2V0PA

The structure of tap42 alpha4 subunit
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
234
structure length
219
Chain Sequence
MASVTEQFNDIISLYSTKLEHTSLRQDSPEYQGLLLSTIKKLLNLKTAIFDRLALTIDDVSTASIKFLAVDYYLGLLISRRQSNDSDVAQRQSMKLIYLKKSVESFINFLTLLQDYKLLDPLVGEKLGNFKDRYNPQLSELYAQPKNNKDLSGAQLKRKEKIELFQRNKEISTKLHCLELELELLRELYLMRLHHFSLDTINNIEQNLFECEMLSNFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords TYPE 2A PHOSPHATASE-ASSOCIATED PROTEIN 42
publication title The Structure of Tap42/Alpha4 Reveals a Tetratricopeptide Repeat-Like Fold and Provides Insights Into Pp2A Regulation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 85
structure length 219
sequence length 234
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.540 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2v0pA00
4IYPA 3QC1A 2V0PA
chains in the Genus database with same CATH superfamily
3KS2A 2J09A 3LDZA 5CBNA 3OXGA 2IO3C 2IJGX 4QFVA 3P1UA 5BUZA 3LYAA 1OWNA 1SA4A 5DIZA 3G2VA 3JQ0A 2CFZA 1N4QA 3L6AA 3CIAA 4B8CB 2P9PG 2BKKB 3ISMC 1KZOA 2LSVA 2EIJE 1UJKA 4J0UA 5BT1A 4KT6B 2L6BA 4GTOA 2LXLA 3PUJA 4AV7A 2FBNA 3UX4A 1FPPA 4TRQA 1NA3A 2XHEA 2J07A 2CHZA 3ASFA 1N0QA 3MZLB 3QWPA 4YDEA 5M72A 3OXFA 4LCTA 4FHKA 1K1BA 3IHVA 1V54E 5LX8A 3S7DA 2F8YA 4PS8A 3ZIMA 3QK0A 1LD8A 4F3VA 3NB2A 3CVWA 2R05A 1UN9A 3ZGQA 4KZCA 2B0OE 4XI9A 3PE4A 3BEEA 5KNHD 1DNPA 1D8EA 3HXEA 1O1RA 3VLEA 2XZDG 3ESLA 4MBGA 1YCSB 5CBOA 2L6JA 1MX2A 3EU9A 3D9OA 2YHEA 3X2QE 3ASNE 3U64A 5CMYA 4HOSA 4JHJA 3NAWA 5LCWC 3MA5A 3PEUB 1ELWA 1TNOA 4N5CA 3V30A 4HB5A 1SA5A 1X81A 3T8MA 3W9FA 3Q4AB 4U0ZA 1H6OA 5KJKA 1ZBPA 3DSSA 4EECA 4ABNA 3CR3A 1OWOA 2I9CA 3D9PA 4R7LA 4I2ZA 2NYJA 1LD7A 3MKQA 5HKPA 5LCWJ 2KCKA 3EHMA 3L54A 1OWLA 2CFUA 4XI0A 3EHRA 2VJ8A 3IBEA 4OAUC 2J49A 2Y69E 4GZCA 4JHKA 2VSXE 4TUUA 4K03A 3CK8A 4BESA 3LY7A 4L9PA 3UKRG 3TG4A 3LJNA 5BPPA 3DEPA 2VSOE 4WWOA 2Q7FA 4CT4A 1AWCB 4XKCA 3Q79A 1N9AA 3R9AB 5FIOA 5E76A 4IYPA 4GU5A 4XX5A 4U63A 3AG1E 2Y4TA 2F8XK 3TWUA 2XEHA 3D9MA 1WAO1 5T4YA 3SY2A 1OCCE 2WXKA 4AOFA 4KYOB 4BETA 1K1AA 4B93B 4DX7D 5CECB 1N4SA 1OCOE 2J8SD 3N71A 2GROB 2A5UA 3UM2A 3FFLA 4GTVA 4ILIA 4FC8A 1O5MA 4DRXE 2HYZA 4XEIG 1IKND 1O1TA 4L1BA 3B7TA 4ATGA 1OWMA 4JHRA 4LERA 3L22A 1SZ9A 4M7CA 4GTTA 3EIJA 3UM0A 1S63A 2AWIA 4AM9A 3HRAA 3QDNA 3TGOA 1Y6IA 4K0RA 5ENPD 3FU6A 3NOGD 4DI3A 2C0MA 5CERB 1BPOA 3GW4A 5ARFA 2DYRE 4HOTA 2IU1A 3Q47B 4LG6A 4JA7A 4C9BB 5G2NA 1TEZA 4G24A 3HXBA 3CVXA 2UY1A 3TAXA 2GW1A 5ENSD 5JA4D 1L5JA 2UWJG 3FUHA 3QAQA 3Q78A 2GRNB 4RQIA 2R5SA 1KLXA 3AJIA 1XGWA 5BXOA 3PZ3A 2KCVA 5FZSA 3ULYA 2JABA 3T8KA 4V3IA 3TJPA 4CZ2D 2YINA 3FY4A 3RRNB 4APOA 4J7WA 1TR4A 3JUEA 1SVXA 2IO2C 2VQ2A 2VSNA 2R03A 2ETBA 2GRQB 4GA1A 3BQOA 2DCPA 5D0QD 4GTMA 4FJZA 3RU0A 2V5FA 3RO3A 3C72A 4J6IA 3UUXA 1IQUA 2XZTG 2DVWA 5ENNA 4B89A 2MHKA 2P2CP 5EN5D 2XENA 4XE0A 1FCHA 5FZQA 3RJVA 3ZRHA 2LAIA 2V0PA 4NACA 3EU5A 2NSZA 3HVEB 3UXGA 1W3BA 5BW8C 4CDRA 1IXVA 4XZ4A 3KEAA 3S7JA 4DUIA 1JPLA 3FU0A 4HI9A 4BX9A 5KCMA 1FVHA 3E4BA 1OCRE 3ESKA 2KC7A 1YMPA 5HRYA 3V31A 4H7YA 2I1JA 2L0TB 4LNUD 3G2WA 2V4LA 3FU5A 3NOCD 4HVBA 3HXFA 4MRUA 4HLEA 3UPVA 3FEYA 4HOUA 5FINA 1OT8A 3CHRA 2JLBA 5FT9A 3CEQA 2P9UG 2R17C 2L9BA 1ELRA 4O60A 2RFAA 3LY9A 2XEVA 1WY6A 4HI8A 4G2VA 4OVUA 3RSEG 2ILRA 2PQNA 5CMWA 4F1SA 2RKKA 1P5QA 2F0YA 2ZU6B 4IRUA 4A3TA 3DSXA 4DX6D 4I6EA 4HRLA 3LCAA 3TWWA 5CEDB 3CHOA 1JCSA 3ZKJA 5LFAA 2ONDA 3ZN3A 3FHEA 3CVNA 3NBNB 5ANLA 1D8DA 2BUGA 4GYYA 1H6PA 4GYWA 5AJLA 1TJCA 2QZAA 5JJTA 3AS8A 4K5BA 4GA2A 4IULA 3ZNGA 4DPRA 1X5BA 3E37A 4FA6A 3JUIA 4I9EA 3KAEA 3CVLA 3PS6A 3CQGB 4J8SA 2BF0X 1TJFA 2NXPA 5A23A 2DWZA 3HG0D 3DXKG 2OV8A 2X6HA 1O1SA 3WG7E 4U0UA 3OTNA 4HFGA 2DZOA 3ABKE 1N4RA 4AEZC 3O48A 5KNGA 1A5EA 3SZ7A 2AXUA 1SZAA 4AXHA 4MS6A 3ASGA 4UWFA 4TXPA 3CVPA 2B6CA 2RFMA 1MYOA 3RIBA 1UW4B 2IONA 2H6FA 4A63B 1H2TC 2QYUA 3QARA 4BFRA 1E7VA 1H0AA 3APCA 3ZXSA 4YVOA 2WXOA 3UIOC 1KPSB 4W9RA 3QC1A 1MJ0A 3PREA 1HFAA 4I17A 3L17A 3Q49B 3E32A 2DIWA 1IYGA 3DRAA 3HVEA 3DSUA 3Q9NC 3PZ4A 4AVXA 3I4RB 3SFZA 4I1MA 3SFXA 1FT1A 2KBXA 3CGHA 2IFUA 4ZHBA 3JXJA 3TWTA 4F6RD 3Q7FA 4L7TA 4ANUA 3PZDA 2YNQA 1JWGA 2VGYA 2UY1B 1VDYA 3EJNA 1H6KA 3Q15A 4N5QA 3ONLA 5BNWA 3TWQA 5AENA 3CVUA 2OEVA 2KATA 4WNEA 1JCQA 4DLOA 1BD8A 5J08A 1TN7A 3FTSA 3CVYA 5E75A 3GZ2A 2BTDA 3QNKA 3C5RA 3U3WA 1NA0A 3EDTB 3AAAC 2FO1E 1TNUA 3NF1A 3FTYA 5FQ8A 5JHAA 2WXGA 4YDOA 4EZKA 1K3ZD 4OVVA 3ABLE 3MJWA 2WB2A 4JVSA 5AQ7A 4KVMA 1YYHA 4CGWA 3IEGA 1BI7B 3MGBA 4I2WA 3TG5A 5EIDA 4N3CA 3TXNA 3CHSA 3FUMA 3FWVA 2RD0A 3V79K 2AJAA 3RRMB 4UQXA 4CCAA 1KT0A 2IQCA 3C3QA 2PM7A 4O6FA 2FO7A 4HOQA 2WVIA 3PEVB 3OXLA 4DJAA 4L2LA 2H6HA 3CVVA 4ANWA 4I6GA 2V5QC 1WM5A 4LRZA 4LEUA 1EF1C 4ANXA 4GZ6A 3R7RA 2CHXA 3AG2E 3ASDA 4PUCA 3TWSA 3FH7A 4NURA 3D3MA 3KSLA 5AARA 5ANRA 1DCEA 1OUVA 4BY6A 3ZEFA 3MCXA 2A5EA 1Z5SC 2VGEA 4GAAA 2E0IA 3UM3A 1N54A 3LEWA 1IHBA 2KZTB 4Z68A 5AIJA 2WXIA 4RVBA 5LP0A 4Y6WA 3RO2A 2I6HA 3E34A 3LXUX 3LPZA 3E30A 2ETAA 4FJYA 4GB9A 1Z3YA 4UI9C 3CQCB 1N94A 4L2YA 1GW6A 4RG9A 1IHGA 1DVPA 4GMRA 4N2SA 1WDYA 1A17A 3MKRA 3VLFA 3ULQA 4LSZE 3I4GA 3QJZA 3ZXPA 1JCRA 4U7EB 4WNFA 4JL0A 4G25A 3B95A 5CRUA 3FTVA 4CT0A 3CHQA 4BTAA 2FF4A 4NIKA 4UI9J 5H7PA 4U8VD 3QB2A 2LXMA 1MX6A 3D9IA 4I9CA 1LTXA 3B7BA 4N2QA 1RZ4A 3T5VA 5KBAA 4DI4A 3CKCA 3UTMA 1S0PA 5B3SE 3U4TA 3ONKA 3J5PA 4UQZA 5D0OD 4DX5D 4AIFA 4PH4B 1OWPA 3V2XA 3L9TA 4JXTA 4TUMA 3IV0A 3B7RL 3ULEG 3BG0B 2CG3A 1MHQA 5ARGA 1RW2A 2V4HC 4I1OB 4CDNA 5FZRA 2WXJA 3BUAA 2EQXA 3TWXA 3JQ1A 1U2VG 3NQPA 4CDMA 4UQYA 3FTZA 2EIKE 3CVQA 4FP7A 5EYLA 4BEPA 2P9KG 1E7UA 2GGFA 1PY1A 3E33A 3R9MA 3FUFA 3UT7A 3FH5A 3IKOB 3HDXA 4ILHB 5D2MC 4OAVB 4HLLA 3HXDA 4FU3A 4G1TA 2RG8A 5AQBA 3T9KA 3I5PA 5G55A 3TXMA 1FVFA 2ZGDA 3PE3A 2V8SE 3CKBA 3QOUA 3ZU7B 3FULA 4GPKA 1K8KG 4GCNA 3EHNA 4C0MA 5JHBA 2X6JA 3SI5A 2FI7A 2LAHA 2XCCA 4GMLA 2WQHA 1UOHA 3ABME 5KJMA 3PH0C 4KZ0A 5B1BE 5C2YA 2LNIA 2A4ZA 3DSVA 1H2UA 4JZYA 2VSYA 2XRZA 4AJWA 4DX2A 3PRZA 2WXNA 3IXEA 2CG2A 4WAFA 1EYHA 3SBSA 2AXVA 2XGMA 4EPZA 2GRRB 1QNFA 2KZTA 4L23A 2WMNA 2IOSA 4GTPA 1UG3A 4CGVA 3Q7AA 1KZPA 3VTYA 4ANVA 2PM6A 2XQ0A 2XGSA 4ILGA 4HS2A 4K5AB 3FP3A 1E8ZA 3KEZA 4G11A 5BXUA 3RK6A 5KWDA 2M63A 1V55E 1D9SA 2PL2A 4JB8P 2MYOA 5ENRD 4D10C 2VGXB 1N95A 4F1PA 3SF4A 1HXIA 3SO8A 5AJDA 3GZ1A 4PDXA 4WNDA 3PVLA 3L16A 2FULA 1BI8B 4BTBA 3FTXA 5EX3A 3AU5A 2HO1A 5G04C 2XCBA 3B13A 3G2SA 4GZ3A 2F37A 2X3MA 1HH8A 3C3RA 3DEOA 2L0IA 3VLDA 4B8AA 3G2TA 3Q73A 2OCCE 4BT8A 4BERA 1HX8A 4J8FA 2AXZA 3DXMG 4GTQA 5EKQD 2OVBA 3UI2A 3FH8A 3AG3E 3SD5A 5CHEE 2GRLA 2J9QA 1G3NB 2PZIA 4GTSA 5BV1A 5CCLA 4YVQC 2WXMA 2QC9A 3MX3A 4GCOA 3R7QA 1OCZE 5BV0A 3UM1A 1MQSA 3ZYKA 5G04J 4U95D 3G2UA 5AN8A 2P9SG 5KJLA 4I1AA 2GRMA 4G26A 1B89A 4OYSA 3ML8A 3MYVA 5D66A 3W9GA 3RRUA 1AP7A 1TN6A 1BLXB 4J8DA 3QWWA 1UN8A 2J08A 3D9HA 4C48B 4EHMA 4KXKB 1XNFA 1EDUA 3ZVVA 4CRWA 2XPYA 1Z6TA 3TWRA 2XS8A 1JUQA 3NZSA 3UT8A 2FEZA 4RLYA 4EBAA 2NC9A 2ZISA 3SHFA 2YHCA 1LF8A 2XS1A 3RAUA 1FT2A 4N39A 1SW6A 2WM9A 4E85A 3SGHA 1S70B 3ZPJA 2OEWA 1Y8MA 3APFA 1IQRA 2QYJA 2DZNA 5T3RA 3CSTA 4HBDA 3PZ1A 3S2AA 2OVFA 4U8YD 4K5CA 5AQ9A 3PDNA 4UWGA 1H19A 1H2VC 4F7AA 2X6IA 4TXRA 3ZW3A 4BWRA 1HG2A 3EIQC 4HRNA 1NP7A 4A1SA 3TWVA 3QKYA 2BEDA 4APFA 1BU9A 2Y1LE 3B7SA 3WXXA 3LKUA 4JW1A 3GZSA 1HE8A 4C0EA 4QQIA 3BU8A 3DPDA 4JD2G 3FEXA 3UMVA 4HXIA 5AAOA 3AS4A 2XRYA 2P9LG 4M3OA 4UUCA 2XGOA 1E96B 1HG5A 4A55A 3PNTB 3FTWA 5A7DB 3C3OA 4I43A 5CCMA 1HO8A 2VGXA 4FULA 4FHJA 1DCQA 2DBAA 3S7FA 3ASHA 5JJ7A 2WXFA 3AS5A 4ACKA 5EIBE 3FUIA 3UQ3A 4RSYA 4BX8A 4WWPA 4U96D 2KCLA 4MLPA 4O1PA 4UWKA 3D9LA 1JWFA 3L08A 4GZDA 3APDA 3PNLB 1TYQG 5ITZF 2EILE 1INZA 2AVPA 3LVQE 3T5XA 1QZ2A 3D9JA 2I1KA 4F53A 3HHMA 4HNAD 4MKTA 2AW6A 2WQ7A 2VTBB 2WXPA 5C1DA 5EDSA 3HXCA 1HZ4A 4GMJA 3FUEA 4ZFHA 4WWNA 3RKVA 1YA0A 1N52A 2QFCA 5IY5E 4HORA 5EX0A 4DX1A 3P2BA 4KVOA 3JCKC 1TN8A 2Y4UA 4XKBA 4JEUA 4DLQA 1E8YA 1E8XA 3JYSA 2HM8A 3ZHEB 4HQDA 2E2EA 4EBAG 3ZUVB 2LO6A 3NZUA 3QWVA 1QYMA 3JXIA 3ASOE 4LNGA 2IY0C 3FDHA 4UWHA 2GRPB 1NZNA 1U3CA 3ZYLA 3FUDA 4URKA 4GTRA 2MRIA 1NFIE 4CYMD 2WMOA 3KSQA 3FTUA 4TXQA 4AY5A 5EYPF 3Q75A 4GPMA 4BSZB 1QQEA 3LVRE 2KXPC 1Q2ZA 2WQ6A 4WUYA 4JA9A 5FTPA 1NL4A 3K9IA 3C98A 1NI1A 5EILA 3ENEA 1N4PA 1TNZA 4AY6A 5KJNA 3LY8A 2R2LA 2OOEA 3PUKA 3U9WA 3ZFWA 5ENQD 3BG1B 1KT1A 4AP2A 2WXHA 5CRVA 1SQMA 3KD7A 2IEJA 1HU3A 4O1OA 1PC2A 4U8HA 4BSXA 4ME2A 4IN3B 5FJYA 4EZLA 3OAWA 1HS6A 4I6JA 1E90A 3B7UX 1DC2A 2HE0A 2X6KA 2ZIRA 3DWLG 5A6CA 4NRHB 2WXLA 1OXJA 5ENTD 2EINE 4DK5A 4JPSA 2H6IA 1ZU2A 3LS8A 5AQAA 3Q5MA 3DSWA 5G05C 3FUJA 2XEEA 4U0SA 4A1GA 3ZYQA 4J8EA 5HS0A 3AU4A 3HIZA 3VTXA 5B1AE 3MEKA 2C0LA 4G8LA 3FUNA 1TNYA 2J4BA 2R59A 3SFYA 1OY3D 4XIFA 4KMOA 4A3VA 5CEAA 1S64A 2C2LA 2JEKA 3DBSA 1ELKA 4P29A 4X8QA 4FLBA 4N3BA 5G05J 4FADA 2ETCA 1PAQA 5JMND 3DPYA 2H6GA 4Q94A 2LSUA 4Q69A 3MV3B 4UWLA 1EPUA 5HI7A 4B0ZA 3MV2B 3HYMB 2VTBA 5AYWD 5ENOD 3V2OA 3GYZA 2BKGA 2WXQA 4Y6CA 3LJ3A 3D9NA 3ZYMA 5FQ4A 4G23A 4PS7A 3PZ2A 5DBKA 4HRMB 2XPIA 2DYSE 4CEMA 3FUKA 3UT4A 4U07A 2X6FA 4ATZD 4U04A 4KBQA 1E8WA 3ZHEA 1HF8A 3ML9A 3CK7A 2PQRA 1TNBA 3L13A 5FQ7A 4G8KA 4YDWA 3U66A 3UKUG 5J90A 2WPVA 2KM4A 2R02A 3SQVA 1MZCA 4UI9K 2WXRA 3CSFA 3CHPA 3L82A 2Y0BG 2ZGGA 2QY7A 4LUNU 3J5QB 2P9NG 1QBQA 2P9IG 4JEHA 4WNGA 4GYOA 3URZA 3AG4E 3CHMA 2MOWA 3FU3A 3IHYA 4FLHA 3CV0A 2P58C 3Q9UC 2IF4A 4TV3A 3EUVA 3I3NA 4YDYA 3CK9A 1U3DA 5HQ8A 3F6QA 3O4ZA 2ZXWE 3EHQA 4JC8A 1N0RA 1N11A 3MKQB 4EQFA 3SNXA 5T8IA 4EZJA 4YNDA 3TL5A 2Y3AA 2VYIA 3UINC 4GZ5A 4J8YA 2PNNA 4NQ0A 4GA0A 2I2OA 5FWQA 4ACLA 2EIME 3UIPC 1MX4A 2XPZA 2CHWA 4RG6A 2IOLA 5JJ6A 4B94A 4H7XA 4E6HA 2YQ8A 3S7BA 4N3AA 2J4DA 4BT9A 3D9KA 3CLJA 4Q96A 2X38A 1Z3XA 2LUHA 1UJJA 2HR2A 5LOZA 1ZB1A 3SBTB 5FQ6A 1WG0A 4PS3A 4LNBA 3DSTA
chains in the Genus database with same CATH topology
1WY6A 3KS2A 2AVPA 2CG3A 4G2VA 2J09A 3LDZA 4OVUA 2ILRA 3LVQE 3OXGA 3T5XA 1QZ2A 3D9JA 1MHQA 2I1KA 4F53A 2IJGX 5ARGA 4I1OB 2PQNA 4QFVA 3P1UA 3HHMA 5BUZA 4CDNA 5FZRA 5CMWA 2WXJA 3LYAA 1OWNA 2EQXA 2AW6A 4MKTA 5DIZA 1P5QA 3JQ1A 2ZU6B 3G2VA 3JQ0A 4IRUA 2CFZA 4A3TA 3NQPA 2VTBB 4I6EA 3L6AA 3CIAA 4CDMA 2WXPA 4UQYA 4B8CB 5C1DA 5EDSA 3LCAA 1HZ4A 3FTZA 4GMJA 3CHOA 3FUEA 3CVQA 4FP7A 4WWNA 5LFAA 2ONDA 3ZN3A 3FHEA 3CVNA 5ANLA 2LSVA 2BUGA 3RKVA 1E7UA 1UJKA 4J0UA 5BT1A 4KT6B 4GYYA 2GGFA 4GYWA 1YA0A 1N52A 2QFCA 5AJLA 1PY1A 4HORA 1TJCA 5EX0A 3FUFA 3UT7A 3FH5A 3IKOB 5JJTA 3AS8A 3PUJA 4AV7A 3P2BA 3HDXA 2FBNA 4ILHB 4KVOA 3JCKC 2Y4UA 3UX4A 4GA2A 4TRQA 4IULA 4XKBA 4DPRA 1NA3A 4JEUA 1X5BA 2XHEA 4DLQA 4FU3A 2J07A 2CHZA 1E8YA 1E8XA 3JYSA 4G1TA 2RG8A 2HM8A 3ASFA 3MZLB 3QWPA 5M72A 3OXFA 4LCTA 3ZHEB 4FHKA 2E2EA 4FA6A 3IHVA 4EBAG 3I5PA 3JUIA 4I9EA 3KAEA 5G55A 3TXMA 5LX8A 3CVLA 3S7DA 2LO6A 1FVFA 3NZUA 3QWVA 3QK0A 4PS8A 3PS6A 3PE3A 3ZIMA 2V8SE 3CQGB 3CKBA 3QOUA 4F3VA 3FULA 4J8SA 2BF0X 4GPKA 1TJFA 3FDHA 4GCNA 3EHNA 4UWHA 2NXPA 4C0MA 5A23A 5JHBA 3CVWA 2X6JA 1UN9A 3SI5A 1NZNA 1U3CA 2FI7A 2LAHA 3FUDA 3ZGQA 4KZCA 3ZYLA 2XCCA 4URKA 2MRIA 4GMLA 2WQHA 2OV8A 2X6HA 4F1SA 4U0UA 2WMOA 4XI9A 3FTUA 3OTNA 4AY5A 4HFGA 3PE4A 3BEEA 5KJMA 3PH0C 4KZ0A 1QQEA 4AEZC 3O48A 1DNPA 3LVRE 5C2YA 2LNIA 3SZ7A 2A4ZA 2AXUA 1SZAA 2WQ6A 4WUYA 3VLEA 1H2UA 4AXHA 4MS6A 3ESLA 3ASGA 4JA9A 4JZYA 5FTPA 4UWFA 2VSYA 3K9IA 2XRZA 3C98A 3CVPA 4AJWA 3PRZA 2L6JA 3ENEA 3RIBA 1UW4B 2IONA 3D9OA 4AY6A 1H2TC 2WXNA 2YHEA 5KJNA 3LY8A 2OOEA 2CG2A 3PUKA 3U64A 3U9WA 4WAFA 1EYHA 5CMYA 4HOSA 3QARA 4JHJA 3SBSA 2AXVA 3ZFWA 4BFRA 2XGMA 5LCWC 4EPZA 1E7VA 3MA5A 3PEUB 1H0AA 3APCA 3BG1B 1QNFA 1ELWA 4N5CA 2KZTA 4L23A 3ZXSA 1KT1A 4AP2A 4YVOA 2WXHA 2WXOA 2WMNA 2IOSA 1UG3A 4CGVA 1SQMA 3KD7A 3T8MA 4W9RA 1HU3A 3QC1A 3Q4AB 4U0ZA 3VTYA 3PREA 4ANVA 2PM6A 2XQ0A 5KJKA 1ZBPA 1PC2A 4U8HA 2XGSA 4ILGA 4BSXA 4ME2A 4HS2A 4IN3B 5FJYA 1HFAA 4EECA 4I17A 4EZLA 3OAWA 4ABNA 3CR3A 1HS6A 3FP3A 3L17A 3Q49B 1E8ZA 1OWOA 2I9CA 3D9PA 3KEZA 4G11A 4I6JA 3RK6A 2DIWA 1E90A 3B7UX 4R7LA 1IYGA 4I2ZA 2M63A 2X6KA 5A6CA 3HVEA 3MKQA 2PL2A 5LCWJ 4NRHB 2KCKA 2WXLA 3EHMA 4D10C 3L54A 1OWLA 2VGXB 2CFUA 4XI0A 4AVXA 2VJ8A 3I4RB 3IBEA 4I1MA 3SFZA 4DK5A 3SF4A 4JPSA 3CGHA 1ZU2A 2IFUA 3LS8A 1HXIA 2J49A 3GZ1A 5AJDA 4L7TA 4GZCA 4JHKA 2VSXE 4PDXA 4ANUA 3Q5MA 3PZDA 4TUUA 4K03A 5G05C 3CK8A 3LY7A 3FUJA 4WNDA 2YNQA 4U0SA 3PVLA 3TG4A 4A1GA 5BPPA 1JWGA 2VSOE 3ZYQA 4J8EA 2VGYA 2UY1B 3AU4A 3HIZA 3L16A 2FULA 3MEKA 4WWOA 2C0LA 1VDYA 3EJNA 3VTXA 2Q7FA 4BTBA 1H6KA 3FUNA 3Q15A 2J4BA 2R59A 3FTXA 3ONLA 5EX3A 4CT4A 5BNWA 5AENA 3CVUA 4XKCA 3AU5A 2HO1A 3R9AB 5G04C 4XIFA 2XCBA 4KMOA 2KATA 3B13A 4WNEA 4A3VA 3G2SA 4IYPA 5E76A 4GZ3A 4GU5A 4XX5A 4DLOA 4U63A 5J08A 2C2LA 2Y4TA 2X3MA 1HH8A 3D9MA 1WAO1 2JEKA 5T4YA 3DBSA 1ELKA 2L0IA 3FTSA 4P29A 3VLDA 3G2TA 4B8AA 4BT8A 3CVYA 1HX8A 3GZ2A 2WXKA 4J8FA 5E75A 4AOFA 2BTDA 3QNKA 4KYOB 2AXZA 5EKQD 2OVBA 4FLBA 3U3WA 1NA0A 3FH8A 3SD5A 4N3BA 5CHEE 3EDTB 2GRLA 5G05J 2J9QA 3N71A 2PZIA 4FADA 1PAQA 5BV1A 5CCLA 4YVQC 4Q94A 2A5UA 2LSUA 4Q69A 3NF1A 3FTYA 5FQ8A 2WXMA 3MV3B 3FFLA 5JHAA 2WXGA 4EZKA 4ILIA 3MX3A 4UWLA 4FC8A 4OVVA 4GCOA 3R7QA 1EPUA 5HI7A 2HYZA 4B0ZA 5BV0A 3MJWA 2WB2A 4JVSA 3MV2B 4L1BA 4KVMA 3B7TA 4ATGA 1MQSA 3ZYKA 5G04J 4CGWA 3HYMB 1OWMA 4JHRA 4LERA 2VTBA 5AYWD 3L22A 3G2UA 1SZ9A 3IEGA 3MGBA 4I2WA 3EIJA 3TG5A 4I1AA 2GRMA 5KJLA 3GYZA 4G26A 1B89A 4N3CA 4OYSA 3CHSA 3ML8A 2WXQA 3TXNA 3MYVA 3FUMA 3FWVA 4Y6CA 3LJ3A 3D9NA 3ZYMA 5FQ4A 2AWIA 4AM9A 2RD0A 4G23A 4PS7A 3QDNA 5DBKA 4UQXA 3RRMB 3TGOA 1Y6IA 4K0RA 4CCAA 1KT0A 2IQCA 3RRUA 2PM7A 3FU6A 4DI3A 2XPIA 2C0MA 4O6FA 1BPOA 2FO7A 3GW4A 4HOQA 4J8DA 5ARFA 2WVIA 3QWWA 4HOTA 1UN8A 2IU1A 3PEVB 3OXLA 2J08A 4KXKB 4DJAA 1XNFA 4L2LA 3Q47B 4CEMA 3CVVA 4ANWA 4I6GA 1EDUA 3FUKA 4JA7A 3UT4A 4U07A 3ZVVA 1WM5A 4C9BB 2X6FA 4U04A 4KBQA 5G2NA 1TEZA 4G24A 3CVXA 1E8WA 2UY1A 4LRZA 3TAXA 3ZHEA 4CRWA 2XPYA 1HF8A 2GW1A 4LEUA 3ML9A 1EF1C 3CK7A 1L5JA 2PQRA 1Z6TA 2UWJG 3L13A 3FUHA 1JUQA 3NZSA 4ANXA 3UT8A 2FEZA 4GZ6A 3R7RA 3QAQA 4EBAA 2NC9A 2CHXA 5FQ7A 3SHFA 3ASDA 4PUCA 2R5SA 2YHCA 1KLXA 3U66A 5J90A 3FH7A 1LF8A 4NURA 1XGWA 2WPVA 3D3MA 2KM4A 4N39A 2KCVA 5FZSA 4UI9K 5ANRA 2WXRA 3CSFA 1OUVA 4BY6A 3CHPA 2WM9A 4V3IA 3ZEFA 3MCXA 4E85A 2QY7A 3TJPA 3SGHA 2YINA 4GAAA 3ZPJA 3FY4A 2E0IA 4LUNU 2WQ7A 3RRNB 4APOA 1Y8MA 3APFA 1N54A 3LEWA 5AIJA 2KZTB 1IQRA 2VQ2A 2VSNA 2WXIA 4RVBA 5T3RA 3CSTA 5LP0A 4GA1A 4Y6WA 3S2AA 2DCPA 4JEHA 5D0QD 4WNGA 4GYOA 4FJZA 3RO2A 2I6HA 2OVFA 3RU0A 2V5FA 3RO3A 3URZA 3LXUX 3CHMA 2MOWA 1H19A 3FU3A 3IHYA 3PDNA 4FLHA 4J6IA 3CV0A 3LPZA 4UWGA 3UUXA 1IQUA 1H2VC 2P58C 4F7AA 2X6IA 2IF4A 4TV3A 5ENNA 3ZW3A 3I3NA 4FJYA 4B89A 2MHKA 1Z3YA 4GB9A 4UI9C 3CQCB 3CK9A 4BWRA 1U3DA 1HG2A 5HQ8A 4XE0A 3EIQC 1FCHA 1NP7A 3O4ZA 4A1SA 5FZQA 4L2YA 1GW6A 4JC8A 3RJVA 3ZRHA 2LAIA 2V0PA 4NACA 3HVEB 2NSZA 3MKQB 3QKYA 1W3BA 4RG9A 1IHGA 5BW8C 4CDRA 1DVPA 4XZ4A 4N2SA 4EQFA 4APFA 1A17A 3S7JA 3MKRA 3SNXA 5T8IA 3ULQA 3VLFA 3B7SA 3I4GA 4EZJA 4YNDA 3QJZA 3TL5A 3WXXA 1JPLA 3LKUA 4JW1A 3GZSA 1HE8A 3FU0A 4WNFA 2Y3AA 2VYIA 4C0EA 4JL0A 3DPDA 4G25A 4GZ5A 4BX9A 3FEXA 3FTVA 3UMVA 4HXIA 4CT0A 5KCMA 3AS4A 3CHQA 4NQ0A 2XRYA 4GA0A 2I2OA 5FWQA 4BTAA 2FF4A 1FVHA 3E4BA 4ACLA 4M3OA 2XGOA 4UI9J 1E96B 3ESKA 1HG5A 2KC7A 2XPZA 2CHWA 3QB2A 4A55A 3PNTB 3FTWA 4H7YA 2I1JA 3D9IA 5A7DB 2L0TB 4RG6A 2IOLA 5JJ6A 3G2WA 4B94A 4H7XA 4I43A 4I9CA 2V4LA 4E6HA 5CCMA 4N2QA 1HO8A 2VGXA 3FU5A 4FULA 3T5VA 4DI4A 4FHJA 2YQ8A 3S7BA 3CKCA 4N3AA 1S0PA 2J4DA 4HVBA 2DBAA 4BT9A 4MRUA 3U4TA 3S7FA 3ASHA 3D9KA 3CLJA 4HLEA 2WXFA 3AS5A 3FEYA 5JJ7A 4Q96A 3UPVA 2X38A 1Z3XA 4ACKA 3FUIA 4HOUA 3ONKA 3UQ3A 3CHRA 1UJJA 4RSYA 2HR2A 4BX8A 4WWPA 2JLBA 4UQZA 5LOZA 5FT9A 3CEQA 2KCLA 2R17C 4MLPA 2L9BA 5D0OD 4UWKA 4AIFA 3D9LA 4PH4B 1ELRA 1OWPA 1JWFA 3L08A 4GZDA 3SBTB 5FQ6A 4JXTA 3APDA 3PNLB 3IV0A 4PS3A 3LY9A 3B7RL 2XEVA 3BG0B 1INZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IYP A;  3QC1 A;  2V0P A; 
#chains in the Genus database with same CATH topology
 3KS2 A;  2J09 A;  3LDZ A;  5CBN A;  3OXG A;  2IO3 C;  2IJG X;  4QFV A;  3P1U A;  5BUZ A;  3LYA A;  1OWN A;  1SA4 A;  5DIZ A;  3G2V A;  3JQ0 A;  2CFZ A;  1N4Q A;  3L6A A;  3CIA A;  4B8C B;  2P9P G;  2BKK B;  3ISM C;  1KZO A;  2LSV A;  2EIJ E;  1UJK A;  4J0U A;  5BT1 A;  4KT6 B;  2L6B A;  4GTO A;  2LXL A;  3PUJ A;  4AV7 A;  2FBN A;  3UX4 A;  1FPP A;  4TRQ A;  1NA3 A;  2XHE A;  2J07 A;  2CHZ A;  3ASF A;  1N0Q A;  3MZL B;  3QWP A;  4YDE A;  5M72 A;  3OXF A;  4LCT A;  4FHK A;  1K1B A;  3IHV A;  1V54 E;  5LX8 A;  3S7D A;  2F8Y A;  4PS8 A;  3ZIM A;  3QK0 A;  1LD8 A;  4F3V A;  3NB2 A;  3CVW A;  2R05 A;  1UN9 A;  3ZGQ A;  4KZC A;  2B0O E;  4XI9 A;  3PE4 A;  3BEE A;  5KNH D;  1DNP A;  1D8E A;  3HXE A;  1O1R A;  3VLE A;  2XZD G;  3ESL A;  4MBG A;  1YCS B;  5CBO A;  2L6J A;  1MX2 A;  3EU9 A;  3D9O A;  2YHE A;  3X2Q E;  3ASN E;  3U64 A;  5CMY A;  4HOS A;  4JHJ A;  3NAW A;  5LCW C;  3MA5 A;  3PEU B;  1ELW A;  1TNO A;  4N5C A;  3V30 A;  4HB5 A;  1SA5 A;  1X81 A;  3T8M A;  3W9F A;  3Q4A B;  4U0Z A;  1H6O A;  5KJK A;  1ZBP A;  3DSS A;  4EEC A;  4ABN A;  3CR3 A;  1OWO A;  2I9C A;  3D9P A;  4R7L A;  4I2Z A;  2NYJ A;  1LD7 A;  3MKQ A;  5HKP A;  5LCW J;  2KCK A;  3EHM A;  3L54 A;  1OWL A;  2CFU A;  4XI0 A;  3EHR A;  2VJ8 A;  3IBE A;  4OAU C;  2J49 A;  2Y69 E;  4GZC A;  4JHK A;  2VSX E;  4TUU A;  4K03 A;  3CK8 A;  4BES A;  3LY7 A;  4L9P A;  3UKR G;  3TG4 A;  3LJN A;  5BPP A;  3DEP A;  2VSO E;  4WWO A;  2Q7F A;  4CT4 A;  1AWC B;  4XKC A;  3Q79 A;  1N9A A;  3R9A B;  5FIO A;  5E76 A;  4IYP A;  4GU5 A;  4XX5 A;  4U63 A;  3AG1 E;  2Y4T A;  2F8X K;  3TWU A;  2XEH A;  3D9M A;  1WAO 1;  5T4Y A;  3SY2 A;  1OCC E;  2WXK A;  4AOF A;  4KYO B;  4BET A;  1K1A A;  4B93 B;  4DX7 D;  5CEC B;  1N4S A;  1OCO E;  2J8S D;  3N71 A;  2GRO B;  2A5U A;  3UM2 A;  3FFL A;  4GTV A;  4ILI A;  4FC8 A;  1O5M A;  4DRX E;  2HYZ A;  4XEI G;  1IKN D;  1O1T A;  4L1B A;  3B7T A;  4ATG A;  1OWM A;  4JHR A;  4LER A;  3L22 A;  1SZ9 A;  4M7C A;  4GTT A;  3EIJ A;  3UM0 A;  1S63 A;  2AWI A;  4AM9 A;  3HRA A;  3QDN A;  3TGO A;  1Y6I A;  4K0R A;  5ENP D;  3FU6 A;  3NOG D;  4DI3 A;  2C0M A;  5CER B;  1BPO A;  3GW4 A;  5ARF A;  2DYR E;  4HOT A;  2IU1 A;  3Q47 B;  4LG6 A;  4JA7 A;  4C9B B;  5G2N A;  1TEZ A;  4G24 A;  3HXB A;  3CVX A;  2UY1 A;  3TAX A;  2GW1 A;  5ENS D;  5JA4 D;  1L5J A;  2UWJ G;  3FUH A;  3QAQ A;  3Q78 A;  2GRN B;  4RQI A;  2R5S A;  1KLX A;  3AJI A;  1XGW A;  5BXO A;  3PZ3 A;  2KCV A;  5FZS A;  3ULY A;  2JAB A;  3T8K A;  4V3I A;  3TJP A;  4CZ2 D;  2YIN A;  3FY4 A;  3RRN B;  4APO A;  4J7W A;  1TR4 A;  3JUE A;  1SVX A;  2IO2 C;  2VQ2 A;  2VSN A;  2R03 A;  2ETB A;  2GRQ B;  4GA1 A;  3BQO A;  2DCP A;  5D0Q D;  4GTM A;  4FJZ A;  3RU0 A;  2V5F A;  3RO3 A;  3C72 A;  4J6I A;  3UUX A;  1IQU A;  2XZT G;  2DVW A;  5ENN A;  4B89 A;  2MHK A;  2P2C P;  5EN5 D;  2XEN A;  4XE0 A;  1FCH A;  5FZQ A;  3RJV A;  3ZRH A;  2LAI A;  2V0P A;  4NAC A;  3EU5 A;  2NSZ A;  3HVE B;  3UXG A;  1W3B A;  5BW8 C;  4CDR A;  1IXV A;  4XZ4 A;  3KEA A;  3S7J A;  4DUI A;  1JPL A;  3FU0 A;  4HI9 A;  4BX9 A;  5KCM A;  1FVH A;  3E4B A;  1OCR E;  3ESK A;  2KC7 A;  1YMP A;  5HRY A;  3V31 A;  4H7Y A;  2I1J A;  2L0T B;  4LNU D;  3G2W A;  2V4L A;  3FU5 A;  3NOC D;  4HVB A;  3HXF A;  4MRU A;  4HLE A;  3UPV A;  3FEY A;  4HOU A;  5FIN A;  1OT8 A;  3CHR A;  2JLB A;  5FT9 A;  3CEQ A;  2P9U G;  2R17 C;  2L9B A;  1ELR A;  4O60 A;  2RFA A;  3LY9 A;  2XEV A;  1WY6 A;  4HI8 A;  4G2V A;  4OVU A;  3RSE G;  2ILR A;  2PQN A;  5CMW A;  4F1S A;  2RKK A;  1P5Q A;  2F0Y A;  2ZU6 B;  4IRU A;  4A3T A;  3DSX A;  4DX6 D;  4I6E A;  4HRL A;  3LCA A;  3TWW A;  5CED B;  3CHO A;  1JCS A;  3ZKJ A;  5LFA A;  2OND A;  3ZN3 A;  3FHE A;  3CVN A;  3NBN B;  5ANL A;  1D8D A;  2BUG A;  4GYY A;  1H6P A;  4GYW A;  5AJL A;  1TJC A;  2QZA A;  5JJT A;  3AS8 A;  4K5B A;  4GA2 A;  4IUL A;  3ZNG A;  4DPR A;  1X5B A;  3E37 A;  4FA6 A;  3JUI A;  4I9E A;  3KAE A;  3CVL A;  3PS6 A;  3CQG B;  4J8S A;  2BF0 X;  1TJF A;  2NXP A;  5A23 A;  2DWZ A;  3HG0 D;  3DXK G;  2OV8 A;  2X6H A;  1O1S A;  3WG7 E;  4U0U A;  3OTN A;  4HFG A;  2DZO A;  3ABK E;  1N4R A;  4AEZ C;  3O48 A;  5KNG A;  1A5E A;  3SZ7 A;  2AXU A;  1SZA A;  4AXH A;  4MS6 A;  3ASG A;  4UWF A;  4TXP A;  3CVP A;  2B6C A;  2RFM A;  1MYO A;  3RIB A;  1UW4 B;  2ION A;  2H6F A;  4A63 B;  1H2T C;  2QYU A;  3QAR A;  4BFR A;  1E7V A;  1H0A A;  3APC A;  3ZXS A;  4YVO A;  2WXO A;  3UIO C;  1KPS B;  4W9R A;  3QC1 A;  1MJ0 A;  3PRE A;  1HFA A;  4I17 A;  3L17 A;  3Q49 B;  3E32 A;  2DIW A;  1IYG A;  3DRA A;  3HVE A;  3DSU A;  3Q9N C;  3PZ4 A;  4AVX A;  3I4R B;  3SFZ A;  4I1M A;  3SFX A;  1FT1 A;  2KBX A;  3CGH A;  2IFU A;  4ZHB A;  3JXJ A;  3TWT A;  4F6R D;  3Q7F A;  4L7T A;  4ANU A;  3PZD A;  2YNQ A;  1JWG A;  2VGY A;  2UY1 B;  1VDY A;  3EJN A;  1H6K A;  3Q15 A;  4N5Q A;  3ONL A;  5BNW A;  3TWQ A;  5AEN A;  3CVU A;  2OEV A;  2KAT A;  4WNE A;  1JCQ A;  4DLO A;  1BD8 A;  5J08 A;  1TN7 A;  3FTS A;  3CVY A;  5E75 A;  3GZ2 A;  2BTD A;  3QNK A;  3C5R A;  3U3W A;  1NA0 A;  3EDT B;  3AAA C;  2FO1 E;  1TNU A;  3NF1 A;  3FTY A;  5FQ8 A;  5JHA A;  2WXG A;  4YDO A;  4EZK A;  1K3Z D;  4OVV A;  3ABL E;  3MJW A;  2WB2 A;  4JVS A;  5AQ7 A;  4KVM A;  1YYH A;  4CGW A;  3IEG A;  1BI7 B;  3MGB A;  4I2W A;  3TG5 A;  5EID A;  4N3C A;  3TXN A;  3CHS A;  3FUM A;  3FWV A;  2RD0 A;  3V79 K;  2AJA A;  3RRM B;  4UQX A;  4CCA A;  1KT0 A;  2IQC A;  3C3Q A;  2PM7 A;  4O6F A;  2FO7 A;  4HOQ A;  2WVI A;  3PEV B;  3OXL A;  4DJA A;  4L2L A;  2H6H A;  3CVV A;  4ANW A;  4I6G A;  2V5Q C;  1WM5 A;  4LRZ A;  4LEU A;  1EF1 C;  4ANX A;  4GZ6 A;  3R7R A;  2CHX A;  3AG2 E;  3ASD A;  4PUC A;  3TWS A;  3FH7 A;  4NUR A;  3D3M A;  3KSL A;  5AAR A;  5ANR A;  1DCE A;  1OUV A;  4BY6 A;  3ZEF A;  3MCX A;  2A5E A;  1Z5S C;  2VGE A;  4GAA A;  2E0I A;  3UM3 A;  1N54 A;  3LEW A;  1IHB A;  2KZT B;  4Z68 A;  5AIJ A;  2WXI A;  4RVB A;  5LP0 A;  4Y6W A;  3RO2 A;  2I6H A;  3E34 A;  3LXU X;  3LPZ A;  3E30 A;  2ETA A;  4FJY A;  4GB9 A;  1Z3Y A;  4UI9 C;  3CQC B;  1N94 A;  4L2Y A;  1GW6 A;  4RG9 A;  1IHG A;  1DVP A;  4GMR A;  4N2S A;  1WDY A;  1A17 A;  3MKR A;  3VLF A;  3ULQ A;  4LSZ E;  3I4G A;  3QJZ A;  3ZXP A;  1JCR A;  4U7E B;  4WNF A;  4JL0 A;  4G25 A;  3B95 A;  5CRU A;  3FTV A;  4CT0 A;  3CHQ A;  4BTA A;  2FF4 A;  4NIK A;  4UI9 J;  5H7P A;  4U8V D;  3QB2 A;  2LXM A;  1MX6 A;  3D9I A;  4I9C A;  1LTX A;  3B7B A;  4N2Q A;  1RZ4 A;  3T5V A;  5KBA A;  4DI4 A;  3CKC A;  3UTM A;  1S0P A;  5B3S E;  3U4T A;  3ONK A;  3J5P A;  4UQZ A;  5D0O D;  4DX5 D;  4AIF A;  4PH4 B;  1OWP A;  3V2X A;  3L9T A;  4JXT A;  4TUM A;  3IV0 A;  3B7R L;  3ULE G;  3BG0 B;  2CG3 A;  1MHQ A;  5ARG A;  1RW2 A;  2V4H C;  4I1O B;  4CDN A;  5FZR A;  2WXJ A;  3BUA A;  2EQX A;  3TWX A;  3JQ1 A;  1U2V G;  3NQP A;  4CDM A;  4UQY A;  3FTZ A;  2EIK E;  3CVQ A;  4FP7 A;  5EYL A;  4BEP A;  2P9K G;  1E7U A;  2GGF A;  1PY1 A;  3E33 A;  3R9M A;  3FUF A;  3UT7 A;  3FH5 A;  3IKO B;  3HDX A;  4ILH B;  5D2M C;  4OAV B;  4HLL A;  3HXD A;  4FU3 A;  4G1T A;  2RG8 A;  5AQB A;  3T9K A;  3I5P A;  5G55 A;  3TXM A;  1FVF A;  2ZGD A;  3PE3 A;  2V8S E;  3CKB A;  3QOU A;  3ZU7 B;  3FUL A;  4GPK A;  1K8K G;  4GCN A;  3EHN A;  4C0M A;  5JHB A;  2X6J A;  3SI5 A;  2FI7 A;  2LAH A;  2XCC A;  4GML A;  2WQH A;  1UOH A;  3ABM E;  5KJM A;  3PH0 C;  4KZ0 A;  5B1B E;  5C2Y A;  2LNI A;  2A4Z A;  3DSV A;  1H2U A;  4JZY A;  2VSY A;  2XRZ A;  4AJW A;  4DX2 A;  3PRZ A;  2WXN A;  3IXE A;  2CG2 A;  4WAF A;  1EYH A;  3SBS A;  2AXV A;  2XGM A;  4EPZ A;  2GRR B;  1QNF A;  2KZT A;  4L23 A;  2WMN A;  2IOS A;  4GTP A;  1UG3 A;  4CGV A;  3Q7A A;  1KZP A;  3VTY A;  4ANV A;  2PM6 A;  2XQ0 A;  2XGS A;  4ILG A;  4HS2 A;  4K5A B;  3FP3 A;  1E8Z A;  3KEZ A;  4G11 A;  5BXU A;  3RK6 A;  5KWD A;  2M63 A;  1V55 E;  1D9S A;  2PL2 A;  4JB8 P;  2MYO A;  5ENR D;  4D10 C;  2VGX B;  1N95 A;  4F1P A;  3SF4 A;  1HXI A;  3SO8 A;  5AJD A;  3GZ1 A;  4PDX A;  4WND A;  3PVL A;  3L16 A;  2FUL A;  1BI8 B;  4BTB A;  3FTX A;  5EX3 A;  3AU5 A;  2HO1 A;  5G04 C;  2XCB A;  3B13 A;  3G2S A;  4GZ3 A;  2F37 A;  2X3M A;  1HH8 A;  3C3R A;  3DEO A;  2L0I A;  3VLD A;  4B8A A;  3G2T A;  3Q73 A;  2OCC E;  4BT8 A;  4BER A;  1HX8 A;  4J8F A;  2AXZ A;  3DXM G;  4GTQ A;  5EKQ D;  2OVB A;  3UI2 A;  3FH8 A;  3AG3 E;  3SD5 A;  5CHE E;  2GRL A;  2J9Q A;  1G3N B;  2PZI A;  4GTS A;  5BV1 A;  5CCL A;  4YVQ C;  2WXM A;  2QC9 A;  3MX3 A;  4GCO A;  3R7Q A;  1OCZ E;  5BV0 A;  3UM1 A;  1MQS A;  3ZYK A;  5G04 J;  4U95 D;  3G2U A;  5AN8 A;  2P9S G;  5KJL A;  4I1A A;  2GRM A;  4G26 A;  1B89 A;  4OYS A;  3ML8 A;  3MYV A;  5D66 A;  3W9G A;  3RRU A;  1AP7 A;  1TN6 A;  1BLX B;  4J8D A;  3QWW A;  1UN8 A;  2J08 A;  3D9H A;  4C48 B;  4EHM A;  4KXK B;  1XNF A;  1EDU A;  3ZVV A;  4CRW A;  2XPY A;  1Z6T A;  3TWR A;  2XS8 A;  1JUQ A;  3NZS A;  3UT8 A;  2FEZ A;  4RLY A;  4EBA A;  2NC9 A;  2ZIS A;  3SHF A;  2YHC A;  1LF8 A;  2XS1 A;  3RAU A;  1FT2 A;  4N39 A;  1SW6 A;  2WM9 A;  4E85 A;  3SGH A;  1S70 B;  3ZPJ A;  2OEW A;  1Y8M A;  3APF A;  1IQR A;  2QYJ A;  2DZN A;  5T3R A;  3CST A;  4HBD A;  3PZ1 A;  3S2A A;  2OVF A;  4U8Y D;  4K5C A;  5AQ9 A;  3PDN A;  4UWG A;  1H19 A;  1H2V C;  4F7A A;  2X6I A;  4TXR A;  3ZW3 A;  4BWR A;  1HG2 A;  3EIQ C;  4HRN A;  1NP7 A;  4A1S A;  3TWV A;  3QKY A;  2BED A;  4APF A;  1BU9 A;  2Y1L E;  3B7S A;  3WXX A;  3LKU A;  4JW1 A;  3GZS A;  1HE8 A;  4C0E A;  4QQI A;  3BU8 A;  3DPD A;  4JD2 G;  3FEX A;  3UMV A;  4HXI A;  5AAO A;  3AS4 A;  2XRY A;  2P9L G;  4M3O A;  4UUC A;  2XGO A;  1E96 B;  1HG5 A;  4A55 A;  3PNT B;  3FTW A;  5A7D B;  3C3O A;  4I43 A;  5CCM A;  1HO8 A;  2VGX A;  4FUL A;  4FHJ A;  1DCQ A;  2DBA A;  3S7F A;  3ASH A;  5JJ7 A;  2WXF A;  3AS5 A;  4ACK A;  5EIB E;  3FUI A;  3UQ3 A;  4RSY A;  4BX8 A;  4WWP A;  4U96 D;  2KCL A;  4MLP A;  4O1P A;  4UWK A;  3D9L A;  1JWF A;  3L08 A;  4GZD A;  3APD A;  3PNL B;  1TYQ G;  5ITZ F;  2EIL E;  1INZ A;  2AVP A;  3LVQ E;  3T5X A;  1QZ2 A;  3D9J A;  2I1K A;  4F53 A;  3HHM A;  4HNA D;  4MKT A;  2AW6 A;  2WQ7 A;  2VTB B;  2WXP A;  5C1D A;  5EDS A;  3HXC A;  1HZ4 A;  4GMJ A;  3FUE A;  4ZFH A;  4WWN A;  3RKV A;  1YA0 A;  1N52 A;  2QFC A;  5IY5 E;  4HOR A;  5EX0 A;  4DX1 A;  3P2B A;  4KVO A;  3JCK C;  1TN8 A;  2Y4U A;  4XKB A;  4JEU A;  4DLQ A;  1E8Y A;  1E8X A;  3JYS A;  2HM8 A;  3ZHE B;  4HQD A;  2E2E A;  4EBA G;  3ZUV B;  2LO6 A;  3NZU A;  3QWV A;  1QYM A;  3JXI A;  3ASO E;  4LNG A;  2IY0 C;  3FDH A;  4UWH A;  2GRP B;  1NZN A;  1U3C A;  3ZYL A;  3FUD A;  4URK A;  4GTR A;  2MRI A;  1NFI E;  4CYM D;  2WMO A;  3KSQ A;  3FTU A;  4TXQ A;  4AY5 A;  5EYP F;  3Q75 A;  4GPM A;  4BSZ B;  1QQE A;  3LVR E;  2KXP C;  1Q2Z A;  2WQ6 A;  4WUY A;  4JA9 A;  5FTP A;  1NL4 A;  3K9I A;  3C98 A;  1NI1 A;  5EIL A;  3ENE A;  1N4P A;  1TNZ A;  4AY6 A;  5KJN A;  3LY8 A;  2R2L A;  2OOE A;  3PUK A;  3U9W A;  3ZFW A;  5ENQ D;  3BG1 B;  1KT1 A;  4AP2 A;  2WXH A;  5CRV A;  1SQM A;  3KD7 A;  2IEJ A;  1HU3 A;  4O1O A;  1PC2 A;  4U8H A;  4BSX A;  4ME2 A;  4IN3 B;  5FJY A;  4EZL A;  3OAW A;  1HS6 A;  4I6J A;  1E90 A;  3B7U X;  1DC2 A;  2HE0 A;  2X6K A;  2ZIR A;  3DWL G;  5A6C A;  4NRH B;  2WXL A;  1OXJ A;  5ENT D;  2EIN E;  4DK5 A;  4JPS A;  2H6I A;  1ZU2 A;  3LS8 A;  5AQA A;  3Q5M A;  3DSW A;  5G05 C;  3FUJ A;  2XEE A;  4U0S A;  4A1G A;  3ZYQ A;  4J8E A;  5HS0 A;  3AU4 A;  3HIZ A;  3VTX A;  5B1A E;  3MEK A;  2C0L A;  4G8L A;  3FUN A;  1TNY A;  2J4B A;  2R59 A;  3SFY A;  1OY3 D;  4XIF A;  4KMO A;  4A3V A;  5CEA A;  1S64 A;  2C2L A;  2JEK A;  3DBS A;  1ELK A;  4P29 A;  4X8Q A;  4FLB A;  4N3B A;  5G05 J;  4FAD A;  2ETC A;  1PAQ A;  5JMN D;  3DPY A;  2H6G A;  4Q94 A;  2LSU A;  4Q69 A;  3MV3 B;  4UWL A;  1EPU A;  5HI7 A;  4B0Z A;  3MV2 B;  3HYM B;  2VTB A;  5AYW D;  5ENO D;  3V2O A;  3GYZ A;  2BKG A;  2WXQ A;  4Y6C A;  3LJ3 A;  3D9N A;  3ZYM A;  5FQ4 A;  4G23 A;  4PS7 A;  3PZ2 A;  5DBK A;  4HRM B;  2XPI A;  2DYS E;  4CEM A;  3FUK A;  3UT4 A;  4U07 A;  2X6F A;  4ATZ D;  4U04 A;  4KBQ A;  1E8W A;  3ZHE A;  1HF8 A;  3ML9 A;  3CK7 A;  2PQR A;  1TNB A;  3L13 A;  5FQ7 A;  4G8K A;  4YDW A;  3U66 A;  3UKU G;  5J90 A;  2WPV A;  2KM4 A;  2R02 A;  3SQV A;  1MZC A;  4UI9 K;  2WXR A;  3CSF A;  3CHP A;  3L82 A;  2Y0B G;  2ZGG A;  2QY7 A;  4LUN U;  3J5Q B;  2P9N G;  1QBQ A;  2P9I G;  4JEH A;  4WNG A;  4GYO A;  3URZ A;  3AG4 E;  3CHM A;  2MOW A;  3FU3 A;  3IHY A;  4FLH A;  3CV0 A;  2P58 C;  3Q9U C;  2IF4 A;  4TV3 A;  3EUV A;  3I3N A;  4YDY A;  3CK9 A;  1U3D A;  5HQ8 A;  3F6Q A;  3O4Z A;  2ZXW E;  3EHQ A;  4JC8 A;  1N0R A;  1N11 A;  3MKQ B;  4EQF A;  3SNX A;  5T8I A;  4EZJ A;  4YND A;  3TL5 A;  2Y3A A;  2VYI A;  3UIN C;  4GZ5 A;  4J8Y A;  2PNN A;  4NQ0 A;  4GA0 A;  2I2O A;  5FWQ A;  4ACL A;  2EIM E;  3UIP C;  1MX4 A;  2XPZ A;  2CHW A;  4RG6 A;  2IOL A;  5JJ6 A;  4B94 A;  4H7X A;  4E6H A;  2YQ8 A;  3S7B A;  4N3A A;  2J4D A;  4BT9 A;  3D9K A;  3CLJ A;  4Q96 A;  2X38 A;  1Z3X A;  2LUH A;  1UJJ A;  2HR2 A;  5LOZ A;  1ZB1 A;  3SBT B;  5FQ6 A;  1WG0 A;  4PS3 A;  4LNB A;  3DST A; 
#chains in the Genus database with same CATH homology
 1WY6 A;  3KS2 A;  2AVP A;  2CG3 A;  4G2V A;  2J09 A;  3LDZ A;  4OVU A;  2ILR A;  3LVQ E;  3OXG A;  3T5X A;  1QZ2 A;  3D9J A;  1MHQ A;  2I1K A;  4F53 A;  2IJG X;  5ARG A;  4I1O B;  2PQN A;  4QFV A;  3P1U A;  3HHM A;  5BUZ A;  4CDN A;  5FZR A;  5CMW A;  2WXJ A;  3LYA A;  1OWN A;  2EQX A;  2AW6 A;  4MKT A;  5DIZ A;  1P5Q A;  3JQ1 A;  2ZU6 B;  3G2V A;  3JQ0 A;  4IRU A;  2CFZ A;  4A3T A;  3NQP A;  2VTB B;  4I6E A;  3L6A A;  3CIA A;  4CDM A;  2WXP A;  4UQY A;  4B8C B;  5C1D A;  5EDS A;  3LCA A;  1HZ4 A;  3FTZ A;  4GMJ A;  3CHO A;  3FUE A;  3CVQ A;  4FP7 A;  4WWN A;  5LFA A;  2OND A;  3ZN3 A;  3FHE A;  3CVN A;  5ANL A;  2LSV A;  2BUG A;  3RKV A;  1E7U A;  1UJK A;  4J0U A;  5BT1 A;  4KT6 B;  4GYY A;  2GGF A;  4GYW A;  1YA0 A;  1N52 A;  2QFC A;  5AJL A;  1PY1 A;  4HOR A;  1TJC A;  5EX0 A;  3FUF A;  3UT7 A;  3FH5 A;  3IKO B;  5JJT A;  3AS8 A;  3PUJ A;  4AV7 A;  3P2B A;  3HDX A;  2FBN A;  4ILH B;  4KVO A;  3JCK C;  2Y4U A;  3UX4 A;  4GA2 A;  4TRQ A;  4IUL A;  4XKB A;  4DPR A;  1NA3 A;  4JEU A;  1X5B A;  2XHE A;  4DLQ A;  4FU3 A;  2J07 A;  2CHZ A;  1E8Y A;  1E8X A;  3JYS A;  4G1T A;  2RG8 A;  2HM8 A;  3ASF A;  3MZL B;  3QWP A;  5M72 A;  3OXF A;  4LCT A;  3ZHE B;  4FHK A;  2E2E A;  4FA6 A;  3IHV A;  4EBA G;  3I5P A;  3JUI A;  4I9E A;  3KAE A;  5G55 A;  3TXM A;  5LX8 A;  3CVL A;  3S7D A;  2LO6 A;  1FVF A;  3NZU A;  3QWV A;  3QK0 A;  4PS8 A;  3PS6 A;  3PE3 A;  3ZIM A;  2V8S E;  3CQG B;  3CKB A;  3QOU A;  4F3V A;  3FUL A;  4J8S A;  2BF0 X;  4GPK A;  1TJF A;  3FDH A;  4GCN A;  3EHN A;  4UWH A;  2NXP A;  4C0M A;  5A23 A;  5JHB A;  3CVW A;  2X6J A;  1UN9 A;  3SI5 A;  1NZN A;  1U3C A;  2FI7 A;  2LAH A;  3FUD A;  3ZGQ A;  4KZC A;  3ZYL A;  2XCC A;  4URK A;  2MRI A;  4GML A;  2WQH A;  2OV8 A;  2X6H A;  4F1S A;  4U0U A;  2WMO A;  4XI9 A;  3FTU A;  3OTN A;  4AY5 A;  4HFG A;  3PE4 A;  3BEE A;  5KJM A;  3PH0 C;  4KZ0 A;  1QQE A;  4AEZ C;  3O48 A;  1DNP A;  3LVR E;  5C2Y A;  2LNI A;  3SZ7 A;  2A4Z A;  2AXU A;  1SZA A;  2WQ6 A;  4WUY A;  3VLE A;  1H2U A;  4AXH A;  4MS6 A;  3ESL A;  3ASG A;  4JA9 A;  4JZY A;  5FTP A;  4UWF A;  2VSY A;  3K9I A;  2XRZ A;  3C98 A;  3CVP A;  4AJW A;  3PRZ A;  2L6J A;  3ENE A;  3RIB A;  1UW4 B;  2ION A;  3D9O A;  4AY6 A;  1H2T C;  2WXN A;  2YHE A;  5KJN A;  3LY8 A;  2OOE A;  2CG2 A;  3PUK A;  3U64 A;  3U9W A;  4WAF A;  1EYH A;  5CMY A;  4HOS A;  3QAR A;  4JHJ A;  3SBS A;  2AXV A;  3ZFW A;  4BFR A;  2XGM A;  5LCW C;  4EPZ A;  1E7V A;  3MA5 A;  3PEU B;  1H0A A;  3APC A;  3BG1 B;  1QNF A;  1ELW A;  4N5C A;  2KZT A;  4L23 A;  3ZXS A;  1KT1 A;  4AP2 A;  4YVO A;  2WXH A;  2WXO A;  2WMN A;  2IOS A;  1UG3 A;  4CGV A;  1SQM A;  3KD7 A;  3T8M A;  4W9R A;  1HU3 A;  3QC1 A;  3Q4A B;  4U0Z A;  3VTY A;  3PRE A;  4ANV A;  2PM6 A;  2XQ0 A;  5KJK A;  1ZBP A;  1PC2 A;  4U8H A;  2XGS A;  4ILG A;  4BSX A;  4ME2 A;  4HS2 A;  4IN3 B;  5FJY A;  1HFA A;  4EEC A;  4I17 A;  4EZL A;  3OAW A;  4ABN A;  3CR3 A;  1HS6 A;  3FP3 A;  3L17 A;  3Q49 B;  1E8Z A;  1OWO A;  2I9C A;  3D9P A;  3KEZ A;  4G11 A;  4I6J A;  3RK6 A;  2DIW A;  1E90 A;  3B7U X;  4R7L A;  1IYG A;  4I2Z A;  2M63 A;  2X6K A;  5A6C A;  3HVE A;  3MKQ A;  2PL2 A;  5LCW J;  4NRH B;  2KCK A;  2WXL A;  3EHM A;  4D10 C;  3L54 A;  1OWL A;  2VGX B;  2CFU A;  4XI0 A;  4AVX A;  2VJ8 A;  3I4R B;  3IBE A;  4I1M A;  3SFZ A;  4DK5 A;  3SF4 A;  4JPS A;  3CGH A;  1ZU2 A;  2IFU A;  3LS8 A;  1HXI A;  2J49 A;  3GZ1 A;  5AJD A;  4L7T A;  4GZC A;  4JHK A;  2VSX E;  4PDX A;  4ANU A;  3Q5M A;  3PZD A;  4TUU A;  4K03 A;  5G05 C;  3CK8 A;  3LY7 A;  3FUJ A;  4WND A;  2YNQ A;  4U0S A;  3PVL A;  3TG4 A;  4A1G A;  5BPP A;  1JWG A;  2VSO E;  3ZYQ A;  4J8E A;  2VGY A;  2UY1 B;  3AU4 A;  3HIZ A;  3L16 A;  2FUL A;  3MEK A;  4WWO A;  2C0L A;  1VDY A;  3EJN A;  3VTX A;  2Q7F A;  4BTB A;  1H6K A;  3FUN A;  3Q15 A;  2J4B A;  2R59 A;  3FTX A;  3ONL A;  5EX3 A;  4CT4 A;  5BNW A;  5AEN A;  3CVU A;  4XKC A;  3AU5 A;  2HO1 A;  3R9A B;  5G04 C;  4XIF A;  2XCB A;  4KMO A;  2KAT A;  3B13 A;  4WNE A;  4A3V A;  3G2S A;  4IYP A;  5E76 A;  4GZ3 A;  4GU5 A;  4XX5 A;  4DLO A;  4U63 A;  5J08 A;  2C2L A;  2Y4T A;  2X3M A;  1HH8 A;  3D9M A;  1WAO 1;  2JEK A;  5T4Y A;  3DBS A;  1ELK A;  2L0I A;  3FTS A;  4P29 A;  3VLD A;  3G2T A;  4B8A A;  4BT8 A;  3CVY A;  1HX8 A;  3GZ2 A;  2WXK A;  4J8F A;  5E75 A;  4AOF A;  2BTD A;  3QNK A;  4KYO B;  2AXZ A;  5EKQ D;  2OVB A;  4FLB A;  3U3W A;  1NA0 A;  3FH8 A;  3SD5 A;  4N3B A;  5CHE E;  3EDT B;  2GRL A;  5G05 J;  2J9Q A;  3N71 A;  2PZI A;  4FAD A;  1PAQ A;  5BV1 A;  5CCL A;  4YVQ C;  4Q94 A;  2A5U A;  2LSU A;  4Q69 A;  3NF1 A;  3FTY A;  5FQ8 A;  2WXM A;  3MV3 B;  3FFL A;  5JHA A;  2WXG A;  4EZK A;  4ILI A;  3MX3 A;  4UWL A;  4FC8 A;  4OVV A;  4GCO A;  3R7Q A;  1EPU A;  5HI7 A;  2HYZ A;  4B0Z A;  5BV0 A;  3MJW A;  2WB2 A;  4JVS A;  3MV2 B;  4L1B A;  4KVM A;  3B7T A;  4ATG A;  1MQS A;  3ZYK A;  5G04 J;  4CGW A;  3HYM B;  1OWM A;  4JHR A;  4LER A;  2VTB A;  5AYW D;  3L22 A;  3G2U A;  1SZ9 A;  3IEG A;  3MGB A;  4I2W A;  3EIJ A;  3TG5 A;  4I1A A;  2GRM A;  5KJL A;  3GYZ A;  4G26 A;  1B89 A;  4N3C A;  4OYS A;  3CHS A;  3ML8 A;  2WXQ A;  3TXN A;  3MYV A;  3FUM A;  3FWV A;  4Y6C A;  3LJ3 A;  3D9N A;  3ZYM A;  5FQ4 A;  2AWI A;  4AM9 A;  2RD0 A;  4G23 A;  4PS7 A;  3QDN A;  5DBK A;  4UQX A;  3RRM B;  3TGO A;  1Y6I A;  4K0R A;  4CCA A;  1KT0 A;  2IQC A;  3RRU A;  2PM7 A;  3FU6 A;  4DI3 A;  2XPI A;  2C0M A;  4O6F A;  1BPO A;  2FO7 A;  3GW4 A;  4HOQ A;  4J8D A;  5ARF A;  2WVI A;  3QWW A;  4HOT A;  1UN8 A;  2IU1 A;  3PEV B;  3OXL A;  2J08 A;  4KXK B;  4DJA A;  1XNF A;  4L2L A;  3Q47 B;  4CEM A;  3CVV A;  4ANW A;  4I6G A;  1EDU A;  3FUK A;  4JA7 A;  3UT4 A;  4U07 A;  3ZVV A;  1WM5 A;  4C9B B;  2X6F A;  4U04 A;  4KBQ A;  5G2N A;  1TEZ A;  4G24 A;  3CVX A;  1E8W A;  2UY1 A;  4LRZ A;  3TAX A;  3ZHE A;  4CRW A;  2XPY A;  1HF8 A;  2GW1 A;  4LEU A;  3ML9 A;  1EF1 C;  3CK7 A;  1L5J A;  2PQR A;  1Z6T A;  2UWJ G;  3L13 A;  3FUH A;  1JUQ A;  3NZS A;  4ANX A;  3UT8 A;  2FEZ A;  4GZ6 A;  3R7R A;  3QAQ A;  4EBA A;  2NC9 A;  2CHX A;  5FQ7 A;  3SHF A;  3ASD A;  4PUC A;  2R5S A;  2YHC A;  1KLX A;  3U66 A;  5J90 A;  3FH7 A;  1LF8 A;  4NUR A;  1XGW A;  2WPV A;  3D3M A;  2KM4 A;  4N39 A;  2KCV A;  5FZS A;  4UI9 K;  5ANR A;  2WXR A;  3CSF A;  1OUV A;  4BY6 A;  3CHP A;  2WM9 A;  4V3I A;  3ZEF A;  3MCX A;  4E85 A;  2QY7 A;  3TJP A;  3SGH A;  2YIN A;  4GAA A;  3ZPJ A;  3FY4 A;  2E0I A;  4LUN U;  2WQ7 A;  3RRN B;  4APO A;  1Y8M A;  3APF A;  1N54 A;  3LEW A;  5AIJ A;  2KZT B;  1IQR A;  2VQ2 A;  2VSN A;  2WXI A;  4RVB A;  5T3R A;  3CST A;  5LP0 A;  4GA1 A;  4Y6W A;  3S2A A;  2DCP A;  4JEH A;  5D0Q D;  4WNG A;  4GYO A;  4FJZ A;  3RO2 A;  2I6H A;  2OVF A;  3RU0 A;  2V5F A;  3RO3 A;  3URZ A;  3LXU X;  3CHM A;  2MOW A;  1H19 A;  3FU3 A;  3IHY A;  3PDN A;  4FLH A;  4J6I A;  3CV0 A;  3LPZ A;  4UWG A;  3UUX A;  1IQU A;  1H2V C;  2P58 C;  4F7A A;  2X6I A;  2IF4 A;  4TV3 A;  5ENN A;  3ZW3 A;  3I3N A;  4FJY A;  4B89 A;  2MHK A;  1Z3Y A;  4GB9 A;  4UI9 C;  3CQC B;  3CK9 A;  4BWR A;  1U3D A;  1HG2 A;  5HQ8 A;  4XE0 A;  3EIQ C;  1FCH A;  1NP7 A;  3O4Z A;  4A1S A;  5FZQ A;  4L2Y A;  1GW6 A;  4JC8 A;  3RJV A;  3ZRH A;  2LAI A;  2V0P A;  4NAC A;  3HVE B;  2NSZ A;  3MKQ B;  3QKY A;  1W3B A;  4RG9 A;  1IHG A;  5BW8 C;  4CDR A;  1DVP A;  4XZ4 A;  4N2S A;  4EQF A;  4APF A;  1A17 A;  3S7J A;  3MKR A;  3SNX A;  5T8I A;  3ULQ A;  3VLF A;  3B7S A;  3I4G A;  4EZJ A;  4YND A;  3QJZ A;  3TL5 A;  3WXX A;  1JPL A;  3LKU A;  4JW1 A;  3GZS A;  1HE8 A;  3FU0 A;  4WNF A;  2Y3A A;  2VYI A;  4C0E A;  4JL0 A;  3DPD A;  4G25 A;  4GZ5 A;  4BX9 A;  3FEX A;  3FTV A;  3UMV A;  4HXI A;  4CT0 A;  5KCM A;  3AS4 A;  3CHQ A;  4NQ0 A;  2XRY A;  4GA0 A;  2I2O A;  5FWQ A;  4BTA A;  2FF4 A;  1FVH A;  3E4B A;  4ACL A;  4M3O A;  2XGO A;  4UI9 J;  1E96 B;  3ESK A;  1HG5 A;  2KC7 A;  2XPZ A;  2CHW A;  3QB2 A;  4A55 A;  3PNT B;  3FTW A;  4H7Y A;  2I1J A;  3D9I A;  5A7D B;  2L0T B;  4RG6 A;  2IOL A;  5JJ6 A;  3G2W A;  4B94 A;  4H7X A;  4I43 A;  4I9C A;  2V4L A;  4E6H A;  5CCM A;  4N2Q A;  1HO8 A;  2VGX A;  3FU5 A;  4FUL A;  3T5V A;  4DI4 A;  4FHJ A;  2YQ8 A;  3S7B A;  3CKC A;  4N3A A;  1S0P A;  2J4D A;  4HVB A;  2DBA A;  4BT9 A;  4MRU A;  3U4T A;  3S7F A;  3ASH A;  3D9K A;  3CLJ A;  4HLE A;  2WXF A;  3AS5 A;  3FEY A;  5JJ7 A;  4Q96 A;  3UPV A;  2X38 A;  1Z3X A;  4ACK A;  3FUI A;  4HOU A;  3ONK A;  3UQ3 A;  3CHR A;  1UJJ A;  4RSY A;  2HR2 A;  4BX8 A;  4WWP A;  2JLB A;  4UQZ A;  5LOZ A;  5FT9 A;  3CEQ A;  2KCL A;  2R17 C;  4MLP A;  2L9B A;  5D0O D;  4UWK A;  4AIF A;  3D9L A;  4PH4 B;  1ELR A;  1OWP A;  1JWF A;  3L08 A;  4GZD A;  3SBT B;  5FQ6 A;  4JXT A;  3APD A;  3PNL B;  3IV0 A;  4PS3 A;  3LY9 A;  3B7R L;  2XEV A;  3BG0 B;  1INZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...