2YINA

Structure of the complex between dock2 and rac1.
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
425
structure length
411
Chain Sequence
SKDNRMSCTVNLLNFYKDNNREEMYIRYLYKLRDLHLDCDNYTEAAYTLLLHTWLLKWSDEQTHRQLKETLYETIIGYFDKGKMWEEAISLCKELAEQYEMEIFDYELLSQNLIQQAKFYESIMKILRPKPDYFAVGYYGQGFPSFLRNKVFIYRGKEYERREDFQMQLMTQFPNAEKMNTTSAPGDDVKNAPGQYIQCFTVQPVLDEHPRFKNKPVPDQIINFYKSNYVQRFHYSRPVRRGTVDPENEFASMWIERTSFVTAYKLPGILRWFEVVHMSQTTISPLENAIETMSTANEKILMMINQYQSDETLPINPLSMLLNGIVDPAVMGGFAKYEKAFFTEEYVRDHPEDQDKLTHLKDLIAWQIPFLGAGIKIHEKRVSDNLRPFHDRMEECFKNLKMKVEKEYGVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Multiple Factors Confer Specific Cdc42 and Rac Protein Activation by Dedicator of Cytokinesis (Dock) Nucleotide Exchange Factors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords DEDICATOR OF CYTOKINESIS PROTEIN 2
total genus 132
structure length 411
sequence length 425
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.740 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2yinA03
1.25.40.410 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2yinA01
3VHLA 3B13A 2YINA 2WMOA 2WM9A 2WMNA
chains in the Genus database with same CATH superfamily
2J4GA 1MIYA 1BR4A 3RSEG 1N54A 4MKTA 1AP7A 3APFA 2XAFB 2LO6A 3RIUA 4A56A 5ABHA 3MKQB 3JXIA 3ESKA 5EX0A 2KM4A 5FWQA 3PV0F 4UVAB 5LHIB 4UUCA 1UW4B 5H6RB 3D3MA 5AQOB 3L39A 3LVRE 1HE8A 1SE7A 5AQSB 1WYBA 4QWNB 2L9BA 2EQXA 5CRUA 1HFAA 2JPFA 5L4HA 5DBKA 3URZA 2LXMA 4HFCA 3UFEA 1XGWA 2FJDA 5JMND 3HHMA 5AQUB 1X79A 2UWJG 5FXVA 4UVCB 5J0ZA 3QK6A 2H7VC 1N94A 4AKLA 3FP3A 3HR0A 3P4PA 5LB7B 2VQ2A 3N71A 5LGTB 1I6ZA 3FZLB 4DPRA 4I50E 4AJWA 2DZOA 2E0IA 3PZ3A 4FU3A 3P4WA 3EHZA 4UI9K 5FTPA 1Y8MA 4J8DA 3S7DA 3LKUA 3OYZA 3TAXA 4TNWA 3AAEB 4JI3T 4JI2T 4RG9A 3ASFA 4EHMA 1HNZT 3TG4A 1E2AA 4I9CA 2KXPC 4PUCA 2MYSA 3GZSA 4IIJE 2P9LG 1E90A 4HOUA 3E34A 3R84B 4U7YA 4JI4T 2PNNA 3HXCA 3T1YT 4APOA 4HEAA 4I43B 4U7IA 2I1JA 1YD8G 3FUNA 4UQYA 3KSQA 5G2NA 4WNFA 4TNVA 1HU3A 4EBAG 1LD8A 3AE4A 3AE1A 2CHZA 2UY1B 2VTBB 4G1TA 2MTQA 1LVKA 3JCFA 5LOVE 4MALA 1N4RA 4C9BB 2Q9QC 4HFHA 2J8SD 5AQFB 1KK7A 2XQ8A 4HFBA 3KSLA 3MA9A 1W09A 3JCKC 4H7XA 3ZYKA 3BQIA 5EN5D 5AENA 3ZN0B 4AM9A 5J2TE 3R9AB 3IHRA 5C8YE 3G2WA 5G04J 4N78D 3TG5A 1MJ0A 3JC6C 4O4IE 2D0TA 4NUUA 5ANLA 5LMUT 3C50A 3FH5A 1E96B 1O1TA 4JBWF 1GQEA 3PUAA 3OAWA 3UM3A 4YLHA 4FHJA 3DEOA 5D2MC 4UI9C 3CK6A 5JDMA 2IAKA 2WCAA 2J09A 1B89A 4KZCA 2JJ9A 4EPZA 3CX8B 3Q5XA 2QA7A 3HI2A 4HRNA 5ENSD 5L3FB 2UUCT 2VWAA 1KEYA 2KCKA 3UI2A 1WRDA 3Q5EA 4CQIA 3U66A 5JR9C 4HI8A 3Q9UC 1QUUA 4NQ0A 5FXZA 2LM2A 1JWFA 4KBQA 3K8PC 4HFVA 4BJNA 1PAQA 5IHYA 1K1BA 2CEAA 2WXHA 2BTDA 2B1EA 4DI4A 1MNEA 4IHJE 4P09A 4LNUD 3C3RA 3U4TA 2V5CA 4LFCT 2GRLA 4B3TT 5L2LA 4N5QA 2KSRA 3FFLA 5IY5E 5JR9A 2XEVA 4DNDA 3AG4E 2FUPA 4JL0A 2OV9A 5FNVE 4O4HE 2RFAA 2XS1A 1NZNA 2P9PG 2PTFA 2CFUA 1OUVA 1VCTA 2NTXA 2OVBA 2MPKA 2C0MA 2VGEA 2N1GA 4UWHA 2XUEA 4KT6B 4GYSA 4QX7B 1X9BA 3D9KA 4NRHB 3LJCA 4EYYR 3CMLA 3R7QA 3ZXPA 3ABLE 4U8HA 2ZM6T 3LDZA 5BPPA 4DR7T 1UUSA 2Y0BG 4WWOA 1S35A 4DMVA 2R17C 5HWXA 3MA5A 3MACA 4MLKA 3DWLG 4HLEA 2BG9E 4B8AA 5HXCA 1FJGT 4U2ZA 3IXEA 3QAQA 1GW6A 4GPMA 2R2LA 3EDTB 4PJNA 1TYQG 1INZA 4YTMA 3MKDA 2ACZA 1Z3XA 3L6AA 3RRNB 5LOZA 2KCLA 4NURA 2NYJA 2FO1E 1G8XA 3UUXA 2XAJB 4FULA 1N52A 5FY0A 5LP0A 3ULYA 4HWIB 2XM2A 2FULA 1UGOA 5FVLA 3AE2A 3UT4A 1IXVA 4JA9A 5T3RA 3N9PA 3BQKA 2F8XK 5CFBA 2QYUA 3FUDA 3UQ3A 3T1HT 4LEUA 2D0UA 2E5VA 4AKGA 3HIZA 2PJQA 4WBNE 4A3VA 1W0AA 2XS8A 5EZYE 2V0PA 2V5DA 3EUVA 5L3GB 4L0RA 3TLTA 1XZYA 3RC3A 4YT0A 1HS6A 3CVRA 5G05J 1HCIA 3NWIA 2P9IG 5LP6E 5M72A 3V2OA 4IDQA 4H9SE 3DRAA 3QARA 4A97A 4L2LA 3RGLA 1AWCB 4PJMA 1HXIA 2DCPA 3IV0A 4K5AB 4BT9A 3IEEA 3PZ4A 5AQ7A 2W0GA 2BBJA 3S2AA 2CM0A 3UU8A 2CLYB 3SWHA 3P4QA 5FQ7A 1YW0A 5B1AE 3HKDE 5BV0A 3PDYA 2FO7A 3CVWA 4L1BA 3NKZA 2CA5A 3S7JA 4G2AA 4YXDA 3MV2B 1U4QA 2WXIA 3QDNA 4XI9A 3AS5A 2X9WA 4ZS3A 2WMNA 3AEBA 2DL1A 3FUFA 2LSIA 3LDQB 4I1MA 4BX9A 2C5JA 1HNWT 1P5QA 2LSUA 3PUWF 2WWVA 3NF1A 2OVFA 2X0HA 2AJAA 3EIJA 3DSSA 3ZHEB 4LG6A 2L6BA 3PU8A 5JR9B 4GTSA 2WXKA 1KZPA 3OTOT 2IFUA 3JQ0A 1VDYA 2C5KT 1XWMA 3CK8A 4Q69A 2XM1A 1WFDA 5JDGA 2L9QA 4TRQA 2QYWA 4HVBA 4O2AE 3KV6A 5JH7E 4I1OB 4HOTA 2VASA 4A98A 3E0ZA 2HPLA 5ADXL 3LG7A 4DR6T 2H6FA 2DHRA 2WZIA 3VU7H 3W15B 3FHEA 3MV3B 3Q79A 1N95A 3CVLA 3RX6A 1L5JA 5KNGA 2DIWA 2PFVA 3GWHA 4CDNA 2XGMA 2EIJE 2UXDT 4ZS2A 3V79K 4KI0F 4PK4A 2DVWA 1SA4A 4IE0A 3PRZA 3EI0A 3PU3A 3UUXB 2QY7A 3RLFF 2BVMA 4IDNA 3ZN1B 1VRBA 4JEHB 2EHOB 5A1LA 4JEUB 3CIAA 3LS8A 1MYOA 4NXNT 4XX5A 1H6PA 2K48A 3D9PA 3ML9A 4DUZT 3ZPOA 3ONXA 3MGBA 3ONJA 5JQGE 4KMCA 1WM5A 1HG5A 2HH7A 2BVLA 2XPIA 4LF8T 2JABA 4HQDA 3HRAA 3ASHA 3OTNA 3I1AA 1MMNA 3VRBA 1BLXB 2IEJA 1IBMT 4EGWA 2V7JA 3MKRA 1Y01A 4TV3A 2CG3A 1H7CA 2KZ7B 3SNXA 4BEPA 3Q75A 5FZSA 2IO3C 3AAAC 4LUNU 4H9NC 3ZSTA 1NAFA 4OVUA 1QBQA 3L08A 2C0SA 3MCXA 1D1BA 4AQYT 1HX8A 3O48A 4JHKA 2IUBA 5AQHB 4ILHB 5AQ9A 5LHGB 4KX6A 3FZKB 3IBEA 4IDPA 2A2FX 2WB5A 2D2SA 3PJAA 4CCAA 4O8SA 3UIPC 2E9XD 3H3MA 4KHZF 2JEKA 2CHWA 4TXRA 3CIRA 2XQYA 2XSBA 1LF8A 1BD8A 4TV8E 1SW6A 3QUJA 5AQPB 2K3WA 4IYPA 1YQ4A 4IREA 4AXPA 3B7UX 5EDSA 2I9CA 4HOSA 1UN8A 5ENPD 3DP7A 1MQSA 1V54E 4FLHA 2PBIA 3N9QA 3AAIA 2Q9QB 3ZMZB 2IQCA 3AU5A 4ERRA 3TWRA 4IE4A 2J9QA 3L3PA 4BSZB 1UJJA 3SGHA 2EHOC 2Q9QD 1XMOT 1K1AA 3BQOA 3RH3A 3PEUB 4I43A 2IC6A 3CVQA 5EX3A 5EK2A 4BWRA 2DZNA 1BR1A 4G26A 4I17A 3DTOA 3HYMB 3RQWA 2F0YA 4U33A 3OXFA 4HS2A 1TJCA 3KEZA 2NWBA 5LCWJ 4DX7D 3KV5A 5ETWA 2LSYA 3FUMA 2NR4A 2XQ9A 2WXMA 5C3JA 2X6IA 2BBHA 2EHOA 1MMAA 2LUHA 1IQRA 5JJ7A 1EF1C 4N3AA 3K3NA 2XEEA 4GAAA 1HO8A 4MBQA 4B6XA 3DPDA 4GMLA 2VQET 3I0OA 3PUGA 5J2UE 2XTLA 4IE7A 1W9RA 4ZI3C 1JCRA 3NZUA 1WLXA 4YTNA 3HKBE 4Q94A 3N2KE 2VSYA 4JVSA 3SHFA 2ZM0A 4EOZB 3DXKG 5CCLA 3HG0D 2W61A 4UVBB 1Z5SC 3EU5A 1FIOA 1DVPA 2NTYA 3CVPA 4XIFA 4L9IA 5KDMC 3GN5B 3RIAA 4ILUA 2VKHA 5ARFA 3ZKRA 3NOGD 2W4XA 3KVAA 2V8SV 1J5WA 4IGUA 3MEKA 3QB2A 1V9DA 1NL4A 2M63A 5LYJE 1KPSB 2NXPA 3ZHEA 4PW8A 2EHOD 4DR1T 4ISSA 3CR3A 4XI0A 2L6JA 2CHXA 4BX8A 3SF4A 1RZ4A 4KVMA 4FA6A 2AXZA 5KJNA 3Q15A 4U74A 5EYPF 3NRXA 2R59A 4U96D 2YNQA 3PUKA 1BR2A 2J49A 3D9OA 3RIBA 3ENEA 3CX7B 4DR4T 2X9XA 3J9X1 3T5XA 3SRZA 3VR9A 2WPVA 3OXGA 3RRMB 3TLVA 5HQ8A 5LCWC 3V5SA 3FULA 3FXDB 1KT1A 1OXJA 5AFUL 2R5SA 4H63V 4X1YE 3OXLA 3ZN3A 1OXZA 5CA0E 4F53A 3UFGA 4JA7A 2VGYA 1KNRA 5B3SE 5KWDA 4CXXA 3FH7A 1NEKA 4OX9T 1MNDA 2BKNA 1TNUA 5FY1A 4NACA 5H7PA 4GU5A 2IIUA 1N4PA 4JEHA 3AEDA 1DC2A 5KBAA 3ZCIA 3CVNA 2RA1A 1O1RA 2ZGGA 3UU5A 2ETCA 3AE7A 1DU2A 1OWMA 3O4ZA 2UUBT 3ESLA 5JRCA 1OCCE 4JUYA 4U0SA 4LCTA 1ELWA 2H6GA 2MRIA 2VYIA 3PE4A 1E8YA 1TEZA 3C72A 3PUQA 4P0BA 3FBLA 2HR2A 3L82A 4RQIA 2IW5B 3P2BA 1TN8A 1XNFA 2LE8A 3R7RA 3I4RB 5JHAA 1IJ5A 2YU1A 4X1IE 2V8SE 4EV6A 4DK5A 2RD0A 5ABEA 1FVHA 2WXNA 3Q5WA 4N5CA 1LVFA 4IULA 4XZCA 2DI4A 4EEBA 4HORA 3JUEA 2X0LB 1IKND 2CXLA 4DR5T 3ZT6A 3SI5A 3D9MA 2M6IA 4G8LA 3T8MA 2XAHB 4GA1A 3S7BA 3I9YA 5HKPA 2PG8A 4N2SA 3QNKA 2ZU6B 3LBXB 1WG0A 3VLFA 1FCHA 4LNBA 3CSTA 4YNDA 2BKGA 1IZNB 4NPPA 3ZYMA 3AVRA 4PFOA 3Q7AA 4A63B 4TUMA 4KVOA 3PE3A 4UIGA 2M6BA 5AN8A 4CZZB 4CI2B 3GYZA 1K8KG 1T8BA 3OYXA 2UY1A 5FT9A 2VTBA 3IKOB 3EHNA 4ZI2D 3Q73A 3UU4A 1MMGA 2HN2A 4G24A 4N2QA 3Q5MA 5IYZE 3EDUA 4V1Av 1YYHA 3ZW3A 2FJBA 1LRZA 4B3RT 4HRMB 5GONE 3RRCA 5T8IA 5DABA 3V31A 4E6HA 1OWAA 4JI5T 3R6NA 5HS0A 2NC9A 3UU3A 4WWNA 4ILIA 4P0AA 5T4YA 3OJAA 4PH4B 5CERB 4LMJA 3ZJ1A 3T8OA 2X9YA 1JNRA 5IUXA 1KLXA 3LK42 3D9JA 2X6KA 3BG1B 3HA4A 3TWTA 3CWZB 2XQ6A 5HXRA 2VQFT 3FU0A 3B95A 2AXVA 3ONLC 1Z3YA 3JAEA 5CCMA 4ATZD 4JI6T 5CBNA 2XAQB 4ZHBA 2WXOA 3J5QB 4CRWA 3AVSA 4TWDA 3PNTB 4A1SA 1MX6A 2V4LA 4B93B 5CHEE 2BG9C 5KX5E 5BW8C 4GYWA 3UUMA 4JB8P 4XEIG 4JLEA 5KXJA 3FXEB 4ACKA 3UM1A 4ZHQE 1N33T 5EK3A 4JW1A 4DMWA 2D5UA 5L3DB 5ARGA 1JCSA 4F3VA 4JD2G 2HO1A 3ONLA 5HXSA 1JUQA 3GA8A 3QC9A 4L7TA 3P50A 3UUNA 4GZ3A 3AA7B 3C51A 3CPZA 2XSAA 5EK4A 4AIUA 1OCOE 1YA0A 1BR0A 2HE0A 4G8KA 4PS8A 5E75A 4BERA 3TLUA 1WCRA 4I9EA 4UV8B 4ABNA 4BA9A 3UUBA 2CHNA 4FI5A 2BKKB 2WXRA 4H9QC 3FDHA 2YDRA 4E7SA 1NI1A 1TNOA 4XKBA 3AXJA 4O6FA 1S70B 3LK3B 2H3RA 2LAHA 3QC1A 4PK6A 3VTXA 4X65T 1ZKEA 2CWOA 3VKGA 4MFRA 5AQVB 3AEEA 2X66A 1QQEA 3E33A 3CVYA 2HPJA 3ZC0A 4QQIA 3ZSSA 4PS3A 4KMOA 3TXMA 5AYWD 4LF4T 2E2EA 2HM8A 3EVYA 3D9LA 4R7LA 3TKLB 2B6CA 2IONA 3AEGA 1NA3A 4ANUA 3FWVA 4JC8A 3ZMSB 4ZZCA 3TWQA 4OYKA 3FTYA 4ISTA 2CXFA 3HVEB 3PNLB 5L3EB 1VCSA 5KNHD 5DQWA 4I1AA 3U9WA 4GMJA 2V5FA 5ENRD 2WS3A 1W0BA 3BK9A 3K1SA 3PE0A 4C0MA 5JDQA 3OPCA 4HOQA 2YKSA 3VKHA 3JAFA 3LFMA 5AQAA 3RKVA 3EDVA 3UT8A 3FU5A 3AE5A 1A5EA 3WXXA 2BKPA 2GGFA 4CT4A 2LRKA 3I5PA 2BZBA 2XY8B 4U07A 4AVXA 3LK2B 1O5MA 3JC6D 3NZQA 3SQVA 1XDOA 3AA1B 5A6CA 3AE8A 1M62A 5LGNB 1NP7A 3UINC 3VLDA 5CBOA 2BKOA 3HKEE 3LEWA 4YTPA 4K0KT 4UEMA 2WXQA 4B0ZA 4ILCA 5C1DA 1TR4A 3PJAJ 2I2OA 3AG2E 1Z8UA 4YSXA 5BT1A 3TWVA 4DV7T 3TJPA 2V6XA 3ETVA 3RPUA 3AA6B 4TUYE 4BTAA 4DUYT 2IDOB 2XQ7A 5AQTB 5J90A 3VHLA 2RG8A 4AIFA 2F37A 2X51A 4BT8A 4UWKA 3U78A 1SZ9A 3PUZF 1H6KA 4EXTA 1QNFA 3WAJA 3BU8A 4RVBA 2ES0A 4YSYA 1HG2A 4HWDA 3KV4A 5J08A 5FIOA 2A5UA 3DJBA 1TJFA 4WNKA 1DCEA 1OCRE 2KLQA 4LF5T 2WAUA 4WAFA 1U3DA 4A3TA 3MZLB 3RIFA 2LKGA 3QWVA 4WBOA 4GK5E 2UU9T 5AQLB 4AQFC 1Q2ZA 1SVXA 1BI8B 3CHRA 2Y3AA 5LMNT 5KJLA 2XPYA 1NA0A 3AXJB 2VSNA 2GROB 3KS2A 3WAKA 3HL6A 2UXXB 3BG0B 3UM2A 5AQJB 4I0UA 1YMPA 2QYJA 1OCZE 4Y6WA 2DCFA 2WBLA 3SFYA 1T7SA 3ZJ2A 3CQXC 4DX6D 1EPUA 4AQFA 1YQ3A 2B76A 4EIWA 4X5TA 1HX1B 2VURA 3T5VA 5A7DB 2ZM2A 1TN6A 4F1PA 3SFXA 1D1CA 3ZLIA 4UI9J 3UPVA 3FTXA 2LOSA 1OWNA 2DWKA 4JXTA 1UJKA 3CKBA 3AS8A 4YDOA 4TWFA 2P58C 2GRPB 2RFMA 3FEYA 4IE6A 3RQUA 4HN9A 1LD7A 4JPSA 4F7AA 2LJLA 2C5IT 3Q9DA 3EU9A 3UQ7A 2LHNA 2WY2A 2DYSE 3JADA 2LHRA 4C91A 4GIWA 2YHCA 3DPYA 5ANRA 3TWXA 2G0UA 1D1AA 1Z6TA 3QWPA 4G23A 1NWMX 4IDOA 5FL0A 2Y4TA 3LPZA 4O2BE 2P9BA 1N34T 3PVLA 4EZJA 3RIUC 1IAPA 2YHEA 4Z91A 4A5XA 4J8EA 3L22A 5LJMA 2Y1LE 5CECB 3G2UA 5JHBA 3PS6A 3GMIA 5FXWA 4QHOA 3LCAA 1XNQT 3R9MA 4ZXLA 1JPLA 2WXPA 3RRUA 2DNXA 2W62A 1ZB1A 4ZOLE 1LKXA 5JDNA 3IHVA 1SA0E 4AKHA 1H6OA 1SUMB 3UXGA 3ISMC 3VLEA 1O1SA 3N5LA 3RKGA 3AA0B 1JNZA 4JYAT 5JRCB 2IOSA 4LNGA 4GKJT 1ELKA 3J7Yq 2J1DG 5JREA 1MX2A 3MYVA 5ABFA 1WR0A 3RYFE 4DX1A 3E22E 2IY0C 2PQRA 2H88A 1OWPA 3B7SA 4L23A 3EAMA 3ASNE 5LA6E 5EYLA 2JIWA 4I2WA 4JI0T 2WQYA 4OAVB 3L16A 3NBXX 4U04A 4W9RA 1SQMA 2Y6XA 4GZDA 4P29A 1J1JA 3FZFB 4KYOB 4GTPA 3RF1A 4E7ZA 3Q78A 3ZNGA 4ANXA 4GTTA 2A3DA 4EZLA 5FQ4A 5HEHA 4UQZA 4WNGA 2LKHA 3CHMA 3FHNA 2GRRB 4GA0A 5HXHA 4C90A 5C2TA 5L4EA 1XNRT 2XQ3A 3DEPA 1FPPA 4J8SA 3OKQA 4UF0A 3KVBA 4O4LE 4LF9T 2ZXWE 4K0RA 4EYUA 2F4VT 2AE9A 3LSVA 4J0UA 5KCMA 1NFIE 3QOUA 2X68A 4CI3B 4AOFA 4FJZA 2MBGA 1E7UA 4EQFA 3L13A 2I0MA 4YDYA 5KJKA 1B7TA 3EHQA 3KINB 3E32A 2QC9A 5AQKB 1N11A 5E76A 4CN1A 2L0TB 2KWIB 1Y6IA 4AY6A 3RHWA 5JVDE 4A1GA 5ENTD 1K3ZD 2AXDS 5L3CB 1ZP0A 4QXBB 3RO2A 3FUHA 2CMRA 4GB9A 3S7FA 1WY6A 4LRZA 4GTRA 3FB2A 1KNZA 2GRNB 3U3IA 4PNIA 1S64A 1FT1A 5FQ8A 3CVVA 3IA3A 4NIQA 5LNKA 2ONDA 5EILA 1U5PA 1US7B 3I9WA 5CMYA 5HAXA 4DJAA 3PUJA 4EB6E 3GZ2A 4JV5T 3ASOE 2VGXA 2W2UA 4CXWA 1ELRA 1N4QA 4K5BA 5HRYA 3BQLA 4F6RD 3U3WA 1ZV4X 3PH0C 3AE9A 2WB2A 5JDFA 2NW7A 4EZKA 2FF4A 5LBMA 2OCCE 4WYVA 4DV1T 3NZPA 3RAUA 5BMVE 4J7WA 1QSDA 3ZMUB 2XENA 2CBIA 3B7TA 1D0ZA 2CHOA 5H6QB 5L3BB 4AV7A 4OHFA 3PEVB 3K3QC 3CLJA 2C0LA 3F6QA 2NP9A 2XQ5A 3MKQA 1IYGA 3A8YC 3G06A 4L2YA 3AAAB 1X5BA 4HLLA 3GN5A 1O3XA 3A7MA 3RC8A 2F8YA 4QX8B 2J08A 3D9HA 5FMNA 3A5XA 2OOEA 3L09A 2VSOE 5CMWA 2KC7A 3KEAA 5AIJA 3LY7A 2PM7A 2YINA 2P2CP 4LFBT 3SY2A 4TX5A 3CQGB 2H6HA 4YVQC 2E9XC 4RLYA 1YCSB 3TWSA 5LXTE 2WQ6A 4PAGA 2ZIRA 2K9AA 3HDXA 1UX4A 3VRAA 3AJIA 5CEDB 3TGOA 3MJWA 4LF7T 3SBTB 2A72A 4I6JA 5ITZF 4L9PA 2LLYA 4Z90A 5CA1E 4H7YA 3G2VA 4AEZC 2WXGA 3ZRHA 2AW6A 2J4DA 3TLWA 4TWHA 2W63A 2IU1A 3PUXF 1NENA 4DR2T 1G3NB 2IO2C 3TWWA 5BNWA 4TUUA 4ME2A 2UUAT 3MXZA 3EHMA 3ULQA 4UF0B 4F1SA 5AQIB 1JCQA 4M7CA 2XASB 5BR8T 1MIWA 3P7IA 2E5LT 1XMQT 2HYZA 1HF8A 4KP3C 4I55E 3TL5A 2WU5A 4FLBA 4GYOA 1VOMA 4QH1A 3HXEA 1PC2A 4YFSA 2OEWA 2W67A 3M3ZB 1MHQA 2XRZA 3SFZA 4CT0A 5LX8A 4GTVA 4IL9A 2B0OE 3UULA 5HXEA 4PJJA 4X1KE 4YHJA 2EIKE 3NB2A 3X1DA 2WP9A 1J5ET 5A23A 2VKOA 1BI7B 2VGXB 4DR3T 2CXDA 4KXKB 1U3CA 2PL2A 1Z0PA 4HRLA 3UMVA 4U8VD 3TLSA 4UWLA 5FYMA 3ZIMA 3ZU7B 3D9IA 4GZCA 5HCMA 2WXLA 4QH4A 2QVAA 1IBLT 4U8YD 2X38A 2L0IA 5AAOA 2VJ8A 5FZRA 1N36T 3I0QA 2R05A 1BPOA 2K24A 2V7LA 5DIZA 2I1KA 3LYAA 5JDHA 2WMOA 3D9NA 2DLRA 4HGAA 2KCVA 5FKYA 1MMDA 1SHZC 1YKEB 3M65A 3E08A 4JHJA 2A9UA 5AJDA 4U2YA 3TWUA 3WI3A 4JZYA 2KZTB 2VB6A 3UU6A 3ZFWA 4L5GA 4J8YA 3KFWX 3SS1A 4CGVA 3ABKE 4I6GA 2LOPA 2WU2A 1PY1A 4ACLA 3P8CD 4BESA 3DSVA 3D0TA 3E4BA 3C4XA 2V7KA 2MHKA 5FVKA 4GCNA 5AJLA 2XJ7A 3JUIA 3G2SA 4CEMA 2FEZA 1ZBPA 2V26A 5CGMA 3T8KA 5FJYA 2JRKA 2ZM8A 1KNPA 3PREA 3I4GA 3N9LA 2WWUA 5AQMB 2ILRA 4I4TE 2CPTA 1KF6A 3N2OA 4GK0E 4N39A 4UWGA 2RPAA 3U64A 4DBQA 5HYAA 2XCCA 2XRYA 3L54A 3C3QA 3EHRA 3CX6B 2MYOA 3DSXA 3KD7A 5BXOA 1FVFA 3DSTA 4APFA 4JI1T 4FC8A 3EUHA 3LBXA 2KATA 2ZMAA 2XGOA 4H9PC 4GKKT 5HEUA 4AI6A 2WVIA 3ZUVB 1U2VG 3W9FA 3ANWB 5JTGA 2X6JA 2BF0X 4PS7A 1E7PA 3ASGA 3FBZA 1EYHA 3AB3B 1OWLA 3AG3E 3IF8B 3JYSA 5EIDA 4DI3A 3TXNA 3NBNB 4IDZA 1DCQA 4BSXA 3NAWA 1YXRA 2UXBT 1IBKT 1E8ZA 3FUJA 4J2CA 3Q5DA 5HCJA 2ETBA 3E37A 5LBQB 4CYMD 4IL4A 3FEXA 1HR0T 4U3CA 3UKRG 3FZHB 3CV0A 3B7RL 3O1JA 5BV1A 2R02A 3FTWA 4V3IA 3J5PA 4TZ4C 4B3ST 5J1GA 3NZSA 4DVDA 5AQNB 2LM9A 1MIVA 3UTKA 2I59A 3GW4A 5LG4A 2V5QC 4OVVA 4LERA 1WAO1 1AJ3A 3ZMTB 3MK7C 3ZCJA 4MHCA 2KBXA 5D0QD 3UM0A 4HFIA 4LMLA 1G73A 2V7MA 1E7VA 4UWFA 1H19A 2A4ZA 4M3OA 2H89A 2BS4A 4YDEA 4CN4A 3FUEA 3SZ7A 2NW9A 1FT2A 5CJ5A 4EZHA 4HNAD 1QZ2A 4AP2A 5FY7A 2KMFA 5F5WA 3H37A 2ZISA 2VVNA 3P4SA 4G11A 4CDRA 4GTQA 3KBUA 2KNDA 1ZHCA 4AKRB 4DV4T 4TV9E 1V55E 4C0EA 5HEGA 3PTRB 2Y4UA 1L0VA 3FZMB 1D8EA 2VVSA 3B57A 3PUVF 2IJGX 4DLOA 2ODVA 3LJ3A 2KINB 4HWFA 3UTMA 1UX5A 2YOEA 2CFZA 1H2UA 2IOLA 4DX5D 4TXPA 2KZTA 2X6FA 2NOXA 3L8RA 5AQBA 5FXXA 5FL1A 3CHSA 3QOFA 4YY3T 2LAIA 4HBDA 3QK0A 3FUIA 5ABFB 3F2EA 3T9KA 4DV3T 4KUMB 2IMLA 4DUIA 5BUZA 2Z6EA 4EECA 3K3OA 3WG7E 3KV9A 4G63A 1SA5A 3K9IA 2M67A 4PDXA 4X8QA 4U72A 5FZQA 5G04C 4ATGA 2YU2A 4GTMA 4YDWA 4P1NA 2CG2A 3JXJA 2DWGA 4IE5A 4MBGA 3C64A 2A5EA 3IBPA 5KJMA 2P9KG 3N9NA 1UCUA 2IC9A 2LXLA 4PK5A 3VR8A 2HN1A 1UN9A 4HTEA 4AQGA 4GPKA 3C98A 4EZ4A 4O1OA 4X20E 3CHOA 4OK0A 2ACXA 2Y48B 4H9RC 4XE0A 4WUYA 2YK0A 1N4SA 2CLYC 5LG3A 3FTVA 2YDQA 4CZ2D 4CXYA 4NIKA 2P9UG 2GRMA 5DJQC 3LY8A 2NW8A 1D0XA 1OEDC 5LHHB 1N0QA 1OEDB 3APDA 2XCBA 3L17A 3AECA 3RK6A 2W66A 2V1DB 2BUGA 4EBAA 3UT5E 4PJLA 3ZEFB 4GCOA 4MRUA 3CKCA 4WWPA 4DV2T 2JQQA 4U31A 2E9XA 4DBRA 4GTOA 5HI7A 3CKDA 1QLBA 4BFRA 4K0UA 4AXHA 5JJTA 3RI5A 2WSSV 4Q25A 5L47A 1S63A 4BJMA 3IEGA 1KFYA 2CCQA 4MLPA 4LFAT 2QZAA 4IRUA 3CK7A 4DRXE 3UQ4A 2BDEA 3KDSE 3BEEA 3V2XA 4QXHB 4YVOA 4FADA 3ZYLA 2SPCA 4CN6A 4QFVA 5C2YA 3P1UA 4Q96A 4EAHA 2FBNA 4KHPT 5AQRB 1R8IA 3B7BA 4DX2A 3CVXA 4GYYA 3APCA 4HB5A 2RP4A 4I6EA 3CHPA 4MS6A 5TAOA 4ANJA 4ZI3D 1YKHB 3ABVA 1IQUA 3C3OA 3ZKJA 1W3BA 3CGHA 3HXBA 5D0OD 5G05C 3UKUG 3LJNA 3Q9NC 2FJAA 4ADZA 4DV0T 3SD5A 2N2NA 1D8DA 2WM9A 2HHHT 2JLBA 3EABA 1FMVA 3RO3A 3O1HA 4DV6T 3NVOA 2D9DA 4A55A 4EEDA 1TNZA 3NQPA 2OA5A 4RSYA 2Y69E 2LNIA 4YJ2E 3FTZA 3I3NA 4B8CB 3MZKB 3Q47B 3C98B 3F57A 4G2VA 3HXDA 4E85A 3JQ1A 5EKQD 1TN7A 4CI1B 4X66T 2L3LA 1OY3D 3ULEG 2BS3A 4BAYB 4ZFHA 2XGSA 2X9HA 2MOWA 3AEAA 4J6IA 2X3MA 2YDSA 4WZXA 1ZOYA 4X62T 1UG3A 3ZVVA 2V6YA 4M1PA 4HKAA 3PDNA 1OEDA 4F6RC 2XPZA 1FEWA 3QB5K 4WNEA 2WDRA 3Q7FA 5HEJA 2LT3A 1WYCA 3ZEFA 4AY5A 3FU6A 3F31A 2LEHA 3EJNA 3HXFA 4PFPA 3ZYQA 4J8FA 3UT7A 2ETAA 3LXUX 5DQVA 2YN6A 4HI9A 4GZ6A 5ABGA 2L8KA 3SFEA 4YJ3E 3Q2MA 2P9SG 4UXNB 3NRYA 3FY4A 2LSVA 1HH8A 3CVUA 2PM6A 2W00A 5AQGB 4C48B 2N9DA 4QXCB 3FH8A 1FMWA 3AEFA 2NSZA 3Q4AB 1H0AA 4TXQA 5AARA 2VK9A 3G2TA 5ENOD 2J07A 4F8HA 4Z8XA 4DLQA 2WQ7A 3RYHE 3DSWA 4JEUA 2XHEB 5FINA 4WW0A 4HWCA 5ENNA 4KBMB 4CGWA 4IN3B 2DBAA 4AISA 4U0UA 4U95D 2CE7A 1D9SA 3V5UA 1BU9A 3PZ2A 2IF4A 4ZI2C 3QJZA 3ZT5A 4K5CA 3RYIE 1IJ6A 1TNYA 3UIOC 3EIQC 2OLTA 4ILGA 3C4WA 3AU4A 1IHBA 4QKNA 1HNXT 2LSJA 2VKJA 3KAEA 2ZGDA 4LMKA 2J47A 4COFA 1HZ4A 2XZTG 4K03A 4KZ0A 4CDMA 1RW2A 3B5MA 4H63H 3ZXSA 5BXUA 2RKKA 3VTYA 3AE6A 3CSFA 5KMGP 2JQ9A 1D0YA 2KT9A 3ML8A 3QNUA 5HEOA 1H2VC 4GYRA 1OWOA 1WDYA 2C2LA 1ZU2A 3FTUA 2XZEA 4DO0A 2UXCT 3FU3A 1N32T 3PZ1A 3RJVA 3O4XE 5M4YA 2E2AA 3RKOA 3BUAA 3RYCE 2GW1A 3UX4A 1MX4A 5FP3A 1T98A 3ZT7A 3NOCD 4OAUC 1UOHA 3PUSA 2FI7A 2X67A 4ZEYA 3HKCE 5EIBE 4HXIA 5JJ6A 3ZGQA 2WXJA 1E8XA 2DYRE 2EIME 2R03A 4X64T 3ZPJA 4Y6CA 4ASKA 3V30A 2VSXE 2Y8DA 2BG9A 1M7KA 4UR9A 2XEHA 3CK9A 4H9OC 1JWGA 2JQHA 1I94T 2EILE 1IHGA 2R6GF 4GOUA 2J4BA 2I6HA 4WNDA 4XBFB 2XZDG 2V4HC 4D10C 1E1HB 4O60A 1WR6A 2XAGB 2V6YB 5IWAT 5LFAA 2PQNA 3QB5A 3PZDA 2KXPB 1UK5A 5JDLA 4FJOA 2EINE 2CWYA 4XKCA 1N9AA 4FP7A 3CQCB 5LJNA 2QGSA 4ILAA 4YSZA 5FQ6A 3N2GE 4ZI7E 2JQKA 3SBSA 4QH5A 1OEDE 5JA4D 1QYMA 1EDUA 3H3AA 3HVEA 4LSZE 4ANWA 4BETA 3KBTA 3FUKA 1XDPA 1CHUA 3QKYA 2E8IA 2VKDA 2K5BB 4GA2A 3W9GA 2JMHA 4UQXA 3LVQE 3ZC1A 2WXFA 1SZAA 3OBVE 2CBJA 3MJXA 2OEVA 3E30A 2FBWA 4JI7T 2XHEA 2X6HA 3S4UA 1OT8A 2BEDA 2AVPA 1DNPA 4DV5T 3IHYA 4B89A 2XQ0A 3B13A 4Z68A 4OYJA 4BTBA 4BY6A 3CEQA 3DSUA 4O1PA 4O4JE 1KT0A 2ZLYA 2QRXA 3ETUA 3C4ZA 4TN7B 3RU0A 3LY9A 1UURA 4B3MT 2DWZA 1TNBA 4I2ZA 4RG6A 4HE8A 3ANWA 4DIDB 2FJEA 3ONKA 1EZ3A 3C5RA 4NXMT 2ODUA 4U0ZA 1HS7A 2LSGA 5LGUB 4JHRA 2KWHA 2GRQB 2H7OA 3DXMG 4HFGA 1A17A 3SFDA 3QWWA 3FTSA 3X2QE 2MOZA 3PURA 5LCYA 3OVUA 4OYSA 2XQAA 2IHR1 4B94A 2J62A 2VL0A 2XPKA 3PUYF 4JI8T 4NUVA 2YEVC 4HFEA 5E0OA 5HWYA 5ENQD 2BS2A 3ABME 1HTJF 3AG1E 1ZEEA 4ILBA 2V7IA 5AQQB 4AKIA 1CUNA 5CB4E 1X81A 4ANVA 3SOLA 3CHQA 1S94A 5F3JA 5F8PA 5D66A 4URKA 3Q49B 4XAXB 4N3CA 2MAWA 1S0PA 4YHHT 2YQ8A 2BG9B 3AE3A 4UV9B 1T72A 3RRWA 3O9XA 4U63A 5G55A 1H2TC 2VL8A 4OFZA 2WDQA 1N0RA 2H6IA 2LRLA 3O1IA 2X0YA 2LSKA 2Q7FA 2WZHA 4UELA 3GZ1A 4ZZBA 3N9MA 4GMRA 2UXNB 3ASDA 5B1BE 4FJYA 3AS4A 2GK9A 2CRBA 2P9NG 3DBSA 2WDVA 2OV8A 4FHKA 2XQ4A 4HFDA 4N3BA 3MX3A 3SO8A 2QFCA 1Y64B 1E8WA 4IT4A 1MZCA 4U7EB 3N9OA 2E9XB 4GZ5A 2AWIA 3L9TA 2JMKA 1LTXA 5CEAA 4HWHA 3ZMVB 2Q9QA 4LF6T 2WQHA 1KZOA 4G25A 2PZIA 4XZ4A 3P4RA 2AXUA 5CRVA
chains in the Genus database with same CATH topology
1MIYA 1BR4A 1N54A 4MKTA 3APFA 2XAFB 2LO6A 4A56A 3MKQB 3ESKA 5EX0A 2KM4A 5FWQA 4UVAB 5LHIB 1UW4B 5H6RB 3D3MA 3LVRE 1HE8A 1WYBA 4QWNB 2L9BA 2EQXA 1HFAA 2JPFA 5DBKA 3URZA 3UFEA 1XGWA 3HHMA 1X79A 2UWJG 5FXVA 4UVCB 3QK6A 2H7VC 4AKLA 3FP3A 3HR0A 2VQ2A 3N71A 5LGTB 4DPRA 4I50E 4AJWA 2E0IA 4FU3A 5FTPA 4UI9K 1Y8MA 4J8DA 3S7DA 3LKUA 3OYZA 3TAXA 3AAEB 4RG9A 3ASFA 3TG4A 4I9CA 4PUCA 2MYSA 3GZSA 4IIJE 1E90A 4HOUA 3R84B 4APOA 4HEAA 4I43B 2I1JA 1YD8G 3FUNA 4UQYA 5G2NA 4WNFA 1HU3A 4EBAG 2CHZA 2UY1B 2VTBB 4G1TA 2MTQA 1LVKA 5LOVE 4MALA 4C9BB 2Q9QC 1KK7A 3MA9A 3JCKC 4H7XA 3ZYKA 3BQIA 5AENA 3ZN0B 4AM9A 5J2TE 3R9AB 3IHRA 5C8YE 3G2WA 5G04J 4N78D 3TG5A 3JC6C 4O4IE 2D0TA 4NUUA 5ANLA 3C50A 3FH5A 1E96B 3PUAA 3OAWA 4YLHA 4FHJA 4UI9C 5JDMA 2IAKA 2J09A 1B89A 4KZCA 2JJ9A 4EPZA 3CX8B 3Q5XA 2QA7A 3HI2A 5L3FB 2VWAA 2KCKA 1WRDA 4CQIA 3U66A 5JR9C 4NQ0A 1QUUA 5FXZA 1JWFA 4KBQA 3K8PC 4HFVA 4BJNA 1PAQA 5IHYA 2CEAA 2WXHA 2BTDA 2B1EA 4DI4A 1MNEA 4IHJE 4P09A 3U4TA 2GRLA 5L2LA 3FFLA 5JR9A 2XEVA 4DNDA 4JL0A 5FNVE 4O4HE 1NZNA 2CFUA 1OUVA 2NTXA 2OVBA 2C0MA 2N1GA 4UWHA 2XUEA 4KT6B 4GYSA 4QX7B 3D9KA 4NRHB 3LJCA 4EYYR 3CMLA 3R7QA 4U8HA 5BPPA 3LDZA 4WWOA 1S35A 4DMVA 2R17C 5HWXA 3MA5A 3MACA 4MLKA 4HLEA 4B8AA 5HXCA 3QAQA 1GW6A 3EDTB 4PJNA 1INZA 3MKDA 1Z3XA 3L6AA 3RRNB 5LOZA 2KCLA 4NURA 1G8XA 3UUXA 2XAJB 4FULA 1N52A 5FY0A 5LP0A 2FULA 3UT4A 4JA9A 5T3RA 3N9PA 3BQKA 3FUDA 3UQ3A 4LEUA 2D0UA 4AKGA 3HIZA 2PJQA 4WBNE 4A3VA 5EZYE 2V0PA 5L3GB 4L0RA 3RC3A 1HS6A 3CVRA 5G05J 1HCIA 5M72A 5LP6E 4H9SE 3QARA 4L2LA 4PJMA 1HXIA 2DCPA 3IV0A 4BT9A 3IEEA 2W0GA 3S2AA 2CM0A 2CLYB 3SWHA 5FQ7A 1YW0A 3HKDE 5BV0A 3PDYA 2FO7A 3CVWA 4L1BA 2CA5A 3S7JA 4G2AA 3MV2B 3QDNA 1U4QA 2WXIA 4XI9A 3AS5A 2X9WA 4ZS3A 2WMNA 3FUFA 2LSIA 4I1MA 4BX9A 2C5JA 1P5QA 2LSUA 3NF1A 2OVFA 3EIJA 3ZHEB 3PU8A 5JR9B 2WXKA 2IFUA 3JQ0A 1VDYA 2C5KT 3CK8A 4Q69A 5JDGA 4TRQA 2L9QA 4HVBA 4O2AE 3KV6A 5JH7E 4I1OB 4HOTA 2VASA 3E0ZA 2HPLA 5ADXL 3LG7A 2DHRA 3VU7H 3W15B 3FHEA 3MV3B 3CVLA 3RX6A 1L5JA 2DIWA 2PFVA 3GWHA 4CDNA 2XGMA 4ZS2A 4PK4A 4IE0A 3PRZA 3PU3A 3UUXB 2QY7A 2BVMA 3ZN1B 1VRBA 4JEHB 2EHOB 5A1LA 4JEUB 3CIAA 3LS8A 4XX5A 2K48A 3D9PA 3ML9A 3ZPOA 3ONXA 3MGBA 5JQGE 4KMCA 1WM5A 1HG5A 2HH7A 2BVLA 2XPIA 3ASHA 3OTNA 3I1AA 1MMNA 3MKRA 2V7JA 4TV3A 2CG3A 1H7CA 2KZ7B 3SNXA 5FZSA 4LUNU 4H9NC 1NAFA 4OVUA 3L08A 2C0SA 3MCXA 1D1BA 3O48A 1HX8A 4JHKA 4ILHB 5LHGB 3IBEA 2A2FX 2D2SA 4CCAA 4O8SA 2E9XD 2JEKA 2CHWA 2XQYA 1LF8A 4TV8E 3QUJA 4IYPA 5EDSA 4AXPA 3B7UX 2I9CA 4HOSA 1UN8A 3DP7A 1MQSA 4FLHA 2PBIA 3N9QA 3AAIA 2Q9QB 3ZMZB 2IQCA 3AU5A 4ERRA 4IE4A 2J9QA 3L3PA 1UJJA 3SGHA 2EHOC 2Q9QD 3RH3A 3PEUB 4I43A 2IC6A 3CVQA 5EX3A 5EK2A 4BWRA 1BR1A 4G26A 4I17A 3DTOA 3HYMB 3OXFA 4HS2A 1TJCA 3KEZA 2NWBA 5LCWJ 3KV5A 5ETWA 2LSYA 3FUMA 2WXMA 2X6IA 2EHOA 1MMAA 5JJ7A 1IQRA 1EF1C 4N3AA 3K3NA 4GAAA 1HO8A 4MBQA 4B6XA 3DPDA 4GMLA 3I0OA 3PUGA 5J2UE 2XTLA 4IE7A 4ZI3C 3NZUA 1WLXA 3HKBE 4Q94A 3N2KE 2VSYA 4JVSA 3SHFA 2ZM0A 4EOZB 5CCLA 2W61A 4UVBB 1FIOA 1DVPA 2NTYA 3CVPA 4XIFA 4L9IA 5KDMC 3GN5B 4ILUA 2VKHA 5ARFA 3KVAA 4IGUA 3MEKA 3QB2A 1V9DA 2M63A 5LYJE 2NXPA 3ZHEA 4PW8A 2EHOD 4ISSA 3CR3A 4XI0A 2L6JA 2CHXA 4BX8A 3SF4A 4KVMA 4FA6A 2AXZA 5KJNA 3Q15A 4U74A 3NRXA 2R59A 2YNQA 3PUKA 1BR2A 2J49A 3D9OA 3RIBA 3ENEA 3CX7B 2X9XA 3J9X1 3T5XA 3SRZA 2WPVA 3OXGA 3RRMB 5HQ8A 5LCWC 3V5SA 3FULA 3FXDB 1KT1A 5AFUL 2R5SA 4H63V 4X1YE 3OXLA 3ZN3A 1OXZA 5CA0E 4F53A 4JA7A 2VGYA 4CXXA 3FH7A 1MNDA 5FY1A 4NACA 4GU5A 4JEHA 3ZCIA 3CVNA 2RA1A 1OWMA 3O4ZA 3ESLA 5JRCA 4JUYA 4U0SA 4LCTA 1ELWA 2MRIA 2VYIA 3PE4A 1E8YA 1TEZA 3PUQA 4P0BA 3FBLA 2HR2A 2IW5B 3P2BA 1XNFA 2LE8A 3R7RA 3I4RB 5JHAA 1IJ5A 2YU1A 4X1IE 2V8SE 4DK5A 2RD0A 1FVHA 2WXNA 3Q5WA 4N5CA 1LVFA 4IULA 4XZCA 2DI4A 4HORA 2X0LB 2CXLA 3SI5A 3D9MA 3T8MA 2XAHB 4GA1A 3S7BA 3I9YA 2PG8A 4N2SA 3QNKA 2ZU6B 3LBXB 3VLFA 1FCHA 3CSTA 4YNDA 1IZNB 4PFOA 3AVRA 3ZYMA 4KVOA 3PE3A 4UIGA 4CZZB 4CI2B 3GYZA 3OYXA 2UY1A 5FT9A 2VTBA 3IKOB 3EHNA 4ZI2D 1MMGA 4G24A 4N2QA 3Q5MA 5IYZE 3EDUA 4V1Av 3ZW3A 1LRZA 5GONE 3RRCA 5T8IA 5DABA 4E6HA 1OWAA 3R6NA 2NC9A 4WWNA 4ILIA 4P0AA 5T4YA 3OJAA 4PH4B 3ZJ1A 3T8OA 2X9YA 1KLXA 3LK42 3D9JA 2X6KA 3BG1B 3HA4A 3CWZB 5HXRA 3FU0A 2AXVA 1Z3YA 5CCMA 2XAQB 2WXOA 4CRWA 3AVSA 3PNTB 4A1SA 2V4LA 5CHEE 5KX5E 5BW8C 4GYWA 3UUMA 4JLEA 3FXEB 4ACKA 4ZHQE 5EK3A 4JW1A 4DMWA 2D5UA 5L3DB 5ARGA 4F3VA 2HO1A 3ONLA 5HXSA 1JUQA 3GA8A 3QC9A 4L7TA 3UUNA 4GZ3A 3AA7B 3C51A 3CPZA 4PS8A 5EK4A 1YA0A 5E75A 1BR0A 4I9EA 4UV8B 4ABNA 4BA9A 4FI5A 5G04C 2WXRA 4H9QC 3FDHA 4XKBA 4E7SA 4O6FA 3LK3B 2H3RA 2LAHA 3QC1A 4PK6A 3VTXA 1ZKEA 2CWOA 3VKGA 4MFRA 2X66A 1QQEA 3CVYA 2HPJA 3ZC0A 4PS3A 3TXMA 4KMOA 5AYWD 2E2EA 2HM8A 3EVYA 3D9LA 4R7LA 3TKLB 2IONA 1NA3A 4ANUA 3FWVA 4JC8A 3ZMSB 4OYKA 3FTYA 4ISTA 2CXFA 3HVEB 3PNLB 5L3EB 5DQWA 4I1AA 3U9WA 4GMJA 2V5FA 3BK9A 3PE0A 4C0MA 5JDQA 4HOQA 3VKHA 3LFMA 3RKVA 3EDVA 3UT8A 3FU5A 3WXXA 2GGFA 4CT4A 3I5PA 2BZBA 4U07A 4AVXA 3LK2B 3JC6D 3NZQA 3AA1B 5A6CA 5LGNB 1NP7A 3VLDA 3HKEE 3LEWA 4UEMA 2WXQA 4B0ZA 5C1DA 2I2OA 5BT1A 3TJPA 3ETVA 3RPUA 3AA6B 4TUYE 4BTAA 5J90A 3VHLA 2RG8A 4AIFA 2X51A 4BT8A 4UWKA 3U78A 1SZ9A 1H6KA 4EXTA 1QNFA 3WAJA 4RVBA 2ES0A 1HG2A 3KV4A 5J08A 2A5UA 3DJBA 1TJFA 4WNKA 2KLQA 2WAUA 4WAFA 1U3DA 4A3TA 3MZLB 3QWVA 4WBOA 4GK5E 4AQFC 3CHRA 2Y3AA 5KJLA 2XPYA 1NA0A 2VSNA 3KS2A 3WAKA 3HL6A 2UXXB 3BG0B 4Y6WA 2DCFA 2WBLA 3ZJ2A 3CQXC 1EPUA 4AQFA 4EIWA 3T5VA 5A7DB 2ZM2A 1D1CA 3ZLIA 4UI9J 3UPVA 3FTXA 2LOSA 1OWNA 2DWKA 4JXTA 1UJKA 3CKBA 3AS8A 2P58C 3FEYA 4IE6A 4HN9A 4JPSA 4F7AA 2LJLA 2C5IT 3Q9DA 2LHNA 2LHRA 4C91A 4GIWA 2YHCA 5ANRA 2G0UA 1Z6TA 1D1AA 3QWPA 4G23A 1NWMX 2Y4TA 3LPZA 4O2BE 2P9BA 3PVLA 4EZJA 1IAPA 2YHEA 4J8EA 3L22A 5LJMA 3G2UA 5JHBA 3PS6A 3GMIA 5FXWA 4QHOA 3LCAA 1JPLA 2WXPA 3RRUA 2DNXA 2W62A 4ZOLE 1LKXA 5JDNA 3IHVA 1SA0E 4AKHA 3VLEA 3N5LA 3AA0B 5JRCB 2IOSA 1ELKA 3J7Yq 2J1DG 5JREA 3MYVA 3RYFE 3E22E 2PQRA 1OWPA 3B7SA 4L23A 5LA6E 4I2WA 3L16A 3NBXX 4U04A 4W9RA 1SQMA 2Y6XA 4GZDA 4P29A 4KYOB 4E7ZA 4ANXA 2A3DA 4EZLA 5FQ4A 4WNGA 4UQZA 3CHMA 3FHNA 4GA0A 5HXHA 4C90A 4J8SA 3OKQA 4UF0A 3KVBA 4O4LE 4K0RA 4EYUA 4J0UA 5KCMA 3QOUA 2X68A 4CI3B 4AOFA 4FJZA 2MBGA 1E7UA 4EQFA 3L13A 5KJKA 1B7TA 3KINB 5E76A 2L0TB 2KWIB 1Y6IA 4AY6A 4A1GA 5JVDE 5L3CB 4QXBB 3RO2A 3FUHA 2CMRA 4GB9A 3S7FA 1WY6A 4LRZA 3FB2A 1KNZA 3U3IA 4PNIA 5FQ8A 3CVVA 5LNKA 2ONDA 1U5PA 1US7B 3I9WA 5CMYA 5HAXA 4DJAA 3PUJA 4EB6E 3GZ2A 2VGXA 4CXWA 1ELRA 3U3WA 3BQLA 1ZV4X 3PH0C 2WB2A 5JDFA 2NW7A 4EZKA 2FF4A 5LBMA 3NZPA 5BMVE 1QSDA 3ZMUB 3B7TA 1D0ZA 5H6QB 5L3BB 4AV7A 4OHFA 3PEVB 3K3QC 3CLJA 2C0LA 2NP9A 3MKQA 1IYGA 4L2YA 3AAAB 1X5BA 3GN5A 1O3XA 3RC8A 4QX8B 2J08A 5FMNA 3A5XA 2OOEA 3L09A 2VSOE 5CMWA 2KC7A 5AIJA 3LY7A 2PM7A 2YINA 4TX5A 3CQGB 4YVQC 2E9XC 5LXTE 2WQ6A 4PAGA 2K9AA 3HDXA 1UX4A 3TGOA 3MJWA 3SBTB 2A72A 4I6JA 5CA1E 4H7YA 3G2VA 4AEZC 2WXGA 3ZRHA 2AW6A 2J4DA 2W63A 2IU1A 5BNWA 4TUUA 4ME2A 3MXZA 3EHMA 3ULQA 4UF0B 4F1SA 2XASB 1MIWA 3P7IA 2HYZA 1HF8A 4KP3C 4I55E 3TL5A 4FLBA 4GYOA 1VOMA 1PC2A 4YFSA 1MHQA 2XRZA 3SFZA 4CT0A 5LX8A 3UULA 5HXEA 4PJJA 4X1KE 4YHJA 5A23A 2VKOA 2VGXB 2CXDA 4KXKB 1U3CA 2PL2A 1Z0PA 3UMVA 4UWLA 5FYMA 3ZIMA 4GZCA 3D9IA 2WXLA 2X38A 2L0IA 2VJ8A 5FZRA 3I0QA 1BPOA 2K24A 2V7LA 5DIZA 2I1KA 3LYAA 5JDHA 2WMOA 3D9NA 2DLRA 4HGAA 2KCVA 1MMDA 1SHZC 1YKEB 3M65A 3E08A 4JHJA 5AJDA 3WI3A 4JZYA 2KZTB 2VB6A 3ZFWA 4L5GA 3KFWX 3SS1A 4CGVA 4I6GA 2LOPA 1PY1A 4ACLA 3P8CD 3D0TA 3E4BA 3C4XA 2V7KA 2MHKA 4GCNA 5AJLA 3JUIA 3G2SA 4CEMA 2FEZA 1ZBPA 2V26A 5FJYA 2JRKA 2ZM8A 3PREA 3I4GA 3N9LA 2WWUA 2ILRA 4I4TE 3N2OA 4GK0E 4N39A 4UWGA 3U64A 4DBQA 5HYAA 2XCCA 2XRYA 3L54A 3CX6B 3KD7A 1FVFA 4APFA 4FC8A 3EUHA 3LBXA 2KATA 2ZMAA 2XGOA 4H9PC 4AI6A 2WVIA 3ANWB 2X6JA 2BF0X 4PS7A 3ASGA 3FBZA 1EYHA 3AB3B 1OWLA 3IF8B 3JYSA 4DI3A 3TXNA 4IDZA 4BSXA 3FUJA 1E8ZA 4J2CA 5LBQB 3FEXA 3CV0A 3B7RL 3O1JA 5BV1A 3FTWA 4V3IA 4TZ4C 5J1GA 3NZSA 4DVDA 2LM9A 1MIVA 3UTKA 2I59A 3GW4A 5LG4A 4OVVA 4LERA 1WAO1 1AJ3A 3MK7C 3ZMTB 3ZCJA 4MHCA 5D0QD 4UWFA 1G73A 2V7MA 1E7VA 1H19A 2A4ZA 4M3OA 3FUEA 3SZ7A 2NW9A 4EZHA 1QZ2A 4AP2A 5FY7A 2KMFA 3H37A 4G11A 4CDRA 3KBUA 2KNDA 1ZHCA 4AKRB 4TV9E 4C0EA 3PTRB 2Y4UA 3B57A 2IJGX 4DLOA 2ODVA 3LJ3A 2KINB 1UX5A 2CFZA 1H2UA 2IOLA 2KZTA 2X6FA 2NOXA 5FXXA 3CHSA 2LAIA 3QK0A 3FUIA 3F2EA 4KUMB 5BUZA 2Z6EA 4EECA 3K3OA 3KV9A 4G63A 3K9IA 4PDXA 2M67A 4U72A 5FZQA 4ATGA 2YU2A 2CG2A 2DWGA 4IE5A 3C64A 3IBPA 5KJMA 3N9NA 1UCUA 2IC9A 4PK5A 1UN9A 4HTEA 4AQGA 4GPKA 3C98A 4EZ4A 4X20E 3CHOA 4OK0A 2ACXA 2Y48B 4H9RC 4XE0A 4WUYA 2YK0A 2CLYC 3FTVA 4CXYA 2GRMA 5DJQC 3LY8A 2NW8A 1D0XA 5LHHB 3APDA 2XCBA 3L17A 3RK6A 2BUGA 2V1DB 4EBAA 3UT5E 4PJLA 3ZEFB 4GCOA 4MRUA 3CKCA 4WWPA 2JQQA 4DBRA 2E9XA 5HI7A 3CKDA 4BFRA 4K0UA 4AXHA 5JJTA 2WSSV 4BJMA 3IEGA 2CCQA 4MLPA 4IRUA 3CK7A 2BDEA 3KDSE 3BEEA 4QXHB 4YVOA 4FADA 3ZYLA 2SPCA 4QFVA 5C2YA 3P1UA 4Q96A 4EAHA 2FBNA 3CVXA 4GYYA 3APCA 2RP4A 4I6EA 3CHPA 4MS6A 5TAOA 4ANJA 4ZI3D 1YKHB 1IQUA 1W3BA 3CGHA 5D0OD 5G05C 4ADZA 3SD5A 2N2NA 2WM9A 2JLBA 1FMVA 3RO3A 3O1HA 4A55A 3NQPA 2OA5A 4RSYA 2LNIA 4YJ2E 3FTZA 3I3NA 4B8CB 3MZKB 3Q47B 3C98B 3F57A 4G2VA 4E85A 3JQ1A 5EKQD 4CI1B 2L3LA 4BAYB 2XGSA 2X9HA 2MOWA 4J6IA 2X3MA 1UG3A 3ZVVA 4M1PA 4HKAA 3PDNA 4F6RC 2XPZA 1FEWA 4WNEA 2LT3A 1WYCA 3ZEFA 4AY5A 3FU6A 3F31A 2LEHA 3EJNA 4PFPA 3ZYQA 4J8FA 3UT7A 3LXUX 5DQVA 4GZ6A 2L8KA 4YJ3E 3Q2MA 4UXNB 3NRYA 3FY4A 2LSVA 1HH8A 3CVUA 2PM6A 2W00A 2N9DA 4QXCB 3FH8A 3Q4AB 1FMWA 2NSZA 1H0AA 2VK9A 3G2TA 2J07A 4DLQA 4Z8XA 2WQ7A 3RYHE 4JEUA 2XHEB 4WW0A 5ENNA 4KBMB 4CGWA 4IN3B 2DBAA 4U0UA 2CE7A 3V5UA 2IF4A 4ZI2C 3QJZA 3RYIE 1IJ6A 3EIQC 4ILGA 3C4WA 3AU4A 4QKNA 2LSJA 2VKJA 3KAEA 4KZ0A 1HZ4A 4K03A 4CDMA 4H63H 3ZXSA 3VTYA 3CSFA 5KMGP 1D0YA 2KT9A 3ML8A 1H2VC 1OWOA 4GYRA 2C2LA 1ZU2A 3FTUA 4DO0A 3FU3A 3RJVA 3O4XE 5M4YA 3RKOA 3RYCE 2GW1A 3UX4A 5FP3A 1T98A 3PUSA 2FI7A 2X67A 3HKCE 4HXIA 5JJ6A 3ZGQA 2WXJA 1E8XA 3ZPJA 4Y6CA 4ASKA 2VSXE 2Y8DA 3CK9A 4H9OC 1JWGA 1IHGA 2J4BA 4GOUA 4WNDA 2I6HA 4XBFB 4D10C 1E1HB 1WR6A 2XAGB 5LFAA 2PQNA 3PZDA 2KXPB 5JDLA 4FJOA 2CWYA 4XKCA 4FP7A 3CQCB 5LJNA 2QGSA 5FQ6A 3N2GE 4ZI7E 3SBSA 1EDUA 3H3AA 3HVEA 4ANWA 3KBTA 3FUKA 3QKYA 2E8IA 2VKDA 2K5BB 4GA2A 2JMHA 4UQXA 3LVQE 3ZC1A 2WXFA 1SZAA 3OBVE 3MJXA 2XHEA 2X6HA 3S4UA 2AVPA 1DNPA 3IHYA 4B89A 2XQ0A 3B13A 4OYJA 4BTBA 4BY6A 3CEQA 4O4JE 1KT0A 2ZLYA 3ETUA 3C4ZA 4TN7B 3RU0A 3LY9A 4I2ZA 4RG6A 4HE8A 3ANWA 3ONKA 1EZ3A 2ODUA 4U0ZA 1HS7A 2LSGA 5LGUB 4JHRA 2KWHA 2H7OA 4HFGA 1A17A 3QWWA 3FTSA 2MOZA 3PURA 5LCYA 4OYSA 4B94A 4NUVA 5E0OA 2YEVC 5HWYA 1HTJF 1ZEEA 2V7IA 4AKIA 1CUNA 5CB4E 4ANVA 3SOLA 3CHQA 1S94A 5F3JA 5F8PA 4URKA 3Q49B 4XAXB 4N3CA 1S0PA 2YQ8A 4UV9B 3RRWA 3O9XA 4U63A 5G55A 1H2TC 2VL8A 4OFZA 3O1IA 2LSKA 2Q7FA 4UELA 3GZ1A 3N9MA 2UXNB 3ASDA 4FJYA 3AS4A 2GK9A 3DBSA 2OV8A 4FHKA 4N3BA 3MX3A 2QFCA 1Y64B 1E8WA 3N9OA 2E9XB 4GZ5A 2AWIA 2JMKA 3ZMVB 2Q9QA 2WQHA 4G25A 2PZIA 4XZ4A 2AXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VHL A;  3B13 A;  2YIN A;  2WMO A;  2WM9 A;  2WMN A; 
#chains in the Genus database with same CATH topology
 2J4G A;  1MIY A;  1BR4 A;  3RSE G;  1N54 A;  4MKT A;  1AP7 A;  3APF A;  2XAF B;  2LO6 A;  3RIU A;  4A56 A;  5ABH A;  3MKQ B;  3JXI A;  3ESK A;  5EX0 A;  2KM4 A;  5FWQ A;  3PV0 F;  4UVA B;  5LHI B;  4UUC A;  1UW4 B;  5H6R B;  3D3M A;  5AQO B;  3L39 A;  3LVR E;  1HE8 A;  1SE7 A;  5AQS B;  1WYB A;  4QWN B;  2L9B A;  2EQX A;  5CRU A;  1HFA A;  2JPF A;  5L4H A;  5DBK A;  3URZ A;  2LXM A;  4HFC A;  3UFE A;  1XGW A;  2FJD A;  5JMN D;  3HHM A;  5AQU B;  1X79 A;  2UWJ G;  5FXV A;  4UVC B;  5J0Z A;  3QK6 A;  2H7V C;  1N94 A;  4AKL A;  3FP3 A;  3HR0 A;  3P4P A;  5LB7 B;  2VQ2 A;  3N71 A;  5LGT B;  1I6Z A;  3FZL B;  4DPR A;  4I50 E;  4AJW A;  2DZO A;  2E0I A;  3PZ3 A;  4FU3 A;  3P4W A;  3EHZ A;  4UI9 K;  5FTP A;  1Y8M A;  4J8D A;  3S7D A;  3LKU A;  3OYZ A;  3TAX A;  4TNW A;  3AAE B;  4JI3 T;  4JI2 T;  4RG9 A;  3ASF A;  4EHM A;  1HNZ T;  3TG4 A;  1E2A A;  4I9C A;  2KXP C;  4PUC A;  2MYS A;  3GZS A;  4IIJ E;  2P9L G;  1E90 A;  4HOU A;  3E34 A;  3R84 B;  4U7Y A;  4JI4 T;  2PNN A;  3HXC A;  3T1Y T;  4APO A;  4HEA A;  4I43 B;  4U7I A;  2I1J A;  1YD8 G;  3FUN A;  4UQY A;  3KSQ A;  5G2N A;  4WNF A;  4TNV A;  1HU3 A;  4EBA G;  1LD8 A;  3AE4 A;  3AE1 A;  2CHZ A;  2UY1 B;  2VTB B;  4G1T A;  2MTQ A;  1LVK A;  3JCF A;  5LOV E;  4MAL A;  1N4R A;  4C9B B;  2Q9Q C;  4HFH A;  2J8S D;  5AQF B;  1KK7 A;  2XQ8 A;  4HFB A;  3KSL A;  3MA9 A;  1W09 A;  3JCK C;  4H7X A;  3ZYK A;  3BQI A;  5EN5 D;  5AEN A;  3ZN0 B;  4AM9 A;  5J2T E;  3R9A B;  3IHR A;  5C8Y E;  3G2W A;  5G04 J;  4N78 D;  3TG5 A;  1MJ0 A;  3JC6 C;  4O4I E;  2D0T A;  4NUU A;  5ANL A;  5LMU T;  3C50 A;  3FH5 A;  1E96 B;  1O1T A;  4JBW F;  1GQE A;  3PUA A;  3OAW A;  3UM3 A;  4YLH A;  4FHJ A;  3DEO A;  5D2M C;  4UI9 C;  3CK6 A;  5JDM A;  2IAK A;  2WCA A;  2J09 A;  1B89 A;  4KZC A;  2JJ9 A;  4EPZ A;  3CX8 B;  3Q5X A;  2QA7 A;  3HI2 A;  4HRN A;  5ENS D;  5L3F B;  2UUC T;  2VWA A;  1KEY A;  2KCK A;  3UI2 A;  1WRD A;  3Q5E A;  4CQI A;  3U66 A;  5JR9 C;  4HI8 A;  3Q9U C;  1QUU A;  4NQ0 A;  5FXZ A;  2LM2 A;  1JWF A;  4KBQ A;  3K8P C;  4HFV A;  4BJN A;  1PAQ A;  5IHY A;  1K1B A;  2CEA A;  2WXH A;  2BTD A;  2B1E A;  4DI4 A;  1MNE A;  4IHJ E;  4P09 A;  4LNU D;  3C3R A;  3U4T A;  2V5C A;  4LFC T;  2GRL A;  4B3T T;  5L2L A;  4N5Q A;  2KSR A;  3FFL A;  5IY5 E;  5JR9 A;  2XEV A;  4DND A;  3AG4 E;  2FUP A;  4JL0 A;  2OV9 A;  5FNV E;  4O4H E;  2RFA A;  2XS1 A;  1NZN A;  2P9P G;  2PTF A;  2CFU A;  1OUV A;  1VCT A;  2NTX A;  2OVB A;  2MPK A;  2C0M A;  2VGE A;  2N1G A;  4UWH A;  2XUE A;  4KT6 B;  4GYS A;  4QX7 B;  1X9B A;  3D9K A;  4NRH B;  3LJC A;  4EYY R;  3CML A;  3R7Q A;  3ZXP A;  3ABL E;  4U8H A;  2ZM6 T;  3LDZ A;  5BPP A;  4DR7 T;  1UUS A;  2Y0B G;  4WWO A;  1S35 A;  4DMV A;  2R17 C;  5HWX A;  3MA5 A;  3MAC A;  4MLK A;  3DWL G;  4HLE A;  2BG9 E;  4B8A A;  5HXC A;  1FJG T;  4U2Z A;  3IXE A;  3QAQ A;  1GW6 A;  4GPM A;  2R2L A;  3EDT B;  4PJN A;  1TYQ G;  1INZ A;  4YTM A;  3MKD A;  2ACZ A;  1Z3X A;  3L6A A;  3RRN B;  5LOZ A;  2KCL A;  4NUR A;  2NYJ A;  2FO1 E;  1G8X A;  3UUX A;  2XAJ B;  4FUL A;  1N52 A;  5FY0 A;  5LP0 A;  3ULY A;  4HWI B;  2XM2 A;  2FUL A;  1UGO A;  5FVL A;  3AE2 A;  3UT4 A;  1IXV A;  4JA9 A;  5T3R A;  3N9P A;  3BQK A;  2F8X K;  5CFB A;  2QYU A;  3FUD A;  3UQ3 A;  3T1H T;  4LEU A;  2D0U A;  2E5V A;  4AKG A;  3HIZ A;  2PJQ A;  4WBN E;  4A3V A;  1W0A A;  2XS8 A;  5EZY E;  2V0P A;  2V5D A;  3EUV A;  5L3G B;  4L0R A;  3TLT A;  1XZY A;  3RC3 A;  4YT0 A;  1HS6 A;  3CVR A;  5G05 J;  1HCI A;  3NWI A;  2P9I G;  5LP6 E;  5M72 A;  3V2O A;  4IDQ A;  4H9S E;  3DRA A;  3QAR A;  4A97 A;  4L2L A;  3RGL A;  1AWC B;  4PJM A;  1HXI A;  2DCP A;  3IV0 A;  4K5A B;  4BT9 A;  3IEE A;  3PZ4 A;  5AQ7 A;  2W0G A;  2BBJ A;  3S2A A;  2CM0 A;  3UU8 A;  2CLY B;  3SWH A;  3P4Q A;  5FQ7 A;  1YW0 A;  5B1A E;  3HKD E;  5BV0 A;  3PDY A;  2FO7 A;  3CVW A;  4L1B A;  3NKZ A;  2CA5 A;  3S7J A;  4G2A A;  4YXD A;  3MV2 B;  1U4Q A;  2WXI A;  3QDN A;  4XI9 A;  3AS5 A;  2X9W A;  4ZS3 A;  2WMN A;  3AEB A;  2DL1 A;  3FUF A;  2LSI A;  3LDQ B;  4I1M A;  4BX9 A;  2C5J A;  1HNW T;  1P5Q A;  2LSU A;  3PUW F;  2WWV A;  3NF1 A;  2OVF A;  2X0H A;  2AJA A;  3EIJ A;  3DSS A;  3ZHE B;  4LG6 A;  2L6B A;  3PU8 A;  5JR9 B;  4GTS A;  2WXK A;  1KZP A;  3OTO T;  2IFU A;  3JQ0 A;  1VDY A;  2C5K T;  1XWM A;  3CK8 A;  4Q69 A;  2XM1 A;  1WFD A;  5JDG A;  2L9Q A;  4TRQ A;  2QYW A;  4HVB A;  4O2A E;  3KV6 A;  5JH7 E;  4I1O B;  4HOT A;  2VAS A;  4A98 A;  3E0Z A;  2HPL A;  5ADX L;  3LG7 A;  4DR6 T;  2H6F A;  2DHR A;  2WZI A;  3VU7 H;  3W15 B;  3FHE A;  3MV3 B;  3Q79 A;  1N95 A;  3CVL A;  3RX6 A;  1L5J A;  5KNG A;  2DIW A;  2PFV A;  3GWH A;  4CDN A;  2XGM A;  2EIJ E;  2UXD T;  4ZS2 A;  3V79 K;  4KI0 F;  4PK4 A;  2DVW A;  1SA4 A;  4IE0 A;  3PRZ A;  3EI0 A;  3PU3 A;  3UUX B;  2QY7 A;  3RLF F;  2BVM A;  4IDN A;  3ZN1 B;  1VRB A;  4JEH B;  2EHO B;  5A1L A;  4JEU B;  3CIA A;  3LS8 A;  1MYO A;  4NXN T;  4XX5 A;  1H6P A;  2K48 A;  3D9P A;  3ML9 A;  4DUZ T;  3ZPO A;  3ONX A;  3MGB A;  3ONJ A;  5JQG E;  4KMC A;  1WM5 A;  1HG5 A;  2HH7 A;  2BVL A;  2XPI A;  4LF8 T;  2JAB A;  4HQD A;  3HRA A;  3ASH A;  3OTN A;  3I1A A;  1MMN A;  3VRB A;  1BLX B;  2IEJ A;  1IBM T;  4EGW A;  2V7J A;  3MKR A;  1Y01 A;  4TV3 A;  2CG3 A;  1H7C A;  2KZ7 B;  3SNX A;  4BEP A;  3Q75 A;  5FZS A;  2IO3 C;  3AAA C;  4LUN U;  4H9N C;  3ZST A;  1NAF A;  4OVU A;  1QBQ A;  3L08 A;  2C0S A;  3MCX A;  1D1B A;  4AQY T;  1HX8 A;  3O48 A;  4JHK A;  2IUB A;  5AQH B;  4ILH B;  5AQ9 A;  5LHG B;  4KX6 A;  3FZK B;  3IBE A;  4IDP A;  2A2F X;  2WB5 A;  2D2S A;  3PJA A;  4CCA A;  4O8S A;  3UIP C;  2E9X D;  3H3M A;  4KHZ F;  2JEK A;  2CHW A;  4TXR A;  3CIR A;  2XQY A;  2XSB A;  1LF8 A;  1BD8 A;  4TV8 E;  1SW6 A;  3QUJ A;  5AQP B;  2K3W A;  4IYP A;  1YQ4 A;  4IRE A;  4AXP A;  3B7U X;  5EDS A;  2I9C A;  4HOS A;  1UN8 A;  5ENP D;  3DP7 A;  1MQS A;  1V54 E;  4FLH A;  2PBI A;  3N9Q A;  3AAI A;  2Q9Q B;  3ZMZ B;  2IQC A;  3AU5 A;  4ERR A;  3TWR A;  4IE4 A;  2J9Q A;  3L3P A;  4BSZ B;  1UJJ A;  3SGH A;  2EHO C;  2Q9Q D;  1XMO T;  1K1A A;  3BQO A;  3RH3 A;  3PEU B;  4I43 A;  2IC6 A;  3CVQ A;  5EX3 A;  5EK2 A;  4BWR A;  2DZN A;  1BR1 A;  4G26 A;  4I17 A;  3DTO A;  3HYM B;  3RQW A;  2F0Y A;  4U33 A;  3OXF A;  4HS2 A;  1TJC A;  3KEZ A;  2NWB A;  5LCW J;  4DX7 D;  3KV5 A;  5ETW A;  2LSY A;  3FUM A;  2NR4 A;  2XQ9 A;  2WXM A;  5C3J A;  2X6I A;  2BBH A;  2EHO A;  1MMA A;  2LUH A;  1IQR A;  5JJ7 A;  1EF1 C;  4N3A A;  3K3N A;  2XEE A;  4GAA A;  1HO8 A;  4MBQ A;  4B6X A;  3DPD A;  4GML A;  2VQE T;  3I0O A;  3PUG A;  5J2U E;  2XTL A;  4IE7 A;  1W9R A;  4ZI3 C;  1JCR A;  3NZU A;  1WLX A;  4YTN A;  3HKB E;  4Q94 A;  3N2K E;  2VSY A;  4JVS A;  3SHF A;  2ZM0 A;  4EOZ B;  3DXK G;  5CCL A;  3HG0 D;  2W61 A;  4UVB B;  1Z5S C;  3EU5 A;  1FIO A;  1DVP A;  2NTY A;  3CVP A;  4XIF A;  4L9I A;  5KDM C;  3GN5 B;  3RIA A;  4ILU A;  2VKH A;  5ARF A;  3ZKR A;  3NOG D;  2W4X A;  3KVA A;  2V8S V;  1J5W A;  4IGU A;  3MEK A;  3QB2 A;  1V9D A;  1NL4 A;  2M63 A;  5LYJ E;  1KPS B;  2NXP A;  3ZHE A;  4PW8 A;  2EHO D;  4DR1 T;  4ISS A;  3CR3 A;  4XI0 A;  2L6J A;  2CHX A;  4BX8 A;  3SF4 A;  1RZ4 A;  4KVM A;  4FA6 A;  2AXZ A;  5KJN A;  3Q15 A;  4U74 A;  5EYP F;  3NRX A;  2R59 A;  4U96 D;  2YNQ A;  3PUK A;  1BR2 A;  2J49 A;  3D9O A;  3RIB A;  3ENE A;  3CX7 B;  4DR4 T;  2X9X A;  3J9X 1;  3T5X A;  3SRZ A;  3VR9 A;  2WPV A;  3OXG A;  3RRM B;  3TLV A;  5HQ8 A;  5LCW C;  3V5S A;  3FUL A;  3FXD B;  1KT1 A;  1OXJ A;  5AFU L;  2R5S A;  4H63 V;  4X1Y E;  3OXL A;  3ZN3 A;  1OXZ A;  5CA0 E;  4F53 A;  3UFG A;  4JA7 A;  2VGY A;  1KNR A;  5B3S E;  5KWD A;  4CXX A;  3FH7 A;  1NEK A;  4OX9 T;  1MND A;  2BKN A;  1TNU A;  5FY1 A;  4NAC A;  5H7P A;  4GU5 A;  2IIU A;  1N4P A;  4JEH A;  3AED A;  1DC2 A;  5KBA A;  3ZCI A;  3CVN A;  2RA1 A;  1O1R A;  2ZGG A;  3UU5 A;  2ETC A;  3AE7 A;  1DU2 A;  1OWM A;  3O4Z A;  2UUB T;  3ESL A;  5JRC A;  1OCC E;  4JUY A;  4U0S A;  4LCT A;  1ELW A;  2H6G A;  2MRI A;  2VYI A;  3PE4 A;  1E8Y A;  1TEZ A;  3C72 A;  3PUQ A;  4P0B A;  3FBL A;  2HR2 A;  3L82 A;  4RQI A;  2IW5 B;  3P2B A;  1TN8 A;  1XNF A;  2LE8 A;  3R7R A;  3I4R B;  5JHA A;  1IJ5 A;  2YU1 A;  4X1I E;  2V8S E;  4EV6 A;  4DK5 A;  2RD0 A;  5ABE A;  1FVH A;  2WXN A;  3Q5W A;  4N5C A;  1LVF A;  4IUL A;  4XZC A;  2DI4 A;  4EEB A;  4HOR A;  3JUE A;  2X0L B;  1IKN D;  2CXL A;  4DR5 T;  3ZT6 A;  3SI5 A;  3D9M A;  2M6I A;  4G8L A;  3T8M A;  2XAH B;  4GA1 A;  3S7B A;  3I9Y A;  5HKP A;  2PG8 A;  4N2S A;  3QNK A;  2ZU6 B;  3LBX B;  1WG0 A;  3VLF A;  1FCH A;  4LNB A;  3CST A;  4YND A;  2BKG A;  1IZN B;  4NPP A;  3ZYM A;  3AVR A;  4PFO A;  3Q7A A;  4A63 B;  4TUM A;  4KVO A;  3PE3 A;  4UIG A;  2M6B A;  5AN8 A;  4CZZ B;  4CI2 B;  3GYZ A;  1K8K G;  1T8B A;  3OYX A;  2UY1 A;  5FT9 A;  2VTB A;  3IKO B;  3EHN A;  4ZI2 D;  3Q73 A;  3UU4 A;  1MMG A;  2HN2 A;  4G24 A;  4N2Q A;  3Q5M A;  5IYZ E;  3EDU A;  4V1A v;  1YYH A;  3ZW3 A;  2FJB A;  1LRZ A;  4B3R T;  4HRM B;  5GON E;  3RRC A;  5T8I A;  5DAB A;  3V31 A;  4E6H A;  1OWA A;  4JI5 T;  3R6N A;  5HS0 A;  2NC9 A;  3UU3 A;  4WWN A;  4ILI A;  4P0A A;  5T4Y A;  3OJA A;  4PH4 B;  5CER B;  4LMJ A;  3ZJ1 A;  3T8O A;  2X9Y A;  1JNR A;  5IUX A;  1KLX A;  3LK4 2;  3D9J A;  2X6K A;  3BG1 B;  3HA4 A;  3TWT A;  3CWZ B;  2XQ6 A;  5HXR A;  2VQF T;  3FU0 A;  3B95 A;  2AXV A;  3ONL C;  1Z3Y A;  3JAE A;  5CCM A;  4ATZ D;  4JI6 T;  5CBN A;  2XAQ B;  4ZHB A;  2WXO A;  3J5Q B;  4CRW A;  3AVS A;  4TWD A;  3PNT B;  4A1S A;  1MX6 A;  2V4L A;  4B93 B;  5CHE E;  2BG9 C;  5KX5 E;  5BW8 C;  4GYW A;  3UUM A;  4JB8 P;  4XEI G;  4JLE A;  5KXJ A;  3FXE B;  4ACK A;  3UM1 A;  4ZHQ E;  1N33 T;  5EK3 A;  4JW1 A;  4DMW A;  2D5U A;  5L3D B;  5ARG A;  1JCS A;  4F3V A;  4JD2 G;  2HO1 A;  3ONL A;  5HXS A;  1JUQ A;  3GA8 A;  3QC9 A;  4L7T A;  3P50 A;  3UUN A;  4GZ3 A;  3AA7 B;  3C51 A;  3CPZ A;  2XSA A;  5EK4 A;  4AIU A;  1OCO E;  1YA0 A;  1BR0 A;  2HE0 A;  4G8K A;  4PS8 A;  5E75 A;  4BER A;  3TLU A;  1WCR A;  4I9E A;  4UV8 B;  4ABN A;  4BA9 A;  3UUB A;  2CHN A;  4FI5 A;  2BKK B;  2WXR A;  4H9Q C;  3FDH A;  2YDR A;  4E7S A;  1NI1 A;  1TNO A;  4XKB A;  3AXJ A;  4O6F A;  1S70 B;  3LK3 B;  2H3R A;  2LAH A;  3QC1 A;  4PK6 A;  3VTX A;  4X65 T;  1ZKE A;  2CWO A;  3VKG A;  4MFR A;  5AQV B;  3AEE A;  2X66 A;  1QQE A;  3E33 A;  3CVY A;  2HPJ A;  3ZC0 A;  4QQI A;  3ZSS A;  4PS3 A;  4KMO A;  3TXM A;  5AYW D;  4LF4 T;  2E2E A;  2HM8 A;  3EVY A;  3D9L A;  4R7L A;  3TKL B;  2B6C A;  2ION A;  3AEG A;  1NA3 A;  4ANU A;  3FWV A;  4JC8 A;  3ZMS B;  4ZZC A;  3TWQ A;  4OYK A;  3FTY A;  4IST A;  2CXF A;  3HVE B;  3PNL B;  5L3E B;  1VCS A;  5KNH D;  5DQW A;  4I1A A;  3U9W A;  4GMJ A;  2V5F A;  5ENR D;  2WS3 A;  1W0B A;  3BK9 A;  3K1S A;  3PE0 A;  4C0M A;  5JDQ A;  3OPC A;  4HOQ A;  2YKS A;  3VKH A;  3JAF A;  3LFM A;  5AQA A;  3RKV A;  3EDV A;  3UT8 A;  3FU5 A;  3AE5 A;  1A5E A;  3WXX A;  2BKP A;  2GGF A;  4CT4 A;  2LRK A;  3I5P A;  2BZB A;  2XY8 B;  4U07 A;  4AVX A;  3LK2 B;  1O5M A;  3JC6 D;  3NZQ A;  3SQV A;  1XDO A;  3AA1 B;  5A6C A;  3AE8 A;  1M62 A;  5LGN B;  1NP7 A;  3UIN C;  3VLD A;  5CBO A;  2BKO A;  3HKE E;  3LEW A;  4YTP A;  4K0K T;  4UEM A;  2WXQ A;  4B0Z A;  4ILC A;  5C1D A;  1TR4 A;  3PJA J;  2I2O A;  3AG2 E;  1Z8U A;  4YSX A;  5BT1 A;  3TWV A;  4DV7 T;  3TJP A;  2V6X A;  3ETV A;  3RPU A;  3AA6 B;  4TUY E;  4BTA A;  4DUY T;  2IDO B;  2XQ7 A;  5AQT B;  5J90 A;  3VHL A;  2RG8 A;  4AIF A;  2F37 A;  2X51 A;  4BT8 A;  4UWK A;  3U78 A;  1SZ9 A;  3PUZ F;  1H6K A;  4EXT A;  1QNF A;  3WAJ A;  3BU8 A;  4RVB A;  2ES0 A;  4YSY A;  1HG2 A;  4HWD A;  3KV4 A;  5J08 A;  5FIO A;  2A5U A;  3DJB A;  1TJF A;  4WNK A;  1DCE A;  1OCR E;  2KLQ A;  4LF5 T;  2WAU A;  4WAF A;  1U3D A;  4A3T A;  3MZL B;  3RIF A;  2LKG A;  3QWV A;  4WBO A;  4GK5 E;  2UU9 T;  5AQL B;  4AQF C;  1Q2Z A;  1SVX A;  1BI8 B;  3CHR A;  2Y3A A;  5LMN T;  5KJL A;  2XPY A;  1NA0 A;  3AXJ B;  2VSN A;  2GRO B;  3KS2 A;  3WAK A;  3HL6 A;  2UXX B;  3BG0 B;  3UM2 A;  5AQJ B;  4I0U A;  1YMP A;  2QYJ A;  1OCZ E;  4Y6W A;  2DCF A;  2WBL A;  3SFY A;  1T7S A;  3ZJ2 A;  3CQX C;  4DX6 D;  1EPU A;  4AQF A;  1YQ3 A;  2B76 A;  4EIW A;  4X5T A;  1HX1 B;  2VUR A;  3T5V A;  5A7D B;  2ZM2 A;  1TN6 A;  4F1P A;  3SFX A;  1D1C A;  3ZLI A;  4UI9 J;  3UPV A;  3FTX A;  2LOS A;  1OWN A;  2DWK A;  4JXT A;  1UJK A;  3CKB A;  3AS8 A;  4YDO A;  4TWF A;  2P58 C;  2GRP B;  2RFM A;  3FEY A;  4IE6 A;  3RQU A;  4HN9 A;  1LD7 A;  4JPS A;  4F7A A;  2LJL A;  2C5I T;  3Q9D A;  3EU9 A;  3UQ7 A;  2LHN A;  2WY2 A;  2DYS E;  3JAD A;  2LHR A;  4C91 A;  4GIW A;  2YHC A;  3DPY A;  5ANR A;  3TWX A;  2G0U A;  1D1A A;  1Z6T A;  3QWP A;  4G23 A;  1NWM X;  4IDO A;  5FL0 A;  2Y4T A;  3LPZ A;  4O2B E;  2P9B A;  1N34 T;  3PVL A;  4EZJ A;  3RIU C;  1IAP A;  2YHE A;  4Z91 A;  4A5X A;  4J8E A;  3L22 A;  5LJM A;  2Y1L E;  5CEC B;  3G2U A;  5JHB A;  3PS6 A;  3GMI A;  5FXW A;  4QHO A;  3LCA A;  1XNQ T;  3R9M A;  4ZXL A;  1JPL A;  2WXP A;  3RRU A;  2DNX A;  2W62 A;  1ZB1 A;  4ZOL E;  1LKX A;  5JDN A;  3IHV A;  1SA0 E;  4AKH A;  1H6O A;  1SUM B;  3UXG A;  3ISM C;  3VLE A;  1O1S A;  3N5L A;  3RKG A;  3AA0 B;  1JNZ A;  4JYA T;  5JRC B;  2IOS A;  4LNG A;  4GKJ T;  1ELK A;  3J7Y q;  2J1D G;  5JRE A;  1MX2 A;  3MYV A;  5ABF A;  1WR0 A;  3RYF E;  4DX1 A;  3E22 E;  2IY0 C;  2PQR A;  2H88 A;  1OWP A;  3B7S A;  4L23 A;  3EAM A;  3ASN E;  5LA6 E;  5EYL A;  2JIW A;  4I2W A;  4JI0 T;  2WQY A;  4OAV B;  3L16 A;  3NBX X;  4U04 A;  4W9R A;  1SQM A;  2Y6X A;  4GZD A;  4P29 A;  1J1J A;  3FZF B;  4KYO B;  4GTP A;  3RF1 A;  4E7Z A;  3Q78 A;  3ZNG A;  4ANX A;  4GTT A;  2A3D A;  4EZL A;  5FQ4 A;  5HEH A;  4UQZ A;  4WNG A;  2LKH A;  3CHM A;  3FHN A;  2GRR B;  4GA0 A;  5HXH A;  4C90 A;  5C2T A;  5L4E A;  1XNR T;  2XQ3 A;  3DEP A;  1FPP A;  4J8S A;  3OKQ A;  4UF0 A;  3KVB A;  4O4L E;  4LF9 T;  2ZXW E;  4K0R A;  4EYU A;  2F4V T;  2AE9 A;  3LSV A;  4J0U A;  5KCM A;  1NFI E;  3QOU A;  2X68 A;  4CI3 B;  4AOF A;  4FJZ A;  2MBG A;  1E7U A;  4EQF A;  3L13 A;  2I0M A;  4YDY A;  5KJK A;  1B7T A;  3EHQ A;  3KIN B;  3E32 A;  2QC9 A;  5AQK B;  1N11 A;  5E76 A;  4CN1 A;  2L0T B;  2KWI B;  1Y6I A;  4AY6 A;  3RHW A;  5JVD E;  4A1G A;  5ENT D;  1K3Z D;  2AXD S;  5L3C B;  1ZP0 A;  4QXB B;  3RO2 A;  3FUH A;  2CMR A;  4GB9 A;  3S7F A;  1WY6 A;  4LRZ A;  4GTR A;  3FB2 A;  1KNZ A;  2GRN B;  3U3I A;  4PNI A;  1S64 A;  1FT1 A;  5FQ8 A;  3CVV A;  3IA3 A;  4NIQ A;  5LNK A;  2OND A;  5EIL A;  1U5P A;  1US7 B;  3I9W A;  5CMY A;  5HAX A;  4DJA A;  3PUJ A;  4EB6 E;  3GZ2 A;  4JV5 T;  3ASO E;  2VGX A;  2W2U A;  4CXW A;  1ELR A;  1N4Q A;  4K5B A;  5HRY A;  3BQL A;  4F6R D;  3U3W A;  1ZV4 X;  3PH0 C;  3AE9 A;  2WB2 A;  5JDF A;  2NW7 A;  4EZK A;  2FF4 A;  5LBM A;  2OCC E;  4WYV A;  4DV1 T;  3NZP A;  3RAU A;  5BMV E;  4J7W A;  1QSD A;  3ZMU B;  2XEN A;  2CBI A;  3B7T A;  1D0Z A;  2CHO A;  5H6Q B;  5L3B B;  4AV7 A;  4OHF A;  3PEV B;  3K3Q C;  3CLJ A;  2C0L A;  3F6Q A;  2NP9 A;  2XQ5 A;  3MKQ A;  1IYG A;  3A8Y C;  3G06 A;  4L2Y A;  3AAA B;  1X5B A;  4HLL A;  3GN5 A;  1O3X A;  3A7M A;  3RC8 A;  2F8Y A;  4QX8 B;  2J08 A;  3D9H A;  5FMN A;  3A5X A;  2OOE A;  3L09 A;  2VSO E;  5CMW A;  2KC7 A;  3KEA A;  5AIJ A;  3LY7 A;  2PM7 A;  2YIN A;  2P2C P;  4LFB T;  3SY2 A;  4TX5 A;  3CQG B;  2H6H A;  4YVQ C;  2E9X C;  4RLY A;  1YCS B;  3TWS A;  5LXT E;  2WQ6 A;  4PAG A;  2ZIR A;  2K9A A;  3HDX A;  1UX4 A;  3VRA A;  3AJI A;  5CED B;  3TGO A;  3MJW A;  4LF7 T;  3SBT B;  2A72 A;  4I6J A;  5ITZ F;  4L9P A;  2LLY A;  4Z90 A;  5CA1 E;  4H7Y A;  3G2V A;  4AEZ C;  2WXG A;  3ZRH A;  2AW6 A;  2J4D A;  3TLW A;  4TWH A;  2W63 A;  2IU1 A;  3PUX F;  1NEN A;  4DR2 T;  1G3N B;  2IO2 C;  3TWW A;  5BNW A;  4TUU A;  4ME2 A;  2UUA T;  3MXZ A;  3EHM A;  3ULQ A;  4UF0 B;  4F1S A;  5AQI B;  1JCQ A;  4M7C A;  2XAS B;  5BR8 T;  1MIW A;  3P7I A;  2E5L T;  1XMQ T;  2HYZ A;  1HF8 A;  4KP3 C;  4I55 E;  3TL5 A;  2WU5 A;  4FLB A;  4GYO A;  1VOM A;  4QH1 A;  3HXE A;  1PC2 A;  4YFS A;  2OEW A;  2W67 A;  3M3Z B;  1MHQ A;  2XRZ A;  3SFZ A;  4CT0 A;  5LX8 A;  4GTV A;  4IL9 A;  2B0O E;  3UUL A;  5HXE A;  4PJJ A;  4X1K E;  4YHJ A;  2EIK E;  3NB2 A;  3X1D A;  2WP9 A;  1J5E T;  5A23 A;  2VKO A;  1BI7 B;  2VGX B;  4DR3 T;  2CXD A;  4KXK B;  1U3C A;  2PL2 A;  1Z0P A;  4HRL A;  3UMV A;  4U8V D;  3TLS A;  4UWL A;  5FYM A;  3ZIM A;  3ZU7 B;  3D9I A;  4GZC A;  5HCM A;  2WXL A;  4QH4 A;  2QVA A;  1IBL T;  4U8Y D;  2X38 A;  2L0I A;  5AAO A;  2VJ8 A;  5FZR A;  1N36 T;  3I0Q A;  2R05 A;  1BPO A;  2K24 A;  2V7L A;  5DIZ A;  2I1K A;  3LYA A;  5JDH A;  2WMO A;  3D9N A;  2DLR A;  4HGA A;  2KCV A;  5FKY A;  1MMD A;  1SHZ C;  1YKE B;  3M65 A;  3E08 A;  4JHJ A;  2A9U A;  5AJD A;  4U2Y A;  3TWU A;  3WI3 A;  4JZY A;  2KZT B;  2VB6 A;  3UU6 A;  3ZFW A;  4L5G A;  4J8Y A;  3KFW X;  3SS1 A;  4CGV A;  3ABK E;  4I6G A;  2LOP A;  2WU2 A;  1PY1 A;  4ACL A;  3P8C D;  4BES A;  3DSV A;  3D0T A;  3E4B A;  3C4X A;  2V7K A;  2MHK A;  5FVK A;  4GCN A;  5AJL A;  2XJ7 A;  3JUI A;  3G2S A;  4CEM A;  2FEZ A;  1ZBP A;  2V26 A;  5CGM A;  3T8K A;  5FJY A;  2JRK A;  2ZM8 A;  1KNP A;  3PRE A;  3I4G A;  3N9L A;  2WWU A;  5AQM B;  2ILR A;  4I4T E;  2CPT A;  1KF6 A;  3N2O A;  4GK0 E;  4N39 A;  4UWG A;  2RPA A;  3U64 A;  4DBQ A;  5HYA A;  2XCC A;  2XRY A;  3L54 A;  3C3Q A;  3EHR A;  3CX6 B;  2MYO A;  3DSX A;  3KD7 A;  5BXO A;  1FVF A;  3DST A;  4APF A;  4JI1 T;  4FC8 A;  3EUH A;  3LBX A;  2KAT A;  2ZMA A;  2XGO A;  4H9P C;  4GKK T;  5HEU A;  4AI6 A;  2WVI A;  3ZUV B;  1U2V G;  3W9F A;  3ANW B;  5JTG A;  2X6J A;  2BF0 X;  4PS7 A;  1E7P A;  3ASG A;  3FBZ A;  1EYH A;  3AB3 B;  1OWL A;  3AG3 E;  3IF8 B;  3JYS A;  5EID A;  4DI3 A;  3TXN A;  3NBN B;  4IDZ A;  1DCQ A;  4BSX A;  3NAW A;  1YXR A;  2UXB T;  1IBK T;  1E8Z A;  3FUJ A;  4J2C A;  3Q5D A;  5HCJ A;  2ETB A;  3E37 A;  5LBQ B;  4CYM D;  4IL4 A;  3FEX A;  1HR0 T;  4U3C A;  3UKR G;  3FZH B;  3CV0 A;  3B7R L;  3O1J A;  5BV1 A;  2R02 A;  3FTW A;  4V3I A;  3J5P A;  4TZ4 C;  4B3S T;  5J1G A;  3NZS A;  4DVD A;  5AQN B;  2LM9 A;  1MIV A;  3UTK A;  2I59 A;  3GW4 A;  5LG4 A;  2V5Q C;  4OVV A;  4LER A;  1WAO 1;  1AJ3 A;  3ZMT B;  3MK7 C;  3ZCJ A;  4MHC A;  2KBX A;  5D0Q D;  3UM0 A;  4HFI A;  4LML A;  1G73 A;  2V7M A;  1E7V A;  4UWF A;  1H19 A;  2A4Z A;  4M3O A;  2H89 A;  2BS4 A;  4YDE A;  4CN4 A;  3FUE A;  3SZ7 A;  2NW9 A;  1FT2 A;  5CJ5 A;  4EZH A;  4HNA D;  1QZ2 A;  4AP2 A;  5FY7 A;  2KMF A;  5F5W A;  3H37 A;  2ZIS A;  2VVN A;  3P4S A;  4G11 A;  4CDR A;  4GTQ A;  3KBU A;  2KND A;  1ZHC A;  4AKR B;  4DV4 T;  4TV9 E;  1V55 E;  4C0E A;  5HEG A;  3PTR B;  2Y4U A;  1L0V A;  3FZM B;  1D8E A;  2VVS A;  3B57 A;  3PUV F;  2IJG X;  4DLO A;  2ODV A;  3LJ3 A;  2KIN B;  4HWF A;  3UTM A;  1UX5 A;  2YOE A;  2CFZ A;  1H2U A;  2IOL A;  4DX5 D;  4TXP A;  2KZT A;  2X6F A;  2NOX A;  3L8R A;  5AQB A;  5FXX A;  5FL1 A;  3CHS A;  3QOF A;  4YY3 T;  2LAI A;  4HBD A;  3QK0 A;  3FUI A;  5ABF B;  3F2E A;  3T9K A;  4DV3 T;  4KUM B;  2IML A;  4DUI A;  5BUZ A;  2Z6E A;  4EEC A;  3K3O A;  3WG7 E;  3KV9 A;  4G63 A;  1SA5 A;  3K9I A;  2M67 A;  4PDX A;  4X8Q A;  4U72 A;  5FZQ A;  5G04 C;  4ATG A;  2YU2 A;  4GTM A;  4YDW A;  4P1N A;  2CG2 A;  3JXJ A;  2DWG A;  4IE5 A;  4MBG A;  3C64 A;  2A5E A;  3IBP A;  5KJM A;  2P9K G;  3N9N A;  1UCU A;  2IC9 A;  2LXL A;  4PK5 A;  3VR8 A;  2HN1 A;  1UN9 A;  4HTE A;  4AQG A;  4GPK A;  3C98 A;  4EZ4 A;  4O1O A;  4X20 E;  3CHO A;  4OK0 A;  2ACX A;  2Y48 B;  4H9R C;  4XE0 A;  4WUY A;  2YK0 A;  1N4S A;  2CLY C;  5LG3 A;  3FTV A;  2YDQ A;  4CZ2 D;  4CXY A;  4NIK A;  2P9U G;  2GRM A;  5DJQ C;  3LY8 A;  2NW8 A;  1D0X A;  1OED C;  5LHH B;  1N0Q A;  1OED B;  3APD A;  2XCB A;  3L17 A;  3AEC A;  3RK6 A;  2W66 A;  2V1D B;  2BUG A;  4EBA A;  3UT5 E;  4PJL A;  3ZEF B;  4GCO A;  4MRU A;  3CKC A;  4WWP A;  4DV2 T;  2JQQ A;  4U31 A;  2E9X A;  4DBR A;  4GTO A;  5HI7 A;  3CKD A;  1QLB A;  4BFR A;  4K0U A;  4AXH A;  5JJT A;  3RI5 A;  2WSS V;  4Q25 A;  5L47 A;  1S63 A;  4BJM A;  3IEG A;  1KFY A;  2CCQ A;  4MLP A;  4LFA T;  2QZA A;  4IRU A;  3CK7 A;  4DRX E;  3UQ4 A;  2BDE A;  3KDS E;  3BEE A;  3V2X A;  4QXH B;  4YVO A;  4FAD A;  3ZYL A;  2SPC A;  4CN6 A;  4QFV A;  5C2Y A;  3P1U A;  4Q96 A;  4EAH A;  2FBN A;  4KHP T;  5AQR B;  1R8I A;  3B7B A;  4DX2 A;  3CVX A;  4GYY A;  3APC A;  4HB5 A;  2RP4 A;  4I6E A;  3CHP A;  4MS6 A;  5TAO A;  4ANJ A;  4ZI3 D;  1YKH B;  3ABV A;  1IQU A;  3C3O A;  3ZKJ A;  1W3B A;  3CGH A;  3HXB A;  5D0O D;  5G05 C;  3UKU G;  3LJN A;  3Q9N C;  2FJA A;  4ADZ A;  4DV0 T;  3SD5 A;  2N2N A;  1D8D A;  2WM9 A;  2HHH T;  2JLB A;  3EAB A;  1FMV A;  3RO3 A;  3O1H A;  4DV6 T;  3NVO A;  2D9D A;  4A55 A;  4EED A;  1TNZ A;  3NQP A;  2OA5 A;  4RSY A;  2Y69 E;  2LNI A;  4YJ2 E;  3FTZ A;  3I3N A;  4B8C B;  3MZK B;  3Q47 B;  3C98 B;  3F57 A;  4G2V A;  3HXD A;  4E85 A;  3JQ1 A;  5EKQ D;  1TN7 A;  4CI1 B;  4X66 T;  2L3L A;  1OY3 D;  3ULE G;  2BS3 A;  4BAY B;  4ZFH A;  2XGS A;  2X9H A;  2MOW A;  3AEA A;  4J6I A;  2X3M A;  2YDS A;  4WZX A;  1ZOY A;  4X62 T;  1UG3 A;  3ZVV A;  2V6Y A;  4M1P A;  4HKA A;  3PDN A;  1OED A;  4F6R C;  2XPZ A;  1FEW A;  3QB5 K;  4WNE A;  2WDR A;  3Q7F A;  5HEJ A;  2LT3 A;  1WYC A;  3ZEF A;  4AY5 A;  3FU6 A;  3F31 A;  2LEH A;  3EJN A;  3HXF A;  4PFP A;  3ZYQ A;  4J8F A;  3UT7 A;  2ETA A;  3LXU X;  5DQV A;  2YN6 A;  4HI9 A;  4GZ6 A;  5ABG A;  2L8K A;  3SFE A;  4YJ3 E;  3Q2M A;  2P9S G;  4UXN B;  3NRY A;  3FY4 A;  2LSV A;  1HH8 A;  3CVU A;  2PM6 A;  2W00 A;  5AQG B;  4C48 B;  2N9D A;  4QXC B;  3FH8 A;  1FMW A;  3AEF A;  2NSZ A;  3Q4A B;  1H0A A;  4TXQ A;  5AAR A;  2VK9 A;  3G2T A;  5ENO D;  2J07 A;  4F8H A;  4Z8X A;  4DLQ A;  2WQ7 A;  3RYH E;  3DSW A;  4JEU A;  2XHE B;  5FIN A;  4WW0 A;  4HWC A;  5ENN A;  4KBM B;  4CGW A;  4IN3 B;  2DBA A;  4AIS A;  4U0U A;  4U95 D;  2CE7 A;  1D9S A;  3V5U A;  1BU9 A;  3PZ2 A;  2IF4 A;  4ZI2 C;  3QJZ A;  3ZT5 A;  4K5C A;  3RYI E;  1IJ6 A;  1TNY A;  3UIO C;  3EIQ C;  2OLT A;  4ILG A;  3C4W A;  3AU4 A;  1IHB A;  4QKN A;  1HNX T;  2LSJ A;  2VKJ A;  3KAE A;  2ZGD A;  4LMK A;  2J47 A;  4COF A;  1HZ4 A;  2XZT G;  4K03 A;  4KZ0 A;  4CDM A;  1RW2 A;  3B5M A;  4H63 H;  3ZXS A;  5BXU A;  2RKK A;  3VTY A;  3AE6 A;  3CSF A;  5KMG P;  2JQ9 A;  1D0Y A;  2KT9 A;  3ML8 A;  3QNU A;  5HEO A;  1H2V C;  4GYR A;  1OWO A;  1WDY A;  2C2L A;  1ZU2 A;  3FTU A;  2XZE A;  4DO0 A;  2UXC T;  3FU3 A;  1N32 T;  3PZ1 A;  3RJV A;  3O4X E;  5M4Y A;  2E2A A;  3RKO A;  3BUA A;  3RYC E;  2GW1 A;  3UX4 A;  1MX4 A;  5FP3 A;  1T98 A;  3ZT7 A;  3NOC D;  4OAU C;  1UOH A;  3PUS A;  2FI7 A;  2X67 A;  4ZEY A;  3HKC E;  5EIB E;  4HXI A;  5JJ6 A;  3ZGQ A;  2WXJ A;  1E8X A;  2DYR E;  2EIM E;  2R03 A;  4X64 T;  3ZPJ A;  4Y6C A;  4ASK A;  3V30 A;  2VSX E;  2Y8D A;  2BG9 A;  1M7K A;  4UR9 A;  2XEH A;  3CK9 A;  4H9O C;  1JWG A;  2JQH A;  1I94 T;  2EIL E;  1IHG A;  2R6G F;  4GOU A;  2J4B A;  2I6H A;  4WND A;  4XBF B;  2XZD G;  2V4H C;  4D10 C;  1E1H B;  4O60 A;  1WR6 A;  2XAG B;  2V6Y B;  5IWA T;  5LFA A;  2PQN A;  3QB5 A;  3PZD A;  2KXP B;  1UK5 A;  5JDL A;  4FJO A;  2EIN E;  2CWY A;  4XKC A;  1N9A A;  4FP7 A;  3CQC B;  5LJN A;  2QGS A;  4ILA A;  4YSZ A;  5FQ6 A;  3N2G E;  4ZI7 E;  2JQK A;  3SBS A;  4QH5 A;  1OED E;  5JA4 D;  1QYM A;  1EDU A;  3H3A A;  3HVE A;  4LSZ E;  4ANW A;  4BET A;  3KBT A;  3FUK A;  1XDP A;  1CHU A;  3QKY A;  2E8I A;  2VKD A;  2K5B B;  4GA2 A;  3W9G A;  2JMH A;  4UQX A;  3LVQ E;  3ZC1 A;  2WXF A;  1SZA A;  3OBV E;  2CBJ A;  3MJX A;  2OEV A;  3E30 A;  2FBW A;  4JI7 T;  2XHE A;  2X6H A;  3S4U A;  1OT8 A;  2BED A;  2AVP A;  1DNP A;  4DV5 T;  3IHY A;  4B89 A;  2XQ0 A;  3B13 A;  4Z68 A;  4OYJ A;  4BTB A;  4BY6 A;  3CEQ A;  3DSU A;  4O1P A;  4O4J E;  1KT0 A;  2ZLY A;  2QRX A;  3ETU A;  3C4Z A;  4TN7 B;  3RU0 A;  3LY9 A;  1UUR A;  4B3M T;  2DWZ A;  1TNB A;  4I2Z A;  4RG6 A;  4HE8 A;  3ANW A;  4DID B;  2FJE A;  3ONK A;  1EZ3 A;  3C5R A;  4NXM T;  2ODU A;  4U0Z A;  1HS7 A;  2LSG A;  5LGU B;  4JHR A;  2KWH A;  2GRQ B;  2H7O A;  3DXM G;  4HFG A;  1A17 A;  3SFD A;  3QWW A;  3FTS A;  3X2Q E;  2MOZ A;  3PUR A;  5LCY A;  3OVU A;  4OYS A;  2XQA A;  2IHR 1;  4B94 A;  2J62 A;  2VL0 A;  2XPK A;  3PUY F;  4JI8 T;  4NUV A;  2YEV C;  4HFE A;  5E0O A;  5HWY A;  5ENQ D;  2BS2 A;  3ABM E;  1HTJ F;  3AG1 E;  1ZEE A;  4ILB A;  2V7I A;  5AQQ B;  4AKI A;  1CUN A;  5CB4 E;  1X81 A;  4ANV A;  3SOL A;  3CHQ A;  1S94 A;  5F3J A;  5F8P A;  5D66 A;  4URK A;  3Q49 B;  4XAX B;  4N3C A;  2MAW A;  1S0P A;  4YHH T;  2YQ8 A;  2BG9 B;  3AE3 A;  4UV9 B;  1T72 A;  3RRW A;  3O9X A;  4U63 A;  5G55 A;  1H2T C;  2VL8 A;  4OFZ A;  2WDQ A;  1N0R A;  2H6I A;  2LRL A;  3O1I A;  2X0Y A;  2LSK A;  2Q7F A;  2WZH A;  4UEL A;  3GZ1 A;  4ZZB A;  3N9M A;  4GMR A;  2UXN B;  3ASD A;  5B1B E;  4FJY A;  3AS4 A;  2GK9 A;  2CRB A;  2P9N G;  3DBS A;  2WDV A;  2OV8 A;  4FHK A;  2XQ4 A;  4HFD A;  4N3B A;  3MX3 A;  3SO8 A;  2QFC A;  1Y64 B;  1E8W A;  4IT4 A;  1MZC A;  4U7E B;  3N9O A;  2E9X B;  4GZ5 A;  2AWI A;  3L9T A;  2JMK A;  1LTX A;  5CEA A;  4HWH A;  3ZMV B;  2Q9Q A;  4LF6 T;  2WQH A;  1KZO A;  4G25 A;  2PZI A;  4XZ4 A;  3P4R A;  2AXU A;  5CRV A; 
#chains in the Genus database with same CATH homology
 1MIY A;  1BR4 A;  1N54 A;  4MKT A;  3APF A;  2XAF B;  2LO6 A;  4A56 A;  3MKQ B;  3ESK A;  5EX0 A;  2KM4 A;  5FWQ A;  4UVA B;  5LHI B;  1UW4 B;  5H6R B;  3D3M A;  3LVR E;  1HE8 A;  1WYB A;  4QWN B;  2L9B A;  2EQX A;  1HFA A;  2JPF A;  5DBK A;  3URZ A;  3UFE A;  1XGW A;  3HHM A;  1X79 A;  2UWJ G;  5FXV A;  4UVC B;  3QK6 A;  2H7V C;  4AKL A;  3FP3 A;  3HR0 A;  2VQ2 A;  3N71 A;  5LGT B;  4DPR A;  4I50 E;  4AJW A;  2E0I A;  4FU3 A;  5FTP A;  4UI9 K;  1Y8M A;  4J8D A;  3S7D A;  3LKU A;  3OYZ A;  3TAX A;  3AAE B;  4RG9 A;  3ASF A;  3TG4 A;  4I9C A;  4PUC A;  2MYS A;  3GZS A;  4IIJ E;  1E90 A;  4HOU A;  3R84 B;  4APO A;  4HEA A;  4I43 B;  2I1J A;  1YD8 G;  3FUN A;  4UQY A;  5G2N A;  4WNF A;  1HU3 A;  4EBA G;  2CHZ A;  2UY1 B;  2VTB B;  4G1T A;  2MTQ A;  1LVK A;  5LOV E;  4MAL A;  4C9B B;  2Q9Q C;  1KK7 A;  3MA9 A;  3JCK C;  4H7X A;  3ZYK A;  3BQI A;  5AEN A;  3ZN0 B;  4AM9 A;  5J2T E;  3R9A B;  3IHR A;  5C8Y E;  3G2W A;  5G04 J;  4N78 D;  3TG5 A;  3JC6 C;  4O4I E;  2D0T A;  4NUU A;  5ANL A;  3C50 A;  3FH5 A;  1E96 B;  3PUA A;  3OAW A;  4YLH A;  4FHJ A;  4UI9 C;  5JDM A;  2IAK A;  2J09 A;  1B89 A;  4KZC A;  2JJ9 A;  4EPZ A;  3CX8 B;  3Q5X A;  2QA7 A;  3HI2 A;  5L3F B;  2VWA A;  2KCK A;  1WRD A;  4CQI A;  3U66 A;  5JR9 C;  4NQ0 A;  1QUU A;  5FXZ A;  1JWF A;  4KBQ A;  3K8P C;  4HFV A;  4BJN A;  1PAQ A;  5IHY A;  2CEA A;  2WXH A;  2BTD A;  2B1E A;  4DI4 A;  1MNE A;  4IHJ E;  4P09 A;  3U4T A;  2GRL A;  5L2L A;  3FFL A;  5JR9 A;  2XEV A;  4DND A;  4JL0 A;  5FNV E;  4O4H E;  1NZN A;  2CFU A;  1OUV A;  2NTX A;  2OVB A;  2C0M A;  2N1G A;  4UWH A;  2XUE A;  4KT6 B;  4GYS A;  4QX7 B;  3D9K A;  4NRH B;  3LJC A;  4EYY R;  3CML A;  3R7Q A;  4U8H A;  5BPP A;  3LDZ A;  4WWO A;  1S35 A;  4DMV A;  2R17 C;  5HWX A;  3MA5 A;  3MAC A;  4MLK A;  4HLE A;  4B8A A;  5HXC A;  3QAQ A;  1GW6 A;  3EDT B;  4PJN A;  1INZ A;  3MKD A;  1Z3X A;  3L6A A;  3RRN B;  5LOZ A;  2KCL A;  4NUR A;  1G8X A;  3UUX A;  2XAJ B;  4FUL A;  1N52 A;  5FY0 A;  5LP0 A;  2FUL A;  3UT4 A;  4JA9 A;  5T3R A;  3N9P A;  3BQK A;  3FUD A;  3UQ3 A;  4LEU A;  2D0U A;  4AKG A;  3HIZ A;  2PJQ A;  4WBN E;  4A3V A;  5EZY E;  2V0P A;  5L3G B;  4L0R A;  3RC3 A;  1HS6 A;  3CVR A;  5G05 J;  1HCI A;  5M72 A;  5LP6 E;  4H9S E;  3QAR A;  4L2L A;  4PJM A;  1HXI A;  2DCP A;  3IV0 A;  4BT9 A;  3IEE A;  2W0G A;  3S2A A;  2CM0 A;  2CLY B;  3SWH A;  5FQ7 A;  1YW0 A;  3HKD E;  5BV0 A;  3PDY A;  2FO7 A;  3CVW A;  4L1B A;  2CA5 A;  3S7J A;  4G2A A;  3MV2 B;  3QDN A;  1U4Q A;  2WXI A;  4XI9 A;  3AS5 A;  2X9W A;  4ZS3 A;  2WMN A;  3FUF A;  2LSI A;  4I1M A;  4BX9 A;  2C5J A;  1P5Q A;  2LSU A;  3NF1 A;  2OVF A;  3EIJ A;  3ZHE B;  3PU8 A;  5JR9 B;  2WXK A;  2IFU A;  3JQ0 A;  1VDY A;  2C5K T;  3CK8 A;  4Q69 A;  5JDG A;  4TRQ A;  2L9Q A;  4HVB A;  4O2A E;  3KV6 A;  5JH7 E;  4I1O B;  4HOT A;  2VAS A;  3E0Z A;  2HPL A;  5ADX L;  3LG7 A;  2DHR A;  3VU7 H;  3W15 B;  3FHE A;  3MV3 B;  3CVL A;  3RX6 A;  1L5J A;  2DIW A;  2PFV A;  3GWH A;  4CDN A;  2XGM A;  4ZS2 A;  4PK4 A;  4IE0 A;  3PRZ A;  3PU3 A;  3UUX B;  2QY7 A;  2BVM A;  3ZN1 B;  1VRB A;  4JEH B;  2EHO B;  5A1L A;  4JEU B;  3CIA A;  3LS8 A;  4XX5 A;  2K48 A;  3D9P A;  3ML9 A;  3ZPO A;  3ONX A;  3MGB A;  5JQG E;  4KMC A;  1WM5 A;  1HG5 A;  2HH7 A;  2BVL A;  2XPI A;  3ASH A;  3OTN A;  3I1A A;  1MMN A;  3MKR A;  2V7J A;  4TV3 A;  2CG3 A;  1H7C A;  2KZ7 B;  3SNX A;  5FZS A;  4LUN U;  4H9N C;  1NAF A;  4OVU A;  3L08 A;  2C0S A;  3MCX A;  1D1B A;  3O48 A;  1HX8 A;  4JHK A;  4ILH B;  5LHG B;  3IBE A;  2A2F X;  2D2S A;  4CCA A;  4O8S A;  2E9X D;  2JEK A;  2CHW A;  2XQY A;  1LF8 A;  4TV8 E;  3QUJ A;  4IYP A;  5EDS A;  4AXP A;  3B7U X;  2I9C A;  4HOS A;  1UN8 A;  3DP7 A;  1MQS A;  4FLH A;  2PBI A;  3N9Q A;  3AAI A;  2Q9Q B;  3ZMZ B;  2IQC A;  3AU5 A;  4ERR A;  4IE4 A;  2J9Q A;  3L3P A;  1UJJ A;  3SGH A;  2EHO C;  2Q9Q D;  3RH3 A;  3PEU B;  4I43 A;  2IC6 A;  3CVQ A;  5EX3 A;  5EK2 A;  4BWR A;  1BR1 A;  4G26 A;  4I17 A;  3DTO A;  3HYM B;  3OXF A;  4HS2 A;  1TJC A;  3KEZ A;  2NWB A;  5LCW J;  3KV5 A;  5ETW A;  2LSY A;  3FUM A;  2WXM A;  2X6I A;  2EHO A;  1MMA A;  5JJ7 A;  1IQR A;  1EF1 C;  4N3A A;  3K3N A;  4GAA A;  1HO8 A;  4MBQ A;  4B6X A;  3DPD A;  4GML A;  3I0O A;  3PUG A;  5J2U E;  2XTL A;  4IE7 A;  4ZI3 C;  3NZU A;  1WLX A;  3HKB E;  4Q94 A;  3N2K E;  2VSY A;  4JVS A;  3SHF A;  2ZM0 A;  4EOZ B;  5CCL A;  2W61 A;  4UVB B;  1FIO A;  1DVP A;  2NTY A;  3CVP A;  4XIF A;  4L9I A;  5KDM C;  3GN5 B;  4ILU A;  2VKH A;  5ARF A;  3KVA A;  4IGU A;  3MEK A;  3QB2 A;  1V9D A;  2M63 A;  5LYJ E;  2NXP A;  3ZHE A;  4PW8 A;  2EHO D;  4ISS A;  3CR3 A;  4XI0 A;  2L6J A;  2CHX A;  4BX8 A;  3SF4 A;  4KVM A;  4FA6 A;  2AXZ A;  5KJN A;  3Q15 A;  4U74 A;  3NRX A;  2R59 A;  2YNQ A;  3PUK A;  1BR2 A;  2J49 A;  3D9O A;  3RIB A;  3ENE A;  3CX7 B;  2X9X A;  3J9X 1;  3T5X A;  3SRZ A;  2WPV A;  3OXG A;  3RRM B;  5HQ8 A;  5LCW C;  3V5S A;  3FUL A;  3FXD B;  1KT1 A;  5AFU L;  2R5S A;  4H63 V;  4X1Y E;  3OXL A;  3ZN3 A;  1OXZ A;  5CA0 E;  4F53 A;  4JA7 A;  2VGY A;  4CXX A;  3FH7 A;  1MND A;  5FY1 A;  4NAC A;  4GU5 A;  4JEH A;  3ZCI A;  3CVN A;  2RA1 A;  1OWM A;  3O4Z A;  3ESL A;  5JRC A;  4JUY A;  4U0S A;  4LCT A;  1ELW A;  2MRI A;  2VYI A;  3PE4 A;  1E8Y A;  1TEZ A;  3PUQ A;  4P0B A;  3FBL A;  2HR2 A;  2IW5 B;  3P2B A;  1XNF A;  2LE8 A;  3R7R A;  3I4R B;  5JHA A;  1IJ5 A;  2YU1 A;  4X1I E;  2V8S E;  4DK5 A;  2RD0 A;  1FVH A;  2WXN A;  3Q5W A;  4N5C A;  1LVF A;  4IUL A;  4XZC A;  2DI4 A;  4HOR A;  2X0L B;  2CXL A;  3SI5 A;  3D9M A;  3T8M A;  2XAH B;  4GA1 A;  3S7B A;  3I9Y A;  2PG8 A;  4N2S A;  3QNK A;  2ZU6 B;  3LBX B;  3VLF A;  1FCH A;  3CST A;  4YND A;  1IZN B;  4PFO A;  3AVR A;  3ZYM A;  4KVO A;  3PE3 A;  4UIG A;  4CZZ B;  4CI2 B;  3GYZ A;  3OYX A;  2UY1 A;  5FT9 A;  2VTB A;  3IKO B;  3EHN A;  4ZI2 D;  1MMG A;  4G24 A;  4N2Q A;  3Q5M A;  5IYZ E;  3EDU A;  4V1A v;  3ZW3 A;  1LRZ A;  5GON E;  3RRC A;  5T8I A;  5DAB A;  4E6H A;  1OWA A;  3R6N A;  2NC9 A;  4WWN A;  4ILI A;  4P0A A;  5T4Y A;  3OJA A;  4PH4 B;  3ZJ1 A;  3T8O A;  2X9Y A;  1KLX A;  3LK4 2;  3D9J A;  2X6K A;  3BG1 B;  3HA4 A;  3CWZ B;  5HXR A;  3FU0 A;  2AXV A;  1Z3Y A;  5CCM A;  2XAQ B;  2WXO A;  4CRW A;  3AVS A;  3PNT B;  4A1S A;  2V4L A;  5CHE E;  5KX5 E;  5BW8 C;  4GYW A;  3UUM A;  4JLE A;  3FXE B;  4ACK A;  4ZHQ E;  5EK3 A;  4JW1 A;  4DMW A;  2D5U A;  5L3D B;  5ARG A;  4F3V A;  2HO1 A;  3ONL A;  5HXS A;  1JUQ A;  3GA8 A;  3QC9 A;  4L7T A;  3UUN A;  4GZ3 A;  3AA7 B;  3C51 A;  3CPZ A;  4PS8 A;  5EK4 A;  1YA0 A;  5E75 A;  1BR0 A;  4I9E A;  4UV8 B;  4ABN A;  4BA9 A;  4FI5 A;  5G04 C;  2WXR A;  4H9Q C;  3FDH A;  4XKB A;  4E7S A;  4O6F A;  3LK3 B;  2H3R A;  2LAH A;  3QC1 A;  4PK6 A;  3VTX A;  1ZKE A;  2CWO A;  3VKG A;  4MFR A;  2X66 A;  1QQE A;  3CVY A;  2HPJ A;  3ZC0 A;  4PS3 A;  3TXM A;  4KMO A;  5AYW D;  2E2E A;  2HM8 A;  3EVY A;  3D9L A;  4R7L A;  3TKL B;  2ION A;  1NA3 A;  4ANU A;  3FWV A;  4JC8 A;  3ZMS B;  4OYK A;  3FTY A;  4IST A;  2CXF A;  3HVE B;  3PNL B;  5L3E B;  5DQW A;  4I1A A;  3U9W A;  4GMJ A;  2V5F A;  3BK9 A;  3PE0 A;  4C0M A;  5JDQ A;  4HOQ A;  3VKH A;  3LFM A;  3RKV A;  3EDV A;  3UT8 A;  3FU5 A;  3WXX A;  2GGF A;  4CT4 A;  3I5P A;  2BZB A;  4U07 A;  4AVX A;  3LK2 B;  3JC6 D;  3NZQ A;  3AA1 B;  5A6C A;  5LGN B;  1NP7 A;  3VLD A;  3HKE E;  3LEW A;  4UEM A;  2WXQ A;  4B0Z A;  5C1D A;  2I2O A;  5BT1 A;  3TJP A;  3ETV A;  3RPU A;  3AA6 B;  4TUY E;  4BTA A;  5J90 A;  3VHL A;  2RG8 A;  4AIF A;  2X51 A;  4BT8 A;  4UWK A;  3U78 A;  1SZ9 A;  1H6K A;  4EXT A;  1QNF A;  3WAJ A;  4RVB A;  2ES0 A;  1HG2 A;  3KV4 A;  5J08 A;  2A5U A;  3DJB A;  1TJF A;  4WNK A;  2KLQ A;  2WAU A;  4WAF A;  1U3D A;  4A3T A;  3MZL B;  3QWV A;  4WBO A;  4GK5 E;  4AQF C;  3CHR A;  2Y3A A;  5KJL A;  2XPY A;  1NA0 A;  2VSN A;  3KS2 A;  3WAK A;  3HL6 A;  2UXX B;  3BG0 B;  4Y6W A;  2DCF A;  2WBL A;  3ZJ2 A;  3CQX C;  1EPU A;  4AQF A;  4EIW A;  3T5V A;  5A7D B;  2ZM2 A;  1D1C A;  3ZLI A;  4UI9 J;  3UPV A;  3FTX A;  2LOS A;  1OWN A;  2DWK A;  4JXT A;  1UJK A;  3CKB A;  3AS8 A;  2P58 C;  3FEY A;  4IE6 A;  4HN9 A;  4JPS A;  4F7A A;  2LJL A;  2C5I T;  3Q9D A;  2LHN A;  2LHR A;  4C91 A;  4GIW A;  2YHC A;  5ANR A;  2G0U A;  1Z6T A;  1D1A A;  3QWP A;  4G23 A;  1NWM X;  2Y4T A;  3LPZ A;  4O2B E;  2P9B A;  3PVL A;  4EZJ A;  1IAP A;  2YHE A;  4J8E A;  3L22 A;  5LJM A;  3G2U A;  5JHB A;  3PS6 A;  3GMI A;  5FXW A;  4QHO A;  3LCA A;  1JPL A;  2WXP A;  3RRU A;  2DNX A;  2W62 A;  4ZOL E;  1LKX A;  5JDN A;  3IHV A;  1SA0 E;  4AKH A;  3VLE A;  3N5L A;  3AA0 B;  5JRC B;  2IOS A;  1ELK A;  3J7Y q;  2J1D G;  5JRE A;  3MYV A;  3RYF E;  3E22 E;  2PQR A;  1OWP A;  3B7S A;  4L23 A;  5LA6 E;  4I2W A;  3L16 A;  3NBX X;  4U04 A;  4W9R A;  1SQM A;  2Y6X A;  4GZD A;  4P29 A;  4KYO B;  4E7Z A;  4ANX A;  2A3D A;  4EZL A;  5FQ4 A;  4WNG A;  4UQZ A;  3CHM A;  3FHN A;  4GA0 A;  5HXH A;  4C90 A;  4J8S A;  3OKQ A;  4UF0 A;  3KVB A;  4O4L E;  4K0R A;  4EYU A;  4J0U A;  5KCM A;  3QOU A;  2X68 A;  4CI3 B;  4AOF A;  4FJZ A;  2MBG A;  1E7U A;  4EQF A;  3L13 A;  5KJK A;  1B7T A;  3KIN B;  5E76 A;  2L0T B;  2KWI B;  1Y6I A;  4AY6 A;  4A1G A;  5JVD E;  5L3C B;  4QXB B;  3RO2 A;  3FUH A;  2CMR A;  4GB9 A;  3S7F A;  1WY6 A;  4LRZ A;  3FB2 A;  1KNZ A;  3U3I A;  4PNI A;  5FQ8 A;  3CVV A;  5LNK A;  2OND A;  1U5P A;  1US7 B;  3I9W A;  5CMY A;  5HAX A;  4DJA A;  3PUJ A;  4EB6 E;  3GZ2 A;  2VGX A;  4CXW A;  1ELR A;  3U3W A;  3BQL A;  1ZV4 X;  3PH0 C;  2WB2 A;  5JDF A;  2NW7 A;  4EZK A;  2FF4 A;  5LBM A;  3NZP A;  5BMV E;  1QSD A;  3ZMU B;  3B7T A;  1D0Z A;  5H6Q B;  5L3B B;  4AV7 A;  4OHF A;  3PEV B;  3K3Q C;  3CLJ A;  2C0L A;  2NP9 A;  3MKQ A;  1IYG A;  4L2Y A;  3AAA B;  1X5B A;  3GN5 A;  1O3X A;  3RC8 A;  4QX8 B;  2J08 A;  5FMN A;  3A5X A;  2OOE A;  3L09 A;  2VSO E;  5CMW A;  2KC7 A;  5AIJ A;  3LY7 A;  2PM7 A;  2YIN A;  4TX5 A;  3CQG B;  4YVQ C;  2E9X C;  5LXT E;  2WQ6 A;  4PAG A;  2K9A A;  3HDX A;  1UX4 A;  3TGO A;  3MJW A;  3SBT B;  2A72 A;  4I6J A;  5CA1 E;  4H7Y A;  3G2V A;  4AEZ C;  2WXG A;  3ZRH A;  2AW6 A;  2J4D A;  2W63 A;  2IU1 A;  5BNW A;  4TUU A;  4ME2 A;  3MXZ A;  3EHM A;  3ULQ A;  4UF0 B;  4F1S A;  2XAS B;  1MIW A;  3P7I A;  2HYZ A;  1HF8 A;  4KP3 C;  4I55 E;  3TL5 A;  4FLB A;  4GYO A;  1VOM A;  1PC2 A;  4YFS A;  1MHQ A;  2XRZ A;  3SFZ A;  4CT0 A;  5LX8 A;  3UUL A;  5HXE A;  4PJJ A;  4X1K E;  4YHJ A;  5A23 A;  2VKO A;  2VGX B;  2CXD A;  4KXK B;  1U3C A;  2PL2 A;  1Z0P A;  3UMV A;  4UWL A;  5FYM A;  3ZIM A;  4GZC A;  3D9I A;  2WXL A;  2X38 A;  2L0I A;  2VJ8 A;  5FZR A;  3I0Q A;  1BPO A;  2K24 A;  2V7L A;  5DIZ A;  2I1K A;  3LYA A;  5JDH A;  2WMO A;  3D9N A;  2DLR A;  4HGA A;  2KCV A;  1MMD A;  1SHZ C;  1YKE B;  3M65 A;  3E08 A;  4JHJ A;  5AJD A;  3WI3 A;  4JZY A;  2KZT B;  2VB6 A;  3ZFW A;  4L5G A;  3KFW X;  3SS1 A;  4CGV A;  4I6G A;  2LOP A;  1PY1 A;  4ACL A;  3P8C D;  3D0T A;  3E4B A;  3C4X A;  2V7K A;  2MHK A;  4GCN A;  5AJL A;  3JUI A;  3G2S A;  4CEM A;  2FEZ A;  1ZBP A;  2V26 A;  5FJY A;  2JRK A;  2ZM8 A;  3PRE A;  3I4G A;  3N9L A;  2WWU A;  2ILR A;  4I4T E;  3N2O A;  4GK0 E;  4N39 A;  4UWG A;  3U64 A;  4DBQ A;  5HYA A;  2XCC A;  2XRY A;  3L54 A;  3CX6 B;  3KD7 A;  1FVF A;  4APF A;  4FC8 A;  3EUH A;  3LBX A;  2KAT A;  2ZMA A;  2XGO A;  4H9P C;  4AI6 A;  2WVI A;  3ANW B;  2X6J A;  2BF0 X;  4PS7 A;  3ASG A;  3FBZ A;  1EYH A;  3AB3 B;  1OWL A;  3IF8 B;  3JYS A;  4DI3 A;  3TXN A;  4IDZ A;  4BSX A;  3FUJ A;  1E8Z A;  4J2C A;  5LBQ B;  3FEX A;  3CV0 A;  3B7R L;  3O1J A;  5BV1 A;  3FTW A;  4V3I A;  4TZ4 C;  5J1G A;  3NZS A;  4DVD A;  2LM9 A;  1MIV A;  3UTK A;  2I59 A;  3GW4 A;  5LG4 A;  4OVV A;  4LER A;  1WAO 1;  1AJ3 A;  3MK7 C;  3ZMT B;  3ZCJ A;  4MHC A;  5D0Q D;  4UWF A;  1G73 A;  2V7M A;  1E7V A;  1H19 A;  2A4Z A;  4M3O A;  3FUE A;  3SZ7 A;  2NW9 A;  4EZH A;  1QZ2 A;  4AP2 A;  5FY7 A;  2KMF A;  3H37 A;  4G11 A;  4CDR A;  3KBU A;  2KND A;  1ZHC A;  4AKR B;  4TV9 E;  4C0E A;  3PTR B;  2Y4U A;  3B57 A;  2IJG X;  4DLO A;  2ODV A;  3LJ3 A;  2KIN B;  1UX5 A;  2CFZ A;  1H2U A;  2IOL A;  2KZT A;  2X6F A;  2NOX A;  5FXX A;  3CHS A;  2LAI A;  3QK0 A;  3FUI A;  3F2E A;  4KUM B;  5BUZ A;  2Z6E A;  4EEC A;  3K3O A;  3KV9 A;  4G63 A;  3K9I A;  4PDX A;  2M67 A;  4U72 A;  5FZQ A;  4ATG A;  2YU2 A;  2CG2 A;  2DWG A;  4IE5 A;  3C64 A;  3IBP A;  5KJM A;  3N9N A;  1UCU A;  2IC9 A;  4PK5 A;  1UN9 A;  4HTE A;  4AQG A;  4GPK A;  3C98 A;  4EZ4 A;  4X20 E;  3CHO A;  4OK0 A;  2ACX A;  2Y48 B;  4H9R C;  4XE0 A;  4WUY A;  2YK0 A;  2CLY C;  3FTV A;  4CXY A;  2GRM A;  5DJQ C;  3LY8 A;  2NW8 A;  1D0X A;  5LHH B;  3APD A;  2XCB A;  3L17 A;  3RK6 A;  2BUG A;  2V1D B;  4EBA A;  3UT5 E;  4PJL A;  3ZEF B;  4GCO A;  4MRU A;  3CKC A;  4WWP A;  2JQQ A;  4DBR A;  2E9X A;  5HI7 A;  3CKD A;  4BFR A;  4K0U A;  4AXH A;  5JJT A;  2WSS V;  4BJM A;  3IEG A;  2CCQ A;  4MLP A;  4IRU A;  3CK7 A;  2BDE A;  3KDS E;  3BEE A;  4QXH B;  4YVO A;  4FAD A;  3ZYL A;  2SPC A;  4QFV A;  5C2Y A;  3P1U A;  4Q96 A;  4EAH A;  2FBN A;  3CVX A;  4GYY A;  3APC A;  2RP4 A;  4I6E A;  3CHP A;  4MS6 A;  5TAO A;  4ANJ A;  4ZI3 D;  1YKH B;  1IQU A;  1W3B A;  3CGH A;  5D0O D;  5G05 C;  4ADZ A;  3SD5 A;  2N2N A;  2WM9 A;  2JLB A;  1FMV A;  3RO3 A;  3O1H A;  4A55 A;  3NQP A;  2OA5 A;  4RSY A;  2LNI A;  4YJ2 E;  3FTZ A;  3I3N A;  4B8C B;  3MZK B;  3Q47 B;  3C98 B;  3F57 A;  4G2V A;  4E85 A;  3JQ1 A;  5EKQ D;  4CI1 B;  2L3L A;  4BAY B;  2XGS A;  2X9H A;  2MOW A;  4J6I A;  2X3M A;  1UG3 A;  3ZVV A;  4M1P A;  4HKA A;  3PDN A;  4F6R C;  2XPZ A;  1FEW A;  4WNE A;  2LT3 A;  1WYC A;  3ZEF A;  4AY5 A;  3FU6 A;  3F31 A;  2LEH A;  3EJN A;  4PFP A;  3ZYQ A;  4J8F A;  3UT7 A;  3LXU X;  5DQV A;  4GZ6 A;  2L8K A;  4YJ3 E;  3Q2M A;  4UXN B;  3NRY A;  3FY4 A;  2LSV A;  1HH8 A;  3CVU A;  2PM6 A;  2W00 A;  2N9D A;  4QXC B;  3FH8 A;  3Q4A B;  1FMW A;  2NSZ A;  1H0A A;  2VK9 A;  3G2T A;  2J07 A;  4DLQ A;  4Z8X A;  2WQ7 A;  3RYH E;  4JEU A;  2XHE B;  4WW0 A;  5ENN A;  4KBM B;  4CGW A;  4IN3 B;  2DBA A;  4U0U A;  2CE7 A;  3V5U A;  2IF4 A;  4ZI2 C;  3QJZ A;  3RYI E;  1IJ6 A;  3EIQ C;  4ILG A;  3C4W A;  3AU4 A;  4QKN A;  2LSJ A;  2VKJ A;  3KAE A;  4KZ0 A;  1HZ4 A;  4K03 A;  4CDM A;  4H63 H;  3ZXS A;  3VTY A;  3CSF A;  5KMG P;  1D0Y A;  2KT9 A;  3ML8 A;  1H2V C;  1OWO A;  4GYR A;  2C2L A;  1ZU2 A;  3FTU A;  4DO0 A;  3FU3 A;  3RJV A;  3O4X E;  5M4Y A;  3RKO A;  3RYC E;  2GW1 A;  3UX4 A;  5FP3 A;  1T98 A;  3PUS A;  2FI7 A;  2X67 A;  3HKC E;  4HXI A;  5JJ6 A;  3ZGQ A;  2WXJ A;  1E8X A;  3ZPJ A;  4Y6C A;  4ASK A;  2VSX E;  2Y8D A;  3CK9 A;  4H9O C;  1JWG A;  1IHG A;  2J4B A;  4GOU A;  4WND A;  2I6H A;  4XBF B;  4D10 C;  1E1H B;  1WR6 A;  2XAG B;  5LFA A;  2PQN A;  3PZD A;  2KXP B;  5JDL A;  4FJO A;  2CWY A;  4XKC A;  4FP7 A;  3CQC B;  5LJN A;  2QGS A;  5FQ6 A;  3N2G E;  4ZI7 E;  3SBS A;  1EDU A;  3H3A A;  3HVE A;  4ANW A;  3KBT A;  3FUK A;  3QKY A;  2E8I A;  2VKD A;  2K5B B;  4GA2 A;  2JMH A;  4UQX A;  3LVQ E;  3ZC1 A;  2WXF A;  1SZA A;  3OBV E;  3MJX A;  2XHE A;  2X6H A;  3S4U A;  2AVP A;  1DNP A;  3IHY A;  4B89 A;  2XQ0 A;  3B13 A;  4OYJ A;  4BTB A;  4BY6 A;  3CEQ A;  4O4J E;  1KT0 A;  2ZLY A;  3ETU A;  3C4Z A;  4TN7 B;  3RU0 A;  3LY9 A;  4I2Z A;  4RG6 A;  4HE8 A;  3ANW A;  3ONK A;  1EZ3 A;  2ODU A;  4U0Z A;  1HS7 A;  2LSG A;  5LGU B;  4JHR A;  2KWH A;  2H7O A;  4HFG A;  1A17 A;  3QWW A;  3FTS A;  2MOZ A;  3PUR A;  5LCY A;  4OYS A;  4B94 A;  4NUV A;  5E0O A;  2YEV C;  5HWY A;  1HTJ F;  1ZEE A;  2V7I A;  4AKI A;  1CUN A;  5CB4 E;  4ANV A;  3SOL A;  3CHQ A;  1S94 A;  5F3J A;  5F8P A;  4URK A;  3Q49 B;  4XAX B;  4N3C A;  1S0P A;  2YQ8 A;  4UV9 B;  3RRW A;  3O9X A;  4U63 A;  5G55 A;  1H2T C;  2VL8 A;  4OFZ A;  3O1I A;  2LSK A;  2Q7F A;  4UEL A;  3GZ1 A;  3N9M A;  2UXN B;  3ASD A;  4FJY A;  3AS4 A;  2GK9 A;  3DBS A;  2OV8 A;  4FHK A;  4N3B A;  3MX3 A;  2QFC A;  1Y64 B;  1E8W A;  3N9O A;  2E9X B;  4GZ5 A;  2AWI A;  2JMK A;  3ZMV B;  2Q9Q A;  2WQH A;  4G25 A;  2PZI A;  4XZ4 A;  2AXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...