2YINA

Structure of the complex between dock2 and rac1.
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
425
structure length
411
Chain Sequence
b'SKDNRMSCTVNLLNFYKDNNREEMYIRYLYKLRDLHLDCDNYTEAAYTLLLHTWLLKWSDEQTHRQLKETLYETIIGYFDKGKMWEEAISLCKELAEQYEMEIFDYELLSQNLIQQAKFYESIMKILRPKPDYFAVGYYGQGFPSFLRNKVFIYRGKEYERREDFQMQLMTQFPNAEKMNTTSAPGDDVKNAPGQYIQCFTVQPVLDEHPRFKNKPVPDQIINFYKSNYVQRFHYSRPVRRGTVDPENEFASMWIERTSFVTAYKLPGILRWFEVVHMSQTTISPLENAIETMSTANEKILMMINQYQSDETLPINPLSMLLNGIVDPAVMGGFAKYEKAFFTEEYVRDHPEDQDKLTHLKDLIAWQIPFLGAGIKIHEKRVSDNLRPFHDRMEECFKNLKMKVEKEYGVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DEDICATOR OF CYTOKINESIS PROTEIN 2
publication title Multiple Factors Confer Specific Cdc42 and Rac Protein Activation by Dedicator of Cytokinesis (Dock) Nucleotide Exchange Factors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 132
structure length 411
sequence length 425
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.740 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2yinA03
1.25.40.410 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2yinA01
3VHLA 2YINA 2WM9A 2WMOA 3B13A 2WMNA
chains in the Genus database with same CATH superfamily
4AXHA 1OWAA 4I6EA 4K5BA 3SOLA 1OEDA 4J8EA 4BTAA 2R02A 3LKUA 1XWMA 3CLJA 3AE3A 3G2UA 1HX8A 2P9BA 2EIKE 2HHHT 4CI1B 1UOHA 3PH0C 4GPMA 4EZJA 1N4PA 4APFA 2V6YA 3KBUA 3I0QA 3D0TA 4G25A 2D9DA 2BTDA 2UU9T 4JV5T 1MIYA 4BA9A 5CB4E 3ABLE 3FUKA 1D0XA 5AN8A 2WDRA 2OV9A 4GKJT 2ZMAA 3D9JA 3ZUVB 4ZI3D 2VASA 3B7SA 2CHWA 3QOFA 1FVFA 4X8QA 3RIAA 5AENA 5AQ9A 2UXBT 2XQYA 5L4HA 2H6HA 1KEYA 1QSDA 5HKPA 4PW8A 5J0ZA 2CFZA 1XNQT 1JWFA 2HH7A 3IKOB 1X79A 4Z8XA 3AAAB 2WQ7A 5LBMA 2G0UA 3AG3E 1HX1B 3CMLA 4GZ3A 2EHOD 5ABHA 2LM9A 2CA5A 2XRYA 4JEUB 5IWAT 3HKDE 3ZW3A 4IDZA 3F2EA 1XMQT 3W15B 4RG6A 5KCMA 3O4XE 3UTMA 3EDUA 4GTOA 2JLBA 3SWHA 1KNPA 4TV8E 5AQTB 1RW2A 1X9BA 4I6JA 4L2YA 1LVFA 5LJMA 3D9IA 5CEAA 2UXXB 2JPFA 4JL0A 2LHRA 5HEJA 4DV6T 1TNOA 2ETBA 4U7YA 4B89A 3D9PA 3DSWA 2ZGDA 2QC9A 3AU4A 3TG5A 3RRUA 3O1JA 5FZRA 3MA5A 1US7B 2XTLA 3WI3A 1D1BA 4UIGA 1S63A 4X5TA 5ENOD 2WSSV 4FJYA 3PREA 3GN5A 4U63A 2BZBA 2MOZA 4OK0A 3FH5A 1FEWA 5T4YA 5FMNA 3K3OA 3HG0D 5ENPD 4HB5A 3EI0A 4CDRA 3PEUB 2A72A 3ASOE 3QARA 3NF1A 3BG1B 2CG3A 5L2LA 4AQYT 4U0SA 3AE8A 4AQFC 3TGOA 3HHMA 4XKBA 4A63B 1EDUA 4ME2A 3ZN1B 4ZI7E 4BESA 3H3MA 1YD8G 2BBHA 3OAWA 3CQXC 4JD2G 2C5KT 3B13A 3QB2A 4IE4A 4H63H 1O5MA 1Y01A 2OOEA 3ZYQA 2JJ9A 5LX8A 4UWGA 2D5UA 3B95A 2CMRA 4PK4A 2LAHA 2CXDA 4NACA 2VGYA 2W62A 3CHSA 5LOVE 5JHBA 4F6RD 4DBQA 5LGTB 3KEAA 4H9RC 3LSVA 2KWHA 1G3NB 4NUVA 3VU7H 4ILCA 1D1AA 4BT8A 5DABA 4CEMA 3NAWA 2VSXE 4IREA 3RYIE 2WB5A 5HS0A 2L3LA 3AG4E 3ULQA 4PJNA 3FB2A 3ASHA 2NW7A 1JNZA 2X6KA 3VKHA 4PUCA 5BUZA 1QNFA 3Q75A 4CT0A 5C8YE 3P8CD 2KLQA 5ARFA 2V8SE 2D2SA 4I4TE 1PAQA 3OPCA 1JPLA 1NA0A 3D9LA 3FUDA 4GZCA 3PUGA 4I55E 2KZ7B 2JMKA 4HE8A 4QKNA 2UUAT 5KBAA 2VL0A 4U33A 1TNZA 1R8IA 1WYBA 2J1DG 3CVRA 2YOEA 1KLXA 2IJGX 1N4SA 1QZ2A 4EZKA 2JQQA 2VVNA 3J7Yq 4OAVB 2VSOE 4O1PA 3L9TA 4DX6D 3ENEA 2MRIA 3MKQA 4OVVA 3N9QA 4W9RA 1UJJA 4G2AA 3NBXX 1N11A 3TWXA 3MJWA 4O4JE 2Y0BG 2WXHA 2AXDS 3PS6A 3F57A 3RU0A 3QJZA 2GRNB 4IIJE 4WWOA 5CEDB 4DR5T 5EYLA 2JQKA 1J1JA 4HFIA 2GROB 3KV6A 2MOWA 4LFCT 3FY4A 1FMVA 4EYUA 1UJKA 1E7VA 4Y6CA 3SGHA 4QWNB 4DIDB 5C2YA 4I1OB 5EN5D 4GZ5A 4XI9A 4CRWA 4EQFA 4UF0A 3RQUA 3JCKC 4DUYT 3HXBA 1KT1A 3PUXF 3O1HA 3ZCJA 4EZHA 4DI4A 4IHJE 3OTNA 3P4QA 5FXXA 3CX7B 3PZ4A 5HEGA 3FTXA 3AU5A 4KUMB 3FDHA 5JRCB 2H6IA 4HFCA 2XM1A 4NXNT 2XCCA 4FHKA 1EF1C 3R6NA 2CHNA 4AY6A 2HPLA 4O2BE 3TKLB 4PFOA 4JEHB 5FYMA 3RC8A 4IRUA 1MX4A 4AKHA 2XQ9A 1N95A 3E4BA 1Y8MA 3IHVA 4BWRA 2X6HA 2WXPA 4YTMA 4JI7T 3ABKE 3E08A 1TJFA 2AVPA 3ZRHA 2X0HA 3RJVA 1KF6A 4YJ2E 3MKDA 1N34T 2VWAA 2B76A 4YY3T 4C0MA 4HFBA 1HG2A 2PQRA 3PZ2A 4X20E 3EIJA 2E2AA 5BR8T 3AG2E 4F1SA 4U0UA 3VRBA 2CEAA 5AQGB 2MYSA 1IQUA 4QXBB 3L82A 3UFGA 2J09A 3LYAA 3FUEA 3UU5A 3QC9A 2WXRA 3RQWA 4WBOA 1X81A 3FUMA 3P4RA 1JWGA 3CR3A 5LGNB 2FUPA 5CGMA 3UU6A 4JHKA 1VDYA 4AEZC 2Y3AA 5EK2A 1SZAA 2LKHA 5L3BB 2OEVA 4FLHA 3PNTB 2R2LA 4ATGA 4HFGA 3CVXA 2N2NA 5JJ6A 3LDZA 4XAXB 1IBKT 1FMWA 3UM0A 3Q78A 2DNXA 2AXUA 2DWZA 5H7PA 3ZMUB 3U4TA 2LLYA 2GRLA 3ZJ2A 3MEKA 4EECA 2P9LG 1W09A 3LK42 2WXJA 1EPUA 1TR4A 1XNFA 3OXLA 4MS6A 2RFMA 4GTMA 2XCBA 3I4RB 1MQSA 2CG2A 1E8WA 3ZU7B 2WP9A 3RYCE 1V55E 2YK0A 2OV8A 4ZS3A 1KK7A 4UI9K 4L9IA 3Q9UC 3B7RL 3GZ1A 3TXMA 4BEPA 1WG0A 3ZT5A 2BKGA 2KNDA 1AWCB 5BMVE 2WY2A 1OWLA 3LVRE 2V7IA 1S70B 4CN1A 4I9CA 1IHGA 2XSBA 3SFYA 4K0UA 3ONKA 2Y48B 3QNKA 3EDTB 1VCSA 1KFYA 4EOZB 2XJ7A 2P9KG 2XS8A 3DSTA 2BVLA 4J6IA 4GCNA 4DLQA 5E75A 1FVHA 2VJ8A 1NI1A 4J7WA 4KMCA 5CA1E 4JHJA 2GRQB 4DX5D 4AQFA 4AKIA 5LMUT 3QWPA 4OYJA 2QA7A 2WXNA 3FTZA 3AEEA 2KT9A 3K3NA 3D9MA 3JXIA 4DX7D 4RQIA 1ZKEA 4CXWA 5LYJE 1L5JA 2XHEA 1N54A 3MGBA 4N5QA 4KZ0A 1VRBA 2XQ8A 3N9NA 2W00A 5AQKB 5E76A 4WNKA 1D0ZA 3AA6B 3EVYA 5EK4A 4TV3A 1T72A 4KP3C 1E7PA 3S7FA 2AE9A 5LP6E 3MKRA 2VGEA 3ETUA 2UXCT 3IEGA 3HKBE 3C3QA 4LCTA 4KI0F 4Q94A 4GPKA 2KCLA 1W0AA 2QVAA 3R84B 4K03A 4AQGA 4G11A 5J2TE 4X1YE 3ANWB 5FXWA 2CFUA 3AJIA 4GA0A 2FJBA 4GKKT 1WRDA 2HN2A 4DV1T 2GRRB 2Y4UA 4GYSA 1KPSB 3S7DA 4U7IA 2V8SV 3I9WA 4UWLA 3MJXA 5LG3A 3KV9A 3KSQA 2V4LA 3URZA 2R5SA 5D66A 5J90A 4YHHT 4KT6B 1D1CA 5L3CB 1T8BA 2YDSA 3RAUA 3CVUA 5LHHB 3LCAA 1W9RA 3HXCA 3ZJ1A 5BV1A 3FU0A 3EABA 3TWQA 4C9BB 3UIOC 1B89A 1K3ZD 1OWPA 2PTFA 2LSGA 3SFDA 1Z3YA 4UWKA 4GTVA 4UI9J 2CXLA 2OLTA 1E2AA 4EHMA 2V5QC 2M63A 4BJMA 1P5QA 4X64T 4IE5A 1UGOA 3BG0B 1IHBA 4DO0A 3Q5MA 4XI0A 4DR6T 3V5UA 1J5WA 5CCLA 2NR4A 2CHZA 4N2SA 4MLKA 3NOGD 1LVKA 3VR9A 3L08A 2WM9A 4JHRA 3PZ1A 4AKRB 4HRNA 4PS8A 5JH7E 1SA0E 1MIVA 2E9XD 2XQ6A 1Z6TA 4NRHB 4HOUA 3V2XA 5LHGB 3RRNB 4J8DA 5JHAA 3DP7A 2L8KA 3SS1A 1FPPA 5CA0E 4LERA 5A1LA 4R7LA 4GTTA 2AXZA 3HKCE 2IY0C 3E33A 2VURA 3PUQA 3ZKRA 4ILGA 3T5XA 4C0EA 2IUBA 3PUZF 1N9AA 4DR1T 2K3WA 3CVLA 3FHNA 3KSLA 1S94A 3FXDB 1S0PA 2W63A 4L0RA 3C72A 5BV0A 3Q47B 4JYAT 3FU3A 2XM2A 5JDGA 1E1HB 4JUYA 2LE8A 4RG9A 3S4UA 4FULA 3TLVA 4KYOB 1UN9A 3EU9A 3TAXA 4U8YD 3O9XA 2P2CP 5AFUL 4A98A 4L5GA 5ENSD 4B8CB 2X9HA 3J5PA 2W61A 4U2ZA 3LJ3A 2XQ7A 2P9UG 4G1TA 5JREA 4YJ3E 1OCRE 1N52A 2KSRA 1MNDA 4DR4T 3L13A 2Y8DA 5DJQC 4AIUA 2AJAA 1K8KG 1N0RA 2ODUA 1SA4A 1E8XA 2XEEA 3W9FA 2H89A 1FCHA 2HYZA 4JZYA 2FEZA 5CFBA 5FXVA 5L3DB 3DPDA 5KNHD 3GMIA 2BKPA 4JA7A 1G73A 2VVSA 4ADZA 5EK3A 1BI7B 1WM5A 2NXPA 1BD8A 3G2WA 4G24A 4EBAG 3G2TA 4L2LA 3CQGB 4GZDA 4KZCA 1BR0A 3E0ZA 3RPUA 3AA0B 3EUHA 5KJNA 5LCWJ 3F31A 5FXZA 4NIQA 4LF4T 2I1JA 2NW8A 3JAFA 4ZHQE 2WXIA 3HYMB 3ULYA 4JVSA 4FADA 1WR0A 3IBEA 4P09A 3APDA 2BG9B 4MHCA 3RGLA 2EHOB 1ZHCA 5HYAA 2LXLA 3NBNB 3H3AA 3Q5XA 5AQQB 2PZIA 3FUFA 1K1AA 1V54E 5LXTE 3ZYKA 2Y69E 3ZMZB 2UY1B 5ITZF 1Y64B 1H2TC 3MXZA 3N9PA 4QH4A 4XIFA 3SFEA 3CWZB 3RRWA 3Q4AB 4I2WA 4Y6WA 5JMND 3TG4A 5JRCA 4AM9A 4MRUA 4G8KA 2I9CA 3CGHA 1LKXA 1TNUA 5LCYA 2VK9A 4JEHA 4LSZE 4HOSA 4YHJA 2ZM2A 4DUIA 3UU4A 2X6JA 3SY2A 4AJWA 5CJ5A 2XHEB 2JQHA 3LBXB 4DR3T 4KHPT 3P7IA 5LNKA 3CHRA 3NRYA 3K1SA 3U9WA 1VOMA 2GRMA 3QKYA 1N0QA 3GWHA 1YKHB 3TLSA 3TWVA 4EV6A 4IGUA 5IUXA 2OVFA 2J4GA 3JXJA 2GW1A 1IZNB 1NL4A 3P4SA 3ZSTA 3IV0A 4KBQA 3X1DA 1YCSB 1N4QA 5JJ7A 3AG1E 5ENTD 3V30A 2KCVA 2A5EA 2P9PG 3NVOA 4UI9C 2MTQA 4DV0T 1BR4A 3UU8A 4B93B 2LEHA 3O4ZA 2L9QA 4YDWA 1HG5A 4P0AA 2XPIA 4U04A 3TWTA 1FT2A 2D0UA 4DUZT 3ZXSA 4ASKA 2VSNA 2IEJA 5ETWA 5G2NA 5L3GB 3ZYMA 4UWFA 4FC8A 4DBRA 3ZFWA 1E8ZA 4GIWA 2VGXB 4ZI3C 1N32T 1RZ4A 4A56A 3ASFA 4B3RT 5ARGA 2EINE 2OVBA 2IOSA 4YTPA 2BVMA 4DX1A 4HORA 3QC1A 4IDNA 1SQMA 4ILBA 4WNEA 3J5QB 4AY5A 2HO1A 3SQVA 3V31A 1Y6IA 3BQIA 4UV8B 3ONLC 2W4XA 2BG9C 3UUXB 1NZNA 3RK6A 2MAWA 2EHOC 4X1KE 2KWIB 3BEEA 4WZXA 3IBPA 1ELKA 4WWNA 4H9OC 1SHZC 4CGWA 3J9X1 3AVSA 5AQRB 4BERA 3FTWA 1BU9A 5H6RB 1WCRA 5AIJA 3GYZA 4N3BA 3RKGA 3FZFB 3M65A 4KBMB 5JR9B 2W67A 4NXMT 2WXGA 2BF0X 3DSVA 3C64A 5HI7A 1QYMA 2WMNA 4OFZA 4D10C 2UXNB 3CX8B 1D8DA 3UM2A 2QFCA 4V1Av 2UUBT 4QH1A 3LDQB 2I2OA 2NC9A 2VQET 5LOZA 4HKAA 2V7LA 5KJLA 1A5EA 1J5ET 4ISTA 1DNPA 2XAGB 1IAPA 3U66A 4O2AE 2NYJA 2QY7A 2L9BA 4CDNA 2J47A 2AXVA 5EZYE 5JDMA 3GW4A 3D9KA 5C2TA 3MV3B 4CYMD 5M4YA 3UM3A 4DV7T 1IYGA 5HEHA 3PUVF 3MZKB 4H9QC 1HS7A 3Q9NC 3Q79A 2WWUA 2D0TA 2XQ4A 3DEOA 4WNFA 1H6PA 4J8FA 1H0AA 4K0KT 3QOUA 5LCWC 2VQFT 3Q5EA 1WLXA 3D9OA 3AA7B 3I9YA 5LJNA 3CVPA 4TXRA 3AEGA 4ATZD 4AKGA 3EAMA 3UQ7A 5AARA 2WCAA 4CXYA 2PQNA 5ABFA 2WDVA 3PE4A 4B0ZA 2H88A 4G26A 3ANWA 2LSYA 3Q2MA 4F7AA 3AE2A 1NEKA 1YKEB 5FL0A 3N71A 4PS3A 4OHFA 4F6RC 5ADXL 3C98B 5AQHB 5AAOA 2E9XA 2DZOA 2NW9A 3GZ2A 4EBAA 3KBTA 4GA2A 1UX5A 1OWMA 3UPVA 4WYVA 1HU3A 2IOLA 3HKEE 2VYIA 3ETVA 4PDXA 3NZQA 1ZOYA 2I1KA 2XPZA 4U95D 2LSVA 1EZ3A 1XDPA 5T3RA 3EHMA 2A2FX 5AQBA 1V9DA 4RSYA 4IE6A 5JR9C 2RA1A 2C0MA 2RD0A 4CZ2D 1AP7A 4GK0E 1OWOA 2GK9A 2IC6A 4I1MA 3VLFA 4A3VA 4KVOA 4WNGA 2VTBA 4C90A 2BEDA 5ENRD 4JBWF 2P58C 2N9DA 4IL9A 4TUUA 3UXGA 3AS4A 4LMJA 4U0ZA 1KZOA 1TN6A 3CX6B 4N3AA 4DV4T 4JI0T 2W0GA 3ZHEB 3NZUA 2BS4A 1O3XA 2YKSA 2PFVA 1MX2A 5F8PA 4GYWA 3ZSSA 2WXQA 4UVAB 5EX3A 4IDOA 4LF6T 2KC7A 2CWYA 3FTUA 1SZ9A 3CKCA 4FLBA 4KHZF 1VCTA 2F8YA 4X62T 3ZMSB 3FEXA 5B1AE 3AE6A 2R6GF 4A1GA 2RFAA 3E30A 3T8KA 3MK7C 3PDYA 5CBOA 3OYXA 1LD7A 2WMOA 3PVLA 2EQXA 3W9GA 2WB2A 5EIBE 3LK3B 1IJ6A 3WAKA 4U96D 5AQFB 5L47A 5JA4D 3L6AA 1TJCA 4DV2T 2KM4A 2HM8A 2JMHA 4QH5A 4BX8A 3KDSE 4HOTA 4YSXA 4DNDA 3FHEA 4E6HA 3T9KA 3RIUA 3EDVA 4E7SA 1WR6A 3U3IA 3T1YT 4Z91A 3MV2B 2UUCT 3AE9A 2K9AA 3OYZA 4EAHA 3JQ1A 4BTBA 4EPZA 3ZPOA 5F3JA 2R59A 5HAXA 4B3TT 3OBVE 4DV3T 4J8SA 3PUWF 4OX9T 1UG3A 3N2GE 2X9WA 1QBQA 3N2KE 3CHMA 4ERRA 3KV5A 3Q5WA 2WS3A 1Z5SC 4XZCA 4JB8P 4F3VA 4EB6E 2PBIA 4JI2T 3AAIA 3AS8A 3PZDA 3HL6A 4TNWA 5AQSB 5CERB 4WBNE 5ABEA 4PK5A 4DPRA 5HXSA 4M1PA 3AE5A 2DYRE 3O48A 4GA1A 5AQLB 4ZEYA 5CBNA 3KVBA 2CBIA 1HTJF 3FZHB 3TWRA 1O1TA 4YVOA 2QGSA 3RHWA 1Z0PA 5IHYA 2H6GA 2VKJA 4HFDA 4HNAD 5ANRA 4DRXE 4COFA 4UWHA 5KXJA 3R7QA 2IW5B 2LNIA 2V6XA 3L54A 4HFHA 1HNZT 2LHNA 3DSUA 4QX7B 3RH3A 2YQ8A 4LF7T 5H6QB 1OUVA 3AE4A 1OCZE 4G63A 2Q7FA 2H7VC 3A8YC 3LY9A 3JADA 3ONLA 2BG9A 4IL4A 1OWNA 4J8YA 2EHOA 3E37A 1ELRA 2XAHB 4ANVA 4ANJA 4YXDA 3MZLB 4UV9B 3ZGQA 3CK8A 1H6OA 2UY1A 2ODVA 4PJJA 1DCQA 5CMYA 2WQYA 2C0SA 4GYRA 1XNRT 5G05J 2DI4A 4GMJA 3VRAA 3CSTA 1JNRA 4DR2T 5J08A 4AXPA 1UW4B 2JQ9A 1AJ3A 4BSXA 5DQVA 4DK5A 5BXOA 4CZZB 2ZM0A 5F5WA 2ILRA 4UUCA 3RLFF 4EXTA 4ISSA 3LBXA 3SRZA 3C4WA 1A17A 5L4EA 4GYYA 4AV7A 3CVNA 3VR8A 4HLLA 1OT8A 2F0YA 1HCIA 3ML8A 1W0BA 4B8AA 4HQDA 2BS3A 2C5IT 4H9SE 5HXRA 4LFAT 4CN6A 3R7RA 5EX0A 3PUAA 4XBFB 2WQHA 5HCJA 2J62A 2ACXA 1O1RA 5AQPB 1ZU2A 4FU3A 3K3QC 3S2AA 3SD5A 2I0MA 3UUMA 1E90A 2YHEA 2XZEA 4GTSA 5HEUA 2WU2A 2WXOA 4EYYR 5LFAA 5ABFB 2ETCA 4DV5T 5FQ7A 2XAFB 5BW8C 4BETA 4TV9E 4XKCA 1SVXA 4O60A 3VLEA 3PUYF 2I59A 4ZOLE 2QZAA 3HRAA 1IBMT 3ABME 2XGOA 2IU1A 3WXXA 5C3JA 2YN6A 4X65T 3UM1A 3R9AB 1BR2A 5E0OA 4F8HA 2E9XB 4V3IA 4HRMB 3H37A 5JDLA 4U72A 3PNLB 2BKKB 5A6CA 2L6JA 2VGXA 3QK0A 4RVBA 4TUYE 5HWYA 1JCRA 5FY0A 3MACA 3TWUA 3UMVA 3DJBA 1FIOA 3E22E 3Q15A 2FF4A 2IMLA 5D2MC 1N4RA 2WWVA 3UUXA 1BLXB 3WAJA 4HFEA 4A97A 2V7JA 4C91A 2LSUA 1PY1A 4ZXLA 2X9XA 1HO8A 1O1SA 2XZDG 3G2SA 4KXKB 2VTBB 2VKOA 3RYFE 3DSXA 4K0RA 3PE3A 3SBSA 3I5PA 3T8MA 2ZM6T 1WYCA 4I43B 4AP2A 3LY8A 2FJAA 2JIWA 1YXRA 1IJ5A 1KZPA 5LB7B 1IQRA 1Z3XA 1MMNA 2YDRA 5JR9A 2V1DB 3FTSA 2WVIA 1JCQA 4LG6A 2DBAA 3AB3B 3C51A 3JYSA 3SFXA 4A1SA 2YHCA 3SFZA 5D0QD 3FUJA 4Z90A 3KINB 3AECA 3JC6D 3QWWA 3PJAJ 3ASNE 4HVBA 1SA5A 1JCSA 4TNVA 4LFBT 4O4IE 5ENNA 2M6BA 2DCPA 2L0IA 3N9MA 3HIZA 4NIKA 4YDOA 2CBJA 4IDPA 1BPOA 1XZYA 1CHUA 2WZIA 2XGMA 3ZKJA 3SHFA 2XQAA 4HWCA 3LEWA 4WUYA 4CI3B 4QQIA 5GONE 4JXTA 3DWLG 2WZHA 4HBDA 2ZGGA 4BAYB 3DTOA 4P29A 3RI5A 2UXDT 2WBLA 1ZBPA 3FZKB 4CCAA 3ZEFB 4HWIB 2KXPB 1U5PA 5AQAA 2J08A 3KFWX 5JQGE 2IF4A 3AS5A 3FWVA 2VL8A 3OVUA 2LSIA 5JVDE 4FJZA 2XQ5A 2E9XC 3JC6C 4GMLA 4LEUA 3ASGA 4O4HE 2ZISA 2PM7A 5CECB 1GW6A 3PURA 3C3OA 2DLRA 2J4BA 5M72A 5KJKA 1QLBA 4J2CA 2LRLA 2EIME 3QWVA 4YDYA 2LSJA 4KMOA 1G8XA 2XS1A 2LUHA 2E5LT 3HXDA 5JTGA 5FIOA 3C98A 2R03A 3ISMC 4N78D 4JI4T 4QX8B 3TLWA 3KS2A 2WDQA 3DXKG 2HPJA 3B7BA 4PH4B 3CK9A 1K1BA 1HH8A 5G05C 3L39A 3ZC1A 3HVEB 4QHOA 2GRPB 4Q25A 3Q73A 3QB5A 2FI7A 5J2UE 3HXEA 2BBJA 2BS2A 4TXPA 3SF4A 3ZN0B 3UX4A 2DVWA 3I0OA 2DYSE 2X0YA 4YFSA 4B3MT 3TJPA 4G23A 2F8XK 4PFPA 3NQPA 4O1OA 4O4LE 4GU5A 1MMDA 3L22A 3OXFA 2R05A 1E7UA 1OXZA 4EIWA 3B5MA 2XENA 5AQUB 3FP3A 2LO6A 4QXHB 2VB6A 2IC9A 4BT9A 2YU2A 3QB5K 3VTYA 3ZVVA 4DJAA 2RPAA 3UT5E 3O1IA 4YSZA 1UCUA 3APCA 3G2VA 3ZMTB 4XEIG 3ZXPA 3FUIA 3ZHEA 3KEZA 4EGWA 2ES0A 3U64A 1HXIA 2CLYB 4U31A 3F6QA 5KDMC 3EHNA 2GGFA 1KNZA 1MHQA 5BT1A 2CXFA 2MHKA 3CVVA 1YYHA 3VLDA 2E5VA 3Q9DA 4IE0A 3RC3A 4WWPA 5FVLA 2KXPC 3PU3A 2FO7A 4O6FA 1KT0A 5KJMA 3RIUC 2XAQB 2XQ3A 2WXLA 2X6IA 4CDMA 4U3CA 5FKYA 1ZB1A 3CKBA 5L3FB 4FI5A 4U8HA 2K5BB 3AEBA 2YEVC 1OCCE 3EU5A 1DC2A 3B57A 4H9PC 2XZTG 3UQ3A 5HQ8A 1OCOE 1I94T 2V0PA 3GZSA 3UT7A 4MALA 5JDHA 2DL1A 5ABGA 3AXJB 3ZC0A 2WXMA 3AE1A 2ZXWE 2LOSA 2J07A 2X3MA 3U3WA 5KNGA 3NRXA 2HE0A 4CGVA 2WXKA 1H2VC 3A5XA 3TLTA 3JUIA 3QNUA 5CMWA 2X68A 1Q2ZA 2E0IA 3ULEG 2X0LB 1YQ3A 2PG8A 4ANUA 4KVMA 3EJNA 4I9EA 4RLYA 3T1HT 4Z68A 4X1IE 3EHRA 1B7TA 5FY7A 3Q7FA 2KMFA 5HRYA 1EYHA 5G04J 3ONJA 3SI5A 3PRZA 2XEHA 4L1BA 1INZA 2Z6EA 1W3BA 3FXEB 4ILUA 2J49A 2Q9QB 3LK2B 3OKQA 4EEDA 4AISA 5EILA 3TXNA 1NFIE 2OCCE 3NOCD 3MCXA 1MMGA 2J8SD 2FJEA 3OXGA 2CLYC 4HEAA 3ZLIA 1MYOA 4TRQA 1HR0T 5JDFA 4ZS2A 3AEFA 3RYHE 3N2OA 4XX5A 5FZSA 4GB9A 4MBGA 2DWKA 2R17C 4C48B 2WQ6A 3DXMG 3VKGA 3PZ3A 4ZFHA 4MKTA 2YU1A 5FY1A 2JEKA 2IAKA 1WFDA 3UTKA 4PAGA 2OEWA 4A55A 2KZTB 2YDQA 2CE7A 2FULA 4UQZA 3PE0A 3T8OA 4GK5E 2FO1E 5DBKA 3BQLA 3ZCIA 3ZPJA 1UURA 3K9IA 3V79K 4B3ST 4QXCB 1M7KA 1D9SA 2WXFA 1N94A 3UINC 4A3TA 3RO3A 5FJYA 4JPSA 4EZLA 3L3PA 1MMAA 2XQ0A 5FL1A 4NPPA 4PJLA 4WNDA 3VTXA 2C0LA 3LJCA 1OXJA 5HXCA 1JUQA 3P4PA 2AW6A 3P2BA 4QFVA 2Q9QD 4WW0A 1TYQG 2JABA 4CN4A 4BX9A 3HR0A 5BNWA 4YNDA 4HXIA 2Y4TA 4TZ4C 3AAAC 4FP7A 1MJ0A 4TXQA 1H6KA 1MZCA 1NAFA 3HDXA 5ANLA 2XPYA 4JW1A 2VKHA 4YTNA 2PM6A 1L0VA 2XEVA 1UX4A 5HXEA 4X66T 2LXMA 5FQ6A 1UUSA 3T5VA 4JLEA 1U4QA 2WU5A 4GYOA 3DPYA 3ZT7A 3EUVA 4XE0A 1TEZA 5FWQA 4LMLA 4ZZCA 2ACZA 2CM0A 2V7KA 1LF8A 3IHYA 3L16A 4P1NA 4LNGA 5FTPA 2QRXA 4HFVA 5KWDA 1XDOA 3AEAA 2HN1A 4JC8A 3D9HA 3P4WA 3UIPC 2EILE 4BJNA 3U78A 1T7SA 2HR2A 2P9NG 5AQMB 1YMPA 4BSZB 5B1BE 2Q9QC 3RF1A 2IFUA 3IF8B 3Q5DA 3APFA 3C5RA 4L9PA 4HI9A 2BDEA 4N2QA 3IA3A 3N9LA 3I1AA 4DLOA 2KBXA 3I3NA 5CHEE 1H2UA 2KATA 2LM2A 2BG9E 4CQIA 5AJDA 4I0UA 2V7MA 5C1DA 4G2VA 2BKNA 2ETAA 1XGWA 3BK9A 2M67A 4I43A 4DMWA 5LP0A 5BPPA 3CQCB 4GTRA 3FTVA 4HWHA 3UQ4A 4LF8T 2H7OA 1BI8B 3C4XA 3G06A 4ILIA 3UKUG 4AVXA 4DI3A 2BUGA 1WAO1 4IULA 2CRBA 3JAEA 1LD8A 4TN7B 3QDNA 2YINA 4IT4A 2H6FA 2J4DA 4HN9A 2NSZA 1CUNA 2NTXA 2X66A 4APOA 2DCFA 1OEDB 4O8SA 5TAOA 1IXVA 1QQEA 2CHXA 3BQOA 3EHQA 3PEVB 5AYWD 4F53A 5CCMA 1D0YA 5LGUB 5AQVB 3MA9A 2IQCA 3N5LA 3CK6A 4TWDA 2H3RA 4K5AB 2V6YB 4UVBB 3BQKA 1NP7A 2IONA 4P0BA 2J9QA 3KVAA 4NUUA 2V5FA 4I6GA 2CPTA 3TLUA 3ZEFA 2IO3C 4UELA 1T98A 5G04C 2WAUA 1H19A 1BR1A 1HFAA 4JI1T 4HWFA 4TWFA 3ONXA 5HEOA 2AWIA 4WAFA 4ZHBA 4K5CA 2B1EA 3RSEG 2V5CA 4GOUA 4OVUA 2RKKA 2C2LA 3HI2A 4OYKA 3PDNA 4LRZA 1TNBA 3PTRB 3FU6A 3FU5A 1X5BA 3WG7E 3DSSA 3BUAA 4F1PA 1DCEA 3CKDA 1S35A 4UR9A 4U07A 2SPCA 4LMKA 5AQJB 4CXXA 3ZIMA 2MBGA 2BKOA 4M7CA 4HS2A 5EYPF 2P9IG 3HVEA 3SZ7A 3NB2A 4YVQC 2IDOB 1SE7A 2K48A 2CCQA 4TX5A 1E96B 5FP3A 4JI3T 3DBSA 1TN7A 4I2ZA 1IBLT 4TUMA 2W2UA 2LAIA 1I6ZA 3SO8A 2RP4A 1NWMX 5DQWA 4TWHA 3PJAA 4FHJA 4ACLA 4NQ0A 4E85A 4N5CA 1M62A 2W66A 5HXHA 5FT9A 2XSAA 3A7MA 2NWBA 4UVCB 4MLPA 1MNEA 2K24A 2XASB 5IY5E 5FQ4A 5FZQA 2CHOA 3AE7A 3GN5B 4Q96A 2X9YA 5AQ7A 3CV0A 4URKA 3CK7A 1ZV4X 4JI5T 3JQ0A 5B3SE 4N39A 4B94A 2XAJB 3P50A 4GZ6A 5FNVE 4ANXA 2MYOA 1WDYA 3FH7A 1OEDC 2VQ2A 4AI6A 3LS8A 3C3RA 5AQNB 4PJMA 1SUMB 3FBLA 4GCOA 2DWGA 1HF8A 3UI2A 2M6IA 5T8IA 2ONDA 3UT4A 3ABVA 3HXFA 2A3DA 2NP9A 3NKZA 1FJGT 4HOQA 1N33T 5HCMA 4KX6A 4U74A 5JDNA 4M3OA 4ACKA 2L0TB 3RIBA 2WPVA 4OAUC 4H7YA 4H9NC 5CRVA 4JI6T 2YNQA 3TL5A 3UFEA 2RG8A 2F37A 3AEDA 2L6BA 2LOPA 3RKVA 4I50E 3SNXA 3M3ZB 4J0UA 4CI2B 3UUNA 2LT3A 4LNBA 3RO2A 1N36T 4UQXA 4HGAA 2Y1LE 5ENQD 3LY7A 2VSYA 3UU3A 3CIAA 2XUEA 3SBTB 1QUUA 3OTOT 2UWJG 3FUHA 2X67A 1DU2A 3FBZA 2E8IA 3Q49B 4HI8A 3ESKA 5AQIB 2FJDA 3AXJA 4AOFA 2ZLYA 1WY6A 3MX3A 3GA8A 2E2EA 3PUJA 2KINB 4YSYA 1U3CA 4MBQA 5KX5E 4JEUA 1UN8A 4JA9A 2LJLA 1ZEEA 4OYSA 3V2OA 4EEBA 5KMGP 2NTYA 2FBNA 4NURA 3FEYA 2IO2C 4UQYA 1SW6A 3CHQA 1LRZA 3QUJA 2V4HC 4ABNA 4HTEA 3PUSA 4ZZBA 4UXNB 5AJLA 2PNNA 2LRKA 2CWOA 3X2QE 1H7CA 4IE7A 2P9SG 3S7JA 3MKQB 3QK6A 4ILAA 3JUEA 3AA1B 4U8VD 1Z8UA 4JI8T 4LF5T 1OY3D 3LXUX 4L7TA 5LHIB 2Q9QA 3LVQE 3ASDA 4ZI2D 3CVQA 4Q69A 1KNRA 2V26A 4LNUD 3RRCA 3CVWA 5L3EB 5JDQA 1ELWA 3CSFA 4YDEA 5A7DB 4IYPA 5A23A 3L17A 3PUKA 5EIDA 5FVKA 3K8PC 2A4ZA 3RX6A 1HZ4A 1TNYA 3VHLA 3EIQC 4H63V 4UF0B 2XY8B 3MYVA 4UEMA 5CRUA 1NA3A 4FJOA 4YLHA 5J1GA 2QYWA 4I1AA 5FQ8A 5AQOB 4LUNU 1OEDE 2A9UA 3PV0F 2KZTA 2DIWA 3C4ZA 3HA4A 3KD7A 4PS7A 3CVYA 1YQ4A 3ZNGA 2V5DA 3V5SA 1HNXT 3FH8A 3B7UX 2XRZA 1MIWA 2MPKA 3UULA 4GAAA 3L09A 3CHOA 2X6FA 1UK5A 3D9NA 5EDSA 4U7EB 3ZT6A 3ZN3A 3KAEA 4I17A 5FINA 3ZYLA 2EIJE 2I6HA 3R9MA 4ZI2C 4DMVA 3FUNA 3C50A 3IXEA 3Q7AA 4ILHB 2JRKA 3CPZA 2ZM8A 4H7XA 1HE8A 1NENA 4BY6A 1LTXA 2DHRA 2IIUA 4A5XA 3L8RA 2XGSA 1S64A 3E32A 4LF9T 3UT8A 2F4VT 1FT1A 4GTQA 5EKQD 3CIRA 3AAEB 4G8LA 2X38A 4PNIA 4IN3B 2QYJA 4DVDA 2FBWA 3CEQA 3FZMB 2ZIRA 4N3CA 3E34A 1HNWT 4GMRA 4E7ZA 3DRAA 1IKND 3BU8A 2OA5A 3DEPA 5LG4A 1ZP0A 3LFMA 2PJQA 4MFRA 4GTPA 1MX6A 5HWXA 1TN8A 5JJTA 2ZU6B 3LG7A 4L23A 3OJAA 3B7TA 2PL2A 3LJNA 4IDQA 4PK6A 1HS6A 3AVRA 4EZ4A 3FULA 3N9OA 1YA0A 2IHR1 2LSKA 2C5JA 1E8YA 3TWWA 4XZ4A 3ML9A 3NWIA 1GQEA 1YW0A 3ZMVB 4U2YA 3IEEA 4AIFA 3FZLB 2B0OE 1XMOT 3FFLA 2VKDA 1U2VG 1PC2A 1D8EA 3IHRA 3TWSA 2XPKA 2A5UA 3NZPA 3NZSA 3LPZA 2NOXA 3P1UA 1U3DA 3UUBA 4BFRA 3S7BA 3D3MA 5D0OD 3RIFA 3EHZA 3QAQA 5G55A 5DIZA 4DX2A 2LKGA 2QYUA 2B6CA 4B6XA 5LMNT 2Y6XA 3CHPA 5IYZE 2X51A 3I4GA 4HRLA 3PU8A 5LBQB 3RRMB 4HLEA 3JCFA 4ANWA 4AKLA 4HWDA 4YT0A 2DZNA 4FA6A 4CT4A 4DR7T 2KCKA 3ESLA 5LA6E 1DVPA 2N1GA 3KV4A 3RKOA 5BXUA 3UKRG 3FTYA
chains in the Genus database with same CATH topology
4AXHA 1OWAA 4I6EA 3SOLA 4J8EA 4BTAA 3LKUA 3CLJA 3G2UA 1HX8A 2P9BA 4CI1B 3PH0C 4EZJA 4APFA 3KBUA 3I0QA 3D0TA 4G25A 2BTDA 1MIYA 4BA9A 5CB4E 3FUKA 1D0XA 2ZMAA 3D9JA 4ZI3D 2VASA 3B7SA 2CHWA 1FVFA 5AENA 2XQYA 1QSDA 4PW8A 2CFZA 1JWFA 2HH7A 3IKOB 1X79A 4Z8XA 3AAAB 2WQ7A 5LBMA 2G0UA 3CMLA 4GZ3A 2EHOD 2LM9A 2CA5A 2XRYA 4JEUB 3HKDE 3ZW3A 4IDZA 3F2EA 3W15B 4RG6A 5KCMA 3O4XE 3EDUA 2JLBA 3SWHA 4TV8E 4I6JA 4L2YA 1LVFA 5LJMA 3D9IA 2UXXB 2JPFA 4JL0A 2LHRA 4B89A 3D9PA 3AU4A 3TG5A 3RRUA 3O1JA 5FZRA 3MA5A 1US7B 2XTLA 3WI3A 1D1BA 4UIGA 2WSSV 4FJYA 3PREA 3GN5A 4U63A 2BZBA 2MOZA 4OK0A 3FH5A 1FEWA 5T4YA 5FMNA 3K3OA 4CDRA 3PEUB 2A72A 3QARA 3NF1A 3BG1B 2CG3A 5L2LA 4U0SA 4AQFC 3TGOA 3HHMA 4XKBA 1EDUA 4ME2A 3ZN1B 4ZI7E 1YD8G 3OAWA 3CQXC 2C5KT 3B13A 3QB2A 4IE4A 4H63H 2OOEA 3ZYQA 2JJ9A 5LX8A 4UWGA 2D5UA 2CMRA 4PK4A 2LAHA 2CXDA 4NACA 2VGYA 2W62A 3CHSA 5LOVE 5JHBA 4DBQA 5LGTB 4H9RC 2KWHA 4NUVA 3VU7H 1D1AA 4BT8A 5DABA 4CEMA 2VSXE 3RYIE 2L3LA 3ULQA 4PJNA 3FB2A 3ASHA 2NW7A 2X6KA 3VKHA 4PUCA 5BUZA 1QNFA 4CT0A 5C8YE 3P8CD 2KLQA 5ARFA 2V8SE 2D2SA 4I4TE 1PAQA 1JPLA 1NA0A 3D9LA 3FUDA 4GZCA 3PUGA 4I55E 2KZ7B 2JMKA 4HE8A 4QKNA 1WYBA 2J1DG 3CVRA 1KLXA 2IJGX 1QZ2A 4EZKA 2JQQA 3J7Yq 2VSOE 3ENEA 2MRIA 3MKQA 4OVVA 3N9QA 4W9RA 1UJJA 4G2AA 3NBXX 3MJWA 4O4JE 2WXHA 3PS6A 3F57A 3RU0A 3QJZA 4IIJE 4WWOA 3KV6A 2MOWA 3FY4A 1FMVA 4EYUA 1UJKA 1E7VA 4Y6CA 3SGHA 4QWNB 5C2YA 4I1OB 4GZ5A 4XI9A 4CRWA 4EQFA 4UF0A 3JCKC 1KT1A 3O1HA 3ZCJA 4EZHA 4DI4A 4IHJE 3OTNA 5FXXA 3CX7B 3FTXA 3AU5A 4KUMB 3FDHA 5JRCB 2XCCA 4FHKA 1EF1C 3R6NA 4AY6A 2HPLA 4O2BE 3TKLB 4PFOA 4JEHB 5FYMA 3RC8A 4IRUA 4AKHA 3E4BA 1Y8MA 3IHVA 4BWRA 2X6HA 2WXPA 3E08A 1TJFA 2AVPA 3ZRHA 3RJVA 4YJ2E 3MKDA 2VWAA 4C0MA 1HG2A 2PQRA 4X20E 3EIJA 4F1SA 4U0UA 2CEAA 2MYSA 1IQUA 4QXBB 2J09A 3LYAA 3FUEA 3QC9A 2WXRA 4WBOA 3FUMA 1JWGA 3CR3A 5LGNB 4JHKA 1VDYA 4AEZC 2Y3AA 5EK2A 1SZAA 4FLHA 5L3BB 3PNTB 4ATGA 4HFGA 3CVXA 2N2NA 5JJ6A 3LDZA 4XAXB 1FMWA 2DNXA 2AXUA 3ZMUB 3U4TA 2GRLA 3ZJ2A 3MEKA 4EECA 3LK42 2WXJA 1EPUA 1XNFA 3OXLA 4MS6A 2XCBA 3I4RB 1MQSA 2CG2A 1E8WA 3RYCE 2YK0A 2OV8A 4ZS3A 1KK7A 4UI9K 4L9IA 3B7RL 3GZ1A 3TXMA 2KNDA 5BMVE 1OWLA 3LVRE 2V7IA 4I9CA 1IHGA 4K0UA 3ONKA 2Y48B 3QNKA 3EDTB 4EOZB 2BVLA 4J6IA 4GCNA 4DLQA 5E75A 1FVHA 2VJ8A 4KMCA 5CA1E 4JHJA 4AQFA 4AKIA 3QWPA 4OYJA 2QA7A 2WXNA 3FTZA 3K3NA 2KT9A 3D9MA 1ZKEA 4CXWA 5LYJE 1L5JA 2XHEA 1N54A 3MGBA 4KZ0A 1VRBA 3N9NA 2W00A 5E76A 4WNKA 1D0ZA 3AA6B 3EVYA 5EK4A 4TV3A 4KP3C 3S7FA 5LP6E 3MKRA 3ETUA 3IEGA 3HKBE 4LCTA 4Q94A 4GPKA 2KCLA 4K03A 3R84B 4AQGA 4G11A 5J2TE 4X1YE 3ANWB 5FXWA 2CFUA 4GA0A 1WRDA 2Y4UA 4GYSA 3S7DA 3I9WA 4UWLA 3MJXA 3KV9A 2V4LA 3URZA 2R5SA 5J90A 4KT6B 1D1CA 5L3CB 3CVUA 5LHHB 3LCAA 3ZJ1A 5BV1A 3FU0A 4C9BB 1B89A 1OWPA 2LSGA 1Z3YA 4UWKA 4UI9J 2CXLA 2M63A 4BJMA 1P5QA 4IE5A 3BG0B 4DO0A 3Q5MA 4XI0A 3V5UA 5CCLA 2CHZA 4N2SA 4MLKA 1LVKA 3L08A 2WM9A 4JHRA 4AKRB 4PS8A 5JH7E 1SA0E 1MIVA 2E9XD 1Z6TA 4NRHB 4HOUA 5LHGB 3RRNB 4J8DA 5JHAA 3DP7A 2L8KA 3SS1A 5CA0E 4LERA 5A1LA 4R7LA 2AXZA 3HKCE 3PUQA 4ILGA 3T5XA 4C0EA 3CVLA 3FHNA 1S94A 3FXDB 1S0PA 2W63A 4L0RA 5BV0A 3Q47B 3FU3A 5JDGA 1E1HB 4JUYA 2LE8A 4RG9A 3S4UA 4FULA 4KYOB 1UN9A 3TAXA 3O9XA 5AFUL 4L5GA 4B8CB 2X9HA 2W61A 3LJ3A 4G1TA 5JREA 4YJ3E 1N52A 1MNDA 3L13A 2Y8DA 5DJQC 2ODUA 1E8XA 1FCHA 2HYZA 4JZYA 2FEZA 5FXVA 5L3DB 3DPDA 3GMIA 4JA7A 1G73A 4ADZA 5EK3A 1WM5A 2NXPA 4G24A 3G2WA 4EBAG 3G2TA 4L2LA 3CQGB 4GZDA 4KZCA 1BR0A 3E0ZA 3RPUA 3AA0B 3EUHA 5KJNA 5LCWJ 3F31A 5FXZA 4FADA 2I1JA 2NW8A 4ZHQE 2WXIA 3HYMB 4JVSA 3IBEA 4P09A 3APDA 4MHCA 2EHOB 1ZHCA 5HYAA 3H3AA 3Q5XA 2PZIA 3FUFA 5LXTE 3ZYKA 3ZMZB 2UY1B 1Y64B 1H2TC 3MXZA 3N9PA 4XIFA 3CWZB 3RRWA 3Q4AB 4I2WA 4Y6WA 3TG4A 5JRCA 4AM9A 4MRUA 2I9CA 3CGHA 1LKXA 5LCYA 2VK9A 4JEHA 4HOSA 4YHJA 2ZM2A 2X6JA 4AJWA 2XHEB 3LBXB 3P7IA 5LNKA 3CHRA 3NRYA 3U9WA 1VOMA 2GRMA 3QKYA 3GWHA 1YKHB 4IGUA 2OVFA 2GW1A 1IZNB 4KBQA 3IV0A 5JJ7A 2KCVA 4UI9C 2MTQA 1BR4A 2LEHA 3O4ZA 2L9QA 1HG5A 4P0AA 2XPIA 4U04A 2D0UA 3ZXSA 4ASKA 2VSNA 5ETWA 5G2NA 5L3GB 3ZYMA 4UWFA 4FC8A 4DBRA 3ZFWA 1E8ZA 4GIWA 2VGXB 4ZI3C 4A56A 3ASFA 5ARGA 2OVBA 2IOSA 2BVMA 4HORA 3QC1A 1SQMA 4WNEA 4AY5A 2HO1A 1Y6IA 3BQIA 4UV8B 3UUXB 1NZNA 3RK6A 4X1KE 2EHOC 2KWIB 3BEEA 3IBPA 1ELKA 4WWNA 4H9OC 1SHZC 4CGWA 3J9X1 3AVSA 3FTWA 5H6RB 5AIJA 3GYZA 4N3BA 3M65A 4KBMB 5JR9B 2WXGA 2BF0X 3C64A 5HI7A 2WMNA 4OFZA 4D10C 2UXNB 3CX8B 2QFCA 4V1Av 2I2OA 2NC9A 5LOZA 4HKAA 2V7LA 5KJLA 4ISTA 1DNPA 2XAGB 1IAPA 3U66A 4O2AE 2QY7A 2L9BA 4CDNA 2AXVA 5EZYE 5JDMA 3GW4A 3D9KA 3MV3B 5M4YA 1IYGA 3MZKB 4H9QC 1HS7A 2WWUA 2D0TA 4WNFA 4J8FA 1H0AA 3QOUA 5LCWC 1WLXA 3D9OA 3AA7B 3I9YA 5LJNA 3CVPA 4AKGA 4CXYA 2PQNA 3PE4A 4B0ZA 4G26A 3ANWA 2LSYA 3Q2MA 4F7AA 1YKEB 3N71A 4PS3A 4OHFA 4F6RC 5ADXL 3C98B 2E9XA 2NW9A 3GZ2A 4EBAA 3KBTA 4GA2A 1UX5A 1OWMA 3UPVA 1HU3A 2IOLA 3HKEE 2VYIA 3ETVA 4PDXA 3NZQA 2I1KA 2XPZA 2LSVA 1EZ3A 5T3RA 3EHMA 2A2FX 1V9DA 4RSYA 4IE6A 5JR9C 2RA1A 2C0MA 2RD0A 4GK0E 1OWOA 2GK9A 2IC6A 4I1MA 3VLFA 4A3VA 4KVOA 4WNGA 2VTBA 4C90A 2P58C 2N9DA 4TUUA 3AS4A 4U0ZA 3CX6B 4N3AA 2W0GA 3ZHEB 3NZUA 1O3XA 2PFVA 5F8PA 4GYWA 2WXQA 4UVAB 5EX3A 2KC7A 2CWYA 3FTUA 1SZ9A 3CKCA 4FLBA 3ZMSB 3FEXA 4A1GA 3MK7C 3PDYA 3OYXA 2WMOA 3PVLA 2EQXA 2WB2A 3LK3B 1IJ6A 3WAKA 3L6AA 1TJCA 2KM4A 2HM8A 2JMHA 4BX8A 3KDSE 4HOTA 4DNDA 3FHEA 4E6HA 3EDVA 4E7SA 1WR6A 3U3IA 3MV2B 3OYZA 2K9AA 4EAHA 3JQ1A 4BTBA 4EPZA 3ZPOA 5F3JA 2R59A 5HAXA 3OBVE 4J8SA 1UG3A 3N2GE 2X9WA 3N2KE 3CHMA 4ERRA 3KV5A 3Q5WA 4XZCA 4F3VA 4EB6E 2PBIA 3AAIA 3AS8A 3PZDA 3HL6A 4WBNE 4PK5A 4DPRA 5HXSA 4M1PA 3O48A 4GA1A 3KVBA 1HTJF 4YVOA 2QGSA 1Z0PA 5IHYA 2VKJA 5ANRA 4UWHA 3R7QA 2IW5B 2LNIA 3L54A 2LHNA 4QX7B 3RH3A 2YQ8A 5H6QB 1OUVA 2Q7FA 4G63A 2H7VC 3LY9A 3ONLA 1OWNA 2EHOA 1ELRA 2XAHB 4ANVA 4ANJA 3MZLB 4UV9B 3ZGQA 3CK8A 2UY1A 2ODVA 4PJJA 5CMYA 2C0SA 4GYRA 5G05J 2DI4A 4GMJA 3CSTA 5J08A 4AXPA 1UW4B 1AJ3A 4BSXA 5DQVA 4DK5A 4CZZB 2ZM0A 2ILRA 4EXTA 4ISSA 3LBXA 3SRZA 3C4WA 1A17A 4GYYA 4AV7A 3CVNA 1HCIA 3ML8A 4B8AA 4H9SE 2C5IT 5HXRA 3R7RA 5EX0A 3PUAA 4XBFB 2WQHA 2ACXA 1ZU2A 4FU3A 3K3QC 3S2AA 3SD5A 2YHEA 3UUMA 1E90A 2WXOA 4EYYR 5LFAA 5FQ7A 2XAFB 5BW8C 4TV9E 4XKCA 3VLEA 2I59A 4ZOLE 2XGOA 2IU1A 3WXXA 3R9AB 1BR2A 5E0OA 4V3IA 2E9XB 3H37A 5JDLA 4U72A 3PNLB 5A6CA 2L6JA 2VGXA 3QK0A 4RVBA 4TUYE 5HWYA 5FY0A 3MACA 3UMVA 3DJBA 1FIOA 3E22E 3Q15A 2FF4A 3UUXA 3WAJA 2V7JA 4C91A 2LSUA 1PY1A 2X9XA 1HO8A 3G2SA 4KXKB 2VTBB 2VKOA 3RYFE 4K0RA 3PE3A 3SBSA 3I5PA 3T8MA 1WYCA 4I43B 4AP2A 3LY8A 1IJ5A 1IQRA 1Z3XA 1MMNA 5JR9A 2V1DB 3FTSA 2WVIA 2DBAA 3AB3B 3C51A 3JYSA 4A1SA 2YHCA 3SFZA 5D0QD 3FUJA 3KINB 3JC6D 3QWWA 4HVBA 4O4IE 5ENNA 2DCPA 2L0IA 3N9MA 3HIZA 1BPOA 2XGMA 3SHFA 3LEWA 4WUYA 4CI3B 5GONE 4JXTA 4BAYB 3DTOA 4P29A 2WBLA 1ZBPA 4CCAA 3ZEFB 2KXPB 1U5PA 2J08A 3KFWX 5JQGE 2IF4A 3AS5A 3FWVA 2VL8A 5JVDE 2LSIA 4FJZA 4LEUA 2E9XC 3JC6C 4GMLA 3ASGA 4O4HE 2PM7A 1GW6A 3PURA 2DLRA 2J4BA 5M72A 5KJKA 4J2CA 3QWVA 2LSJA 4KMOA 1G8XA 3C98A 4N78D 4QX8B 3KS2A 2HPJA 4PH4B 5G05C 3CK9A 1HH8A 3ZC1A 3HVEB 4QHOA 3UX4A 2FI7A 5J2UE 3SF4A 3ZN0B 3I0OA 4YFSA 3TJPA 4G23A 4PFPA 3NQPA 4O4LE 4GU5A 1MMDA 3L22A 3OXFA 1E7UA 1OXZA 4EIWA 3FP3A 2LO6A 4QXHB 2VB6A 2IC9A 4BT9A 2YU2A 3VTYA 3ZVVA 4DJAA 3UT5E 3O1IA 3APCA 1UCUA 3G2VA 3ZMTB 3FUIA 3ZHEA 3KEZA 2ES0A 3U64A 1HXIA 2CLYB 5KDMC 3EHNA 2GGFA 1KNZA 1MHQA 5BT1A 2CXFA 2MHKA 3CVVA 3VLDA 3Q9DA 4IE0A 3RC3A 4WWPA 3PU3A 2FO7A 4O6FA 1KT0A 5KJMA 2XAQB 2WXLA 2X6IA 4CDMA 3CKBA 5L3FB 4FI5A 4U8HA 2K5BB 2YEVC 3B57A 4H9PC 3UQ3A 5HQ8A 3GZSA 2V0PA 3UT7A 4MALA 5JDHA 3ZC0A 2WXMA 2LOSA 2J07A 2X3MA 3U3WA 3NRXA 4CGVA 2WXKA 1H2VC 3A5XA 3JUIA 5CMWA 2X68A 2E0IA 2X0LB 2PG8A 4ANUA 4KVMA 3EJNA 4I9EA 4X1IE 1B7TA 5FY7A 2KMFA 1EYHA 5G04J 3SI5A 3PRZA 1INZA 4L1BA 2Z6EA 1W3BA 3FXEB 4ILUA 2J49A 2Q9QB 3LK2B 3OKQA 3TXNA 3MCXA 1MMGA 3OXGA 2CLYC 4HEAA 3ZLIA 4TRQA 5JDFA 4ZS2A 3RYHE 3N2OA 4XX5A 5FZSA 4GB9A 2DWKA 2R17C 2WQ6A 3VKGA 4MKTA 2YU1A 5FY1A 2JEKA 2IAKA 3UTKA 4PAGA 4A55A 2KZTB 2CE7A 2FULA 4UQZA 3PE0A 3T8OA 4GK5E 5DBKA 3BQLA 3ZCIA 3ZPJA 3K9IA 4QXCB 2WXFA 4A3TA 3RO3A 5FJYA 4JPSA 4EZLA 3L3PA 1MMAA 2XQ0A 4WNDA 4PJLA 3VTXA 2C0LA 3LJCA 5HXCA 1JUQA 2AW6A 3P2BA 4QFVA 2Q9QD 4WW0A 4BX9A 3HR0A 5BNWA 4YNDA 4HXIA 2Y4TA 4TZ4C 4FP7A 1H6KA 1NAFA 3HDXA 5ANLA 2XPYA 4JW1A 2VKHA 2PM6A 2XEVA 1UX4A 5HXEA 5FQ6A 3T5VA 4JLEA 1U4QA 4GYOA 4XE0A 1TEZA 5FWQA 3L16A 1LF8A 2CM0A 2V7KA 3IHYA 5FTPA 4HFVA 4JC8A 4BJNA 3U78A 2HR2A 2Q9QC 2IFUA 3IF8B 3APFA 4N2QA 2BDEA 3N9LA 4DLOA 3I1AA 3I3NA 5CHEE 1H2UA 2KATA 4CQIA 5AJDA 2V7MA 5C1DA 4G2VA 1XGWA 3BK9A 2M67A 4I43A 4DMWA 5LP0A 5BPPA 3CQCB 3FTVA 2H7OA 3C4XA 4ILIA 4AVXA 4DI3A 2BUGA 1WAO1 4IULA 4TN7B 3QDNA 2YINA 2J4DA 4HN9A 2NSZA 1CUNA 2NTXA 2X66A 4APOA 2DCFA 4O8SA 5TAOA 1QQEA 5AYWD 2CHXA 5CCMA 3PEVB 4F53A 1D0YA 5LGUB 3MA9A 2IQCA 3N5LA 2H3RA 4UVBB 3BQKA 1NP7A 2IONA 4P0BA 2J9QA 3KVAA 4NUUA 2V5FA 4I6GA 3ZEFA 4UELA 1T98A 5G04C 2WAUA 1H19A 1BR1A 1HFAA 3ONXA 2AWIA 4WAFA 2B1EA 4GOUA 4OVUA 2C2LA 3HI2A 4OYKA 3PDNA 4LRZA 3PTRB 3FU6A 3FU5A 1X5BA 3CKDA 1S35A 4U07A 2SPCA 4CXXA 3ZIMA 2MBGA 4HS2A 3HVEA 3SZ7A 4YVQC 2K48A 2CCQA 4TX5A 1E96B 5FP3A 3DBSA 4I2ZA 2LAIA 2RP4A 1NWMX 5DQWA 4FHJA 4ACLA 4NQ0A 4E85A 4N5CA 5HXHA 5FT9A 2NWBA 4UVCB 4MLPA 1MNEA 2K24A 2XASB 5FQ4A 5FZQA 3GN5B 4Q96A 2X9YA 3CV0A 4URKA 3CK7A 1ZV4X 3JQ0A 4N39A 4B94A 2XAJB 4GZ6A 5FNVE 4ANXA 3FH7A 2VQ2A 4AI6A 3LS8A 4PJMA 3FBLA 4GCOA 2DWGA 1HF8A 5T8IA 2ONDA 3UT4A 2A3DA 2NP9A 4HOQA 5JDNA 4U74A 4M3OA 4ACKA 2L0TB 3RIBA 2WPVA 4H7YA 4H9NC 2YNQA 3TL5A 3UFEA 2RG8A 2LOPA 3RKVA 4I50E 3SNXA 4J0UA 4CI2B 3UUNA 2LT3A 3RO2A 4UQXA 4HGAA 3LY7A 2VSYA 3CIAA 2XUEA 3SBTB 1QUUA 2UWJG 3FUHA 2X67A 3FBZA 2E8IA 3Q49B 3ESKA 4AOFA 2ZLYA 1WY6A 3MX3A 3GA8A 2E2EA 3PUJA 2KINB 1U3CA 4MBQA 5KX5E 4JEUA 1UN8A 4JA9A 2LJLA 1ZEEA 4OYSA 5KMGP 2NTYA 2FBNA 4NURA 3FEYA 4UQYA 3CHQA 1LRZA 3QUJA 4ABNA 4HTEA 3PUSA 4UXNB 5AJLA 2CWOA 1H7CA 4IE7A 3S7JA 3MKQB 3QK6A 3AA1B 3LXUX 4L7TA 5LHIB 2Q9QA 3LVQE 3ASDA 4ZI2D 3CVQA 4Q69A 2V26A 3RRCA 3CVWA 5L3EB 5JDQA 1ELWA 3CSFA 5A7DB 4IYPA 5A23A 3L17A 3PUKA 3K8PC 2A4ZA 3RX6A 1HZ4A 3VHLA 3EIQC 4H63V 4UF0B 3MYVA 4UEMA 1NA3A 4FJOA 4YLHA 5J1GA 4I1AA 5FQ8A 4LUNU 2KZTA 2DIWA 3C4ZA 3HA4A 3KD7A 4PS7A 3CVYA 3V5SA 3FH8A 3B7UX 2XRZA 1MIWA 3UULA 4GAAA 3L09A 3CHOA 2X6FA 3D9NA 5EDSA 3ZN3A 3KAEA 4I17A 3ZYLA 2I6HA 4ZI2C 4DMVA 3FUNA 3C50A 4ILHB 2JRKA 3CPZA 2ZM8A 4H7XA 1HE8A 4BY6A 2DHRA 2XGSA 3UT8A 5EKQD 3AAEB 2X38A 4PNIA 4IN3B 4DVDA 3CEQA 4N3CA 4E7ZA 2OA5A 5LG4A 3LFMA 2PJQA 4MFRA 5HWXA 5JJTA 2ZU6B 3LG7A 4L23A 3OJAA 3B7TA 2PL2A 4PK6A 1HS6A 3AVRA 4EZ4A 3FULA 3N9OA 1YA0A 2LSKA 2C5JA 1E8YA 4XZ4A 3ML9A 1YW0A 3ZMVB 3IEEA 4AIFA 3FFLA 2VKDA 1PC2A 3IHRA 2A5UA 3NZPA 3NZSA 3LPZA 2NOXA 3P1UA 1U3DA 4BFRA 3S7BA 3D3MA 5D0OD 3QAQA 5G55A 5DIZA 4B6XA 2Y6XA 3CHPA 5IYZE 2X51A 3I4GA 3PU8A 5LBQB 3RRMB 4HLEA 4ANWA 4AKLA 4FA6A 4CT4A 2KCKA 3ESLA 5LA6E 1DVPA 2N1GA 3KV4A 3RKOA 3FTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VHL A;  2YIN A;  2WM9 A;  2WMO A;  3B13 A;  2WMN A; 
#chains in the Genus database with same CATH topology
 4AXH A;  1OWA A;  4I6E A;  4K5B A;  3SOL A;  1OED A;  4J8E A;  4BTA A;  2R02 A;  3LKU A;  1XWM A;  3CLJ A;  3AE3 A;  3G2U A;  1HX8 A;  2P9B A;  2EIK E;  2HHH T;  4CI1 B;  1UOH A;  3PH0 C;  4GPM A;  4EZJ A;  1N4P A;  4APF A;  2V6Y A;  3KBU A;  3I0Q A;  3D0T A;  4G25 A;  2D9D A;  2BTD A;  2UU9 T;  4JV5 T;  1MIY A;  4BA9 A;  5CB4 E;  3ABL E;  3FUK A;  1D0X A;  5AN8 A;  2WDR A;  2OV9 A;  4GKJ T;  2ZMA A;  3D9J A;  3ZUV B;  4ZI3 D;  2VAS A;  3B7S A;  2CHW A;  3QOF A;  1FVF A;  4X8Q A;  3RIA A;  5AEN A;  5AQ9 A;  2UXB T;  2XQY A;  5L4H A;  2H6H A;  1KEY A;  1QSD A;  5HKP A;  4PW8 A;  5J0Z A;  2CFZ A;  1XNQ T;  1JWF A;  2HH7 A;  3IKO B;  1X79 A;  4Z8X A;  3AAA B;  2WQ7 A;  5LBM A;  2G0U A;  3AG3 E;  1HX1 B;  3CML A;  4GZ3 A;  2EHO D;  5ABH A;  2LM9 A;  2CA5 A;  2XRY A;  4JEU B;  5IWA T;  3HKD E;  3ZW3 A;  4IDZ A;  3F2E A;  1XMQ T;  3W15 B;  4RG6 A;  5KCM A;  3O4X E;  3UTM A;  3EDU A;  4GTO A;  2JLB A;  3SWH A;  1KNP A;  4TV8 E;  5AQT B;  1RW2 A;  1X9B A;  4I6J A;  4L2Y A;  1LVF A;  5LJM A;  3D9I A;  5CEA A;  2UXX B;  2JPF A;  4JL0 A;  2LHR A;  5HEJ A;  4DV6 T;  1TNO A;  2ETB A;  4U7Y A;  4B89 A;  3D9P A;  3DSW A;  2ZGD A;  2QC9 A;  3AU4 A;  3TG5 A;  3RRU A;  3O1J A;  5FZR A;  3MA5 A;  1US7 B;  2XTL A;  3WI3 A;  1D1B A;  4UIG A;  1S63 A;  4X5T A;  5ENO D;  2WSS V;  4FJY A;  3PRE A;  3GN5 A;  4U63 A;  2BZB A;  2MOZ A;  4OK0 A;  3FH5 A;  1FEW A;  5T4Y A;  5FMN A;  3K3O A;  3HG0 D;  5ENP D;  4HB5 A;  3EI0 A;  4CDR A;  3PEU B;  2A72 A;  3ASO E;  3QAR A;  3NF1 A;  3BG1 B;  2CG3 A;  5L2L A;  4AQY T;  4U0S A;  3AE8 A;  4AQF C;  3TGO A;  3HHM A;  4XKB A;  4A63 B;  1EDU A;  4ME2 A;  3ZN1 B;  4ZI7 E;  4BES A;  3H3M A;  1YD8 G;  2BBH A;  3OAW A;  3CQX C;  4JD2 G;  2C5K T;  3B13 A;  3QB2 A;  4IE4 A;  4H63 H;  1O5M A;  1Y01 A;  2OOE A;  3ZYQ A;  2JJ9 A;  5LX8 A;  4UWG A;  2D5U A;  3B95 A;  2CMR A;  4PK4 A;  2LAH A;  2CXD A;  4NAC A;  2VGY A;  2W62 A;  3CHS A;  5LOV E;  5JHB A;  4F6R D;  4DBQ A;  5LGT B;  3KEA A;  4H9R C;  3LSV A;  2KWH A;  1G3N B;  4NUV A;  3VU7 H;  4ILC A;  1D1A A;  4BT8 A;  5DAB A;  4CEM A;  3NAW A;  2VSX E;  4IRE A;  3RYI E;  2WB5 A;  5HS0 A;  2L3L A;  3AG4 E;  3ULQ A;  4PJN A;  3FB2 A;  3ASH A;  2NW7 A;  1JNZ A;  2X6K A;  3VKH A;  4PUC A;  5BUZ A;  1QNF A;  3Q75 A;  4CT0 A;  5C8Y E;  3P8C D;  2KLQ A;  5ARF A;  2V8S E;  2D2S A;  4I4T E;  1PAQ A;  3OPC A;  1JPL A;  1NA0 A;  3D9L A;  3FUD A;  4GZC A;  3PUG A;  4I55 E;  2KZ7 B;  2JMK A;  4HE8 A;  4QKN A;  2UUA T;  5KBA A;  2VL0 A;  4U33 A;  1TNZ A;  1R8I A;  1WYB A;  2J1D G;  3CVR A;  2YOE A;  1KLX A;  2IJG X;  1N4S A;  1QZ2 A;  4EZK A;  2JQQ A;  2VVN A;  3J7Y q;  4OAV B;  2VSO E;  4O1P A;  3L9T A;  4DX6 D;  3ENE A;  2MRI A;  3MKQ A;  4OVV A;  3N9Q A;  4W9R A;  1UJJ A;  4G2A A;  3NBX X;  1N11 A;  3TWX A;  3MJW A;  4O4J E;  2Y0B G;  2WXH A;  2AXD S;  3PS6 A;  3F57 A;  3RU0 A;  3QJZ A;  2GRN B;  4IIJ E;  4WWO A;  5CED B;  4DR5 T;  5EYL A;  2JQK A;  1J1J A;  4HFI A;  2GRO B;  3KV6 A;  2MOW A;  4LFC T;  3FY4 A;  1FMV A;  4EYU A;  1UJK A;  1E7V A;  4Y6C A;  3SGH A;  4QWN B;  4DID B;  5C2Y A;  4I1O B;  5EN5 D;  4GZ5 A;  4XI9 A;  4CRW A;  4EQF A;  4UF0 A;  3RQU A;  3JCK C;  4DUY T;  3HXB A;  1KT1 A;  3PUX F;  3O1H A;  3ZCJ A;  4EZH A;  4DI4 A;  4IHJ E;  3OTN A;  3P4Q A;  5FXX A;  3CX7 B;  3PZ4 A;  5HEG A;  3FTX A;  3AU5 A;  4KUM B;  3FDH A;  5JRC B;  2H6I A;  4HFC A;  2XM1 A;  4NXN T;  2XCC A;  4FHK A;  1EF1 C;  3R6N A;  2CHN A;  4AY6 A;  2HPL A;  4O2B E;  3TKL B;  4PFO A;  4JEH B;  5FYM A;  3RC8 A;  4IRU A;  1MX4 A;  4AKH A;  2XQ9 A;  1N95 A;  3E4B A;  1Y8M A;  3IHV A;  4BWR A;  2X6H A;  2WXP A;  4YTM A;  4JI7 T;  3ABK E;  3E08 A;  1TJF A;  2AVP A;  3ZRH A;  2X0H A;  3RJV A;  1KF6 A;  4YJ2 E;  3MKD A;  1N34 T;  2VWA A;  2B76 A;  4YY3 T;  4C0M A;  4HFB A;  1HG2 A;  2PQR A;  3PZ2 A;  4X20 E;  3EIJ A;  2E2A A;  5BR8 T;  3AG2 E;  4F1S A;  4U0U A;  3VRB A;  2CEA A;  5AQG B;  2MYS A;  1IQU A;  4QXB B;  3L82 A;  3UFG A;  2J09 A;  3LYA A;  3FUE A;  3UU5 A;  3QC9 A;  2WXR A;  3RQW A;  4WBO A;  1X81 A;  3FUM A;  3P4R A;  1JWG A;  3CR3 A;  5LGN B;  2FUP A;  5CGM A;  3UU6 A;  4JHK A;  1VDY A;  4AEZ C;  2Y3A A;  5EK2 A;  1SZA A;  2LKH A;  5L3B B;  2OEV A;  4FLH A;  3PNT B;  2R2L A;  4ATG A;  4HFG A;  3CVX A;  2N2N A;  5JJ6 A;  3LDZ A;  4XAX B;  1IBK T;  1FMW A;  3UM0 A;  3Q78 A;  2DNX A;  2AXU A;  2DWZ A;  5H7P A;  3ZMU B;  3U4T A;  2LLY A;  2GRL A;  3ZJ2 A;  3MEK A;  4EEC A;  2P9L G;  1W09 A;  3LK4 2;  2WXJ A;  1EPU A;  1TR4 A;  1XNF A;  3OXL A;  4MS6 A;  2RFM A;  4GTM A;  2XCB A;  3I4R B;  1MQS A;  2CG2 A;  1E8W A;  3ZU7 B;  2WP9 A;  3RYC E;  1V55 E;  2YK0 A;  2OV8 A;  4ZS3 A;  1KK7 A;  4UI9 K;  4L9I A;  3Q9U C;  3B7R L;  3GZ1 A;  3TXM A;  4BEP A;  1WG0 A;  3ZT5 A;  2BKG A;  2KND A;  1AWC B;  5BMV E;  2WY2 A;  1OWL A;  3LVR E;  2V7I A;  1S70 B;  4CN1 A;  4I9C A;  1IHG A;  2XSB A;  3SFY A;  4K0U A;  3ONK A;  2Y48 B;  3QNK A;  3EDT B;  1VCS A;  1KFY A;  4EOZ B;  2XJ7 A;  2P9K G;  2XS8 A;  3DST A;  2BVL A;  4J6I A;  4GCN A;  4DLQ A;  5E75 A;  1FVH A;  2VJ8 A;  1NI1 A;  4J7W A;  4KMC A;  5CA1 E;  4JHJ A;  2GRQ B;  4DX5 D;  4AQF A;  4AKI A;  5LMU T;  3QWP A;  4OYJ A;  2QA7 A;  2WXN A;  3FTZ A;  3AEE A;  2KT9 A;  3K3N A;  3D9M A;  3JXI A;  4DX7 D;  4RQI A;  1ZKE A;  4CXW A;  5LYJ E;  1L5J A;  2XHE A;  1N54 A;  3MGB A;  4N5Q A;  4KZ0 A;  1VRB A;  2XQ8 A;  3N9N A;  2W00 A;  5AQK B;  5E76 A;  4WNK A;  1D0Z A;  3AA6 B;  3EVY A;  5EK4 A;  4TV3 A;  1T72 A;  4KP3 C;  1E7P A;  3S7F A;  2AE9 A;  5LP6 E;  3MKR A;  2VGE A;  3ETU A;  2UXC T;  3IEG A;  3HKB E;  3C3Q A;  4LCT A;  4KI0 F;  4Q94 A;  4GPK A;  2KCL A;  1W0A A;  2QVA A;  3R84 B;  4K03 A;  4AQG A;  4G11 A;  5J2T E;  4X1Y E;  3ANW B;  5FXW A;  2CFU A;  3AJI A;  4GA0 A;  2FJB A;  4GKK T;  1WRD A;  2HN2 A;  4DV1 T;  2GRR B;  2Y4U A;  4GYS A;  1KPS B;  3S7D A;  4U7I A;  2V8S V;  3I9W A;  4UWL A;  3MJX A;  5LG3 A;  3KV9 A;  3KSQ A;  2V4L A;  3URZ A;  2R5S A;  5D66 A;  5J90 A;  4YHH T;  4KT6 B;  1D1C A;  5L3C B;  1T8B A;  2YDS A;  3RAU A;  3CVU A;  5LHH B;  3LCA A;  1W9R A;  3HXC A;  3ZJ1 A;  5BV1 A;  3FU0 A;  3EAB A;  3TWQ A;  4C9B B;  3UIO C;  1B89 A;  1K3Z D;  1OWP A;  2PTF A;  2LSG A;  3SFD A;  1Z3Y A;  4UWK A;  4GTV A;  4UI9 J;  2CXL A;  2OLT A;  1E2A A;  4EHM A;  2V5Q C;  2M63 A;  4BJM A;  1P5Q A;  4X64 T;  4IE5 A;  1UGO A;  3BG0 B;  1IHB A;  4DO0 A;  3Q5M A;  4XI0 A;  4DR6 T;  3V5U A;  1J5W A;  5CCL A;  2NR4 A;  2CHZ A;  4N2S A;  4MLK A;  3NOG D;  1LVK A;  3VR9 A;  3L08 A;  2WM9 A;  4JHR A;  3PZ1 A;  4AKR B;  4HRN A;  4PS8 A;  5JH7 E;  1SA0 E;  1MIV A;  2E9X D;  2XQ6 A;  1Z6T A;  4NRH B;  4HOU A;  3V2X A;  5LHG B;  3RRN B;  4J8D A;  5JHA A;  3DP7 A;  2L8K A;  3SS1 A;  1FPP A;  5CA0 E;  4LER A;  5A1L A;  4R7L A;  4GTT A;  2AXZ A;  3HKC E;  2IY0 C;  3E33 A;  2VUR A;  3PUQ A;  3ZKR A;  4ILG A;  3T5X A;  4C0E A;  2IUB A;  3PUZ F;  1N9A A;  4DR1 T;  2K3W A;  3CVL A;  3FHN A;  3KSL A;  1S94 A;  3FXD B;  1S0P A;  2W63 A;  4L0R A;  3C72 A;  5BV0 A;  3Q47 B;  4JYA T;  3FU3 A;  2XM2 A;  5JDG A;  1E1H B;  4JUY A;  2LE8 A;  4RG9 A;  3S4U A;  4FUL A;  3TLV A;  4KYO B;  1UN9 A;  3EU9 A;  3TAX A;  4U8Y D;  3O9X A;  2P2C P;  5AFU L;  4A98 A;  4L5G A;  5ENS D;  4B8C B;  2X9H A;  3J5P A;  2W61 A;  4U2Z A;  3LJ3 A;  2XQ7 A;  2P9U G;  4G1T A;  5JRE A;  4YJ3 E;  1OCR E;  1N52 A;  2KSR A;  1MND A;  4DR4 T;  3L13 A;  2Y8D A;  5DJQ C;  4AIU A;  2AJA A;  1K8K G;  1N0R A;  2ODU A;  1SA4 A;  1E8X A;  2XEE A;  3W9F A;  2H89 A;  1FCH A;  2HYZ A;  4JZY A;  2FEZ A;  5CFB A;  5FXV A;  5L3D B;  3DPD A;  5KNH D;  3GMI A;  2BKP A;  4JA7 A;  1G73 A;  2VVS A;  4ADZ A;  5EK3 A;  1BI7 B;  1WM5 A;  2NXP A;  1BD8 A;  3G2W A;  4G24 A;  4EBA G;  3G2T A;  4L2L A;  3CQG B;  4GZD A;  4KZC A;  1BR0 A;  3E0Z A;  3RPU A;  3AA0 B;  3EUH A;  5KJN A;  5LCW J;  3F31 A;  5FXZ A;  4NIQ A;  4LF4 T;  2I1J A;  2NW8 A;  3JAF A;  4ZHQ E;  2WXI A;  3HYM B;  3ULY A;  4JVS A;  4FAD A;  1WR0 A;  3IBE A;  4P09 A;  3APD A;  2BG9 B;  4MHC A;  3RGL A;  2EHO B;  1ZHC A;  5HYA A;  2LXL A;  3NBN B;  3H3A A;  3Q5X A;  5AQQ B;  2PZI A;  3FUF A;  1K1A A;  1V54 E;  5LXT E;  3ZYK A;  2Y69 E;  3ZMZ B;  2UY1 B;  5ITZ F;  1Y64 B;  1H2T C;  3MXZ A;  3N9P A;  4QH4 A;  4XIF A;  3SFE A;  3CWZ B;  3RRW A;  3Q4A B;  4I2W A;  4Y6W A;  5JMN D;  3TG4 A;  5JRC A;  4AM9 A;  4MRU A;  4G8K A;  2I9C A;  3CGH A;  1LKX A;  1TNU A;  5LCY A;  2VK9 A;  4JEH A;  4LSZ E;  4HOS A;  4YHJ A;  2ZM2 A;  4DUI A;  3UU4 A;  2X6J A;  3SY2 A;  4AJW A;  5CJ5 A;  2XHE B;  2JQH A;  3LBX B;  4DR3 T;  4KHP T;  3P7I A;  5LNK A;  3CHR A;  3NRY A;  3K1S A;  3U9W A;  1VOM A;  2GRM A;  3QKY A;  1N0Q A;  3GWH A;  1YKH B;  3TLS A;  3TWV A;  4EV6 A;  4IGU A;  5IUX A;  2OVF A;  2J4G A;  3JXJ A;  2GW1 A;  1IZN B;  1NL4 A;  3P4S A;  3ZST A;  3IV0 A;  4KBQ A;  3X1D A;  1YCS B;  1N4Q A;  5JJ7 A;  3AG1 E;  5ENT D;  3V30 A;  2KCV A;  2A5E A;  2P9P G;  3NVO A;  4UI9 C;  2MTQ A;  4DV0 T;  1BR4 A;  3UU8 A;  4B93 B;  2LEH A;  3O4Z A;  2L9Q A;  4YDW A;  1HG5 A;  4P0A A;  2XPI A;  4U04 A;  3TWT A;  1FT2 A;  2D0U A;  4DUZ T;  3ZXS A;  4ASK A;  2VSN A;  2IEJ A;  5ETW A;  5G2N A;  5L3G B;  3ZYM A;  4UWF A;  4FC8 A;  4DBR A;  3ZFW A;  1E8Z A;  4GIW A;  2VGX B;  4ZI3 C;  1N32 T;  1RZ4 A;  4A56 A;  3ASF A;  4B3R T;  5ARG A;  2EIN E;  2OVB A;  2IOS A;  4YTP A;  2BVM A;  4DX1 A;  4HOR A;  3QC1 A;  4IDN A;  1SQM A;  4ILB A;  4WNE A;  3J5Q B;  4AY5 A;  2HO1 A;  3SQV A;  3V31 A;  1Y6I A;  3BQI A;  4UV8 B;  3ONL C;  2W4X A;  2BG9 C;  3UUX B;  1NZN A;  3RK6 A;  2MAW A;  2EHO C;  4X1K E;  2KWI B;  3BEE A;  4WZX A;  3IBP A;  1ELK A;  4WWN A;  4H9O C;  1SHZ C;  4CGW A;  3J9X 1;  3AVS A;  5AQR B;  4BER A;  3FTW A;  1BU9 A;  5H6R B;  1WCR A;  5AIJ A;  3GYZ A;  4N3B A;  3RKG A;  3FZF B;  3M65 A;  4KBM B;  5JR9 B;  2W67 A;  4NXM T;  2WXG A;  2BF0 X;  3DSV A;  3C64 A;  5HI7 A;  1QYM A;  2WMN A;  4OFZ A;  4D10 C;  2UXN B;  3CX8 B;  1D8D A;  3UM2 A;  2QFC A;  4V1A v;  2UUB T;  4QH1 A;  3LDQ B;  2I2O A;  2NC9 A;  2VQE T;  5LOZ A;  4HKA A;  2V7L A;  5KJL A;  1A5E A;  1J5E T;  4IST A;  1DNP A;  2XAG B;  1IAP A;  3U66 A;  4O2A E;  2NYJ A;  2QY7 A;  2L9B A;  4CDN A;  2J47 A;  2AXV A;  5EZY E;  5JDM A;  3GW4 A;  3D9K A;  5C2T A;  3MV3 B;  4CYM D;  5M4Y A;  3UM3 A;  4DV7 T;  1IYG A;  5HEH A;  3PUV F;  3MZK B;  4H9Q C;  1HS7 A;  3Q9N C;  3Q79 A;  2WWU A;  2D0T A;  2XQ4 A;  3DEO A;  4WNF A;  1H6P A;  4J8F A;  1H0A A;  4K0K T;  3QOU A;  5LCW C;  2VQF T;  3Q5E A;  1WLX A;  3D9O A;  3AA7 B;  3I9Y A;  5LJN A;  3CVP A;  4TXR A;  3AEG A;  4ATZ D;  4AKG A;  3EAM A;  3UQ7 A;  5AAR A;  2WCA A;  4CXY A;  2PQN A;  5ABF A;  2WDV A;  3PE4 A;  4B0Z A;  2H88 A;  4G26 A;  3ANW A;  2LSY A;  3Q2M A;  4F7A A;  3AE2 A;  1NEK A;  1YKE B;  5FL0 A;  3N71 A;  4PS3 A;  4OHF A;  4F6R C;  5ADX L;  3C98 B;  5AQH B;  5AAO A;  2E9X A;  2DZO A;  2NW9 A;  3GZ2 A;  4EBA A;  3KBT A;  4GA2 A;  1UX5 A;  1OWM A;  3UPV A;  4WYV A;  1HU3 A;  2IOL A;  3HKE E;  2VYI A;  3ETV A;  4PDX A;  3NZQ A;  1ZOY A;  2I1K A;  2XPZ A;  4U95 D;  2LSV A;  1EZ3 A;  1XDP A;  5T3R A;  3EHM A;  2A2F X;  5AQB A;  1V9D A;  4RSY A;  4IE6 A;  5JR9 C;  2RA1 A;  2C0M A;  2RD0 A;  4CZ2 D;  1AP7 A;  4GK0 E;  1OWO A;  2GK9 A;  2IC6 A;  4I1M A;  3VLF A;  4A3V A;  4KVO A;  4WNG A;  2VTB A;  4C90 A;  2BED A;  5ENR D;  4JBW F;  2P58 C;  2N9D A;  4IL9 A;  4TUU A;  3UXG A;  3AS4 A;  4LMJ A;  4U0Z A;  1KZO A;  1TN6 A;  3CX6 B;  4N3A A;  4DV4 T;  4JI0 T;  2W0G A;  3ZHE B;  3NZU A;  2BS4 A;  1O3X A;  2YKS A;  2PFV A;  1MX2 A;  5F8P A;  4GYW A;  3ZSS A;  2WXQ A;  4UVA B;  5EX3 A;  4IDO A;  4LF6 T;  2KC7 A;  2CWY A;  3FTU A;  1SZ9 A;  3CKC A;  4FLB A;  4KHZ F;  1VCT A;  2F8Y A;  4X62 T;  3ZMS B;  3FEX A;  5B1A E;  3AE6 A;  2R6G F;  4A1G A;  2RFA A;  3E30 A;  3T8K A;  3MK7 C;  3PDY A;  5CBO A;  3OYX A;  1LD7 A;  2WMO A;  3PVL A;  2EQX A;  3W9G A;  2WB2 A;  5EIB E;  3LK3 B;  1IJ6 A;  3WAK A;  4U96 D;  5AQF B;  5L47 A;  5JA4 D;  3L6A A;  1TJC A;  4DV2 T;  2KM4 A;  2HM8 A;  2JMH A;  4QH5 A;  4BX8 A;  3KDS E;  4HOT A;  4YSX A;  4DND A;  3FHE A;  4E6H A;  3T9K A;  3RIU A;  3EDV A;  4E7S A;  1WR6 A;  3U3I A;  3T1Y T;  4Z91 A;  3MV2 B;  2UUC T;  3AE9 A;  2K9A A;  3OYZ A;  4EAH A;  3JQ1 A;  4BTB A;  4EPZ A;  3ZPO A;  5F3J A;  2R59 A;  5HAX A;  4B3T T;  3OBV E;  4DV3 T;  4J8S A;  3PUW F;  4OX9 T;  1UG3 A;  3N2G E;  2X9W A;  1QBQ A;  3N2K E;  3CHM A;  4ERR A;  3KV5 A;  3Q5W A;  2WS3 A;  1Z5S C;  4XZC A;  4JB8 P;  4F3V A;  4EB6 E;  2PBI A;  4JI2 T;  3AAI A;  3AS8 A;  3PZD A;  3HL6 A;  4TNW A;  5AQS B;  5CER B;  4WBN E;  5ABE A;  4PK5 A;  4DPR A;  5HXS A;  4M1P A;  3AE5 A;  2DYR E;  3O48 A;  4GA1 A;  5AQL B;  4ZEY A;  5CBN A;  3KVB A;  2CBI A;  1HTJ F;  3FZH B;  3TWR A;  1O1T A;  4YVO A;  2QGS A;  3RHW A;  1Z0P A;  5IHY A;  2H6G A;  2VKJ A;  4HFD A;  4HNA D;  5ANR A;  4DRX E;  4COF A;  4UWH A;  5KXJ A;  3R7Q A;  2IW5 B;  2LNI A;  2V6X A;  3L54 A;  4HFH A;  1HNZ T;  2LHN A;  3DSU A;  4QX7 B;  3RH3 A;  2YQ8 A;  4LF7 T;  5H6Q B;  1OUV A;  3AE4 A;  1OCZ E;  4G63 A;  2Q7F A;  2H7V C;  3A8Y C;  3LY9 A;  3JAD A;  3ONL A;  2BG9 A;  4IL4 A;  1OWN A;  4J8Y A;  2EHO A;  3E37 A;  1ELR A;  2XAH B;  4ANV A;  4ANJ A;  4YXD A;  3MZL B;  4UV9 B;  3ZGQ A;  3CK8 A;  1H6O A;  2UY1 A;  2ODV A;  4PJJ A;  1DCQ A;  5CMY A;  2WQY A;  2C0S A;  4GYR A;  1XNR T;  5G05 J;  2DI4 A;  4GMJ A;  3VRA A;  3CST A;  1JNR A;  4DR2 T;  5J08 A;  4AXP A;  1UW4 B;  2JQ9 A;  1AJ3 A;  4BSX A;  5DQV A;  4DK5 A;  5BXO A;  4CZZ B;  2ZM0 A;  5F5W A;  2ILR A;  4UUC A;  3RLF F;  4EXT A;  4ISS A;  3LBX A;  3SRZ A;  3C4W A;  1A17 A;  5L4E A;  4GYY A;  4AV7 A;  3CVN A;  3VR8 A;  4HLL A;  1OT8 A;  2F0Y A;  1HCI A;  3ML8 A;  1W0B A;  4B8A A;  4HQD A;  2BS3 A;  2C5I T;  4H9S E;  5HXR A;  4LFA T;  4CN6 A;  3R7R A;  5EX0 A;  3PUA A;  4XBF B;  2WQH A;  5HCJ A;  2J62 A;  2ACX A;  1O1R A;  5AQP B;  1ZU2 A;  4FU3 A;  3K3Q C;  3S2A A;  3SD5 A;  2I0M A;  3UUM A;  1E90 A;  2YHE A;  2XZE A;  4GTS A;  5HEU A;  2WU2 A;  2WXO A;  4EYY R;  5LFA A;  5ABF B;  2ETC A;  4DV5 T;  5FQ7 A;  2XAF B;  5BW8 C;  4BET A;  4TV9 E;  4XKC A;  1SVX A;  4O60 A;  3VLE A;  3PUY F;  2I59 A;  4ZOL E;  2QZA A;  3HRA A;  1IBM T;  3ABM E;  2XGO A;  2IU1 A;  3WXX A;  5C3J A;  2YN6 A;  4X65 T;  3UM1 A;  3R9A B;  1BR2 A;  5E0O A;  4F8H A;  2E9X B;  4V3I A;  4HRM B;  3H37 A;  5JDL A;  4U72 A;  3PNL B;  2BKK B;  5A6C A;  2L6J A;  2VGX A;  3QK0 A;  4RVB A;  4TUY E;  5HWY A;  1JCR A;  5FY0 A;  3MAC A;  3TWU A;  3UMV A;  3DJB A;  1FIO A;  3E22 E;  3Q15 A;  2FF4 A;  2IML A;  5D2M C;  1N4R A;  2WWV A;  3UUX A;  1BLX B;  3WAJ A;  4HFE A;  4A97 A;  2V7J A;  4C91 A;  2LSU A;  1PY1 A;  4ZXL A;  2X9X A;  1HO8 A;  1O1S A;  2XZD G;  3G2S A;  4KXK B;  2VTB B;  2VKO A;  3RYF E;  3DSX A;  4K0R A;  3PE3 A;  3SBS A;  3I5P A;  3T8M A;  2ZM6 T;  1WYC A;  4I43 B;  4AP2 A;  3LY8 A;  2FJA A;  2JIW A;  1YXR A;  1IJ5 A;  1KZP A;  5LB7 B;  1IQR A;  1Z3X A;  1MMN A;  2YDR A;  5JR9 A;  2V1D B;  3FTS A;  2WVI A;  1JCQ A;  4LG6 A;  2DBA A;  3AB3 B;  3C51 A;  3JYS A;  3SFX A;  4A1S A;  2YHC A;  3SFZ A;  5D0Q D;  3FUJ A;  4Z90 A;  3KIN B;  3AEC A;  3JC6 D;  3QWW A;  3PJA J;  3ASN E;  4HVB A;  1SA5 A;  1JCS A;  4TNV A;  4LFB T;  4O4I E;  5ENN A;  2M6B A;  2DCP A;  2L0I A;  3N9M A;  3HIZ A;  4NIK A;  4YDO A;  2CBJ A;  4IDP A;  1BPO A;  1XZY A;  1CHU A;  2WZI A;  2XGM A;  3ZKJ A;  3SHF A;  2XQA A;  4HWC A;  3LEW A;  4WUY A;  4CI3 B;  4QQI A;  5GON E;  4JXT A;  3DWL G;  2WZH A;  4HBD A;  2ZGG A;  4BAY B;  3DTO A;  4P29 A;  3RI5 A;  2UXD T;  2WBL A;  1ZBP A;  3FZK B;  4CCA A;  3ZEF B;  4HWI B;  2KXP B;  1U5P A;  5AQA A;  2J08 A;  3KFW X;  5JQG E;  2IF4 A;  3AS5 A;  3FWV A;  2VL8 A;  3OVU A;  2LSI A;  5JVD E;  4FJZ A;  2XQ5 A;  2E9X C;  3JC6 C;  4GML A;  4LEU A;  3ASG A;  4O4H E;  2ZIS A;  2PM7 A;  5CEC B;  1GW6 A;  3PUR A;  3C3O A;  2DLR A;  2J4B A;  5M72 A;  5KJK A;  1QLB A;  4J2C A;  2LRL A;  2EIM E;  3QWV A;  4YDY A;  2LSJ A;  4KMO A;  1G8X A;  2XS1 A;  2LUH A;  2E5L T;  3HXD A;  5JTG A;  5FIO A;  3C98 A;  2R03 A;  3ISM C;  4N78 D;  4JI4 T;  4QX8 B;  3TLW A;  3KS2 A;  2WDQ A;  3DXK G;  2HPJ A;  3B7B A;  4PH4 B;  3CK9 A;  1K1B A;  1HH8 A;  5G05 C;  3L39 A;  3ZC1 A;  3HVE B;  4QHO A;  2GRP B;  4Q25 A;  3Q73 A;  3QB5 A;  2FI7 A;  5J2U E;  3HXE A;  2BBJ A;  2BS2 A;  4TXP A;  3SF4 A;  3ZN0 B;  3UX4 A;  2DVW A;  3I0O A;  2DYS E;  2X0Y A;  4YFS A;  4B3M T;  3TJP A;  4G23 A;  2F8X K;  4PFP A;  3NQP A;  4O1O A;  4O4L E;  4GU5 A;  1MMD A;  3L22 A;  3OXF A;  2R05 A;  1E7U A;  1OXZ A;  4EIW A;  3B5M A;  2XEN A;  5AQU B;  3FP3 A;  2LO6 A;  4QXH B;  2VB6 A;  2IC9 A;  4BT9 A;  2YU2 A;  3QB5 K;  3VTY A;  3ZVV A;  4DJA A;  2RPA A;  3UT5 E;  3O1I A;  4YSZ A;  1UCU A;  3APC A;  3G2V A;  3ZMT B;  4XEI G;  3ZXP A;  3FUI A;  3ZHE A;  3KEZ A;  4EGW A;  2ES0 A;  3U64 A;  1HXI A;  2CLY B;  4U31 A;  3F6Q A;  5KDM C;  3EHN A;  2GGF A;  1KNZ A;  1MHQ A;  5BT1 A;  2CXF A;  2MHK A;  3CVV A;  1YYH A;  3VLD A;  2E5V A;  3Q9D A;  4IE0 A;  3RC3 A;  4WWP A;  5FVL A;  2KXP C;  3PU3 A;  2FO7 A;  4O6F A;  1KT0 A;  5KJM A;  3RIU C;  2XAQ B;  2XQ3 A;  2WXL A;  2X6I A;  4CDM A;  4U3C A;  5FKY A;  1ZB1 A;  3CKB A;  5L3F B;  4FI5 A;  4U8H A;  2K5B B;  3AEB A;  2YEV C;  1OCC E;  3EU5 A;  1DC2 A;  3B57 A;  4H9P C;  2XZT G;  3UQ3 A;  5HQ8 A;  1OCO E;  1I94 T;  2V0P A;  3GZS A;  3UT7 A;  4MAL A;  5JDH A;  2DL1 A;  5ABG A;  3AXJ B;  3ZC0 A;  2WXM A;  3AE1 A;  2ZXW E;  2LOS A;  2J07 A;  2X3M A;  3U3W A;  5KNG A;  3NRX A;  2HE0 A;  4CGV A;  2WXK A;  1H2V C;  3A5X A;  3TLT A;  3JUI A;  3QNU A;  5CMW A;  2X68 A;  1Q2Z A;  2E0I A;  3ULE G;  2X0L B;  1YQ3 A;  2PG8 A;  4ANU A;  4KVM A;  3EJN A;  4I9E A;  4RLY A;  3T1H T;  4Z68 A;  4X1I E;  3EHR A;  1B7T A;  5FY7 A;  3Q7F A;  2KMF A;  5HRY A;  1EYH A;  5G04 J;  3ONJ A;  3SI5 A;  3PRZ A;  2XEH A;  4L1B A;  1INZ A;  2Z6E A;  1W3B A;  3FXE B;  4ILU A;  2J49 A;  2Q9Q B;  3LK2 B;  3OKQ A;  4EED A;  4AIS A;  5EIL A;  3TXN A;  1NFI E;  2OCC E;  3NOC D;  3MCX A;  1MMG A;  2J8S D;  2FJE A;  3OXG A;  2CLY C;  4HEA A;  3ZLI A;  1MYO A;  4TRQ A;  1HR0 T;  5JDF A;  4ZS2 A;  3AEF A;  3RYH E;  3N2O A;  4XX5 A;  5FZS A;  4GB9 A;  4MBG A;  2DWK A;  2R17 C;  4C48 B;  2WQ6 A;  3DXM G;  3VKG A;  3PZ3 A;  4ZFH A;  4MKT A;  2YU1 A;  5FY1 A;  2JEK A;  2IAK A;  1WFD A;  3UTK A;  4PAG A;  2OEW A;  4A55 A;  2KZT B;  2YDQ A;  2CE7 A;  2FUL A;  4UQZ A;  3PE0 A;  3T8O A;  4GK5 E;  2FO1 E;  5DBK A;  3BQL A;  3ZCI A;  3ZPJ A;  1UUR A;  3K9I A;  3V79 K;  4B3S T;  4QXC B;  1M7K A;  1D9S A;  2WXF A;  1N94 A;  3UIN C;  4A3T A;  3RO3 A;  5FJY A;  4JPS A;  4EZL A;  3L3P A;  1MMA A;  2XQ0 A;  5FL1 A;  4NPP A;  4PJL A;  4WND A;  3VTX A;  2C0L A;  3LJC A;  1OXJ A;  5HXC A;  1JUQ A;  3P4P A;  2AW6 A;  3P2B A;  4QFV A;  2Q9Q D;  4WW0 A;  1TYQ G;  2JAB A;  4CN4 A;  4BX9 A;  3HR0 A;  5BNW A;  4YND A;  4HXI A;  2Y4T A;  4TZ4 C;  3AAA C;  4FP7 A;  1MJ0 A;  4TXQ A;  1H6K A;  1MZC A;  1NAF A;  3HDX A;  5ANL A;  2XPY A;  4JW1 A;  2VKH A;  4YTN A;  2PM6 A;  1L0V A;  2XEV A;  1UX4 A;  5HXE A;  4X66 T;  2LXM A;  5FQ6 A;  1UUS A;  3T5V A;  4JLE A;  1U4Q A;  2WU5 A;  4GYO A;  3DPY A;  3ZT7 A;  3EUV A;  4XE0 A;  1TEZ A;  5FWQ A;  4LML A;  4ZZC A;  2ACZ A;  2CM0 A;  2V7K A;  1LF8 A;  3IHY A;  3L16 A;  4P1N A;  4LNG A;  5FTP A;  2QRX A;  4HFV A;  5KWD A;  1XDO A;  3AEA A;  2HN1 A;  4JC8 A;  3D9H A;  3P4W A;  3UIP C;  2EIL E;  4BJN A;  3U78 A;  1T7S A;  2HR2 A;  2P9N G;  5AQM B;  1YMP A;  4BSZ B;  5B1B E;  2Q9Q C;  3RF1 A;  2IFU A;  3IF8 B;  3Q5D A;  3APF A;  3C5R A;  4L9P A;  4HI9 A;  2BDE A;  4N2Q A;  3IA3 A;  3N9L A;  3I1A A;  4DLO A;  2KBX A;  3I3N A;  5CHE E;  1H2U A;  2KAT A;  2LM2 A;  2BG9 E;  4CQI A;  5AJD A;  4I0U A;  2V7M A;  5C1D A;  4G2V A;  2BKN A;  2ETA A;  1XGW A;  3BK9 A;  2M67 A;  4I43 A;  4DMW A;  5LP0 A;  5BPP A;  3CQC B;  4GTR A;  3FTV A;  4HWH A;  3UQ4 A;  4LF8 T;  2H7O A;  1BI8 B;  3C4X A;  3G06 A;  4ILI A;  3UKU G;  4AVX A;  4DI3 A;  2BUG A;  1WAO 1;  4IUL A;  2CRB A;  3JAE A;  1LD8 A;  4TN7 B;  3QDN A;  2YIN A;  4IT4 A;  2H6F A;  2J4D A;  4HN9 A;  2NSZ A;  1CUN A;  2NTX A;  2X66 A;  4APO A;  2DCF A;  1OED B;  4O8S A;  5TAO A;  1IXV A;  1QQE A;  2CHX A;  3BQO A;  3EHQ A;  3PEV B;  5AYW D;  4F53 A;  5CCM A;  1D0Y A;  5LGU B;  5AQV B;  3MA9 A;  2IQC A;  3N5L A;  3CK6 A;  4TWD A;  2H3R A;  4K5A B;  2V6Y B;  4UVB B;  3BQK A;  1NP7 A;  2ION A;  4P0B A;  2J9Q A;  3KVA A;  4NUU A;  2V5F A;  4I6G A;  2CPT A;  3TLU A;  3ZEF A;  2IO3 C;  4UEL A;  1T98 A;  5G04 C;  2WAU A;  1H19 A;  1BR1 A;  1HFA A;  4JI1 T;  4HWF A;  4TWF A;  3ONX A;  5HEO A;  2AWI A;  4WAF A;  4ZHB A;  4K5C A;  2B1E A;  3RSE G;  2V5C A;  4GOU A;  4OVU A;  2RKK A;  2C2L A;  3HI2 A;  4OYK A;  3PDN A;  4LRZ A;  1TNB A;  3PTR B;  3FU6 A;  3FU5 A;  1X5B A;  3WG7 E;  3DSS A;  3BUA A;  4F1P A;  1DCE A;  3CKD A;  1S35 A;  4UR9 A;  4U07 A;  2SPC A;  4LMK A;  5AQJ B;  4CXX A;  3ZIM A;  2MBG A;  2BKO A;  4M7C A;  4HS2 A;  5EYP F;  2P9I G;  3HVE A;  3SZ7 A;  3NB2 A;  4YVQ C;  2IDO B;  1SE7 A;  2K48 A;  2CCQ A;  4TX5 A;  1E96 B;  5FP3 A;  4JI3 T;  3DBS A;  1TN7 A;  4I2Z A;  1IBL T;  4TUM A;  2W2U A;  2LAI A;  1I6Z A;  3SO8 A;  2RP4 A;  1NWM X;  5DQW A;  4TWH A;  3PJA A;  4FHJ A;  4ACL A;  4NQ0 A;  4E85 A;  4N5C A;  1M62 A;  2W66 A;  5HXH A;  5FT9 A;  2XSA A;  3A7M A;  2NWB A;  4UVC B;  4MLP A;  1MNE A;  2K24 A;  2XAS B;  5IY5 E;  5FQ4 A;  5FZQ A;  2CHO A;  3AE7 A;  3GN5 B;  4Q96 A;  2X9Y A;  5AQ7 A;  3CV0 A;  4URK A;  3CK7 A;  1ZV4 X;  4JI5 T;  3JQ0 A;  5B3S E;  4N39 A;  4B94 A;  2XAJ B;  3P50 A;  4GZ6 A;  5FNV E;  4ANX A;  2MYO A;  1WDY A;  3FH7 A;  1OED C;  2VQ2 A;  4AI6 A;  3LS8 A;  3C3R A;  5AQN B;  4PJM A;  1SUM B;  3FBL A;  4GCO A;  2DWG A;  1HF8 A;  3UI2 A;  2M6I A;  5T8I A;  2OND A;  3UT4 A;  3ABV A;  3HXF A;  2A3D A;  2NP9 A;  3NKZ A;  1FJG T;  4HOQ A;  1N33 T;  5HCM A;  4KX6 A;  4U74 A;  5JDN A;  4M3O A;  4ACK A;  2L0T B;  3RIB A;  2WPV A;  4OAU C;  4H7Y A;  4H9N C;  5CRV A;  4JI6 T;  2YNQ A;  3TL5 A;  3UFE A;  2RG8 A;  2F37 A;  3AED A;  2L6B A;  2LOP A;  3RKV A;  4I50 E;  3SNX A;  3M3Z B;  4J0U A;  4CI2 B;  3UUN A;  2LT3 A;  4LNB A;  3RO2 A;  1N36 T;  4UQX A;  4HGA A;  2Y1L E;  5ENQ D;  3LY7 A;  2VSY A;  3UU3 A;  3CIA A;  2XUE A;  3SBT B;  1QUU A;  3OTO T;  2UWJ G;  3FUH A;  2X67 A;  1DU2 A;  3FBZ A;  2E8I A;  3Q49 B;  4HI8 A;  3ESK A;  5AQI B;  2FJD A;  3AXJ A;  4AOF A;  2ZLY A;  1WY6 A;  3MX3 A;  3GA8 A;  2E2E A;  3PUJ A;  2KIN B;  4YSY A;  1U3C A;  4MBQ A;  5KX5 E;  4JEU A;  1UN8 A;  4JA9 A;  2LJL A;  1ZEE A;  4OYS A;  3V2O A;  4EEB A;  5KMG P;  2NTY A;  2FBN A;  4NUR A;  3FEY A;  2IO2 C;  4UQY A;  1SW6 A;  3CHQ A;  1LRZ A;  3QUJ A;  2V4H C;  4ABN A;  4HTE A;  3PUS A;  4ZZB A;  4UXN B;  5AJL A;  2PNN A;  2LRK A;  2CWO A;  3X2Q E;  1H7C A;  4IE7 A;  2P9S G;  3S7J A;  3MKQ B;  3QK6 A;  4ILA A;  3JUE A;  3AA1 B;  4U8V D;  1Z8U A;  4JI8 T;  4LF5 T;  1OY3 D;  3LXU X;  4L7T A;  5LHI B;  2Q9Q A;  3LVQ E;  3ASD A;  4ZI2 D;  3CVQ A;  4Q69 A;  1KNR A;  2V26 A;  4LNU D;  3RRC A;  3CVW A;  5L3E B;  5JDQ A;  1ELW A;  3CSF A;  4YDE A;  5A7D B;  4IYP A;  5A23 A;  3L17 A;  3PUK A;  5EID A;  5FVK A;  3K8P C;  2A4Z A;  3RX6 A;  1HZ4 A;  1TNY A;  3VHL A;  3EIQ C;  4H63 V;  4UF0 B;  2XY8 B;  3MYV A;  4UEM A;  5CRU A;  1NA3 A;  4FJO A;  4YLH A;  5J1G A;  2QYW A;  4I1A A;  5FQ8 A;  5AQO B;  4LUN U;  1OED E;  2A9U A;  3PV0 F;  2KZT A;  2DIW A;  3C4Z A;  3HA4 A;  3KD7 A;  4PS7 A;  3CVY A;  1YQ4 A;  3ZNG A;  2V5D A;  3V5S A;  1HNX T;  3FH8 A;  3B7U X;  2XRZ A;  1MIW A;  2MPK A;  3UUL A;  4GAA A;  3L09 A;  3CHO A;  2X6F A;  1UK5 A;  3D9N A;  5EDS A;  4U7E B;  3ZT6 A;  3ZN3 A;  3KAE A;  4I17 A;  5FIN A;  3ZYL A;  2EIJ E;  2I6H A;  3R9M A;  4ZI2 C;  4DMV A;  3FUN A;  3C50 A;  3IXE A;  3Q7A A;  4ILH B;  2JRK A;  3CPZ A;  2ZM8 A;  4H7X A;  1HE8 A;  1NEN A;  4BY6 A;  1LTX A;  2DHR A;  2IIU A;  4A5X A;  3L8R A;  2XGS A;  1S64 A;  3E32 A;  4LF9 T;  3UT8 A;  2F4V T;  1FT1 A;  4GTQ A;  5EKQ D;  3CIR A;  3AAE B;  4G8L A;  2X38 A;  4PNI A;  4IN3 B;  2QYJ A;  4DVD A;  2FBW A;  3CEQ A;  3FZM B;  2ZIR A;  4N3C A;  3E34 A;  1HNW T;  4GMR A;  4E7Z A;  3DRA A;  1IKN D;  3BU8 A;  2OA5 A;  3DEP A;  5LG4 A;  1ZP0 A;  3LFM A;  2PJQ A;  4MFR A;  4GTP A;  1MX6 A;  5HWX A;  1TN8 A;  5JJT A;  2ZU6 B;  3LG7 A;  4L23 A;  3OJA A;  3B7T A;  2PL2 A;  3LJN A;  4IDQ A;  4PK6 A;  1HS6 A;  3AVR A;  4EZ4 A;  3FUL A;  3N9O A;  1YA0 A;  2IHR 1;  2LSK A;  2C5J A;  1E8Y A;  3TWW A;  4XZ4 A;  3ML9 A;  3NWI A;  1GQE A;  1YW0 A;  3ZMV B;  4U2Y A;  3IEE A;  4AIF A;  3FZL B;  2B0O E;  1XMO T;  3FFL A;  2VKD A;  1U2V G;  1PC2 A;  1D8E A;  3IHR A;  3TWS A;  2XPK A;  2A5U A;  3NZP A;  3NZS A;  3LPZ A;  2NOX A;  3P1U A;  1U3D A;  3UUB A;  4BFR A;  3S7B A;  3D3M A;  5D0O D;  3RIF A;  3EHZ A;  3QAQ A;  5G55 A;  5DIZ A;  4DX2 A;  2LKG A;  2QYU A;  2B6C A;  4B6X A;  5LMN T;  2Y6X A;  3CHP A;  5IYZ E;  2X51 A;  3I4G A;  4HRL A;  3PU8 A;  5LBQ B;  3RRM B;  4HLE A;  3JCF A;  4ANW A;  4AKL A;  4HWD A;  4YT0 A;  2DZN A;  4FA6 A;  4CT4 A;  4DR7 T;  2KCK A;  3ESL A;  5LA6 E;  1DVP A;  2N1G A;  3KV4 A;  3RKO A;  5BXU A;  3UKR G;  3FTY A; 
#chains in the Genus database with same CATH homology
 4AXH A;  1OWA A;  4I6E A;  3SOL A;  4J8E A;  4BTA A;  3LKU A;  3CLJ A;  3G2U A;  1HX8 A;  2P9B A;  4CI1 B;  3PH0 C;  4EZJ A;  4APF A;  3KBU A;  3I0Q A;  3D0T A;  4G25 A;  2BTD A;  1MIY A;  4BA9 A;  5CB4 E;  3FUK A;  1D0X A;  2ZMA A;  3D9J A;  4ZI3 D;  2VAS A;  3B7S A;  2CHW A;  1FVF A;  5AEN A;  2XQY A;  1QSD A;  4PW8 A;  2CFZ A;  1JWF A;  2HH7 A;  3IKO B;  1X79 A;  4Z8X A;  3AAA B;  2WQ7 A;  5LBM A;  2G0U A;  3CML A;  4GZ3 A;  2EHO D;  2LM9 A;  2CA5 A;  2XRY A;  4JEU B;  3HKD E;  3ZW3 A;  4IDZ A;  3F2E A;  3W15 B;  4RG6 A;  5KCM A;  3O4X E;  3EDU A;  2JLB A;  3SWH A;  4TV8 E;  4I6J A;  4L2Y A;  1LVF A;  5LJM A;  3D9I A;  2UXX B;  2JPF A;  4JL0 A;  2LHR A;  4B89 A;  3D9P A;  3AU4 A;  3TG5 A;  3RRU A;  3O1J A;  5FZR A;  3MA5 A;  1US7 B;  2XTL A;  3WI3 A;  1D1B A;  4UIG A;  2WSS V;  4FJY A;  3PRE A;  3GN5 A;  4U63 A;  2BZB A;  2MOZ A;  4OK0 A;  3FH5 A;  1FEW A;  5T4Y A;  5FMN A;  3K3O A;  4CDR A;  3PEU B;  2A72 A;  3QAR A;  3NF1 A;  3BG1 B;  2CG3 A;  5L2L A;  4U0S A;  4AQF C;  3TGO A;  3HHM A;  4XKB A;  1EDU A;  4ME2 A;  3ZN1 B;  4ZI7 E;  1YD8 G;  3OAW A;  3CQX C;  2C5K T;  3B13 A;  3QB2 A;  4IE4 A;  4H63 H;  2OOE A;  3ZYQ A;  2JJ9 A;  5LX8 A;  4UWG A;  2D5U A;  2CMR A;  4PK4 A;  2LAH A;  2CXD A;  4NAC A;  2VGY A;  2W62 A;  3CHS A;  5LOV E;  5JHB A;  4DBQ A;  5LGT B;  4H9R C;  2KWH A;  4NUV A;  3VU7 H;  1D1A A;  4BT8 A;  5DAB A;  4CEM A;  2VSX E;  3RYI E;  2L3L A;  3ULQ A;  4PJN A;  3FB2 A;  3ASH A;  2NW7 A;  2X6K A;  3VKH A;  4PUC A;  5BUZ A;  1QNF A;  4CT0 A;  5C8Y E;  3P8C D;  2KLQ A;  5ARF A;  2V8S E;  2D2S A;  4I4T E;  1PAQ A;  1JPL A;  1NA0 A;  3D9L A;  3FUD A;  4GZC A;  3PUG A;  4I55 E;  2KZ7 B;  2JMK A;  4HE8 A;  4QKN A;  1WYB A;  2J1D G;  3CVR A;  1KLX A;  2IJG X;  1QZ2 A;  4EZK A;  2JQQ A;  3J7Y q;  2VSO E;  3ENE A;  2MRI A;  3MKQ A;  4OVV A;  3N9Q A;  4W9R A;  1UJJ A;  4G2A A;  3NBX X;  3MJW A;  4O4J E;  2WXH A;  3PS6 A;  3F57 A;  3RU0 A;  3QJZ A;  4IIJ E;  4WWO A;  3KV6 A;  2MOW A;  3FY4 A;  1FMV A;  4EYU A;  1UJK A;  1E7V A;  4Y6C A;  3SGH A;  4QWN B;  5C2Y A;  4I1O B;  4GZ5 A;  4XI9 A;  4CRW A;  4EQF A;  4UF0 A;  3JCK C;  1KT1 A;  3O1H A;  3ZCJ A;  4EZH A;  4DI4 A;  4IHJ E;  3OTN A;  5FXX A;  3CX7 B;  3FTX A;  3AU5 A;  4KUM B;  3FDH A;  5JRC B;  2XCC A;  4FHK A;  1EF1 C;  3R6N A;  4AY6 A;  2HPL A;  4O2B E;  3TKL B;  4PFO A;  4JEH B;  5FYM A;  3RC8 A;  4IRU A;  4AKH A;  3E4B A;  1Y8M A;  3IHV A;  4BWR A;  2X6H A;  2WXP A;  3E08 A;  1TJF A;  2AVP A;  3ZRH A;  3RJV A;  4YJ2 E;  3MKD A;  2VWA A;  4C0M A;  1HG2 A;  2PQR A;  4X20 E;  3EIJ A;  4F1S A;  4U0U A;  2CEA A;  2MYS A;  1IQU A;  4QXB B;  2J09 A;  3LYA A;  3FUE A;  3QC9 A;  2WXR A;  4WBO A;  3FUM A;  1JWG A;  3CR3 A;  5LGN B;  4JHK A;  1VDY A;  4AEZ C;  2Y3A A;  5EK2 A;  1SZA A;  4FLH A;  5L3B B;  3PNT B;  4ATG A;  4HFG A;  3CVX A;  2N2N A;  5JJ6 A;  3LDZ A;  4XAX B;  1FMW A;  2DNX A;  2AXU A;  3ZMU B;  3U4T A;  2GRL A;  3ZJ2 A;  3MEK A;  4EEC A;  3LK4 2;  2WXJ A;  1EPU A;  1XNF A;  3OXL A;  4MS6 A;  2XCB A;  3I4R B;  1MQS A;  2CG2 A;  1E8W A;  3RYC E;  2YK0 A;  2OV8 A;  4ZS3 A;  1KK7 A;  4UI9 K;  4L9I A;  3B7R L;  3GZ1 A;  3TXM A;  2KND A;  5BMV E;  1OWL A;  3LVR E;  2V7I A;  4I9C A;  1IHG A;  4K0U A;  3ONK A;  2Y48 B;  3QNK A;  3EDT B;  4EOZ B;  2BVL A;  4J6I A;  4GCN A;  4DLQ A;  5E75 A;  1FVH A;  2VJ8 A;  4KMC A;  5CA1 E;  4JHJ A;  4AQF A;  4AKI A;  3QWP A;  4OYJ A;  2QA7 A;  2WXN A;  3FTZ A;  3K3N A;  2KT9 A;  3D9M A;  1ZKE A;  4CXW A;  5LYJ E;  1L5J A;  2XHE A;  1N54 A;  3MGB A;  4KZ0 A;  1VRB A;  3N9N A;  2W00 A;  5E76 A;  4WNK A;  1D0Z A;  3AA6 B;  3EVY A;  5EK4 A;  4TV3 A;  4KP3 C;  3S7F A;  5LP6 E;  3MKR A;  3ETU A;  3IEG A;  3HKB E;  4LCT A;  4Q94 A;  4GPK A;  2KCL A;  4K03 A;  3R84 B;  4AQG A;  4G11 A;  5J2T E;  4X1Y E;  3ANW B;  5FXW A;  2CFU A;  4GA0 A;  1WRD A;  2Y4U A;  4GYS A;  3S7D A;  3I9W A;  4UWL A;  3MJX A;  3KV9 A;  2V4L A;  3URZ A;  2R5S A;  5J90 A;  4KT6 B;  1D1C A;  5L3C B;  3CVU A;  5LHH B;  3LCA A;  3ZJ1 A;  5BV1 A;  3FU0 A;  4C9B B;  1B89 A;  1OWP A;  2LSG A;  1Z3Y A;  4UWK A;  4UI9 J;  2CXL A;  2M63 A;  4BJM A;  1P5Q A;  4IE5 A;  3BG0 B;  4DO0 A;  3Q5M A;  4XI0 A;  3V5U A;  5CCL A;  2CHZ A;  4N2S A;  4MLK A;  1LVK A;  3L08 A;  2WM9 A;  4JHR A;  4AKR B;  4PS8 A;  5JH7 E;  1SA0 E;  1MIV A;  2E9X D;  1Z6T A;  4NRH B;  4HOU A;  5LHG B;  3RRN B;  4J8D A;  5JHA A;  3DP7 A;  2L8K A;  3SS1 A;  5CA0 E;  4LER A;  5A1L A;  4R7L A;  2AXZ A;  3HKC E;  3PUQ A;  4ILG A;  3T5X A;  4C0E A;  3CVL A;  3FHN A;  1S94 A;  3FXD B;  1S0P A;  2W63 A;  4L0R A;  5BV0 A;  3Q47 B;  3FU3 A;  5JDG A;  1E1H B;  4JUY A;  2LE8 A;  4RG9 A;  3S4U A;  4FUL A;  4KYO B;  1UN9 A;  3TAX A;  3O9X A;  5AFU L;  4L5G A;  4B8C B;  2X9H A;  2W61 A;  3LJ3 A;  4G1T A;  5JRE A;  4YJ3 E;  1N52 A;  1MND A;  3L13 A;  2Y8D A;  5DJQ C;  2ODU A;  1E8X A;  1FCH A;  2HYZ A;  4JZY A;  2FEZ A;  5FXV A;  5L3D B;  3DPD A;  3GMI A;  4JA7 A;  1G73 A;  4ADZ A;  5EK3 A;  1WM5 A;  2NXP A;  4G24 A;  3G2W A;  4EBA G;  3G2T A;  4L2L A;  3CQG B;  4GZD A;  4KZC A;  1BR0 A;  3E0Z A;  3RPU A;  3AA0 B;  3EUH A;  5KJN A;  5LCW J;  3F31 A;  5FXZ A;  4FAD A;  2I1J A;  2NW8 A;  4ZHQ E;  2WXI A;  3HYM B;  4JVS A;  3IBE A;  4P09 A;  3APD A;  4MHC A;  2EHO B;  1ZHC A;  5HYA A;  3H3A A;  3Q5X A;  2PZI A;  3FUF A;  5LXT E;  3ZYK A;  3ZMZ B;  2UY1 B;  1Y64 B;  1H2T C;  3MXZ A;  3N9P A;  4XIF A;  3CWZ B;  3RRW A;  3Q4A B;  4I2W A;  4Y6W A;  3TG4 A;  5JRC A;  4AM9 A;  4MRU A;  2I9C A;  3CGH A;  1LKX A;  5LCY A;  2VK9 A;  4JEH A;  4HOS A;  4YHJ A;  2ZM2 A;  2X6J A;  4AJW A;  2XHE B;  3LBX B;  3P7I A;  5LNK A;  3CHR A;  3NRY A;  3U9W A;  1VOM A;  2GRM A;  3QKY A;  3GWH A;  1YKH B;  4IGU A;  2OVF A;  2GW1 A;  1IZN B;  4KBQ A;  3IV0 A;  5JJ7 A;  2KCV A;  4UI9 C;  2MTQ A;  1BR4 A;  2LEH A;  3O4Z A;  2L9Q A;  1HG5 A;  4P0A A;  2XPI A;  4U04 A;  2D0U A;  3ZXS A;  4ASK A;  2VSN A;  5ETW A;  5G2N A;  5L3G B;  3ZYM A;  4UWF A;  4FC8 A;  4DBR A;  3ZFW A;  1E8Z A;  4GIW A;  2VGX B;  4ZI3 C;  4A56 A;  3ASF A;  5ARG A;  2OVB A;  2IOS A;  2BVM A;  4HOR A;  3QC1 A;  1SQM A;  4WNE A;  4AY5 A;  2HO1 A;  1Y6I A;  3BQI A;  4UV8 B;  3UUX B;  1NZN A;  3RK6 A;  4X1K E;  2EHO C;  2KWI B;  3BEE A;  3IBP A;  1ELK A;  4WWN A;  4H9O C;  1SHZ C;  4CGW A;  3J9X 1;  3AVS A;  3FTW A;  5H6R B;  5AIJ A;  3GYZ A;  4N3B A;  3M65 A;  4KBM B;  5JR9 B;  2WXG A;  2BF0 X;  3C64 A;  5HI7 A;  2WMN A;  4OFZ A;  4D10 C;  2UXN B;  3CX8 B;  2QFC A;  4V1A v;  2I2O A;  2NC9 A;  5LOZ A;  4HKA A;  2V7L A;  5KJL A;  4IST A;  1DNP A;  2XAG B;  1IAP A;  3U66 A;  4O2A E;  2QY7 A;  2L9B A;  4CDN A;  2AXV A;  5EZY E;  5JDM A;  3GW4 A;  3D9K A;  3MV3 B;  5M4Y A;  1IYG A;  3MZK B;  4H9Q C;  1HS7 A;  2WWU A;  2D0T A;  4WNF A;  4J8F A;  1H0A A;  3QOU A;  5LCW C;  1WLX A;  3D9O A;  3AA7 B;  3I9Y A;  5LJN A;  3CVP A;  4AKG A;  4CXY A;  2PQN A;  3PE4 A;  4B0Z A;  4G26 A;  3ANW A;  2LSY A;  3Q2M A;  4F7A A;  1YKE B;  3N71 A;  4PS3 A;  4OHF A;  4F6R C;  5ADX L;  3C98 B;  2E9X A;  2NW9 A;  3GZ2 A;  4EBA A;  3KBT A;  4GA2 A;  1UX5 A;  1OWM A;  3UPV A;  1HU3 A;  2IOL A;  3HKE E;  2VYI A;  3ETV A;  4PDX A;  3NZQ A;  2I1K A;  2XPZ A;  2LSV A;  1EZ3 A;  5T3R A;  3EHM A;  2A2F X;  1V9D A;  4RSY A;  4IE6 A;  5JR9 C;  2RA1 A;  2C0M A;  2RD0 A;  4GK0 E;  1OWO A;  2GK9 A;  2IC6 A;  4I1M A;  3VLF A;  4A3V A;  4KVO A;  4WNG A;  2VTB A;  4C90 A;  2P58 C;  2N9D A;  4TUU A;  3AS4 A;  4U0Z A;  3CX6 B;  4N3A A;  2W0G A;  3ZHE B;  3NZU A;  1O3X A;  2PFV A;  5F8P A;  4GYW A;  2WXQ A;  4UVA B;  5EX3 A;  2KC7 A;  2CWY A;  3FTU A;  1SZ9 A;  3CKC A;  4FLB A;  3ZMS B;  3FEX A;  4A1G A;  3MK7 C;  3PDY A;  3OYX A;  2WMO A;  3PVL A;  2EQX A;  2WB2 A;  3LK3 B;  1IJ6 A;  3WAK A;  3L6A A;  1TJC A;  2KM4 A;  2HM8 A;  2JMH A;  4BX8 A;  3KDS E;  4HOT A;  4DND A;  3FHE A;  4E6H A;  3EDV A;  4E7S A;  1WR6 A;  3U3I A;  3MV2 B;  3OYZ A;  2K9A A;  4EAH A;  3JQ1 A;  4BTB A;  4EPZ A;  3ZPO A;  5F3J A;  2R59 A;  5HAX A;  3OBV E;  4J8S A;  1UG3 A;  3N2G E;  2X9W A;  3N2K E;  3CHM A;  4ERR A;  3KV5 A;  3Q5W A;  4XZC A;  4F3V A;  4EB6 E;  2PBI A;  3AAI A;  3AS8 A;  3PZD A;  3HL6 A;  4WBN E;  4PK5 A;  4DPR A;  5HXS A;  4M1P A;  3O48 A;  4GA1 A;  3KVB A;  1HTJ F;  4YVO A;  2QGS A;  1Z0P A;  5IHY A;  2VKJ A;  5ANR A;  4UWH A;  3R7Q A;  2IW5 B;  2LNI A;  3L54 A;  2LHN A;  4QX7 B;  3RH3 A;  2YQ8 A;  5H6Q B;  1OUV A;  2Q7F A;  4G63 A;  2H7V C;  3LY9 A;  3ONL A;  1OWN A;  2EHO A;  1ELR A;  2XAH B;  4ANV A;  4ANJ A;  3MZL B;  4UV9 B;  3ZGQ A;  3CK8 A;  2UY1 A;  2ODV A;  4PJJ A;  5CMY A;  2C0S A;  4GYR A;  5G05 J;  2DI4 A;  4GMJ A;  3CST A;  5J08 A;  4AXP A;  1UW4 B;  1AJ3 A;  4BSX A;  5DQV A;  4DK5 A;  4CZZ B;  2ZM0 A;  2ILR A;  4EXT A;  4ISS A;  3LBX A;  3SRZ A;  3C4W A;  1A17 A;  4GYY A;  4AV7 A;  3CVN A;  1HCI A;  3ML8 A;  4B8A A;  4H9S E;  2C5I T;  5HXR A;  3R7R A;  5EX0 A;  3PUA A;  4XBF B;  2WQH A;  2ACX A;  1ZU2 A;  4FU3 A;  3K3Q C;  3S2A A;  3SD5 A;  2YHE A;  3UUM A;  1E90 A;  2WXO A;  4EYY R;  5LFA A;  5FQ7 A;  2XAF B;  5BW8 C;  4TV9 E;  4XKC A;  3VLE A;  2I59 A;  4ZOL E;  2XGO A;  2IU1 A;  3WXX A;  3R9A B;  1BR2 A;  5E0O A;  4V3I A;  2E9X B;  3H37 A;  5JDL A;  4U72 A;  3PNL B;  5A6C A;  2L6J A;  2VGX A;  3QK0 A;  4RVB A;  4TUY E;  5HWY A;  5FY0 A;  3MAC A;  3UMV A;  3DJB A;  1FIO A;  3E22 E;  3Q15 A;  2FF4 A;  3UUX A;  3WAJ A;  2V7J A;  4C91 A;  2LSU A;  1PY1 A;  2X9X A;  1HO8 A;  3G2S A;  4KXK B;  2VTB B;  2VKO A;  3RYF E;  4K0R A;  3PE3 A;  3SBS A;  3I5P A;  3T8M A;  1WYC A;  4I43 B;  4AP2 A;  3LY8 A;  1IJ5 A;  1IQR A;  1Z3X A;  1MMN A;  5JR9 A;  2V1D B;  3FTS A;  2WVI A;  2DBA A;  3AB3 B;  3C51 A;  3JYS A;  4A1S A;  2YHC A;  3SFZ A;  5D0Q D;  3FUJ A;  3KIN B;  3JC6 D;  3QWW A;  4HVB A;  4O4I E;  5ENN A;  2DCP A;  2L0I A;  3N9M A;  3HIZ A;  1BPO A;  2XGM A;  3SHF A;  3LEW A;  4WUY A;  4CI3 B;  5GON E;  4JXT A;  4BAY B;  3DTO A;  4P29 A;  2WBL A;  1ZBP A;  4CCA A;  3ZEF B;  2KXP B;  1U5P A;  2J08 A;  3KFW X;  5JQG E;  2IF4 A;  3AS5 A;  3FWV A;  2VL8 A;  5JVD E;  2LSI A;  4FJZ A;  4LEU A;  2E9X C;  3JC6 C;  4GML A;  3ASG A;  4O4H E;  2PM7 A;  1GW6 A;  3PUR A;  2DLR A;  2J4B A;  5M72 A;  5KJK A;  4J2C A;  3QWV A;  2LSJ A;  4KMO A;  1G8X A;  3C98 A;  4N78 D;  4QX8 B;  3KS2 A;  2HPJ A;  4PH4 B;  5G05 C;  3CK9 A;  1HH8 A;  3ZC1 A;  3HVE B;  4QHO A;  3UX4 A;  2FI7 A;  5J2U E;  3SF4 A;  3ZN0 B;  3I0O A;  4YFS A;  3TJP A;  4G23 A;  4PFP A;  3NQP A;  4O4L E;  4GU5 A;  1MMD A;  3L22 A;  3OXF A;  1E7U A;  1OXZ A;  4EIW A;  3FP3 A;  2LO6 A;  4QXH B;  2VB6 A;  2IC9 A;  4BT9 A;  2YU2 A;  3VTY A;  3ZVV A;  4DJA A;  3UT5 E;  3O1I A;  3APC A;  1UCU A;  3G2V A;  3ZMT B;  3FUI A;  3ZHE A;  3KEZ A;  2ES0 A;  3U64 A;  1HXI A;  2CLY B;  5KDM C;  3EHN A;  2GGF A;  1KNZ A;  1MHQ A;  5BT1 A;  2CXF A;  2MHK A;  3CVV A;  3VLD A;  3Q9D A;  4IE0 A;  3RC3 A;  4WWP A;  3PU3 A;  2FO7 A;  4O6F A;  1KT0 A;  5KJM A;  2XAQ B;  2WXL A;  2X6I A;  4CDM A;  3CKB A;  5L3F B;  4FI5 A;  4U8H A;  2K5B B;  2YEV C;  3B57 A;  4H9P C;  3UQ3 A;  5HQ8 A;  3GZS A;  2V0P A;  3UT7 A;  4MAL A;  5JDH A;  3ZC0 A;  2WXM A;  2LOS A;  2J07 A;  2X3M A;  3U3W A;  3NRX A;  4CGV A;  2WXK A;  1H2V C;  3A5X A;  3JUI A;  5CMW A;  2X68 A;  2E0I A;  2X0L B;  2PG8 A;  4ANU A;  4KVM A;  3EJN A;  4I9E A;  4X1I E;  1B7T A;  5FY7 A;  2KMF A;  1EYH A;  5G04 J;  3SI5 A;  3PRZ A;  1INZ A;  4L1B A;  2Z6E A;  1W3B A;  3FXE B;  4ILU A;  2J49 A;  2Q9Q B;  3LK2 B;  3OKQ A;  3TXN A;  3MCX A;  1MMG A;  3OXG A;  2CLY C;  4HEA A;  3ZLI A;  4TRQ A;  5JDF A;  4ZS2 A;  3RYH E;  3N2O A;  4XX5 A;  5FZS A;  4GB9 A;  2DWK A;  2R17 C;  2WQ6 A;  3VKG A;  4MKT A;  2YU1 A;  5FY1 A;  2JEK A;  2IAK A;  3UTK A;  4PAG A;  4A55 A;  2KZT B;  2CE7 A;  2FUL A;  4UQZ A;  3PE0 A;  3T8O A;  4GK5 E;  5DBK A;  3BQL A;  3ZCI A;  3ZPJ A;  3K9I A;  4QXC B;  2WXF A;  4A3T A;  3RO3 A;  5FJY A;  4JPS A;  4EZL A;  3L3P A;  1MMA A;  2XQ0 A;  4WND A;  4PJL A;  3VTX A;  2C0L A;  3LJC A;  5HXC A;  1JUQ A;  2AW6 A;  3P2B A;  4QFV A;  2Q9Q D;  4WW0 A;  4BX9 A;  3HR0 A;  5BNW A;  4YND A;  4HXI A;  2Y4T A;  4TZ4 C;  4FP7 A;  1H6K A;  1NAF A;  3HDX A;  5ANL A;  2XPY A;  4JW1 A;  2VKH A;  2PM6 A;  2XEV A;  1UX4 A;  5HXE A;  5FQ6 A;  3T5V A;  4JLE A;  1U4Q A;  4GYO A;  4XE0 A;  1TEZ A;  5FWQ A;  3L16 A;  1LF8 A;  2CM0 A;  2V7K A;  3IHY A;  5FTP A;  4HFV A;  4JC8 A;  4BJN A;  3U78 A;  2HR2 A;  2Q9Q C;  2IFU A;  3IF8 B;  3APF A;  4N2Q A;  2BDE A;  3N9L A;  4DLO A;  3I1A A;  3I3N A;  5CHE E;  1H2U A;  2KAT A;  4CQI A;  5AJD A;  2V7M A;  5C1D A;  4G2V A;  1XGW A;  3BK9 A;  2M67 A;  4I43 A;  4DMW A;  5LP0 A;  5BPP A;  3CQC B;  3FTV A;  2H7O A;  3C4X A;  4ILI A;  4AVX A;  4DI3 A;  2BUG A;  1WAO 1;  4IUL A;  4TN7 B;  3QDN A;  2YIN A;  2J4D A;  4HN9 A;  2NSZ A;  1CUN A;  2NTX A;  2X66 A;  4APO A;  2DCF A;  4O8S A;  5TAO A;  1QQE A;  5AYW D;  2CHX A;  5CCM A;  3PEV B;  4F53 A;  1D0Y A;  5LGU B;  3MA9 A;  2IQC A;  3N5L A;  2H3R A;  4UVB B;  3BQK A;  1NP7 A;  2ION A;  4P0B A;  2J9Q A;  3KVA A;  4NUU A;  2V5F A;  4I6G A;  3ZEF A;  4UEL A;  1T98 A;  5G04 C;  2WAU A;  1H19 A;  1BR1 A;  1HFA A;  3ONX A;  2AWI A;  4WAF A;  2B1E A;  4GOU A;  4OVU A;  2C2L A;  3HI2 A;  4OYK A;  3PDN A;  4LRZ A;  3PTR B;  3FU6 A;  3FU5 A;  1X5B A;  3CKD A;  1S35 A;  4U07 A;  2SPC A;  4CXX A;  3ZIM A;  2MBG A;  4HS2 A;  3HVE A;  3SZ7 A;  4YVQ C;  2K48 A;  2CCQ A;  4TX5 A;  1E96 B;  5FP3 A;  3DBS A;  4I2Z A;  2LAI A;  2RP4 A;  1NWM X;  5DQW A;  4FHJ A;  4ACL A;  4NQ0 A;  4E85 A;  4N5C A;  5HXH A;  5FT9 A;  2NWB A;  4UVC B;  4MLP A;  1MNE A;  2K24 A;  2XAS B;  5FQ4 A;  5FZQ A;  3GN5 B;  4Q96 A;  2X9Y A;  3CV0 A;  4URK A;  3CK7 A;  1ZV4 X;  3JQ0 A;  4N39 A;  4B94 A;  2XAJ B;  4GZ6 A;  5FNV E;  4ANX A;  3FH7 A;  2VQ2 A;  4AI6 A;  3LS8 A;  4PJM A;  3FBL A;  4GCO A;  2DWG A;  1HF8 A;  5T8I A;  2OND A;  3UT4 A;  2A3D A;  2NP9 A;  4HOQ A;  5JDN A;  4U74 A;  4M3O A;  4ACK A;  2L0T B;  3RIB A;  2WPV A;  4H7Y A;  4H9N C;  2YNQ A;  3TL5 A;  3UFE A;  2RG8 A;  2LOP A;  3RKV A;  4I50 E;  3SNX A;  4J0U A;  4CI2 B;  3UUN A;  2LT3 A;  3RO2 A;  4UQX A;  4HGA A;  3LY7 A;  2VSY A;  3CIA A;  2XUE A;  3SBT B;  1QUU A;  2UWJ G;  3FUH A;  2X67 A;  3FBZ A;  2E8I A;  3Q49 B;  3ESK A;  4AOF A;  2ZLY A;  1WY6 A;  3MX3 A;  3GA8 A;  2E2E A;  3PUJ A;  2KIN B;  1U3C A;  4MBQ A;  5KX5 E;  4JEU A;  1UN8 A;  4JA9 A;  2LJL A;  1ZEE A;  4OYS A;  5KMG P;  2NTY A;  2FBN A;  4NUR A;  3FEY A;  4UQY A;  3CHQ A;  1LRZ A;  3QUJ A;  4ABN A;  4HTE A;  3PUS A;  4UXN B;  5AJL A;  2CWO A;  1H7C A;  4IE7 A;  3S7J A;  3MKQ B;  3QK6 A;  3AA1 B;  3LXU X;  4L7T A;  5LHI B;  2Q9Q A;  3LVQ E;  3ASD A;  4ZI2 D;  3CVQ A;  4Q69 A;  2V26 A;  3RRC A;  3CVW A;  5L3E B;  5JDQ A;  1ELW A;  3CSF A;  5A7D B;  4IYP A;  5A23 A;  3L17 A;  3PUK A;  3K8P C;  2A4Z A;  3RX6 A;  1HZ4 A;  3VHL A;  3EIQ C;  4H63 V;  4UF0 B;  3MYV A;  4UEM A;  1NA3 A;  4FJO A;  4YLH A;  5J1G A;  4I1A A;  5FQ8 A;  4LUN U;  2KZT A;  2DIW A;  3C4Z A;  3HA4 A;  3KD7 A;  4PS7 A;  3CVY A;  3V5S A;  3FH8 A;  3B7U X;  2XRZ A;  1MIW A;  3UUL A;  4GAA A;  3L09 A;  3CHO A;  2X6F A;  3D9N A;  5EDS A;  3ZN3 A;  3KAE A;  4I17 A;  3ZYL A;  2I6H A;  4ZI2 C;  4DMV A;  3FUN A;  3C50 A;  4ILH B;  2JRK A;  3CPZ A;  2ZM8 A;  4H7X A;  1HE8 A;  4BY6 A;  2DHR A;  2XGS A;  3UT8 A;  5EKQ D;  3AAE B;  2X38 A;  4PNI A;  4IN3 B;  4DVD A;  3CEQ A;  4N3C A;  4E7Z A;  2OA5 A;  5LG4 A;  3LFM A;  2PJQ A;  4MFR A;  5HWX A;  5JJT A;  2ZU6 B;  3LG7 A;  4L23 A;  3OJA A;  3B7T A;  2PL2 A;  4PK6 A;  1HS6 A;  3AVR A;  4EZ4 A;  3FUL A;  3N9O A;  1YA0 A;  2LSK A;  2C5J A;  1E8Y A;  4XZ4 A;  3ML9 A;  1YW0 A;  3ZMV B;  3IEE A;  4AIF A;  3FFL A;  2VKD A;  1PC2 A;  3IHR A;  2A5U A;  3NZP A;  3NZS A;  3LPZ A;  2NOX A;  3P1U A;  1U3D A;  4BFR A;  3S7B A;  3D3M A;  5D0O D;  3QAQ A;  5G55 A;  5DIZ A;  4B6X A;  2Y6X A;  3CHP A;  5IYZ E;  2X51 A;  3I4G A;  3PU8 A;  5LBQ B;  3RRM B;  4HLE A;  4ANW A;  4AKL A;  4FA6 A;  4CT4 A;  2KCK A;  3ESL A;  5LA6 E;  1DVP A;  2N1G A;  3KV4 A;  3RKO A;  3FTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...