3CQCB

Nucleoporin nup107/nup133 interaction complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
225
structure length
186
Chain Sequence
SHMLSWLHEINSQELEKAHATLLGLANMETRYFAKKKTLLGLSKLAALASDFSEDMLQEKIEEMAEQERFLLHQETLPEQLLAEKQLNLSAMPVLTAPQLIGLYICEENRRANEYDFKKALDLLEYIDININDLKLEILCKALQRDNWVSKDSIFVKILLPEVKDLLQADEFVLKANYEYYVQGQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords Nuclear pore complex protein Nup107
publication title Structural and functional studies of Nup107/Nup133 interaction and its implications for the architecture of the nuclear pore complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 186
sequence length 225
ec nomenclature
pdb deposition date 2008-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1380 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3cqcB01
1.25.40.700 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3cqcB02
3CQGB 3CQCB 3I4RB
chains in the Genus database with same CATH superfamily
2BVMA 3P50A 4ZOLE 3RRUA 4ZZCA 1ZKEA 5BW8C 2PM7A 1YXRA 3NVOA 2VYIA 5FY0A 4CN4A 3RIAA 2LM2A 4XZ4A 1K1BA 5E75A 4G8LA 3CMLA 2H7VC 2E5VA 1JUQA 5LNKA 4ADZA 1YYHA 5H6RB 5AFUL 1K3ZD 2J8SD 3VR9A 5CEDB 3B7RL 4FU3A 5A7DB 4UR9A 1VOMA 3RSEG 4GTRA 4EYYR 4UQXA 4EBAG 3VTYA 2Y1LE 1YKHB 4UELA 2RFMA 4CXWA 3FU5A 4ILBA 2W0GA 1KLXA 4IYPA 1DC2A 4JBWF 1KT0A 2QYJA 2VGEA 4I50E 3NZUA 4XKCA 4LF4T 4IHJE 1HR0T 4V3IA 5EIBE 3ONJA 4LF6T 3CVUA 5LCWC 4AISA 1MMNA 4DI3A 3RIFA 2FJEA 3PEUB 2OLTA 3JADA 5JR9A 1N4RA 1NENA 2XHEB 3KAEA 3KBTA 4JHRA 2LRKA 5FL0A 1UN8A 2CHWA 2CCQA 2A2FX 1M62A 2JQHA 1MJ0A 3FULA 4DV5T 3GZSA 3MA9A 2HPLA 2D2SA 4DX7D 3AA1B 4JZYA 3M3ZB 4KBQA 3TWUA 2OVFA 1OCRE 2IOLA 4U2ZA 3KSQA 5HEOA 5LOVE 3L3PA 2Q9QB 4RG9A 1LD7A 5EYLA 2Q9QC 4GYRA 4J6IA 1US7B 3UU6A 5LHHB 3FBZA 4TUYE 4WWOA 4DUIA 3GN5A 4IE4A 2ZLYA 4WNKA 5HKPA 5BMVE 3W9GA 1TN8A 4P1NA 2BBJA 4U7IA 3KFWX 2LSJA 5LBMA 4AQGA 2HHHT 3L9TA 4CQIA 2BS2A 1LTXA 4U72A 4UWFA 2BG9A 2XAFB 5FNVE 1TNOA 1Y8MA 1FEWA 3B5MA 3AE6A 4ZS3A 3L82A 3V2OA 3EVYA 4FJYA 3DXKG 2XQ8A 1O1RA 5FQ4A 3ZT7A 4EBAA 2HE0A 5BV1A 4DV4T 2XQ7A 4WAFA 2MBGA 5C3JA 3RX6A 3ZEFB 4I0UA 1BR2A 5CMYA 4DR5T 2EIJE 3GA8A 1SE7A 4DV2T 4H7YA 2H7OA 2WDRA 5EYPF 1S70B 5BT1A 3QDNA 4G63A 3LKUA 3SFZA 4AP2A 4I17A 3FBLA 3CIRA 4ANXA 3J9X1 2XPYA 1W09A 4J2CA 3U9WA 5AQSB 4GK0E 5AQBA 2L3LA 4OX9T 2W67A 4HFHA 4X1IE 5HEUA 5JDQA 5LG3A 2OEVA 3CK9A 3FHEA 3SD5A 4KMCA 2EHOD 4YXDA 2YKSA 2CMRA 5GONE 2WVIA 4F1PA 4MBGA 1NA0A 3IKOB 4X65T 3JQ0A 1OWOA 2JIWA 3PDNA 1KFYA 5CA0E 1Y64B 2I6HA 3HKBE 4KUMB 2LEHA 3C72A 2Y6XA 4H9QC 4EPZA 1HNXT 2P9BA 3N9NA 4CN6A 3TKLB 5FY7A 4FHKA 2ODVA 3TWRA 2NW7A 2PZIA 5EDSA 1KZOA 3GZ2A 3OXGA 5ABFA 1XZYA 4BETA 2UY1B 3P4PA 3N9QA 4CGVA 1J5WA 2RKKA 3AU4A 1UCUA 2K48A 3G2TA 4GYYA 2VVNA 2X9HA 2CXFA 2I2OA 3RRNB 2WS3A 3APCA 4UEMA 4DRXE 3RRWA 4JV5T 2DVWA 2I9CA 2DCPA 4LRZA 4DBQA 2F8XK 4PFPA 4UF0A 4J8EA 3RKOA 4CEMA 2V7LA 4B3TT 4GMLA 4DX1A 2FI7A 2DWGA 3L39A 4XE0A 2AXVA 3UUXB 1E8YA 1TEZA 3N9OA 3HYMB 2XCCA 4I43A 1E96B 2J62A 4ZI7E 4KP3C 1XMOT 4JEUB 2WAUA 5JMND 4U0SA 2VSOE 3AAIA 1IHGA 2YN6A 2WP9A 3AE7A 4TUMA 3PUGA 3RI5A 1Z0PA 4HWCA 3HRAA 3U3IA 4ZI2D 5BV0A 3CSFA 1WAO1 3LDZA 3R7QA 5LP0A 4QXCB 2OCCE 1KNRA 4JI6T 3IEGA 2VTBB 3N71A 3URZA 3KV4A 5EN5D 3G2UA 1V54E 3RH3A 1U2VG 5L4HA 3UU4A 2J47A 3UT4A 1YW0A 1MNDA 5HRYA 4LFCT 2OV9A 2VQ2A 3MJXA 3IA3A 1HE8A 4AM9A 3PJAA 2Y4TA 2H88A 4HVBA 2ZM8A 3F31A 2CG3A 3C50A 2DL1A 4RVBA 2X0LB 5JTGA 2NTYA 2FJBA 4HFBA 4Z8XA 1UG3A 5AJDA 2X6HA 3MV3B 1QNFA 3N9PA 2LSKA 3DSVA 4YFSA 3ZPOA 4WWNA 2X9WA 2V7KA 4FLHA 3ETUA 2EQXA 4X1KE 4HQDA 2Y69E 1N36T 3RGLA 4UWKA 4LCTA 1MMAA 2X51A 5HEGA 4CI2B 3Q2MA 2D0TA 2IJGX 2AJAA 3UKRG 4ZZBA 3QJZA 3QNUA 5KNGA 1N0QA 1DNPA 4ZXLA 3LY8A 4CT0A 4WWPA 4N3AA 4TN7B 4P29A 2LUHA 5KCMA 4OYKA 3MEKA 3T5XA 3I4RB 2Y4UA 5AQLB 4QXBB 3CK8A 1HXIA 3JYSA 3TXNA 3JAEA 4DK5A 3P2BA 3UT7A 3UU3A 5BXOA 4XZCA 2CA5A 5LB7B 4ZEYA 3IHRA 1MIVA 1KF6A 4O6FA 2EILE 4BTAA 2XZEA 2MYOA 4PS8A 3FWVA 2WZHA 4OHFA 4QX7B 1P5QA 3S2AA 2YQ8A 4HFGA 4E7SA 5CMWA 3WAJA 5AQVB 2UXCT 2XZTG 2B6CA 4HXIA 3Q47B 2PQNA 3ETVA 3ASFA 2ZXWE 2HPJA 3OJAA 4HWHA 1HCIA 4PJJA 1W9RA 3CQXC 5LBQB 4OYJA 4AKGA 4HRMB 3HL6A 4HKAA 5CHEE 3UU8A 4RG6A 4ATGA 1B89A 3FUKA 4YTPA 3RIUC 5L3GB 2J9QA 1K1AA 4HFVA 1S63A 4KZCA 4UWLA 4AVXA 5FZQA 2WDVA 2Q9QD 2FJAA 4K5BA 4MALA 3JAFA 4DR2T 3FXEB 1ZEEA 4A3TA 2XSAA 1O3XA 4DR7T 2WQYA 2BVLA 5FXVA 5F5WA 3ONLC 2HO1A 5BNWA 3O1IA 1ZOYA 1HO8A 3CHOA 4L23A 3DEOA 2E8IA 5ENTD 2I1KA 3FY4A 4U8YD 1D0YA 5AQAA 3PUXF 4IE6A 2I0MA 4IL9A 3D9LA 5CRVA 2WXHA 4K0KT 1MYOA 1X79A 2QFCA 4GA0A 3VKHA 4JA7A 2WM9A 5AQGB 4GA1A 4JPSA 3ZN3A 3QUJA 4JI1T 3RO3A 4PS3A 4QFVA 2J1DG 4EB6E 2BUGA 4G8KA 4B3RT 2HYZA 2ETCA 4F8HA 4BWRA 2NWBA 2LXLA 1H2TC 2R5SA 2QC9A 1N4QA 5ARFA 1CHUA 1NA3A 4EIWA 1D1BA 5EX3A 2NOXA 3B95A 3CK7A 5DJQC 1HZ4A 2CXDA 2XQ6A 4N3BA 2ES0A 4H9OC 3C4WA 1TR4A 3SQVA 1IZNB 5AQRB 2DI4A 4MFRA 3LJNA 3OVUA 4JUYA 1IKND 3FEXA 2YINA 3PE3A 2WQHA 3QWPA 3R84B 2XGSA 4U07A 1YQ3A 1IXVA 1QZ2A 4DUYT 3QB5K 4F6RD 3ANWB 4U33A 2AXUA 3K1SA 3ABKE 3J5QB 5EK4A 1QUUA 3LDQB 2AXZA 3Q9UC 4JLEA 2X9YA 1W3BA 2X38A 4ZI3C 3ZJ2A 5T8IA 3TWSA 1TNYA 5D66A 1Z6TA 3ZJ1A 1O1SA 1SUMB 1T8BA 2QY7A 3NF1A 1OWNA 3U64A 1KZPA 1YKEB 2ZISA 4HWIB 3ZKJA 5JHAA 3TG5A 2ZMAA 3EI0A 3C64A 4ANUA 3GMIA 1D1AA 3B13A 1S94A 3P4QA 4LF5T 2WMNA 3PUQA 4UQYA 2YDSA 1QYMA 2BKGA 3OXLA 2QYWA 2V7MA 4L2LA 3ULQA 2IW5B 1BR1A 4DPRA 2EHOA 2XM2A 4UV9B 5DIZA 1KNPA 1SW6A 1JCRA 3QKYA 4MBQA 2NW9A 2F8YA 5HEHA 3VHLA 1HFAA 5H7PA 1WDYA 2C5KT 3ABVA 4BT9A 2YNQA 4DX6D 2XEEA 3QC1A 2P58C 3LPZA 3UX4A 4DMWA 3BG0B 1Z8UA 3UUNA 4XKBA 3TG4A 2WXIA 3FUNA 3T8KA 3CVNA 5HS0A 3DTOA 3O1JA 3B7UX 4AIFA 1Y01A 3JCFA 1SA0E 3ASHA 3ZKRA 3FXDB 3APDA 2IONA 1SZAA 3RK6A 2QYUA 4G11A 3EDVA 2H6IA 3LBXB 4KZ0A 4P09A 1IAPA 3S7DA 5JHBA 2YHCA 3PV0F 4KBMB 4GTMA 2VB6A 2DHRA 1UOHA 2YHEA 2UXNB 3P4RA 3ZXPA 3ULYA 4DR6T 3APFA 4Y6CA 4ZFHA 2WY2A 4HNAD 4IE0A 4EAHA 3IXEA 1UX4A 2GW1A 4ATZD 2UXDT 2XQAA 2UXBT 2CWOA 4B6XA 4X1YE 3BQIA 4WYVA 3TLWA 3ULEG 4NIKA 5EK2A 1HF8A 3AS4A 3SFEA 4LMJA 3BQKA 2XUEA 3PUVF 1IBMT 2GRMA 1TNZA 1HNWT 1WCRA 3NQPA 3ZW3A 3ZC1A 3IBEA 4GTSA 3Q5XA 4KMOA 5J2UE 3HIZA 4NQ0A 3FUIA 3UPVA 5LP6E 3ENEA 3S7FA 3HVEB 3CGHA 4NRHB 1LVKA 3R7RA 3E08A 3HKEE 1J5ET 4JXTA 2WWUA 2N1GA 4FADA 3UTMA 3QB5A 5LFAA 4X66T 3NB2A 2YEVC 2W2UA 3B7SA 4IDZA 3FH5A 2BKNA 3E33A 3ZUVB 5FXWA 2H6FA 5L47A 4ZS2A 2KINB 3JC6C 2XZDG 3AE3A 3MACA 4N78D 4HS2A 3CVYA 1IBLT 5J2TE 2K9AA 4NPPA 2WB2A 2LSUA 3AXJA 3PDYA 4L1BA 3D9KA 1VRBA 2E9XB 3UTKA 4AQFA 2IO3C 4A1GA 3VLFA 3AVSA 2E9XC 4LSZE 4EGWA 2VGXB 1SA5A 2ZGDA 3ZXSA 2QRXA 2HN2A 2FBNA 4EYUA 1N11A 5J08A 3TWQA 1WG0A 4J8YA 3FB2A 5LCWJ 1HS6A 2CE7A 1KT1A 4XAXB 2DNXA 2WXFA 3QC9A 3UULA 3EIJA 2ILRA 2IFUA 2ACZA 3N5LA 3ZSTA 4B94A 3G2SA 2ETAA 3LFMA 4WNFA 4HEAA 2PG8A 3ZRHA 3U66A 4OK0A 5ABHA 3UI2A 4OAUC 2MYSA 1TN7A 1XNRT 4CDNA 3ZMVB 4UWHA 4EECA 4DNDA 2L0IA 4C0EA 1BI8B 1H6KA 3AEEA 4MKTA 2JMKA 3P1UA 4B8AA 1KEYA 1EYHA 2KZTB 2D0UA 2FBWA 2XCBA 3V5SA 3ABME 1G3NB 3G2WA 3EABA 5E0OA 3T8OA 2QGSA 3L6AA 2ODUA 5HXHA 5ABEA 2XHEA 1FVFA 3ASDA 2KXPB 3GWHA 3ZYMA 1BI7B 3DSTA 4U0UA 2KXPC 5EIDA 4YDOA 4C90A 3SBTB 3T9KA 3VLEA 4G2VA 4GTOA 4NURA 5FZRA 5EK3A 4HOSA 4A63B 1UW4B 4EV6A 3U4TA 3LJCA 5JR9C 4G25A 1MHQA 1FJGT 3I9WA 4FJZA 5KWDA 4FJOA 2YK0A 2DZNA 5L2LA 3CHPA 1HX8A 2XY8B 3EU9A 1AWCB 2Q9QA 3HHMA 3PUYF 3ZSSA 3X2QE 4PAGA 2F0YA 4B0ZA 4XI9A 2A72A 5FMNA 3LY7A 2XPKA 2K5BB 1UURA 5AJLA 5KJNA 2ZU6B 3D9JA 4O1OA 2GRQB 4HWFA 1I6ZA 3MZLB 4X20E 4GB9A 1AP7A 2V8SV 4EEBA 3AE1A 5FTPA 2J09A 3JUIA 2OV8A 2KSRA 1JWFA 2EIKE 3K3NA 2ACXA 4H9NC 3ZMUB 3PZ2A 3SF4A 3OTNA 4AQYT 4PK4A 5DABA 1XNFA 3VU7H 1GW6A 3AEFA 3LEWA 4GTVA 4I6JA 5AQMB 5AIJA 3HA4A 4HE8A 5HXSA 1OEDE 5ENNA 4A97A 3HXDA 5LX8A 5LGUB 3MKQB 4IDQA 4JD2G 3ZEFA 4X8QA 3S7JA 1OXZA 5JDFA 4N5CA 3D9OA 2P9LG 2K24A 3I1AA 2UXXB 3IHVA 3WG7E 4PDXA 3FTZA 4BESA 2BTDA 2DBAA 3AJIA 1JNRA 4BSXA 2JQKA 2RFAA 4K0UA 2ZM0A 4IDNA 4WNEA 3N2KE 4ZHQE 1E8XA 4UVAB 1JWGA 2M67A 1SHZC 4MLKA 5JVDE 2GRPB 2LT3A 4A55A 3MXZA 2Y0BG 1EDUA 2ONDA 4I1OB 1OWPA 3RJVA 4AKLA 5CCLA 2J4DA 3DP7A 1YCSB 5JDLA 3L08A 4B89A 3V79K 5EZYE 5ENQD 3LSVA 3RYHE 1ZU2A 3TAXA 2B0OE 2LRLA 5KMGP 2DCFA 3RYIE 2IO2C 4CT4A 2OVBA 4WZXA 3AE5A 4L9IA 4HFCA 2XAHB 5KJKA 3HXFA 1X81A 2ZM6T 1ZB1A 2C0MA 5FY1A 3QK0A 3AECA 5E76A 2UY1A 4GMRA 4B3ST 2GROB 2P9NG 2PNNA 3R9AB 4J0UA 2LHRA 5C2TA 2MOWA 4YSZA 5LJNA 2PTFA 5LYJE 2E2EA 3DSUA 4ISTA 4PJLA 4Z91A 2NXPA 3CHSA 4QH4A 2UWJG 4HI9A 1KNZA 4CRWA 3PUKA 1BPOA 4XEIG 3CHMA 4PS7A 3RYFE 1MX4A 4CCAA 4GTTA 4BTBA 3L54A 5J90A 3NZPA 4O4LE 4JHJA 3ZHEB 3UUXA 2KT9A 2V6YB 1IQRA 1E1HB 4DV6T 2VKJA 2R2LA 1UGOA 4JEHB 2BZBA 4M3OA 5HXEA 4U8HA 2J07A 3ASOE 2M6BA 5LOZA 4E6HA 1OWAA 3CLJA 2DYRE 1HH8A 3PE4A 4JEUA 4KVMA 2WB5A 2F4VT 4NACA 5FVLA 3X1DA 1D9SA 1D0ZA 4Z90A 2C5JA 3N2OA 5A1LA 1DCEA 4U7YA 2PL2A 4N2SA 4NIQA 5AQKB 5JQGE 2E5LT 3T1HT 3PRZA 2VTBA 2VKHA 4JI0T 1ELKA 1KK7A 4H63H 3UM0A 2V4HC 4AXHA 3QWVA 2B76A 2WWVA 3RYCE 1ZP0A 5HCMA 4G26A 2J49A 2RA1A 4BJNA 1WFDA 3B57A 3FUDA 4FHJA 3KBUA 4EQFA 4YVQC 1S35A 3KV6A 4HOQA 2KWHA 4PJMA 3SNXA 5FJYA 2XTLA 3ML9A 2WXKA 3IV0A 1Z3XA 4UI9K 1YD8G 5ADXL 3FUMA 2C2LA 3AE2A 3FZKB 4LFBT 4JC8A 3V31A 4GPKA 3RF1A 2JLBA 3CVLA 3FTSA 3CV0A 2GRRB 3VLDA 4Y6WA 3T1YT 1OY3D 2WMOA 1O1TA 5HYAA 2N9DA 3ASGA 1J1JA 2SPCA 2R02A 4PFOA 3PZDA 1NP7A 1WR0A 1HS7A 4AKHA 3ZT6A 3OTOT 1EF1C 4WBNE 3PURA 3AE8A 3I5PA 3P7IA 2CG2A 4AOFA 3RC3A 3C98B 3MV2B 5AARA 3F57A 4GZCA 2L8KA 2V7JA 2A5UA 2V7IA 2CHZA 3EHMA 3FTUA 4YDEA 3HXCA 5A6CA 2WU2A 4GPMA 4U74A 3RRCA 3Q15A 3KV9A 3H37A 4O60A 5EX0A 4AEZC 4XBFB 1L5JA 3RU0A 5CERB 4UXNB 4E7ZA 4JYAT 3Q7FA 4BT8A 4FA6A 3O4ZA 4UQZA 4XIFA 4WNDA 4GZ6A 2ETBA 4H9PC 1HX1B 3PNTB 3S7BA 2X67A 2X66A 3ONXA 4U31A 4DLOA 5H6QB 2VKDA 4FP7A 4I4TE 3KEAA 3K8PC 1MQSA 5FIOA 5ENSD 4DV1T 3NOGD 3PS6A 2AE9A 4LFAT 1IJ5A 3P4WA 3N2GE 3ISMC 1TN6A 3AA7B 4AXPA 5HAXA 2CHXA 4DIDB 4U8VD 3RIUA 3RKVA 2UUCT 4AV7A 2MHKA 3RPUA 1WR6A 3NOCD 1OCZE 2L0TB 4GCOA 4H9RC 2VL8A 4LF9T 2FO7A 2QZAA 3KDSE 4X62T 3TJPA 3NBNB 2IQCA 3A5XA 4YHHT 3E0ZA 2WXRA 2NR4A 3BQLA 4HFDA 4GKJT 3O1HA 4G1TA 1JCQA 4DBRA 3FUJA 2X9XA 3QAQA 3QB2A 1EZ3A 4GCNA 3KINB 1YMPA 5AQUB 3WI3A 3ZYQA 4TV9E 5LA6E 5FVKA 3UIOC 3OKQA 5BR8T 3CVQA 3NZQA 3VR8A 3L13A 4CDRA 1OUVA 3ZNGA 1QLBA 4EZKA 4MLPA 3ZVVA 2PJQA 3AG1E 5ENPD 4I6EA 3PTRB 4NUVA 3AEBA 4GTQA 1H6PA 3DPDA 1MZCA 2R59A 2XAJB 5CECB 2JEKA 4ILHB 4QWNB 4EZHA 1BLXB 4O4HE 1UJJA 3PU8A 1Q2ZA 2CXLA 2WXJA 1PY1A 3FUHA 3MCXA 3SWHA 4JB8P 1OEDB 3Q9DA 4DX5D 1OEDC 4PJNA 4HN9A 4F7AA 4GYOA 4LEUA 5LXTE 1FT1A 3OYXA 3CKBA 3SOLA 3O4XE 1XNQT 3L09A 4JA9A 1D1CA 2CFUA 4QX8B 5DQVA 3AG2E 2BG9E 3EUVA 4DX2A 5J1GA 2LAIA 4MRUA 1QSDA 3AAAB 3AU5A 2WSSV 3FZFB 1TNUA 2V4LA 4I1AA 3AAAC 2N2NA 1FPPA 5C8YE 4DV0T 3LVRE 3SBSA 4GU5A 3ANWA 1A17A 1FMVA 4AI6A 2XENA 1V55E 4HFEA 2YU1A 4LMKA 2JABA 4K0RA 5HWXA 4O8SA 2P2CP 2HM8A 1TJFA 1MX6A 4DO0A 2MOZA 4HFIA 4HB5A 2RP4A 2GGFA 3QWWA 5KX5E 3MA5A 1WYCA 2YOEA 5EILA 3HDXA 4BX9A 5ETWA 2KWIB 3LJ3A 3QNKA 5LCYA 4GA2A 2H3RA 3RC8A 1FVHA 1OXJA 4KXKB 4PH4B 4HLEA 3FUFA 5FXZA 2CLYB 2IOSA 4C9BB 3ONKA 2IF4A 2CLYC 2FF4A 3UIPC 4DR1T 4PNIA 3FU6A 2K3WA 4YDYA 2DWZA 5AN8A 4LNBA 3BUAA 4NUUA 1UUSA 3DJBA 5KDMC 3CEQA 4GTPA 2V1DB 1PAQA 3RQUA 2EHOC 3V5UA 4R7LA 3ZIMA 2X0HA 1NAFA 4BAYB 5L4EA 3I0OA 2VGYA 1IQUA 2CRBA 2C0LA 5A23A 2WCAA 5JRCB 2JQQA 2V5QC 3BK9A 2IIUA 3CX8B 3T8MA 3KSLA 2C5IT 2B1EA 3Q78A 3CVPA 3CKDA 5JDNA 3JXIA 4L5GA 3UT8A 2WU5A 3CVXA 4I2WA 1BD8A 4WUYA 2IC6A 2XQ9A 1H2VC 2MAWA 1NFIE 1XDOA 2V26A 1Z3YA 5L3EB 3CQCB 2V5CA 3ZC0A 2P9IG 3GYZA 1ELWA 3LBXA 3PVLA 3LK3B 3LCAA 4RQIA 3RIBA 4XX5A 3UINC 2R05A 3HKCE 3DSWA 4HGAA 5AAOA 4A56A 4BFRA 4M7CA 4Z68A 4DV3T 3D9NA 4IL4A 2JPFA 4J8SA 3ZMTB 5HEJA 4TNVA 3QOUA 4I9EA 3J7Yq 2LJLA 4NXMT 4ERRA 4PK5A 1QBQA 1N4SA 1XDPA 3SO8A 2DWKA 5AQPB 4BERA 3Q7AA 1LKXA 2DYSE 2M63A 2Y3AA 3WAKA 3CWZB 4ME2A 4FULA 3R6NA 2R03A 2LLYA 3ZFWA 5L3BB 5LJMA 2VSYA 5HXCA 4HOUA 5G05J 3ML8A 3T5VA 5HXRA 4ZI2C 4KX6A 3HVEA 2WZIA 4CI3B 5LHGB 2WXNA 3SI5A 4N2QA 3CVWA 3EHRA 3BEEA 5CCMA 2ZIRA 2W61A 2C0SA 3MJWA 3NRXA 1FIOA 4QH5A 3UXGA 3Q4AB 4I9CA 2LKHA 2AVPA 2YU2A 5CBOA 3CR3A 4DR3T 3Q73A 2DLRA 2KLQA 2AW6A 5G05C 2FO1E 3K3OA 3CHQA 3PUZF 3TLVA 5B3SE 1OWMA 1SQMA 4G2AA 2NTXA 4TNWA 2LSYA 2A5EA 2E9XA 3G2VA 3P4SA 2KMFA 5KJLA 1U5PA 5AENA 5F3JA 2R6GF 4V1Av 1A5EA 5D0QD 2V0PA 3TWTA 3E30A 1U3DA 2IEJA 3EHQA 4TWDA 2XASB 4AQFC 5LGNB 1OT8A 3DEPA 4MHCA 2CPTA 3ZLIA 4AY5A 3EAMA 4TWFA 2XQYA 5FQ6A 4ACKA 4L0RA 2BF0X 2NSZA 5J0ZA 3JCKC 3VKGA 3ZN1B 1H19A 4A5XA 2A4ZA 4A3VA 3PUWF 5AQ9A 4Q69A 2X68A 2IDOB 3FTYA 2CFZA 3WXXA 1YA0A 2KBXA 3RKGA 5AQOB 5FL1A 3GZ1A 4K03A 3AVRA 4EEDA 4YVOA 1WYBA 2CHOA 2QA7A 2WXQA 3FP3A 4DUZT 2LAHA 3K9IA 2XQ5A 4IE7A 2HR2A 3ZMZB 3DPYA 2KZTA 4JW1A 3HR0A 3LK2B 5IHYA 4YLHA 2LSGA 3OPCA 4BJMA 1MMGA 4JI2T 3ESLA 5JR9B 3J5PA 2P9SG 2MRIA 3AG3E 4TUUA 3VRAA 3TWVA 3L16A 5BUZA 4K5CA 2BDEA 2RG8A 2VQFT 4H9SE 4C91A 3I0QA 1JNZA 3AB3B 1W0AA 4BSZB 3L22A 3KEZA 4IT4A 1ELRA 2FUPA 1K8KG 4ISSA 5FINA 2XRYA 2XSBA 3FZLB 3EJNA 3D9HA 2W62A 3AE9A 3KVBA 3DSSA 5KNHD 3W15B 1HTJF 4I6GA 1V9DA 1LVFA 2BKOA 2VL0A 1E90A 4U2YA 3QK6A 4JI8T 4PK6A 5AQNB 4HRNA 5B1AE 1N32T 2XS8A 3GN5B 3CIAA 2CEAA 5ITZF 1H6OA 5LGTB 4LNGA 2VWAA 5IY5E 1UN9A 1INZA 4HORA 3NBXX 4PUCA 1AJ3A 4U63A 1E2AA 2UUAT 4X5TA 2KCLA 1N9AA 5TAOA 4X64T 5FYMA 4ZI3D 2J4GA 1WM5A 2BBHA 2KC7A 3Q9NC 3D9PA 3H3MA 4ANJA 3UQ4A 4DR4T 2BG9B 2PM6A 3DXMG 5CEAA 2BG9C 3EDUA 5FQ7A 3LG7A 3PUAA 4GK5E 2AWIA 3MKQA 3SS1A 3EDTB 4AY6A 3E22E 3UT5E 4DMVA 2GK9A 1IHBA 5LMUT 4FC8A 4LG6A 4D10C 3FUEA 5HI7A 3SGHA 2P9KG 4OVVA 4YTMA 2WBLA 2LOPA 2NP9A 3F2EA 1NWMX 3ABLE 5C1DA 3FTVA 2VK9A 2PFVA 2L9BA 2H6HA 3E32A 2XGOA 4JHKA 3UUMA 3L17A 4DLQA 4U7EB 1DU2A 2XQ0A 4L7TA 5EKQD 4UVCB 3CHRA 4HI8A 3RAUA 4IE5A 3AEGA 4ILIA 4C48B 5FKYA 2KATA 3ZU7B 4CGWA 1N0RA 5KJMA 3C3OA 2G0UA 5JDGA 4ABNA 4AKRB 3TLUA 4P0AA 3TLTA 1WY6A 2WQ6A 2VURA 2CM0A 3UKUG 1T72A 1NL4A 3K3QC 4H7XA 4F53A 3S4UA 4MS6A 1KPSB 4KVOA 3BG1B 4AKIA 3PEVB 4LF7T 5ABFB 3ZCJA 4F6RC 1Z5SC 4JI7T 2J4BA 3EU5A 1U3CA 5CBNA 2I59A 2RPAA 2MTQA 3HXEA 5G55A 2X6IA 2LE8A 3M65A 2IUBA 5FZSA 4IDOA 4BA9A 4COFA 3DSXA 3FH8A 5AQHB 4UF0B 5LMNT 2XGMA 5IUXA 1RZ4A 3ZHEA 5DQWA 3BQOA 4ZHBA 2XAGB 1N34T 2V6YA 3D0TA 4JEHA 2GRNB 4F1SA 3PREA 4I43B 1MNEA 1H0AA 2VASA 5FT9A 3Q79A 1VDYA 4IULA 3DWLG 2YDRA 4UV8B 3PJAJ 4KI0F 5BXUA 5FXXA 2VKOA 3NZSA 4P0BA 5AQJB 1S64A 3Q5MA 5HCJA 3MX3A 2PBIA 3TWXA 5T3RA 5LG4A 2XAQB 4JI4T 1PC2A 2ZGGA 4H63V 2YDQA 2JRKA 4G24A 4IREA 3CX7B 4Q96A 4TWHA 4A98A 5L3DB 4U04A 4TXQA 4UWGA 5HWYA 3L8RA 3NAWA 4N3CA 5AQFB 3JC6D 1U4QA 2Q7FA 4YNDA 4HBDA 4CZ2D 3SFXA 1TJCA 3UUBA 1UX5A 1E7UA 3G06A 2EIME 2JMHA 2X0YA 2XRZA 2LNIA 2E9XD 2W00A 2OOEA 3E34A 3LK42 4LMLA 4WW0A 2FULA 5ENOD 4ANVA 4IIJE 1E8ZA 3D9MA 3MKDA 5HQ8A 3C5RA 1T7SA 2OA5A 4EHMA 2LSVA 3SFDA 3I3NA 3JQ1A 4J8FA 5JJ6A 4UUCA 3MYVA 3H3AA 3OYZA 3UMVA 3FFLA 2HH7A 2LHNA 4TZ4C 1SZ9A 4CN1A 5AQ7A 4BEPA 2A9UA 3N9MA 4O4JE 5M72A 1X9BA 1IBKT 4GMJA 3LYAA 5D2MC 3HXBA 4GAAA 5KXJA 5CGMA 1D8EA 3C98A 4ILGA 4YDWA 3AAEB 4FI5A 4JI5T 4ILUA 3UQ7A 2WQ7A 4K5AB 1XGWA 2V5DA 4I1MA 3C3RA 3RLFF 3SFYA 5JDHA 4Q94A 3EUHA 4YSYA 3TXMA 3I4GA 3TLSA 4CI1B 2IAKA 3IEEA 1WLXA 3A8YC 5C2YA 3ZYKA 4UVBB 3IHYA 2LKGA 3LS8A 3Q75A 3CVVA 1W0BA 1FT2A 1UK5A 3QOFA 2L9QA 2BKPA 5CFBA 2CWYA 2UU9T 3KD7A 4BY6A 2Y48B 3TL5A 3RRMB 3UM2A 2KZ7B 3CQGB 3NKZA 3NRYA 4YJ3E 1T98A 4KHPT 2A3DA 2CHNA 2VSNA 3EIQC 2VVSA 2LSIA 3C4XA 4B93B 3V2XA 4GZ5A 1LRZA 4EXTA 3ESKA 2UUBT 3HG0D 3HI2A 4FLBA 3PE0A 2LO6A 5JJTA 4O1PA 4URKA 1Y6IA 4YHJA 2M6IA 2DIWA 3TWWA 1QQEA 4OYSA 2L6JA 2IMLA 4RSYA 4GYWA 5B1BE 4WBOA 3RQWA 2D9DA 3AE4A 1BU9A 5JA4D 4IGUA 3UM1A 3ZN0B 3Q5WA 3IF8B 4TRQA 3ONLA 1BR4A 4JL0A 2E2AA 1SA4A 2OEWA 2IHR1 1O5MA 3O9XA 3VTXA 3B7TA 3P8CD 3SRZA 3VRBA 3AG4E 5JH7E 1HG5A 1UJKA 3AEDA 2KM4A 2Z6EA 1BR0A 3ASNE 3E4BA 2NW8A 1N95A 5T4YA 3JUEA 4QHOA 1MMDA 4UIGA 4QXHB 2XEHA 3C51A 3UM3A 1S0PA 2IY0C 3R9MA 4JVSA 4AIUA 2D5UA 4OVUA 2LOSA 4E85A 1VCTA 2XQ4A 2WXGA 4YTNA 2WXMA 2AXDS 4DV7T 2W4XA 4TV8E 3OXFA 4UI9J 1EPUA 1N4PA 1N33T 3RO2A 2VSXE 2CBIA 1RW2A 5G04J 1FMWA 2X3MA 2NC9A 3FHNA 5KBAA 5JJ7A 3AA6B 1IYGA 4I55E 4GIWA 1XMQT 3DRAA 4B8CB 1HNZT 5LHIB 4CYMD 3HKDE 3ZGQA 1OEDA 2KCKA 4GZ3A 2CBJA 4GYSA 3CX6B 4J8DA 4KHZF 3PU3A 5FWQA 3PH0C 5ARGA 5L3CB 4UI9C 1WRDA 3OBVE 4LUNU 4N39A 3QARA 4M1PA 1OWLA 4GOUA 4PW8A 3JXJA 4CDMA 1YQ4A 3AA0B 3CSTA 1N94A 5G04C 4EOZB 4BX8A 5AQQB 2VQET 5M4YA 2KCVA 4L2YA 1N52A 3UQ3A 1R8IA 3U78A 3PUSA 5AQIB 1I94T 3FEYA 4Q25A 4EZ4A 4B3MT 3KS2A 5F8PA 2L6BA 2XEVA 5FQ8A 5G2NA 5ENRD 3I9YA 1NEKA 4IDPA 1N54A 4U96D 4APFA 4ANWA 3U3WA 5CB4E 4J7WA 4LF8T 2WXLA 4TX5A 1DCQA 4GZDA 2BKKB 4OAVB 4G23A 3AS5A 2JQ9A 3C3QA 2Y8DA 4O2AE 3CVRA 3BU8A 1MIWA 4HLLA 2BS3A 4CXYA 2QVAA 3FU0A 3LY9A 4KT6B 2HN1A 2W63A 3B7BA 3Q5DA 5ABGA 2E0IA 4KYOB 5JREA 1ZBPA 3V30A 4YSXA 1B7TA 4L9PA 4I2ZA 1E8WA 2XQ3A 1DVPA 3UFGA 3PZ3A 2EHOB 2DZOA 1JPLA 2IU1A 3MGBA 2P9UG 4LERA 5AQTB 4N5QA 4WNGA 3CK6A 1OCOE 5AYWD 4DJAA 4CXXA 3EHZA 4QH1A 2V6XA 3SY2A 5CRUA 5JRCA 4JI3T 3DBSA 3KV5A 1HG2A 1E7PA 3A7MA 1MX2A 2WXPA 1M7KA 1D8DA 1OCCE 2EINE 3RHWA 4GKKT 2MPKA 4IN3B 2W66A 2JJ9A 2GRLA 1NZNA 3D9IA 4LNUD 2PQRA 3OAWA 5D0OD 2F37A 2R17C 2X6JA 1VCSA 3KVAA 2BS4A 1X5BA 3LXUX 3UFEA 1L0VA 2FEZA 3CPZA 5FP3A 5CJ5A 2XPZA 3D3MA 4CZZB 2ZM2A 3FTWA 3E37A 4DI4A 3SHFA 3CKCA 1H2UA 1MIYA 4O2BE 4NXNT 3MZKB 2J08A 2P9PG 2XM1A 2I1JA 4YY3T 2XJ7A 1TYQG 3Q5EA 2KNDA 5BPPA 3PZ1A 3AEAA 2V8SE 3Q49B 4TXPA 3MK7C 1NI1A 3PZ4A 4W9RA 1G73A 1IJ6A 2VJ8A 3TGOA 2WXOA 4C0MA 3AS8A 3FZMB 3FH7A 5DBKA 4U95D 1LF8A 2XPIA 4A1SA 4ASKA 2XS1A 1ZHCA 4EZLA 4APOA 3FZHB 3N9LA 3F6QA 4XI0A 1E7VA 3PNLB 4DVDA 4TV3A 1GQEA 2LM9A 4ACLA 3FU3A 3NWIA 4QKNA 3W9FA 4TXRA 2V5FA 4F3VA 4HWDA 2IC9A 3EHNA 4ILAA 3O48A 3IBPA 2WDQA 3C4ZA 3FTXA 3MKRA 1JCSA 3FDHA 2RD0A 2H89A 4ILCA 4QQIA 1SVXA 2NYJA 3LVQE 5ANRA 3UU5A 2BEDA 4IRUA 4AJWA 4OFZA 2LXMA 3GW4A 1H7CA 4O4IE 4YT0A 1HU3A 1D0XA 3ZPJA 5IYZE 5ANLA 4HOTA 2FJDA 5L3FB 2VGXA 1ZV4X 1CUNA 1TNBA 2X6KA 4U0ZA 3ZMSB 3ZYLA 3SZ7A 4HRLA 4YJ2E 1FCHA 3AXJB 5IWAT 4U3CA 2X6FA 3ZT5A 3PUJA 1LD8A 2H6GA 4HTEA 1G8XA 4EZJA 5CA1E 5JDMA 1XWMA 3ZCIA 2WPVA 4RLYA
chains in the Genus database with same CATH topology
2BVMA 4ZOLE 3RRUA 1ZKEA 5BW8C 2PM7A 2VYIA 5FY0A 4XZ4A 5E75A 3CMLA 2H7VC 1JUQA 5LNKA 4ADZA 5H6RB 5AFUL 3B7RL 4FU3A 5A7DB 1VOMA 4EYYR 4UQXA 4EBAG 3VTYA 1YKHB 4UELA 4CXWA 3FU5A 2W0GA 1KLXA 4IYPA 1KT0A 4I50E 3NZUA 4XKCA 4IHJE 4V3IA 3CVUA 5LCWC 4DI3A 1MMNA 3PEUB 5JR9A 2XHEB 3KAEA 3KBTA 4JHRA 1UN8A 2CHWA 2CCQA 2A2FX 3FULA 3GZSA 3MA9A 2HPLA 2D2SA 3AA1B 4JZYA 4KBQA 2OVFA 2IOLA 5LOVE 3L3PA 2Q9QB 4RG9A 2Q9QC 4GYRA 4J6IA 1US7B 5LHHB 3FBZA 4TUYE 4WWOA 3GN5A 4IE4A 2ZLYA 4WNKA 5BMVE 3KFWX 2LSJA 5LBMA 4AQGA 4CQIA 4U72A 4UWFA 2XAFB 5FNVE 1Y8MA 1FEWA 4ZS3A 3EVYA 4FJYA 4EBAA 5FQ4A 5BV1A 4WAFA 2MBGA 3RX6A 3ZEFB 1BR2A 5CMYA 3GA8A 4H7YA 2H7OA 3QDNA 4G63A 3LKUA 3SFZA 4AP2A 4I17A 3FBLA 4ANXA 3J9X1 2XPYA 4J2CA 3U9WA 4GK0E 2L3LA 3SD5A 4X1IE 5JDQA 3CK9A 3FHEA 4KMCA 2EHOD 2CMRA 5GONE 2WVIA 1NA0A 3IKOB 3JQ0A 1OWOA 3PDNA 5CA0E 1Y64B 3HKBE 4KUMB 2I6HA 2LEHA 2Y6XA 4H9QC 4EPZA 2P9BA 3N9NA 3TKLB 5FY7A 4FHKA 2ODVA 2NW7A 2PZIA 5EDSA 3GZ2A 3OXGA 2UY1B 3N9QA 4CGVA 3AU4A 1UCUA 2K48A 3G2TA 4GYYA 2X9HA 2CXFA 2I2OA 3RRNB 3APCA 4UEMA 3RRWA 2I9CA 2DCPA 4LRZA 4DBQA 4PFPA 4UF0A 4J8EA 3RKOA 4CEMA 2V7LA 4GMLA 2FI7A 2DWGA 4XE0A 2AXVA 3UUXB 1E8YA 1TEZA 3N9OA 3HYMB 2XCCA 4I43A 1E96B 4ZI7E 4KP3C 4JEUB 2WAUA 4U0SA 2VSOE 3AAIA 1IHGA 3PUGA 1Z0PA 3U3IA 4ZI2D 5BV0A 3CSFA 1WAO1 3LDZA 3R7QA 5LP0A 4QXCB 2VTBB 3IEGA 3N71A 3URZA 3KV4A 3G2UA 3RH3A 3UT4A 1YW0A 1MNDA 2VQ2A 3MJXA 1HE8A 4AM9A 2Y4TA 4HVBA 2ZM8A 3F31A 2CG3A 3C50A 4RVBA 2X0LB 2NTYA 4Z8XA 1UG3A 5AJDA 2X6HA 3MV3B 1QNFA 3N9PA 2LSKA 4YFSA 3ZPOA 4WWNA 2X9WA 2V7KA 4FLHA 3ETUA 2EQXA 4X1KE 4UWKA 4LCTA 1MMAA 2X51A 4CI2B 3Q2MA 2D0TA 2IJGX 3QJZA 1DNPA 3LY8A 4CT0A 4WWPA 4N3AA 4TN7B 4P29A 5KCMA 4OYKA 3MEKA 3T5XA 3I4RB 2Y4UA 4QXBB 3CK8A 1HXIA 3JYSA 3TXNA 4DK5A 3P2BA 3UT7A 4XZCA 2CA5A 3IHRA 1MIVA 4O6FA 4BTAA 4PS8A 3FWVA 4OHFA 4QX7B 1P5QA 3S2AA 2YQ8A 4HFGA 4E7SA 5CMWA 3WAJA 4HXIA 3Q47B 2PQNA 3ETVA 3ASFA 2HPJA 3OJAA 1HCIA 4PJJA 3CQXC 5LBQB 4OYJA 4AKGA 3HL6A 4HKAA 5CHEE 4RG6A 4ATGA 1B89A 3FUKA 5L3GB 2J9QA 4HFVA 4KZCA 4UWLA 4AVXA 5FZQA 2Q9QD 4MALA 3FXEB 1ZEEA 4A3TA 1O3XA 2BVLA 5FXVA 2HO1A 5BNWA 3O1IA 1HO8A 3CHOA 4L23A 2E8IA 2I1KA 3FY4A 1D0YA 4IE6A 3D9LA 2WXHA 1X79A 2QFCA 4GA0A 3VKHA 4JA7A 2WM9A 4GA1A 4JPSA 3ZN3A 3QUJA 3RO3A 4PS3A 4QFVA 2J1DG 4EB6E 2BUGA 2HYZA 4BWRA 2NWBA 1H2TC 2R5SA 5ARFA 1NA3A 4EIWA 1D1BA 5EX3A 2NOXA 3CK7A 5DJQC 1HZ4A 2CXDA 4N3BA 2ES0A 4H9OC 3C4WA 1IZNB 2DI4A 4MFRA 4JUYA 3FEXA 2YINA 3PE3A 2WQHA 3QWPA 3R84B 2XGSA 4U07A 1QZ2A 3ANWB 2AXUA 5EK4A 1QUUA 2AXZA 4JLEA 2X9YA 1W3BA 2X38A 4ZI3C 3ZJ2A 5T8IA 1Z6TA 3ZJ1A 2QY7A 3NF1A 1OWNA 3U64A 1YKEB 5JHAA 3TG5A 2ZMAA 3C64A 4ANUA 3GMIA 1D1AA 3B13A 1S94A 2WMNA 3PUQA 4UQYA 3OXLA 2V7MA 4L2LA 3ULQA 2IW5B 1BR1A 4DPRA 2EHOA 4UV9B 5DIZA 3QKYA 4MBQA 2NW9A 3VHLA 1HFAA 2C5KT 4BT9A 2YNQA 3QC1A 2P58C 3LPZA 3UX4A 4DMWA 3BG0B 3UUNA 4XKBA 3TG4A 2WXIA 3FUNA 3CVNA 3DTOA 3O1JA 3B7UX 4AIFA 1SA0E 3ASHA 3FXDB 3APDA 2IONA 1SZAA 3RK6A 4G11A 3EDVA 3LBXB 4KZ0A 4P09A 1IAPA 3S7DA 5JHBA 2YHCA 4KBMB 2VB6A 2DHRA 2YHEA 2UXNB 3APFA 4Y6CA 4IE0A 4EAHA 1UX4A 2GW1A 2CWOA 4B6XA 4X1YE 3BQIA 5EK2A 1HF8A 3AS4A 3BQKA 2XUEA 2GRMA 3NQPA 3ZW3A 3ZC1A 3IBEA 3Q5XA 4KMOA 5J2UE 3HIZA 4NQ0A 3FUIA 3UPVA 5LP6E 3ENEA 3S7FA 3HVEB 3CGHA 4NRHB 1LVKA 3R7RA 3E08A 3HKEE 4JXTA 2WWUA 2N1GA 4FADA 5LFAA 2YEVC 3B7SA 4IDZA 3FH5A 5FXWA 4ZS2A 2KINB 3JC6C 3MACA 4N78D 4HS2A 3CVYA 5J2TE 2K9AA 2WB2A 2LSUA 3PDYA 4L1BA 3D9KA 1VRBA 2E9XB 3UTKA 4AQFA 4A1GA 3VLFA 3AVSA 2E9XC 2VGXB 3ZXSA 2FBNA 4EYUA 5J08A 3FB2A 5LCWJ 1HS6A 2CE7A 1KT1A 4XAXB 2DNXA 2WXFA 3QC9A 3UULA 3EIJA 2ILRA 2IFUA 3N5LA 4B94A 3G2SA 3LFMA 4WNFA 4HEAA 2PG8A 3ZRHA 3U66A 4OK0A 2MYSA 4CDNA 3ZMVB 4UWHA 4EECA 4DNDA 2L0IA 4C0EA 1H6KA 4MKTA 2JMKA 3P1UA 4B8AA 1EYHA 2KZTB 2D0UA 2XCBA 3V5SA 3G2WA 5E0OA 3L6AA 3T8OA 2QGSA 2ODUA 5HXHA 3ASDA 2XHEA 1FVFA 2KXPB 3GWHA 3ZYMA 4U0UA 4C90A 3SBTB 3VLEA 4G2VA 4NURA 5FZRA 5EK3A 4HOSA 1UW4B 3U4TA 3LJCA 5JR9C 4G25A 1MHQA 3I9WA 4FJZA 4FJOA 2YK0A 5L2LA 3CHPA 1HX8A 2Q9QA 3HHMA 4PAGA 4B0ZA 4XI9A 2A72A 5FMNA 3LY7A 2K5BB 5AJLA 5KJNA 2ZU6B 3D9JA 3MZLB 4X20E 4GB9A 5FTPA 2J09A 3JUIA 2OV8A 1JWFA 3K3NA 2ACXA 4H9NC 3ZMUB 3SF4A 3OTNA 4PK4A 5DABA 1XNFA 3VU7H 1GW6A 3LEWA 4I6JA 5AIJA 3HA4A 4HE8A 5HXSA 5ENNA 5LX8A 5LGUB 3MKQB 3ZEFA 3S7JA 1OXZA 5JDFA 4N5CA 3D9OA 2K24A 3I1AA 2UXXB 3IHVA 4PDXA 3FTZA 2BTDA 2DBAA 4BSXA 4K0UA 2ZM0A 4WNEA 3N2KE 4ZHQE 1E8XA 4UVAB 1JWGA 2M67A 1SHZC 4MLKA 5JVDE 2LT3A 4A55A 3MXZA 1EDUA 2ONDA 4I1OB 1OWPA 3RJVA 4AKLA 5CCLA 2J4DA 3DP7A 5JDLA 3L08A 4B89A 5EZYE 3RYHE 1ZU2A 3TAXA 5KMGP 2DCFA 3RYIE 4CT4A 2OVBA 4L9IA 2XAHB 5KJKA 2C0MA 5FY1A 3QK0A 5E76A 2UY1A 3R9AB 4J0UA 2LHRA 2MOWA 5LYJE 5LJNA 2E2EA 4ISTA 4PJLA 2NXPA 3CHSA 2UWJG 1KNZA 4CRWA 3PUKA 1BPOA 3CHMA 4PS7A 3RYFE 4CCAA 4BTBA 3L54A 5J90A 3NZPA 4O4LE 4JHJA 3ZHEB 3UUXA 2KT9A 1IQRA 1E1HB 2VKJA 4JEHB 2BZBA 4M3OA 5HXEA 4U8HA 2J07A 5LOZA 4E6HA 1OWAA 3CLJA 1HH8A 3PE4A 4JEUA 4KVMA 4NACA 1D0ZA 2C5JA 3N2OA 5A1LA 2PL2A 4N2SA 5JQGE 3PRZA 2VTBA 2VKHA 1ELKA 1KK7A 4H63H 4AXHA 3QWVA 3RYCE 4G26A 2J49A 2RA1A 4BJNA 3B57A 3FUDA 4FHJA 3KBUA 4EQFA 4YVQC 1S35A 3KV6A 4HOQA 2KWHA 4PJMA 3SNXA 5FJYA 2XTLA 3ML9A 2WXKA 3IV0A 1Z3XA 4UI9K 1YD8G 5ADXL 3FUMA 2C2LA 4JC8A 4GPKA 2JLBA 3CVLA 3FTSA 3CV0A 3VLDA 4Y6WA 2WMOA 5HYAA 2N9DA 3ASGA 2SPCA 4PFOA 3PZDA 1NP7A 1HS7A 4AKHA 1EF1C 4WBNE 3PURA 3I5PA 3P7IA 2CG2A 4AOFA 3RC3A 3C98B 3MV2B 3F57A 4GZCA 2L8KA 2V7JA 2A5UA 2V7IA 2CHZA 3EHMA 3FTUA 5A6CA 4U74A 3RRCA 3Q15A 3KV9A 3H37A 5EX0A 4AEZC 4XBFB 1L5JA 3RU0A 4UXNB 4E7ZA 4BT8A 4FA6A 3O4ZA 4UQZA 4XIFA 4WNDA 4GZ6A 4H9PC 3PNTB 3S7BA 2X67A 2X66A 3ONXA 4DLOA 5H6QB 2VKDA 4FP7A 4I4TE 3K8PC 1MQSA 3PS6A 1IJ5A 3N2GE 3AA7B 4AXPA 5HAXA 2CHXA 3RKVA 4AV7A 2MHKA 3RPUA 1WR6A 2L0TB 4GCOA 4H9RC 2VL8A 2FO7A 3KDSE 3TJPA 2IQCA 3A5XA 3E0ZA 2WXRA 3BQLA 3O1HA 4G1TA 4DBRA 3FUJA 2X9XA 3QAQA 3QB2A 1EZ3A 4GCNA 3KINB 3WI3A 3ZYQA 4TV9E 5LA6E 3OKQA 3CVQA 3NZQA 3L13A 4CDRA 1OUVA 4EZKA 4MLPA 3ZVVA 2PJQA 4I6EA 3PTRB 4NUVA 3DPDA 2R59A 2XAJB 2JEKA 4ILHB 4QWNB 4EZHA 4O4HE 1UJJA 3PU8A 2WXJA 2CXLA 1PY1A 3FUHA 3MCXA 3SWHA 3Q9DA 4PJNA 4HN9A 4F7AA 4GYOA 4LEUA 5LXTE 3OYXA 3CKBA 3SOLA 3O4XE 3L09A 4JA9A 1D1CA 2CFUA 4QX8B 5DQVA 5J1GA 2LAIA 4MRUA 1QSDA 3AAAB 3AU5A 2WSSV 2V4LA 4I1AA 2N2NA 5C8YE 3SBSA 3LVRE 4GU5A 3ANWA 1A17A 1FMVA 4AI6A 2YU1A 4K0RA 5HWXA 4O8SA 2HM8A 1TJFA 4DO0A 2MOZA 2RP4A 2GGFA 3QWWA 5KX5E 3MA5A 1WYCA 3HDXA 4BX9A 5ETWA 2KWIB 3LJ3A 3QNKA 5LCYA 4GA2A 2H3RA 3RC8A 1FVHA 4KXKB 4PH4B 4HLEA 3FUFA 5FXZA 2CLYB 2IOSA 4C9BB 3ONKA 2IF4A 2CLYC 2FF4A 4PNIA 3FU6A 4NUUA 3DJBA 5KDMC 3CEQA 2V1DB 1PAQA 2EHOC 3V5UA 4R7LA 3ZIMA 1NAFA 4BAYB 3I0OA 2VGYA 1IQUA 2C0LA 5A23A 5JRCB 2JQQA 3BK9A 3CX8B 3T8MA 2C5IT 2B1EA 3CVPA 3CKDA 5JDNA 3UT8A 4L5GA 3CVXA 4I2WA 4WUYA 2IC6A 1H2VC 2V26A 1Z3YA 3GYZA 5L3EB 3CQCB 3ZC0A 3PVLA 3RIBA 1ELWA 3LBXA 5BT1A 3LK3B 3LCAA 4XX5A 3HKCE 4HGAA 4A56A 4BFRA 3D9NA 2JPFA 4J8SA 3ZMTB 3QOUA 4I9EA 3J7Yq 2LJLA 4ERRA 4PK5A 2DWKA 1LKXA 2M63A 2Y3AA 3WAKA 3CWZB 4ME2A 4FULA 3R6NA 3ZFWA 5L3BB 5LJMA 2VSYA 5HXCA 4HOUA 5G05J 3ML8A 3T5VA 5HXRA 4ZI2C 3HVEA 4CI3B 2WXNA 5LHGB 3SI5A 4N2QA 3CVWA 3BEEA 5CCMA 2W61A 2C0SA 3MJWA 3NRXA 1FIOA 3Q4AB 4I9CA 2AVPA 2YU2A 3CR3A 2DLRA 2KLQA 2AW6A 5G05C 3K3OA 3CHQA 1OWMA 1SQMA 4G2AA 2NTXA 2LSYA 2E9XA 3G2VA 2KMFA 5KJLA 1U5PA 5AENA 5F3JA 4V1Av 5D0QD 2V0PA 1U3DA 2XASB 4AQFC 5LGNB 4MHCA 3ZLIA 4AY5A 2XQYA 5FQ6A 4ACKA 4L0RA 2BF0X 2NSZA 3JCKC 3VKGA 3ZN1B 1H19A 2A4ZA 4A3VA 4Q69A 2X68A 3FTYA 2CFZA 3WXXA 1YA0A 3GZ1A 4K03A 3AVRA 4YVOA 1WYBA 3FP3A 2QA7A 2WXQA 2LAHA 3K9IA 4IE7A 2HR2A 3ZMZB 2KZTA 4JW1A 3HR0A 3LK2B 5IHYA 4YLHA 2LSGA 4BJMA 1MMGA 3ESLA 5JR9B 2MRIA 4TUUA 3L16A 5BUZA 2RG8A 2BDEA 4H9SE 4C91A 3I0QA 3AB3B 3L22A 3KEZA 1ELRA 4ISSA 2XRYA 3EJNA 2W62A 3KVBA 3W15B 1HTJF 4I6GA 1V9DA 1LVFA 1E90A 3QK6A 4PK6A 3CIAA 3GN5B 2CEAA 5LGTB 2VWAA 1UN9A 1INZA 4HORA 3NBXX 4PUCA 1AJ3A 4U63A 2KCLA 5TAOA 5FYMA 4ZI3D 1WM5A 2KC7A 3D9PA 4ANJA 2PM6A 3EDUA 5FQ7A 3LG7A 3PUAA 4GK5E 2AWIA 3MKQA 3SS1A 3EDTB 4AY6A 3E22E 3UT5E 4DMVA 2GK9A 4FC8A 4D10C 3FUEA 5HI7A 3SGHA 4OVVA 2WBLA 2LOPA 2NP9A 3F2EA 1NWMX 5C1DA 3FTVA 2VK9A 2PFVA 2L9BA 2XGOA 4JHKA 3UUMA 3L17A 4DLQA 2XQ0A 4L7TA 5EKQD 4UVCB 3CHRA 4IE5A 4ILIA 2KATA 4CGWA 5KJMA 2G0UA 5JDGA 4ABNA 4AKRB 4P0AA 1WY6A 2WQ6A 2CM0A 3K3QC 4H7XA 4F53A 3S4UA 4MS6A 4KVOA 3BG1B 4AKIA 3PEVB 3ZCJA 4F6RC 2J4BA 1U3CA 2I59A 2MTQA 5G55A 2X6IA 2LE8A 3M65A 5FZSA 4BA9A 3FH8A 4UF0B 2XGMA 3ZHEA 5DQWA 2XAGB 3D0TA 4JEHA 4F1SA 3PREA 4I43B 1MNEA 1H0AA 2VASA 5FT9A 1VDYA 4IULA 4UV8B 5FXXA 2VKOA 3NZSA 4P0BA 3Q5MA 3MX3A 2PBIA 5T3RA 5LG4A 2XAQB 1PC2A 4H63V 2JRKA 4G24A 3CX7B 4Q96A 5L3DB 4U04A 4UWGA 5HWYA 4N3CA 3JC6D 1U4QA 2Q7FA 4YNDA 1TJCA 1UX5A 1E7UA 2JMHA 2XRZA 2LNIA 2E9XD 2W00A 2OOEA 3LK42 4WW0A 4ANVA 2FULA 4IIJE 1E8ZA 3D9MA 3MKDA 5HQ8A 2OA5A 2LSVA 3I3NA 3JQ1A 4J8FA 5JJ6A 3MYVA 3H3AA 3OYZA 3UMVA 3FFLA 2HH7A 2LHNA 4TZ4C 1SZ9A 3N9MA 4O4JE 5M72A 4GMJA 3LYAA 4GAAA 3C98A 4ILGA 3AAEB 4FI5A 4ILUA 2WQ7A 1XGWA 4I1MA 5JDHA 4Q94A 3EUHA 3TXMA 3I4GA 4CI1B 2IAKA 3IEEA 1WLXA 5C2YA 3ZYKA 4UVBB 3IHYA 3LS8A 3CVVA 2L9QA 3KD7A 2CWYA 4BY6A 2Y48B 3TL5A 3RRMB 2KZ7B 3CQGB 3NRYA 4YJ3E 1T98A 2A3DA 2VSNA 3EIQC 2LSIA 3C4XA 4GZ5A 1LRZA 4EXTA 3ESKA 3HI2A 4FLBA 3PE0A 2LO6A 5JJTA 4URKA 1Y6IA 4YHJA 2DIWA 1QQEA 4OYSA 2L6JA 4RSYA 4GYWA 4WBOA 4IGUA 3ZN0B 3Q5WA 3IF8B 4TRQA 3ONLA 1BR4A 4JL0A 3O9XA 3VTXA 3B7TA 3P8CD 3SRZA 5JH7E 1HG5A 1UJKA 2KM4A 2Z6EA 1BR0A 3E4BA 2NW8A 5T4YA 4QHOA 1MMDA 4UIGA 4QXHB 3C51A 1S0PA 4JVSA 4OVUA 2D5UA 2LOSA 4E85A 2WXGA 2WXMA 4TV8E 3OXFA 4UI9J 1EPUA 3RO2A 2VSXE 5G04J 1FMWA 2X3MA 2NC9A 3FHNA 5JJ7A 3AA6B 1IYGA 4I55E 4GIWA 4B8CB 5LHIB 3HKDE 3ZGQA 2KCKA 4GZ3A 4GYSA 3CX6B 4J8DA 3PU3A 5FWQA 3PH0C 5ARGA 5L3CB 4UI9C 1WRDA 3OBVE 4LUNU 4N39A 3QARA 4M1PA 1OWLA 4GOUA 4PW8A 4CDMA 3AA0B 3CSTA 5G04C 4EOZB 4BX8A 5M4YA 2KCVA 4L2YA 1N52A 3UQ3A 3U78A 3PUSA 3FEYA 4EZ4A 3KS2A 5F8PA 2XEVA 5FQ8A 5G2NA 3I9YA 1N54A 4APFA 4ANWA 3U3WA 5CB4E 2WXLA 4TX5A 4GZDA 4G23A 3AS5A 2Y8DA 4O2AE 3CVRA 1MIWA 4CXYA 3FU0A 3LY9A 4KT6B 2W63A 2E0IA 4KYOB 5JREA 1ZBPA 1B7TA 4I2ZA 1E8WA 1DVPA 2EHOB 1JPLA 2IU1A 3MGBA 4LERA 4WNGA 5AYWD 4DJAA 4CXXA 5JRCA 3DBSA 3KV5A 1HG2A 2WXPA 4IN3B 2JJ9A 2GRLA 1NZNA 3D9IA 2PQRA 3OAWA 5D0OD 2R17C 2X6JA 3KVAA 1X5BA 3LXUX 3UFEA 2FEZA 3CPZA 5FP3A 2XPZA 3D3MA 4CZZB 2ZM2A 3FTWA 4DI4A 3SHFA 3CKCA 1H2UA 1MIYA 4O2BE 3MZKB 2J08A 2I1JA 2KNDA 5BPPA 2V8SE 3Q49B 3MK7C 4W9RA 1G73A 1IJ6A 2VJ8A 3TGOA 2WXOA 4C0MA 3AS8A 3FH7A 5DBKA 1LF8A 2XPIA 4A1SA 4ASKA 1ZHCA 4EZLA 4APOA 3N9LA 4XI0A 1E7VA 3PNLB 4DVDA 4TV3A 2LM9A 4ACLA 3FU3A 4QKNA 2V5FA 4F3VA 2IC9A 3EHNA 3O48A 3IBPA 3C4ZA 3FTXA 3MKRA 3FDHA 2RD0A 3LVQE 5ANRA 4IRUA 4AJWA 4OFZA 3GW4A 1H7CA 4O4IE 1HU3A 1D0XA 3ZPJA 5IYZE 5ANLA 4HOTA 2VGXA 5L3FB 1ZV4X 1CUNA 2X6KA 4U0ZA 3ZMSB 3ZYLA 3SZ7A 4YJ2E 1FCHA 2X6FA 3PUJA 4HTEA 1G8XA 4EZJA 5CA1E 5JDMA 3ZCIA 2WPVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQG B;  3CQC B;  3I4R B; 
#chains in the Genus database with same CATH topology
 2BVM A;  3P50 A;  4ZOL E;  3RRU A;  4ZZC A;  1ZKE A;  5BW8 C;  2PM7 A;  1YXR A;  3NVO A;  2VYI A;  5FY0 A;  4CN4 A;  3RIA A;  2LM2 A;  4XZ4 A;  1K1B A;  5E75 A;  4G8L A;  3CML A;  2H7V C;  2E5V A;  1JUQ A;  5LNK A;  4ADZ A;  1YYH A;  5H6R B;  5AFU L;  1K3Z D;  2J8S D;  3VR9 A;  5CED B;  3B7R L;  4FU3 A;  5A7D B;  4UR9 A;  1VOM A;  3RSE G;  4GTR A;  4EYY R;  4UQX A;  4EBA G;  3VTY A;  2Y1L E;  1YKH B;  4UEL A;  2RFM A;  4CXW A;  3FU5 A;  4ILB A;  2W0G A;  1KLX A;  4IYP A;  1DC2 A;  4JBW F;  1KT0 A;  2QYJ A;  2VGE A;  4I50 E;  3NZU A;  4XKC A;  4LF4 T;  4IHJ E;  1HR0 T;  4V3I A;  5EIB E;  3ONJ A;  4LF6 T;  3CVU A;  5LCW C;  4AIS A;  1MMN A;  4DI3 A;  3RIF A;  2FJE A;  3PEU B;  2OLT A;  3JAD A;  5JR9 A;  1N4R A;  1NEN A;  2XHE B;  3KAE A;  3KBT A;  4JHR A;  2LRK A;  5FL0 A;  1UN8 A;  2CHW A;  2CCQ A;  2A2F X;  1M62 A;  2JQH A;  1MJ0 A;  3FUL A;  4DV5 T;  3GZS A;  3MA9 A;  2HPL A;  2D2S A;  4DX7 D;  3AA1 B;  4JZY A;  3M3Z B;  4KBQ A;  3TWU A;  2OVF A;  1OCR E;  2IOL A;  4U2Z A;  3KSQ A;  5HEO A;  5LOV E;  3L3P A;  2Q9Q B;  4RG9 A;  1LD7 A;  5EYL A;  2Q9Q C;  4GYR A;  4J6I A;  1US7 B;  3UU6 A;  5LHH B;  3FBZ A;  4TUY E;  4WWO A;  4DUI A;  3GN5 A;  4IE4 A;  2ZLY A;  4WNK A;  5HKP A;  5BMV E;  3W9G A;  1TN8 A;  4P1N A;  2BBJ A;  4U7I A;  3KFW X;  2LSJ A;  5LBM A;  4AQG A;  2HHH T;  3L9T A;  4CQI A;  2BS2 A;  1LTX A;  4U72 A;  4UWF A;  2BG9 A;  2XAF B;  5FNV E;  1TNO A;  1Y8M A;  1FEW A;  3B5M A;  3AE6 A;  4ZS3 A;  3L82 A;  3V2O A;  3EVY A;  4FJY A;  3DXK G;  2XQ8 A;  1O1R A;  5FQ4 A;  3ZT7 A;  4EBA A;  2HE0 A;  5BV1 A;  4DV4 T;  2XQ7 A;  4WAF A;  2MBG A;  5C3J A;  3RX6 A;  3ZEF B;  4I0U A;  1BR2 A;  5CMY A;  4DR5 T;  2EIJ E;  3GA8 A;  1SE7 A;  4DV2 T;  4H7Y A;  2H7O A;  2WDR A;  5EYP F;  1S70 B;  5BT1 A;  3QDN A;  4G63 A;  3LKU A;  3SFZ A;  4AP2 A;  4I17 A;  3FBL A;  3CIR A;  4ANX A;  3J9X 1;  2XPY A;  1W09 A;  4J2C A;  3U9W A;  5AQS B;  4GK0 E;  5AQB A;  2L3L A;  4OX9 T;  2W67 A;  4HFH A;  4X1I E;  5HEU A;  5JDQ A;  5LG3 A;  2OEV A;  3CK9 A;  3FHE A;  3SD5 A;  4KMC A;  2EHO D;  4YXD A;  2YKS A;  2CMR A;  5GON E;  2WVI A;  4F1P A;  4MBG A;  1NA0 A;  3IKO B;  4X65 T;  3JQ0 A;  1OWO A;  2JIW A;  3PDN A;  1KFY A;  5CA0 E;  1Y64 B;  2I6H A;  3HKB E;  4KUM B;  2LEH A;  3C72 A;  2Y6X A;  4H9Q C;  4EPZ A;  1HNX T;  2P9B A;  3N9N A;  4CN6 A;  3TKL B;  5FY7 A;  4FHK A;  2ODV A;  3TWR A;  2NW7 A;  2PZI A;  5EDS A;  1KZO A;  3GZ2 A;  3OXG A;  5ABF A;  1XZY A;  4BET A;  2UY1 B;  3P4P A;  3N9Q A;  4CGV A;  1J5W A;  2RKK A;  3AU4 A;  1UCU A;  2K48 A;  3G2T A;  4GYY A;  2VVN A;  2X9H A;  2CXF A;  2I2O A;  3RRN B;  2WS3 A;  3APC A;  4UEM A;  4DRX E;  3RRW A;  4JV5 T;  2DVW A;  2I9C A;  2DCP A;  4LRZ A;  4DBQ A;  2F8X K;  4PFP A;  4UF0 A;  4J8E A;  3RKO A;  4CEM A;  2V7L A;  4B3T T;  4GML A;  4DX1 A;  2FI7 A;  2DWG A;  3L39 A;  4XE0 A;  2AXV A;  3UUX B;  1E8Y A;  1TEZ A;  3N9O A;  3HYM B;  2XCC A;  4I43 A;  1E96 B;  2J62 A;  4ZI7 E;  4KP3 C;  1XMO T;  4JEU B;  2WAU A;  5JMN D;  4U0S A;  2VSO E;  3AAI A;  1IHG A;  2YN6 A;  2WP9 A;  3AE7 A;  4TUM A;  3PUG A;  3RI5 A;  1Z0P A;  4HWC A;  3HRA A;  3U3I A;  4ZI2 D;  5BV0 A;  3CSF A;  1WAO 1;  3LDZ A;  3R7Q A;  5LP0 A;  4QXC B;  2OCC E;  1KNR A;  4JI6 T;  3IEG A;  2VTB B;  3N71 A;  3URZ A;  3KV4 A;  5EN5 D;  3G2U A;  1V54 E;  3RH3 A;  1U2V G;  5L4H A;  3UU4 A;  2J47 A;  3UT4 A;  1YW0 A;  1MND A;  5HRY A;  4LFC T;  2OV9 A;  2VQ2 A;  3MJX A;  3IA3 A;  1HE8 A;  4AM9 A;  3PJA A;  2Y4T A;  2H88 A;  4HVB A;  2ZM8 A;  3F31 A;  2CG3 A;  3C50 A;  2DL1 A;  4RVB A;  2X0L B;  5JTG A;  2NTY A;  2FJB A;  4HFB A;  4Z8X A;  1UG3 A;  5AJD A;  2X6H A;  3MV3 B;  1QNF A;  3N9P A;  2LSK A;  3DSV A;  4YFS A;  3ZPO A;  4WWN A;  2X9W A;  2V7K A;  4FLH A;  3ETU A;  2EQX A;  4X1K E;  4HQD A;  2Y69 E;  1N36 T;  3RGL A;  4UWK A;  4LCT A;  1MMA A;  2X51 A;  5HEG A;  4CI2 B;  3Q2M A;  2D0T A;  2IJG X;  2AJA A;  3UKR G;  4ZZB A;  3QJZ A;  3QNU A;  5KNG A;  1N0Q A;  1DNP A;  4ZXL A;  3LY8 A;  4CT0 A;  4WWP A;  4N3A A;  4TN7 B;  4P29 A;  2LUH A;  5KCM A;  4OYK A;  3MEK A;  3T5X A;  3I4R B;  2Y4U A;  5AQL B;  4QXB B;  3CK8 A;  1HXI A;  3JYS A;  3TXN A;  3JAE A;  4DK5 A;  3P2B A;  3UT7 A;  3UU3 A;  5BXO A;  4XZC A;  2CA5 A;  5LB7 B;  4ZEY A;  3IHR A;  1MIV A;  1KF6 A;  4O6F A;  2EIL E;  4BTA A;  2XZE A;  2MYO A;  4PS8 A;  3FWV A;  2WZH A;  4OHF A;  4QX7 B;  1P5Q A;  3S2A A;  2YQ8 A;  4HFG A;  4E7S A;  5CMW A;  3WAJ A;  5AQV B;  2UXC T;  2XZT G;  2B6C A;  4HXI A;  3Q47 B;  2PQN A;  3ETV A;  3ASF A;  2ZXW E;  2HPJ A;  3OJA A;  4HWH A;  1HCI A;  4PJJ A;  1W9R A;  3CQX C;  5LBQ B;  4OYJ A;  4AKG A;  4HRM B;  3HL6 A;  4HKA A;  5CHE E;  3UU8 A;  4RG6 A;  4ATG A;  1B89 A;  3FUK A;  4YTP A;  3RIU C;  5L3G B;  2J9Q A;  1K1A A;  4HFV A;  1S63 A;  4KZC A;  4UWL A;  4AVX A;  5FZQ A;  2WDV A;  2Q9Q D;  2FJA A;  4K5B A;  4MAL A;  3JAF A;  4DR2 T;  3FXE B;  1ZEE A;  4A3T A;  2XSA A;  1O3X A;  4DR7 T;  2WQY A;  2BVL A;  5FXV A;  5F5W A;  3ONL C;  2HO1 A;  5BNW A;  3O1I A;  1ZOY A;  1HO8 A;  3CHO A;  4L23 A;  3DEO A;  2E8I A;  5ENT D;  2I1K A;  3FY4 A;  4U8Y D;  1D0Y A;  5AQA A;  3PUX F;  4IE6 A;  2I0M A;  4IL9 A;  3D9L A;  5CRV A;  2WXH A;  4K0K T;  1MYO A;  1X79 A;  2QFC A;  4GA0 A;  3VKH A;  4JA7 A;  2WM9 A;  5AQG B;  4GA1 A;  4JPS A;  3ZN3 A;  3QUJ A;  4JI1 T;  3RO3 A;  4PS3 A;  4QFV A;  2J1D G;  4EB6 E;  2BUG A;  4G8K A;  4B3R T;  2HYZ A;  2ETC A;  4F8H A;  4BWR A;  2NWB A;  2LXL A;  1H2T C;  2R5S A;  2QC9 A;  1N4Q A;  5ARF A;  1CHU A;  1NA3 A;  4EIW A;  1D1B A;  5EX3 A;  2NOX A;  3B95 A;  3CK7 A;  5DJQ C;  1HZ4 A;  2CXD A;  2XQ6 A;  4N3B A;  2ES0 A;  4H9O C;  3C4W A;  1TR4 A;  3SQV A;  1IZN B;  5AQR B;  2DI4 A;  4MFR A;  3LJN A;  3OVU A;  4JUY A;  1IKN D;  3FEX A;  2YIN A;  3PE3 A;  2WQH A;  3QWP A;  3R84 B;  2XGS A;  4U07 A;  1YQ3 A;  1IXV A;  1QZ2 A;  4DUY T;  3QB5 K;  4F6R D;  3ANW B;  4U33 A;  2AXU A;  3K1S A;  3ABK E;  3J5Q B;  5EK4 A;  1QUU A;  3LDQ B;  2AXZ A;  3Q9U C;  4JLE A;  2X9Y A;  1W3B A;  2X38 A;  4ZI3 C;  3ZJ2 A;  5T8I A;  3TWS A;  1TNY A;  5D66 A;  1Z6T A;  3ZJ1 A;  1O1S A;  1SUM B;  1T8B A;  2QY7 A;  3NF1 A;  1OWN A;  3U64 A;  1KZP A;  1YKE B;  2ZIS A;  4HWI B;  3ZKJ A;  5JHA A;  3TG5 A;  2ZMA A;  3EI0 A;  3C64 A;  4ANU A;  3GMI A;  1D1A A;  3B13 A;  1S94 A;  3P4Q A;  4LF5 T;  2WMN A;  3PUQ A;  4UQY A;  2YDS A;  1QYM A;  2BKG A;  3OXL A;  2QYW A;  2V7M A;  4L2L A;  3ULQ A;  2IW5 B;  1BR1 A;  4DPR A;  2EHO A;  2XM2 A;  4UV9 B;  5DIZ A;  1KNP A;  1SW6 A;  1JCR A;  3QKY A;  4MBQ A;  2NW9 A;  2F8Y A;  5HEH A;  3VHL A;  1HFA A;  5H7P A;  1WDY A;  2C5K T;  3ABV A;  4BT9 A;  2YNQ A;  4DX6 D;  2XEE A;  3QC1 A;  2P58 C;  3LPZ A;  3UX4 A;  4DMW A;  3BG0 B;  1Z8U A;  3UUN A;  4XKB A;  3TG4 A;  2WXI A;  3FUN A;  3T8K A;  3CVN A;  5HS0 A;  3DTO A;  3O1J A;  3B7U X;  4AIF A;  1Y01 A;  3JCF A;  1SA0 E;  3ASH A;  3ZKR A;  3FXD B;  3APD A;  2ION A;  1SZA A;  3RK6 A;  2QYU A;  4G11 A;  3EDV A;  2H6I A;  3LBX B;  4KZ0 A;  4P09 A;  1IAP A;  3S7D A;  5JHB A;  2YHC A;  3PV0 F;  4KBM B;  4GTM A;  2VB6 A;  2DHR A;  1UOH A;  2YHE A;  2UXN B;  3P4R A;  3ZXP A;  3ULY A;  4DR6 T;  3APF A;  4Y6C A;  4ZFH A;  2WY2 A;  4HNA D;  4IE0 A;  4EAH A;  3IXE A;  1UX4 A;  2GW1 A;  4ATZ D;  2UXD T;  2XQA A;  2UXB T;  2CWO A;  4B6X A;  4X1Y E;  3BQI A;  4WYV A;  3TLW A;  3ULE G;  4NIK A;  5EK2 A;  1HF8 A;  3AS4 A;  3SFE A;  4LMJ A;  3BQK A;  2XUE A;  3PUV F;  1IBM T;  2GRM A;  1TNZ A;  1HNW T;  1WCR A;  3NQP A;  3ZW3 A;  3ZC1 A;  3IBE A;  4GTS A;  3Q5X A;  4KMO A;  5J2U E;  3HIZ A;  4NQ0 A;  3FUI A;  3UPV A;  5LP6 E;  3ENE A;  3S7F A;  3HVE B;  3CGH A;  4NRH B;  1LVK A;  3R7R A;  3E08 A;  3HKE E;  1J5E T;  4JXT A;  2WWU A;  2N1G A;  4FAD A;  3UTM A;  3QB5 A;  5LFA A;  4X66 T;  3NB2 A;  2YEV C;  2W2U A;  3B7S A;  4IDZ A;  3FH5 A;  2BKN A;  3E33 A;  3ZUV B;  5FXW A;  2H6F A;  5L47 A;  4ZS2 A;  2KIN B;  3JC6 C;  2XZD G;  3AE3 A;  3MAC A;  4N78 D;  4HS2 A;  3CVY A;  1IBL T;  5J2T E;  2K9A A;  4NPP A;  2WB2 A;  2LSU A;  3AXJ A;  3PDY A;  4L1B A;  3D9K A;  1VRB A;  2E9X B;  3UTK A;  4AQF A;  2IO3 C;  4A1G A;  3VLF A;  3AVS A;  2E9X C;  4LSZ E;  4EGW A;  2VGX B;  1SA5 A;  2ZGD A;  3ZXS A;  2QRX A;  2HN2 A;  2FBN A;  4EYU A;  1N11 A;  5J08 A;  3TWQ A;  1WG0 A;  4J8Y A;  3FB2 A;  5LCW J;  1HS6 A;  2CE7 A;  1KT1 A;  4XAX B;  2DNX A;  2WXF A;  3QC9 A;  3UUL A;  3EIJ A;  2ILR A;  2IFU A;  2ACZ A;  3N5L A;  3ZST A;  4B94 A;  3G2S A;  2ETA A;  3LFM A;  4WNF A;  4HEA A;  2PG8 A;  3ZRH A;  3U66 A;  4OK0 A;  5ABH A;  3UI2 A;  4OAU C;  2MYS A;  1TN7 A;  1XNR T;  4CDN A;  3ZMV B;  4UWH A;  4EEC A;  4DND A;  2L0I A;  4C0E A;  1BI8 B;  1H6K A;  3AEE A;  4MKT A;  2JMK A;  3P1U A;  4B8A A;  1KEY A;  1EYH A;  2KZT B;  2D0U A;  2FBW A;  2XCB A;  3V5S A;  3ABM E;  1G3N B;  3G2W A;  3EAB A;  5E0O A;  3T8O A;  2QGS A;  3L6A A;  2ODU A;  5HXH A;  5ABE A;  2XHE A;  1FVF A;  3ASD A;  2KXP B;  3GWH A;  3ZYM A;  1BI7 B;  3DST A;  4U0U A;  2KXP C;  5EID A;  4YDO A;  4C90 A;  3SBT B;  3T9K A;  3VLE A;  4G2V A;  4GTO A;  4NUR A;  5FZR A;  5EK3 A;  4HOS A;  4A63 B;  1UW4 B;  4EV6 A;  3U4T A;  3LJC A;  5JR9 C;  4G25 A;  1MHQ A;  1FJG T;  3I9W A;  4FJZ A;  5KWD A;  4FJO A;  2YK0 A;  2DZN A;  5L2L A;  3CHP A;  1HX8 A;  2XY8 B;  3EU9 A;  1AWC B;  2Q9Q A;  3HHM A;  3PUY F;  3ZSS A;  3X2Q E;  4PAG A;  2F0Y A;  4B0Z A;  4XI9 A;  2A72 A;  5FMN A;  3LY7 A;  2XPK A;  2K5B B;  1UUR A;  5AJL A;  5KJN A;  2ZU6 B;  3D9J A;  4O1O A;  2GRQ B;  4HWF A;  1I6Z A;  3MZL B;  4X20 E;  4GB9 A;  1AP7 A;  2V8S V;  4EEB A;  3AE1 A;  5FTP A;  2J09 A;  3JUI A;  2OV8 A;  2KSR A;  1JWF A;  2EIK E;  3K3N A;  2ACX A;  4H9N C;  3ZMU B;  3PZ2 A;  3SF4 A;  3OTN A;  4AQY T;  4PK4 A;  5DAB A;  1XNF A;  3VU7 H;  1GW6 A;  3AEF A;  3LEW A;  4GTV A;  4I6J A;  5AQM B;  5AIJ A;  3HA4 A;  4HE8 A;  5HXS A;  1OED E;  5ENN A;  4A97 A;  3HXD A;  5LX8 A;  5LGU B;  3MKQ B;  4IDQ A;  4JD2 G;  3ZEF A;  4X8Q A;  3S7J A;  1OXZ A;  5JDF A;  4N5C A;  3D9O A;  2P9L G;  2K24 A;  3I1A A;  2UXX B;  3IHV A;  3WG7 E;  4PDX A;  3FTZ A;  4BES A;  2BTD A;  2DBA A;  3AJI A;  1JNR A;  4BSX A;  2JQK A;  2RFA A;  4K0U A;  2ZM0 A;  4IDN A;  4WNE A;  3N2K E;  4ZHQ E;  1E8X A;  4UVA B;  1JWG A;  2M67 A;  1SHZ C;  4MLK A;  5JVD E;  2GRP B;  2LT3 A;  4A55 A;  3MXZ A;  2Y0B G;  1EDU A;  2OND A;  4I1O B;  1OWP A;  3RJV A;  4AKL A;  5CCL A;  2J4D A;  3DP7 A;  1YCS B;  5JDL A;  3L08 A;  4B89 A;  3V79 K;  5EZY E;  5ENQ D;  3LSV A;  3RYH E;  1ZU2 A;  3TAX A;  2B0O E;  2LRL A;  5KMG P;  2DCF A;  3RYI E;  2IO2 C;  4CT4 A;  2OVB A;  4WZX A;  3AE5 A;  4L9I A;  4HFC A;  2XAH B;  5KJK A;  3HXF A;  1X81 A;  2ZM6 T;  1ZB1 A;  2C0M A;  5FY1 A;  3QK0 A;  3AEC A;  5E76 A;  2UY1 A;  4GMR A;  4B3S T;  2GRO B;  2P9N G;  2PNN A;  3R9A B;  4J0U A;  2LHR A;  5C2T A;  2MOW A;  4YSZ A;  5LJN A;  2PTF A;  5LYJ E;  2E2E A;  3DSU A;  4IST A;  4PJL A;  4Z91 A;  2NXP A;  3CHS A;  4QH4 A;  2UWJ G;  4HI9 A;  1KNZ A;  4CRW A;  3PUK A;  1BPO A;  4XEI G;  3CHM A;  4PS7 A;  3RYF E;  1MX4 A;  4CCA A;  4GTT A;  4BTB A;  3L54 A;  5J90 A;  3NZP A;  4O4L E;  4JHJ A;  3ZHE B;  3UUX A;  2KT9 A;  2V6Y B;  1IQR A;  1E1H B;  4DV6 T;  2VKJ A;  2R2L A;  1UGO A;  4JEH B;  2BZB A;  4M3O A;  5HXE A;  4U8H A;  2J07 A;  3ASO E;  2M6B A;  5LOZ A;  4E6H A;  1OWA A;  3CLJ A;  2DYR E;  1HH8 A;  3PE4 A;  4JEU A;  4KVM A;  2WB5 A;  2F4V T;  4NAC A;  5FVL A;  3X1D A;  1D9S A;  1D0Z A;  4Z90 A;  2C5J A;  3N2O A;  5A1L A;  1DCE A;  4U7Y A;  2PL2 A;  4N2S A;  4NIQ A;  5AQK B;  5JQG E;  2E5L T;  3T1H T;  3PRZ A;  2VTB A;  2VKH A;  4JI0 T;  1ELK A;  1KK7 A;  4H63 H;  3UM0 A;  2V4H C;  4AXH A;  3QWV A;  2B76 A;  2WWV A;  3RYC E;  1ZP0 A;  5HCM A;  4G26 A;  2J49 A;  2RA1 A;  4BJN A;  1WFD A;  3B57 A;  3FUD A;  4FHJ A;  3KBU A;  4EQF A;  4YVQ C;  1S35 A;  3KV6 A;  4HOQ A;  2KWH A;  4PJM A;  3SNX A;  5FJY A;  2XTL A;  3ML9 A;  2WXK A;  3IV0 A;  1Z3X A;  4UI9 K;  1YD8 G;  5ADX L;  3FUM A;  2C2L A;  3AE2 A;  3FZK B;  4LFB T;  4JC8 A;  3V31 A;  4GPK A;  3RF1 A;  2JLB A;  3CVL A;  3FTS A;  3CV0 A;  2GRR B;  3VLD A;  4Y6W A;  3T1Y T;  1OY3 D;  2WMO A;  1O1T A;  5HYA A;  2N9D A;  3ASG A;  1J1J A;  2SPC A;  2R02 A;  4PFO A;  3PZD A;  1NP7 A;  1WR0 A;  1HS7 A;  4AKH A;  3ZT6 A;  3OTO T;  1EF1 C;  4WBN E;  3PUR A;  3AE8 A;  3I5P A;  3P7I A;  2CG2 A;  4AOF A;  3RC3 A;  3C98 B;  3MV2 B;  5AAR A;  3F57 A;  4GZC A;  2L8K A;  2V7J A;  2A5U A;  2V7I A;  2CHZ A;  3EHM A;  3FTU A;  4YDE A;  3HXC A;  5A6C A;  2WU2 A;  4GPM A;  4U74 A;  3RRC A;  3Q15 A;  3KV9 A;  3H37 A;  4O60 A;  5EX0 A;  4AEZ C;  4XBF B;  1L5J A;  3RU0 A;  5CER B;  4UXN B;  4E7Z A;  4JYA T;  3Q7F A;  4BT8 A;  4FA6 A;  3O4Z A;  4UQZ A;  4XIF A;  4WND A;  4GZ6 A;  2ETB A;  4H9P C;  1HX1 B;  3PNT B;  3S7B A;  2X67 A;  2X66 A;  3ONX A;  4U31 A;  4DLO A;  5H6Q B;  2VKD A;  4FP7 A;  4I4T E;  3KEA A;  3K8P C;  1MQS A;  5FIO A;  5ENS D;  4DV1 T;  3NOG D;  3PS6 A;  2AE9 A;  4LFA T;  1IJ5 A;  3P4W A;  3N2G E;  3ISM C;  1TN6 A;  3AA7 B;  4AXP A;  5HAX A;  2CHX A;  4DID B;  4U8V D;  3RIU A;  3RKV A;  2UUC T;  4AV7 A;  2MHK A;  3RPU A;  1WR6 A;  3NOC D;  1OCZ E;  2L0T B;  4GCO A;  4H9R C;  2VL8 A;  4LF9 T;  2FO7 A;  2QZA A;  3KDS E;  4X62 T;  3TJP A;  3NBN B;  2IQC A;  3A5X A;  4YHH T;  3E0Z A;  2WXR A;  2NR4 A;  3BQL A;  4HFD A;  4GKJ T;  3O1H A;  4G1T A;  1JCQ A;  4DBR A;  3FUJ A;  2X9X A;  3QAQ A;  3QB2 A;  1EZ3 A;  4GCN A;  3KIN B;  1YMP A;  5AQU B;  3WI3 A;  3ZYQ A;  4TV9 E;  5LA6 E;  5FVK A;  3UIO C;  3OKQ A;  5BR8 T;  3CVQ A;  3NZQ A;  3VR8 A;  3L13 A;  4CDR A;  1OUV A;  3ZNG A;  1QLB A;  4EZK A;  4MLP A;  3ZVV A;  2PJQ A;  3AG1 E;  5ENP D;  4I6E A;  3PTR B;  4NUV A;  3AEB A;  4GTQ A;  1H6P A;  3DPD A;  1MZC A;  2R59 A;  2XAJ B;  5CEC B;  2JEK A;  4ILH B;  4QWN B;  4EZH A;  1BLX B;  4O4H E;  1UJJ A;  3PU8 A;  1Q2Z A;  2CXL A;  2WXJ A;  1PY1 A;  3FUH A;  3MCX A;  3SWH A;  4JB8 P;  1OED B;  3Q9D A;  4DX5 D;  1OED C;  4PJN A;  4HN9 A;  4F7A A;  4GYO A;  4LEU A;  5LXT E;  1FT1 A;  3OYX A;  3CKB A;  3SOL A;  3O4X E;  1XNQ T;  3L09 A;  4JA9 A;  1D1C A;  2CFU A;  4QX8 B;  5DQV A;  3AG2 E;  2BG9 E;  3EUV A;  4DX2 A;  5J1G A;  2LAI A;  4MRU A;  1QSD A;  3AAA B;  3AU5 A;  2WSS V;  3FZF B;  1TNU A;  2V4L A;  4I1A A;  3AAA C;  2N2N A;  1FPP A;  5C8Y E;  4DV0 T;  3LVR E;  3SBS A;  4GU5 A;  3ANW A;  1A17 A;  1FMV A;  4AI6 A;  2XEN A;  1V55 E;  4HFE A;  2YU1 A;  4LMK A;  2JAB A;  4K0R A;  5HWX A;  4O8S A;  2P2C P;  2HM8 A;  1TJF A;  1MX6 A;  4DO0 A;  2MOZ A;  4HFI A;  4HB5 A;  2RP4 A;  2GGF A;  3QWW A;  5KX5 E;  3MA5 A;  1WYC A;  2YOE A;  5EIL A;  3HDX A;  4BX9 A;  5ETW A;  2KWI B;  3LJ3 A;  3QNK A;  5LCY A;  4GA2 A;  2H3R A;  3RC8 A;  1FVH A;  1OXJ A;  4KXK B;  4PH4 B;  4HLE A;  3FUF A;  5FXZ A;  2CLY B;  2IOS A;  4C9B B;  3ONK A;  2IF4 A;  2CLY C;  2FF4 A;  3UIP C;  4DR1 T;  4PNI A;  3FU6 A;  2K3W A;  4YDY A;  2DWZ A;  5AN8 A;  4LNB A;  3BUA A;  4NUU A;  1UUS A;  3DJB A;  5KDM C;  3CEQ A;  4GTP A;  2V1D B;  1PAQ A;  3RQU A;  2EHO C;  3V5U A;  4R7L A;  3ZIM A;  2X0H A;  1NAF A;  4BAY B;  5L4E A;  3I0O A;  2VGY A;  1IQU A;  2CRB A;  2C0L A;  5A23 A;  2WCA A;  5JRC B;  2JQQ A;  2V5Q C;  3BK9 A;  2IIU A;  3CX8 B;  3T8M A;  3KSL A;  2C5I T;  2B1E A;  3Q78 A;  3CVP A;  3CKD A;  5JDN A;  3JXI A;  4L5G A;  3UT8 A;  2WU5 A;  3CVX A;  4I2W A;  1BD8 A;  4WUY A;  2IC6 A;  2XQ9 A;  1H2V C;  2MAW A;  1NFI E;  1XDO A;  2V26 A;  1Z3Y A;  5L3E B;  3CQC B;  2V5C A;  3ZC0 A;  2P9I G;  3GYZ A;  1ELW A;  3LBX A;  3PVL A;  3LK3 B;  3LCA A;  4RQI A;  3RIB A;  4XX5 A;  3UIN C;  2R05 A;  3HKC E;  3DSW A;  4HGA A;  5AAO A;  4A56 A;  4BFR A;  4M7C A;  4Z68 A;  4DV3 T;  3D9N A;  4IL4 A;  2JPF A;  4J8S A;  3ZMT B;  5HEJ A;  4TNV A;  3QOU A;  4I9E A;  3J7Y q;  2LJL A;  4NXM T;  4ERR A;  4PK5 A;  1QBQ A;  1N4S A;  1XDP A;  3SO8 A;  2DWK A;  5AQP B;  4BER A;  3Q7A A;  1LKX A;  2DYS E;  2M63 A;  2Y3A A;  3WAK A;  3CWZ B;  4ME2 A;  4FUL A;  3R6N A;  2R03 A;  2LLY A;  3ZFW A;  5L3B B;  5LJM A;  2VSY A;  5HXC A;  4HOU A;  5G05 J;  3ML8 A;  3T5V A;  5HXR A;  4ZI2 C;  4KX6 A;  3HVE A;  2WZI A;  4CI3 B;  5LHG B;  2WXN A;  3SI5 A;  4N2Q A;  3CVW A;  3EHR A;  3BEE A;  5CCM A;  2ZIR A;  2W61 A;  2C0S A;  3MJW A;  3NRX A;  1FIO A;  4QH5 A;  3UXG A;  3Q4A B;  4I9C A;  2LKH A;  2AVP A;  2YU2 A;  5CBO A;  3CR3 A;  4DR3 T;  3Q73 A;  2DLR A;  2KLQ A;  2AW6 A;  5G05 C;  2FO1 E;  3K3O A;  3CHQ A;  3PUZ F;  3TLV A;  5B3S E;  1OWM A;  1SQM A;  4G2A A;  2NTX A;  4TNW A;  2LSY A;  2A5E A;  2E9X A;  3G2V A;  3P4S A;  2KMF A;  5KJL A;  1U5P A;  5AEN A;  5F3J A;  2R6G F;  4V1A v;  1A5E A;  5D0Q D;  2V0P A;  3TWT A;  3E30 A;  1U3D A;  2IEJ A;  3EHQ A;  4TWD A;  2XAS B;  4AQF C;  5LGN B;  1OT8 A;  3DEP A;  4MHC A;  2CPT A;  3ZLI A;  4AY5 A;  3EAM A;  4TWF A;  2XQY A;  5FQ6 A;  4ACK A;  4L0R A;  2BF0 X;  2NSZ A;  5J0Z A;  3JCK C;  3VKG A;  3ZN1 B;  1H19 A;  4A5X A;  2A4Z A;  4A3V A;  3PUW F;  5AQ9 A;  4Q69 A;  2X68 A;  2IDO B;  3FTY A;  2CFZ A;  3WXX A;  1YA0 A;  2KBX A;  3RKG A;  5AQO B;  5FL1 A;  3GZ1 A;  4K03 A;  3AVR A;  4EED A;  4YVO A;  1WYB A;  2CHO A;  2QA7 A;  2WXQ A;  3FP3 A;  4DUZ T;  2LAH A;  3K9I A;  2XQ5 A;  4IE7 A;  2HR2 A;  3ZMZ B;  3DPY A;  2KZT A;  4JW1 A;  3HR0 A;  3LK2 B;  5IHY A;  4YLH A;  2LSG A;  3OPC A;  4BJM A;  1MMG A;  4JI2 T;  3ESL A;  5JR9 B;  3J5P A;  2P9S G;  2MRI A;  3AG3 E;  4TUU A;  3VRA A;  3TWV A;  3L16 A;  5BUZ A;  4K5C A;  2BDE A;  2RG8 A;  2VQF T;  4H9S E;  4C91 A;  3I0Q A;  1JNZ A;  3AB3 B;  1W0A A;  4BSZ B;  3L22 A;  3KEZ A;  4IT4 A;  1ELR A;  2FUP A;  1K8K G;  4ISS A;  5FIN A;  2XRY A;  2XSB A;  3FZL B;  3EJN A;  3D9H A;  2W62 A;  3AE9 A;  3KVB A;  3DSS A;  5KNH D;  3W15 B;  1HTJ F;  4I6G A;  1V9D A;  1LVF A;  2BKO A;  2VL0 A;  1E90 A;  4U2Y A;  3QK6 A;  4JI8 T;  4PK6 A;  5AQN B;  4HRN A;  5B1A E;  1N32 T;  2XS8 A;  3GN5 B;  3CIA A;  2CEA A;  5ITZ F;  1H6O A;  5LGT B;  4LNG A;  2VWA A;  5IY5 E;  1UN9 A;  1INZ A;  4HOR A;  3NBX X;  4PUC A;  1AJ3 A;  4U63 A;  1E2A A;  2UUA T;  4X5T A;  2KCL A;  1N9A A;  5TAO A;  4X64 T;  5FYM A;  4ZI3 D;  2J4G A;  1WM5 A;  2BBH A;  2KC7 A;  3Q9N C;  3D9P A;  3H3M A;  4ANJ A;  3UQ4 A;  4DR4 T;  2BG9 B;  2PM6 A;  3DXM G;  5CEA A;  2BG9 C;  3EDU A;  5FQ7 A;  3LG7 A;  3PUA A;  4GK5 E;  2AWI A;  3MKQ A;  3SS1 A;  3EDT B;  4AY6 A;  3E22 E;  3UT5 E;  4DMV A;  2GK9 A;  1IHB A;  5LMU T;  4FC8 A;  4LG6 A;  4D10 C;  3FUE A;  5HI7 A;  3SGH A;  2P9K G;  4OVV A;  4YTM A;  2WBL A;  2LOP A;  2NP9 A;  3F2E A;  1NWM X;  3ABL E;  5C1D A;  3FTV A;  2VK9 A;  2PFV A;  2L9B A;  2H6H A;  3E32 A;  2XGO A;  4JHK A;  3UUM A;  3L17 A;  4DLQ A;  4U7E B;  1DU2 A;  2XQ0 A;  4L7T A;  5EKQ D;  4UVC B;  3CHR A;  4HI8 A;  3RAU A;  4IE5 A;  3AEG A;  4ILI A;  4C48 B;  5FKY A;  2KAT A;  3ZU7 B;  4CGW A;  1N0R A;  5KJM A;  3C3O A;  2G0U A;  5JDG A;  4ABN A;  4AKR B;  3TLU A;  4P0A A;  3TLT A;  1WY6 A;  2WQ6 A;  2VUR A;  2CM0 A;  3UKU G;  1T72 A;  1NL4 A;  3K3Q C;  4H7X A;  4F53 A;  3S4U A;  4MS6 A;  1KPS B;  4KVO A;  3BG1 B;  4AKI A;  3PEV B;  4LF7 T;  5ABF B;  3ZCJ A;  4F6R C;  1Z5S C;  4JI7 T;  2J4B A;  3EU5 A;  1U3C A;  5CBN A;  2I59 A;  2RPA A;  2MTQ A;  3HXE A;  5G55 A;  2X6I A;  2LE8 A;  3M65 A;  2IUB A;  5FZS A;  4IDO A;  4BA9 A;  4COF A;  3DSX A;  3FH8 A;  5AQH B;  4UF0 B;  5LMN T;  2XGM A;  5IUX A;  1RZ4 A;  3ZHE A;  5DQW A;  3BQO A;  4ZHB A;  2XAG B;  1N34 T;  2V6Y A;  3D0T A;  4JEH A;  2GRN B;  4F1S A;  3PRE A;  4I43 B;  1MNE A;  1H0A A;  2VAS A;  5FT9 A;  3Q79 A;  1VDY A;  4IUL A;  3DWL G;  2YDR A;  4UV8 B;  3PJA J;  4KI0 F;  5BXU A;  5FXX A;  2VKO A;  3NZS A;  4P0B A;  5AQJ B;  1S64 A;  3Q5M A;  5HCJ A;  3MX3 A;  2PBI A;  3TWX A;  5T3R A;  5LG4 A;  2XAQ B;  4JI4 T;  1PC2 A;  2ZGG A;  4H63 V;  2YDQ A;  2JRK A;  4G24 A;  4IRE A;  3CX7 B;  4Q96 A;  4TWH A;  4A98 A;  5L3D B;  4U04 A;  4TXQ A;  4UWG A;  5HWY A;  3L8R A;  3NAW A;  4N3C A;  5AQF B;  3JC6 D;  1U4Q A;  2Q7F A;  4YND A;  4HBD A;  4CZ2 D;  3SFX A;  1TJC A;  3UUB A;  1UX5 A;  1E7U A;  3G06 A;  2EIM E;  2JMH A;  2X0Y A;  2XRZ A;  2LNI A;  2E9X D;  2W00 A;  2OOE A;  3E34 A;  3LK4 2;  4LML A;  4WW0 A;  2FUL A;  5ENO D;  4ANV A;  4IIJ E;  1E8Z A;  3D9M A;  3MKD A;  5HQ8 A;  3C5R A;  1T7S A;  2OA5 A;  4EHM A;  2LSV A;  3SFD A;  3I3N A;  3JQ1 A;  4J8F A;  5JJ6 A;  4UUC A;  3MYV A;  3H3A A;  3OYZ A;  3UMV A;  3FFL A;  2HH7 A;  2LHN A;  4TZ4 C;  1SZ9 A;  4CN1 A;  5AQ7 A;  4BEP A;  2A9U A;  3N9M A;  4O4J E;  5M72 A;  1X9B A;  1IBK T;  4GMJ A;  3LYA A;  5D2M C;  3HXB A;  4GAA A;  5KXJ A;  5CGM A;  1D8E A;  3C98 A;  4ILG A;  4YDW A;  3AAE B;  4FI5 A;  4JI5 T;  4ILU A;  3UQ7 A;  2WQ7 A;  4K5A B;  1XGW A;  2V5D A;  4I1M A;  3C3R A;  3RLF F;  3SFY A;  5JDH A;  4Q94 A;  3EUH A;  4YSY A;  3TXM A;  3I4G A;  3TLS A;  4CI1 B;  2IAK A;  3IEE A;  1WLX A;  3A8Y C;  5C2Y A;  3ZYK A;  4UVB B;  3IHY A;  2LKG A;  3LS8 A;  3Q75 A;  3CVV A;  1W0B A;  1FT2 A;  1UK5 A;  3QOF A;  2L9Q A;  2BKP A;  5CFB A;  2CWY A;  2UU9 T;  3KD7 A;  4BY6 A;  2Y48 B;  3TL5 A;  3RRM B;  3UM2 A;  2KZ7 B;  3CQG B;  3NKZ A;  3NRY A;  4YJ3 E;  1T98 A;  4KHP T;  2A3D A;  2CHN A;  2VSN A;  3EIQ C;  2VVS A;  2LSI A;  3C4X A;  4B93 B;  3V2X A;  4GZ5 A;  1LRZ A;  4EXT A;  3ESK A;  2UUB T;  3HG0 D;  3HI2 A;  4FLB A;  3PE0 A;  2LO6 A;  5JJT A;  4O1P A;  4URK A;  1Y6I A;  4YHJ A;  2M6I A;  2DIW A;  3TWW A;  1QQE A;  4OYS A;  2L6J A;  2IML A;  4RSY A;  4GYW A;  5B1B E;  4WBO A;  3RQW A;  2D9D A;  3AE4 A;  1BU9 A;  5JA4 D;  4IGU A;  3UM1 A;  3ZN0 B;  3Q5W A;  3IF8 B;  4TRQ A;  3ONL A;  1BR4 A;  4JL0 A;  2E2A A;  1SA4 A;  2OEW A;  2IHR 1;  1O5M A;  3O9X A;  3VTX A;  3B7T A;  3P8C D;  3SRZ A;  3VRB A;  3AG4 E;  5JH7 E;  1HG5 A;  1UJK A;  3AED A;  2KM4 A;  2Z6E A;  1BR0 A;  3ASN E;  3E4B A;  2NW8 A;  1N95 A;  5T4Y A;  3JUE A;  4QHO A;  1MMD A;  4UIG A;  4QXH B;  2XEH A;  3C51 A;  3UM3 A;  1S0P A;  2IY0 C;  3R9M A;  4JVS A;  4AIU A;  2D5U A;  4OVU A;  2LOS A;  4E85 A;  1VCT A;  2XQ4 A;  2WXG A;  4YTN A;  2WXM A;  2AXD S;  4DV7 T;  2W4X A;  4TV8 E;  3OXF A;  4UI9 J;  1EPU A;  1N4P A;  1N33 T;  3RO2 A;  2VSX E;  2CBI A;  1RW2 A;  5G04 J;  1FMW A;  2X3M A;  2NC9 A;  3FHN A;  5KBA A;  5JJ7 A;  3AA6 B;  1IYG A;  4I55 E;  4GIW A;  1XMQ T;  3DRA A;  4B8C B;  1HNZ T;  5LHI B;  4CYM D;  3HKD E;  3ZGQ A;  1OED A;  2KCK A;  4GZ3 A;  2CBJ A;  4GYS A;  3CX6 B;  4J8D A;  4KHZ F;  3PU3 A;  5FWQ A;  3PH0 C;  5ARG A;  5L3C B;  4UI9 C;  1WRD A;  3OBV E;  4LUN U;  4N39 A;  3QAR A;  4M1P A;  1OWL A;  4GOU A;  4PW8 A;  3JXJ A;  4CDM A;  1YQ4 A;  3AA0 B;  3CST A;  1N94 A;  5G04 C;  4EOZ B;  4BX8 A;  5AQQ B;  2VQE T;  5M4Y A;  2KCV A;  4L2Y A;  1N52 A;  3UQ3 A;  1R8I A;  3U78 A;  3PUS A;  5AQI B;  1I94 T;  3FEY A;  4Q25 A;  4EZ4 A;  4B3M T;  3KS2 A;  5F8P A;  2L6B A;  2XEV A;  5FQ8 A;  5G2N A;  5ENR D;  3I9Y A;  1NEK A;  4IDP A;  1N54 A;  4U96 D;  4APF A;  4ANW A;  3U3W A;  5CB4 E;  4J7W A;  4LF8 T;  2WXL A;  4TX5 A;  1DCQ A;  4GZD A;  2BKK B;  4OAV B;  4G23 A;  3AS5 A;  2JQ9 A;  3C3Q A;  2Y8D A;  4O2A E;  3CVR A;  3BU8 A;  1MIW A;  4HLL A;  2BS3 A;  4CXY A;  2QVA A;  3FU0 A;  3LY9 A;  4KT6 B;  2HN1 A;  2W63 A;  3B7B A;  3Q5D A;  5ABG A;  2E0I A;  4KYO B;  5JRE A;  1ZBP A;  3V30 A;  4YSX A;  1B7T A;  4L9P A;  4I2Z A;  1E8W A;  2XQ3 A;  1DVP A;  3UFG A;  3PZ3 A;  2EHO B;  2DZO A;  1JPL A;  2IU1 A;  3MGB A;  2P9U G;  4LER A;  5AQT B;  4N5Q A;  4WNG A;  3CK6 A;  1OCO E;  5AYW D;  4DJA A;  4CXX A;  3EHZ A;  4QH1 A;  2V6X A;  3SY2 A;  5CRU A;  5JRC A;  4JI3 T;  3DBS A;  3KV5 A;  1HG2 A;  1E7P A;  3A7M A;  1MX2 A;  2WXP A;  1M7K A;  1D8D A;  1OCC E;  2EIN E;  3RHW A;  4GKK T;  2MPK A;  4IN3 B;  2W66 A;  2JJ9 A;  2GRL A;  1NZN A;  3D9I A;  4LNU D;  2PQR A;  3OAW A;  5D0O D;  2F37 A;  2R17 C;  2X6J A;  1VCS A;  3KVA A;  2BS4 A;  1X5B A;  3LXU X;  3UFE A;  1L0V A;  2FEZ A;  3CPZ A;  5FP3 A;  5CJ5 A;  2XPZ A;  3D3M A;  4CZZ B;  2ZM2 A;  3FTW A;  3E37 A;  4DI4 A;  3SHF A;  3CKC A;  1H2U A;  1MIY A;  4O2B E;  4NXN T;  3MZK B;  2J08 A;  2P9P G;  2XM1 A;  2I1J A;  4YY3 T;  2XJ7 A;  1TYQ G;  3Q5E A;  2KND A;  5BPP A;  3PZ1 A;  3AEA A;  2V8S E;  3Q49 B;  4TXP A;  3MK7 C;  1NI1 A;  3PZ4 A;  4W9R A;  1G73 A;  1IJ6 A;  2VJ8 A;  3TGO A;  2WXO A;  4C0M A;  3AS8 A;  3FZM B;  3FH7 A;  5DBK A;  4U95 D;  1LF8 A;  2XPI A;  4A1S A;  4ASK A;  2XS1 A;  1ZHC A;  4EZL A;  4APO A;  3FZH B;  3N9L A;  3F6Q A;  4XI0 A;  1E7V A;  3PNL B;  4DVD A;  4TV3 A;  1GQE A;  2LM9 A;  4ACL A;  3FU3 A;  3NWI A;  4QKN A;  3W9F A;  4TXR A;  2V5F A;  4F3V A;  4HWD A;  2IC9 A;  3EHN A;  4ILA A;  3O48 A;  3IBP A;  2WDQ A;  3C4Z A;  3FTX A;  3MKR A;  1JCS A;  3FDH A;  2RD0 A;  2H89 A;  4ILC A;  4QQI A;  1SVX A;  2NYJ A;  3LVQ E;  5ANR A;  3UU5 A;  2BED A;  4IRU A;  4AJW A;  4OFZ A;  2LXM A;  3GW4 A;  1H7C A;  4O4I E;  4YT0 A;  1HU3 A;  1D0X A;  3ZPJ A;  5IYZ E;  5ANL A;  4HOT A;  2FJD A;  5L3F B;  2VGX A;  1ZV4 X;  1CUN A;  1TNB A;  2X6K A;  4U0Z A;  3ZMS B;  3ZYL A;  3SZ7 A;  4HRL A;  4YJ2 E;  1FCH A;  3AXJ B;  5IWA T;  4U3C A;  2X6F A;  3ZT5 A;  3PUJ A;  1LD8 A;  2H6G A;  4HTE A;  1G8X A;  4EZJ A;  5CA1 E;  5JDM A;  1XWM A;  3ZCI A;  2WPV A;  4RLY A; 
#chains in the Genus database with same CATH homology
 2BVM A;  4ZOL E;  3RRU A;  1ZKE A;  5BW8 C;  2PM7 A;  2VYI A;  5FY0 A;  4XZ4 A;  5E75 A;  3CML A;  2H7V C;  1JUQ A;  5LNK A;  4ADZ A;  5H6R B;  5AFU L;  3B7R L;  4FU3 A;  5A7D B;  1VOM A;  4EYY R;  4UQX A;  4EBA G;  3VTY A;  1YKH B;  4UEL A;  4CXW A;  3FU5 A;  2W0G A;  1KLX A;  4IYP A;  1KT0 A;  4I50 E;  3NZU A;  4XKC A;  4IHJ E;  4V3I A;  3CVU A;  5LCW C;  4DI3 A;  1MMN A;  3PEU B;  5JR9 A;  2XHE B;  3KAE A;  3KBT A;  4JHR A;  1UN8 A;  2CHW A;  2CCQ A;  2A2F X;  3FUL A;  3GZS A;  3MA9 A;  2HPL A;  2D2S A;  3AA1 B;  4JZY A;  4KBQ A;  2OVF A;  2IOL A;  5LOV E;  3L3P A;  2Q9Q B;  4RG9 A;  2Q9Q C;  4GYR A;  4J6I A;  1US7 B;  5LHH B;  3FBZ A;  4TUY E;  4WWO A;  3GN5 A;  4IE4 A;  2ZLY A;  4WNK A;  5BMV E;  3KFW X;  2LSJ A;  5LBM A;  4AQG A;  4CQI A;  4U72 A;  4UWF A;  2XAF B;  5FNV E;  1Y8M A;  1FEW A;  4ZS3 A;  3EVY A;  4FJY A;  4EBA A;  5FQ4 A;  5BV1 A;  4WAF A;  2MBG A;  3RX6 A;  3ZEF B;  1BR2 A;  5CMY A;  3GA8 A;  4H7Y A;  2H7O A;  3QDN A;  4G63 A;  3LKU A;  3SFZ A;  4AP2 A;  4I17 A;  3FBL A;  4ANX A;  3J9X 1;  2XPY A;  4J2C A;  3U9W A;  4GK0 E;  2L3L A;  3SD5 A;  4X1I E;  5JDQ A;  3CK9 A;  3FHE A;  4KMC A;  2EHO D;  2CMR A;  5GON E;  2WVI A;  1NA0 A;  3IKO B;  3JQ0 A;  1OWO A;  3PDN A;  5CA0 E;  1Y64 B;  3HKB E;  4KUM B;  2I6H A;  2LEH A;  2Y6X A;  4H9Q C;  4EPZ A;  2P9B A;  3N9N A;  3TKL B;  5FY7 A;  4FHK A;  2ODV A;  2NW7 A;  2PZI A;  5EDS A;  3GZ2 A;  3OXG A;  2UY1 B;  3N9Q A;  4CGV A;  3AU4 A;  1UCU A;  2K48 A;  3G2T A;  4GYY A;  2X9H A;  2CXF A;  2I2O A;  3RRN B;  3APC A;  4UEM A;  3RRW A;  2I9C A;  2DCP A;  4LRZ A;  4DBQ A;  4PFP A;  4UF0 A;  4J8E A;  3RKO A;  4CEM A;  2V7L A;  4GML A;  2FI7 A;  2DWG A;  4XE0 A;  2AXV A;  3UUX B;  1E8Y A;  1TEZ A;  3N9O A;  3HYM B;  2XCC A;  4I43 A;  1E96 B;  4ZI7 E;  4KP3 C;  4JEU B;  2WAU A;  4U0S A;  2VSO E;  3AAI A;  1IHG A;  3PUG A;  1Z0P A;  3U3I A;  4ZI2 D;  5BV0 A;  3CSF A;  1WAO 1;  3LDZ A;  3R7Q A;  5LP0 A;  4QXC B;  2VTB B;  3IEG A;  3N71 A;  3URZ A;  3KV4 A;  3G2U A;  3RH3 A;  3UT4 A;  1YW0 A;  1MND A;  2VQ2 A;  3MJX A;  1HE8 A;  4AM9 A;  2Y4T A;  4HVB A;  2ZM8 A;  3F31 A;  2CG3 A;  3C50 A;  4RVB A;  2X0L B;  2NTY A;  4Z8X A;  1UG3 A;  5AJD A;  2X6H A;  3MV3 B;  1QNF A;  3N9P A;  2LSK A;  4YFS A;  3ZPO A;  4WWN A;  2X9W A;  2V7K A;  4FLH A;  3ETU A;  2EQX A;  4X1K E;  4UWK A;  4LCT A;  1MMA A;  2X51 A;  4CI2 B;  3Q2M A;  2D0T A;  2IJG X;  3QJZ A;  1DNP A;  3LY8 A;  4CT0 A;  4WWP A;  4N3A A;  4TN7 B;  4P29 A;  5KCM A;  4OYK A;  3MEK A;  3T5X A;  3I4R B;  2Y4U A;  4QXB B;  3CK8 A;  1HXI A;  3JYS A;  3TXN A;  4DK5 A;  3P2B A;  3UT7 A;  4XZC A;  2CA5 A;  3IHR A;  1MIV A;  4O6F A;  4BTA A;  4PS8 A;  3FWV A;  4OHF A;  4QX7 B;  1P5Q A;  3S2A A;  2YQ8 A;  4HFG A;  4E7S A;  5CMW A;  3WAJ A;  4HXI A;  3Q47 B;  2PQN A;  3ETV A;  3ASF A;  2HPJ A;  3OJA A;  1HCI A;  4PJJ A;  3CQX C;  5LBQ B;  4OYJ A;  4AKG A;  3HL6 A;  4HKA A;  5CHE E;  4RG6 A;  4ATG A;  1B89 A;  3FUK A;  5L3G B;  2J9Q A;  4HFV A;  4KZC A;  4UWL A;  4AVX A;  5FZQ A;  2Q9Q D;  4MAL A;  3FXE B;  1ZEE A;  4A3T A;  1O3X A;  2BVL A;  5FXV A;  2HO1 A;  5BNW A;  3O1I A;  1HO8 A;  3CHO A;  4L23 A;  2E8I A;  2I1K A;  3FY4 A;  1D0Y A;  4IE6 A;  3D9L A;  2WXH A;  1X79 A;  2QFC A;  4GA0 A;  3VKH A;  4JA7 A;  2WM9 A;  4GA1 A;  4JPS A;  3ZN3 A;  3QUJ A;  3RO3 A;  4PS3 A;  4QFV A;  2J1D G;  4EB6 E;  2BUG A;  2HYZ A;  4BWR A;  2NWB A;  1H2T C;  2R5S A;  5ARF A;  1NA3 A;  4EIW A;  1D1B A;  5EX3 A;  2NOX A;  3CK7 A;  5DJQ C;  1HZ4 A;  2CXD A;  4N3B A;  2ES0 A;  4H9O C;  3C4W A;  1IZN B;  2DI4 A;  4MFR A;  4JUY A;  3FEX A;  2YIN A;  3PE3 A;  2WQH A;  3QWP A;  3R84 B;  2XGS A;  4U07 A;  1QZ2 A;  3ANW B;  2AXU A;  5EK4 A;  1QUU A;  2AXZ A;  4JLE A;  2X9Y A;  1W3B A;  2X38 A;  4ZI3 C;  3ZJ2 A;  5T8I A;  1Z6T A;  3ZJ1 A;  2QY7 A;  3NF1 A;  1OWN A;  3U64 A;  1YKE B;  5JHA A;  3TG5 A;  2ZMA A;  3C64 A;  4ANU A;  3GMI A;  1D1A A;  3B13 A;  1S94 A;  2WMN A;  3PUQ A;  4UQY A;  3OXL A;  2V7M A;  4L2L A;  3ULQ A;  2IW5 B;  1BR1 A;  4DPR A;  2EHO A;  4UV9 B;  5DIZ A;  3QKY A;  4MBQ A;  2NW9 A;  3VHL A;  1HFA A;  2C5K T;  4BT9 A;  2YNQ A;  3QC1 A;  2P58 C;  3LPZ A;  3UX4 A;  4DMW A;  3BG0 B;  3UUN A;  4XKB A;  3TG4 A;  2WXI A;  3FUN A;  3CVN A;  3DTO A;  3O1J A;  3B7U X;  4AIF A;  1SA0 E;  3ASH A;  3FXD B;  3APD A;  2ION A;  1SZA A;  3RK6 A;  4G11 A;  3EDV A;  3LBX B;  4KZ0 A;  4P09 A;  1IAP A;  3S7D A;  5JHB A;  2YHC A;  4KBM B;  2VB6 A;  2DHR A;  2YHE A;  2UXN B;  3APF A;  4Y6C A;  4IE0 A;  4EAH A;  1UX4 A;  2GW1 A;  2CWO A;  4B6X A;  4X1Y E;  3BQI A;  5EK2 A;  1HF8 A;  3AS4 A;  3BQK A;  2XUE A;  2GRM A;  3NQP A;  3ZW3 A;  3ZC1 A;  3IBE A;  3Q5X A;  4KMO A;  5J2U E;  3HIZ A;  4NQ0 A;  3FUI A;  3UPV A;  5LP6 E;  3ENE A;  3S7F A;  3HVE B;  3CGH A;  4NRH B;  1LVK A;  3R7R A;  3E08 A;  3HKE E;  4JXT A;  2WWU A;  2N1G A;  4FAD A;  5LFA A;  2YEV C;  3B7S A;  4IDZ A;  3FH5 A;  5FXW A;  4ZS2 A;  2KIN B;  3JC6 C;  3MAC A;  4N78 D;  4HS2 A;  3CVY A;  5J2T E;  2K9A A;  2WB2 A;  2LSU A;  3PDY A;  4L1B A;  3D9K A;  1VRB A;  2E9X B;  3UTK A;  4AQF A;  4A1G A;  3VLF A;  3AVS A;  2E9X C;  2VGX B;  3ZXS A;  2FBN A;  4EYU A;  5J08 A;  3FB2 A;  5LCW J;  1HS6 A;  2CE7 A;  1KT1 A;  4XAX B;  2DNX A;  2WXF A;  3QC9 A;  3UUL A;  3EIJ A;  2ILR A;  2IFU A;  3N5L A;  4B94 A;  3G2S A;  3LFM A;  4WNF A;  4HEA A;  2PG8 A;  3ZRH A;  3U66 A;  4OK0 A;  2MYS A;  4CDN A;  3ZMV B;  4UWH A;  4EEC A;  4DND A;  2L0I A;  4C0E A;  1H6K A;  4MKT A;  2JMK A;  3P1U A;  4B8A A;  1EYH A;  2KZT B;  2D0U A;  2XCB A;  3V5S A;  3G2W A;  5E0O A;  3L6A A;  3T8O A;  2QGS A;  2ODU A;  5HXH A;  3ASD A;  2XHE A;  1FVF A;  2KXP B;  3GWH A;  3ZYM A;  4U0U A;  4C90 A;  3SBT B;  3VLE A;  4G2V A;  4NUR A;  5FZR A;  5EK3 A;  4HOS A;  1UW4 B;  3U4T A;  3LJC A;  5JR9 C;  4G25 A;  1MHQ A;  3I9W A;  4FJZ A;  4FJO A;  2YK0 A;  5L2L A;  3CHP A;  1HX8 A;  2Q9Q A;  3HHM A;  4PAG A;  4B0Z A;  4XI9 A;  2A72 A;  5FMN A;  3LY7 A;  2K5B B;  5AJL A;  5KJN A;  2ZU6 B;  3D9J A;  3MZL B;  4X20 E;  4GB9 A;  5FTP A;  2J09 A;  3JUI A;  2OV8 A;  1JWF A;  3K3N A;  2ACX A;  4H9N C;  3ZMU B;  3SF4 A;  3OTN A;  4PK4 A;  5DAB A;  1XNF A;  3VU7 H;  1GW6 A;  3LEW A;  4I6J A;  5AIJ A;  3HA4 A;  4HE8 A;  5HXS A;  5ENN A;  5LX8 A;  5LGU B;  3MKQ B;  3ZEF A;  3S7J A;  1OXZ A;  5JDF A;  4N5C A;  3D9O A;  2K24 A;  3I1A A;  2UXX B;  3IHV A;  4PDX A;  3FTZ A;  2BTD A;  2DBA A;  4BSX A;  4K0U A;  2ZM0 A;  4WNE A;  3N2K E;  4ZHQ E;  1E8X A;  4UVA B;  1JWG A;  2M67 A;  1SHZ C;  4MLK A;  5JVD E;  2LT3 A;  4A55 A;  3MXZ A;  1EDU A;  2OND A;  4I1O B;  1OWP A;  3RJV A;  4AKL A;  5CCL A;  2J4D A;  3DP7 A;  5JDL A;  3L08 A;  4B89 A;  5EZY E;  3RYH E;  1ZU2 A;  3TAX A;  5KMG P;  2DCF A;  3RYI E;  4CT4 A;  2OVB A;  4L9I A;  2XAH B;  5KJK A;  2C0M A;  5FY1 A;  3QK0 A;  5E76 A;  2UY1 A;  3R9A B;  4J0U A;  2LHR A;  2MOW A;  5LYJ E;  5LJN A;  2E2E A;  4IST A;  4PJL A;  2NXP A;  3CHS A;  2UWJ G;  1KNZ A;  4CRW A;  3PUK A;  1BPO A;  3CHM A;  4PS7 A;  3RYF E;  4CCA A;  4BTB A;  3L54 A;  5J90 A;  3NZP A;  4O4L E;  4JHJ A;  3ZHE B;  3UUX A;  2KT9 A;  1IQR A;  1E1H B;  2VKJ A;  4JEH B;  2BZB A;  4M3O A;  5HXE A;  4U8H A;  2J07 A;  5LOZ A;  4E6H A;  1OWA A;  3CLJ A;  1HH8 A;  3PE4 A;  4JEU A;  4KVM A;  4NAC A;  1D0Z A;  2C5J A;  3N2O A;  5A1L A;  2PL2 A;  4N2S A;  5JQG E;  3PRZ A;  2VTB A;  2VKH A;  1ELK A;  1KK7 A;  4H63 H;  4AXH A;  3QWV A;  3RYC E;  4G26 A;  2J49 A;  2RA1 A;  4BJN A;  3B57 A;  3FUD A;  4FHJ A;  3KBU A;  4EQF A;  4YVQ C;  1S35 A;  3KV6 A;  4HOQ A;  2KWH A;  4PJM A;  3SNX A;  5FJY A;  2XTL A;  3ML9 A;  2WXK A;  3IV0 A;  1Z3X A;  4UI9 K;  1YD8 G;  5ADX L;  3FUM A;  2C2L A;  4JC8 A;  4GPK A;  2JLB A;  3CVL A;  3FTS A;  3CV0 A;  3VLD A;  4Y6W A;  2WMO A;  5HYA A;  2N9D A;  3ASG A;  2SPC A;  4PFO A;  3PZD A;  1NP7 A;  1HS7 A;  4AKH A;  1EF1 C;  4WBN E;  3PUR A;  3I5P A;  3P7I A;  2CG2 A;  4AOF A;  3RC3 A;  3C98 B;  3MV2 B;  3F57 A;  4GZC A;  2L8K A;  2V7J A;  2A5U A;  2V7I A;  2CHZ A;  3EHM A;  3FTU A;  5A6C A;  4U74 A;  3RRC A;  3Q15 A;  3KV9 A;  3H37 A;  5EX0 A;  4AEZ C;  4XBF B;  1L5J A;  3RU0 A;  4UXN B;  4E7Z A;  4BT8 A;  4FA6 A;  3O4Z A;  4UQZ A;  4XIF A;  4WND A;  4GZ6 A;  4H9P C;  3PNT B;  3S7B A;  2X67 A;  2X66 A;  3ONX A;  4DLO A;  5H6Q B;  2VKD A;  4FP7 A;  4I4T E;  3K8P C;  1MQS A;  3PS6 A;  1IJ5 A;  3N2G E;  3AA7 B;  4AXP A;  5HAX A;  2CHX A;  3RKV A;  4AV7 A;  2MHK A;  3RPU A;  1WR6 A;  2L0T B;  4GCO A;  4H9R C;  2VL8 A;  2FO7 A;  3KDS E;  3TJP A;  2IQC A;  3A5X A;  3E0Z A;  2WXR A;  3BQL A;  3O1H A;  4G1T A;  4DBR A;  3FUJ A;  2X9X A;  3QAQ A;  3QB2 A;  1EZ3 A;  4GCN A;  3KIN B;  3WI3 A;  3ZYQ A;  4TV9 E;  5LA6 E;  3OKQ A;  3CVQ A;  3NZQ A;  3L13 A;  4CDR A;  1OUV A;  4EZK A;  4MLP A;  3ZVV A;  2PJQ A;  4I6E A;  3PTR B;  4NUV A;  3DPD A;  2R59 A;  2XAJ B;  2JEK A;  4ILH B;  4QWN B;  4EZH A;  4O4H E;  1UJJ A;  3PU8 A;  2WXJ A;  2CXL A;  1PY1 A;  3FUH A;  3MCX A;  3SWH A;  3Q9D A;  4PJN A;  4HN9 A;  4F7A A;  4GYO A;  4LEU A;  5LXT E;  3OYX A;  3CKB A;  3SOL A;  3O4X E;  3L09 A;  4JA9 A;  1D1C A;  2CFU A;  4QX8 B;  5DQV A;  5J1G A;  2LAI A;  4MRU A;  1QSD A;  3AAA B;  3AU5 A;  2WSS V;  2V4L A;  4I1A A;  2N2N A;  5C8Y E;  3SBS A;  3LVR E;  4GU5 A;  3ANW A;  1A17 A;  1FMV A;  4AI6 A;  2YU1 A;  4K0R A;  5HWX A;  4O8S A;  2HM8 A;  1TJF A;  4DO0 A;  2MOZ A;  2RP4 A;  2GGF A;  3QWW A;  5KX5 E;  3MA5 A;  1WYC A;  3HDX A;  4BX9 A;  5ETW A;  2KWI B;  3LJ3 A;  3QNK A;  5LCY A;  4GA2 A;  2H3R A;  3RC8 A;  1FVH A;  4KXK B;  4PH4 B;  4HLE A;  3FUF A;  5FXZ A;  2CLY B;  2IOS A;  4C9B B;  3ONK A;  2IF4 A;  2CLY C;  2FF4 A;  4PNI A;  3FU6 A;  4NUU A;  3DJB A;  5KDM C;  3CEQ A;  2V1D B;  1PAQ A;  2EHO C;  3V5U A;  4R7L A;  3ZIM A;  1NAF A;  4BAY B;  3I0O A;  2VGY A;  1IQU A;  2C0L A;  5A23 A;  5JRC B;  2JQQ A;  3BK9 A;  3CX8 B;  3T8M A;  2C5I T;  2B1E A;  3CVP A;  3CKD A;  5JDN A;  3UT8 A;  4L5G A;  3CVX A;  4I2W A;  4WUY A;  2IC6 A;  1H2V C;  2V26 A;  1Z3Y A;  3GYZ A;  5L3E B;  3CQC B;  3ZC0 A;  3PVL A;  3RIB A;  1ELW A;  3LBX A;  5BT1 A;  3LK3 B;  3LCA A;  4XX5 A;  3HKC E;  4HGA A;  4A56 A;  4BFR A;  3D9N A;  2JPF A;  4J8S A;  3ZMT B;  3QOU A;  4I9E A;  3J7Y q;  2LJL A;  4ERR A;  4PK5 A;  2DWK A;  1LKX A;  2M63 A;  2Y3A A;  3WAK A;  3CWZ B;  4ME2 A;  4FUL A;  3R6N A;  3ZFW A;  5L3B B;  5LJM A;  2VSY A;  5HXC A;  4HOU A;  5G05 J;  3ML8 A;  3T5V A;  5HXR A;  4ZI2 C;  3HVE A;  4CI3 B;  2WXN A;  5LHG B;  3SI5 A;  4N2Q A;  3CVW A;  3BEE A;  5CCM A;  2W61 A;  2C0S A;  3MJW A;  3NRX A;  1FIO A;  3Q4A B;  4I9C A;  2AVP A;  2YU2 A;  3CR3 A;  2DLR A;  2KLQ A;  2AW6 A;  5G05 C;  3K3O A;  3CHQ A;  1OWM A;  1SQM A;  4G2A A;  2NTX A;  2LSY A;  2E9X A;  3G2V A;  2KMF A;  5KJL A;  1U5P A;  5AEN A;  5F3J A;  4V1A v;  5D0Q D;  2V0P A;  1U3D A;  2XAS B;  4AQF C;  5LGN B;  4MHC A;  3ZLI A;  4AY5 A;  2XQY A;  5FQ6 A;  4ACK A;  4L0R A;  2BF0 X;  2NSZ A;  3JCK C;  3VKG A;  3ZN1 B;  1H19 A;  2A4Z A;  4A3V A;  4Q69 A;  2X68 A;  3FTY A;  2CFZ A;  3WXX A;  1YA0 A;  3GZ1 A;  4K03 A;  3AVR A;  4YVO A;  1WYB A;  3FP3 A;  2QA7 A;  2WXQ A;  2LAH A;  3K9I A;  4IE7 A;  2HR2 A;  3ZMZ B;  2KZT A;  4JW1 A;  3HR0 A;  3LK2 B;  5IHY A;  4YLH A;  2LSG A;  4BJM A;  1MMG A;  3ESL A;  5JR9 B;  2MRI A;  4TUU A;  3L16 A;  5BUZ A;  2RG8 A;  2BDE A;  4H9S E;  4C91 A;  3I0Q A;  3AB3 B;  3L22 A;  3KEZ A;  1ELR A;  4ISS A;  2XRY A;  3EJN A;  2W62 A;  3KVB A;  3W15 B;  1HTJ F;  4I6G A;  1V9D A;  1LVF A;  1E90 A;  3QK6 A;  4PK6 A;  3CIA A;  3GN5 B;  2CEA A;  5LGT B;  2VWA A;  1UN9 A;  1INZ A;  4HOR A;  3NBX X;  4PUC A;  1AJ3 A;  4U63 A;  2KCL A;  5TAO A;  5FYM A;  4ZI3 D;  1WM5 A;  2KC7 A;  3D9P A;  4ANJ A;  2PM6 A;  3EDU A;  5FQ7 A;  3LG7 A;  3PUA A;  4GK5 E;  2AWI A;  3MKQ A;  3SS1 A;  3EDT B;  4AY6 A;  3E22 E;  3UT5 E;  4DMV A;  2GK9 A;  4FC8 A;  4D10 C;  3FUE A;  5HI7 A;  3SGH A;  4OVV A;  2WBL A;  2LOP A;  2NP9 A;  3F2E A;  1NWM X;  5C1D A;  3FTV A;  2VK9 A;  2PFV A;  2L9B A;  2XGO A;  4JHK A;  3UUM A;  3L17 A;  4DLQ A;  2XQ0 A;  4L7T A;  5EKQ D;  4UVC B;  3CHR A;  4IE5 A;  4ILI A;  2KAT A;  4CGW A;  5KJM A;  2G0U A;  5JDG A;  4ABN A;  4AKR B;  4P0A A;  1WY6 A;  2WQ6 A;  2CM0 A;  3K3Q C;  4H7X A;  4F53 A;  3S4U A;  4MS6 A;  4KVO A;  3BG1 B;  4AKI A;  3PEV B;  3ZCJ A;  4F6R C;  2J4B A;  1U3C A;  2I59 A;  2MTQ A;  5G55 A;  2X6I A;  2LE8 A;  3M65 A;  5FZS A;  4BA9 A;  3FH8 A;  4UF0 B;  2XGM A;  3ZHE A;  5DQW A;  2XAG B;  3D0T A;  4JEH A;  4F1S A;  3PRE A;  4I43 B;  1MNE A;  1H0A A;  2VAS A;  5FT9 A;  1VDY A;  4IUL A;  4UV8 B;  5FXX A;  2VKO A;  3NZS A;  4P0B A;  3Q5M A;  3MX3 A;  2PBI A;  5T3R A;  5LG4 A;  2XAQ B;  1PC2 A;  4H63 V;  2JRK A;  4G24 A;  3CX7 B;  4Q96 A;  5L3D B;  4U04 A;  4UWG A;  5HWY A;  4N3C A;  3JC6 D;  1U4Q A;  2Q7F A;  4YND A;  1TJC A;  1UX5 A;  1E7U A;  2JMH A;  2XRZ A;  2LNI A;  2E9X D;  2W00 A;  2OOE A;  3LK4 2;  4WW0 A;  4ANV A;  2FUL A;  4IIJ E;  1E8Z A;  3D9M A;  3MKD A;  5HQ8 A;  2OA5 A;  2LSV A;  3I3N A;  3JQ1 A;  4J8F A;  5JJ6 A;  3MYV A;  3H3A A;  3OYZ A;  3UMV A;  3FFL A;  2HH7 A;  2LHN A;  4TZ4 C;  1SZ9 A;  3N9M A;  4O4J E;  5M72 A;  4GMJ A;  3LYA A;  4GAA A;  3C98 A;  4ILG A;  3AAE B;  4FI5 A;  4ILU A;  2WQ7 A;  1XGW A;  4I1M A;  5JDH A;  4Q94 A;  3EUH A;  3TXM A;  3I4G A;  4CI1 B;  2IAK A;  3IEE A;  1WLX A;  5C2Y A;  3ZYK A;  4UVB B;  3IHY A;  3LS8 A;  3CVV A;  2L9Q A;  3KD7 A;  2CWY A;  4BY6 A;  2Y48 B;  3TL5 A;  3RRM B;  2KZ7 B;  3CQG B;  3NRY A;  4YJ3 E;  1T98 A;  2A3D A;  2VSN A;  3EIQ C;  2LSI A;  3C4X A;  4GZ5 A;  1LRZ A;  4EXT A;  3ESK A;  3HI2 A;  4FLB A;  3PE0 A;  2LO6 A;  5JJT A;  4URK A;  1Y6I A;  4YHJ A;  2DIW A;  1QQE A;  4OYS A;  2L6J A;  4RSY A;  4GYW A;  4WBO A;  4IGU A;  3ZN0 B;  3Q5W A;  3IF8 B;  4TRQ A;  3ONL A;  1BR4 A;  4JL0 A;  3O9X A;  3VTX A;  3B7T A;  3P8C D;  3SRZ A;  5JH7 E;  1HG5 A;  1UJK A;  2KM4 A;  2Z6E A;  1BR0 A;  3E4B A;  2NW8 A;  5T4Y A;  4QHO A;  1MMD A;  4UIG A;  4QXH B;  3C51 A;  1S0P A;  4JVS A;  4OVU A;  2D5U A;  2LOS A;  4E85 A;  2WXG A;  2WXM A;  4TV8 E;  3OXF A;  4UI9 J;  1EPU A;  3RO2 A;  2VSX E;  5G04 J;  1FMW A;  2X3M A;  2NC9 A;  3FHN A;  5JJ7 A;  3AA6 B;  1IYG A;  4I55 E;  4GIW A;  4B8C B;  5LHI B;  3HKD E;  3ZGQ A;  2KCK A;  4GZ3 A;  4GYS A;  3CX6 B;  4J8D A;  3PU3 A;  5FWQ A;  3PH0 C;  5ARG A;  5L3C B;  4UI9 C;  1WRD A;  3OBV E;  4LUN U;  4N39 A;  3QAR A;  4M1P A;  1OWL A;  4GOU A;  4PW8 A;  4CDM A;  3AA0 B;  3CST A;  5G04 C;  4EOZ B;  4BX8 A;  5M4Y A;  2KCV A;  4L2Y A;  1N52 A;  3UQ3 A;  3U78 A;  3PUS A;  3FEY A;  4EZ4 A;  3KS2 A;  5F8P A;  2XEV A;  5FQ8 A;  5G2N A;  3I9Y A;  1N54 A;  4APF A;  4ANW A;  3U3W A;  5CB4 E;  2WXL A;  4TX5 A;  4GZD A;  4G23 A;  3AS5 A;  2Y8D A;  4O2A E;  3CVR A;  1MIW A;  4CXY A;  3FU0 A;  3LY9 A;  4KT6 B;  2W63 A;  2E0I A;  4KYO B;  5JRE A;  1ZBP A;  1B7T A;  4I2Z A;  1E8W A;  1DVP A;  2EHO B;  1JPL A;  2IU1 A;  3MGB A;  4LER A;  4WNG A;  5AYW D;  4DJA A;  4CXX A;  5JRC A;  3DBS A;  3KV5 A;  1HG2 A;  2WXP A;  4IN3 B;  2JJ9 A;  2GRL A;  1NZN A;  3D9I A;  2PQR A;  3OAW A;  5D0O D;  2R17 C;  2X6J A;  3KVA A;  1X5B A;  3LXU X;  3UFE A;  2FEZ A;  3CPZ A;  5FP3 A;  2XPZ A;  3D3M A;  4CZZ B;  2ZM2 A;  3FTW A;  4DI4 A;  3SHF A;  3CKC A;  1H2U A;  1MIY A;  4O2B E;  3MZK B;  2J08 A;  2I1J A;  2KND A;  5BPP A;  2V8S E;  3Q49 B;  3MK7 C;  4W9R A;  1G73 A;  1IJ6 A;  2VJ8 A;  3TGO A;  2WXO A;  4C0M A;  3AS8 A;  3FH7 A;  5DBK A;  1LF8 A;  2XPI A;  4A1S A;  4ASK A;  1ZHC A;  4EZL A;  4APO A;  3N9L A;  4XI0 A;  1E7V A;  3PNL B;  4DVD A;  4TV3 A;  2LM9 A;  4ACL A;  3FU3 A;  4QKN A;  2V5F A;  4F3V A;  2IC9 A;  3EHN A;  3O48 A;  3IBP A;  3C4Z A;  3FTX A;  3MKR A;  3FDH A;  2RD0 A;  3LVQ E;  5ANR A;  4IRU A;  4AJW A;  4OFZ A;  3GW4 A;  1H7C A;  4O4I E;  1HU3 A;  1D0X A;  3ZPJ A;  5IYZ E;  5ANL A;  4HOT A;  2VGX A;  5L3F B;  1ZV4 X;  1CUN A;  2X6K A;  4U0Z A;  3ZMS B;  3ZYL A;  3SZ7 A;  4YJ2 E;  1FCH A;  2X6F A;  3PUJ A;  4HTE A;  1G8X A;  4EZJ A;  5CA1 E;  5JDM A;  3ZCI A;  2WPV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...