3CQCB

Nucleoporin nup107/nup133 interaction complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
225
structure length
186
Chain Sequence
b'SHMLSWLHEINSQELEKAHATLLGLANMETRYFAKKKTLLGLSKLAALASDFSEDMLQEKIEEMAEQERFLLHQETLPEQLLAEKQLNLSAMPVLTAPQLIGLYICEENRRANEYDFKKALDLLEYIDININDLKLEILCKALQRDNWVSKDSIFVKILLPEVKDLLQADEFVLKANYEYYVQGQI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nuclear pore complex protein Nup107
publication title Structural and functional studies of Nup107/Nup133 interaction and its implications for the architecture of the nuclear pore complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 55
structure length 186
sequence length 225
ec nomenclature
pdb deposition date 2008-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1380 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3cqcB01
1.25.40.700 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3cqcB02
3I4RB 3CQGB 3CQCB
chains in the Genus database with same CATH superfamily
2P9SG 1OUVA 3DSVA 4LMJA 3TXNA 2LM2A 4WNKA 4CDMA 2IQCA 3KV4A 2DZNA 3FY4A 1D1AA 2ZGGA 3T5XA 2VKJA 4Z8XA 1IBLT 2CG3A 4HRMB 4N5QA 4F1SA 2A5UA 3G2TA 3LG7A 4YJ3E 5FZSA 1UX4A 4PK4A 3RIBA 1X81A 3KVBA 1IXVA 4CN6A 4CI2B 5KMGP 4QXBB 3ASDA 5L2LA 2ODVA 2XS8A 2XPZA 2ZISA 2IC9A 3MCXA 3EDUA 3D9NA 3J5PA 2XPIA 3UTKA 3K1SA 3GN5B 2W00A 4JI0T 4Y6CA 2CXDA 4ZZCA 1OY3D 2Y3AA 2D5UA 5HXRA 3DJBA 3PZ1A 5EK4A 2HYZA 4QH4A 1ZBPA 2X9XA 4LUNU 3LK42 4GYSA 2KZTB 5JJ6A 2WZHA 4JLEA 4G63A 5JDLA 5J08A 1N32T 4FHKA 3L54A 4I1AA 5FVLA 2ZIRA 3DEOA 2FJDA 1U3DA 1ZB1A 4HWFA 3ZMUB 3C98B 1IJ5A 5HYAA 1BLXB 2IU1A 2BZBA 1UN9A 3SFZA 2XENA 4WBNE 4FLHA 4XIFA 4JI6T 3LYAA 3AECA 2IF4A 2J8SD 5FXXA 3Q47B 2KZ7B 3FH8A 4TUUA 4IN3B 3D0TA 2LSVA 2A72A 2X66A 4U3CA 4AY5A 2NW7A 3UM3A 1HH8A 4HORA 1MIYA 4GTSA 3VR8A 1HCIA 4H9PC 4U96D 1NL4A 4IREA 4U63A 1XNRT 3MJXA 5D0OD 3IBPA 2BKOA 3WAJA 4WZXA 1Y8MA 4N39A 2R6GF 2WQHA 1Q2ZA 3QWVA 4U31A 3ZMVB 3NAWA 3LY7A 2UY1B 5BPPA 3Q5WA 4LEUA 2NTXA 5BR8T 4L5GA 5LOZA 4A63B 4O1PA 2MYOA 3NOGD 3FUDA 2L9QA 3CHOA 4C90A 5HS0A 4GPKA 2BBJA 3AEFA 2QC9A 1E7UA 1SA4A 2FJEA 3ZMSB 2BS4A 3N2KE 1US7B 5JDNA 4V3IA 4KBMB 1TN8A 1Z3XA 1FIOA 2VURA 3C64A 3HIZA 1HX1B 2CFZA 4I2WA 3SNXA 3T8OA 4ZOLE 2HN2A 3ABLE 2RP4A 3IBEA 4JEUA 5G04C 2GRMA 2WY2A 1JCQA 3PUSA 4J8SA 3RKOA 1J5ET 4IYPA 1P5QA 2BF0X 1IZNB 4JI2T 4NIQA 2WQ7A 2XAHB 5EIBE 3HHMA 3NBNB 1Y64B 4H9QC 3P4RA 4ZXLA 3HDXA 2LHNA 3AA6B 1O1RA 3L9TA 4DX2A 4CXYA 4GYRA 4W9RA 1HS6A 3KSLA 4QH5A 2KM4A 3RRUA 4EPZA 3FU6A 3NZUA 4QXCB 3TLVA 4DUYT 1NENA 3ZT5A 1TNUA 2YOEA 2UU9T 4JPSA 2JQKA 5EX3A 2E9XD 3D9JA 4LF9T 2QYJA 5FZQA 4U0ZA 4J8YA 5B3SE 4YT0A 4ANUA 4BT8A 3CSTA 3IHYA 3VTYA 4DNDA 2ES0A 2XRYA 5AYWD 3CVUA 3AA7B 3ESLA 3TLTA 1Y6IA 5DJQC 3EUVA 5IWAT 3MJWA 3PUAA 2AJAA 1WR6A 4H63V 2OEVA 2X68A 5FT9A 1MYOA 3CV0A 2VK9A 4AQFA 1O3XA 4B8AA 3CGHA 4QXHB 3CK7A 3N9QA 2J08A 5LG4A 1MIVA 2W66A 2IUBA 4GOUA 4KVOA 4IE5A 4HOUA 2X51A 4LMKA 2MBGA 4YHJA 2ZM6T 3QNKA 4DIDB 4G1TA 4I6JA 4IE7A 2C2LA 4JBWF 4BERA 2ODUA 4Q25A 4XZCA 1OWNA 2XGMA 4GKKT 3TLWA 4IL4A 5JRCA 3Q73A 5KBAA 3E22E 1PAQA 3E08A 3HXEA 2WQYA 4ILAA 2EILE 2B0OE 3IHVA 4GA1A 1BR0A 3F2EA 5BT1A 2IMLA 2JMHA 5LHIB 4EEBA 3CQGB 4DLOA 3R6NA 5E0OA 4EYUA 5LXTE 3E34A 4LRZA 3TWWA 4GZ3A 2EHOA 2RA1A 5FVKA 5LX8A 3FULA 4JI1T 4G8LA 4UXNB 3ISMC 3Q7FA 4A3TA 3PH0C 2DIWA 2WXOA 3R9AB 3TAXA 1L0VA 5HEGA 1Z0PA 5FY1A 3MV2B 4YFSA 1K3ZD 1D0YA 3RGLA 4I43A 4JXTA 3I9YA 3FEYA 4JV5T 4UQYA 4YJ2E 4KBQA 1HZ4A 3TXMA 4TWHA 3UUXA 2R05A 3AAAC 4NACA 2QGSA 3U66A 2K5BB 3HXCA 3DWLG 4NUVA 1D1CA 2IO3C 4H9SE 4BY6A 5LGNB 1K8KG 3LDZA 4HS2A 2I1JA 3F57A 2L0TB 4DBQA 2DCPA 1RW2A 2MOWA 4H7XA 2XCBA 3JUIA 5LGUB 5M4YA 4FLBA 1JCSA 2R5SA 3LK3B 5JDGA 4EZLA 1E1HB 2J9QA 2JPFA 2KZTA 3FUHA 2VL8A 4DBRA 4RVBA 1VRBA 5LBQB 3I4RB 4BTBA 4RSYA 4H9OC 3PUZF 4HVBA 2C0SA 4U7IA 4ZZBA 1T72A 3IV0A 4O2AE 4LERA 1S35A 4JUYA 4HWDA 2R17C 4MKTA 3G2VA 2HH7A 2V8SV 4UI9C 2J4GA 2OCCE 4ME2A 1MZCA 1SZAA 3AE9A 2CXLA 2KLQA 3SBSA 3BQLA 3FB2A 2YEVC 4JEHB 3FUEA 4BT9A 4XI0A 4APOA 4A1GA 2HM8A 1N33T 3VRBA 4ACKA 2AVPA 2DYRE 3ZPJA 5LMNT 4IRUA 5JHAA 4AXPA 3CHMA 1HNWT 3FTXA 2P9KG 4DMVA 3B5MA 5BW8C 4ERRA 5L3BB 3J7Yq 4CGVA 4TRQA 3HVEA 2W4XA 3RH3A 4LFBT 3ZFWA 2WPVA 3CKDA 3LY9A 3HXBA 1HNZT 1X5BA 2BTDA 5HEOA 3PUQA 2DHRA 3ZU7B 4ZI3D 2WXFA 4EQFA 3B7SA 3P4QA 3ZCJA 3ZNGA 1NA3A 2CWOA 4F6RC 2LRKA 4CXXA 5HWYA 3RSEG 5JA4D 4QKNA 5HEUA 3PUYF 3ZSSA 4DV4T 3V79K 4WW0A 1YXRA 4IDNA 1H6PA 4EECA 1DVPA 4CEMA 3MA9A 2X9HA 3JCFA 5ABGA 3G2WA 3CK9A 2XTLA 3T1HT 2CA5A 2FEZA 4FJYA 2YK0A 5FY0A 1BD8A 2GRNB 3EHNA 3QARA 4OHFA 4BJMA 2V5DA 5L4EA 4IDPA 4UEMA 3AE6A 1BI7B 3FTSA 3X2QE 1SZ9A 5FXVA 2XGSA 3R84B 1V55E 1V54E 4UI9K 5L3EB 4GAAA 4AKRB 5JR9A 4CT4A 3ZMTB 3FDHA 2FBWA 3K8PC 3HYMB 3KEZA 1OWPA 5EYLA 3SO8A 3SI5A 3DTOA 1JUQA 3LS8A 2R02A 4O1OA 2CCQA 3CK8A 3MA5A 3KVAA 3OJAA 1XDOA 3HG0D 4NXMT 4K0UA 2RG8A 3JCKC 2XQ7A 2DWKA 5LYJE 2KCVA 4GPMA 4UQZA 2ACZA 3G2SA 4Z68A 3MYVA 4M1PA 4JB8P 1OWOA 4KHZF 3MKRA 4DUIA 3QC9A 3SFEA 2KXPB 2QYUA 5LBMA 3EHMA 1JNRA 3AE2A 3O1JA 1E90A 3EABA 2NXPA 3HL6A 3RRWA 3QB5A 4UIGA 1WDYA 2WXIA 2WXQA 4YDEA 3I5PA 3KV6A 4QX7B 5G05C 2ZMAA 3L16A 2XSBA 2WS3A 4AISA 4LNUD 1LD8A 4HFVA 2OEWA 2NC9A 2V4LA 2DBAA 3GZSA 3CVNA 2OV8A 4JW1A 1D8EA 4EZ4A 2CRBA 4MLKA 3B13A 4I6GA 2X38A 3T1YT 3OTOT 2VSYA 3FUJA 3SGHA 2I0MA 1KT1A 1IQUA 1H2VC 1TNZA 4I1MA 3QOUA 1GW6A 1KEYA 3CKCA 2E5LT 2BG9A 3UT7A 3FHNA 4K5AB 3ZYLA 4ZI2C 3EU9A 3W15B 4JEUB 4JI8T 1QNFA 2OLTA 3AAEB 2FI7A 4G8KA 5JHBA 4GK0E 2WXPA 1OCRE 2WXNA 4CQIA 3EI0A 4F3VA 5AQIB 1OCOE 2X9YA 3HI2A 5AQFB 1BI8B 2K24A 4BA9A 2J1DG 5L3GB 3PDNA 5CEDB 1BR1A 2KINB 5KWDA 1FPPA 2Z6EA 4GTPA 4GKJT 1NZNA 3PZ3A 1XMQT 4GYYA 1H19A 3Q5MA 2AWIA 1ZKEA 2LXMA 3OXFA 4ILBA 3UULA 2LSYA 4U7YA 2DYSE 2QRXA 3ZLIA 4AY6A 1EF1C 2H89A 3AEGA 3KBTA 5EILA 1D9SA 4GTQA 4YLHA 4KZ0A 5G04J 4YDWA 3N71A 4HOTA 4BEPA 4UUCA 3L13A 2AXUA 2FO1E 2D9DA 4G25A 4PK6A 3C4ZA 3EIQC 4PFOA 1FVFA 3AG2E 3NF1A 3TWSA 1IAPA 4U07A 3SQVA 3FTYA 4OVVA 3SRZA 2C5JA 2Q9QA 2PBIA 3P50A 3D9LA 4LF8T 1LF8A 4G26A 3SHFA 4FJOA 4AQFC 4HKAA 1UUSA 5FY7A 3TL5A 1Y01A 2IO2C 2I1KA 5FKYA 2JABA 1UG3A 1KLXA 3KSQA 4GTRA 1N0RA 3CVVA 1OEDE 4O8SA 5JRCB 3UT4A 1WFDA 3PTRB 4YHHT 1TNBA 2WXLA 4O4HE 2FBNA 4QFVA 2AXVA 3E33A 4AEZC 4CZ2D 5ETWA 2L6BA 2F4VT 3CX6B 4A5XA 3U64A 3RIFA 4AKHA 2F8YA 4J8FA 4GMRA 2EHOB 1TJFA 3AJIA 1E8ZA 1JWGA 5M72A 4IIJE 2J4BA 3ZJ1A 3UI2A 2EHOC 2WDVA 3NBXX 3FZMB 3NWIA 2X0HA 1FT2A 2LAHA 5GONE 1XNFA 4I43B 5KDMC 5BV1A 4GMLA 5LP6E 5KX5E 5LG3A 2WWVA 2OOEA 4LG6A 1W0AA 3W9FA 3FXEB 3HXFA 4DJAA 3UUXB 2VSOE 5CBNA 2LEHA 2YHEA 2VSXE 2WXKA 4XKBA 3BUAA 5J0ZA 1PY1A 3T9KA 4J8EA 3ZHEA 5JVDE 4GCNA 2PL2A 2EIJE 1TJCA 4DX7D 3ZSTA 3O9XA 4X64T 1M62A 3AEDA 4YVOA 3GA8A 1QUUA 2KNDA 2V7JA 2X6KA 1OWLA 5L47A 3DSTA 4TWDA 4H9NC 3RQUA 2MOZA 2W61A 3BQKA 2XSAA 1SHZC 4AV7A 1DNPA 1WYCA 3RPUA 2H3RA 4WUYA 3MKDA 5ARGA 2LSGA 5IYZE 1J1JA 1WYBA 3QUJA 2WQ6A 5FINA 4AXHA 5G2NA 3P4PA 4E85A 4OVUA 4X8QA 5FZRA 3QKYA 5T8IA 4B3TT 1EYHA 1I94T 2X0YA 5AQNB 3QNUA 3TWQA 2UWJG 4PAGA 4N3AA 5LJNA 5AQAA 2EIME 4EBAG 5CECB 3RKGA 2FJBA 5AQSB 3D9MA 2CXFA 2AXZA 2L9BA 4OYJA 2K3WA 2Y4TA 1MX2A 2FULA 1IYGA 3N9PA 1FJGT 3AE1A 4TX5A 4NPPA 2EQXA 2E9XA 4BWRA 4E6HA 4XBFB 4X1YE 3EUHA 2YDQA 3PNLB 4MBQA 3LBXB 2WVIA 2L3LA 1O1TA 4ILGA 3HA4A 3L3PA 3BG1B 4WNFA 3LJNA 5LCYA 3PRZA 3HVEB 5KJNA 1OCCE 4LNBA 4UI9J 4UWLA 4GA2A 5HXCA 1LKXA 3O48A 4NQ0A 3ETUA 5E75A 5LOVE 5DIZA 2WU2A 3OPCA 3S2AA 3TG5A 5J90A 4B89A 2GGFA 4K0RA 5F3JA 4HB5A 3EHQA 4F6RD 4B6XA 4F53A 5HAXA 4PJMA 3FUKA 5ANRA 4BX9A 3JQ1A 4GA0A 5ENQD 1U3CA 3LVQE 3UFEA 5AQHB 4C48B 1FMVA 3D3MA 4N78D 5L3CB 2PQRA 4GYOA 3QC1A 2E0IA 1KZPA 2NP9A 5CA0E 1MMGA 3VKHA 2BKKB 3AU5A 1G8XA 3FTZA 3Q5DA 3PVLA 4JHJA 3SFDA 2RFMA 2XEEA 3LSVA 4DV0T 3PUGA 1W9RA 2B76A 4DUZT 4PJLA 3TLSA 3FTVA 2V6YA 3U3IA 1MX4A 4ZFHA 1MHQA 4L9PA 5LHGB 4HLLA 3TG4A 4OYSA 4B8CB 2V26A 3C72A 1IQRA 3IEEA 2EINE 2X3MA 4FP7A 5KXJA 1YKHB 1O5MA 4EZJA 4FI5A 2PZIA 3OYZA 4HWIB 3ZMZB 3EDTB 1XWMA 4P29A 5KJMA 4LMLA 2XCCA 5JR9B 3E32A 3DSUA 3FZFB 3Q49B 3R7RA 3H37A 3UQ7A 4HBDA 3MKQA 5JR9C 4O60A 4HN9A 5F5WA 1SUMB 3DRAA 1YKEB 2PQNA 3CSFA 1NFIE 4NURA 5AQJB 3T5VA 2PNNA 5JDHA 4UF0A 3RC3A 2N1GA 2KC7A 5CEAA 5T3RA 4EHMA 3UTMA 2JLBA 3MGBA 3SD5A 4MLPA 3S4UA 5EKQD 3IF8B 2X6FA 3C4WA 4WYVA 5L3DB 2WDQA 4HQDA 4R7LA 4ILHB 4M7CA 3RO2A 1QZ2A 1TN6A 4AIFA 3IXEA 4EAHA 2VKOA 4QQIA 4MHCA 2KWHA 2LSUA 1EDUA 2E8IA 3AS5A 2SPCA 2YU2A 3WXXA 3TJPA 3PEUB 4OFZA 3MK7C 1IJ6A 3FZHB 3QDNA 3D9HA 3BK9A 2JJ9A 4DV3T 1HFAA 4KX6A 5KCMA 4YY3T 5ANLA 3ESKA 2J07A 4IE6A 5C3JA 5FXZA 3RX6A 3L09A 3UINC 4C0EA 3EAMA 2V7KA 5AQPB 3CVQA 2V5QC 3FU3A 1HTJF 4B3ST 2ACXA 4BJNA 5ENPD 2ZM2A 2XJ7A 3Q5XA 1IBMT 4X5TA 5A6CA 1H6OA 4P1NA 3JAFA 2BG9B 4KZCA 4CYMD 2IHR1 2XQYA 3GYZA 3MACA 2A9UA 1MIWA 2MTQA 5ENTD 5G05J 2GRLA 3UFGA 4I9CA 3KV5A 3RIAA 2BG9C 4A97A 2F37A 4L23A 3CVXA 4O4LE 4YDOA 2HPLA 4UELA 5IUXA 2P9UG 5HXHA 1ELRA 2P58C 3TWXA 2CPTA 2XAJB 2NSZA 2UUAT 5ABFA 2BUGA 4GK5E 1N0QA 3QK0A 3RRMB 4E7SA 5ENRD 2E5VA 2NOXA 2QZAA 2ZGDA 4F1PA 3TLUA 4DR1T 4DR6T 1S63A 4L2YA 5LHHB 4HFIA 5FQ6A 3EHZA 2VVNA 4TNWA 1MX6A 1TYQG 3KDSE 2YU1A 3UU3A 2H6GA 5FQ8A 1JNZA 3FU0A 3RHWA 3S7FA 3MX3A 1HS7A 1YQ4A 3VR9A 4ISSA 1OT8A 3IEGA 4JA9A 3P1UA 1XNQT 2WZIA 4CT0A 2VTBA 3B7UX 1LVKA 3SF4A 3CHQA 2CHOA 1SW6A 4XKCA 3ZN3A 4HE8A 2PM6A 4U2YA 5JMND 4P0AA 3O4ZA 1S64A 2Q9QB 2X0LB 1OCZE 3DSXA 5JREA 5KNGA 4ABNA 4APFA 4CI1B 2V7IA 4FA6A 2C5IT 3QB5K 4AM9A 1ZOYA 4HNAD 3Q75A 2DCFA 2Q9QC 3JUEA 4O4IE 2IDOB 1OEDA 3TWUA 1IKND 2F0YA 3C3RA 1SVXA 3JXJA 3EVYA 3VLDA 2X6JA 1TNYA 3ABME 2CG2A 1ZU2A 4LF4T 2KCLA 3LKUA 5LFAA 4HWHA 1N9AA 2R03A 5AQKB 2QA7A 3DP7A 3LBXA 3ML9A 2LOPA 5ENSD 3BEEA 3BU8A 3PJAA 3QK6A 3FBZA 3SWHA 1SQMA 4TV9E 3JC6C 5D66A 5B1AE 3ZYQA 2EHOD 1LTXA 3C51A 1MMAA 3V5SA 3IA3A 4YSXA 3AA1B 4GCOA 4GIWA 1HO8A 3A7MA 2JEKA 2BS2A 5AQMB 2JQQA 1TNOA 3ZT6A 4C91A 2VL0A 3Q2MA 4E7ZA 2WMNA 1N94A 3U9WA 1DCQA 3H3AA 4HRNA 2XY8B 5H6QB 2M67A 5CB4E 4TNVA 4IE0A 2CM0A 3PZ4A 1E7PA 2LM9A 3UUBA 2P9LG 1FMWA 5J2TE 4TUYE 4X20E 3Q5EA 3R7QA 3I1AA 4IE4A 3RLFF 3IHRA 2WM9A 4HEAA 4NXNT 4PJJA 3AS4A 4HFEA 3ONLA 4U95D 4XE0A 4QX8B 3ZHEB 2XQ4A 1KNPA 3GW4A 4DLQA 3Q9DA 3PUKA 5CRVA 4DX1A 1TEZA 3ZN1B 3FZLB 3F6QA 4HOSA 2CLYB 3FEXA 4DK5A 3S7BA 3C5RA 5L3FB 1FEWA 3NZPA 4I55E 4AKLA 3ML8A 2V7LA 1UX5A 2GK9A 2ZM8A 5LNKA 2UXNB 4HWCA 5C8YE 3NZSA 2CLYC 4EOZB 2Y4UA 4O4JE 3CHRA 4WNDA 5EK3A 2M6BA 4TXPA 4P0BA 1G3NB 2LSIA 1BR4A 3CMLA 2KSRA 1HF8A 3SFXA 5CJ5A 2LXLA 3DXMG 5G55A 2NW8A 4I0UA 3EJNA 3URZA 4MRUA 5ENOD 4B3MT 1J5WA 2ETAA 2JRKA 2Y6XA 4N5CA 4I4TE 1RZ4A 2VYIA 1AP7A 4EZKA 3J9X1 1X9BA 4JHKA 2MAWA 4D10C 3BQIA 4GB9A 2Y48B 2XPKA 3JADA 4AQYT 3QOFA 4KMCA 4COFA 4H7YA 4N2QA 2W63A 2WXMA 2XAFB 2KMFA 1OXJA 1S0PA 2UXDT 4YVQC 1VDYA 1HG2A 4ACLA 4F7AA 3UT5E 1WRDA 2E9XB 4BTAA 4GTOA 4EV6A 3V5UA 4A98A 2H6FA 2Y1LE 4NRHB 3ONKA 3QWWA 3AG4E 2E9XC 5LMUT 4DI4A 4DR5T 2YQ8A 4ASKA 2IEJA 3AG3E 2CHZA 5LCWC 1JWFA 2KXPC 4JL0A 1QYMA 2XQAA 4MBGA 2NWBA 4L0RA 4GTVA 4OAUC 1YD8G 2XHEA 5CBOA 2FJAA 3X1DA 3HKCE 3K3QC 1N4PA 3PUXF 4ZI7E 3KAEA 3GMIA 2V5FA 3KEAA 1I6ZA 5AQLB 4DR2T 3L22A 1OXZA 5AQ9A 4Q96A 3FH5A 1NEKA 1WR0A 2KATA 2VWAA 3FU5A 2XZDG 2FUPA 1D8DA 3AU4A 1R8IA 3CX7B 3UUMA 4EEDA 2KT9A 2UUBT 2C0MA 4RG9A 4QHOA 3JYSA 2IOSA 4IL9A 1Z3YA 2MHKA 1N11A 2X6HA 1E8XA 4DV2T 3CIRA 3ZPOA 2X6IA 3AE7A 4YNDA 4FU3A 1UGOA 1DU2A 3Q9UC 4WWNA 3ULQA 3V2XA 3ZRHA 2YDSA 4KT6B 4EIWA 3Q7AA 2I2OA 1B89A 4J0UA 2BVMA 1IHGA 3TWTA 3PURA 3CLJA 2ZLYA 3E0ZA 1E7VA 3VLEA 1KT0A 1UN8A 2DVWA 4BETA 2V6YB 2YN6A 5FNVE 3RYFE 4K5BA 5LJMA 4HFCA 3UXGA 3APCA 4ZS3A 3I3NA 1QQEA 4U0UA 5AQOB 2D0TA 2YDRA 5JQGE 4RQIA 3QJZA 2OA5A 5JDFA 3OVUA 3UM0A 3DEPA 2LNIA 4X66T 2B1EA 4QWNB 3VKGA 4WWPA 3ZC0A 4CI3B 4JVSA 4TUMA 2AW6A 4DI3A 4GU5A 4LNGA 3APFA 4FADA 3AVSA 3UIOC 3NB2A 3MKQB 3PS6A 2GRRB 2H7OA 4JI4T 1VCTA 4ILUA 4PFPA 5LP0A 1W0BA 1KPSB 4UF0B 3D9PA 2MRIA 3T8MA 2DZOA 3KBUA 2IAKA 4ANXA 1KNZA 3QAQA 3AE8A 5KJLA 1W09A 3L17A 5BXUA 4Z90A 2QYWA 4AKGA 2P9NG 2FO7A 3RKVA 2LHRA 3TGOA 2JIWA 1N95A 5FTPA 3JXIA 5F8PA 2A3DA 2H6IA 1M7KA 2W67A 2VQ2A 4RG6A 1KF6A 3DXKG 2CFUA 4LFAT 2A4ZA 5HWXA 5T4YA 5C1DA 2FF4A 3UPVA 5FL1A 2BKGA 4CZZB 1NP7A 4XX5A 3RC8A 3S7JA 2LOSA 4EXTA 2GRQB 1N52A 4JA7A 2IOLA 2ONDA 4L2LA 4MS6A 3NKZA 4DX5D 3PNTB 1UURA 1JCRA 3ENEA 5IHYA 2UXCT 3PUWF 4DV1T 5FYMA 1VOMA 4HOQA 3UQ3A 5H7PA 4B93B 5JDMA 3CVLA 3ZCIA 2DI4A 3FUNA 3HKEE 2V6XA 1QSDA 5AJLA 3Q9NC 3VLFA 5FP3A 2BEDA 1HX8A 3FH7A 2XZEA 3VHLA 3RQWA 1HG5A 3KV9A 2HO1A 4X62T 3CIAA 2ZM0A 4DR3T 3LPZA 4LF6T 2LO6A 2KWIB 4KI0F 4BSZB 2DL1A 4X1IE 2YKSA 3N2OA 4QH1A 2L6JA 1K1AA 2J47A 3FUIA 2XQ9A 3PREA 1ELKA 4UWHA 2BKPA 1MNDA 5ABFB 1SA5A 4CXWA 4EYYR 3NRXA 4TN7B 3H3MA 4HTEA 1N36T 1T8BA 3KD7A 4BESA 3A5XA 1XMOT 4F8HA 4U74A 4PS8A 5CERB 3M3ZB 3PDYA 4I17A 1UCUA 4HI8A 4I2ZA 1LD7A 4B3RT 3CQXC 3ASOE 4ZI3C 4CDNA 1S94A 2H88A 4FJZA 4J6IA 3NZQA 3MV3B 2BKNA 3CVYA 2VTBB 4N3BA 1G73A 4U7EB 2WDRA 4J2CA 3LCAA 2F8XK 4AIUA 1KZOA 4EZHA 3UU8A 5FIOA 5LB7B 3UKUG 4UV9B 3U4TA 3PUVF 2LAIA 2XQ0A 3Q78A 4IHJE 3SBTB 3SZ7A 3ASGA 4UVAB 5LA6E 1N54A 2Q9QD 2WXGA 1NA0A 1W3BA 3AA0B 2K9AA 1OEDB 4EGWA 4GTMA 2PG8A 4A3VA 2V1DB 4YTPA 3DSSA 3C50A 4DV5T 3FWVA 3OTNA 2I6HA 2GRPB 1OEDC 2V7MA 4HFGA 2YHCA 5FWQA 5BUZA 3S7DA 3OXGA 4DVDA 5KNHD 2J09A 2UUCT 1UK5A 3C3OA 2A5EA 4MALA 5HI7A 1ELWA 3JC6D 2GW1A 1K1BA 3TWRA 5CHEE 1IHBA 3FP3A 1CHUA 3AXJA 4XAXB 4K5CA 3EHRA 3OKQA 3HKBE 4I9EA 2RFAA 3ASNE 2XZTG 1U5PA 2XGOA 3PE3A 5AENA 4GZ6A 2C5KT 1WM5A 5JTGA 1E8WA 3AEBA 2VKHA 3K3NA 3RAUA 1KK7A 4ANJA 3I9WA 3LFMA 3P7IA 3PEVB 2DWZA 4A55A 4O6FA 4HFBA 2WMOA 1T7SA 2NW9A 5C2TA 3GZ1A 2XUEA 3OYXA 2E2EA 4YSYA 4TZ4C 4M3OA 3B7RL 4NUUA 1MNEA 3ASHA 5IY5E 3CX8B 3DSWA 3WAKA 2MPKA 3C4XA 3ZYKA 2IFUA 5AJDA 1WLXA 4XEIG 3ONLC 3MZKB 1ZP0A 1PC2A 4HFHA 4IDQA 4JI5T 3KFWX 5AQGB 2V8SE 3ZEFA 5FMNA 4JZYA 5BXOA 2J62A 2V5CA 3LK2B 2KCKA 2CMRA 2IC6A 4Q94A 4DO0A 2YINA 3ETVA 3N9OA 2EIKE 4PH4B 2XASB 3FBLA 1KFYA 4WNEA 3UT8A 1NAFA 3RYCE 3RK6A 1NWMX 5ENNA 2NTYA 2IONA 1WG0A 3LEWA 3UX4A 2BG9E 3ONJA 5CMWA 2XQ3A 4G2AA 3CEQA 4A56A 5ADXL 4G24A 3RU0A 4X65T 3AG1E 3G06A 3Q79A 2RD0A 4ZHQE 5AAOA 5ABHA 3K3OA 4ATZD 3RIUA 2VJ8A 3NQPA 4OAVB 5TAOA 3CVRA 1CUNA 2QVAA 3B7TA 2DLRA 5FQ4A 4BX8A 2AE9A 5HCJA 4PW8A 2Q7FA 4TWFA 3FXDB 1AWCB 4XZ4A 2CWYA 1BR2A 3ONXA 1FCHA 3FUFA 1MQSA 2P9BA 2P2CP 4AVXA 2VGEA 4PJNA 2PM7A 3VU7H 2ETCA 3O1IA 2M6IA 2WBLA 2XHEB 1H2UA 2LSJA 3B95A 3V2OA 2VGXA 3AE4A 3NOCD 1EZ3A 4HGAA 2LSKA 1S70B 4PUCA 5A7DB 1AJ3A 1DC2A 4OYKA 2HHHT 4LSZE 3N9LA 3ABVA 4JI7T 4OX9T 3ZT7A 5CA1E 4EBAA 4JI3T 1ZHCA 3QB2A 2LKHA 2R59A 2UXBT 2H7VC 3PU3A 2QFCA 4U2ZA 3BG0B 3MXZA 2LUHA 4HFDA 4ZI2D 5LCWJ 2JMKA 3AEAA 3ANWA 4H63H 5HCMA 2CHWA 5D2MC 4U8VD 4FHJA 2P9IG 5CMYA 1MJ0A 3AB3B 5C2YA 1MMNA 1INZA 2D0UA 3F31A 3LJ3A 3J5QB 3EDVA 3B7BA 4L9IA 1YQ3A 2VB6A 4B94A 3K9IA 2X9WA 3M65A 2N2NA 1L5JA 1XGWA 4KVMA 3WG7E 2BDEA 4C9BB 4DR7T 3SS1A 3FFLA 5BV0A 2AXDS 3HR0A 2W62A 3BQOA 3CWZB 5ABEA 3FTWA 1SE7A 3U78A 4UVBB 1ZEEA 3AAAB 4UWGA 5EIDA 3LY8A 4IDZA 2WWUA 5FQ7A 2HN1A 4CCAA 2LJLA 2D2SA 3PV0F 3ZN0B 3D9OA 3ZVVA 2HR2A 4KMOA 5AQ7A 3ULYA 2G0UA 1YMPA 3HXDA 1H2TC 4AI6A 2VVSA 4N3CA 4A1SA 4DPRA 3CPZA 4X1KE 3CHPA 2XM2A 3DBSA 5EX0A 3LJCA 5HEHA 3GN5A 2LLYA 5E76A 4DV6T 2LRLA 4LF7T 1Z8UA 2HPJA 4CGWA 1V9DA 3UQ4A 4HXIA 4WBOA 2LT3A 4JHRA 4DV7T 3RRNB 5JH7E 3ABKE 3RJVA 4U0SA 1H7CA 4DR4T 3ASFA 3G2UA 5AQTB 2BS3A 5DABA 1LRZA 4KP3C 1TN7A 4KYOB 3U3WA 3MEKA 1E96B 3PU8A 5AQBA 4N2SA 3AVRA 1DCEA 3UKRG 3RYHE 4Z91A 3C98A 3N5LA 3P4WA 2B6CA 4ANVA 3KINB 5CCMA 5HRYA 2Y69E 1QLBA 2QY7A 4UQXA 5D0QD 3RI5A 4Q69A 5HXEA 2WXRA 3CVWA 3UMVA 2CE7A 5JJ7A 1U2VG 1N4RA 3AS8A 2OVBA 2P9PG 3KS2A 4U72A 1FVHA 5A1LA 1IBKT 4ATGA 4CN1A 1HNXT 2R2LA 5AQRB 5LGTB 2BVLA 3ZW3A 4CRWA 2DWGA 3P2BA 5B1BE 2ZXWE 3P4SA 2Y0BG 2E2AA 3CKBA 3JQ0A 4FULA 4JD2G 4K03A 2XAQB 5H6RB 5EZYE 5CGMA 1H0AA 3UU4A 5AIJA 1D1BA 4V1Av 1VCSA 4I1OB 3TWVA 2IW5B 4EB6E 3FTUA 3LXUX 4BSXA 4HRLA 2NR4A 2UY1A 3SFYA 5BNWA 3AAIA 1OWMA 3O4XE 3MZLB 1BU9A 3SY2A 3CHSA 3CR3A 3V30A 4GYWA 3LVRE 4B0ZA 3N9NA 4G2VA 1H6KA 2WXJA 3I4GA 5A23A 3NVOA 4YTNA 4URKA 2WP9A 2I59A 1WCRA 4PNIA 2OV9A 3UM2A 3A8YC 3VTXA 5ITZF 2XPYA 2V0PA 4U04A 5EYPF 3APDA 2YNQA 5JDQA 4PS3A 2L8KA 2ILRA 1YCSB 3L39A 3Q4AB 2X67A 4TXRA 2XAGB 2RPAA 4UV8B 5HXSA 4GTTA 4GZCA 4ILCA 1YA0A 4G23A 3RRCA 3UUNA 1D0ZA 2V4HC 3E4BA 5FJYA 3PUJA 4G11A 5AQVB 2W2UA 4PDXA 4JYAT 3JAEA 1Z6TA 4YSZA 3ZGQA 4I50E 4ZS2A 5J1GA 2K48A 2JQ9A 1TR4A 3DPDA 4L1BA 2WU5A 5JJTA 1MMDA 4CN4A 3OAWA 4KHPT 4NIKA 3L6AA 2RKKA 2JQHA 1OWAA 3NRYA 2M63A 4AOFA 4KUMB 3CK6A 4OK0A 1Z5SC 2NYJA 4HI9A 2C0LA 1SA0E 2VQFT 2VASA 2GROB 4HLEA 5AQQB 1A17A 3T8KA 2ZU6B 2PJQA 3UU6A 4AQGA 3ZXSA 2UXXB 5CFBA 4GZ5A 3B57A 5L4HA 3AXJB 3RYIE 3PE0A 2PFVA 3GZ2A 1KNRA 3N9MA 4IDOA 4AKIA 1HE8A 3SOLA 1UOHA 5J2UE 4H9RC 4DRXE 3CVPA 5FXWA 1N4QA 1HR0T 2J4DA 5EDSA 3E30A 4GZDA 4U33A 5FL0A 1HXIA 4FC8A 2PTFA 2WAUA 3L82A 2IY0C 3Q15A 4YTMA 1EPUA 3P8CD 4LFCT 3DPYA 3TKLB 3O1HA 4UR9A 3AE5A 3I0QA 5HQ8A 4ZHBA 3PZDA 5AFUL 3EU5A 4DX6D 3ZJ2A 2N9DA 2XQ5A 2WCAA 2J49A 4RLYA 3ZC1A 1UJKA 3WI3A 1T98A 2XEHA 4AP2A 4PK5A 3GWHA 3AE3A 3PJAJ 3ZEFB 4ZEYA 1X79A 2VSNA 3D9KA 3PE4A 1N4SA 4YXDA 1FT1A 1E8YA 4WAFA 3RF1A 5KJKA 3ZXPA 4TV3A 4LF5T 3C3QA 4UWFA 4P09A 2WB5A 4L7TA 4ILIA 3LDQB 4AJWA 3L8RA 3FZKB 4CDRA 4TV8E 5HKPA 3IKOB 1ZV4X 4MFRA 3I0OA 4XI9A 5EN5D 2OVFA 3HKDE 3E37A 3PZ2A 3W9GA 3ZKJA 3AEEA 3VRAA 3UIPC 2CHXA 5EK2A 4C0MA 2CEAA 2BBHA 1YW0A 4I6EA 1QBQA 2L0IA 4K0KT 4IULA 4PS7A 4WWOA 1UW4B 1A5EA 3RIUC 2XRZA 2IJGX 3UM1A 4ANWA 2VKDA 1LVFA 1BPOA 1NI1A 2KBXA 4UWKA 3UU5A 5AN8A 4ISTA 1JPLA 4ADZA 4KXKB 1GQEA 3N2GE 3FHEA 2A2FX 3ZKRA 1U4QA 2IIUA 2H6HA 4LCTA 4BAYB 5AQUB 2WXHA 5BMVE 4GMJA 5DBKA 2XS1A 4IT4A 2VGXB 1N34T 4Y6WA 2XM1A 1YYHA 1UJJA 3D9IA 3R9MA 4J7WA 5CCLA 2WB2A 2HE0A 1D0XA 5DQVA 1XDPA 4BFRA 3L08A 3ZYMA 2CHNA 1E2AA 2CBIA 2MYSA 2VQET 2I9CA 5HEJA 2ETBA 2VGYA 3ZUVB 2Y8DA 4UVCB 4U8HA 5AARA 2XQ6A 1HU3A 4JEHA 2W0GA 4YDYA 1WAO1 5ARFA 1WY6A 1B7TA 2WSSV 3ANWB 3OXLA 3V31A 3RO3A 2LKGA 4WNGA 3FUMA 5DQWA 1O1SA 4O2BE 2XQ8A 3EIJA 5CRUA 3OBVE 4DMWA 2CBJA 3HRAA 3CQCB 2LE8A 2XEVA 3ZIMA 3QWPA 4TXQA 1XZYA 2DNXA 3ULEG 4J8DA 4JC8A 4U8YD 4IGUA
chains in the Genus database with same CATH topology
1OUVA 3TXNA 4WNKA 4CDMA 2IQCA 3KV4A 3FY4A 1D1AA 3T5XA 2VKJA 4Z8XA 2CG3A 4F1SA 2A5UA 3G2TA 3LG7A 4YJ3E 5FZSA 1UX4A 4PK4A 3RIBA 3KVBA 4CI2B 5KMGP 4QXBB 3ASDA 5L2LA 2ODVA 2XPZA 2IC9A 3MCXA 3EDUA 3D9NA 2XPIA 3UTKA 3GN5B 2W00A 4Y6CA 2CXDA 2Y3AA 2D5UA 5HXRA 3DJBA 5EK4A 2HYZA 1ZBPA 2X9XA 4LUNU 3LK42 4GYSA 2KZTB 5JJ6A 4JLEA 4G63A 5JDLA 5J08A 4FHKA 3L54A 4I1AA 1U3DA 3ZMUB 3C98B 1IJ5A 5HYAA 2IU1A 2BZBA 1UN9A 3SFZA 4WBNE 4FLHA 4XIFA 3LYAA 2IF4A 5FXXA 3Q47B 2KZ7B 3FH8A 4TUUA 4IN3B 3D0TA 2LSVA 2A72A 2X66A 4AY5A 2NW7A 1HH8A 4HORA 1MIYA 1HCIA 4H9PC 4U63A 3MJXA 5D0OD 3IBPA 3WAJA 1Y8MA 4N39A 2WQHA 3QWVA 3ZMVB 3LY7A 2UY1B 5BPPA 3Q5WA 4LEUA 2NTXA 4L5GA 5LOZA 3FUDA 2L9QA 3CHOA 4C90A 4GPKA 1E7UA 3ZMSB 3N2KE 1US7B 5JDNA 4V3IA 4KBMB 1Z3XA 1FIOA 3C64A 3HIZA 2CFZA 4I2WA 3SNXA 3T8OA 4ZOLE 2RP4A 3IBEA 4JEUA 5G04C 2GRMA 3PUSA 4J8SA 3RKOA 4IYPA 1P5QA 2BF0X 1IZNB 2WQ7A 2XAHB 3HHMA 1Y64B 4H9QC 3HDXA 2LHNA 3AA6B 4CXYA 4GYRA 4W9RA 1HS6A 2KM4A 3RRUA 4EPZA 3FU6A 3NZUA 4QXCB 4JPSA 5EX3A 2E9XD 3D9JA 5FZQA 4U0ZA 4ANUA 4BT8A 3CSTA 3IHYA 3VTYA 4DNDA 2ES0A 2XRYA 5AYWD 3CVUA 3AA7B 3ESLA 1Y6IA 5DJQC 3MJWA 3PUAA 1WR6A 4H63V 2X68A 5FT9A 3CV0A 2VK9A 4AQFA 1O3XA 4B8AA 3CGHA 4QXHB 3CK7A 3N9QA 2J08A 5LG4A 1MIVA 4GOUA 4KVOA 4IE5A 4HOUA 2X51A 2MBGA 3QNKA 4YHJA 4G1TA 4I6JA 4IE7A 2C2LA 2ODUA 4XZCA 1OWNA 2XGMA 5JRCA 3E22E 1PAQA 3E08A 3IHVA 4GA1A 1BR0A 3F2EA 5BT1A 2JMHA 5LHIB 3CQGB 4DLOA 3R6NA 5E0OA 4EYUA 5LXTE 4LRZA 4GZ3A 2EHOA 2RA1A 5LX8A 3FULA 4UXNB 4A3TA 3PH0C 2DIWA 2WXOA 3R9AB 3TAXA 1Z0PA 5FY1A 3MV2B 4YFSA 1D0YA 4I43A 4JXTA 3I9YA 3FEYA 4UQYA 4YJ2E 4KBQA 1HZ4A 3TXMA 3UUXA 4NACA 2QGSA 3U66A 2K5BB 4NUVA 1D1CA 4H9SE 4BY6A 5LGNB 3LDZA 4HS2A 2I1JA 3F57A 2L0TB 4DBQA 2DCPA 2MOWA 4H7XA 2XCBA 3JUIA 5LGUB 5M4YA 4FLBA 2R5SA 3LK3B 5JDGA 4EZLA 1E1HB 2KZTA 2JPFA 3FUHA 2J9QA 2VL8A 4DBRA 4RVBA 1VRBA 5LBQB 3I4RB 4BTBA 4RSYA 4H9OC 4HVBA 2C0SA 3IV0A 4O2AE 4LERA 1S35A 4JUYA 2R17C 4MKTA 3G2VA 2HH7A 4UI9C 4ME2A 1SZAA 2CXLA 2KLQA 3SBSA 3BQLA 3FB2A 2YEVC 4JEHB 3FUEA 4BT9A 4XI0A 4APOA 4A1GA 2HM8A 4ACKA 2AVPA 3ZPJA 4IRUA 5JHAA 4AXPA 3CHMA 3FTXA 4DMVA 5BW8C 4ERRA 5L3BB 3J7Yq 4CGVA 4TRQA 3HVEA 3RH3A 3ZFWA 2WPVA 3CKDA 3LY9A 1X5BA 2BTDA 3PUQA 2DHRA 4ZI3D 2WXFA 4EQFA 3B7SA 3ZCJA 1NA3A 2CWOA 4F6RC 4CXXA 5HWYA 4QKNA 4WW0A 4EECA 1DVPA 4CEMA 3MA9A 2X9HA 3G2WA 3CK9A 2XTLA 2CA5A 2FEZA 4FJYA 2YK0A 5FY0A 3EHNA 3QARA 4OHFA 4BJMA 4UEMA 3FTSA 1SZ9A 5FXVA 2XGSA 3R84B 4UI9K 5L3EB 4GAAA 4AKRB 5JR9A 4CT4A 3ZMTB 3FDHA 3K8PC 3HYMB 3KEZA 1OWPA 3SI5A 3DTOA 1JUQA 3LS8A 2CCQA 3CK8A 3MA5A 3KVAA 3OJAA 4K0UA 2RG8A 3JCKC 2DWKA 5LYJE 2KCVA 4UQZA 3G2SA 3MYVA 4M1PA 1OWOA 3MKRA 3QC9A 2KXPB 5LBMA 3EHMA 3O1JA 1E90A 2NXPA 3HL6A 3RRWA 2WXIA 4UIGA 2WXQA 3I5PA 3KV6A 4QX7B 5G05C 2ZMAA 3L16A 4HFVA 2NC9A 2V4LA 2DBAA 3GZSA 3CVNA 2OV8A 4JW1A 4EZ4A 4MLKA 3B13A 4I6GA 2X38A 2VSYA 3FUJA 3SGHA 1KT1A 1IQUA 1H2VC 4I1MA 3QOUA 1GW6A 3CKCA 3UT7A 3FHNA 3ZYLA 4ZI2C 3W15B 4JEUB 1QNFA 3AAEB 2FI7A 5JHBA 4GK0E 2WXPA 2WXNA 4CQIA 4F3VA 2X9YA 3HI2A 2K24A 4BA9A 2J1DG 5L3GB 3PDNA 1BR1A 2KINB 2Z6EA 1NZNA 4GYYA 1H19A 3Q5MA 2AWIA 1ZKEA 3OXFA 3UULA 2LSYA 3ZLIA 4AY6A 1EF1C 3KBTA 4YLHA 4KZ0A 5G04J 3N71A 4HOTA 3L13A 2AXUA 4G25A 4PK6A 3C4ZA 3EIQC 4PFOA 1FVFA 3NF1A 1IAPA 4U07A 3FTYA 4OVVA 3SRZA 2C5JA 2Q9QA 2PBIA 3D9LA 1LF8A 4G26A 3SHFA 4FJOA 4AQFC 4HKAA 5FY7A 3TL5A 2I1KA 1UG3A 1KLXA 3CVVA 4O8SA 5JRCB 3UT4A 3PTRB 2WXLA 4O4HE 2FBNA 4QFVA 2AXVA 4AEZC 5ETWA 3CX6B 3U64A 4AKHA 4J8FA 2EHOB 1TJFA 1E8ZA 1JWGA 5M72A 4IIJE 2J4BA 3ZJ1A 2EHOC 3NBXX 2LAHA 5GONE 1XNFA 4I43B 5KDMC 5BV1A 4GMLA 5LP6E 5KX5E 2OOEA 3FXEB 4DJAA 3UUXB 2VSOE 2LEHA 2YHEA 2VSXE 2WXKA 4XKBA 1PY1A 4J8EA 3ZHEA 5JVDE 4GCNA 2PL2A 1TJCA 3O9XA 4YVOA 3GA8A 1QUUA 2KNDA 2V7JA 2X6KA 1OWLA 4H9NC 2MOZA 2W61A 3BQKA 1SHZC 4AV7A 1DNPA 1WYCA 3RPUA 2H3RA 4WUYA 3MKDA 5ARGA 2LSGA 5IYZE 1WYBA 3QUJA 2WQ6A 4AXHA 5G2NA 4E85A 4OVUA 5FZRA 3QKYA 5T8IA 1EYHA 2UWJG 4PAGA 4N3AA 5LJNA 4EBAG 3D9MA 2CXFA 2AXZA 2L9BA 4OYJA 2Y4TA 2FULA 1IYGA 3N9PA 4TX5A 2EQXA 2E9XA 4BWRA 4E6HA 4XBFB 4X1YE 3EUHA 3PNLB 4MBQA 3LBXB 2WVIA 2L3LA 4ILGA 3HA4A 3L3PA 3BG1B 4WNFA 5LCYA 3PRZA 3HVEB 5KJNA 4UI9J 4UWLA 4GA2A 5HXCA 1LKXA 3O48A 4NQ0A 3ETUA 5E75A 5LOVE 5DIZA 3S2AA 3TG5A 5J90A 4B89A 2GGFA 4K0RA 5F3JA 4B6XA 4F53A 5HAXA 4PJMA 3FUKA 5ANRA 4BX9A 3JQ1A 4GA0A 1U3CA 3LVQE 3UFEA 1FMVA 3D3MA 4N78D 5L3CB 2PQRA 4GYOA 3QC1A 2E0IA 2NP9A 5CA0E 1MMGA 3VKHA 3AU5A 1G8XA 3FTZA 3PVLA 4JHJA 3PUGA 4PJLA 3FTVA 3U3IA 1MHQA 5LHGB 3TG4A 4OYSA 4B8CB 2V26A 1IQRA 3IEEA 2X3MA 4FP7A 1YKHB 4EZJA 4FI5A 2PZIA 3OYZA 3EDTB 3ZMZB 4P29A 5KJMA 2XCCA 5JR9B 3Q49B 3R7RA 3H37A 3MKQA 5JR9C 4HN9A 1YKEB 2PQNA 3CSFA 4NURA 3T5VA 5JDHA 4UF0A 3RC3A 2N1GA 2KC7A 5T3RA 2JLBA 3MGBA 3SD5A 4MLPA 3S4UA 5EKQD 3IF8B 2X6FA 3C4WA 5L3DB 4R7LA 4ILHB 3RO2A 1QZ2A 4AIFA 4EAHA 2VKOA 4MHCA 2KWHA 2LSUA 1EDUA 2E8IA 3AS5A 2SPCA 2YU2A 3WXXA 3TJPA 3PEUB 4OFZA 3MK7C 1IJ6A 3QDNA 3BK9A 2JJ9A 1HFAA 5KCMA 5ANLA 3ESKA 2J07A 4IE6A 5FXZA 3RX6A 3L09A 4C0EA 2V7KA 3CVQA 3FU3A 1HTJF 2ACXA 4BJNA 2ZM2A 3Q5XA 5A6CA 4KZCA 2XQYA 3GYZA 3MACA 1MIWA 2MTQA 5G05J 2GRLA 4I9CA 3KV5A 3CVXA 4L23A 4O4LE 2HPLA 4UELA 5HXHA 1ELRA 2P58C 2XAJB 2NSZA 2BUGA 4GK5E 3QK0A 3RRMB 4E7SA 2NOXA 4L2YA 5LHHB 5FQ6A 3KDSE 2YU1A 5FQ8A 3FU0A 3S7FA 3MX3A 1HS7A 4ISSA 3IEGA 4JA9A 3P1UA 4CT0A 2VTBA 3B7UX 1LVKA 3SF4A 3CHQA 4XKCA 3ZN3A 4HE8A 2PM6A 4P0AA 3O4ZA 2Q9QB 2X0LB 4FA6A 5JREA 4ABNA 4APFA 4CI1B 2V7IA 2C5IT 4AM9A 2DCFA 2Q9QC 4O4IE 3EVYA 3VLDA 2X6JA 2CG2A 1ZU2A 2KCLA 3LKUA 5LFAA 2QA7A 3DP7A 3LBXA 3ML9A 2LOPA 3BEEA 3QK6A 3FBZA 3SWHA 1SQMA 4TV9E 3JC6C 3ZYQA 2EHOD 3C51A 1MMAA 3V5SA 3AA1B 4GCOA 4GIWA 1HO8A 2JEKA 2JQQA 4C91A 3Q2MA 4E7ZA 2WMNA 3U9WA 3H3AA 5H6QB 2M67A 5CB4E 4IE0A 2CM0A 2LM9A 1FMWA 5J2TE 4TUYE 4X20E 3R7QA 3I1AA 4IE4A 3IHRA 2WM9A 4HEAA 4PJJA 3AS4A 3ONLA 4XE0A 4QX8B 3ZHEB 3GW4A 4DLQA 3Q9DA 3PUKA 1TEZA 3ZN1B 4HOSA 2CLYB 3FEXA 4DK5A 3S7BA 5L3FB 1FEWA 3NZPA 4I55E 4AKLA 3ML8A 2V7LA 1UX5A 2GK9A 2ZM8A 5LNKA 2UXNB 5C8YE 3NZSA 2CLYC 4EOZB 2Y4UA 4O4JE 3CHRA 4WNDA 5EK3A 4P0BA 1BR4A 2LSIA 3CMLA 1HF8A 5G55A 2NW8A 3URZA 3EJNA 4MRUA 2JRKA 2Y6XA 4N5CA 4I4TE 2VYIA 4EZKA 3J9X1 4JHKA 4D10C 3BQIA 4GB9A 2Y48B 4KMCA 4N2QA 4H7YA 2W63A 2WXMA 2XAFB 2KMFA 1S0PA 4YVQC 1VDYA 1HG2A 4ACLA 4F7AA 3UT5E 1WRDA 2E9XB 4BTAA 3V5UA 4NRHB 3ONKA 3QWWA 2E9XC 4DI4A 2YQ8A 4ASKA 2CHZA 5LCWC 1JWFA 4JL0A 2NWBA 4L0RA 1YD8G 2XHEA 3HKCE 3K3QC 4ZI7E 3KAEA 3GMIA 2V5FA 3L22A 1OXZA 4Q96A 3FH5A 2KATA 2VWAA 3FU5A 3AU4A 3CX7B 3UUMA 2KT9A 2C0MA 4RG9A 4QHOA 3JYSA 2IOSA 2MHKA 1Z3YA 2X6HA 1E8XA 3ZPOA 2X6IA 4YNDA 4FU3A 4WWNA 3ULQA 3ZRHA 4KT6B 4EIWA 2I2OA 1B89A 4J0UA 2BVMA 1IHGA 3PURA 3CLJA 2ZLYA 3E0ZA 1E7VA 3VLEA 1KT0A 1UN8A 3RYFE 5FNVE 5LJMA 3APCA 4ZS3A 3I3NA 1QQEA 4U0UA 2D0TA 5JQGE 3QJZA 2OA5A 5JDFA 2LNIA 2B1EA 4QWNB 3VKGA 4WWPA 3ZC0A 4CI3B 4JVSA 4DI3A 2AW6A 4GU5A 3APFA 4FADA 3AVSA 3MKQB 3PS6A 2H7OA 4ILUA 4PFPA 5LP0A 4UF0B 3D9PA 2MRIA 3T8MA 3KBUA 2IAKA 4ANXA 1KNZA 3QAQA 5KJLA 3L17A 4AKGA 2FO7A 3RKVA 2LHRA 3TGOA 5FTPA 5F8PA 2A3DA 2VQ2A 4RG6A 2CFUA 2A4ZA 5HWXA 5T4YA 5C1DA 2FF4A 3UPVA 4CZZB 1NP7A 4XX5A 3RC8A 3S7JA 2LOSA 4EXTA 1N52A 4JA7A 2IOLA 2ONDA 4L2LA 4MS6A 3PNTB 3ENEA 5IHYA 5FYMA 1VOMA 4HOQA 3UQ3A 5JDMA 3CVLA 3ZCIA 2DI4A 3FUNA 3HKEE 1QSDA 5AJLA 3VLFA 5FP3A 1HX8A 3FH7A 3VHLA 1HG5A 3KV9A 2HO1A 3CIAA 2ZM0A 3LPZA 2LO6A 2KWIB 4X1IE 3N2OA 2L6JA 3FUIA 3PREA 4UWHA 1ELKA 1MNDA 4CXWA 4EYYR 3NRXA 4TN7B 4HTEA 3KD7A 3A5XA 4U74A 4PS8A 3PDYA 4I17A 1UCUA 4I2ZA 3CQXC 4CDNA 4ZI3C 1S94A 4FJZA 4J6IA 3NZQA 3MV3B 3CVYA 2VTBB 4N3BA 1G73A 4J2CA 3LCAA 4EZHA 4UV9B 3U4TA 2LAIA 2XQ0A 3SZ7A 4IHJE 3SBTB 3ASGA 4UVAB 5LA6E 1N54A 2Q9QD 2WXGA 1NA0A 1W3BA 3AA0B 2K9AA 2PG8A 4A3VA 2V1DB 3C50A 3FWVA 3OTNA 2I6HA 2V7MA 4HFGA 2YHCA 5FWQA 5BUZA 3S7DA 3OXGA 4DVDA 2J09A 4MALA 5HI7A 1ELWA 3JC6D 2GW1A 5CHEE 3FP3A 4XAXB 3OKQA 3HKBE 4I9EA 1U5PA 2XGOA 3PE3A 5AENA 4GZ6A 2C5KT 1WM5A 1E8WA 2VKHA 3K3NA 1KK7A 4ANJA 3I9WA 3LFMA 3P7IA 3PEVB 4A55A 4O6FA 2WMOA 2NW9A 3GZ1A 2XUEA 3OYXA 2E2EA 4M3OA 4TZ4C 3B7RL 4NUUA 1MNEA 3ASHA 3CX8B 3WAKA 3C4XA 3ZYKA 2IFUA 5AJDA 1WLXA 3MZKB 1PC2A 3KFWX 2V8SE 3ZEFA 5FMNA 4JZYA 3LK2B 2KCKA 2CMRA 2IC6A 4Q94A 4DO0A 2YINA 3ETVA 3N9OA 4PH4B 2XASB 3FBLA 4WNEA 3UT8A 1NAFA 3RYCE 3RK6A 1NWMX 5ENNA 2NTYA 2IONA 3LEWA 3UX4A 5CMWA 4G2AA 3CEQA 4A56A 5ADXL 4G24A 3RU0A 2RD0A 4ZHQE 3K3OA 2VJ8A 3NQPA 5TAOA 3CVRA 1CUNA 3B7TA 2DLRA 5FQ4A 4BX8A 4PW8A 2Q7FA 3FXDB 4XZ4A 2CWYA 1BR2A 3ONXA 1FCHA 3FUFA 1MQSA 2P9BA 4AVXA 4PJNA 2PM7A 3VU7H 3O1IA 2WBLA 2XHEB 1H2UA 2LSJA 2VGXA 1EZ3A 4HGAA 2LSKA 4PUCA 5A7DB 1AJ3A 4OYKA 3N9LA 5CA1E 4EBAA 1ZHCA 3QB2A 2R59A 2H7VC 3PU3A 2QFCA 3BG0B 3MXZA 4ZI2D 5LCWJ 2JMKA 3ANWA 4H63H 2CHWA 4FHJA 5CMYA 3AB3B 5C2YA 1MMNA 1INZA 2D0UA 3F31A 3LJ3A 3EDVA 4L9IA 2VB6A 4B94A 3K9IA 2X9WA 3M65A 2N2NA 1L5JA 1XGWA 4KVMA 2BDEA 4C9BB 3SS1A 3FFLA 5BV0A 3HR0A 2W62A 3CWZB 3FTWA 3U78A 4UVBB 3AAAB 1ZEEA 4UWGA 3LY8A 4IDZA 2WWUA 5FQ7A 4CCAA 2LJLA 2D2SA 3ZN0B 3D9OA 3ZVVA 2HR2A 4KMOA 2G0UA 1H2TC 4AI6A 4N3CA 4A1SA 4DPRA 3CPZA 4X1KE 3CHPA 3DBSA 5EX0A 3LJCA 3GN5A 5E76A 2HPJA 4CGWA 1V9DA 4HXIA 4WBOA 2LT3A 4JHRA 3RRNB 5JH7E 3RJVA 4U0SA 1H7CA 3ASFA 3G2UA 5DABA 1LRZA 4KP3C 4KYOB 3U3WA 3MEKA 1E96B 3PU8A 4N2SA 3AVRA 3RYHE 3C98A 3N5LA 4ANVA 3KINB 5CCMA 2QY7A 4UQXA 5D0QD 4Q69A 5HXEA 2WXRA 3CVWA 3UMVA 2CE7A 5JJ7A 3AS8A 2OVBA 3KS2A 4U72A 1FVHA 5A1LA 4ATGA 5LGTB 2BVLA 3ZW3A 4CRWA 2DWGA 3P2BA 3CKBA 3JQ0A 4FULA 4K03A 2XAQB 5H6RB 5EZYE 1H0AA 5AIJA 1D1BA 4V1Av 4I1OB 2IW5B 4EB6E 3FTUA 3LXUX 4BSXA 2UY1A 5BNWA 3AAIA 1OWMA 3O4XE 3MZLB 3CHSA 3CR3A 4GYWA 3LVRE 4B0ZA 3N9NA 4G2VA 1H6KA 2WXJA 3I4GA 5A23A 4URKA 2I59A 4PNIA 3VTXA 2XPYA 2V0PA 4U04A 3APDA 2YNQA 5JDQA 4PS3A 2L8KA 2ILRA 3Q4AB 2X67A 2XAGB 4UV8B 5HXSA 4GZCA 1YA0A 4G23A 3RRCA 3UUNA 1D0ZA 3E4BA 5FJYA 3PUJA 4G11A 4PDXA 1Z6TA 3ZGQA 4I50E 4ZS2A 5J1GA 2K48A 3DPDA 4L1BA 5JJTA 1MMDA 3OAWA 3L6AA 1OWAA 3NRYA 2M63A 4AOFA 4KUMB 4OK0A 2C0LA 1SA0E 2VASA 4HLEA 1A17A 2ZU6B 2PJQA 4AQGA 3ZXSA 2UXXB 4GZ5A 3B57A 3RYIE 3PE0A 2PFVA 3GZ2A 3N9MA 4AKIA 1HE8A 3SOLA 5J2UE 4H9RC 3CVPA 5FXWA 5EDSA 2J4DA 4GZDA 1HXIA 4FC8A 2WAUA 3Q15A 1EPUA 3P8CD 3TKLB 3O1HA 3I0QA 5HQ8A 3PZDA 5AFUL 3ZJ2A 2N9DA 2J49A 3ZC1A 1UJKA 3WI3A 1T98A 4AP2A 4PK5A 3GWHA 3ZEFB 1X79A 2VSNA 3D9KA 3PE4A 1E8YA 4WAFA 5KJKA 4TV3A 4UWFA 4P09A 4L7TA 4ILIA 4AJWA 4CDRA 4TV8E 3IKOB 1ZV4X 4MFRA 3I0OA 4XI9A 2OVFA 3HKDE 2CHXA 5EK2A 4C0MA 2CEAA 1YW0A 4I6EA 2L0IA 4IULA 4PS7A 4WWOA 1UW4B 2XRZA 2IJGX 4ANWA 2VKDA 1LVFA 1BPOA 4UWKA 4ISTA 1JPLA 4ADZA 4KXKB 3N2GE 3FHEA 2A2FX 1U4QA 4LCTA 4BAYB 2WXHA 5BMVE 4GMJA 5DBKA 2VGXB 4Y6WA 1UJJA 3D9IA 2WB2A 5CCLA 1D0XA 5DQVA 4BFRA 3L08A 3ZYMA 2MYSA 2I9CA 2VGYA 2Y8DA 4UVCB 4U8HA 1HU3A 4JEHA 2W0GA 1WAO1 5ARFA 1WY6A 1B7TA 2WSSV 3ANWB 3OXLA 3RO3A 4WNGA 3FUMA 5DQWA 4O2BE 3EIJA 3OBVE 4DMWA 3CQCB 2LE8A 2XEVA 3ZIMA 3QWPA 2DNXA 4J8DA 4JC8A 4IGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I4R B;  3CQG B;  3CQC B; 
#chains in the Genus database with same CATH topology
 2P9S G;  1OUV A;  3DSV A;  4LMJ A;  3TXN A;  2LM2 A;  4WNK A;  4CDM A;  2IQC A;  3KV4 A;  2DZN A;  3FY4 A;  1D1A A;  2ZGG A;  3T5X A;  2VKJ A;  4Z8X A;  1IBL T;  2CG3 A;  4HRM B;  4N5Q A;  4F1S A;  2A5U A;  3G2T A;  3LG7 A;  4YJ3 E;  5FZS A;  1UX4 A;  4PK4 A;  3RIB A;  1X81 A;  3KVB A;  1IXV A;  4CN6 A;  4CI2 B;  5KMG P;  4QXB B;  3ASD A;  5L2L A;  2ODV A;  2XS8 A;  2XPZ A;  2ZIS A;  2IC9 A;  3MCX A;  3EDU A;  3D9N A;  3J5P A;  2XPI A;  3UTK A;  3K1S A;  3GN5 B;  2W00 A;  4JI0 T;  4Y6C A;  2CXD A;  4ZZC A;  1OY3 D;  2Y3A A;  2D5U A;  5HXR A;  3DJB A;  3PZ1 A;  5EK4 A;  2HYZ A;  4QH4 A;  1ZBP A;  2X9X A;  4LUN U;  3LK4 2;  4GYS A;  2KZT B;  5JJ6 A;  2WZH A;  4JLE A;  4G63 A;  5JDL A;  5J08 A;  1N32 T;  4FHK A;  3L54 A;  4I1A A;  5FVL A;  2ZIR A;  3DEO A;  2FJD A;  1U3D A;  1ZB1 A;  4HWF A;  3ZMU B;  3C98 B;  1IJ5 A;  5HYA A;  1BLX B;  2IU1 A;  2BZB A;  1UN9 A;  3SFZ A;  2XEN A;  4WBN E;  4FLH A;  4XIF A;  4JI6 T;  3LYA A;  3AEC A;  2IF4 A;  2J8S D;  5FXX A;  3Q47 B;  2KZ7 B;  3FH8 A;  4TUU A;  4IN3 B;  3D0T A;  2LSV A;  2A72 A;  2X66 A;  4U3C A;  4AY5 A;  2NW7 A;  3UM3 A;  1HH8 A;  4HOR A;  1MIY A;  4GTS A;  3VR8 A;  1HCI A;  4H9P C;  4U96 D;  1NL4 A;  4IRE A;  4U63 A;  1XNR T;  3MJX A;  5D0O D;  3IBP A;  2BKO A;  3WAJ A;  4WZX A;  1Y8M A;  4N39 A;  2R6G F;  2WQH A;  1Q2Z A;  3QWV A;  4U31 A;  3ZMV B;  3NAW A;  3LY7 A;  2UY1 B;  5BPP A;  3Q5W A;  4LEU A;  2NTX A;  5BR8 T;  4L5G A;  5LOZ A;  4A63 B;  4O1P A;  2MYO A;  3NOG D;  3FUD A;  2L9Q A;  3CHO A;  4C90 A;  5HS0 A;  4GPK A;  2BBJ A;  3AEF A;  2QC9 A;  1E7U A;  1SA4 A;  2FJE A;  3ZMS B;  2BS4 A;  3N2K E;  1US7 B;  5JDN A;  4V3I A;  4KBM B;  1TN8 A;  1Z3X A;  1FIO A;  2VUR A;  3C64 A;  3HIZ A;  1HX1 B;  2CFZ A;  4I2W A;  3SNX A;  3T8O A;  4ZOL E;  2HN2 A;  3ABL E;  2RP4 A;  3IBE A;  4JEU A;  5G04 C;  2GRM A;  2WY2 A;  1JCQ A;  3PUS A;  4J8S A;  3RKO A;  1J5E T;  4IYP A;  1P5Q A;  2BF0 X;  1IZN B;  4JI2 T;  4NIQ A;  2WQ7 A;  2XAH B;  5EIB E;  3HHM A;  3NBN B;  1Y64 B;  4H9Q C;  3P4R A;  4ZXL A;  3HDX A;  2LHN A;  3AA6 B;  1O1R A;  3L9T A;  4DX2 A;  4CXY A;  4GYR A;  4W9R A;  1HS6 A;  3KSL A;  4QH5 A;  2KM4 A;  3RRU A;  4EPZ A;  3FU6 A;  3NZU A;  4QXC B;  3TLV A;  4DUY T;  1NEN A;  3ZT5 A;  1TNU A;  2YOE A;  2UU9 T;  4JPS A;  2JQK A;  5EX3 A;  2E9X D;  3D9J A;  4LF9 T;  2QYJ A;  5FZQ A;  4U0Z A;  4J8Y A;  5B3S E;  4YT0 A;  4ANU A;  4BT8 A;  3CST A;  3IHY A;  3VTY A;  4DND A;  2ES0 A;  2XRY A;  5AYW D;  3CVU A;  3AA7 B;  3ESL A;  3TLT A;  1Y6I A;  5DJQ C;  3EUV A;  5IWA T;  3MJW A;  3PUA A;  2AJA A;  1WR6 A;  4H63 V;  2OEV A;  2X68 A;  5FT9 A;  1MYO A;  3CV0 A;  2VK9 A;  4AQF A;  1O3X A;  4B8A A;  3CGH A;  4QXH B;  3CK7 A;  3N9Q A;  2J08 A;  5LG4 A;  1MIV A;  2W66 A;  2IUB A;  4GOU A;  4KVO A;  4IE5 A;  4HOU A;  2X51 A;  4LMK A;  2MBG A;  4YHJ A;  2ZM6 T;  3QNK A;  4DID B;  4G1T A;  4I6J A;  4IE7 A;  2C2L A;  4JBW F;  4BER A;  2ODU A;  4Q25 A;  4XZC A;  1OWN A;  2XGM A;  4GKK T;  3TLW A;  4IL4 A;  5JRC A;  3Q73 A;  5KBA A;  3E22 E;  1PAQ A;  3E08 A;  3HXE A;  2WQY A;  4ILA A;  2EIL E;  2B0O E;  3IHV A;  4GA1 A;  1BR0 A;  3F2E A;  5BT1 A;  2IML A;  2JMH A;  5LHI B;  4EEB A;  3CQG B;  4DLO A;  3R6N A;  5E0O A;  4EYU A;  5LXT E;  3E34 A;  4LRZ A;  3TWW A;  4GZ3 A;  2EHO A;  2RA1 A;  5FVK A;  5LX8 A;  3FUL A;  4JI1 T;  4G8L A;  4UXN B;  3ISM C;  3Q7F A;  4A3T A;  3PH0 C;  2DIW A;  2WXO A;  3R9A B;  3TAX A;  1L0V A;  5HEG A;  1Z0P A;  5FY1 A;  3MV2 B;  4YFS A;  1K3Z D;  1D0Y A;  3RGL A;  4I43 A;  4JXT A;  3I9Y A;  3FEY A;  4JV5 T;  4UQY A;  4YJ2 E;  4KBQ A;  1HZ4 A;  3TXM A;  4TWH A;  3UUX A;  2R05 A;  3AAA C;  4NAC A;  2QGS A;  3U66 A;  2K5B B;  3HXC A;  3DWL G;  4NUV A;  1D1C A;  2IO3 C;  4H9S E;  4BY6 A;  5LGN B;  1K8K G;  3LDZ A;  4HS2 A;  2I1J A;  3F57 A;  2L0T B;  4DBQ A;  2DCP A;  1RW2 A;  2MOW A;  4H7X A;  2XCB A;  3JUI A;  5LGU B;  5M4Y A;  4FLB A;  1JCS A;  2R5S A;  3LK3 B;  5JDG A;  4EZL A;  1E1H B;  2J9Q A;  2JPF A;  2KZT A;  3FUH A;  2VL8 A;  4DBR A;  4RVB A;  1VRB A;  5LBQ B;  3I4R B;  4BTB A;  4RSY A;  4H9O C;  3PUZ F;  4HVB A;  2C0S A;  4U7I A;  4ZZB A;  1T72 A;  3IV0 A;  4O2A E;  4LER A;  1S35 A;  4JUY A;  4HWD A;  2R17 C;  4MKT A;  3G2V A;  2HH7 A;  2V8S V;  4UI9 C;  2J4G A;  2OCC E;  4ME2 A;  1MZC A;  1SZA A;  3AE9 A;  2CXL A;  2KLQ A;  3SBS A;  3BQL A;  3FB2 A;  2YEV C;  4JEH B;  3FUE A;  4BT9 A;  4XI0 A;  4APO A;  4A1G A;  2HM8 A;  1N33 T;  3VRB A;  4ACK A;  2AVP A;  2DYR E;  3ZPJ A;  5LMN T;  4IRU A;  5JHA A;  4AXP A;  3CHM A;  1HNW T;  3FTX A;  2P9K G;  4DMV A;  3B5M A;  5BW8 C;  4ERR A;  5L3B B;  3J7Y q;  4CGV A;  4TRQ A;  3HVE A;  2W4X A;  3RH3 A;  4LFB T;  3ZFW A;  2WPV A;  3CKD A;  3LY9 A;  3HXB A;  1HNZ T;  1X5B A;  2BTD A;  5HEO A;  3PUQ A;  2DHR A;  3ZU7 B;  4ZI3 D;  2WXF A;  4EQF A;  3B7S A;  3P4Q A;  3ZCJ A;  3ZNG A;  1NA3 A;  2CWO A;  4F6R C;  2LRK A;  4CXX A;  5HWY A;  3RSE G;  5JA4 D;  4QKN A;  5HEU A;  3PUY F;  3ZSS A;  4DV4 T;  3V79 K;  4WW0 A;  1YXR A;  4IDN A;  1H6P A;  4EEC A;  1DVP A;  4CEM A;  3MA9 A;  2X9H A;  3JCF A;  5ABG A;  3G2W A;  3CK9 A;  2XTL A;  3T1H T;  2CA5 A;  2FEZ A;  4FJY A;  2YK0 A;  5FY0 A;  1BD8 A;  2GRN B;  3EHN A;  3QAR A;  4OHF A;  4BJM A;  2V5D A;  5L4E A;  4IDP A;  4UEM A;  3AE6 A;  1BI7 B;  3FTS A;  3X2Q E;  1SZ9 A;  5FXV A;  2XGS A;  3R84 B;  1V55 E;  1V54 E;  4UI9 K;  5L3E B;  4GAA A;  4AKR B;  5JR9 A;  4CT4 A;  3ZMT B;  3FDH A;  2FBW A;  3K8P C;  3HYM B;  3KEZ A;  1OWP A;  5EYL A;  3SO8 A;  3SI5 A;  3DTO A;  1JUQ A;  3LS8 A;  2R02 A;  4O1O A;  2CCQ A;  3CK8 A;  3MA5 A;  3KVA A;  3OJA A;  1XDO A;  3HG0 D;  4NXM T;  4K0U A;  2RG8 A;  3JCK C;  2XQ7 A;  2DWK A;  5LYJ E;  2KCV A;  4GPM A;  4UQZ A;  2ACZ A;  3G2S A;  4Z68 A;  3MYV A;  4M1P A;  4JB8 P;  1OWO A;  4KHZ F;  3MKR A;  4DUI A;  3QC9 A;  3SFE A;  2KXP B;  2QYU A;  5LBM A;  3EHM A;  1JNR A;  3AE2 A;  3O1J A;  1E90 A;  3EAB A;  2NXP A;  3HL6 A;  3RRW A;  3QB5 A;  4UIG A;  1WDY A;  2WXI A;  2WXQ A;  4YDE A;  3I5P A;  3KV6 A;  4QX7 B;  5G05 C;  2ZMA A;  3L16 A;  2XSB A;  2WS3 A;  4AIS A;  4LNU D;  1LD8 A;  4HFV A;  2OEW A;  2NC9 A;  2V4L A;  2DBA A;  3GZS A;  3CVN A;  2OV8 A;  4JW1 A;  1D8E A;  4EZ4 A;  2CRB A;  4MLK A;  3B13 A;  4I6G A;  2X38 A;  3T1Y T;  3OTO T;  2VSY A;  3FUJ A;  3SGH A;  2I0M A;  1KT1 A;  1IQU A;  1H2V C;  1TNZ A;  4I1M A;  3QOU A;  1GW6 A;  1KEY A;  3CKC A;  2E5L T;  2BG9 A;  3UT7 A;  3FHN A;  4K5A B;  3ZYL A;  4ZI2 C;  3EU9 A;  3W15 B;  4JEU B;  4JI8 T;  1QNF A;  2OLT A;  3AAE B;  2FI7 A;  4G8K A;  5JHB A;  4GK0 E;  2WXP A;  1OCR E;  2WXN A;  4CQI A;  3EI0 A;  4F3V A;  5AQI B;  1OCO E;  2X9Y A;  3HI2 A;  5AQF B;  1BI8 B;  2K24 A;  4BA9 A;  2J1D G;  5L3G B;  3PDN A;  5CED B;  1BR1 A;  2KIN B;  5KWD A;  1FPP A;  2Z6E A;  4GTP A;  4GKJ T;  1NZN A;  3PZ3 A;  1XMQ T;  4GYY A;  1H19 A;  3Q5M A;  2AWI A;  1ZKE A;  2LXM A;  3OXF A;  4ILB A;  3UUL A;  2LSY A;  4U7Y A;  2DYS E;  2QRX A;  3ZLI A;  4AY6 A;  1EF1 C;  2H89 A;  3AEG A;  3KBT A;  5EIL A;  1D9S A;  4GTQ A;  4YLH A;  4KZ0 A;  5G04 J;  4YDW A;  3N71 A;  4HOT A;  4BEP A;  4UUC A;  3L13 A;  2AXU A;  2FO1 E;  2D9D A;  4G25 A;  4PK6 A;  3C4Z A;  3EIQ C;  4PFO A;  1FVF A;  3AG2 E;  3NF1 A;  3TWS A;  1IAP A;  4U07 A;  3SQV A;  3FTY A;  4OVV A;  3SRZ A;  2C5J A;  2Q9Q A;  2PBI A;  3P50 A;  3D9L A;  4LF8 T;  1LF8 A;  4G26 A;  3SHF A;  4FJO A;  4AQF C;  4HKA A;  1UUS A;  5FY7 A;  3TL5 A;  1Y01 A;  2IO2 C;  2I1K A;  5FKY A;  2JAB A;  1UG3 A;  1KLX A;  3KSQ A;  4GTR A;  1N0R A;  3CVV A;  1OED E;  4O8S A;  5JRC B;  3UT4 A;  1WFD A;  3PTR B;  4YHH T;  1TNB A;  2WXL A;  4O4H E;  2FBN A;  4QFV A;  2AXV A;  3E33 A;  4AEZ C;  4CZ2 D;  5ETW A;  2L6B A;  2F4V T;  3CX6 B;  4A5X A;  3U64 A;  3RIF A;  4AKH A;  2F8Y A;  4J8F A;  4GMR A;  2EHO B;  1TJF A;  3AJI A;  1E8Z A;  1JWG A;  5M72 A;  4IIJ E;  2J4B A;  3ZJ1 A;  3UI2 A;  2EHO C;  2WDV A;  3NBX X;  3FZM B;  3NWI A;  2X0H A;  1FT2 A;  2LAH A;  5GON E;  1XNF A;  4I43 B;  5KDM C;  5BV1 A;  4GML A;  5LP6 E;  5KX5 E;  5LG3 A;  2WWV A;  2OOE A;  4LG6 A;  1W0A A;  3W9F A;  3FXE B;  3HXF A;  4DJA A;  3UUX B;  2VSO E;  5CBN A;  2LEH A;  2YHE A;  2VSX E;  2WXK A;  4XKB A;  3BUA A;  5J0Z A;  1PY1 A;  3T9K A;  4J8E A;  3ZHE A;  5JVD E;  4GCN A;  2PL2 A;  2EIJ E;  1TJC A;  4DX7 D;  3ZST A;  3O9X A;  4X64 T;  1M62 A;  3AED A;  4YVO A;  3GA8 A;  1QUU A;  2KND A;  2V7J A;  2X6K A;  1OWL A;  5L47 A;  3DST A;  4TWD A;  4H9N C;  3RQU A;  2MOZ A;  2W61 A;  3BQK A;  2XSA A;  1SHZ C;  4AV7 A;  1DNP A;  1WYC A;  3RPU A;  2H3R A;  4WUY A;  3MKD A;  5ARG A;  2LSG A;  5IYZ E;  1J1J A;  1WYB A;  3QUJ A;  2WQ6 A;  5FIN A;  4AXH A;  5G2N A;  3P4P A;  4E85 A;  4OVU A;  4X8Q A;  5FZR A;  3QKY A;  5T8I A;  4B3T T;  1EYH A;  1I94 T;  2X0Y A;  5AQN B;  3QNU A;  3TWQ A;  2UWJ G;  4PAG A;  4N3A A;  5LJN A;  5AQA A;  2EIM E;  4EBA G;  5CEC B;  3RKG A;  2FJB A;  5AQS B;  3D9M A;  2CXF A;  2AXZ A;  2L9B A;  4OYJ A;  2K3W A;  2Y4T A;  1MX2 A;  2FUL A;  1IYG A;  3N9P A;  1FJG T;  3AE1 A;  4TX5 A;  4NPP A;  2EQX A;  2E9X A;  4BWR A;  4E6H A;  4XBF B;  4X1Y E;  3EUH A;  2YDQ A;  3PNL B;  4MBQ A;  3LBX B;  2WVI A;  2L3L A;  1O1T A;  4ILG A;  3HA4 A;  3L3P A;  3BG1 B;  4WNF A;  3LJN A;  5LCY A;  3PRZ A;  3HVE B;  5KJN A;  1OCC E;  4LNB A;  4UI9 J;  4UWL A;  4GA2 A;  5HXC A;  1LKX A;  3O48 A;  4NQ0 A;  3ETU A;  5E75 A;  5LOV E;  5DIZ A;  2WU2 A;  3OPC A;  3S2A A;  3TG5 A;  5J90 A;  4B89 A;  2GGF A;  4K0R A;  5F3J A;  4HB5 A;  3EHQ A;  4F6R D;  4B6X A;  4F53 A;  5HAX A;  4PJM A;  3FUK A;  5ANR A;  4BX9 A;  3JQ1 A;  4GA0 A;  5ENQ D;  1U3C A;  3LVQ E;  3UFE A;  5AQH B;  4C48 B;  1FMV A;  3D3M A;  4N78 D;  5L3C B;  2PQR A;  4GYO A;  3QC1 A;  2E0I A;  1KZP A;  2NP9 A;  5CA0 E;  1MMG A;  3VKH A;  2BKK B;  3AU5 A;  1G8X A;  3FTZ A;  3Q5D A;  3PVL A;  4JHJ A;  3SFD A;  2RFM A;  2XEE A;  3LSV A;  4DV0 T;  3PUG A;  1W9R A;  2B76 A;  4DUZ T;  4PJL A;  3TLS A;  3FTV A;  2V6Y A;  3U3I A;  1MX4 A;  4ZFH A;  1MHQ A;  4L9P A;  5LHG B;  4HLL A;  3TG4 A;  4OYS A;  4B8C B;  2V26 A;  3C72 A;  1IQR A;  3IEE A;  2EIN E;  2X3M A;  4FP7 A;  5KXJ A;  1YKH B;  1O5M A;  4EZJ A;  4FI5 A;  2PZI A;  3OYZ A;  4HWI B;  3ZMZ B;  3EDT B;  1XWM A;  4P29 A;  5KJM A;  4LML A;  2XCC A;  5JR9 B;  3E32 A;  3DSU A;  3FZF B;  3Q49 B;  3R7R A;  3H37 A;  3UQ7 A;  4HBD A;  3MKQ A;  5JR9 C;  4O60 A;  4HN9 A;  5F5W A;  1SUM B;  3DRA A;  1YKE B;  2PQN A;  3CSF A;  1NFI E;  4NUR A;  5AQJ B;  3T5V A;  2PNN A;  5JDH A;  4UF0 A;  3RC3 A;  2N1G A;  2KC7 A;  5CEA A;  5T3R A;  4EHM A;  3UTM A;  2JLB A;  3MGB A;  3SD5 A;  4MLP A;  3S4U A;  5EKQ D;  3IF8 B;  2X6F A;  3C4W A;  4WYV A;  5L3D B;  2WDQ A;  4HQD A;  4R7L A;  4ILH B;  4M7C A;  3RO2 A;  1QZ2 A;  1TN6 A;  4AIF A;  3IXE A;  4EAH A;  2VKO A;  4QQI A;  4MHC A;  2KWH A;  2LSU A;  1EDU A;  2E8I A;  3AS5 A;  2SPC A;  2YU2 A;  3WXX A;  3TJP A;  3PEU B;  4OFZ A;  3MK7 C;  1IJ6 A;  3FZH B;  3QDN A;  3D9H A;  3BK9 A;  2JJ9 A;  4DV3 T;  1HFA A;  4KX6 A;  5KCM A;  4YY3 T;  5ANL A;  3ESK A;  2J07 A;  4IE6 A;  5C3J A;  5FXZ A;  3RX6 A;  3L09 A;  3UIN C;  4C0E A;  3EAM A;  2V7K A;  5AQP B;  3CVQ A;  2V5Q C;  3FU3 A;  1HTJ F;  4B3S T;  2ACX A;  4BJN A;  5ENP D;  2ZM2 A;  2XJ7 A;  3Q5X A;  1IBM T;  4X5T A;  5A6C A;  1H6O A;  4P1N A;  3JAF A;  2BG9 B;  4KZC A;  4CYM D;  2IHR 1;  2XQY A;  3GYZ A;  3MAC A;  2A9U A;  1MIW A;  2MTQ A;  5ENT D;  5G05 J;  2GRL A;  3UFG A;  4I9C A;  3KV5 A;  3RIA A;  2BG9 C;  4A97 A;  2F37 A;  4L23 A;  3CVX A;  4O4L E;  4YDO A;  2HPL A;  4UEL A;  5IUX A;  2P9U G;  5HXH A;  1ELR A;  2P58 C;  3TWX A;  2CPT A;  2XAJ B;  2NSZ A;  2UUA T;  5ABF A;  2BUG A;  4GK5 E;  1N0Q A;  3QK0 A;  3RRM B;  4E7S A;  5ENR D;  2E5V A;  2NOX A;  2QZA A;  2ZGD A;  4F1P A;  3TLU A;  4DR1 T;  4DR6 T;  1S63 A;  4L2Y A;  5LHH B;  4HFI A;  5FQ6 A;  3EHZ A;  2VVN A;  4TNW A;  1MX6 A;  1TYQ G;  3KDS E;  2YU1 A;  3UU3 A;  2H6G A;  5FQ8 A;  1JNZ A;  3FU0 A;  3RHW A;  3S7F A;  3MX3 A;  1HS7 A;  1YQ4 A;  3VR9 A;  4ISS A;  1OT8 A;  3IEG A;  4JA9 A;  3P1U A;  1XNQ T;  2WZI A;  4CT0 A;  2VTB A;  3B7U X;  1LVK A;  3SF4 A;  3CHQ A;  2CHO A;  1SW6 A;  4XKC A;  3ZN3 A;  4HE8 A;  2PM6 A;  4U2Y A;  5JMN D;  4P0A A;  3O4Z A;  1S64 A;  2Q9Q B;  2X0L B;  1OCZ E;  3DSX A;  5JRE A;  5KNG A;  4ABN A;  4APF A;  4CI1 B;  2V7I A;  4FA6 A;  2C5I T;  3QB5 K;  4AM9 A;  1ZOY A;  4HNA D;  3Q75 A;  2DCF A;  2Q9Q C;  3JUE A;  4O4I E;  2IDO B;  1OED A;  3TWU A;  1IKN D;  2F0Y A;  3C3R A;  1SVX A;  3JXJ A;  3EVY A;  3VLD A;  2X6J A;  1TNY A;  3ABM E;  2CG2 A;  1ZU2 A;  4LF4 T;  2KCL A;  3LKU A;  5LFA A;  4HWH A;  1N9A A;  2R03 A;  5AQK B;  2QA7 A;  3DP7 A;  3LBX A;  3ML9 A;  2LOP A;  5ENS D;  3BEE A;  3BU8 A;  3PJA A;  3QK6 A;  3FBZ A;  3SWH A;  1SQM A;  4TV9 E;  3JC6 C;  5D66 A;  5B1A E;  3ZYQ A;  2EHO D;  1LTX A;  3C51 A;  1MMA A;  3V5S A;  3IA3 A;  4YSX A;  3AA1 B;  4GCO A;  4GIW A;  1HO8 A;  3A7M A;  2JEK A;  2BS2 A;  5AQM B;  2JQQ A;  1TNO A;  3ZT6 A;  4C91 A;  2VL0 A;  3Q2M A;  4E7Z A;  2WMN A;  1N94 A;  3U9W A;  1DCQ A;  3H3A A;  4HRN A;  2XY8 B;  5H6Q B;  2M67 A;  5CB4 E;  4TNV A;  4IE0 A;  2CM0 A;  3PZ4 A;  1E7P A;  2LM9 A;  3UUB A;  2P9L G;  1FMW A;  5J2T E;  4TUY E;  4X20 E;  3Q5E A;  3R7Q A;  3I1A A;  4IE4 A;  3RLF F;  3IHR A;  2WM9 A;  4HEA A;  4NXN T;  4PJJ A;  3AS4 A;  4HFE A;  3ONL A;  4U95 D;  4XE0 A;  4QX8 B;  3ZHE B;  2XQ4 A;  1KNP A;  3GW4 A;  4DLQ A;  3Q9D A;  3PUK A;  5CRV A;  4DX1 A;  1TEZ A;  3ZN1 B;  3FZL B;  3F6Q A;  4HOS A;  2CLY B;  3FEX A;  4DK5 A;  3S7B A;  3C5R A;  5L3F B;  1FEW A;  3NZP A;  4I55 E;  4AKL A;  3ML8 A;  2V7L A;  1UX5 A;  2GK9 A;  2ZM8 A;  5LNK A;  2UXN B;  4HWC A;  5C8Y E;  3NZS A;  2CLY C;  4EOZ B;  2Y4U A;  4O4J E;  3CHR A;  4WND A;  5EK3 A;  2M6B A;  4TXP A;  4P0B A;  1G3N B;  2LSI A;  1BR4 A;  3CML A;  2KSR A;  1HF8 A;  3SFX A;  5CJ5 A;  2LXL A;  3DXM G;  5G55 A;  2NW8 A;  4I0U A;  3EJN A;  3URZ A;  4MRU A;  5ENO D;  4B3M T;  1J5W A;  2ETA A;  2JRK A;  2Y6X A;  4N5C A;  4I4T E;  1RZ4 A;  2VYI A;  1AP7 A;  4EZK A;  3J9X 1;  1X9B A;  4JHK A;  2MAW A;  4D10 C;  3BQI A;  4GB9 A;  2Y48 B;  2XPK A;  3JAD A;  4AQY T;  3QOF A;  4KMC A;  4COF A;  4H7Y A;  4N2Q A;  2W63 A;  2WXM A;  2XAF B;  2KMF A;  1OXJ A;  1S0P A;  2UXD T;  4YVQ C;  1VDY A;  1HG2 A;  4ACL A;  4F7A A;  3UT5 E;  1WRD A;  2E9X B;  4BTA A;  4GTO A;  4EV6 A;  3V5U A;  4A98 A;  2H6F A;  2Y1L E;  4NRH B;  3ONK A;  3QWW A;  3AG4 E;  2E9X C;  5LMU T;  4DI4 A;  4DR5 T;  2YQ8 A;  4ASK A;  2IEJ A;  3AG3 E;  2CHZ A;  5LCW C;  1JWF A;  2KXP C;  4JL0 A;  1QYM A;  2XQA A;  4MBG A;  2NWB A;  4L0R A;  4GTV A;  4OAU C;  1YD8 G;  2XHE A;  5CBO A;  2FJA A;  3X1D A;  3HKC E;  3K3Q C;  1N4P A;  3PUX F;  4ZI7 E;  3KAE A;  3GMI A;  2V5F A;  3KEA A;  1I6Z A;  5AQL B;  4DR2 T;  3L22 A;  1OXZ A;  5AQ9 A;  4Q96 A;  3FH5 A;  1NEK A;  1WR0 A;  2KAT A;  2VWA A;  3FU5 A;  2XZD G;  2FUP A;  1D8D A;  3AU4 A;  1R8I A;  3CX7 B;  3UUM A;  4EED A;  2KT9 A;  2UUB T;  2C0M A;  4RG9 A;  4QHO A;  3JYS A;  2IOS A;  4IL9 A;  1Z3Y A;  2MHK A;  1N11 A;  2X6H A;  1E8X A;  4DV2 T;  3CIR A;  3ZPO A;  2X6I A;  3AE7 A;  4YND A;  4FU3 A;  1UGO A;  1DU2 A;  3Q9U C;  4WWN A;  3ULQ A;  3V2X A;  3ZRH A;  2YDS A;  4KT6 B;  4EIW A;  3Q7A A;  2I2O A;  1B89 A;  4J0U A;  2BVM A;  1IHG A;  3TWT A;  3PUR A;  3CLJ A;  2ZLY A;  3E0Z A;  1E7V A;  3VLE A;  1KT0 A;  1UN8 A;  2DVW A;  4BET A;  2V6Y B;  2YN6 A;  5FNV E;  3RYF E;  4K5B A;  5LJM A;  4HFC A;  3UXG A;  3APC A;  4ZS3 A;  3I3N A;  1QQE A;  4U0U A;  5AQO B;  2D0T A;  2YDR A;  5JQG E;  4RQI A;  3QJZ A;  2OA5 A;  5JDF A;  3OVU A;  3UM0 A;  3DEP A;  2LNI A;  4X66 T;  2B1E A;  4QWN B;  3VKG A;  4WWP A;  3ZC0 A;  4CI3 B;  4JVS A;  4TUM A;  2AW6 A;  4DI3 A;  4GU5 A;  4LNG A;  3APF A;  4FAD A;  3AVS A;  3UIO C;  3NB2 A;  3MKQ B;  3PS6 A;  2GRR B;  2H7O A;  4JI4 T;  1VCT A;  4ILU A;  4PFP A;  5LP0 A;  1W0B A;  1KPS B;  4UF0 B;  3D9P A;  2MRI A;  3T8M A;  2DZO A;  3KBU A;  2IAK A;  4ANX A;  1KNZ A;  3QAQ A;  3AE8 A;  5KJL A;  1W09 A;  3L17 A;  5BXU A;  4Z90 A;  2QYW A;  4AKG A;  2P9N G;  2FO7 A;  3RKV A;  2LHR A;  3TGO A;  2JIW A;  1N95 A;  5FTP A;  3JXI A;  5F8P A;  2A3D A;  2H6I A;  1M7K A;  2W67 A;  2VQ2 A;  4RG6 A;  1KF6 A;  3DXK G;  2CFU A;  4LFA T;  2A4Z A;  5HWX A;  5T4Y A;  5C1D A;  2FF4 A;  3UPV A;  5FL1 A;  2BKG A;  4CZZ B;  1NP7 A;  4XX5 A;  3RC8 A;  3S7J A;  2LOS A;  4EXT A;  2GRQ B;  1N52 A;  4JA7 A;  2IOL A;  2OND A;  4L2L A;  4MS6 A;  3NKZ A;  4DX5 D;  3PNT B;  1UUR A;  1JCR A;  3ENE A;  5IHY A;  2UXC T;  3PUW F;  4DV1 T;  5FYM A;  1VOM A;  4HOQ A;  3UQ3 A;  5H7P A;  4B93 B;  5JDM A;  3CVL A;  3ZCI A;  2DI4 A;  3FUN A;  3HKE E;  2V6X A;  1QSD A;  5AJL A;  3Q9N C;  3VLF A;  5FP3 A;  2BED A;  1HX8 A;  3FH7 A;  2XZE A;  3VHL A;  3RQW A;  1HG5 A;  3KV9 A;  2HO1 A;  4X62 T;  3CIA A;  2ZM0 A;  4DR3 T;  3LPZ A;  4LF6 T;  2LO6 A;  2KWI B;  4KI0 F;  4BSZ B;  2DL1 A;  4X1I E;  2YKS A;  3N2O A;  4QH1 A;  2L6J A;  1K1A A;  2J47 A;  3FUI A;  2XQ9 A;  3PRE A;  1ELK A;  4UWH A;  2BKP A;  1MND A;  5ABF B;  1SA5 A;  4CXW A;  4EYY R;  3NRX A;  4TN7 B;  3H3M A;  4HTE A;  1N36 T;  1T8B A;  3KD7 A;  4BES A;  3A5X A;  1XMO T;  4F8H A;  4U74 A;  4PS8 A;  5CER B;  3M3Z B;  3PDY A;  4I17 A;  1UCU A;  4HI8 A;  4I2Z A;  1LD7 A;  4B3R T;  3CQX C;  3ASO E;  4ZI3 C;  4CDN A;  1S94 A;  2H88 A;  4FJZ A;  4J6I A;  3NZQ A;  3MV3 B;  2BKN A;  3CVY A;  2VTB B;  4N3B A;  1G73 A;  4U7E B;  2WDR A;  4J2C A;  3LCA A;  2F8X K;  4AIU A;  1KZO A;  4EZH A;  3UU8 A;  5FIO A;  5LB7 B;  3UKU G;  4UV9 B;  3U4T A;  3PUV F;  2LAI A;  2XQ0 A;  3Q78 A;  4IHJ E;  3SBT B;  3SZ7 A;  3ASG A;  4UVA B;  5LA6 E;  1N54 A;  2Q9Q D;  2WXG A;  1NA0 A;  1W3B A;  3AA0 B;  2K9A A;  1OED B;  4EGW A;  4GTM A;  2PG8 A;  4A3V A;  2V1D B;  4YTP A;  3DSS A;  3C50 A;  4DV5 T;  3FWV A;  3OTN A;  2I6H A;  2GRP B;  1OED C;  2V7M A;  4HFG A;  2YHC A;  5FWQ A;  5BUZ A;  3S7D A;  3OXG A;  4DVD A;  5KNH D;  2J09 A;  2UUC T;  1UK5 A;  3C3O A;  2A5E A;  4MAL A;  5HI7 A;  1ELW A;  3JC6 D;  2GW1 A;  1K1B A;  3TWR A;  5CHE E;  1IHB A;  3FP3 A;  1CHU A;  3AXJ A;  4XAX B;  4K5C A;  3EHR A;  3OKQ A;  3HKB E;  4I9E A;  2RFA A;  3ASN E;  2XZT G;  1U5P A;  2XGO A;  3PE3 A;  5AEN A;  4GZ6 A;  2C5K T;  1WM5 A;  5JTG A;  1E8W A;  3AEB A;  2VKH A;  3K3N A;  3RAU A;  1KK7 A;  4ANJ A;  3I9W A;  3LFM A;  3P7I A;  3PEV B;  2DWZ A;  4A55 A;  4O6F A;  4HFB A;  2WMO A;  1T7S A;  2NW9 A;  5C2T A;  3GZ1 A;  2XUE A;  3OYX A;  2E2E A;  4YSY A;  4TZ4 C;  4M3O A;  3B7R L;  4NUU A;  1MNE A;  3ASH A;  5IY5 E;  3CX8 B;  3DSW A;  3WAK A;  2MPK A;  3C4X A;  3ZYK A;  2IFU A;  5AJD A;  1WLX A;  4XEI G;  3ONL C;  3MZK B;  1ZP0 A;  1PC2 A;  4HFH A;  4IDQ A;  4JI5 T;  3KFW X;  5AQG B;  2V8S E;  3ZEF A;  5FMN A;  4JZY A;  5BXO A;  2J62 A;  2V5C A;  3LK2 B;  2KCK A;  2CMR A;  2IC6 A;  4Q94 A;  4DO0 A;  2YIN A;  3ETV A;  3N9O A;  2EIK E;  4PH4 B;  2XAS B;  3FBL A;  1KFY A;  4WNE A;  3UT8 A;  1NAF A;  3RYC E;  3RK6 A;  1NWM X;  5ENN A;  2NTY A;  2ION A;  1WG0 A;  3LEW A;  3UX4 A;  2BG9 E;  3ONJ A;  5CMW A;  2XQ3 A;  4G2A A;  3CEQ A;  4A56 A;  5ADX L;  4G24 A;  3RU0 A;  4X65 T;  3AG1 E;  3G06 A;  3Q79 A;  2RD0 A;  4ZHQ E;  5AAO A;  5ABH A;  3K3O A;  4ATZ D;  3RIU A;  2VJ8 A;  3NQP A;  4OAV B;  5TAO A;  3CVR A;  1CUN A;  2QVA A;  3B7T A;  2DLR A;  5FQ4 A;  4BX8 A;  2AE9 A;  5HCJ A;  4PW8 A;  2Q7F A;  4TWF A;  3FXD B;  1AWC B;  4XZ4 A;  2CWY A;  1BR2 A;  3ONX A;  1FCH A;  3FUF A;  1MQS A;  2P9B A;  2P2C P;  4AVX A;  2VGE A;  4PJN A;  2PM7 A;  3VU7 H;  2ETC A;  3O1I A;  2M6I A;  2WBL A;  2XHE B;  1H2U A;  2LSJ A;  3B95 A;  3V2O A;  2VGX A;  3AE4 A;  3NOC D;  1EZ3 A;  4HGA A;  2LSK A;  1S70 B;  4PUC A;  5A7D B;  1AJ3 A;  1DC2 A;  4OYK A;  2HHH T;  4LSZ E;  3N9L A;  3ABV A;  4JI7 T;  4OX9 T;  3ZT7 A;  5CA1 E;  4EBA A;  4JI3 T;  1ZHC A;  3QB2 A;  2LKH A;  2R59 A;  2UXB T;  2H7V C;  3PU3 A;  2QFC A;  4U2Z A;  3BG0 B;  3MXZ A;  2LUH A;  4HFD A;  4ZI2 D;  5LCW J;  2JMK A;  3AEA A;  3ANW A;  4H63 H;  5HCM A;  2CHW A;  5D2M C;  4U8V D;  4FHJ A;  2P9I G;  5CMY A;  1MJ0 A;  3AB3 B;  5C2Y A;  1MMN A;  1INZ A;  2D0U A;  3F31 A;  3LJ3 A;  3J5Q B;  3EDV A;  3B7B A;  4L9I A;  1YQ3 A;  2VB6 A;  4B94 A;  3K9I A;  2X9W A;  3M65 A;  2N2N A;  1L5J A;  1XGW A;  4KVM A;  3WG7 E;  2BDE A;  4C9B B;  4DR7 T;  3SS1 A;  3FFL A;  5BV0 A;  2AXD S;  3HR0 A;  2W62 A;  3BQO A;  3CWZ B;  5ABE A;  3FTW A;  1SE7 A;  3U78 A;  4UVB B;  1ZEE A;  3AAA B;  4UWG A;  5EID A;  3LY8 A;  4IDZ A;  2WWU A;  5FQ7 A;  2HN1 A;  4CCA A;  2LJL A;  2D2S A;  3PV0 F;  3ZN0 B;  3D9O A;  3ZVV A;  2HR2 A;  4KMO A;  5AQ7 A;  3ULY A;  2G0U A;  1YMP A;  3HXD A;  1H2T C;  4AI6 A;  2VVS A;  4N3C A;  4A1S A;  4DPR A;  3CPZ A;  4X1K E;  3CHP A;  2XM2 A;  3DBS A;  5EX0 A;  3LJC A;  5HEH A;  3GN5 A;  2LLY A;  5E76 A;  4DV6 T;  2LRL A;  4LF7 T;  1Z8U A;  2HPJ A;  4CGW A;  1V9D A;  3UQ4 A;  4HXI A;  4WBO A;  2LT3 A;  4JHR A;  4DV7 T;  3RRN B;  5JH7 E;  3ABK E;  3RJV A;  4U0S A;  1H7C A;  4DR4 T;  3ASF A;  3G2U A;  5AQT B;  2BS3 A;  5DAB A;  1LRZ A;  4KP3 C;  1TN7 A;  4KYO B;  3U3W A;  3MEK A;  1E96 B;  3PU8 A;  5AQB A;  4N2S A;  3AVR A;  1DCE A;  3UKR G;  3RYH E;  4Z91 A;  3C98 A;  3N5L A;  3P4W A;  2B6C A;  4ANV A;  3KIN B;  5CCM A;  5HRY A;  2Y69 E;  1QLB A;  2QY7 A;  4UQX A;  5D0Q D;  3RI5 A;  4Q69 A;  5HXE A;  2WXR A;  3CVW A;  3UMV A;  2CE7 A;  5JJ7 A;  1U2V G;  1N4R A;  3AS8 A;  2OVB A;  2P9P G;  3KS2 A;  4U72 A;  1FVH A;  5A1L A;  1IBK T;  4ATG A;  4CN1 A;  1HNX T;  2R2L A;  5AQR B;  5LGT B;  2BVL A;  3ZW3 A;  4CRW A;  2DWG A;  3P2B A;  5B1B E;  2ZXW E;  3P4S A;  2Y0B G;  2E2A A;  3CKB A;  3JQ0 A;  4FUL A;  4JD2 G;  4K03 A;  2XAQ B;  5H6R B;  5EZY E;  5CGM A;  1H0A A;  3UU4 A;  5AIJ A;  1D1B A;  4V1A v;  1VCS A;  4I1O B;  3TWV A;  2IW5 B;  4EB6 E;  3FTU A;  3LXU X;  4BSX A;  4HRL A;  2NR4 A;  2UY1 A;  3SFY A;  5BNW A;  3AAI A;  1OWM A;  3O4X E;  3MZL B;  1BU9 A;  3SY2 A;  3CHS A;  3CR3 A;  3V30 A;  4GYW A;  3LVR E;  4B0Z A;  3N9N A;  4G2V A;  1H6K A;  2WXJ A;  3I4G A;  5A23 A;  3NVO A;  4YTN A;  4URK A;  2WP9 A;  2I59 A;  1WCR A;  4PNI A;  2OV9 A;  3UM2 A;  3A8Y C;  3VTX A;  5ITZ F;  2XPY A;  2V0P A;  4U04 A;  5EYP F;  3APD A;  2YNQ A;  5JDQ A;  4PS3 A;  2L8K A;  2ILR A;  1YCS B;  3L39 A;  3Q4A B;  2X67 A;  4TXR A;  2XAG B;  2RPA A;  4UV8 B;  5HXS A;  4GTT A;  4GZC A;  4ILC A;  1YA0 A;  4G23 A;  3RRC A;  3UUN A;  1D0Z A;  2V4H C;  3E4B A;  5FJY A;  3PUJ A;  4G11 A;  5AQV B;  2W2U A;  4PDX A;  4JYA T;  3JAE A;  1Z6T A;  4YSZ A;  3ZGQ A;  4I50 E;  4ZS2 A;  5J1G A;  2K48 A;  2JQ9 A;  1TR4 A;  3DPD A;  4L1B A;  2WU5 A;  5JJT A;  1MMD A;  4CN4 A;  3OAW A;  4KHP T;  4NIK A;  3L6A A;  2RKK A;  2JQH A;  1OWA A;  3NRY A;  2M63 A;  4AOF A;  4KUM B;  3CK6 A;  4OK0 A;  1Z5S C;  2NYJ A;  4HI9 A;  2C0L A;  1SA0 E;  2VQF T;  2VAS A;  2GRO B;  4HLE A;  5AQQ B;  1A17 A;  3T8K A;  2ZU6 B;  2PJQ A;  3UU6 A;  4AQG A;  3ZXS A;  2UXX B;  5CFB A;  4GZ5 A;  3B57 A;  5L4H A;  3AXJ B;  3RYI E;  3PE0 A;  2PFV A;  3GZ2 A;  1KNR A;  3N9M A;  4IDO A;  4AKI A;  1HE8 A;  3SOL A;  1UOH A;  5J2U E;  4H9R C;  4DRX E;  3CVP A;  5FXW A;  1N4Q A;  1HR0 T;  2J4D A;  5EDS A;  3E30 A;  4GZD A;  4U33 A;  5FL0 A;  1HXI A;  4FC8 A;  2PTF A;  2WAU A;  3L82 A;  2IY0 C;  3Q15 A;  4YTM A;  1EPU A;  3P8C D;  4LFC T;  3DPY A;  3TKL B;  3O1H A;  4UR9 A;  3AE5 A;  3I0Q A;  5HQ8 A;  4ZHB A;  3PZD A;  5AFU L;  3EU5 A;  4DX6 D;  3ZJ2 A;  2N9D A;  2XQ5 A;  2WCA A;  2J49 A;  4RLY A;  3ZC1 A;  1UJK A;  3WI3 A;  1T98 A;  2XEH A;  4AP2 A;  4PK5 A;  3GWH A;  3AE3 A;  3PJA J;  3ZEF B;  4ZEY A;  1X79 A;  2VSN A;  3D9K A;  3PE4 A;  1N4S A;  4YXD A;  1FT1 A;  1E8Y A;  4WAF A;  3RF1 A;  5KJK A;  3ZXP A;  4TV3 A;  4LF5 T;  3C3Q A;  4UWF A;  4P09 A;  2WB5 A;  4L7T A;  4ILI A;  3LDQ B;  4AJW A;  3L8R A;  3FZK B;  4CDR A;  4TV8 E;  5HKP A;  3IKO B;  1ZV4 X;  4MFR A;  3I0O A;  4XI9 A;  5EN5 D;  2OVF A;  3HKD E;  3E37 A;  3PZ2 A;  3W9G A;  3ZKJ A;  3AEE A;  3VRA A;  3UIP C;  2CHX A;  5EK2 A;  4C0M A;  2CEA A;  2BBH A;  1YW0 A;  4I6E A;  1QBQ A;  2L0I A;  4K0K T;  4IUL A;  4PS7 A;  4WWO A;  1UW4 B;  1A5E A;  3RIU C;  2XRZ A;  2IJG X;  3UM1 A;  4ANW A;  2VKD A;  1LVF A;  1BPO A;  1NI1 A;  2KBX A;  4UWK A;  3UU5 A;  5AN8 A;  4IST A;  1JPL A;  4ADZ A;  4KXK B;  1GQE A;  3N2G E;  3FHE A;  2A2F X;  3ZKR A;  1U4Q A;  2IIU A;  2H6H A;  4LCT A;  4BAY B;  5AQU B;  2WXH A;  5BMV E;  4GMJ A;  5DBK A;  2XS1 A;  4IT4 A;  2VGX B;  1N34 T;  4Y6W A;  2XM1 A;  1YYH A;  1UJJ A;  3D9I A;  3R9M A;  4J7W A;  5CCL A;  2WB2 A;  2HE0 A;  1D0X A;  5DQV A;  1XDP A;  4BFR A;  3L08 A;  3ZYM A;  2CHN A;  1E2A A;  2CBI A;  2MYS A;  2VQE T;  2I9C A;  5HEJ A;  2ETB A;  2VGY A;  3ZUV B;  2Y8D A;  4UVC B;  4U8H A;  5AAR A;  2XQ6 A;  1HU3 A;  4JEH A;  2W0G A;  4YDY A;  1WAO 1;  5ARF A;  1WY6 A;  1B7T A;  2WSS V;  3ANW B;  3OXL A;  3V31 A;  3RO3 A;  2LKG A;  4WNG A;  3FUM A;  5DQW A;  1O1S A;  4O2B E;  2XQ8 A;  3EIJ A;  5CRU A;  3OBV E;  4DMW A;  2CBJ A;  3HRA A;  3CQC B;  2LE8 A;  2XEV A;  3ZIM A;  3QWP A;  4TXQ A;  1XZY A;  2DNX A;  3ULE G;  4J8D A;  4JC8 A;  4U8Y D;  4IGU A; 
#chains in the Genus database with same CATH homology
 1OUV A;  3TXN A;  4WNK A;  4CDM A;  2IQC A;  3KV4 A;  3FY4 A;  1D1A A;  3T5X A;  2VKJ A;  4Z8X A;  2CG3 A;  4F1S A;  2A5U A;  3G2T A;  3LG7 A;  4YJ3 E;  5FZS A;  1UX4 A;  4PK4 A;  3RIB A;  3KVB A;  4CI2 B;  5KMG P;  4QXB B;  3ASD A;  5L2L A;  2ODV A;  2XPZ A;  2IC9 A;  3MCX A;  3EDU A;  3D9N A;  2XPI A;  3UTK A;  3GN5 B;  2W00 A;  4Y6C A;  2CXD A;  2Y3A A;  2D5U A;  5HXR A;  3DJB A;  5EK4 A;  2HYZ A;  1ZBP A;  2X9X A;  4LUN U;  3LK4 2;  4GYS A;  2KZT B;  5JJ6 A;  4JLE A;  4G63 A;  5JDL A;  5J08 A;  4FHK A;  3L54 A;  4I1A A;  1U3D A;  3ZMU B;  3C98 B;  1IJ5 A;  5HYA A;  2IU1 A;  2BZB A;  1UN9 A;  3SFZ A;  4WBN E;  4FLH A;  4XIF A;  3LYA A;  2IF4 A;  5FXX A;  3Q47 B;  2KZ7 B;  3FH8 A;  4TUU A;  4IN3 B;  3D0T A;  2LSV A;  2A72 A;  2X66 A;  4AY5 A;  2NW7 A;  1HH8 A;  4HOR A;  1MIY A;  1HCI A;  4H9P C;  4U63 A;  3MJX A;  5D0O D;  3IBP A;  3WAJ A;  1Y8M A;  4N39 A;  2WQH A;  3QWV A;  3ZMV B;  3LY7 A;  2UY1 B;  5BPP A;  3Q5W A;  4LEU A;  2NTX A;  4L5G A;  5LOZ A;  3FUD A;  2L9Q A;  3CHO A;  4C90 A;  4GPK A;  1E7U A;  3ZMS B;  3N2K E;  1US7 B;  5JDN A;  4V3I A;  4KBM B;  1Z3X A;  1FIO A;  3C64 A;  3HIZ A;  2CFZ A;  4I2W A;  3SNX A;  3T8O A;  4ZOL E;  2RP4 A;  3IBE A;  4JEU A;  5G04 C;  2GRM A;  3PUS A;  4J8S A;  3RKO A;  4IYP A;  1P5Q A;  2BF0 X;  1IZN B;  2WQ7 A;  2XAH B;  3HHM A;  1Y64 B;  4H9Q C;  3HDX A;  2LHN A;  3AA6 B;  4CXY A;  4GYR A;  4W9R A;  1HS6 A;  2KM4 A;  3RRU A;  4EPZ A;  3FU6 A;  3NZU A;  4QXC B;  4JPS A;  5EX3 A;  2E9X D;  3D9J A;  5FZQ A;  4U0Z A;  4ANU A;  4BT8 A;  3CST A;  3IHY A;  3VTY A;  4DND A;  2ES0 A;  2XRY A;  5AYW D;  3CVU A;  3AA7 B;  3ESL A;  1Y6I A;  5DJQ C;  3MJW A;  3PUA A;  1WR6 A;  4H63 V;  2X68 A;  5FT9 A;  3CV0 A;  2VK9 A;  4AQF A;  1O3X A;  4B8A A;  3CGH A;  4QXH B;  3CK7 A;  3N9Q A;  2J08 A;  5LG4 A;  1MIV A;  4GOU A;  4KVO A;  4IE5 A;  4HOU A;  2X51 A;  2MBG A;  3QNK A;  4YHJ A;  4G1T A;  4I6J A;  4IE7 A;  2C2L A;  2ODU A;  4XZC A;  1OWN A;  2XGM A;  5JRC A;  3E22 E;  1PAQ A;  3E08 A;  3IHV A;  4GA1 A;  1BR0 A;  3F2E A;  5BT1 A;  2JMH A;  5LHI B;  3CQG B;  4DLO A;  3R6N A;  5E0O A;  4EYU A;  5LXT E;  4LRZ A;  4GZ3 A;  2EHO A;  2RA1 A;  5LX8 A;  3FUL A;  4UXN B;  4A3T A;  3PH0 C;  2DIW A;  2WXO A;  3R9A B;  3TAX A;  1Z0P A;  5FY1 A;  3MV2 B;  4YFS A;  1D0Y A;  4I43 A;  4JXT A;  3I9Y A;  3FEY A;  4UQY A;  4YJ2 E;  4KBQ A;  1HZ4 A;  3TXM A;  3UUX A;  4NAC A;  2QGS A;  3U66 A;  2K5B B;  4NUV A;  1D1C A;  4H9S E;  4BY6 A;  5LGN B;  3LDZ A;  4HS2 A;  2I1J A;  3F57 A;  2L0T B;  4DBQ A;  2DCP A;  2MOW A;  4H7X A;  2XCB A;  3JUI A;  5LGU B;  5M4Y A;  4FLB A;  2R5S A;  3LK3 B;  5JDG A;  4EZL A;  1E1H B;  2KZT A;  2JPF A;  3FUH A;  2J9Q A;  2VL8 A;  4DBR A;  4RVB A;  1VRB A;  5LBQ B;  3I4R B;  4BTB A;  4RSY A;  4H9O C;  4HVB A;  2C0S A;  3IV0 A;  4O2A E;  4LER A;  1S35 A;  4JUY A;  2R17 C;  4MKT A;  3G2V A;  2HH7 A;  4UI9 C;  4ME2 A;  1SZA A;  2CXL A;  2KLQ A;  3SBS A;  3BQL A;  3FB2 A;  2YEV C;  4JEH B;  3FUE A;  4BT9 A;  4XI0 A;  4APO A;  4A1G A;  2HM8 A;  4ACK A;  2AVP A;  3ZPJ A;  4IRU A;  5JHA A;  4AXP A;  3CHM A;  3FTX A;  4DMV A;  5BW8 C;  4ERR A;  5L3B B;  3J7Y q;  4CGV A;  4TRQ A;  3HVE A;  3RH3 A;  3ZFW A;  2WPV A;  3CKD A;  3LY9 A;  1X5B A;  2BTD A;  3PUQ A;  2DHR A;  4ZI3 D;  2WXF A;  4EQF A;  3B7S A;  3ZCJ A;  1NA3 A;  2CWO A;  4F6R C;  4CXX A;  5HWY A;  4QKN A;  4WW0 A;  4EEC A;  1DVP A;  4CEM A;  3MA9 A;  2X9H A;  3G2W A;  3CK9 A;  2XTL A;  2CA5 A;  2FEZ A;  4FJY A;  2YK0 A;  5FY0 A;  3EHN A;  3QAR A;  4OHF A;  4BJM A;  4UEM A;  3FTS A;  1SZ9 A;  5FXV A;  2XGS A;  3R84 B;  4UI9 K;  5L3E B;  4GAA A;  4AKR B;  5JR9 A;  4CT4 A;  3ZMT B;  3FDH A;  3K8P C;  3HYM B;  3KEZ A;  1OWP A;  3SI5 A;  3DTO A;  1JUQ A;  3LS8 A;  2CCQ A;  3CK8 A;  3MA5 A;  3KVA A;  3OJA A;  4K0U A;  2RG8 A;  3JCK C;  2DWK A;  5LYJ E;  2KCV A;  4UQZ A;  3G2S A;  3MYV A;  4M1P A;  1OWO A;  3MKR A;  3QC9 A;  2KXP B;  5LBM A;  3EHM A;  3O1J A;  1E90 A;  2NXP A;  3HL6 A;  3RRW A;  2WXI A;  4UIG A;  2WXQ A;  3I5P A;  3KV6 A;  4QX7 B;  5G05 C;  2ZMA A;  3L16 A;  4HFV A;  2NC9 A;  2V4L A;  2DBA A;  3GZS A;  3CVN A;  2OV8 A;  4JW1 A;  4EZ4 A;  4MLK A;  3B13 A;  4I6G A;  2X38 A;  2VSY A;  3FUJ A;  3SGH A;  1KT1 A;  1IQU A;  1H2V C;  4I1M A;  3QOU A;  1GW6 A;  3CKC A;  3UT7 A;  3FHN A;  3ZYL A;  4ZI2 C;  3W15 B;  4JEU B;  1QNF A;  3AAE B;  2FI7 A;  5JHB A;  4GK0 E;  2WXP A;  2WXN A;  4CQI A;  4F3V A;  2X9Y A;  3HI2 A;  2K24 A;  4BA9 A;  2J1D G;  5L3G B;  3PDN A;  1BR1 A;  2KIN B;  2Z6E A;  1NZN A;  4GYY A;  1H19 A;  3Q5M A;  2AWI A;  1ZKE A;  3OXF A;  3UUL A;  2LSY A;  3ZLI A;  4AY6 A;  1EF1 C;  3KBT A;  4YLH A;  4KZ0 A;  5G04 J;  3N71 A;  4HOT A;  3L13 A;  2AXU A;  4G25 A;  4PK6 A;  3C4Z A;  3EIQ C;  4PFO A;  1FVF A;  3NF1 A;  1IAP A;  4U07 A;  3FTY A;  4OVV A;  3SRZ A;  2C5J A;  2Q9Q A;  2PBI A;  3D9L A;  1LF8 A;  4G26 A;  3SHF A;  4FJO A;  4AQF C;  4HKA A;  5FY7 A;  3TL5 A;  2I1K A;  1UG3 A;  1KLX A;  3CVV A;  4O8S A;  5JRC B;  3UT4 A;  3PTR B;  2WXL A;  4O4H E;  2FBN A;  4QFV A;  2AXV A;  4AEZ C;  5ETW A;  3CX6 B;  3U64 A;  4AKH A;  4J8F A;  2EHO B;  1TJF A;  1E8Z A;  1JWG A;  5M72 A;  4IIJ E;  2J4B A;  3ZJ1 A;  2EHO C;  3NBX X;  2LAH A;  5GON E;  1XNF A;  4I43 B;  5KDM C;  5BV1 A;  4GML A;  5LP6 E;  5KX5 E;  2OOE A;  3FXE B;  4DJA A;  3UUX B;  2VSO E;  2LEH A;  2YHE A;  2VSX E;  2WXK A;  4XKB A;  1PY1 A;  4J8E A;  3ZHE A;  5JVD E;  4GCN A;  2PL2 A;  1TJC A;  3O9X A;  4YVO A;  3GA8 A;  1QUU A;  2KND A;  2V7J A;  2X6K A;  1OWL A;  4H9N C;  2MOZ A;  2W61 A;  3BQK A;  1SHZ C;  4AV7 A;  1DNP A;  1WYC A;  3RPU A;  2H3R A;  4WUY A;  3MKD A;  5ARG A;  2LSG A;  5IYZ E;  1WYB A;  3QUJ A;  2WQ6 A;  4AXH A;  5G2N A;  4E85 A;  4OVU A;  5FZR A;  3QKY A;  5T8I A;  1EYH A;  2UWJ G;  4PAG A;  4N3A A;  5LJN A;  4EBA G;  3D9M A;  2CXF A;  2AXZ A;  2L9B A;  4OYJ A;  2Y4T A;  2FUL A;  1IYG A;  3N9P A;  4TX5 A;  2EQX A;  2E9X A;  4BWR A;  4E6H A;  4XBF B;  4X1Y E;  3EUH A;  3PNL B;  4MBQ A;  3LBX B;  2WVI A;  2L3L A;  4ILG A;  3HA4 A;  3L3P A;  3BG1 B;  4WNF A;  5LCY A;  3PRZ A;  3HVE B;  5KJN A;  4UI9 J;  4UWL A;  4GA2 A;  5HXC A;  1LKX A;  3O48 A;  4NQ0 A;  3ETU A;  5E75 A;  5LOV E;  5DIZ A;  3S2A A;  3TG5 A;  5J90 A;  4B89 A;  2GGF A;  4K0R A;  5F3J A;  4B6X A;  4F53 A;  5HAX A;  4PJM A;  3FUK A;  5ANR A;  4BX9 A;  3JQ1 A;  4GA0 A;  1U3C A;  3LVQ E;  3UFE A;  1FMV A;  3D3M A;  4N78 D;  5L3C B;  2PQR A;  4GYO A;  3QC1 A;  2E0I A;  2NP9 A;  5CA0 E;  1MMG A;  3VKH A;  3AU5 A;  1G8X A;  3FTZ A;  3PVL A;  4JHJ A;  3PUG A;  4PJL A;  3FTV A;  3U3I A;  1MHQ A;  5LHG B;  3TG4 A;  4OYS A;  4B8C B;  2V26 A;  1IQR A;  3IEE A;  2X3M A;  4FP7 A;  1YKH B;  4EZJ A;  4FI5 A;  2PZI A;  3OYZ A;  3EDT B;  3ZMZ B;  4P29 A;  5KJM A;  2XCC A;  5JR9 B;  3Q49 B;  3R7R A;  3H37 A;  3MKQ A;  5JR9 C;  4HN9 A;  1YKE B;  2PQN A;  3CSF A;  4NUR A;  3T5V A;  5JDH A;  4UF0 A;  3RC3 A;  2N1G A;  2KC7 A;  5T3R A;  2JLB A;  3MGB A;  3SD5 A;  4MLP A;  3S4U A;  5EKQ D;  3IF8 B;  2X6F A;  3C4W A;  5L3D B;  4R7L A;  4ILH B;  3RO2 A;  1QZ2 A;  4AIF A;  4EAH A;  2VKO A;  4MHC A;  2KWH A;  2LSU A;  1EDU A;  2E8I A;  3AS5 A;  2SPC A;  2YU2 A;  3WXX A;  3TJP A;  3PEU B;  4OFZ A;  3MK7 C;  1IJ6 A;  3QDN A;  3BK9 A;  2JJ9 A;  1HFA A;  5KCM A;  5ANL A;  3ESK A;  2J07 A;  4IE6 A;  5FXZ A;  3RX6 A;  3L09 A;  4C0E A;  2V7K A;  3CVQ A;  3FU3 A;  1HTJ F;  2ACX A;  4BJN A;  2ZM2 A;  3Q5X A;  5A6C A;  4KZC A;  2XQY A;  3GYZ A;  3MAC A;  1MIW A;  2MTQ A;  5G05 J;  2GRL A;  4I9C A;  3KV5 A;  3CVX A;  4L23 A;  4O4L E;  2HPL A;  4UEL A;  5HXH A;  1ELR A;  2P58 C;  2XAJ B;  2NSZ A;  2BUG A;  4GK5 E;  3QK0 A;  3RRM B;  4E7S A;  2NOX A;  4L2Y A;  5LHH B;  5FQ6 A;  3KDS E;  2YU1 A;  5FQ8 A;  3FU0 A;  3S7F A;  3MX3 A;  1HS7 A;  4ISS A;  3IEG A;  4JA9 A;  3P1U A;  4CT0 A;  2VTB A;  3B7U X;  1LVK A;  3SF4 A;  3CHQ A;  4XKC A;  3ZN3 A;  4HE8 A;  2PM6 A;  4P0A A;  3O4Z A;  2Q9Q B;  2X0L B;  4FA6 A;  5JRE A;  4ABN A;  4APF A;  4CI1 B;  2V7I A;  2C5I T;  4AM9 A;  2DCF A;  2Q9Q C;  4O4I E;  3EVY A;  3VLD A;  2X6J A;  2CG2 A;  1ZU2 A;  2KCL A;  3LKU A;  5LFA A;  2QA7 A;  3DP7 A;  3LBX A;  3ML9 A;  2LOP A;  3BEE A;  3QK6 A;  3FBZ A;  3SWH A;  1SQM A;  4TV9 E;  3JC6 C;  3ZYQ A;  2EHO D;  3C51 A;  1MMA A;  3V5S A;  3AA1 B;  4GCO A;  4GIW A;  1HO8 A;  2JEK A;  2JQQ A;  4C91 A;  3Q2M A;  4E7Z A;  2WMN A;  3U9W A;  3H3A A;  5H6Q B;  2M67 A;  5CB4 E;  4IE0 A;  2CM0 A;  2LM9 A;  1FMW A;  5J2T E;  4TUY E;  4X20 E;  3R7Q A;  3I1A A;  4IE4 A;  3IHR A;  2WM9 A;  4HEA A;  4PJJ A;  3AS4 A;  3ONL A;  4XE0 A;  4QX8 B;  3ZHE B;  3GW4 A;  4DLQ A;  3Q9D A;  3PUK A;  1TEZ A;  3ZN1 B;  4HOS A;  2CLY B;  3FEX A;  4DK5 A;  3S7B A;  5L3F B;  1FEW A;  3NZP A;  4I55 E;  4AKL A;  3ML8 A;  2V7L A;  1UX5 A;  2GK9 A;  2ZM8 A;  5LNK A;  2UXN B;  5C8Y E;  3NZS A;  2CLY C;  4EOZ B;  2Y4U A;  4O4J E;  3CHR A;  4WND A;  5EK3 A;  4P0B A;  1BR4 A;  2LSI A;  3CML A;  1HF8 A;  5G55 A;  2NW8 A;  3URZ A;  3EJN A;  4MRU A;  2JRK A;  2Y6X A;  4N5C A;  4I4T E;  2VYI A;  4EZK A;  3J9X 1;  4JHK A;  4D10 C;  3BQI A;  4GB9 A;  2Y48 B;  4KMC A;  4N2Q A;  4H7Y A;  2W63 A;  2WXM A;  2XAF B;  2KMF A;  1S0P A;  4YVQ C;  1VDY A;  1HG2 A;  4ACL A;  4F7A A;  3UT5 E;  1WRD A;  2E9X B;  4BTA A;  3V5U A;  4NRH B;  3ONK A;  3QWW A;  2E9X C;  4DI4 A;  2YQ8 A;  4ASK A;  2CHZ A;  5LCW C;  1JWF A;  4JL0 A;  2NWB A;  4L0R A;  1YD8 G;  2XHE A;  3HKC E;  3K3Q C;  4ZI7 E;  3KAE A;  3GMI A;  2V5F A;  3L22 A;  1OXZ A;  4Q96 A;  3FH5 A;  2KAT A;  2VWA A;  3FU5 A;  3AU4 A;  3CX7 B;  3UUM A;  2KT9 A;  2C0M A;  4RG9 A;  4QHO A;  3JYS A;  2IOS A;  2MHK A;  1Z3Y A;  2X6H A;  1E8X A;  3ZPO A;  2X6I A;  4YND A;  4FU3 A;  4WWN A;  3ULQ A;  3ZRH A;  4KT6 B;  4EIW A;  2I2O A;  1B89 A;  4J0U A;  2BVM A;  1IHG A;  3PUR A;  3CLJ A;  2ZLY A;  3E0Z A;  1E7V A;  3VLE A;  1KT0 A;  1UN8 A;  3RYF E;  5FNV E;  5LJM A;  3APC A;  4ZS3 A;  3I3N A;  1QQE A;  4U0U A;  2D0T A;  5JQG E;  3QJZ A;  2OA5 A;  5JDF A;  2LNI A;  2B1E A;  4QWN B;  3VKG A;  4WWP A;  3ZC0 A;  4CI3 B;  4JVS A;  4DI3 A;  2AW6 A;  4GU5 A;  3APF A;  4FAD A;  3AVS A;  3MKQ B;  3PS6 A;  2H7O A;  4ILU A;  4PFP A;  5LP0 A;  4UF0 B;  3D9P A;  2MRI A;  3T8M A;  3KBU A;  2IAK A;  4ANX A;  1KNZ A;  3QAQ A;  5KJL A;  3L17 A;  4AKG A;  2FO7 A;  3RKV A;  2LHR A;  3TGO A;  5FTP A;  5F8P A;  2A3D A;  2VQ2 A;  4RG6 A;  2CFU A;  2A4Z A;  5HWX A;  5T4Y A;  5C1D A;  2FF4 A;  3UPV A;  4CZZ B;  1NP7 A;  4XX5 A;  3RC8 A;  3S7J A;  2LOS A;  4EXT A;  1N52 A;  4JA7 A;  2IOL A;  2OND A;  4L2L A;  4MS6 A;  3PNT B;  3ENE A;  5IHY A;  5FYM A;  1VOM A;  4HOQ A;  3UQ3 A;  5JDM A;  3CVL A;  3ZCI A;  2DI4 A;  3FUN A;  3HKE E;  1QSD A;  5AJL A;  3VLF A;  5FP3 A;  1HX8 A;  3FH7 A;  3VHL A;  1HG5 A;  3KV9 A;  2HO1 A;  3CIA A;  2ZM0 A;  3LPZ A;  2LO6 A;  2KWI B;  4X1I E;  3N2O A;  2L6J A;  3FUI A;  3PRE A;  4UWH A;  1ELK A;  1MND A;  4CXW A;  4EYY R;  3NRX A;  4TN7 B;  4HTE A;  3KD7 A;  3A5X A;  4U74 A;  4PS8 A;  3PDY A;  4I17 A;  1UCU A;  4I2Z A;  3CQX C;  4CDN A;  4ZI3 C;  1S94 A;  4FJZ A;  4J6I A;  3NZQ A;  3MV3 B;  3CVY A;  2VTB B;  4N3B A;  1G73 A;  4J2C A;  3LCA A;  4EZH A;  4UV9 B;  3U4T A;  2LAI A;  2XQ0 A;  3SZ7 A;  4IHJ E;  3SBT B;  3ASG A;  4UVA B;  5LA6 E;  1N54 A;  2Q9Q D;  2WXG A;  1NA0 A;  1W3B A;  3AA0 B;  2K9A A;  2PG8 A;  4A3V A;  2V1D B;  3C50 A;  3FWV A;  3OTN A;  2I6H A;  2V7M A;  4HFG A;  2YHC A;  5FWQ A;  5BUZ A;  3S7D A;  3OXG A;  4DVD A;  2J09 A;  4MAL A;  5HI7 A;  1ELW A;  3JC6 D;  2GW1 A;  5CHE E;  3FP3 A;  4XAX B;  3OKQ A;  3HKB E;  4I9E A;  1U5P A;  2XGO A;  3PE3 A;  5AEN A;  4GZ6 A;  2C5K T;  1WM5 A;  1E8W A;  2VKH A;  3K3N A;  1KK7 A;  4ANJ A;  3I9W A;  3LFM A;  3P7I A;  3PEV B;  4A55 A;  4O6F A;  2WMO A;  2NW9 A;  3GZ1 A;  2XUE A;  3OYX A;  2E2E A;  4M3O A;  4TZ4 C;  3B7R L;  4NUU A;  1MNE A;  3ASH A;  3CX8 B;  3WAK A;  3C4X A;  3ZYK A;  2IFU A;  5AJD A;  1WLX A;  3MZK B;  1PC2 A;  3KFW X;  2V8S E;  3ZEF A;  5FMN A;  4JZY A;  3LK2 B;  2KCK A;  2CMR A;  2IC6 A;  4Q94 A;  4DO0 A;  2YIN A;  3ETV A;  3N9O A;  4PH4 B;  2XAS B;  3FBL A;  4WNE A;  3UT8 A;  1NAF A;  3RYC E;  3RK6 A;  1NWM X;  5ENN A;  2NTY A;  2ION A;  3LEW A;  3UX4 A;  5CMW A;  4G2A A;  3CEQ A;  4A56 A;  5ADX L;  4G24 A;  3RU0 A;  2RD0 A;  4ZHQ E;  3K3O A;  2VJ8 A;  3NQP A;  5TAO A;  3CVR A;  1CUN A;  3B7T A;  2DLR A;  5FQ4 A;  4BX8 A;  4PW8 A;  2Q7F A;  3FXD B;  4XZ4 A;  2CWY A;  1BR2 A;  3ONX A;  1FCH A;  3FUF A;  1MQS A;  2P9B A;  4AVX A;  4PJN A;  2PM7 A;  3VU7 H;  3O1I A;  2WBL A;  2XHE B;  1H2U A;  2LSJ A;  2VGX A;  1EZ3 A;  4HGA A;  2LSK A;  4PUC A;  5A7D B;  1AJ3 A;  4OYK A;  3N9L A;  5CA1 E;  4EBA A;  1ZHC A;  3QB2 A;  2R59 A;  2H7V C;  3PU3 A;  2QFC A;  3BG0 B;  3MXZ A;  4ZI2 D;  5LCW J;  2JMK A;  3ANW A;  4H63 H;  2CHW A;  4FHJ A;  5CMY A;  3AB3 B;  5C2Y A;  1MMN A;  1INZ A;  2D0U A;  3F31 A;  3LJ3 A;  3EDV A;  4L9I A;  2VB6 A;  4B94 A;  3K9I A;  2X9W A;  3M65 A;  2N2N A;  1L5J A;  1XGW A;  4KVM A;  2BDE A;  4C9B B;  3SS1 A;  3FFL A;  5BV0 A;  3HR0 A;  2W62 A;  3CWZ B;  3FTW A;  3U78 A;  4UVB B;  3AAA B;  1ZEE A;  4UWG A;  3LY8 A;  4IDZ A;  2WWU A;  5FQ7 A;  4CCA A;  2LJL A;  2D2S A;  3ZN0 B;  3D9O A;  3ZVV A;  2HR2 A;  4KMO A;  2G0U A;  1H2T C;  4AI6 A;  4N3C A;  4A1S A;  4DPR A;  3CPZ A;  4X1K E;  3CHP A;  3DBS A;  5EX0 A;  3LJC A;  3GN5 A;  5E76 A;  2HPJ A;  4CGW A;  1V9D A;  4HXI A;  4WBO A;  2LT3 A;  4JHR A;  3RRN B;  5JH7 E;  3RJV A;  4U0S A;  1H7C A;  3ASF A;  3G2U A;  5DAB A;  1LRZ A;  4KP3 C;  4KYO B;  3U3W A;  3MEK A;  1E96 B;  3PU8 A;  4N2S A;  3AVR A;  3RYH E;  3C98 A;  3N5L A;  4ANV A;  3KIN B;  5CCM A;  2QY7 A;  4UQX A;  5D0Q D;  4Q69 A;  5HXE A;  2WXR A;  3CVW A;  3UMV A;  2CE7 A;  5JJ7 A;  3AS8 A;  2OVB A;  3KS2 A;  4U72 A;  1FVH A;  5A1L A;  4ATG A;  5LGT B;  2BVL A;  3ZW3 A;  4CRW A;  2DWG A;  3P2B A;  3CKB A;  3JQ0 A;  4FUL A;  4K03 A;  2XAQ B;  5H6R B;  5EZY E;  1H0A A;  5AIJ A;  1D1B A;  4V1A v;  4I1O B;  2IW5 B;  4EB6 E;  3FTU A;  3LXU X;  4BSX A;  2UY1 A;  5BNW A;  3AAI A;  1OWM A;  3O4X E;  3MZL B;  3CHS A;  3CR3 A;  4GYW A;  3LVR E;  4B0Z A;  3N9N A;  4G2V A;  1H6K A;  2WXJ A;  3I4G A;  5A23 A;  4URK A;  2I59 A;  4PNI A;  3VTX A;  2XPY A;  2V0P A;  4U04 A;  3APD A;  2YNQ A;  5JDQ A;  4PS3 A;  2L8K A;  2ILR A;  3Q4A B;  2X67 A;  2XAG B;  4UV8 B;  5HXS A;  4GZC A;  1YA0 A;  4G23 A;  3RRC A;  3UUN A;  1D0Z A;  3E4B A;  5FJY A;  3PUJ A;  4G11 A;  4PDX A;  1Z6T A;  3ZGQ A;  4I50 E;  4ZS2 A;  5J1G A;  2K48 A;  3DPD A;  4L1B A;  5JJT A;  1MMD A;  3OAW A;  3L6A A;  1OWA A;  3NRY A;  2M63 A;  4AOF A;  4KUM B;  4OK0 A;  2C0L A;  1SA0 E;  2VAS A;  4HLE A;  1A17 A;  2ZU6 B;  2PJQ A;  4AQG A;  3ZXS A;  2UXX B;  4GZ5 A;  3B57 A;  3RYI E;  3PE0 A;  2PFV A;  3GZ2 A;  3N9M A;  4AKI A;  1HE8 A;  3SOL A;  5J2U E;  4H9R C;  3CVP A;  5FXW A;  5EDS A;  2J4D A;  4GZD A;  1HXI A;  4FC8 A;  2WAU A;  3Q15 A;  1EPU A;  3P8C D;  3TKL B;  3O1H A;  3I0Q A;  5HQ8 A;  3PZD A;  5AFU L;  3ZJ2 A;  2N9D A;  2J49 A;  3ZC1 A;  1UJK A;  3WI3 A;  1T98 A;  4AP2 A;  4PK5 A;  3GWH A;  3ZEF B;  1X79 A;  2VSN A;  3D9K A;  3PE4 A;  1E8Y A;  4WAF A;  5KJK A;  4TV3 A;  4UWF A;  4P09 A;  4L7T A;  4ILI A;  4AJW A;  4CDR A;  4TV8 E;  3IKO B;  1ZV4 X;  4MFR A;  3I0O A;  4XI9 A;  2OVF A;  3HKD E;  2CHX A;  5EK2 A;  4C0M A;  2CEA A;  1YW0 A;  4I6E A;  2L0I A;  4IUL A;  4PS7 A;  4WWO A;  1UW4 B;  2XRZ A;  2IJG X;  4ANW A;  2VKD A;  1LVF A;  1BPO A;  4UWK A;  4IST A;  1JPL A;  4ADZ A;  4KXK B;  3N2G E;  3FHE A;  2A2F X;  1U4Q A;  4LCT A;  4BAY B;  2WXH A;  5BMV E;  4GMJ A;  5DBK A;  2VGX B;  4Y6W A;  1UJJ A;  3D9I A;  2WB2 A;  5CCL A;  1D0X A;  5DQV A;  4BFR A;  3L08 A;  3ZYM A;  2MYS A;  2I9C A;  2VGY A;  2Y8D A;  4UVC B;  4U8H A;  1HU3 A;  4JEH A;  2W0G A;  1WAO 1;  5ARF A;  1WY6 A;  1B7T A;  2WSS V;  3ANW B;  3OXL A;  3RO3 A;  4WNG A;  3FUM A;  5DQW A;  4O2B E;  3EIJ A;  3OBV E;  4DMW A;  3CQC B;  2LE8 A;  2XEV A;  3ZIM A;  3QWP A;  2DNX A;  4J8D A;  4JC8 A;  4IGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...