3CQCB

Nucleoporin nup107/nup133 interaction complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
225
structure length
186
Chain Sequence
SHMLSWLHEINSQELEKAHATLLGLANMETRYFAKKKTLLGLSKLAALASDFSEDMLQEKIEEMAEQERFLLHQETLPEQLLAEKQLNLSAMPVLTAPQLIGLYICEENRRANEYDFKKALDLLEYIDININDLKLEILCKALQRDNWVSKDSIFVKILLPEVKDLLQADEFVLKANYEYYVQGQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional studies of Nup107/Nup133 interaction and its implications for the architecture of the nuclear pore complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Nuclear pore complex protein Nup107
total genus 55
structure length 186
sequence length 225
ec nomenclature
pdb deposition date 2008-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1380 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3cqcB01
1.25.40.700 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3cqcB02
3CQGB 3CQCB 3I4RB
chains in the Genus database with same CATH superfamily
4COFA 4P29A 4YSXA 4K5CA 3RKOA 2FO7A 3AS8A 4IT4A 2KZTA 3DBSA 3P4QA 2FULA 3T9KA 2VURA 5JR9B 4N5CA 4ASKA 3WAJA 4GTVA 2H7OA 4APFA 5LMNT 1N4PA 2X67A 1D9SA 4G2VA 5JR9C 3HRAA 4IHJE 3UUXA 3Q5EA 2ILRA 4AVXA 4ILGA 4EBAA 3PNLB 1SA5A 3MACA 4UVBB 4FJYA 3SOLA 2AJAA 2QYUA 5L3CB 4GPMA 2MYSA 1MMDA 4EYYR 5EN5D 2VQET 2WY2A 3RC3A 4B8AA 2JQQA 1X5BA 3R84B 1FT2A 4BT9A 4DBQA 4Q94A 3C3OA 5ADXL 4HS2A 1D1AA 4BA9A 3CV0A 4B3RT 2JIWA 4N2SA 4AIUA 2J47A 3ZIMA 4PUCA 3QDNA 3NZQA 2BTDA 4I43B 3AE4A 3L13A 2ZM6T 4U2YA 3UU8A 2I6HA 2ZM2A 3OAWA 5E75A 1MYOA 5FT9A 4Q69A 4G24A 3IEEA 3PH0C 4ERRA 4JA9A 3RU0A 4UI9C 5JJ6A 2XQ0A 2WXLA 3N9NA 4LMKA 4DR4T 3AE8A 5C8YE 3P2BA 3DP7A 4ILBA 4UI9K 2F8YA 2VSOE 4DMVA 3Q5MA 4YXDA 2BEDA 3FUDA 3HIZA 3MEKA 3UULA 4U95D 1IQRA 2PM6A 4XI0A 5KDMC 4HVBA 5JJTA 5KWDA 4AKRB 1OWMA 2XAQB 2XS8A 4U3CA 5FVKA 4UR9A 1E8XA 5EDSA 2UY1B 3FTSA 1TN8A 4HFBA 4YHHT 5HXCA 4GA1A 3BUAA 3OKQA 3PU8A 5J2UE 2E9XD 2XEVA 2CFUA 2OVBA 3ASFA 2LJLA 3F31A 2PG8A 1MX4A 3FUNA 1T72A 2IMLA 4WBNE 3V31A 2UUBT 4YFSA 5FY0A 4I1OB 2FBWA 4YDWA 1MMAA 2Y8DA 5FZRA 2WXRA 4J7WA 4HEAA 4CYMD 3D9JA 4MALA 4ANVA 4O4LE 3FXEB 4ZZBA 4CN1A 5GONE 2M6IA 4K0KT 3WG7E 3KBUA 2HPJA 1OEDC 5DQVA 3UM1A 5HEJA 5HEHA 1KZOA 3KINB 2ZLYA 2KWIB 4ILCA 1SZ9A 2B0OE 4JHKA 1ZEEA 4F53A 3JC6D 4PW8A 3RYCE 4BFRA 1JPLA 3RKVA 4YVOA 2BKPA 3KV9A 2IAKA 5HCMA 2X6FA 4P1NA 2J8SD 4HRLA 4B94A 3ZW3A 3ESLA 2P9SG 2PNNA 1OWAA 4K03A 4AQGA 3FH7A 3NB2A 3MZLB 3TJPA 5JDGA 5LCWC 4MBQA 5C2TA 1K3ZD 2LSUA 4YDOA 2J07A 2VWAA 3ZT7A 2VGYA 5FWQA 3EJNA 4ILHB 2X9HA 4BETA 2R02A 4C48B 2WXFA 2XAHB 3ZYQA 1BR2A 4UEMA 4GTSA 3ASHA 4IE5A 3NF1A 4TV3A 3ZEFB 1OUVA 3MX3A 3N9QA 5LMUT 4F1PA 2XAFB 1NWMX 4IE0A 4G23A 4XZ4A 2LSIA 5JDHA 4WAFA 2KSRA 4DUYT 3FWVA 5FQ7A 2DLRA 4G8LA 4QXBB 2VKJA 4ANJA 2BG9A 2ZGGA 4AOFA 1S0PA 4PNIA 2LKHA 4H7YA 2QFCA 3UT8A 3RPUA 2X38A 3EIJA 3WXXA 5BT1A 3NQPA 2I1KA 1BR0A 3CHRA 4DR7T 3S7BA 2R03A 5G05J 1BI8B 3UU5A 5EK4A 4AP2A 4Z8XA 3UKRG 3SI5A 4BTAA 3EVYA 4AKIA 4QHOA 2KM4A 1FJGT 4MS6A 2BS3A 4UQXA 2LUHA 3L09A 4IDPA 3R6NA 3FTVA 1KLXA 4ME2A 1W0BA 1D0YA 4TUMA 2KCKA 2R59A 3CQCB 3UTKA 5CMWA 4LF5T 3Q7AA 3V2XA 5BXOA 4G2AA 1JWFA 4W9RA 4ACKA 2XAJB 3KFWX 4UXNB 3CK7A 3CVPA 2XUEA 3MGBA 5JRCA 5IYZE 5LG4A 4DR5T 3O4ZA 4G1TA 5HWYA 2E2EA 3MJWA 4B6XA 4L9IA 4L2LA 1N95A 5EILA 2WXKA 1E1HB 1V55E 4BESA 2DCFA 2VSNA 3TAXA 2H6FA 4DNDA 3VKHA 2I59A 1K8KG 3QB5K 2BS2A 2IW5B 5LOVE 3AU5A 2MAWA 4CZ2D 5IY5E 2HO1A 4KUMB 2VGXA 3ZCJA 4WWPA 1N34T 4E6HA 3MZKB 3GA8A 4GZ6A 4O1PA 4A5XA 5M72A 4EXTA 1FVHA 3RIUA 3S7FA 2J4DA 1SA4A 3MK7C 4BTBA 3HYMB 3U66A 5D66A 3KAEA 4I6EA 1E8YA 3SFZA 3CKCA 5L2LA 2E9XB 4AISA 3G2WA 5JDMA 3FU5A 3I3NA 4TUUA 3LVQE 5FZSA 1WAO1 4DV0T 3J5PA 3U3WA 1ZKEA 4I9CA 2WM9A 2XASB 3CQXC 1WLXA 3CGHA 1MMGA 4HWHA 4IN3B 3ZLIA 1QQEA 3AECA 5F5WA 2K9AA 1MX2A 4IE4A 3FZLB 4QX8B 3A5XA 4YY3T 3UUMA 2DYSE 3A8YC 4X65T 3KBTA 3KSLA 4EZ4A 1XNFA 3I5PA 3PZ4A 2CRBA 2AE9A 1EF1C 3C4ZA 1HO8A 3NZSA 3AXJB 4AXHA 2ETAA 1ELRA 4WBOA 5ETWA 3ZN0B 3ZT6A 3FB2A 4HFCA 2I1JA 3Q15A 1T98A 5AQRB 3ZC0A 5JH7E 3AE2A 2IIUA 2Q9QD 2FJEA 3E30A 4N5QA 4U04A 4GAAA 4PK4A 4LF4T 1IJ6A 2MOZA 3J9X1 3GYZA 1H2VC 3QNKA 5KJMA 2YDSA 4I17A 3P4WA 2WXJA 3FUMA 2ODUA 3L8RA 4JEUA 1H2TC 2LSGA 2NXPA 4DI3A 4ZXLA 3PEVB 3L9TA 2K3WA 4JEHA 1N32T 1KNZA 4FI5A 4MLPA 3RHWA 4CGVA 3C51A 4HOUA 4UV8B 3KS2A 3QC9A 1UX5A 5FQ8A 4UWGA 2CFZA 2JRKA 1HTJF 1VCTA 3U9WA 4LNBA 2WDRA 4HWCA 3MKDA 3PUKA 3PZ2A 2JPFA 4GZ3A 3GZ2A 1MIYA 3L3PA 5JDLA 3MV2B 5HRYA 2FBNA 3TG4A 1JWGA 4U8YD 2QRXA 5LCWJ 4OYKA 2KNDA 4I1AA 3D3MA 2GRRB 3SZ7A 5HXRA 3JXJA 5FYMA 4DIDB 4L0RA 2VYIA 5HKPA 5JDFA 4GOUA 2LXMA 1IJ5A 3F6QA 3K1SA 5HAXA 5FY1A 2IONA 1UW4B 5AJDA 5L4HA 2LRKA 3C4WA 5KJNA 3UQ4A 3X1DA 1OEDE 1NZNA 2XM1A 2XRZA 3EHQA 2Y4TA 3EIQC 3IBPA 5B1AE 4A55A 3PNTB 3DEPA 4GA2A 2XPIA 3CMLA 3HR0A 4LFCT 2A2FX 2PZIA 4I2WA 5BPPA 5JA4D 4X5TA 2AXUA 1HXIA 2Q7FA 1MQSA 4DO0A 4JD2G 2OV8A 4B3MT 3RGLA 5KMGP 2BKKB 1YKHB 1BD8A 4LMJA 3E34A 2XENA 1L0VA 4NIKA 4I43A 2XQ5A 1LD7A 1S63A 3N9LA 3RO3A 4N3AA 3ML9A 3UQ7A 4GKJT 3CX6B 5L3GB 2XAGB 1D0XA 3UKUG 2DHRA 4X1IE 2WXNA 2R2LA 4FLHA 4O6FA 3PDYA 2ZM8A 4B3TT 4PAGA 4F6RD 4GA0A 3QAQA 1UJJA 4HOTA 1E7PA 5LGUB 5CA0E 4TUYE 5FTPA 4AI6A 4L5GA 2EQXA 3ONLA 1XWMA 4HOSA 2H88A 2JMKA 5JDQA 2IY0C 4TRQA 1Z6TA 3EAMA 3HI2A 4LF8T 3EDVA 4ANUA 1W0AA 1WYBA 1QNFA 2V0PA 2ACXA 2LSJA 5J2TE 3K3OA 3EU9A 4F1SA 2X6IA 1K1BA 4YVQC 5EYPF 4M1PA 2FF4A 1ZP0A 2A9UA 2X68A 1HCIA 3CX7B 3ISMC 1H2UA 4G11A 1IHGA 1YA0A 1HFAA 3QK6A 3E22E 2CXLA 2CHWA 3ZEFA 4X1YE 3UUBA 4LUNU 1OWPA 3ZN1B 4QFVA 2QVAA 2HH7A 2FO1E 4DX7D 3QKYA 5AQVB 4C0EA 5L4EA 2FJAA 3Q79A 4FADA 3T5VA 4I4TE 3LK42 4FP7A 5J90A 2Q9QB 2ZIRA 2V7JA 1N4RA 4JI7T 3BEEA 2W63A 4I55E 2YK0A 4J2CA 5ABGA 3AAIA 4HOQA 2HYZA 2L3LA 2CM0A 1JUQA 2DYRE 3RAUA 3AG2E 3ZHEA 4RG6A 2DZOA 4IULA 2C2LA 3B57A 2XGOA 4DK5A 2G0UA 4A3TA 2VKDA 3O4XE 3ZKJA 1E2AA 2DWZA 1S35A 2Q9QA 5FQ4A 3TWQA 5BXUA 2NWBA 4YNDA 4DR2T 4WNGA 3RO2A 1XMQT 3NAWA 4IDZA 5AQLB 4EYUA 4PJLA 4U31A 2I2OA 4NXNT 3G2SA 4L2YA 2UWJG 2E9XC 2LT3A 3BG1B 4U0ZA 4KP3C 2WXGA 4AV7A 3FH5A 4XX5A 2WXIA 4U72A 2BKGA 4BJNA 5KJKA 5ARFA 2FJDA 2UXCT 4CGWA 3LYAA 2BKNA 4QH4A 4EZLA 3J5QB 3JUEA 3FHNA 5DBKA 4EV6A 1Z8UA 4OFZA 4U7EB 1CUNA 2W61A 3ZFWA 3KSQA 1T7SA 4UQZA 4ILAA 5G2NA 4N78D 2XZEA 4B89A 3CQGB 2VGXB 1T8BA 4BX8A 5AQPB 4CDNA 1GW6A 2XSBA 2K5BB 2PTFA 3K3NA 3DSSA 2KINB 5ENSD 2LRLA 3RQUA 3KVAA 3PUYF 3FTXA 2J4GA 3ZN3A 2XQ4A 2LKGA 5LGNB 4HBDA 5AQNB 4EPZA 2D9DA 3EHNA 2B76A 2Y48B 2VVNA 4BT8A 3T8KA 2FUPA 3MJXA 3U4TA 3S2AA 4EIWA 3O1HA 5IHYA 2MYOA 4C90A 2VL0A 5AQAA 3G06A 4JI6T 4JI2T 1W09A 5FXXA 2P2CP 4U0UA 3ZXSA 4CT0A 4CDRA 3P8CD 3PUGA 4R7LA 2M6BA 3V5UA 4LERA 4TXQA 1P5QA 5H6QB 4F3VA 4WNKA 3KV4A 4IDNA 2WWUA 3QK0A 3KDSE 4U7IA 3AAAC 4OVUA 4FA6A 3Q9DA 1ELWA 5CEAA 1LD8A 4WNFA 1YKEB 2RFMA 4JPSA 4ZI7E 3CSTA 2WDQA 3EDUA 3TWSA 4UQYA 5AQKB 2V7IA 4CQIA 4GCOA 5ITZF 3UINC 4U74A 2PQRA 4GZCA 4KZCA 2XGMA 4CXYA 3AEAA 4JHRA 4PS3A 3S7JA 3B7SA 1H7CA 2WS3A 4PFOA 3BQOA 3SO8A 3JAFA 5L3EB 5AN8A 2KLQA 4U63A 4K5AB 4JA7A 2Y69E 1QUUA 2R6GF 3APDA 1AWCB 2BZBA 3DSTA 2V5FA 1E7VA 4KMCA 4TV9E 5CJ5A 3SBSA 3PS6A 1QLBA 4UVAB 4FJOA 3E0ZA 4GB9A 2EINE 3TLSA 4FU3A 4LFBT 2W67A 3GW4A 3DSUA 3ONJA 4ZI2C 2D0UA 4O1OA 2L9BA 4Q25A 1B89A 3SFYA 2E2AA 1Z3YA 2GK9A 2J49A 5BNWA 2UXDT 4GMLA 4Z90A 1E7UA 1HE8A 1OEDA 2BBHA 3WAKA 2WQHA 2CPTA 2E8IA 1VDYA 3Q5XA 5CRVA 2JABA 3FZHB 1A5EA 4DPRA 1U3CA 4UELA 2LM2A 2LLYA 4CDMA 1WG0A 2ETBA 4BSXA 3FZMB 3OVUA 3P4PA 1R8IA 3UT7A 3O1JA 4YDYA 1ZV4X 2L6BA 4O4JE 3G2TA 2VKOA 4JYAT 1FIOA 1D8EA 2W62A 3HXFA 3UI2A 2EIME 3HKDE 1DU2A 4HQDA 3Q5DA 3ONLC 5EK3A 3W15B 3FUFA 3ONKA 4BAYB 1TNUA 5L3BB 2Y4UA 5AQUB 4IDOA 5AJLA 3WI3A 1XNRT 4K0RA 3C98A 3PV0F 3P4SA 4GTQA 3FTWA 3I0OA 3APFA 1OT8A 4AQFA 5FQ6A 5DQWA 3NZUA 5CRUA 3N71A 3PUWF 4HWIB 2IUBA 4V1Av 4ZOLE 4TWHA 4LF7T 3FEXA 2CBIA 2V6YB 1U5PA 1LF8A 2J4BA 5KJLA 3JCFA 3RRUA 4GMRA 4KI0F 4RSYA 4AY6A 3OXGA 3OPCA 5CECB 1H6PA 1QYMA 1OY3D 1TN7A 4ZHQE 3FU3A 2Y1LE 4G63A 2YDQA 2BDEA 3OTOT 1UUSA 2ACZA 5IUXA 4DLOA 2KZTB 1Z0PA 4X66T 2CHXA 2LSVA 5ABEA 2LM9A 2GW1A 4DX6D 5A7DB 2K48A 2LXLA 4H9QC 3PZ3A 3DJBA 5LHIB 3ZNGA 2WPVA 3D9NA 4CN4A 2RP4A 5FZQA 3HXBA 3NBNB 4NXMT 2DBAA 4PS8A 1G3NB 2B1EA 1KPSB 2DZNA 5G55A 4A97A 2XQ7A 3ULEG 3ENEA 2JQ9A 2F0YA 1UG3A 1KZPA 1X81A 1NA0A 2CG2A 3H3MA 4DX2A 3DWLG 4JI4T 3PUSA 1IBLT 5JR9A 3TLTA 3O1IA 5LCYA 2HHHT 3M65A 4B0ZA 3HKEE 4ADZA 3PE4A 5CEDB 1E90A 2HR2A 3LY7A 3GN5B 4OX9T 3I1AA 4ATGA 4HN9A 2R5SA 2WU2A 1Y64B 2RFAA 1N4QA 2WXOA 1PAQA 4DJAA 3RYHE 1DCEA 4JB8P 5AQMB 5ANLA 4EECA 3S4UA 1VRBA 3VRAA 1N4SA 2ZISA 5BW8C 2VTBA 1BI7B 2XS1A 5AYWD 5FINA 4JBWF 1L5JA 4GTTA 4U33A 3AA6B 4KHZF 4U8HA 3V5SA 2XEEA 1M62A 2X3MA 2CHZA 4GIWA 3ASOE 2BUGA 2J1DG 4J8YA 5JQGE 3JQ1A 3FXDB 2QYJA 3VLFA 1OXJA 4U2ZA 3ZYKA 2IF4A 3BG0B 3TG5A 2YN6A 4EQFA 3RIUC 4IYPA 4HI9A 1HS6A 3G2UA 1FCHA 2E0IA 3CR3A 2X0YA 4BY6A 5TAOA 3CLJA 2P9BA 2EHOD 4G26A 3AEEA 1BLXB 2OLTA 3BQLA 2WU5A 3LJ3A 4CI3B 4LCTA 4FHJA 1YW0A 2VKHA 5JVDE 4JI3T 2LSYA 2CEAA 2SPCA 3HXEA 5ENQD 4HLEA 2WQ6A 4MKTA 3HL6A 4LFAT 3OJAA 2F37A 4JZYA 3NBXX 4ATZD 3CVRA 4ILIA 4HTEA 4WNDA 4HI8A 4X8QA 3ESKA 3L6AA 3I4RB 3PUAA 2M67A 5JHBA 2WZIA 1FMVA 4BERA 4KX6A 2UXNB 4CT4A 2P58C 1IHBA 2P9PG 4EAHA 2OCCE 3AG1E 5D2MC 3RC8A 5EYLA 3G2VA 2X6HA 4ZS3A 3RRCA 5M4YA 1JNZA 3JC6C 3EDTB 3L17A 3FUKA 4CXXA 3QOUA 4UWFA 4J6IA 2V6YA 1TNYA 2WXQA 3CHOA 5LBMA 5A1LA 2QGSA 2VSXE 2WBLA 4GK5E 4HFIA 4DR3T 1OWLA 5CHEE 5G04J 2EHOC 3Q4AB 3HHMA 1UURA 4LSZE 4KBMB 4GZDA 2GROB 3ZSSA 5HYAA 4HB5A 5LJNA 3OBVE 3L08A 3UPVA 4P0AA 1DCQA 5CMYA 3NOGD 3CVNA 2CBJA 4YDEA 1EPUA 3KEAA 3RIAA 5AQHB 2EILE 4ZHBA 1Q2ZA 2V7MA 3EUVA 4FC8A 3P1UA 3RSEG 3FEYA 3A7MA 1KF6A 4PFPA 5CBOA 3EUHA 4XZCA 3AJIA 3PZ1A 4B93B 3V30A 2OOEA 2E5LT 1MZCA 4HRMB 4U96D 3TWVA 2XQYA 3FTYA 4DBRA 5FL1A 2CHNA 4X20E 2A5EA 2P9UG 4P0BA 3CVUA 1HNZT 4AKLA 5HEUA 3UIOC 3VLDA 1US7B 3O48A 5CBNA 5KBAA 3V2OA 4BX9A 3UU4A 3RJVA 2A72A 3T5XA 2LE8A 2EIKE 4TZ4C 2XSAA 3B7RL 1H19A 3Q73A 3LFMA 2XQAA 3PJAJ 3LXUX 5BV1A 5JMND 2J09A 4NUVA 4AXPA 5G05C 4ABNA 3DRAA 5DABA 2I0MA 3ZPJA 2NYJA 3UQ3A 1ZB1A 4PJJA 2GRQB 3N9PA 3B7TA 5A6CA 2BF0X 1KNPA 3LSVA 4I6GA 5E76A 2UXBT 2UUCT 1NENA 2V26A 2JMHA 3ANWA 3CIAA 2LSKA 4K5BA 1BU9A 1EYHA 1XDPA 2A5UA 2XZTG 2YNQA 3ABME 2WP9A 3UT5E 1B7TA 4AEZC 2HN1A 3DXMG 4ISTA 2ES0A 2MHKA 3RF1A 2EHOB 4HGAA 5HXEA 3FUEA 4CEMA 4YTNA 3NWIA 3DSVA 3FZFB 3T8MA 4AJWA 3LY9A 4UUCA 2V8SE 3T1YT 5T8IA 4F6RC 3FULA 3ZGQA 3PTRB 2X9XA 3ABVA 4YSYA 4YSZA 5BR8T 1KK7A 3M3ZB 3RYIE 1N54A 4PK5A 3Q5WA 3PE0A 2DVWA 1N0RA 3ZT5A 4N39A 2KXPB 3UM0A 2BG9E 1JNRA 2PBIA 2VASA 1FVFA 4H9NC 4YLHA 2B6CA 3CHSA 2WZHA 4GYSA 3LJCA 5AQOB 5LGTB 4TXRA 3CIRA 1W9RA 2WSSV 3UM3A 5BUZA 3UTMA 2WWVA 4UWHA 2P9LG 4GMJA 2LEHA 5BMVE 1LVKA 3AG3E 4H63V 5LP6E 2V6XA 4IE7A 4HFEA 3AE7A 1Z5SC 1OWNA 3NZPA 2LAIA 3LKUA 1UK5A 3QARA 4QXCB 3ZU7B 2XHEA 4Z68A 4J8SA 5HI7A 3R7QA 4UWLA 3FTUA 4JI1T 1OCCE 4EBAG 2P9IG 4QH1A 3KV5A 1N52A 1HS7A 4PJMA 4GTOA 4GCNA 2I9CA 3EHRA 3FHEA 4KBQA 3BQKA 1N11A 2VK9A 2VTBB 2JLBA 3CSFA 4B8CB 1HU3A 5FKYA 3H3AA 3RH3A 1OEDB 5L3DB 2GRMA 3ZJ2A 3LCAA 1DNPA 4Y6CA 5J08A 4GTPA 2OV9A 3PRZA 3UMVA 3HKBE 1PY1A 4DX5D 4A56A 5JHAA 3PDNA 3MA9A 2Y3AA 5CA1E 3APCA 4U7YA 1TJFA 4EEBA 2KWHA 5FVLA 1IYGA 1TNOA 2IQCA 3OXFA 5L47A 2X0HA 4BWRA 2KBXA 1IAPA 3GWHA 2XGSA 1S64A 3HKCE 3TXMA 3FP3A 2XEHA 2WB2A 4CXWA 3TKLB 5D0QD 2YHEA 2OA5A 5JTGA 2KCLA 2L8KA 3AA1B 3VLEA 4ISSA 3PEUB 4CN6A 3D9OA 4GK0E 2UXXB 3TL5A 2BG9B 2PFVA 4WZXA 3AEGA 1XMOT 3UT4A 2CMRA 2VQ2A 4LF9T 3MXZA 2YDRA 3O9XA 1SE7A 4GYRA 4YHJA 2L6JA 4HFDA 4JL0A 4RVBA 2WXHA 2CCQA 3FU0A 4PDXA 4E7ZA 2HN2A 5ENNA 5FXWA 4J8DA 2V7LA 4LF6T 5CCLA 4QH5A 4ZS2A 4OK0A 3UUNA 1MNEA 4XAXB 3JYSA 4EZHA 4GYYA 1G8XA 4JI8T 4I0UA 3HDXA 2XPZA 1N94A 3L39A 1SA0E 5H7PA 4Q96A 3TGOA 2HE0A 1A17A 1YMPA 4OHFA 2JQHA 2V5DA 3EU5A 4APOA 5FNVE 3ABLE 4EB6E 5AQTB 2V7KA 2N9DA 4HKAA 5CCMA 3ZUVB 4HLLA 1KFYA 5ENOD 2IO2C 1G73A 1S94A 4TX5A 5G04C 1YYHA 3KD7A 2CE7A 3UM2A 3D9PA 4GYWA 3LBXA 3VTXA 3Q75A 3DTOA 1TYQG 4AQFC 1N9AA 4DMWA 2XPYA 3LK2B 4NIQA 1FPPA 4TNWA 5DIZA 3PZDA 4N3BA 1HH8A 4HFGA 3ASDA 4JXTA 4NPPA 1DC2A 1WRDA 2GRLA 3SGHA 2LAHA 4XEIG 1WFDA 4E85A 2HPLA 3OYZA 5HS0A 4DI4A 2YU2A 5L3FB 3Q49B 3DSXA 1UGOA 1LKXA 3CVWA 1OCRE 2YEVC 2L0TB 2FJBA 5AQSB 4C91A 2KXPC 5ABFA 5AQJB 2QA7A 5LYJE 3N9MA 2V8SV 2CXDA 1UN8A 2IU1A 2XCCA 4L23A 4DV1T 2RD0A 2MBGA 4K0UA 3UX4A 3IHYA 3CK8A 4LMLA 4DV5T 2QY7A 4ANXA 1BR4A 2KMFA 3ZC1A 5LB7B 1MNDA 4OYJA 2XQ8A 2AXDS 3N9OA 1JCRA 4DLQA 2L0IA 3QB5A 3UU3A 1SHZC 2NTXA 2XRYA 5EZYE 3ASNE 1XDOA 2DWGA 4E7SA 5H6RB 4RG9A 3AE5A 5FL0A 4M7CA 2WMOA 3JUIA 2X0LB 5FXVA 3CEQA 4O2BE 3QNUA 2Z6EA 2GGFA 4I2ZA 3UXGA 1K1AA 5KNHD 4DX1A 2BVMA 3AVSA 2UU9T 5JRCB 2AVPA 3IHVA 4QXHB 4HXIA 4DV3T 3C64A 4IIJE 2D0TA 2J62A 4WWNA 2YQ8A 3LJNA 1UX4A 3CHMA 1EDUA 3I4GA 3P7IA 3L54A 3Q9NC 2JJ9A 4JI5T 1YQ4A 3ZMSB 2CXFA 2EHOA 4H9SE 4WW0A 3ZSTA 4HORA 1MIWA 3ZPOA 1WM5A 4FHKA 4EZJA 4LEUA 3W9FA 5KXJA 3SF4A 3U78A 4OAUC 1LTXA 5HCJA 3AA0B 2VGEA 3OYXA 4UI9J 3CK6A 4LG6A 3F2EA 3PUJA 1LVFA 1NI1A 5EKQD 4JI0T 4WWOA 2D5UA 3TWRA 1IXVA 2C0LA 4UF0B 1HX8A 2V4LA 4IGUA 4DR6T 4TN7B 4WNEA 2DCPA 4IE6A 3QOFA 2H89A 1O3XA 3ZMUB 2KCVA 3EABA 5CERB 1YCSB 4ZZCA 2J9QA 4MRUA 2XY8B 3U3IA 2J08A 3FU6A 5FMNA 4KVMA 1UN9A 4X62T 3PUXF 4YT0A 3F57A 1RW2A 3UU6A 1TEZA 5D0OD 2BS4A 3IV0A 5FJYA 2CLYC 2C5IT 2IOLA 3JCKC 4WYVA 1HG2A 1OCOE 3VRBA 4UVCB 3VHLA 2WXPA 3C72A 2LHNA 4AY5A 4CI2B 2X6JA 1UCUA 2QYWA 5ABFB 1TNZA 1QBQA 4XKBA 3ZVVA 5IWAT 4C9BB 4B3ST 3ABKE 1EZ3A 2K24A 4F7AA 3X2QE 2LHRA 1LRZA 1N36T 1OXZA 5LHGB 3MKQB 4U0SA 2JEKA 3K9IA 3RI5A 4J0UA 1U3DA 3UFGA 3PU3A 3B13A 3Q47B 4CCAA 4D10C 5CGMA 5LOZA 1J1JA 2LNIA 3E33A 4YTPA 4H9OC 2XQ9A 1TJCA 3PE3A 3CVYA 2KT9A 4AIFA 3RYFE 2E5VA 4IL9A 2ONDA 4HWDA 2NP9A 5ANRA 4YJ3E 4LRZA 4I1MA 4WUYA 2YOEA 3TWUA 3AU4A 4ZI3C 2W00A 2VQFT 2CA5A 2FI7A 4KHPT 3CX8B 4DUIA 4JHJA 3E08A 5E0OA 4NUUA 3AS5A 2PQNA 3DPYA 3AXJA 4O4IE 2VSYA 4TXPA 2H6IA 2RG8A 4RQIA 3L16A 3FUIA 2YKSA 2C5KT 3I0QA 4ZI2D 3PVLA 2LO6A 3FZKB 4FULA 1BR1A 1Y8MA 3RQWA 5KNGA 4Y6WA 4LNGA 4MBGA 2X9WA 2ZM0A 2FEZA 4A3VA 3FY4A 3NRYA 3AEFA 1D1BA 3D9KA 4GTRA 3QC1A 4JVSA 3TWTA 3N2KE 1CHUA 3SRZA 4HFVA 1HR0T 2OVFA 3CKBA 4JEHB 5AQIB 3PREA 3ZYMA 3ONXA 4FLBA 1SUMB 4H7XA 3CVQA 3ZMZB 4ZFHA 2QC9A 4QKNA 3Q9UC 2HM8A 5HEGA 1IKND 5LP0A 3ZKRA 5CFBA 1HF8A 4AM9A 3QWVA 3GN5A 4EZKA 3UUXB 3SHFA 3KV6A 1KT0A 4HNAD 4A63B 1S70B 2E9XA 5ABHA 1ZU2A 2R17C 3B7BA 2ZXWE 3CVVA 5LFAA 2UUAT 3TLUA 3D9LA 4HWFA 5AENA 3RLFF 4JC8A 3MV3B 4KYOB 4M3OA 1KEYA 3B95A 1FMWA 1E8ZA 1O5MA 2H6HA 2H6GA 4N2QA 3SQVA 3LS8A 2W66A 3RIBA 3ANWB 1N33T 2WB5A 3C3QA 3ZMTB 3IKOB 2CWYA 1IBMT 2A4ZA 2OEVA 5B1BE 3ZRHA 2MTQA 1NAFA 3VKGA 1TN6A 5AQ7A 1IZNB 3FUHA 4UF0A 3SFDA 4G25A 2WQYA 3OTNA 1WDYA 3LVRE 1YXRA 5C1DA 1JCQA 4JUYA 4I6JA 3PURA 2XM2A 3T8OA 1W3BA 3FBLA 4O60A 3TWWA 1FT1A 5AAOA 4MHCA 1INZA 3HVEA 3NKZA 2XPKA 3C5RA 2BVLA 3CPZA 5AIJA 4KT6B 3C50A 5J1GA 2DI4A 1IBKT 2KC7A 2PJQA 3C3RA 4ZI3D 3SFXA 2Y6XA 4A98A 4X64T 4N3CA 3RRNB 3R9MA 4O2AE 3QWPA 1NP7A 4LNUD 2QZAA 2NTYA 2PL2A 4U07A 3QJZA 2LOPA 5EIDA 1QZ2A 4AQYT 2IHR1 1V9DA 2X66A 3FDHA 5FXZA 3E4BA 1WR6A 2X6KA 2DL1A 4H63H 2YHCA 4KMOA 3ZHEB 3NRXA 5DJQC 5ENTD 1E96B 4JEUB 4XBFB 3AE3A 2ODVA 2BBJA 2A3DA 3L82A 4MFRA 5FP3A 3IA3A 1D1CA 3AS4A 1XGWA 1X9BA 4CZZB 3MCXA 3DEOA 2DWKA 4L1BA 1UOHA 1I94T 4CI1B 2IC9A 3Q7FA 3QWWA 1NFIE 2NSZA 1H0AA 1TR4A 2NW8A 1GQEA 2AWIA 3CHQA 1U4QA 2WAUA 4IREA 4RLYA 3FH8A 1SW6A 2KATA 3DPDA 3ML8A 1HNXT 3LPZA 3ZYLA 2KZ7B 3LDZA 3PUZF 4Z91A 4QX7B 1XZYA 3ZCIA 4DV7T 5AQBA 4J8EA 3SS1A 2NR4A 3PUQA 4AKHA 4GU5A 2XQ6A 2D2SA 2MPKA 5B3SE 4TWFA 5LX8A 2VVSA 3HA4A 2IOSA 3RKGA 3FTZA 3IHRA 4GKKT 5JJ7A 1KT1A 5LG3A 3U64A 4I9EA 5ENPD 3N5LA 5KX5E 3CKDA 4KXKB 4A1SA 1RZ4A 3LDQB 2IJGX 3RX6A 4UWKA 3RIFA 5KCMA 3ZMVB 1TNBA 4DR1T 3TXNA 4X1KE 1H6KA 4L9PA 2N2NA 4J8FA 3SY2A 3ULYA 2RKKA 4F8HA 5FIOA 3OXLA 3QUJA 5F8PA 3NVOA 5T3RA 1NA3A 2WQ7A 1XNQT 2DIWA 4PS7A 3FUJA 1U2VG 3AG4E 3FFLA 2F8XK 3LG7A 4UIGA 1BPOA 1D8DA 4GPKA 5J0ZA 3NOCD 3KVBA 3CVLA 2R05A 5AQFB 3ASGA 3S7DA 1WCRA 4G8KA 3R9AB 2XJ7A 2AXZA 1QSDA 5AFUL 1AJ3A 4V3IA 1KNRA 4KVOA 5C3JA 2ETCA 2V4HC 2BKOA 2GRPB 3BU8A 4YTMA 5ENRD 4AKGA 5EX3A 2P9KG 5T4YA 2W0GA 1M7KA 4BSZB 1V54E 4H9PC 4BJMA 3Q2MA 2NW9A 1MJ0A 3ETUA 2IEJA 5A23A 3GZSA 3EHMA 3AA7B 1HZ4A 3C98B 5F3JA 3ULQA 1MHQA 4OAVB 1SZAA 1E8WA 3D9HA 3VTYA 2IFUA 3N2OA 1OCZE 2NW7A 2UY1A 4GTMA 5ARGA 1PC2A 4A1GA 3RRWA 2YU1A 3JQ0A 3GMIA 3HXCA 3AE6A 1O1TA 3AVRA 4PJNA 5EIBE 3EI0A 4HRNA 4GYOA 2XTLA 4MLKA 3H37A 3TWXA 2MOWA 1IQUA 3V79K 5C2YA 2IC6A 1HNWT 4EOZB 2ZU6B 4NQ0A 2W2UA 2BG9C 2Q9QC 2IO3C 4U8VD 2PM7A 3MA5A 3LEWA 4IDQA 2W4XA 2M63A 3VU7H 1YD8G 2V5QC 5CB4E 1I6ZA 3P50A 4HFHA 3TLVA 1JCSA 3ZJ1A 2YINA 2CWOA 3K8PC 3L22A 3DXKG 4DUZT 2ZMAA 2VB6A 2XHEB 4UV9B 1Z3XA 2WDVA 4BEPA 2V5CA 5AQQB 3DSWA 4NRHB 2F4VT 3K3QC 5LXTE 2WVIA 4QQIA 1H6OA 4TV8E 3JADA 2VJ8A 3AEBA 1HG5A 3PUVF 4OVVA 3URZA 4XIFA 4CRWA 4DV4T 3N2GE 2ZGDA 4JW1A 3LK3B 3R7RA 2AXVA 3CHPA 2GRNB 3RRMB 4DV6T 5LJMA 1SQMA 4HE8A 3HG0D 3AEDA 3AB3B 2CHOA 5AARA 3BQIA 3D9MA 5FY7A 4I50E 4FJZA 4IL4A 3W9GA 2H7VC 1N0QA 3UIPC 1VCSA 3B7UX 1OWOA 5AQGB 3HXDA 2C5JA 5LBQB 2JQKA 1X79A 4URKA 4H9RC 3CK9A 4DVDA 1MX6A 4JV5T 2X51A 4PK6A 4TNVA 5EK2A 4O4HE 1ELKA 4ILUA 3FBZA 3HVEB 4P09A 3D9IA 3VR9A 5JREA 1O1RA 1UJKA 3QB2A 5HWXA 3T1HT 2CLYB 4XI9A 3E37A 1NL4A 3SNXA 5AQ9A 1WYCA 2C0MA 4XE0A 2V1DB 3AAEB 1FEWA 1J5WA 5HXSA 2DNXA 5EX0A 3UFEA 3D0TA 5LHHB 2XZDG 3LY8A 3CWZB 4L7TA 1J5ET 1D0ZA 1HX1B 3KEZA 1AP7A 1MIVA 5HXHA 4NURA 2WCAA 2RPAA 3EHZA 3J7Yq 3ETVA 4TWDA 1SVXA 3CVXA 5HEOA 1DVPA 4EHMA 3SWHA 4EGWA 1Y6IA 3IEGA 4NACA 2LOSA 2NC9A 3MKRA 4PH4B 3RK6A 3ZXPA 2RA1A 3BK9A 2P9NG 3I9WA 4JLEA 1YQ3A 1ZBPA 1ZOYA 3PJAA 3GZ1A 2AW6A 2MRIA 2H3RA 3AE9A 2XCBA 4IRUA 3SFEA 2Y0BG 2N1GA 4O8SA 2EIJE 3SBTB 4ZEYA 3IF8B 4OYSA 1O1SA 4DV2T 4KZ0A 4DRXE 4EEDA 3TLWA 2CG3A 2NOXA 4ANWA 3VR8A 3SD5A 3B5MA 2IDOB 2X9YA 4C0MA 1WY6A 4ACLA 3LBXB 4QWNB 3P4RA 2VL8A 2OEWA 1Y01A 5HQ8A 2WMNA 3IBEA 4XKCA 5JDNA 3JXIA 4GZ5A 5LNKA 1WR0A 1NEKA 1MMNA 3Q78A 3MYVA 4YJ2E 3C4XA 2WXMA 5LA6E 2L9QA 1VOMA 3AE1A 2XQ3A 3AAAB 3I9YA 3E32A 3MKQA 1ZHCA 5BV0A 3JAEA 3IXEA 2C0SA
chains in the Genus database with same CATH topology
4P29A 3RKOA 2FO7A 3AS8A 2KZTA 3DBSA 2FULA 5JR9B 4N5CA 4ASKA 3WAJA 2H7OA 4APFA 2X67A 4G2VA 5JR9C 4IHJE 3UUXA 2ILRA 4AVXA 4ILGA 4EBAA 3PNLB 3MACA 4UVBB 4FJYA 3SOLA 5L3CB 2MYSA 1MMDA 4EYYR 3RC3A 4B8AA 2JQQA 1X5BA 3R84B 4BT9A 4DBQA 4Q94A 5ADXL 4HS2A 1D1AA 4BA9A 3CV0A 4N2SA 3ZIMA 4PUCA 3QDNA 3NZQA 2BTDA 4I43B 3L13A 5E75A 2ZM2A 2I6HA 3OAWA 5FT9A 4Q69A 4G24A 3IEEA 3PH0C 4ERRA 4JA9A 3RU0A 4UI9C 5JJ6A 2XQ0A 2WXLA 3N9NA 3P2BA 5C8YE 3DP7A 4UI9K 2VSOE 4DMVA 3Q5MA 3FUDA 3HIZA 3MEKA 3UULA 1IQRA 2PM6A 4XI0A 5KDMC 4HVBA 5JJTA 4AKRB 1OWMA 2XAQB 1E8XA 5EDSA 2UY1B 3FTSA 5HXCA 4GA1A 3OKQA 3PU8A 5J2UE 2E9XD 2XEVA 2CFUA 2OVBA 3ASFA 2LJLA 3F31A 2PG8A 3FUNA 4WBNE 4YFSA 5FY0A 4I1OB 1MMAA 2Y8DA 5FZRA 2WXRA 4HEAA 3D9JA 4MALA 4ANVA 4O4LE 3FXEB 5GONE 3KBUA 2HPJA 5DQVA 3KINB 2ZLYA 2KWIB 1SZ9A 4JHKA 1ZEEA 4F53A 3JC6D 4PW8A 3RYCE 4BFRA 1JPLA 3RKVA 4YVOA 3KV9A 2IAKA 2X6FA 4B94A 3ZW3A 3ESLA 4K03A 1OWAA 4AQGA 3FH7A 3MZLB 3TJPA 5JDGA 5LCWC 4MBQA 2LSUA 2J07A 2VWAA 2VGYA 5FWQA 3EJNA 4ILHB 2X9HA 2WXFA 2XAHB 3ZYQA 1BR2A 4UEMA 3ASHA 4IE5A 3NF1A 4TV3A 3ZEFB 1OUVA 3MX3A 3N9QA 2XAFB 1NWMX 4IE0A 4G23A 4XZ4A 2LSIA 5JDHA 4WAFA 3FWVA 5FQ7A 2DLRA 4QXBB 2VKJA 4ANJA 4AOFA 1S0PA 4PNIA 4H7YA 2QFCA 3UT8A 3RPUA 2X38A 3EIJA 3WXXA 5BT1A 3NQPA 2I1KA 1BR0A 3CHRA 3S7BA 5G05J 5EK4A 4AP2A 4Z8XA 3SI5A 4BTAA 3EVYA 4AKIA 4QHOA 2KM4A 4MS6A 4UQXA 3L09A 3R6NA 3FTVA 1KLXA 4ME2A 1D0YA 2KCKA 2R59A 3CQCB 3UTKA 5CMWA 4G2AA 1JWFA 4W9RA 4ACKA 2XAJB 3KFWX 4UXNB 3CK7A 3CVPA 2XUEA 3MGBA 5JRCA 5IYZE 5LG4A 3O4ZA 4G1TA 5HWYA 2E2EA 3MJWA 4B6XA 4L9IA 4L2LA 2WXKA 1E1HB 2DCFA 2VSNA 3TAXA 4DNDA 3VKHA 2I59A 3AU5A 2IW5B 5LOVE 2HO1A 4KUMB 2VGXA 3ZCJA 4WWPA 4E6HA 3MZKB 3GA8A 4GZ6A 5M72A 4EXTA 1FVHA 3S7FA 2J4DA 3MK7C 4BTBA 3HYMB 3U66A 3KAEA 4I6EA 1E8YA 3SFZA 3CKCA 5L2LA 2E9XB 3G2WA 5JDMA 3FU5A 3I3NA 4TUUA 3LVQE 5FZSA 1WAO1 3U3WA 1ZKEA 4I9CA 2WM9A 2XASB 3CQXC 1WLXA 3CGHA 1MMGA 4IN3B 3ZLIA 1QQEA 2K9AA 4IE4A 4QX8B 3A5XA 3UUMA 3KBTA 4EZ4A 1XNFA 3I5PA 1EF1C 3C4ZA 1HO8A 3NZSA 4AXHA 1ELRA 4WBOA 5ETWA 3ZN0B 3FB2A 2I1JA 3Q15A 1T98A 3ZC0A 5JH7E 4U04A 2Q9QD 4GAAA 4PK4A 1IJ6A 2MOZA 3J9X1 3GYZA 1H2VC 3QNKA 5KJMA 4I17A 2WXJA 3FUMA 2ODUA 4JEUA 1H2TC 2LSGA 2NXPA 4DI3A 3PEVB 4JEHA 1KNZA 4FI5A 4MLPA 4CGVA 3C51A 4HOUA 4UV8B 3KS2A 3QC9A 1UX5A 5FQ8A 4UWGA 2CFZA 2JRKA 1HTJF 3U9WA 3MKDA 3PUKA 2JPFA 4GZ3A 3GZ2A 1MIYA 3L3PA 5JDLA 3MV2B 2FBNA 3TG4A 1JWGA 5LCWJ 4OYKA 2KNDA 4I1AA 3D3MA 3SZ7A 5HXRA 5FYMA 4L0RA 2VYIA 5JDFA 4GOUA 1IJ5A 5HAXA 5FY1A 2IONA 1UW4B 5AJDA 3C4WA 5KJNA 1NZNA 2XRZA 2Y4TA 3EIQC 3IBPA 4A55A 3PNTB 4GA2A 2XPIA 3CMLA 3HR0A 2A2FX 2PZIA 4I2WA 5BPPA 2AXUA 1HXIA 2Q7FA 1MQSA 4DO0A 2OV8A 5KMGP 1YKHB 4I43A 3N9LA 3RO3A 4N3AA 3ML9A 3CX6B 5L3GB 2XAGB 1D0XA 2DHRA 4X1IE 2WXNA 4FLHA 4O6FA 3PDYA 2ZM8A 4PAGA 4GA0A 3QAQA 1UJJA 4HOTA 5LGUB 5CA0E 4TUYE 5FTPA 4AI6A 4L5GA 2EQXA 3ONLA 4HOSA 2JMKA 5JDQA 4TRQA 1Z6TA 3HI2A 3EDVA 4ANUA 1WYBA 1QNFA 2V0PA 2ACXA 2LSJA 5J2TE 3K3OA 4F1SA 2X6IA 4YVQC 4M1PA 2FF4A 2X68A 1HCIA 3CX7B 1H2UA 4G11A 1IHGA 1YA0A 1HFAA 3QK6A 3E22E 2CXLA 2CHWA 3ZEFA 4X1YE 4LUNU 1OWPA 3ZN1B 4QFVA 2HH7A 3QKYA 4C0EA 3T5VA 4FADA 4I4TE 3LK42 4FP7A 5J90A 2Q9QB 2V7JA 3BEEA 2W63A 4I55E 2YK0A 4J2CA 3AAIA 4HOQA 2HYZA 2L3LA 2CM0A 1JUQA 3ZHEA 4RG6A 4IULA 2C2LA 3B57A 2XGOA 4DK5A 2G0UA 4A3TA 2VKDA 3O4XE 1S35A 2Q9QA 5FQ4A 2NWBA 4YNDA 4WNGA 3RO2A 4IDZA 4EYUA 4PJLA 2I2OA 3G2SA 4L2YA 2UWJG 2E9XC 2LT3A 3BG1B 4U0ZA 4KP3C 2WXGA 4AV7A 3FH5A 4XX5A 2WXIA 4U72A 4BJNA 5KJKA 5ARFA 4CGWA 3LYAA 4EZLA 3FHNA 5DBKA 4OFZA 1CUNA 2W61A 3ZFWA 4UQZA 5G2NA 4N78D 4B89A 3CQGB 2VGXB 4BX8A 4CDNA 1GW6A 2K5BB 3K3NA 2KINB 3KVAA 3FTXA 3ZN3A 5LGNB 4EPZA 3EHNA 2Y48B 4BT8A 3MJXA 3U4TA 3S2AA 4EIWA 3O1HA 5IHYA 4C90A 5FXXA 4U0UA 3ZXSA 4CT0A 4CDRA 3P8CD 3PUGA 4R7LA 3V5UA 4LERA 1P5QA 5H6QB 4F3VA 4WNKA 3KV4A 2WWUA 3QK0A 3KDSE 4FA6A 4OVUA 3Q9DA 1ELWA 4WNFA 1YKEB 4JPSA 4ZI7E 3CSTA 3EDUA 4UQYA 2V7IA 4CQIA 4GCOA 4U74A 2PQRA 4GZCA 4KZCA 2XGMA 4CXYA 4JHRA 4PS3A 3S7JA 3B7SA 1H7CA 4PFOA 5L3EB 2KLQA 4U63A 4JA7A 1QUUA 3APDA 2BZBA 2V5FA 1E7VA 4KMCA 4TV9E 3SBSA 3PS6A 4UVAB 4FJOA 3E0ZA 4GB9A 4FU3A 3GW4A 4ZI2C 2D0UA 2L9BA 1B89A 1Z3YA 2GK9A 2J49A 5BNWA 4GMLA 1E7UA 1HE8A 3WAKA 2WQHA 2E8IA 1VDYA 3Q5XA 4DPRA 1U3CA 4UELA 4CDMA 4BSXA 3UT7A 3O1JA 1ZV4X 4O4JE 3G2TA 2VKOA 1FIOA 2W62A 3HKDE 5EK3A 3W15B 3FUFA 3ONKA 4BAYB 5L3BB 2Y4UA 5AJLA 3WI3A 4K0RA 3C98A 3FTWA 3I0OA 3APFA 4AQFA 5FQ6A 5DQWA 3NZUA 3N71A 4V1Av 4ZOLE 3FEXA 1U5PA 1LF8A 2J4BA 5KJLA 3RRUA 4RSYA 4AY6A 3OXGA 4ZHQE 3FU3A 4G63A 2BDEA 4DLOA 2KZTB 1Z0PA 2CHXA 2LSVA 2LM9A 2GW1A 5A7DB 2K48A 4H9QC 3DJBA 5LHIB 2WPVA 3D9NA 2RP4A 5FZQA 2DBAA 4PS8A 5G55A 2B1EA 3ENEA 1UG3A 1NA0A 2CG2A 3PUSA 5JR9A 3O1IA 5LCYA 3M65A 4B0ZA 3HKEE 4ADZA 3PE4A 1E90A 2HR2A 3LY7A 3GN5B 3I1AA 4ATGA 4HN9A 2R5SA 1Y64B 2WXOA 1PAQA 4DJAA 3RYHE 5ANLA 4EECA 3S4UA 1VRBA 5BW8C 2VTBA 5AYWD 1L5JA 3AA6B 4U8HA 3V5SA 2X3MA 2CHZA 4GIWA 2BUGA 2J1DG 5JQGE 3JQ1A 3FXDB 3VLFA 3ZYKA 2IF4A 3BG0B 3TG5A 4EQFA 4IYPA 1HS6A 3G2UA 1FCHA 2E0IA 3CR3A 4BY6A 5TAOA 3CLJA 2P9BA 2EHOD 4G26A 3BQLA 3LJ3A 4CI3B 4LCTA 4FHJA 1YW0A 2VKHA 5JVDE 4HLEA 2LSYA 2CEAA 2SPCA 2WQ6A 4MKTA 3HL6A 3OJAA 4JZYA 3NBXX 3CVRA 4ILIA 4HTEA 4WNDA 3ESKA 3L6AA 3I4RB 3PUAA 2M67A 5JHBA 1FMVA 2UXNB 4CT4A 2P58C 4EAHA 3RC8A 3G2VA 2X6HA 4ZS3A 3RRCA 5M4YA 3JC6C 3L17A 3EDTB 3FUKA 4CXXA 3QOUA 4UWFA 4J6IA 2WXQA 3CHOA 5LBMA 5A1LA 2QGSA 2VSXE 2WBLA 4GK5E 5CHEE 1OWLA 5G04J 2EHOC 3Q4AB 3HHMA 4KBMB 4GZDA 5HYAA 5LJNA 3OBVE 3L08A 3UPVA 4P0AA 5CMYA 3CVNA 1EPUA 2V7MA 4FC8A 3P1UA 3FEYA 4PFPA 3EUHA 4XZCA 2OOEA 2XQYA 3FTYA 4DBRA 4X20E 4P0BA 3CVUA 4AKLA 3VLDA 1US7B 3O48A 4BX9A 3RJVA 2A72A 3T5XA 2LE8A 4TZ4C 3B7RL 1H19A 3LFMA 3LXUX 5BV1A 2J09A 4NUVA 4AXPA 5G05C 4ABNA 5DABA 3ZPJA 3UQ3A 4PJJA 3N9PA 3B7TA 5A6CA 2BF0X 4I6GA 5E76A 2V26A 2JMHA 3ANWA 3CIAA 2LSKA 1EYHA 2A5UA 2YNQA 3UT5E 1B7TA 4AEZC 4ISTA 2ES0A 2MHKA 2EHOB 4HGAA 5HXEA 3FUEA 4CEMA 3T8MA 4AJWA 3LY9A 2V8SE 5T8IA 4F6RC 3FULA 3ZGQA 3PTRB 2X9XA 1KK7A 3RYIE 1N54A 4PK5A 3Q5WA 3PE0A 4N39A 2KXPB 2PBIA 2VASA 1FVFA 4H9NC 4YLHA 3CHSA 4GYSA 3LJCA 5LGTB 2WSSV 5BUZA 4UWHA 4GMJA 2LEHA 5BMVE 1LVKA 4H63V 5LP6E 4IE7A 1OWNA 3NZPA 2LAIA 3LKUA 3QARA 4QXCB 2XHEA 4J8SA 5HI7A 3R7QA 4UWLA 3FTUA 4EBAG 3KV5A 1N52A 1HS7A 4PJMA 4GCNA 2I9CA 4KBQA 3FHEA 3BQKA 2VTBB 2VK9A 2JLBA 3CSFA 4B8CB 1HU3A 3H3AA 3RH3A 5L3DB 2GRMA 3ZJ2A 3LCAA 1DNPA 4Y6CA 5J08A 3PRZA 3UMVA 3HKBE 1PY1A 4A56A 5JHAA 3PDNA 3MA9A 2Y3AA 5CA1E 3APCA 1TJFA 2KWHA 1IYGA 2IQCA 3OXFA 4BWRA 1IAPA 3GWHA 2XGSA 3TXMA 3HKCE 3FP3A 2WB2A 4CXWA 3TKLB 5D0QD 2YHEA 2OA5A 2KCLA 2L8KA 3AA1B 3VLEA 4ISSA 3PEUB 3D9OA 4GK0E 2UXXB 3TL5A 2PFVA 3UT4A 2CMRA 2VQ2A 3MXZA 3O9XA 4YHJA 4GYRA 2L6JA 4JL0A 4RVBA 2WXHA 2CCQA 3FU0A 4PDXA 4E7ZA 5ENNA 5FXWA 4J8DA 2V7LA 5CCLA 4ZS2A 4OK0A 3UUNA 1MNEA 4XAXB 3JYSA 4EZHA 4GYYA 1G8XA 3HDXA 2XPZA 1SA0E 4Q96A 3TGOA 1A17A 4OHFA 4APOA 5FNVE 4EB6E 2V7KA 2N9DA 4HKAA 5CCMA 1G73A 1S94A 4TX5A 5G04C 3KD7A 2CE7A 3D9PA 4GYWA 3LBXA 3VTXA 3DTOA 4AQFC 4DMWA 2XPYA 3LK2B 5DIZA 3PZDA 4N3BA 1HH8A 4HFGA 3ASDA 4JXTA 1WRDA 2GRLA 3SGHA 2LAHA 4E85A 2HPLA 3OYZA 4DI4A 2YU2A 5L3FB 3Q49B 1LKXA 3CVWA 2YEVC 2L0TB 4C91A 2QA7A 5LYJE 3N9MA 2CXDA 1UN8A 2IU1A 2XCCA 4L23A 2RD0A 2MBGA 4K0UA 3UX4A 3IHYA 3CK8A 2QY7A 4ANXA 1BR4A 2KMFA 3ZC1A 1MNDA 4OYJA 3N9OA 4DLQA 2L0IA 1SHZC 2NTXA 2XRYA 5EZYE 2DWGA 4E7SA 5H6RB 4RG9A 2WMOA 3JUIA 2X0LB 5FXVA 3CEQA 4O2BE 2Z6EA 2GGFA 4I2ZA 2BVMA 3AVSA 5JRCB 4HXIA 2AVPA 4QXHB 3IHVA 3C64A 4IIJE 2D0TA 4WWNA 2YQ8A 1UX4A 3CHMA 1EDUA 3I4GA 3P7IA 3L54A 2JJ9A 3ZMSB 2CXFA 2EHOA 4H9SE 4WW0A 4HORA 1MIWA 3ZPOA 4FHKA 1WM5A 4EZJA 4LEUA 3SF4A 3U78A 3AA0B 3OYXA 4UI9J 3F2EA 3PUJA 1LVFA 5EKQD 4WWOA 2D5UA 2C0LA 4UF0B 1HX8A 2V4LA 4IGUA 4TN7B 4WNEA 2DCPA 4IE6A 1O3XA 3ZMUB 2KCVA 2J9QA 4MRUA 3U3IA 2J08A 3FU6A 5FMNA 4KVMA 1UN9A 3F57A 1TEZA 5D0OD 3IV0A 5FJYA 2CLYC 2C5IT 2IOLA 3JCKC 1HG2A 4UVCB 3VHLA 2WXPA 2LHNA 4AY5A 4CI2B 2X6JA 1UCUA 4XKBA 3ZVVA 4C9BB 1EZ3A 2K24A 4F7AA 2LHRA 1LRZA 3MKQB 1OXZA 5LHGB 4U0SA 2JEKA 3K9IA 4J0UA 1U3DA 3PU3A 3B13A 3Q47B 4CCAA 4D10C 5LOZA 2LNIA 4H9OC 1TJCA 3PE3A 3CVYA 2KT9A 4AIFA 3RYFE 2ONDA 2NP9A 5ANRA 4YJ3E 4LRZA 4I1MA 4WUYA 3AU4A 4ZI3C 2W00A 2CA5A 2FI7A 3CX8B 4JHJA 3E08A 5E0OA 4NUUA 3AS5A 2PQNA 4O4IE 2VSYA 2RG8A 3L16A 3FUIA 3I0QA 2C5KT 4ZI2D 3PVLA 2LO6A 4FULA 1BR1A 1Y8MA 4Y6WA 2X9WA 2ZM0A 2FEZA 4A3VA 3FY4A 3NRYA 1D1BA 3D9KA 3QC1A 4JVSA 3N2KE 3SRZA 4HFVA 2OVFA 3CKBA 4JEHB 3PREA 3ZYMA 3ONXA 4FLBA 4H7XA 3CVQA 3ZMZB 4QKNA 2HM8A 5LP0A 1HF8A 4AM9A 3QWVA 3GN5A 4EZKA 3UUXB 3SHFA 3KV6A 1KT0A 2E9XA 1ZU2A 2R17C 3CVVA 5LFAA 3D9LA 5AENA 4JC8A 3MV3B 4KYOB 4M3OA 1FMWA 1E8ZA 4N2QA 3LS8A 3RIBA 3ANWB 3ZMTB 3IKOB 2CWYA 2A4ZA 3ZRHA 2MTQA 1NAFA 3VKGA 1IZNB 3FUHA 4UF0A 4G25A 3OTNA 3LVRE 5C1DA 4JUYA 4I6JA 3PURA 3T8OA 1W3BA 3FBLA 4MHCA 1INZA 3HVEA 2BVLA 3CPZA 5AIJA 4KT6B 3C50A 5J1GA 2DI4A 2KC7A 2PJQA 4ZI3D 2Y6XA 4N3CA 3RRNB 4O2AE 3QWPA 1NP7A 2NTYA 2PL2A 4U07A 3QJZA 2LOPA 1QZ2A 1V9DA 2X66A 3FDHA 5FXZA 3E4BA 1WR6A 2X6KA 4H63H 2YHCA 4KMOA 3ZHEB 3NRXA 5DJQC 1E96B 4JEUB 4XBFB 2ODVA 2A3DA 4MFRA 5FP3A 1D1CA 3AS4A 1XGWA 4CZZB 3MCXA 2DWKA 4L1BA 4CI1B 2IC9A 3QWWA 2NSZA 1H0AA 2AWIA 2NW8A 3CHQA 1U4QA 2WAUA 3FH8A 2KATA 3DPDA 3ML8A 3LPZA 3ZYLA 2KZ7B 3LDZA 4QX7B 3ZCIA 4J8EA 3SS1A 3PUQA 4AKHA 4GU5A 2D2SA 5LX8A 3HA4A 2IOSA 3FTZA 3IHRA 5JJ7A 1KT1A 3U64A 4I9EA 3N5LA 5KX5E 3CKDA 4KXKB 4A1SA 2IJGX 3RX6A 4UWKA 5KCMA 3ZMVB 3TXNA 4X1KE 1H6KA 2N2NA 4J8FA 3OXLA 3QUJA 5F8PA 5T3RA 1NA3A 2WQ7A 2DIWA 4PS7A 3FUJA 3FFLA 3LG7A 4UIGA 1BPOA 4GPKA 3KVBA 3CVLA 3ASGA 3S7DA 3R9AB 2AXZA 1QSDA 5AFUL 1AJ3A 4V3IA 4KVOA 5EX3A 4AKGA 5T4YA 2W0GA 4H9PC 4BJMA 3Q2MA 2NW9A 3ETUA 5A23A 3GZSA 3EHMA 3AA7B 1HZ4A 3C98B 5F3JA 3ULQA 1MHQA 1SZAA 1E8WA 3VTYA 2IFUA 3N2OA 5ARGA 2NW7A 2UY1A 4A1GA 1PC2A 3RRWA 2YU1A 3JQ0A 3GMIA 3AVRA 4PJNA 4GYOA 2XTLA 4MLKA 3H37A 2MOWA 1IQUA 5C2YA 2IC6A 4EOZB 2ZU6B 4NQ0A 2Q9QC 2PM7A 3MA5A 3LEWA 2M63A 3VU7H 1YD8G 5CB4E 3ZJ1A 2YINA 2CWOA 3K8PC 3L22A 2ZMAA 2VB6A 2XHEB 4UV9B 1Z3XA 4NRHB 3K3QC 5LXTE 2WVIA 4TV8E 2VJ8A 1HG5A 4OVVA 3URZA 4XIFA 4CRWA 3N2GE 4JW1A 3LK3B 3R7RA 2AXVA 3CHPA 3RRMB 5LJMA 1SQMA 4HE8A 3AB3B 3BQIA 3D9MA 5FY7A 4I50E 4FJZA 2H7VC 3B7UX 1OWOA 2C5JA 5LBQB 1X79A 4URKA 4H9RC 3CK9A 4DVDA 2X51A 4PK6A 5EK2A 4O4HE 1ELKA 4ILUA 3FBZA 3HVEB 4P09A 3D9IA 5JREA 1UJKA 3QB2A 5HWXA 2CLYB 4XI9A 3SNXA 1WYCA 2C0MA 4XE0A 2V1DB 3AAEB 1FEWA 5HXSA 2DNXA 5EX0A 3UFEA 3D0TA 5LHHB 3LY8A 3CWZB 4L7TA 1D0ZA 3KEZA 1MIVA 5HXHA 4NURA 3J7Yq 3ETVA 3CVXA 1DVPA 3SWHA 1Y6IA 3IEGA 4NACA 2LOSA 2NC9A 3MKRA 4PH4B 3RK6A 2RA1A 3BK9A 3I9WA 4JLEA 1ZBPA 3GZ1A 2AW6A 2MRIA 2H3RA 2XCBA 4IRUA 2N1GA 4O8SA 3SBTB 3IF8B 4OYSA 4KZ0A 2CG3A 2NOXA 4ANWA 3SD5A 2X9YA 4C0MA 1WY6A 4ACLA 3LBXB 4QWNB 2VL8A 5HQ8A 2WMNA 3IBEA 4XKCA 5JDNA 4GZ5A 5LNKA 1MMNA 3MYVA 4YJ2E 3C4XA 2WXMA 5LA6E 2L9QA 1VOMA 3AAAB 3I9YA 3MKQA 1ZHCA 5BV0A 2C0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQG B;  3CQC B;  3I4R B; 
#chains in the Genus database with same CATH topology
 4COF A;  4P29 A;  4YSX A;  4K5C A;  3RKO A;  2FO7 A;  3AS8 A;  4IT4 A;  2KZT A;  3DBS A;  3P4Q A;  2FUL A;  3T9K A;  2VUR A;  5JR9 B;  4N5C A;  4ASK A;  3WAJ A;  4GTV A;  2H7O A;  4APF A;  5LMN T;  1N4P A;  2X67 A;  1D9S A;  4G2V A;  5JR9 C;  3HRA A;  4IHJ E;  3UUX A;  3Q5E A;  2ILR A;  4AVX A;  4ILG A;  4EBA A;  3PNL B;  1SA5 A;  3MAC A;  4UVB B;  4FJY A;  3SOL A;  2AJA A;  2QYU A;  5L3C B;  4GPM A;  2MYS A;  1MMD A;  4EYY R;  5EN5 D;  2VQE T;  2WY2 A;  3RC3 A;  4B8A A;  2JQQ A;  1X5B A;  3R84 B;  1FT2 A;  4BT9 A;  4DBQ A;  4Q94 A;  3C3O A;  5ADX L;  4HS2 A;  1D1A A;  4BA9 A;  3CV0 A;  4B3R T;  2JIW A;  4N2S A;  4AIU A;  2J47 A;  3ZIM A;  4PUC A;  3QDN A;  3NZQ A;  2BTD A;  4I43 B;  3AE4 A;  3L13 A;  2ZM6 T;  4U2Y A;  3UU8 A;  2I6H A;  2ZM2 A;  3OAW A;  5E75 A;  1MYO A;  5FT9 A;  4Q69 A;  4G24 A;  3IEE A;  3PH0 C;  4ERR A;  4JA9 A;  3RU0 A;  4UI9 C;  5JJ6 A;  2XQ0 A;  2WXL A;  3N9N A;  4LMK A;  4DR4 T;  3AE8 A;  5C8Y E;  3P2B A;  3DP7 A;  4ILB A;  4UI9 K;  2F8Y A;  2VSO E;  4DMV A;  3Q5M A;  4YXD A;  2BED A;  3FUD A;  3HIZ A;  3MEK A;  3UUL A;  4U95 D;  1IQR A;  2PM6 A;  4XI0 A;  5KDM C;  4HVB A;  5JJT A;  5KWD A;  4AKR B;  1OWM A;  2XAQ B;  2XS8 A;  4U3C A;  5FVK A;  4UR9 A;  1E8X A;  5EDS A;  2UY1 B;  3FTS A;  1TN8 A;  4HFB A;  4YHH T;  5HXC A;  4GA1 A;  3BUA A;  3OKQ A;  3PU8 A;  5J2U E;  2E9X D;  2XEV A;  2CFU A;  2OVB A;  3ASF A;  2LJL A;  3F31 A;  2PG8 A;  1MX4 A;  3FUN A;  1T72 A;  2IML A;  4WBN E;  3V31 A;  2UUB T;  4YFS A;  5FY0 A;  4I1O B;  2FBW A;  4YDW A;  1MMA A;  2Y8D A;  5FZR A;  2WXR A;  4J7W A;  4HEA A;  4CYM D;  3D9J A;  4MAL A;  4ANV A;  4O4L E;  3FXE B;  4ZZB A;  4CN1 A;  5GON E;  2M6I A;  4K0K T;  3WG7 E;  3KBU A;  2HPJ A;  1OED C;  5DQV A;  3UM1 A;  5HEJ A;  5HEH A;  1KZO A;  3KIN B;  2ZLY A;  2KWI B;  4ILC A;  1SZ9 A;  2B0O E;  4JHK A;  1ZEE A;  4F53 A;  3JC6 D;  4PW8 A;  3RYC E;  4BFR A;  1JPL A;  3RKV A;  4YVO A;  2BKP A;  3KV9 A;  2IAK A;  5HCM A;  2X6F A;  4P1N A;  2J8S D;  4HRL A;  4B94 A;  3ZW3 A;  3ESL A;  2P9S G;  2PNN A;  1OWA A;  4K03 A;  4AQG A;  3FH7 A;  3NB2 A;  3MZL B;  3TJP A;  5JDG A;  5LCW C;  4MBQ A;  5C2T A;  1K3Z D;  2LSU A;  4YDO A;  2J07 A;  2VWA A;  3ZT7 A;  2VGY A;  5FWQ A;  3EJN A;  4ILH B;  2X9H A;  4BET A;  2R02 A;  4C48 B;  2WXF A;  2XAH B;  3ZYQ A;  1BR2 A;  4UEM A;  4GTS A;  3ASH A;  4IE5 A;  3NF1 A;  4TV3 A;  3ZEF B;  1OUV A;  3MX3 A;  3N9Q A;  5LMU T;  4F1P A;  2XAF B;  1NWM X;  4IE0 A;  4G23 A;  4XZ4 A;  2LSI A;  5JDH A;  4WAF A;  2KSR A;  4DUY T;  3FWV A;  5FQ7 A;  2DLR A;  4G8L A;  4QXB B;  2VKJ A;  4ANJ A;  2BG9 A;  2ZGG A;  4AOF A;  1S0P A;  4PNI A;  2LKH A;  4H7Y A;  2QFC A;  3UT8 A;  3RPU A;  2X38 A;  3EIJ A;  3WXX A;  5BT1 A;  3NQP A;  2I1K A;  1BR0 A;  3CHR A;  4DR7 T;  3S7B A;  2R03 A;  5G05 J;  1BI8 B;  3UU5 A;  5EK4 A;  4AP2 A;  4Z8X A;  3UKR G;  3SI5 A;  4BTA A;  3EVY A;  4AKI A;  4QHO A;  2KM4 A;  1FJG T;  4MS6 A;  2BS3 A;  4UQX A;  2LUH A;  3L09 A;  4IDP A;  3R6N A;  3FTV A;  1KLX A;  4ME2 A;  1W0B A;  1D0Y A;  4TUM A;  2KCK A;  2R59 A;  3CQC B;  3UTK A;  5CMW A;  4LF5 T;  3Q7A A;  3V2X A;  5BXO A;  4G2A A;  1JWF A;  4W9R A;  4ACK A;  2XAJ B;  3KFW X;  4UXN B;  3CK7 A;  3CVP A;  2XUE A;  3MGB A;  5JRC A;  5IYZ E;  5LG4 A;  4DR5 T;  3O4Z A;  4G1T A;  5HWY A;  2E2E A;  3MJW A;  4B6X A;  4L9I A;  4L2L A;  1N95 A;  5EIL A;  2WXK A;  1E1H B;  1V55 E;  4BES A;  2DCF A;  2VSN A;  3TAX A;  2H6F A;  4DND A;  3VKH A;  2I59 A;  1K8K G;  3QB5 K;  2BS2 A;  2IW5 B;  5LOV E;  3AU5 A;  2MAW A;  4CZ2 D;  5IY5 E;  2HO1 A;  4KUM B;  2VGX A;  3ZCJ A;  4WWP A;  1N34 T;  4E6H A;  3MZK B;  3GA8 A;  4GZ6 A;  4O1P A;  4A5X A;  5M72 A;  4EXT A;  1FVH A;  3RIU A;  3S7F A;  2J4D A;  1SA4 A;  3MK7 C;  4BTB A;  3HYM B;  3U66 A;  5D66 A;  3KAE A;  4I6E A;  1E8Y A;  3SFZ A;  3CKC A;  5L2L A;  2E9X B;  4AIS A;  3G2W A;  5JDM A;  3FU5 A;  3I3N A;  4TUU A;  3LVQ E;  5FZS A;  1WAO 1;  4DV0 T;  3J5P A;  3U3W A;  1ZKE A;  4I9C A;  2WM9 A;  2XAS B;  3CQX C;  1WLX A;  3CGH A;  1MMG A;  4HWH A;  4IN3 B;  3ZLI A;  1QQE A;  3AEC A;  5F5W A;  2K9A A;  1MX2 A;  4IE4 A;  3FZL B;  4QX8 B;  3A5X A;  4YY3 T;  3UUM A;  2DYS E;  3A8Y C;  4X65 T;  3KBT A;  3KSL A;  4EZ4 A;  1XNF A;  3I5P A;  3PZ4 A;  2CRB A;  2AE9 A;  1EF1 C;  3C4Z A;  1HO8 A;  3NZS A;  3AXJ B;  4AXH A;  2ETA A;  1ELR A;  4WBO A;  5ETW A;  3ZN0 B;  3ZT6 A;  3FB2 A;  4HFC A;  2I1J A;  3Q15 A;  1T98 A;  5AQR B;  3ZC0 A;  5JH7 E;  3AE2 A;  2IIU A;  2Q9Q D;  2FJE A;  3E30 A;  4N5Q A;  4U04 A;  4GAA A;  4PK4 A;  4LF4 T;  1IJ6 A;  2MOZ A;  3J9X 1;  3GYZ A;  1H2V C;  3QNK A;  5KJM A;  2YDS A;  4I17 A;  3P4W A;  2WXJ A;  3FUM A;  2ODU A;  3L8R A;  4JEU A;  1H2T C;  2LSG A;  2NXP A;  4DI3 A;  4ZXL A;  3PEV B;  3L9T A;  2K3W A;  4JEH A;  1N32 T;  1KNZ A;  4FI5 A;  4MLP A;  3RHW A;  4CGV A;  3C51 A;  4HOU A;  4UV8 B;  3KS2 A;  3QC9 A;  1UX5 A;  5FQ8 A;  4UWG A;  2CFZ A;  2JRK A;  1HTJ F;  1VCT A;  3U9W A;  4LNB A;  2WDR A;  4HWC A;  3MKD A;  3PUK A;  3PZ2 A;  2JPF A;  4GZ3 A;  3GZ2 A;  1MIY A;  3L3P A;  5JDL A;  3MV2 B;  5HRY A;  2FBN A;  3TG4 A;  1JWG A;  4U8Y D;  2QRX A;  5LCW J;  4OYK A;  2KND A;  4I1A A;  3D3M A;  2GRR B;  3SZ7 A;  5HXR A;  3JXJ A;  5FYM A;  4DID B;  4L0R A;  2VYI A;  5HKP A;  5JDF A;  4GOU A;  2LXM A;  1IJ5 A;  3F6Q A;  3K1S A;  5HAX A;  5FY1 A;  2ION A;  1UW4 B;  5AJD A;  5L4H A;  2LRK A;  3C4W A;  5KJN A;  3UQ4 A;  3X1D A;  1OED E;  1NZN A;  2XM1 A;  2XRZ A;  3EHQ A;  2Y4T A;  3EIQ C;  3IBP A;  5B1A E;  4A55 A;  3PNT B;  3DEP A;  4GA2 A;  2XPI A;  3CML A;  3HR0 A;  4LFC T;  2A2F X;  2PZI A;  4I2W A;  5BPP A;  5JA4 D;  4X5T A;  2AXU A;  1HXI A;  2Q7F A;  1MQS A;  4DO0 A;  4JD2 G;  2OV8 A;  4B3M T;  3RGL A;  5KMG P;  2BKK B;  1YKH B;  1BD8 A;  4LMJ A;  3E34 A;  2XEN A;  1L0V A;  4NIK A;  4I43 A;  2XQ5 A;  1LD7 A;  1S63 A;  3N9L A;  3RO3 A;  4N3A A;  3ML9 A;  3UQ7 A;  4GKJ T;  3CX6 B;  5L3G B;  2XAG B;  1D0X A;  3UKU G;  2DHR A;  4X1I E;  2WXN A;  2R2L A;  4FLH A;  4O6F A;  3PDY A;  2ZM8 A;  4B3T T;  4PAG A;  4F6R D;  4GA0 A;  3QAQ A;  1UJJ A;  4HOT A;  1E7P A;  5LGU B;  5CA0 E;  4TUY E;  5FTP A;  4AI6 A;  4L5G A;  2EQX A;  3ONL A;  1XWM A;  4HOS A;  2H88 A;  2JMK A;  5JDQ A;  2IY0 C;  4TRQ A;  1Z6T A;  3EAM A;  3HI2 A;  4LF8 T;  3EDV A;  4ANU A;  1W0A A;  1WYB A;  1QNF A;  2V0P A;  2ACX A;  2LSJ A;  5J2T E;  3K3O A;  3EU9 A;  4F1S A;  2X6I A;  1K1B A;  4YVQ C;  5EYP F;  4M1P A;  2FF4 A;  1ZP0 A;  2A9U A;  2X68 A;  1HCI A;  3CX7 B;  3ISM C;  1H2U A;  4G11 A;  1IHG A;  1YA0 A;  1HFA A;  3QK6 A;  3E22 E;  2CXL A;  2CHW A;  3ZEF A;  4X1Y E;  3UUB A;  4LUN U;  1OWP A;  3ZN1 B;  4QFV A;  2QVA A;  2HH7 A;  2FO1 E;  4DX7 D;  3QKY A;  5AQV B;  4C0E A;  5L4E A;  2FJA A;  3Q79 A;  4FAD A;  3T5V A;  4I4T E;  3LK4 2;  4FP7 A;  5J90 A;  2Q9Q B;  2ZIR A;  2V7J A;  1N4R A;  4JI7 T;  3BEE A;  2W63 A;  4I55 E;  2YK0 A;  4J2C A;  5ABG A;  3AAI A;  4HOQ A;  2HYZ A;  2L3L A;  2CM0 A;  1JUQ A;  2DYR E;  3RAU A;  3AG2 E;  3ZHE A;  4RG6 A;  2DZO A;  4IUL A;  2C2L A;  3B57 A;  2XGO A;  4DK5 A;  2G0U A;  4A3T A;  2VKD A;  3O4X E;  3ZKJ A;  1E2A A;  2DWZ A;  1S35 A;  2Q9Q A;  5FQ4 A;  3TWQ A;  5BXU A;  2NWB A;  4YND A;  4DR2 T;  4WNG A;  3RO2 A;  1XMQ T;  3NAW A;  4IDZ A;  5AQL B;  4EYU A;  4PJL A;  4U31 A;  2I2O A;  4NXN T;  3G2S A;  4L2Y A;  2UWJ G;  2E9X C;  2LT3 A;  3BG1 B;  4U0Z A;  4KP3 C;  2WXG A;  4AV7 A;  3FH5 A;  4XX5 A;  2WXI A;  4U72 A;  2BKG A;  4BJN A;  5KJK A;  5ARF A;  2FJD A;  2UXC T;  4CGW A;  3LYA A;  2BKN A;  4QH4 A;  4EZL A;  3J5Q B;  3JUE A;  3FHN A;  5DBK A;  4EV6 A;  1Z8U A;  4OFZ A;  4U7E B;  1CUN A;  2W61 A;  3ZFW A;  3KSQ A;  1T7S A;  4UQZ A;  4ILA A;  5G2N A;  4N78 D;  2XZE A;  4B89 A;  3CQG B;  2VGX B;  1T8B A;  4BX8 A;  5AQP B;  4CDN A;  1GW6 A;  2XSB A;  2K5B B;  2PTF A;  3K3N A;  3DSS A;  2KIN B;  5ENS D;  2LRL A;  3RQU A;  3KVA A;  3PUY F;  3FTX A;  2J4G A;  3ZN3 A;  2XQ4 A;  2LKG A;  5LGN B;  4HBD A;  5AQN B;  4EPZ A;  2D9D A;  3EHN A;  2B76 A;  2Y48 B;  2VVN A;  4BT8 A;  3T8K A;  2FUP A;  3MJX A;  3U4T A;  3S2A A;  4EIW A;  3O1H A;  5IHY A;  2MYO A;  4C90 A;  2VL0 A;  5AQA A;  3G06 A;  4JI6 T;  4JI2 T;  1W09 A;  5FXX A;  2P2C P;  4U0U A;  3ZXS A;  4CT0 A;  4CDR A;  3P8C D;  3PUG A;  4R7L A;  2M6B A;  3V5U A;  4LER A;  4TXQ A;  1P5Q A;  5H6Q B;  4F3V A;  4WNK A;  3KV4 A;  4IDN A;  2WWU A;  3QK0 A;  3KDS E;  4U7I A;  3AAA C;  4OVU A;  4FA6 A;  3Q9D A;  1ELW A;  5CEA A;  1LD8 A;  4WNF A;  1YKE B;  2RFM A;  4JPS A;  4ZI7 E;  3CST A;  2WDQ A;  3EDU A;  3TWS A;  4UQY A;  5AQK B;  2V7I A;  4CQI A;  4GCO A;  5ITZ F;  3UIN C;  4U74 A;  2PQR A;  4GZC A;  4KZC A;  2XGM A;  4CXY A;  3AEA A;  4JHR A;  4PS3 A;  3S7J A;  3B7S A;  1H7C A;  2WS3 A;  4PFO A;  3BQO A;  3SO8 A;  3JAF A;  5L3E B;  5AN8 A;  2KLQ A;  4U63 A;  4K5A B;  4JA7 A;  2Y69 E;  1QUU A;  2R6G F;  3APD A;  1AWC B;  2BZB A;  3DST A;  2V5F A;  1E7V A;  4KMC A;  4TV9 E;  5CJ5 A;  3SBS A;  3PS6 A;  1QLB A;  4UVA B;  4FJO A;  3E0Z A;  4GB9 A;  2EIN E;  3TLS A;  4FU3 A;  4LFB T;  2W67 A;  3GW4 A;  3DSU A;  3ONJ A;  4ZI2 C;  2D0U A;  4O1O A;  2L9B A;  4Q25 A;  1B89 A;  3SFY A;  2E2A A;  1Z3Y A;  2GK9 A;  2J49 A;  5BNW A;  2UXD T;  4GML A;  4Z90 A;  1E7U A;  1HE8 A;  1OED A;  2BBH A;  3WAK A;  2WQH A;  2CPT A;  2E8I A;  1VDY A;  3Q5X A;  5CRV A;  2JAB A;  3FZH B;  1A5E A;  4DPR A;  1U3C A;  4UEL A;  2LM2 A;  2LLY A;  4CDM A;  1WG0 A;  2ETB A;  4BSX A;  3FZM B;  3OVU A;  3P4P A;  1R8I A;  3UT7 A;  3O1J A;  4YDY A;  1ZV4 X;  2L6B A;  4O4J E;  3G2T A;  2VKO A;  4JYA T;  1FIO A;  1D8E A;  2W62 A;  3HXF A;  3UI2 A;  2EIM E;  3HKD E;  1DU2 A;  4HQD A;  3Q5D A;  3ONL C;  5EK3 A;  3W15 B;  3FUF A;  3ONK A;  4BAY B;  1TNU A;  5L3B B;  2Y4U A;  5AQU B;  4IDO A;  5AJL A;  3WI3 A;  1XNR T;  4K0R A;  3C98 A;  3PV0 F;  3P4S A;  4GTQ A;  3FTW A;  3I0O A;  3APF A;  1OT8 A;  4AQF A;  5FQ6 A;  5DQW A;  3NZU A;  5CRU A;  3N71 A;  3PUW F;  4HWI B;  2IUB A;  4V1A v;  4ZOL E;  4TWH A;  4LF7 T;  3FEX A;  2CBI A;  2V6Y B;  1U5P A;  1LF8 A;  2J4B A;  5KJL A;  3JCF A;  3RRU A;  4GMR A;  4KI0 F;  4RSY A;  4AY6 A;  3OXG A;  3OPC A;  5CEC B;  1H6P A;  1QYM A;  1OY3 D;  1TN7 A;  4ZHQ E;  3FU3 A;  2Y1L E;  4G63 A;  2YDQ A;  2BDE A;  3OTO T;  1UUS A;  2ACZ A;  5IUX A;  4DLO A;  2KZT B;  1Z0P A;  4X66 T;  2CHX A;  2LSV A;  5ABE A;  2LM9 A;  2GW1 A;  4DX6 D;  5A7D B;  2K48 A;  2LXL A;  4H9Q C;  3PZ3 A;  3DJB A;  5LHI B;  3ZNG A;  2WPV A;  3D9N A;  4CN4 A;  2RP4 A;  5FZQ A;  3HXB A;  3NBN B;  4NXM T;  2DBA A;  4PS8 A;  1G3N B;  2B1E A;  1KPS B;  2DZN A;  5G55 A;  4A97 A;  2XQ7 A;  3ULE G;  3ENE A;  2JQ9 A;  2F0Y A;  1UG3 A;  1KZP A;  1X81 A;  1NA0 A;  2CG2 A;  3H3M A;  4DX2 A;  3DWL G;  4JI4 T;  3PUS A;  1IBL T;  5JR9 A;  3TLT A;  3O1I A;  5LCY A;  2HHH T;  3M65 A;  4B0Z A;  3HKE E;  4ADZ A;  3PE4 A;  5CED B;  1E90 A;  2HR2 A;  3LY7 A;  3GN5 B;  4OX9 T;  3I1A A;  4ATG A;  4HN9 A;  2R5S A;  2WU2 A;  1Y64 B;  2RFA A;  1N4Q A;  2WXO A;  1PAQ A;  4DJA A;  3RYH E;  1DCE A;  4JB8 P;  5AQM B;  5ANL A;  4EEC A;  3S4U A;  1VRB A;  3VRA A;  1N4S A;  2ZIS A;  5BW8 C;  2VTB A;  1BI7 B;  2XS1 A;  5AYW D;  5FIN A;  4JBW F;  1L5J A;  4GTT A;  4U33 A;  3AA6 B;  4KHZ F;  4U8H A;  3V5S A;  2XEE A;  1M62 A;  2X3M A;  2CHZ A;  4GIW A;  3ASO E;  2BUG A;  2J1D G;  4J8Y A;  5JQG E;  3JQ1 A;  3FXD B;  2QYJ A;  3VLF A;  1OXJ A;  4U2Z A;  3ZYK A;  2IF4 A;  3BG0 B;  3TG5 A;  2YN6 A;  4EQF A;  3RIU C;  4IYP A;  4HI9 A;  1HS6 A;  3G2U A;  1FCH A;  2E0I A;  3CR3 A;  2X0Y A;  4BY6 A;  5TAO A;  3CLJ A;  2P9B A;  2EHO D;  4G26 A;  3AEE A;  1BLX B;  2OLT A;  3BQL A;  2WU5 A;  3LJ3 A;  4CI3 B;  4LCT A;  4FHJ A;  1YW0 A;  2VKH A;  5JVD E;  4JI3 T;  2LSY A;  2CEA A;  2SPC A;  3HXE A;  5ENQ D;  4HLE A;  2WQ6 A;  4MKT A;  3HL6 A;  4LFA T;  3OJA A;  2F37 A;  4JZY A;  3NBX X;  4ATZ D;  3CVR A;  4ILI A;  4HTE A;  4WND A;  4HI8 A;  4X8Q A;  3ESK A;  3L6A A;  3I4R B;  3PUA A;  2M67 A;  5JHB A;  2WZI A;  1FMV A;  4BER A;  4KX6 A;  2UXN B;  4CT4 A;  2P58 C;  1IHB A;  2P9P G;  4EAH A;  2OCC E;  3AG1 E;  5D2M C;  3RC8 A;  5EYL A;  3G2V A;  2X6H A;  4ZS3 A;  3RRC A;  5M4Y A;  1JNZ A;  3JC6 C;  3EDT B;  3L17 A;  3FUK A;  4CXX A;  3QOU A;  4UWF A;  4J6I A;  2V6Y A;  1TNY A;  2WXQ A;  3CHO A;  5LBM A;  5A1L A;  2QGS A;  2VSX E;  2WBL A;  4GK5 E;  4HFI A;  4DR3 T;  1OWL A;  5CHE E;  5G04 J;  2EHO C;  3Q4A B;  3HHM A;  1UUR A;  4LSZ E;  4KBM B;  4GZD A;  2GRO B;  3ZSS A;  5HYA A;  4HB5 A;  5LJN A;  3OBV E;  3L08 A;  3UPV A;  4P0A A;  1DCQ A;  5CMY A;  3NOG D;  3CVN A;  2CBJ A;  4YDE A;  1EPU A;  3KEA A;  3RIA A;  5AQH B;  2EIL E;  4ZHB A;  1Q2Z A;  2V7M A;  3EUV A;  4FC8 A;  3P1U A;  3RSE G;  3FEY A;  3A7M A;  1KF6 A;  4PFP A;  5CBO A;  3EUH A;  4XZC A;  3AJI A;  3PZ1 A;  4B93 B;  3V30 A;  2OOE A;  2E5L T;  1MZC A;  4HRM B;  4U96 D;  3TWV A;  2XQY A;  3FTY A;  4DBR A;  5FL1 A;  2CHN A;  4X20 E;  2A5E A;  2P9U G;  4P0B A;  3CVU A;  1HNZ T;  4AKL A;  5HEU A;  3UIO C;  3VLD A;  1US7 B;  3O48 A;  5CBN A;  5KBA A;  3V2O A;  4BX9 A;  3UU4 A;  3RJV A;  2A72 A;  3T5X A;  2LE8 A;  2EIK E;  4TZ4 C;  2XSA A;  3B7R L;  1H19 A;  3Q73 A;  3LFM A;  2XQA A;  3PJA J;  3LXU X;  5BV1 A;  5JMN D;  2J09 A;  4NUV A;  4AXP A;  5G05 C;  4ABN A;  3DRA A;  5DAB A;  2I0M A;  3ZPJ A;  2NYJ A;  3UQ3 A;  1ZB1 A;  4PJJ A;  2GRQ B;  3N9P A;  3B7T A;  5A6C A;  2BF0 X;  1KNP A;  3LSV A;  4I6G A;  5E76 A;  2UXB T;  2UUC T;  1NEN A;  2V26 A;  2JMH A;  3ANW A;  3CIA A;  2LSK A;  4K5B A;  1BU9 A;  1EYH A;  1XDP A;  2A5U A;  2XZT G;  2YNQ A;  3ABM E;  2WP9 A;  3UT5 E;  1B7T A;  4AEZ C;  2HN1 A;  3DXM G;  4IST A;  2ES0 A;  2MHK A;  3RF1 A;  2EHO B;  4HGA A;  5HXE A;  3FUE A;  4CEM A;  4YTN A;  3NWI A;  3DSV A;  3FZF B;  3T8M A;  4AJW A;  3LY9 A;  4UUC A;  2V8S E;  3T1Y T;  5T8I A;  4F6R C;  3FUL A;  3ZGQ A;  3PTR B;  2X9X A;  3ABV A;  4YSY A;  4YSZ A;  5BR8 T;  1KK7 A;  3M3Z B;  3RYI E;  1N54 A;  4PK5 A;  3Q5W A;  3PE0 A;  2DVW A;  1N0R A;  3ZT5 A;  4N39 A;  2KXP B;  3UM0 A;  2BG9 E;  1JNR A;  2PBI A;  2VAS A;  1FVF A;  4H9N C;  4YLH A;  2B6C A;  3CHS A;  2WZH A;  4GYS A;  3LJC A;  5AQO B;  5LGT B;  4TXR A;  3CIR A;  1W9R A;  2WSS V;  3UM3 A;  5BUZ A;  3UTM A;  2WWV A;  4UWH A;  2P9L G;  4GMJ A;  2LEH A;  5BMV E;  1LVK A;  3AG3 E;  4H63 V;  5LP6 E;  2V6X A;  4IE7 A;  4HFE A;  3AE7 A;  1Z5S C;  1OWN A;  3NZP A;  2LAI A;  3LKU A;  1UK5 A;  3QAR A;  4QXC B;  3ZU7 B;  2XHE A;  4Z68 A;  4J8S A;  5HI7 A;  3R7Q A;  4UWL A;  3FTU A;  4JI1 T;  1OCC E;  4EBA G;  2P9I G;  4QH1 A;  3KV5 A;  1N52 A;  1HS7 A;  4PJM A;  4GTO A;  4GCN A;  2I9C A;  3EHR A;  3FHE A;  4KBQ A;  3BQK A;  1N11 A;  2VK9 A;  2VTB B;  2JLB A;  3CSF A;  4B8C B;  1HU3 A;  5FKY A;  3H3A A;  3RH3 A;  1OED B;  5L3D B;  2GRM A;  3ZJ2 A;  3LCA A;  1DNP A;  4Y6C A;  5J08 A;  4GTP A;  2OV9 A;  3PRZ A;  3UMV A;  3HKB E;  1PY1 A;  4DX5 D;  4A56 A;  5JHA A;  3PDN A;  3MA9 A;  2Y3A A;  5CA1 E;  3APC A;  4U7Y A;  1TJF A;  4EEB A;  2KWH A;  5FVL A;  1IYG A;  1TNO A;  2IQC A;  3OXF A;  5L47 A;  2X0H A;  4BWR A;  2KBX A;  1IAP A;  3GWH A;  2XGS A;  1S64 A;  3HKC E;  3TXM A;  3FP3 A;  2XEH A;  2WB2 A;  4CXW A;  3TKL B;  5D0Q D;  2YHE A;  2OA5 A;  5JTG A;  2KCL A;  2L8K A;  3AA1 B;  3VLE A;  4ISS A;  3PEU B;  4CN6 A;  3D9O A;  4GK0 E;  2UXX B;  3TL5 A;  2BG9 B;  2PFV A;  4WZX A;  3AEG A;  1XMO T;  3UT4 A;  2CMR A;  2VQ2 A;  4LF9 T;  3MXZ A;  2YDR A;  3O9X A;  1SE7 A;  4GYR A;  4YHJ A;  2L6J A;  4HFD A;  4JL0 A;  4RVB A;  2WXH A;  2CCQ A;  3FU0 A;  4PDX A;  4E7Z A;  2HN2 A;  5ENN A;  5FXW A;  4J8D A;  2V7L A;  4LF6 T;  5CCL A;  4QH5 A;  4ZS2 A;  4OK0 A;  3UUN A;  1MNE A;  4XAX B;  3JYS A;  4EZH A;  4GYY A;  1G8X A;  4JI8 T;  4I0U A;  3HDX A;  2XPZ A;  1N94 A;  3L39 A;  1SA0 E;  5H7P A;  4Q96 A;  3TGO A;  2HE0 A;  1A17 A;  1YMP A;  4OHF A;  2JQH A;  2V5D A;  3EU5 A;  4APO A;  5FNV E;  3ABL E;  4EB6 E;  5AQT B;  2V7K A;  2N9D A;  4HKA A;  5CCM A;  3ZUV B;  4HLL A;  1KFY A;  5ENO D;  2IO2 C;  1G73 A;  1S94 A;  4TX5 A;  5G04 C;  1YYH A;  3KD7 A;  2CE7 A;  3UM2 A;  3D9P A;  4GYW A;  3LBX A;  3VTX A;  3Q75 A;  3DTO A;  1TYQ G;  4AQF C;  1N9A A;  4DMW A;  2XPY A;  3LK2 B;  4NIQ A;  1FPP A;  4TNW A;  5DIZ A;  3PZD A;  4N3B A;  1HH8 A;  4HFG A;  3ASD A;  4JXT A;  4NPP A;  1DC2 A;  1WRD A;  2GRL A;  3SGH A;  2LAH A;  4XEI G;  1WFD A;  4E85 A;  2HPL A;  3OYZ A;  5HS0 A;  4DI4 A;  2YU2 A;  5L3F B;  3Q49 B;  3DSX A;  1UGO A;  1LKX A;  3CVW A;  1OCR E;  2YEV C;  2L0T B;  2FJB A;  5AQS B;  4C91 A;  2KXP C;  5ABF A;  5AQJ B;  2QA7 A;  5LYJ E;  3N9M A;  2V8S V;  2CXD A;  1UN8 A;  2IU1 A;  2XCC A;  4L23 A;  4DV1 T;  2RD0 A;  2MBG A;  4K0U A;  3UX4 A;  3IHY A;  3CK8 A;  4LML A;  4DV5 T;  2QY7 A;  4ANX A;  1BR4 A;  2KMF A;  3ZC1 A;  5LB7 B;  1MND A;  4OYJ A;  2XQ8 A;  2AXD S;  3N9O A;  1JCR A;  4DLQ A;  2L0I A;  3QB5 A;  3UU3 A;  1SHZ C;  2NTX A;  2XRY A;  5EZY E;  3ASN E;  1XDO A;  2DWG A;  4E7S A;  5H6R B;  4RG9 A;  3AE5 A;  5FL0 A;  4M7C A;  2WMO A;  3JUI A;  2X0L B;  5FXV A;  3CEQ A;  4O2B E;  3QNU A;  2Z6E A;  2GGF A;  4I2Z A;  3UXG A;  1K1A A;  5KNH D;  4DX1 A;  2BVM A;  3AVS A;  2UU9 T;  5JRC B;  2AVP A;  3IHV A;  4QXH B;  4HXI A;  4DV3 T;  3C64 A;  4IIJ E;  2D0T A;  2J62 A;  4WWN A;  2YQ8 A;  3LJN A;  1UX4 A;  3CHM A;  1EDU A;  3I4G A;  3P7I A;  3L54 A;  3Q9N C;  2JJ9 A;  4JI5 T;  1YQ4 A;  3ZMS B;  2CXF A;  2EHO A;  4H9S E;  4WW0 A;  3ZST A;  4HOR A;  1MIW A;  3ZPO A;  1WM5 A;  4FHK A;  4EZJ A;  4LEU A;  3W9F A;  5KXJ A;  3SF4 A;  3U78 A;  4OAU C;  1LTX A;  5HCJ A;  3AA0 B;  2VGE A;  3OYX A;  4UI9 J;  3CK6 A;  4LG6 A;  3F2E A;  3PUJ A;  1LVF A;  1NI1 A;  5EKQ D;  4JI0 T;  4WWO A;  2D5U A;  3TWR A;  1IXV A;  2C0L A;  4UF0 B;  1HX8 A;  2V4L A;  4IGU A;  4DR6 T;  4TN7 B;  4WNE A;  2DCP A;  4IE6 A;  3QOF A;  2H89 A;  1O3X A;  3ZMU B;  2KCV A;  3EAB A;  5CER B;  1YCS B;  4ZZC A;  2J9Q A;  4MRU A;  2XY8 B;  3U3I A;  2J08 A;  3FU6 A;  5FMN A;  4KVM A;  1UN9 A;  4X62 T;  3PUX F;  4YT0 A;  3F57 A;  1RW2 A;  3UU6 A;  1TEZ A;  5D0O D;  2BS4 A;  3IV0 A;  5FJY A;  2CLY C;  2C5I T;  2IOL A;  3JCK C;  4WYV A;  1HG2 A;  1OCO E;  3VRB A;  4UVC B;  3VHL A;  2WXP A;  3C72 A;  2LHN A;  4AY5 A;  4CI2 B;  2X6J A;  1UCU A;  2QYW A;  5ABF B;  1TNZ A;  1QBQ A;  4XKB A;  3ZVV A;  5IWA T;  4C9B B;  4B3S T;  3ABK E;  1EZ3 A;  2K24 A;  4F7A A;  3X2Q E;  2LHR A;  1LRZ A;  1N36 T;  1OXZ A;  5LHG B;  3MKQ B;  4U0S A;  2JEK A;  3K9I A;  3RI5 A;  4J0U A;  1U3D A;  3UFG A;  3PU3 A;  3B13 A;  3Q47 B;  4CCA A;  4D10 C;  5CGM A;  5LOZ A;  1J1J A;  2LNI A;  3E33 A;  4YTP A;  4H9O C;  2XQ9 A;  1TJC A;  3PE3 A;  3CVY A;  2KT9 A;  4AIF A;  3RYF E;  2E5V A;  4IL9 A;  2OND A;  4HWD A;  2NP9 A;  5ANR A;  4YJ3 E;  4LRZ A;  4I1M A;  4WUY A;  2YOE A;  3TWU A;  3AU4 A;  4ZI3 C;  2W00 A;  2VQF T;  2CA5 A;  2FI7 A;  4KHP T;  3CX8 B;  4DUI A;  4JHJ A;  3E08 A;  5E0O A;  4NUU A;  3AS5 A;  2PQN A;  3DPY A;  3AXJ A;  4O4I E;  2VSY A;  4TXP A;  2H6I A;  2RG8 A;  4RQI A;  3L16 A;  3FUI A;  2YKS A;  2C5K T;  3I0Q A;  4ZI2 D;  3PVL A;  2LO6 A;  3FZK B;  4FUL A;  1BR1 A;  1Y8M A;  3RQW A;  5KNG A;  4Y6W A;  4LNG A;  4MBG A;  2X9W A;  2ZM0 A;  2FEZ A;  4A3V A;  3FY4 A;  3NRY A;  3AEF A;  1D1B A;  3D9K A;  4GTR A;  3QC1 A;  4JVS A;  3TWT A;  3N2K E;  1CHU A;  3SRZ A;  4HFV A;  1HR0 T;  2OVF A;  3CKB A;  4JEH B;  5AQI B;  3PRE A;  3ZYM A;  3ONX A;  4FLB A;  1SUM B;  4H7X A;  3CVQ A;  3ZMZ B;  4ZFH A;  2QC9 A;  4QKN A;  3Q9U C;  2HM8 A;  5HEG A;  1IKN D;  5LP0 A;  3ZKR A;  5CFB A;  1HF8 A;  4AM9 A;  3QWV A;  3GN5 A;  4EZK A;  3UUX B;  3SHF A;  3KV6 A;  1KT0 A;  4HNA D;  4A63 B;  1S70 B;  2E9X A;  5ABH A;  1ZU2 A;  2R17 C;  3B7B A;  2ZXW E;  3CVV A;  5LFA A;  2UUA T;  3TLU A;  3D9L A;  4HWF A;  5AEN A;  3RLF F;  4JC8 A;  3MV3 B;  4KYO B;  4M3O A;  1KEY A;  3B95 A;  1FMW A;  1E8Z A;  1O5M A;  2H6H A;  2H6G A;  4N2Q A;  3SQV A;  3LS8 A;  2W66 A;  3RIB A;  3ANW B;  1N33 T;  2WB5 A;  3C3Q A;  3ZMT B;  3IKO B;  2CWY A;  1IBM T;  2A4Z A;  2OEV A;  5B1B E;  3ZRH A;  2MTQ A;  1NAF A;  3VKG A;  1TN6 A;  5AQ7 A;  1IZN B;  3FUH A;  4UF0 A;  3SFD A;  4G25 A;  2WQY A;  3OTN A;  1WDY A;  3LVR E;  1YXR A;  5C1D A;  1JCQ A;  4JUY A;  4I6J A;  3PUR A;  2XM2 A;  3T8O A;  1W3B A;  3FBL A;  4O60 A;  3TWW A;  1FT1 A;  5AAO A;  4MHC A;  1INZ A;  3HVE A;  3NKZ A;  2XPK A;  3C5R A;  2BVL A;  3CPZ A;  5AIJ A;  4KT6 B;  3C50 A;  5J1G A;  2DI4 A;  1IBK T;  2KC7 A;  2PJQ A;  3C3R A;  4ZI3 D;  3SFX A;  2Y6X A;  4A98 A;  4X64 T;  4N3C A;  3RRN B;  3R9M A;  4O2A E;  3QWP A;  1NP7 A;  4LNU D;  2QZA A;  2NTY A;  2PL2 A;  4U07 A;  3QJZ A;  2LOP A;  5EID A;  1QZ2 A;  4AQY T;  2IHR 1;  1V9D A;  2X66 A;  3FDH A;  5FXZ A;  3E4B A;  1WR6 A;  2X6K A;  2DL1 A;  4H63 H;  2YHC A;  4KMO A;  3ZHE B;  3NRX A;  5DJQ C;  5ENT D;  1E96 B;  4JEU B;  4XBF B;  3AE3 A;  2ODV A;  2BBJ A;  2A3D A;  3L82 A;  4MFR A;  5FP3 A;  3IA3 A;  1D1C A;  3AS4 A;  1XGW A;  1X9B A;  4CZZ B;  3MCX A;  3DEO A;  2DWK A;  4L1B A;  1UOH A;  1I94 T;  4CI1 B;  2IC9 A;  3Q7F A;  3QWW A;  1NFI E;  2NSZ A;  1H0A A;  1TR4 A;  2NW8 A;  1GQE A;  2AWI A;  3CHQ A;  1U4Q A;  2WAU A;  4IRE A;  4RLY A;  3FH8 A;  1SW6 A;  2KAT A;  3DPD A;  3ML8 A;  1HNX T;  3LPZ A;  3ZYL A;  2KZ7 B;  3LDZ A;  3PUZ F;  4Z91 A;  4QX7 B;  1XZY A;  3ZCI A;  4DV7 T;  5AQB A;  4J8E A;  3SS1 A;  2NR4 A;  3PUQ A;  4AKH A;  4GU5 A;  2XQ6 A;  2D2S A;  2MPK A;  5B3S E;  4TWF A;  5LX8 A;  2VVS A;  3HA4 A;  2IOS A;  3RKG A;  3FTZ A;  3IHR A;  4GKK T;  5JJ7 A;  1KT1 A;  5LG3 A;  3U64 A;  4I9E A;  5ENP D;  3N5L A;  5KX5 E;  3CKD A;  4KXK B;  4A1S A;  1RZ4 A;  3LDQ B;  2IJG X;  3RX6 A;  4UWK A;  3RIF A;  5KCM A;  3ZMV B;  1TNB A;  4DR1 T;  3TXN A;  4X1K E;  1H6K A;  4L9P A;  2N2N A;  4J8F A;  3SY2 A;  3ULY A;  2RKK A;  4F8H A;  5FIO A;  3OXL A;  3QUJ A;  5F8P A;  3NVO A;  5T3R A;  1NA3 A;  2WQ7 A;  1XNQ T;  2DIW A;  4PS7 A;  3FUJ A;  1U2V G;  3AG4 E;  3FFL A;  2F8X K;  3LG7 A;  4UIG A;  1BPO A;  1D8D A;  4GPK A;  5J0Z A;  3NOC D;  3KVB A;  3CVL A;  2R05 A;  5AQF B;  3ASG A;  3S7D A;  1WCR A;  4G8K A;  3R9A B;  2XJ7 A;  2AXZ A;  1QSD A;  5AFU L;  1AJ3 A;  4V3I A;  1KNR A;  4KVO A;  5C3J A;  2ETC A;  2V4H C;  2BKO A;  2GRP B;  3BU8 A;  4YTM A;  5ENR D;  4AKG A;  5EX3 A;  2P9K G;  5T4Y A;  2W0G A;  1M7K A;  4BSZ B;  1V54 E;  4H9P C;  4BJM A;  3Q2M A;  2NW9 A;  1MJ0 A;  3ETU A;  2IEJ A;  5A23 A;  3GZS A;  3EHM A;  3AA7 B;  1HZ4 A;  3C98 B;  5F3J A;  3ULQ A;  1MHQ A;  4OAV B;  1SZA A;  1E8W A;  3D9H A;  3VTY A;  2IFU A;  3N2O A;  1OCZ E;  2NW7 A;  2UY1 A;  4GTM A;  5ARG A;  1PC2 A;  4A1G A;  3RRW A;  2YU1 A;  3JQ0 A;  3GMI A;  3HXC A;  3AE6 A;  1O1T A;  3AVR A;  4PJN A;  5EIB E;  3EI0 A;  4HRN A;  4GYO A;  2XTL A;  4MLK A;  3H37 A;  3TWX A;  2MOW A;  1IQU A;  3V79 K;  5C2Y A;  2IC6 A;  1HNW T;  4EOZ B;  2ZU6 B;  4NQ0 A;  2W2U A;  2BG9 C;  2Q9Q C;  2IO3 C;  4U8V D;  2PM7 A;  3MA5 A;  3LEW A;  4IDQ A;  2W4X A;  2M63 A;  3VU7 H;  1YD8 G;  2V5Q C;  5CB4 E;  1I6Z A;  3P50 A;  4HFH A;  3TLV A;  1JCS A;  3ZJ1 A;  2YIN A;  2CWO A;  3K8P C;  3L22 A;  3DXK G;  4DUZ T;  2ZMA A;  2VB6 A;  2XHE B;  4UV9 B;  1Z3X A;  2WDV A;  4BEP A;  2V5C A;  5AQQ B;  3DSW A;  4NRH B;  2F4V T;  3K3Q C;  5LXT E;  2WVI A;  4QQI A;  1H6O A;  4TV8 E;  3JAD A;  2VJ8 A;  3AEB A;  1HG5 A;  3PUV F;  4OVV A;  3URZ A;  4XIF A;  4CRW A;  4DV4 T;  3N2G E;  2ZGD A;  4JW1 A;  3LK3 B;  3R7R A;  2AXV A;  3CHP A;  2GRN B;  3RRM B;  4DV6 T;  5LJM A;  1SQM A;  4HE8 A;  3HG0 D;  3AED A;  3AB3 B;  2CHO A;  5AAR A;  3BQI A;  3D9M A;  5FY7 A;  4I50 E;  4FJZ A;  4IL4 A;  3W9G A;  2H7V C;  1N0Q A;  3UIP C;  1VCS A;  3B7U X;  1OWO A;  5AQG B;  3HXD A;  2C5J A;  5LBQ B;  2JQK A;  1X79 A;  4URK A;  4H9R C;  3CK9 A;  4DVD A;  1MX6 A;  4JV5 T;  2X51 A;  4PK6 A;  4TNV A;  5EK2 A;  4O4H E;  1ELK A;  4ILU A;  3FBZ A;  3HVE B;  4P09 A;  3D9I A;  3VR9 A;  5JRE A;  1O1R A;  1UJK A;  3QB2 A;  5HWX A;  3T1H T;  2CLY B;  4XI9 A;  3E37 A;  1NL4 A;  3SNX A;  5AQ9 A;  1WYC A;  2C0M A;  4XE0 A;  2V1D B;  3AAE B;  1FEW A;  1J5W A;  5HXS A;  2DNX A;  5EX0 A;  3UFE A;  3D0T A;  5LHH B;  2XZD G;  3LY8 A;  3CWZ B;  4L7T A;  1J5E T;  1D0Z A;  1HX1 B;  3KEZ A;  1AP7 A;  1MIV A;  5HXH A;  4NUR A;  2WCA A;  2RPA A;  3EHZ A;  3J7Y q;  3ETV A;  4TWD A;  1SVX A;  3CVX A;  5HEO A;  1DVP A;  4EHM A;  3SWH A;  4EGW A;  1Y6I A;  3IEG A;  4NAC A;  2LOS A;  2NC9 A;  3MKR A;  4PH4 B;  3RK6 A;  3ZXP A;  2RA1 A;  3BK9 A;  2P9N G;  3I9W A;  4JLE A;  1YQ3 A;  1ZBP A;  1ZOY A;  3PJA A;  3GZ1 A;  2AW6 A;  2MRI A;  2H3R A;  3AE9 A;  2XCB A;  4IRU A;  3SFE A;  2Y0B G;  2N1G A;  4O8S A;  2EIJ E;  3SBT B;  4ZEY A;  3IF8 B;  4OYS A;  1O1S A;  4DV2 T;  4KZ0 A;  4DRX E;  4EED A;  3TLW A;  2CG3 A;  2NOX A;  4ANW A;  3VR8 A;  3SD5 A;  3B5M A;  2IDO B;  2X9Y A;  4C0M A;  1WY6 A;  4ACL A;  3LBX B;  4QWN B;  3P4R A;  2VL8 A;  2OEW A;  1Y01 A;  5HQ8 A;  2WMN A;  3IBE A;  4XKC A;  5JDN A;  3JXI A;  4GZ5 A;  5LNK A;  1WR0 A;  1NEK A;  1MMN A;  3Q78 A;  3MYV A;  4YJ2 E;  3C4X A;  2WXM A;  5LA6 E;  2L9Q A;  1VOM A;  3AE1 A;  2XQ3 A;  3AAA B;  3I9Y A;  3E32 A;  3MKQ A;  1ZHC A;  5BV0 A;  3JAE A;  3IXE A;  2C0S A; 
#chains in the Genus database with same CATH homology
 4P29 A;  3RKO A;  2FO7 A;  3AS8 A;  2KZT A;  3DBS A;  2FUL A;  5JR9 B;  4N5C A;  4ASK A;  3WAJ A;  2H7O A;  4APF A;  2X67 A;  4G2V A;  5JR9 C;  4IHJ E;  3UUX A;  2ILR A;  4AVX A;  4ILG A;  4EBA A;  3PNL B;  3MAC A;  4UVB B;  4FJY A;  3SOL A;  5L3C B;  2MYS A;  1MMD A;  4EYY R;  3RC3 A;  4B8A A;  2JQQ A;  1X5B A;  3R84 B;  4BT9 A;  4DBQ A;  4Q94 A;  5ADX L;  4HS2 A;  1D1A A;  4BA9 A;  3CV0 A;  4N2S A;  3ZIM A;  4PUC A;  3QDN A;  3NZQ A;  2BTD A;  4I43 B;  3L13 A;  5E75 A;  2ZM2 A;  2I6H A;  3OAW A;  5FT9 A;  4Q69 A;  4G24 A;  3IEE A;  3PH0 C;  4ERR A;  4JA9 A;  3RU0 A;  4UI9 C;  5JJ6 A;  2XQ0 A;  2WXL A;  3N9N A;  3P2B A;  5C8Y E;  3DP7 A;  4UI9 K;  2VSO E;  4DMV A;  3Q5M A;  3FUD A;  3HIZ A;  3MEK A;  3UUL A;  1IQR A;  2PM6 A;  4XI0 A;  5KDM C;  4HVB A;  5JJT A;  4AKR B;  1OWM A;  2XAQ B;  1E8X A;  5EDS A;  2UY1 B;  3FTS A;  5HXC A;  4GA1 A;  3OKQ A;  3PU8 A;  5J2U E;  2E9X D;  2XEV A;  2CFU A;  2OVB A;  3ASF A;  2LJL A;  3F31 A;  2PG8 A;  3FUN A;  4WBN E;  4YFS A;  5FY0 A;  4I1O B;  1MMA A;  2Y8D A;  5FZR A;  2WXR A;  4HEA A;  3D9J A;  4MAL A;  4ANV A;  4O4L E;  3FXE B;  5GON E;  3KBU A;  2HPJ A;  5DQV A;  3KIN B;  2ZLY A;  2KWI B;  1SZ9 A;  4JHK A;  1ZEE A;  4F53 A;  3JC6 D;  4PW8 A;  3RYC E;  4BFR A;  1JPL A;  3RKV A;  4YVO A;  3KV9 A;  2IAK A;  2X6F A;  4B94 A;  3ZW3 A;  3ESL A;  4K03 A;  1OWA A;  4AQG A;  3FH7 A;  3MZL B;  3TJP A;  5JDG A;  5LCW C;  4MBQ A;  2LSU A;  2J07 A;  2VWA A;  2VGY A;  5FWQ A;  3EJN A;  4ILH B;  2X9H A;  2WXF A;  2XAH B;  3ZYQ A;  1BR2 A;  4UEM A;  3ASH A;  4IE5 A;  3NF1 A;  4TV3 A;  3ZEF B;  1OUV A;  3MX3 A;  3N9Q A;  2XAF B;  1NWM X;  4IE0 A;  4G23 A;  4XZ4 A;  2LSI A;  5JDH A;  4WAF A;  3FWV A;  5FQ7 A;  2DLR A;  4QXB B;  2VKJ A;  4ANJ A;  4AOF A;  1S0P A;  4PNI A;  4H7Y A;  2QFC A;  3UT8 A;  3RPU A;  2X38 A;  3EIJ A;  3WXX A;  5BT1 A;  3NQP A;  2I1K A;  1BR0 A;  3CHR A;  3S7B A;  5G05 J;  5EK4 A;  4AP2 A;  4Z8X A;  3SI5 A;  4BTA A;  3EVY A;  4AKI A;  4QHO A;  2KM4 A;  4MS6 A;  4UQX A;  3L09 A;  3R6N A;  3FTV A;  1KLX A;  4ME2 A;  1D0Y A;  2KCK A;  2R59 A;  3CQC B;  3UTK A;  5CMW A;  4G2A A;  1JWF A;  4W9R A;  4ACK A;  2XAJ B;  3KFW X;  4UXN B;  3CK7 A;  3CVP A;  2XUE A;  3MGB A;  5JRC A;  5IYZ E;  5LG4 A;  3O4Z A;  4G1T A;  5HWY A;  2E2E A;  3MJW A;  4B6X A;  4L9I A;  4L2L A;  2WXK A;  1E1H B;  2DCF A;  2VSN A;  3TAX A;  4DND A;  3VKH A;  2I59 A;  3AU5 A;  2IW5 B;  5LOV E;  2HO1 A;  4KUM B;  2VGX A;  3ZCJ A;  4WWP A;  4E6H A;  3MZK B;  3GA8 A;  4GZ6 A;  5M72 A;  4EXT A;  1FVH A;  3S7F A;  2J4D A;  3MK7 C;  4BTB A;  3HYM B;  3U66 A;  3KAE A;  4I6E A;  1E8Y A;  3SFZ A;  3CKC A;  5L2L A;  2E9X B;  3G2W A;  5JDM A;  3FU5 A;  3I3N A;  4TUU A;  3LVQ E;  5FZS A;  1WAO 1;  3U3W A;  1ZKE A;  4I9C A;  2WM9 A;  2XAS B;  3CQX C;  1WLX A;  3CGH A;  1MMG A;  4IN3 B;  3ZLI A;  1QQE A;  2K9A A;  4IE4 A;  4QX8 B;  3A5X A;  3UUM A;  3KBT A;  4EZ4 A;  1XNF A;  3I5P A;  1EF1 C;  3C4Z A;  1HO8 A;  3NZS A;  4AXH A;  1ELR A;  4WBO A;  5ETW A;  3ZN0 B;  3FB2 A;  2I1J A;  3Q15 A;  1T98 A;  3ZC0 A;  5JH7 E;  4U04 A;  2Q9Q D;  4GAA A;  4PK4 A;  1IJ6 A;  2MOZ A;  3J9X 1;  3GYZ A;  1H2V C;  3QNK A;  5KJM A;  4I17 A;  2WXJ A;  3FUM A;  2ODU A;  4JEU A;  1H2T C;  2LSG A;  2NXP A;  4DI3 A;  3PEV B;  4JEH A;  1KNZ A;  4FI5 A;  4MLP A;  4CGV A;  3C51 A;  4HOU A;  4UV8 B;  3KS2 A;  3QC9 A;  1UX5 A;  5FQ8 A;  4UWG A;  2CFZ A;  2JRK A;  1HTJ F;  3U9W A;  3MKD A;  3PUK A;  2JPF A;  4GZ3 A;  3GZ2 A;  1MIY A;  3L3P A;  5JDL A;  3MV2 B;  2FBN A;  3TG4 A;  1JWG A;  5LCW J;  4OYK A;  2KND A;  4I1A A;  3D3M A;  3SZ7 A;  5HXR A;  5FYM A;  4L0R A;  2VYI A;  5JDF A;  4GOU A;  1IJ5 A;  5HAX A;  5FY1 A;  2ION A;  1UW4 B;  5AJD A;  3C4W A;  5KJN A;  1NZN A;  2XRZ A;  2Y4T A;  3EIQ C;  3IBP A;  4A55 A;  3PNT B;  4GA2 A;  2XPI A;  3CML A;  3HR0 A;  2A2F X;  2PZI A;  4I2W A;  5BPP A;  2AXU A;  1HXI A;  2Q7F A;  1MQS A;  4DO0 A;  2OV8 A;  5KMG P;  1YKH B;  4I43 A;  3N9L A;  3RO3 A;  4N3A A;  3ML9 A;  3CX6 B;  5L3G B;  2XAG B;  1D0X A;  2DHR A;  4X1I E;  2WXN A;  4FLH A;  4O6F A;  3PDY A;  2ZM8 A;  4PAG A;  4GA0 A;  3QAQ A;  1UJJ A;  4HOT A;  5LGU B;  5CA0 E;  4TUY E;  5FTP A;  4AI6 A;  4L5G A;  2EQX A;  3ONL A;  4HOS A;  2JMK A;  5JDQ A;  4TRQ A;  1Z6T A;  3HI2 A;  3EDV A;  4ANU A;  1WYB A;  1QNF A;  2V0P A;  2ACX A;  2LSJ A;  5J2T E;  3K3O A;  4F1S A;  2X6I A;  4YVQ C;  4M1P A;  2FF4 A;  2X68 A;  1HCI A;  3CX7 B;  1H2U A;  4G11 A;  1IHG A;  1YA0 A;  1HFA A;  3QK6 A;  3E22 E;  2CXL A;  2CHW A;  3ZEF A;  4X1Y E;  4LUN U;  1OWP A;  3ZN1 B;  4QFV A;  2HH7 A;  3QKY A;  4C0E A;  3T5V A;  4FAD A;  4I4T E;  3LK4 2;  4FP7 A;  5J90 A;  2Q9Q B;  2V7J A;  3BEE A;  2W63 A;  4I55 E;  2YK0 A;  4J2C A;  3AAI A;  4HOQ A;  2HYZ A;  2L3L A;  2CM0 A;  1JUQ A;  3ZHE A;  4RG6 A;  4IUL A;  2C2L A;  3B57 A;  2XGO A;  4DK5 A;  2G0U A;  4A3T A;  2VKD A;  3O4X E;  1S35 A;  2Q9Q A;  5FQ4 A;  2NWB A;  4YND A;  4WNG A;  3RO2 A;  4IDZ A;  4EYU A;  4PJL A;  2I2O A;  3G2S A;  4L2Y A;  2UWJ G;  2E9X C;  2LT3 A;  3BG1 B;  4U0Z A;  4KP3 C;  2WXG A;  4AV7 A;  3FH5 A;  4XX5 A;  2WXI A;  4U72 A;  4BJN A;  5KJK A;  5ARF A;  4CGW A;  3LYA A;  4EZL A;  3FHN A;  5DBK A;  4OFZ A;  1CUN A;  2W61 A;  3ZFW A;  4UQZ A;  5G2N A;  4N78 D;  4B89 A;  3CQG B;  2VGX B;  4BX8 A;  4CDN A;  1GW6 A;  2K5B B;  3K3N A;  2KIN B;  3KVA A;  3FTX A;  3ZN3 A;  5LGN B;  4EPZ A;  3EHN A;  2Y48 B;  4BT8 A;  3MJX A;  3U4T A;  3S2A A;  4EIW A;  3O1H A;  5IHY A;  4C90 A;  5FXX A;  4U0U A;  3ZXS A;  4CT0 A;  4CDR A;  3P8C D;  3PUG A;  4R7L A;  3V5U A;  4LER A;  1P5Q A;  5H6Q B;  4F3V A;  4WNK A;  3KV4 A;  2WWU A;  3QK0 A;  3KDS E;  4FA6 A;  4OVU A;  3Q9D A;  1ELW A;  4WNF A;  1YKE B;  4JPS A;  4ZI7 E;  3CST A;  3EDU A;  4UQY A;  2V7I A;  4CQI A;  4GCO A;  4U74 A;  2PQR A;  4GZC A;  4KZC A;  2XGM A;  4CXY A;  4JHR A;  4PS3 A;  3S7J A;  3B7S A;  1H7C A;  4PFO A;  5L3E B;  2KLQ A;  4U63 A;  4JA7 A;  1QUU A;  3APD A;  2BZB A;  2V5F A;  1E7V A;  4KMC A;  4TV9 E;  3SBS A;  3PS6 A;  4UVA B;  4FJO A;  3E0Z A;  4GB9 A;  4FU3 A;  3GW4 A;  4ZI2 C;  2D0U A;  2L9B A;  1B89 A;  1Z3Y A;  2GK9 A;  2J49 A;  5BNW A;  4GML A;  1E7U A;  1HE8 A;  3WAK A;  2WQH A;  2E8I A;  1VDY A;  3Q5X A;  4DPR A;  1U3C A;  4UEL A;  4CDM A;  4BSX A;  3UT7 A;  3O1J A;  1ZV4 X;  4O4J E;  3G2T A;  2VKO A;  1FIO A;  2W62 A;  3HKD E;  5EK3 A;  3W15 B;  3FUF A;  3ONK A;  4BAY B;  5L3B B;  2Y4U A;  5AJL A;  3WI3 A;  4K0R A;  3C98 A;  3FTW A;  3I0O A;  3APF A;  4AQF A;  5FQ6 A;  5DQW A;  3NZU A;  3N71 A;  4V1A v;  4ZOL E;  3FEX A;  1U5P A;  1LF8 A;  2J4B A;  5KJL A;  3RRU A;  4RSY A;  4AY6 A;  3OXG A;  4ZHQ E;  3FU3 A;  4G63 A;  2BDE A;  4DLO A;  2KZT B;  1Z0P A;  2CHX A;  2LSV A;  2LM9 A;  2GW1 A;  5A7D B;  2K48 A;  4H9Q C;  3DJB A;  5LHI B;  2WPV A;  3D9N A;  2RP4 A;  5FZQ A;  2DBA A;  4PS8 A;  5G55 A;  2B1E A;  3ENE A;  1UG3 A;  1NA0 A;  2CG2 A;  3PUS A;  5JR9 A;  3O1I A;  5LCY A;  3M65 A;  4B0Z A;  3HKE E;  4ADZ A;  3PE4 A;  1E90 A;  2HR2 A;  3LY7 A;  3GN5 B;  3I1A A;  4ATG A;  4HN9 A;  2R5S A;  1Y64 B;  2WXO A;  1PAQ A;  4DJA A;  3RYH E;  5ANL A;  4EEC A;  3S4U A;  1VRB A;  5BW8 C;  2VTB A;  5AYW D;  1L5J A;  3AA6 B;  4U8H A;  3V5S A;  2X3M A;  2CHZ A;  4GIW A;  2BUG A;  2J1D G;  5JQG E;  3JQ1 A;  3FXD B;  3VLF A;  3ZYK A;  2IF4 A;  3BG0 B;  3TG5 A;  4EQF A;  4IYP A;  1HS6 A;  3G2U A;  1FCH A;  2E0I A;  3CR3 A;  4BY6 A;  5TAO A;  3CLJ A;  2P9B A;  2EHO D;  4G26 A;  3BQL A;  3LJ3 A;  4CI3 B;  4LCT A;  4FHJ A;  1YW0 A;  2VKH A;  5JVD E;  4HLE A;  2LSY A;  2CEA A;  2SPC A;  2WQ6 A;  4MKT A;  3HL6 A;  3OJA A;  4JZY A;  3NBX X;  3CVR A;  4ILI A;  4HTE A;  4WND A;  3ESK A;  3L6A A;  3I4R B;  3PUA A;  2M67 A;  5JHB A;  1FMV A;  2UXN B;  4CT4 A;  2P58 C;  4EAH A;  3RC8 A;  3G2V A;  2X6H A;  4ZS3 A;  3RRC A;  5M4Y A;  3JC6 C;  3L17 A;  3EDT B;  3FUK A;  4CXX A;  3QOU A;  4UWF A;  4J6I A;  2WXQ A;  3CHO A;  5LBM A;  5A1L A;  2QGS A;  2VSX E;  2WBL A;  4GK5 E;  5CHE E;  1OWL A;  5G04 J;  2EHO C;  3Q4A B;  3HHM A;  4KBM B;  4GZD A;  5HYA A;  5LJN A;  3OBV E;  3L08 A;  3UPV A;  4P0A A;  5CMY A;  3CVN A;  1EPU A;  2V7M A;  4FC8 A;  3P1U A;  3FEY A;  4PFP A;  3EUH A;  4XZC A;  2OOE A;  2XQY A;  3FTY A;  4DBR A;  4X20 E;  4P0B A;  3CVU A;  4AKL A;  3VLD A;  1US7 B;  3O48 A;  4BX9 A;  3RJV A;  2A72 A;  3T5X A;  2LE8 A;  4TZ4 C;  3B7R L;  1H19 A;  3LFM A;  3LXU X;  5BV1 A;  2J09 A;  4NUV A;  4AXP A;  5G05 C;  4ABN A;  5DAB A;  3ZPJ A;  3UQ3 A;  4PJJ A;  3N9P A;  3B7T A;  5A6C A;  2BF0 X;  4I6G A;  5E76 A;  2V26 A;  2JMH A;  3ANW A;  3CIA A;  2LSK A;  1EYH A;  2A5U A;  2YNQ A;  3UT5 E;  1B7T A;  4AEZ C;  4IST A;  2ES0 A;  2MHK A;  2EHO B;  4HGA A;  5HXE A;  3FUE A;  4CEM A;  3T8M A;  4AJW A;  3LY9 A;  2V8S E;  5T8I A;  4F6R C;  3FUL A;  3ZGQ A;  3PTR B;  2X9X A;  1KK7 A;  3RYI E;  1N54 A;  4PK5 A;  3Q5W A;  3PE0 A;  4N39 A;  2KXP B;  2PBI A;  2VAS A;  1FVF A;  4H9N C;  4YLH A;  3CHS A;  4GYS A;  3LJC A;  5LGT B;  2WSS V;  5BUZ A;  4UWH A;  4GMJ A;  2LEH A;  5BMV E;  1LVK A;  4H63 V;  5LP6 E;  4IE7 A;  1OWN A;  3NZP A;  2LAI A;  3LKU A;  3QAR A;  4QXC B;  2XHE A;  4J8S A;  5HI7 A;  3R7Q A;  4UWL A;  3FTU A;  4EBA G;  3KV5 A;  1N52 A;  1HS7 A;  4PJM A;  4GCN A;  2I9C A;  4KBQ A;  3FHE A;  3BQK A;  2VTB B;  2VK9 A;  2JLB A;  3CSF A;  4B8C B;  1HU3 A;  3H3A A;  3RH3 A;  5L3D B;  2GRM A;  3ZJ2 A;  3LCA A;  1DNP A;  4Y6C A;  5J08 A;  3PRZ A;  3UMV A;  3HKB E;  1PY1 A;  4A56 A;  5JHA A;  3PDN A;  3MA9 A;  2Y3A A;  5CA1 E;  3APC A;  1TJF A;  2KWH A;  1IYG A;  2IQC A;  3OXF A;  4BWR A;  1IAP A;  3GWH A;  2XGS A;  3TXM A;  3HKC E;  3FP3 A;  2WB2 A;  4CXW A;  3TKL B;  5D0Q D;  2YHE A;  2OA5 A;  2KCL A;  2L8K A;  3AA1 B;  3VLE A;  4ISS A;  3PEU B;  3D9O A;  4GK0 E;  2UXX B;  3TL5 A;  2PFV A;  3UT4 A;  2CMR A;  2VQ2 A;  3MXZ A;  3O9X A;  4YHJ A;  4GYR A;  2L6J A;  4JL0 A;  4RVB A;  2WXH A;  2CCQ A;  3FU0 A;  4PDX A;  4E7Z A;  5ENN A;  5FXW A;  4J8D A;  2V7L A;  5CCL A;  4ZS2 A;  4OK0 A;  3UUN A;  1MNE A;  4XAX B;  3JYS A;  4EZH A;  4GYY A;  1G8X A;  3HDX A;  2XPZ A;  1SA0 E;  4Q96 A;  3TGO A;  1A17 A;  4OHF A;  4APO A;  5FNV E;  4EB6 E;  2V7K A;  2N9D A;  4HKA A;  5CCM A;  1G73 A;  1S94 A;  4TX5 A;  5G04 C;  3KD7 A;  2CE7 A;  3D9P A;  4GYW A;  3LBX A;  3VTX A;  3DTO A;  4AQF C;  4DMW A;  2XPY A;  3LK2 B;  5DIZ A;  3PZD A;  4N3B A;  1HH8 A;  4HFG A;  3ASD A;  4JXT A;  1WRD A;  2GRL A;  3SGH A;  2LAH A;  4E85 A;  2HPL A;  3OYZ A;  4DI4 A;  2YU2 A;  5L3F B;  3Q49 B;  1LKX A;  3CVW A;  2YEV C;  2L0T B;  4C91 A;  2QA7 A;  5LYJ E;  3N9M A;  2CXD A;  1UN8 A;  2IU1 A;  2XCC A;  4L23 A;  2RD0 A;  2MBG A;  4K0U A;  3UX4 A;  3IHY A;  3CK8 A;  2QY7 A;  4ANX A;  1BR4 A;  2KMF A;  3ZC1 A;  1MND A;  4OYJ A;  3N9O A;  4DLQ A;  2L0I A;  1SHZ C;  2NTX A;  2XRY A;  5EZY E;  2DWG A;  4E7S A;  5H6R B;  4RG9 A;  2WMO A;  3JUI A;  2X0L B;  5FXV A;  3CEQ A;  4O2B E;  2Z6E A;  2GGF A;  4I2Z A;  2BVM A;  3AVS A;  5JRC B;  4HXI A;  2AVP A;  4QXH B;  3IHV A;  3C64 A;  4IIJ E;  2D0T A;  4WWN A;  2YQ8 A;  1UX4 A;  3CHM A;  1EDU A;  3I4G A;  3P7I A;  3L54 A;  2JJ9 A;  3ZMS B;  2CXF A;  2EHO A;  4H9S E;  4WW0 A;  4HOR A;  1MIW A;  3ZPO A;  4FHK A;  1WM5 A;  4EZJ A;  4LEU A;  3SF4 A;  3U78 A;  3AA0 B;  3OYX A;  4UI9 J;  3F2E A;  3PUJ A;  1LVF A;  5EKQ D;  4WWO A;  2D5U A;  2C0L A;  4UF0 B;  1HX8 A;  2V4L A;  4IGU A;  4TN7 B;  4WNE A;  2DCP A;  4IE6 A;  1O3X A;  3ZMU B;  2KCV A;  2J9Q A;  4MRU A;  3U3I A;  2J08 A;  3FU6 A;  5FMN A;  4KVM A;  1UN9 A;  3F57 A;  1TEZ A;  5D0O D;  3IV0 A;  5FJY A;  2CLY C;  2C5I T;  2IOL A;  3JCK C;  1HG2 A;  4UVC B;  3VHL A;  2WXP A;  2LHN A;  4AY5 A;  4CI2 B;  2X6J A;  1UCU A;  4XKB A;  3ZVV A;  4C9B B;  1EZ3 A;  2K24 A;  4F7A A;  2LHR A;  1LRZ A;  3MKQ B;  1OXZ A;  5LHG B;  4U0S A;  2JEK A;  3K9I A;  4J0U A;  1U3D A;  3PU3 A;  3B13 A;  3Q47 B;  4CCA A;  4D10 C;  5LOZ A;  2LNI A;  4H9O C;  1TJC A;  3PE3 A;  3CVY A;  2KT9 A;  4AIF A;  3RYF E;  2OND A;  2NP9 A;  5ANR A;  4YJ3 E;  4LRZ A;  4I1M A;  4WUY A;  3AU4 A;  4ZI3 C;  2W00 A;  2CA5 A;  2FI7 A;  3CX8 B;  4JHJ A;  3E08 A;  5E0O A;  4NUU A;  3AS5 A;  2PQN A;  4O4I E;  2VSY A;  2RG8 A;  3L16 A;  3FUI A;  3I0Q A;  2C5K T;  4ZI2 D;  3PVL A;  2LO6 A;  4FUL A;  1BR1 A;  1Y8M A;  4Y6W A;  2X9W A;  2ZM0 A;  2FEZ A;  4A3V A;  3FY4 A;  3NRY A;  1D1B A;  3D9K A;  3QC1 A;  4JVS A;  3N2K E;  3SRZ A;  4HFV A;  2OVF A;  3CKB A;  4JEH B;  3PRE A;  3ZYM A;  3ONX A;  4FLB A;  4H7X A;  3CVQ A;  3ZMZ B;  4QKN A;  2HM8 A;  5LP0 A;  1HF8 A;  4AM9 A;  3QWV A;  3GN5 A;  4EZK A;  3UUX B;  3SHF A;  3KV6 A;  1KT0 A;  2E9X A;  1ZU2 A;  2R17 C;  3CVV A;  5LFA A;  3D9L A;  5AEN A;  4JC8 A;  3MV3 B;  4KYO B;  4M3O A;  1FMW A;  1E8Z A;  4N2Q A;  3LS8 A;  3RIB A;  3ANW B;  3ZMT B;  3IKO B;  2CWY A;  2A4Z A;  3ZRH A;  2MTQ A;  1NAF A;  3VKG A;  1IZN B;  3FUH A;  4UF0 A;  4G25 A;  3OTN A;  3LVR E;  5C1D A;  4JUY A;  4I6J A;  3PUR A;  3T8O A;  1W3B A;  3FBL A;  4MHC A;  1INZ A;  3HVE A;  2BVL A;  3CPZ A;  5AIJ A;  4KT6 B;  3C50 A;  5J1G A;  2DI4 A;  2KC7 A;  2PJQ A;  4ZI3 D;  2Y6X A;  4N3C A;  3RRN B;  4O2A E;  3QWP A;  1NP7 A;  2NTY A;  2PL2 A;  4U07 A;  3QJZ A;  2LOP A;  1QZ2 A;  1V9D A;  2X66 A;  3FDH A;  5FXZ A;  3E4B A;  1WR6 A;  2X6K A;  4H63 H;  2YHC A;  4KMO A;  3ZHE B;  3NRX A;  5DJQ C;  1E96 B;  4JEU B;  4XBF B;  2ODV A;  2A3D A;  4MFR A;  5FP3 A;  1D1C A;  3AS4 A;  1XGW A;  4CZZ B;  3MCX A;  2DWK A;  4L1B A;  4CI1 B;  2IC9 A;  3QWW A;  2NSZ A;  1H0A A;  2AWI A;  2NW8 A;  3CHQ A;  1U4Q A;  2WAU A;  3FH8 A;  2KAT A;  3DPD A;  3ML8 A;  3LPZ A;  3ZYL A;  2KZ7 B;  3LDZ A;  4QX7 B;  3ZCI A;  4J8E A;  3SS1 A;  3PUQ A;  4AKH A;  4GU5 A;  2D2S A;  5LX8 A;  3HA4 A;  2IOS A;  3FTZ A;  3IHR A;  5JJ7 A;  1KT1 A;  3U64 A;  4I9E A;  3N5L A;  5KX5 E;  3CKD A;  4KXK B;  4A1S A;  2IJG X;  3RX6 A;  4UWK A;  5KCM A;  3ZMV B;  3TXN A;  4X1K E;  1H6K A;  2N2N A;  4J8F A;  3OXL A;  3QUJ A;  5F8P A;  5T3R A;  1NA3 A;  2WQ7 A;  2DIW A;  4PS7 A;  3FUJ A;  3FFL A;  3LG7 A;  4UIG A;  1BPO A;  4GPK A;  3KVB A;  3CVL A;  3ASG A;  3S7D A;  3R9A B;  2AXZ A;  1QSD A;  5AFU L;  1AJ3 A;  4V3I A;  4KVO A;  5EX3 A;  4AKG A;  5T4Y A;  2W0G A;  4H9P C;  4BJM A;  3Q2M A;  2NW9 A;  3ETU A;  5A23 A;  3GZS A;  3EHM A;  3AA7 B;  1HZ4 A;  3C98 B;  5F3J A;  3ULQ A;  1MHQ A;  1SZA A;  1E8W A;  3VTY A;  2IFU A;  3N2O A;  5ARG A;  2NW7 A;  2UY1 A;  4A1G A;  1PC2 A;  3RRW A;  2YU1 A;  3JQ0 A;  3GMI A;  3AVR A;  4PJN A;  4GYO A;  2XTL A;  4MLK A;  3H37 A;  2MOW A;  1IQU A;  5C2Y A;  2IC6 A;  4EOZ B;  2ZU6 B;  4NQ0 A;  2Q9Q C;  2PM7 A;  3MA5 A;  3LEW A;  2M63 A;  3VU7 H;  1YD8 G;  5CB4 E;  3ZJ1 A;  2YIN A;  2CWO A;  3K8P C;  3L22 A;  2ZMA A;  2VB6 A;  2XHE B;  4UV9 B;  1Z3X A;  4NRH B;  3K3Q C;  5LXT E;  2WVI A;  4TV8 E;  2VJ8 A;  1HG5 A;  4OVV A;  3URZ A;  4XIF A;  4CRW A;  3N2G E;  4JW1 A;  3LK3 B;  3R7R A;  2AXV A;  3CHP A;  3RRM B;  5LJM A;  1SQM A;  4HE8 A;  3AB3 B;  3BQI A;  3D9M A;  5FY7 A;  4I50 E;  4FJZ A;  2H7V C;  3B7U X;  1OWO A;  2C5J A;  5LBQ B;  1X79 A;  4URK A;  4H9R C;  3CK9 A;  4DVD A;  2X51 A;  4PK6 A;  5EK2 A;  4O4H E;  1ELK A;  4ILU A;  3FBZ A;  3HVE B;  4P09 A;  3D9I A;  5JRE A;  1UJK A;  3QB2 A;  5HWX A;  2CLY B;  4XI9 A;  3SNX A;  1WYC A;  2C0M A;  4XE0 A;  2V1D B;  3AAE B;  1FEW A;  5HXS A;  2DNX A;  5EX0 A;  3UFE A;  3D0T A;  5LHH B;  3LY8 A;  3CWZ B;  4L7T A;  1D0Z A;  3KEZ A;  1MIV A;  5HXH A;  4NUR A;  3J7Y q;  3ETV A;  3CVX A;  1DVP A;  3SWH A;  1Y6I A;  3IEG A;  4NAC A;  2LOS A;  2NC9 A;  3MKR A;  4PH4 B;  3RK6 A;  2RA1 A;  3BK9 A;  3I9W A;  4JLE A;  1ZBP A;  3GZ1 A;  2AW6 A;  2MRI A;  2H3R A;  2XCB A;  4IRU A;  2N1G A;  4O8S A;  3SBT B;  3IF8 B;  4OYS A;  4KZ0 A;  2CG3 A;  2NOX A;  4ANW A;  3SD5 A;  2X9Y A;  4C0M A;  1WY6 A;  4ACL A;  3LBX B;  4QWN B;  2VL8 A;  5HQ8 A;  2WMN A;  3IBE A;  4XKC A;  5JDN A;  4GZ5 A;  5LNK A;  1MMN A;  3MYV A;  4YJ2 E;  3C4X A;  2WXM A;  5LA6 E;  2L9Q A;  1VOM A;  3AAA B;  3I9Y A;  3MKQ A;  1ZHC A;  5BV0 A;  2C0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...