NXP A;  5LHI B;  3Q4A B;  1SHZ C;  1JPL A;  4BT8 A;  2DCF A;  3CVL A;  2BZB A;  5CMW A;  1EPU A;  1E8Z A;  4DO0 A;  3JCK C;  3FUJ A;  5JDM A;  4O2B E;  2Y4U A;  3QJZ A;  4GA1 A;  3ZPO A;  4F1S A;  3FUK A;  3NZS A;  5G55 A;  3H37 A;  1HG5 A;  3BQK A;  5LXT E;  2X6J A;  4UF0 B;  4JA7 A;  5EK3 A;  3ZYQ A;  5JJ7 A;  4P0B A;  2W61 A;  3SBS A;  4AM9 A;  4G2V A;  4QFV A;  2LM9 A;  2V7L A;  4KZC A;  3G2W A;  1P5Q A;  1MMA A;  2J4B A;  2VKD A;  4KBQ A;  4WBO A;  4J2C A;  3IF8 B;  4MLK A;  2Y3A A;  3MA9 A;  3FHE A;  3ZC1 A;  4UI9 J;  2V7J A;  4HOR A;  1ELR A;  5T8I A;  2NW9 A;  1WYB A;  1OUV A;  4B8A A;  4FC8 A;  4N2Q A;  1LKX A;  5J2T E;  2JRK A;  2CFZ A;  2X9X A;  5ANR A;  3DBS A;  2CLY C;  4HN9 A;  3WI3 A;  1QQE A;  3PU8 A;  4DMV A;  4YLH A;  4ANV A;  5A7D B;  3RKV A;  4F6R C;  4LEU A;  3FEY A;  1HE8 A;  2GGF A;  1Y6I A;  3S7D A;  2NP9 A;  3FUM A;  4UIG A;  5ETW A;  2CE7 A;  3UT4 A;  2ODV A;  4QXH B;  1T98 A;  1O3X A;  4JW1 A;  3VHL A;  1H6K A;  4E85 A;  4UI9 C;  2BF0 X;  5FZQ A;  4ACK A;  3QK6 A;  4GYY A;  3CKB A;  1KLX A;  2KCV A;  3I4G A;  1N54 A;  2UXN B;  5FJY A;  1BPO A;  3CVR A;  2LAH A;  4DPR A;  3Q5M A;  4KP3 C;  1PC2 A;  3D9N A;  3L17 A;  5BW8 C;  1FMW A;  4TRQ A;  3JC6 C;  2WPV A;  1YKH B;  2YNQ A;  1LRZ A;  3FH7 A;  4CXY A;  3N2K E;  3O1J A;  5LHH B;  2Q9Q A;  5LP0 A;  5A1L A;  3ZEF B;  3LG7 A;  3PRE A;  2OND A;  1OWN A;  4X20 E;  5KCM A;  4AQF A;  4GA2 A;  5M4Y A;  4G26 A;  2CG2 A;  3KBT A;  2NWB A;  4L2Y A;  5KJN A;  1Y8M A;  3JYS A;  3KIN B;  2LJL A;  1HCI A;  4GZD A;  2DWK A;  4PUC A;  4LER A;  4Q96 A;  2VK9 A;  4N3B A;  3VTX A;  5FY1 A;  3HVE B;  3FH5 A;  3PRZ A;  1D1B A;  1E1H B;  4IE4 A;  2L3L A;  4WWN A;  5LG4 A;  2V8S E;  2VB6 A;  4NAC A;  2X6I A;  2HM8 A;  3L09 A;  3N71 A;  4GCO A;  3FBZ A;  3K8P C;  2NTX A;  4ILU A;  4WNG A;  5BUZ A;  4I2Z A;  3ZMZ B;  1ZV4 X;  2AXV A;  3KBU A;  4U63 A;  2CHX A;  3FUL A;  4J6I A;  4JLE A;  4HKA A;  1EF1 C;  3HKD E;  5KJL A;  2X9H A;  4GK5 E;  4EEC A;  3GA8 A;  4G2A A;  4AP2 A;  5HYA A;  2KT9 A;  5FQ8 A;  2LOS A;  3RYH E;  2HPJ A;  4A55 A;  3HDX A;  3ZPJ A;  2J9Q A;  4CXX A;  2CXD A;  1LVK A;  4DJA A;  1IQR A;  1WLX A;  3CX7 B;  5FXV A;  4FJY A;  4H9N C;  2V4L A;  3ZJ1 A;  4O2A E;  3ANW B;  2WMN A;  3TL5 A;  4ILI A;  2J08 A;  3FU0 A;  3LK4 2;  4OYJ A;  3QB2 A;  4QXC B;  3QAR A;  3PVL A;  2XPZ A;  4WNF A;  1NA3 A;  2JMK A;  5EK4 A;  3RRU A;  4RVB A;  4JVS A;  2NOX A;  4UVB B;  5L3D B;  2WSS V;  2K5B B;  4ZHQ E;  4AI6 A;  3PE4 A;  3IHR A;  3R7Q A;  4ADZ A;  4ZOL E;  3N9N A;  3CVU A;  1INZ A;  1ZU2 A;  3C64 A;  4KMO A;  3ZMS B;  2DLR A;  3OBV E;  1D0Y A;  5ADX L;  1LF8 A;  1V9D A;  2IOL A;  5L2L A;  3SI5 A;  3H3A A;  2OV8 A;  1Z0P A;  4IDZ A;  1HS7 A;  3O1I A;  3ZRH A;  3FFL A;  5FZR A;  4CCA A;  1MMD A;  3FDH A;  2QFC A;  2LOP A;  4UQZ A;  3AU5 A;  3BG0 B;  1YKE B;  5BT1 A;  1SZ9 A;  2X68 A;  3GZ1 A;  2XAQ B;  1YA0 A;  2PM6 A;  3RH3 A;  1ELK A;  3CK7 A;  4EIW A;  4A3V A;  3ETV A;  1UN8 A;  3PUK A;  2X67 A;  2L9Q A;  3B7R L;  4GYW A;  4UXN B;  5LGN B;  4UWG A;  1MIW A;  4BAY B;  4KUM B;  3ASG A;  4FU3 A;  3ZN3 A;  1G73 A;  4TV9 E;  3ZVV A;  4CZZ B;  1XGW A;  4ABN A;  4AOF A;  3LFM A;  4HTE A;  1EDU A;  3AB3 B;  2VWA A;  4B89 A;  3ULQ A;  3IEG A;  2CG3 A;  3LVR E;  3KFW X;  2CLY B;  5C2Y A;  3KDS E;  2XTL A;  5FMN A;  2RA1 A;  4ERR A;  3O4X E;  4CI1 B;  2JJ9 A;  2PL2 A;  4ISS A;  4JEH A;  2YU1 A;  3UT5 E;  4GB9 A;  1E7V A;  4M3O A;  4P29 A;  2CXF A;  3GW4 A;  2I59 A;  2XCB A;  5BPP A;  5G2N A;  1E96 B;  3E4B A;  3I1A A;  4KVO A;  2VGX B;  4BJN A;  3GMI A;  4WND A;  3G2T A;  1SZA A;  3ZYL A;  4I6E A;  3UUX B;  2X66 A;  1HO8 A;  2IF4 A;  4X1Y E;  2LSU A;  4I6G A;  3SF4 A;  1WR6 A;  5JRC B;  1SA0 E;  2EHO A;  4GOU A;  5EK2 A;  5LOV E;  4AKR B;  2ODU A;  3FTZ A;  4GK0 E;  2X0L B;  1E8Y A;  1U3C A;  4CXW A;  1NP7 A;  2GW1 A;  4A3T A;  3LJ3 A;  3FTY A;  3IHV A;  4KYO B;  3NF1 A;  3AA6 B;  3CV0 A;  5JHB A;  4WW0 A;  4Z8X A;  4AY5 A;  2J09 A;  4K0U A;  3S2A A;  3JQ1 A;  3MJX A;  1NZN A;  3F57 A;  1HH8 A;  4UQY A;  5L3B B;  2CHZ A;  2IOS A;  3PS6 A;  5HXR A;  5AIJ A;  4MRU A;  1FIO A;  5D0Q D;  2ZM8 A;  2FBN A;  4JUY A;  3VLD A;  4CDM A;  4JEU A;  3LY7 A;  2EQX A;  5ANL A;  4ZI3 D;  3CVX A;  4TUU A;  5HWY A;  2D5U A;  4HOS A;  1MIY A;  2JLB A;  4X1K E;  3PUR A;  5JDQ A;  3AAA B;  3D0T A;  4BT9 A;  4AKH A;  4O4J E;  5HWX A;  4YND A;  3RPU A;  3I0O A;  2V7I A;  3WXX A;  2DBA A;  3FY4 A;  5LHG B;  3E0Z A;  4EYU A;  4XBF B;  1MHQ A;  1U4Q A;  4UV9 B;  3WAK A;  2WXG A;  2R17 C;  3I9W A;  3CVW A;  2XPI A;  4HOQ A;  2X6H A;  4BX8 A;  5JDG A;  3R6N A;  2KMF A;  3OXL A;  5DBK A;  2YIN A;  4G11 A;  2JEK A;  1FMV A;  4N78 D;  4C90 A;  3CVY A;  1SQM A;  3APC A;  1X79 A;  3CHR A;  4HOT A;  2JMH A;  3BK9 A;  3FTX A;  1D0Z A;  4MAL A;  1LVF A;  5DQW A;  2XQ0 A;  3W15 B;  3K9I A;  2XQY A;  2XAJ B;  4TX5 A;  5F3J A;  1H2V C;  2ION A;  3ZXS A;  4H9R C;  4GPK A;  2WAU A;  3L13 A;  1HU3 A;  3L16 A;  3N9P A;  1NWM X;  2Q9Q C;  1B89 A;  1S35 A;  3E22 E;  4RSY A;  1HZ4 A;  3Q9D A;  3QWP A;  4EB6 E;  1WAO 1;  3RYI E;  4AQF C;  2OVB A;  3B13 A;  3LVQ E;  2RG8 A;  4CQI A;  3ZYM A;  4ZI2 D;  3VKH A;  3RK6 A;  5LGT B;  3AA7 B;  3LDZ A;  4YVQ C;  3FEX A;  3Q49 B;  4AY6 A;  5CCM A;  4CRW A;  3URZ A;  4H9S E;  5BV1 A;  4KMC A;  3QNK A;  2CWY A;  5FQ6 A;  3PNT B;  2M67 A;  4O6F A;  3FUE A;  1FCH A;  2LSJ A;  2E9X A;  3CQX C;  3B7S A;  1HG2 A;  5HAX A;  2HH7 A;  4OYK A;  1HXI A;  2WQH A;  3EDU A;  2IW5 B;  2KWH A;  1BR4 A;  3QWV A;  1PY1 A;  4KZ0 A;  4L2L A;  3LK2 B;  4APF A;  3F2E A;  4UI9 K;  1OWA A;  5FXZ A;  3QAQ A;  3T8O A;  4UWF A;  5CCL A;  4HGA A;  2KWI B;  4AKI A;  3C98 A;  2VKO A;  3B57 A;  2ZM2 A;  3HKC E;  3TXM A;  3BG1 B;  2XGO A;  4DBQ A;  2QGS A;  3ONX A;  4BY6 A;  4FHJ A;  2VSY A;  4E6H A;  1UCU A;  4O4I E;  2VKJ A;  3OKQ A;  1ZKE A;  4OHF A;  4MKT A;  4FA6 A;  5JHA A;  4P09 A;  5JH7 E;  1QSD A;  1W3B A;  3ZEF A;  4I2W A;  2W63 A;  2AWI A;  3GWH A;  2LHR A;  2GRL A;  4H9P C;  2JPF A;  1OWP A;  4J8E A;  3KV9 A;  1UX4 A;  3NQP A;  3LXU X;  3ML8 A;  3ZIM A;  4TV8 E;  2HPL A;  4EYY R;  2KM4 A;  1QZ2 A;  5LCY A;  3OAW A;  3C51 A;  3GN5 A;  3A5X A;  3CR3 A;  3IV0 A;  3MV3 B;  3FBL A;  2KAT A;  2YQ8 A;  4ZS2 A;  5L3G B;  2PQN A;  3TGO A;  3OXF A;  3D9L A;  4C0M A;  5J2U E;  3UQ3 A;  3PNL B;  4Q94 A;  1OWM A;  2PG8 A;  4YVO A;  5M72 A;  5LBQ B;  4FAD A;  3L6A A;  4XZC A;  1HF8 A;  4H7X A;  5FQ7 A;  2BDE A;  3CVV A;  3AA0 B;  2YHE A;  1FVF A;  3OYZ A;  3KS2 A;  2IQC A;  4PAG A;  3EHM A;  2DWG A;  3FU6 A;  2A3D A;  2MHK A;  3UX4 A;  3RO3 A;  3CQG B;  3I4R B;  3DJB A;  3I0Q A;  3ZJ2 A;  4RG6 A;  1KK7 A;  3OJA A;  4DI4 A;  2KXP B;  3MXZ A;  5JR9 A;  4FP7 A;  2Q7F A;  5CA1 E;  2DNX A;  5E75 A;  4CGW A;  1UX5 A;  2LAI A;  1H2T C;  4I43 A;  2WXH A;  1IJ6 A;  4CDN A;  5A6C A;  4RG9 A;  4BWR A;  2R59 A;  4B94 A;  4JPS A;  3GYZ A;  3SNX A;  4JA9 A;  2V7M A;  5DJQ C;  5JJT A;  3TG5 A;  3K3O A;  3CHS A;  4XZ4 A;  4ME2 A;  2V1D B;  2A5U A;  2V26 A;  3KVB A;  2ZMA A;  2WXI A;  4PFO A;  2SPC A;  2H7O A;  3IEE A;  5J1G A;  2Y8D A;  2M63 A;  4M1P A;  2V0P A;  4OVV A;  4I4T E;  3HYM B;  5HI7 A;  3MKQ A;  2C5K T;  2RP4 A;  2HYZ A;  4HFG A;  1MQS A;  4PS8 A;  5LP6 E;  4L7T A;  3MKR A;  3EHN A;  2N2N A;  2Y6X A;  3RJV A;  5LX8 A;  1N52 A;  5IHY A;  2BUG A;  3OTN A;  4EPZ A;  2IAK A;  3G2S A;  2FEZ A;  2WXN A;  3FUF A;  3U66 A;  3N2O A;  4FHK A;  2LEH A;  5HXC A;  3D3M A;  3L08 A;  3G2U A;  3QUJ A;  3ASD A;  3FTW A;  3UFE A;  2LSI A;  2CA5 A;  2DI4 A;  4NRH B;  1Z3X A;  4GZ3 A;  3JC6 D;  4WWP A;  5ARF A;  4UVC B;  4GYR A;  5H6R B;  1H19 A;  3GZ2 A;  5J08 A;  3CKD A;  5LGU B;  3MKD A;  5FYM A;  3NBX X;  5KDM C;  3PH0 C;  3MAC A;  1D0X A;  2EHO C;  3ZHE B;  5DIZ A;  3L54 A;  3PE3 A;  4PDX A;  1JWF A;  3JUI A;  4Y6W A;  2MTQ A;  4GYS A;  1L5J A;  4YJ3 E;  3M65 A;  4XKB A;  4G24 A;  4EZJ A;  5BV0 A;  3KEZ A;  3CST A;  3D9O A;  3LKU A;  3APD A;  2WXR A;  2KND A;  5G04 J;  2KIN B;  4XIF A;  4PJN A;  4UWK A;  5L3C B;  1JWG A;  2VSX E;  4JHR A;  3VTY A;  2HR2 A;  2H3R A;  3PUJ A;  2WQ7 A;  3ESL A;  3FXD B;  2J1D G;  3R9A B;  2X38 A;  4EXT A;  2IFU A;  1BR2 A;  2Y48 B;  5EZY E;  2ZLY A;  1DVP A;  4GCN A;  4NUV A;  4FJZ A;  2XAH B;  4FI5 A;  3BQI A;  3LY8 A;  4DI3 A;  3J7Y q;  3D9K A;  3S7J A;  2JQQ A;  1CUN A;  5KJM A;  4EBA A;  4O4H E;  3N5L A;  3UUM A;  4GZC A;  2ACX A;  5JRC A;  5G04 C;  5FTP A;  5TAO A;  4CI2 B;  3MYV A;  4G63 A;  2ZU6 B;  1UJK A;  4GIW A;  1VRB A;  5DQV A;  2GK9 A;  2P58 C;  3LBX A;  4IE6 A;  4K0R A;  5T4Y A;  4LCT A;  2VTB A;  3I5P A;  3NZP A;  4B8C B;  2VSO E;  3BEE A;  3HR0 A;  3ZMU B;  1AJ3 A;  3BQL A;  2AXZ A;  2WXK A;  3IHY A;  4JHJ A;  4TN7 B;  4F3V A;  2X9Y A;  3LS8 A;  4U04 A;  2XHE B;  2WWU A;  1KNZ A;  2KZ7 B;  3O1H A;  2XPY A;  2AW6 A;  3F31 A;  3CHO A;  4E7S A;  2VSN A;  4I55 E;  5EX0 A;  4TUY E;  4O8S A;  4H9Q C;  4HXI A;  4NQ0 A;  3RC3 A;  3U3I A;  3EIJ A;  2KC7 A;  2K9A A;  1U5P A;  4N3A A;  3P8C D;  3IBE A;  2RD0 A;  3RRN B;  3LJC A;  1ZEE A;  2E9X C;  1TEZ A;  2XGM A;  5FXW A;  2YK0 A;  3PU3 A;  3FP3 A;  4H63 V;  2E8I A;  5EX3 A;  4GZ6 A;  3D9M A;  3FH8 A;  3LY9 A;  1HFA A;  2WQ6 A;  4IST A;  1IHG A;  3CVN A;  2W62 A;  3RU0 A;  2XEV A;  3OXG A;  3FUN A;  3EDT B;  3DP7 A;  3CQC B;  3K3N A;  3IBP A;  3SRZ A;  3U78 A;  3P2B A;  2WVI A;  4F53 A;  4GMJ A;  4IYP A;  2C0M A;  5BNW A;  4EZK A;  3Q2M A;  2AVP A;  3JQ0 A;  3O9X A;  4WAF A;  3T5X A;  4QXB B;  4QWN B;  3AS5 A;  5FXX A;  5FY7 A;  1ZBP A;  2LSY A;  1U3D A;  3B7U X;  4N2S A;  3FTU A;  2X6F A;  4HE8 A;  1D1A A;  1X5B A;  2MBG A;  4EQF A;  2X9W A;  4DVD A;  5IYZ E;  3FTS A;  3CGH A;  2FUL A;  2KZT B;  3AS4 A;  3U64 A;  4AKG A;  2D2S A;  1FVH A;  3RKO A;  5LJM A;  4I17 A;  1ELW A;  3LK3 B;  1IJ5 A;  2FO7 A;  4JZY A;  5FY0 A;  5JQG E;  4BTB A;  4NUU A;  3VLF A;  3FUH A;  4WWO A;  5T3R A;  3ONL A;  3N9L A;  4UF0 A;  3NZU A;  3CK9 A;  3QDN A;  4U0S A;  4V3I A;  4L1B A;  3ZN0 B;  4HVB A;  1XNF A;  1E90 A;  1Y64 B;  3PEU B;  2IJG X;  2L0T B;  4G1T A;  3TG4 A;  3FHN A;  1G8X A;  4EBA G;  4PFP A;  1DNP A;  2LT3 A;  4GU5 A;  5F8P A;  4DBR A;  4XE0 A;  4JC8 A;  3FU5 A;  3MA5 A;  3PE0 A;  3Q47 B;  5JR9 C;  4Q69 A;  2NC9 A;  3VKG A;  4DK5 A;  4C9B B;  4JXT A;  4ZS3 A;  2PZI A;  2LSV A;  3CHP A;  3LYA A;  3MV2 B;  3SBT B;  3LCA A;  2PQR A;  2AXU A;  2QY7 A;  4TV3 A;  3HI2 A;  3KV4 A;  1BR0 A;  4I1M A;  4ASK A;  1S0P A;  1Z3Y A;  4HEA A;  1E8X A;  3FUD A;  4L5G A;  3RRM B;  4H9O C;  3EUH A;  4I6J A;  2H7V C;  4AVX A;  3P1U A;  2Y4T A;  3O4Z A;  2UY1 B;  5L3E B;  3CVQ A;  3FUI A;  3ZGQ A;  5JJ6 A;  3CX6 B;  3TJP A;  5LNK A;  4EOZ B;  4UEM A;  1MMG A;  3B7T A;  4AV7 A;  4U72 A;  4JEU B;  2VKH A;  2LHN A;  1NAF A;  1H2U A;  4I1A A;  2MOW A;  4QHO A;  3ZC0 A;  2CCQ A;  2CHW A;  3U9W A;  3HHM A;  2C0S A;  4OVU A;  1S94 A;  1OXZ A;  2NTY A;  3C50 A;  2Q9Q D;  4B0Z A;  4WNE A;  4KBM B;  1MMN A;  2ILR A;  4UWL A;  4A1G A;  4URK A;  3CLJ A;  3I3N A;  2WXF A;  2YEV C;  4O4L E;  3CK8 A;  3MZL B;  3HIZ A;  3CVP A;  3TKL B;  2A2F X;  2CWO A;  4GYO A;  3HVE A;  4HFV A;  4ILG A;  2C2L A;  5LOZ A;  2G0U A;  1KT1 A;  2OA5 A;  4APO A;  3ASH A;  3MK7 C;  4AEZ C;  5LCW J;  4MLP A;  4IN3 B;  3Q5W A;  4NUR A;  4PW8 A;  1Z6T A;  4E7Z A;  3DPD A;  4BFR A;  3ENE A;  4PS3 A;  2CEA A;  1E7U A;  5DAB A;  5KX5 E;  4HOU A;  4JL0 A;  1OWL A;  4UQX A;  5JVD E;  5JRE A;  5A23 A;  3SS1 A;  4OYS A;  1VOM A;  3APF A;  2J07 A;  4ANU A;  3KD7 A;  2VGY A;  2CXL A;  3RIB A;  5EDS A;  2BVM A;  1HX8 A;  4H63 H;  2XAS B;  4N39 A;  4U0U A;  4G25 A;  2E9X B;  3MCX A;  3PUS A;  5AFU L;  2E2E A;  1TJC A;  2X3M A;  3CX8 B;  3RYF E;  4HS2 A;  1IYG A;  2IU1 A;  3UTK A;  2KCL A;  4IUL A;  3SD5 A;  5LFA A;  5KJK A;  3V5S A;  2UWJ G;  3QK0 A;  2LNI A;  4IE0 A;  3E08 A;  3PDY A;  2YHC A;  2D0U A;  3ANW A;  3C98 B;  4PJL A;  2XCC A;  4PS7 A;  5LCW C;  3L22 A;  3ZHE A;  4PJM A;  2PM7 A;  3SGH A;  3PEV B;  2I1J A;  3FWV A;  3KVA A;  3QKY A;  4L9I A;  3D9J A;  3QWW A;  4GA0 A;  5LA6 E;  4I9E A;  4IRU A;  3O48 A;  4JHK A;  1D1C A;  1UN9 A;  4ANJ A;  3HKE E;  3ZCI A;  5CB4 E;  4YJ2 E;  2C0L A;  3VLE A;  2C5J A;  1UW4 B;  3MGB A;  3FU3 A;  2N9D A;  4GAA A;  2LO6 A;  3GN5 B;  5HXS A;  2KCK A;  3SWH A;  4MFR A;  2NW7 A;  2WXL A;  4F7A A;  1IZN B;  5BMV E;  2X51 A;  1HTJ F;  4L23 A;  2YU2 A;  4EZ4 A;  2XRY A;  3FB2 A;  4J8D A;  2N1G A;  3QC9 A;  4H7Y A;  3AS8 A;  1YD8 G;  4UWH A;  2LSK A;  3PUA A;  3ZCJ A;  2I6H A;  4OK0 A;  5E0O A;  3S4U A;  2FI7 A;  1IQU A;  2K24 A;  2CM0 A;  2UXX B;  3HL6 A;  2BTD A;  1WYC A;  2ZM0 A;  2X6K A;  4AXP A;  4L0R A;  3S7B A;  1MIV A;  2I1K A;  3PUG A;  2DIW A;  3CHQ A;  3UT7 A;  4FLB A;  3IKO B;  4AXH A;  3HKB E;  2LE8 A;  4ANW A;  4PK4 A;  3MJW A;  2R5S A;  4UV8 B;  3N9M A;  4BX9 A;  5LYJ E;  3LPZ A;  5G05 J;  5JR9 B;  1BR1 A;  3AVR A;  5LBM A;  2CFU A;  2Q9Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...