2YINA

Structure of the complex between dock2 and rac1.
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
425
structure length
411
Chain Sequence
SKDNRMSCTVNLLNFYKDNNREEMYIRYLYKLRDLHLDCDNYTEAAYTLLLHTWLLKWSDEQTHRQLKETLYETIIGYFDKGKMWEEAISLCKELAEQYEMEIFDYELLSQNLIQQAKFYESIMKILRPKPDYFAVGYYGQGFPSFLRNKVFIYRGKEYERREDFQMQLMTQFPNAEKMNTTSAPGDDVKNAPGQYIQCFTVQPVLDEHPRFKNKPVPDQIINFYKSNYVQRFHYSRPVRRGTVDPENEFASMWIERTSFVTAYKLPGILRWFEVVHMSQTTISPLENAIETMSTANEKILMMINQYQSDETLPINPLSMLLNGIVDPAVMGGFAKYEKAFFTEEYVRDHPEDQDKLTHLKDLIAWQIPFLGAGIKIHEKRVSDNLRPFHDRMEECFKNLKMKVEKEYGVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Multiple Factors Confer Specific Cdc42 and Rac Protein Activation by Dedicator of Cytokinesis (Dock) Nucleotide Exchange Factors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords DEDICATOR OF CYTOKINESIS PROTEIN 2
total genus 132
structure length 411
sequence length 425
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.740 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2yinA03
1.25.40.410 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2yinA01
2WMNA 2WM9A 2WMOA 2YINA 3B13A 3VHLA
chains in the Genus database with same CATH superfamily
2YDRA 3L08A 4DR3T 4DUYT 4Q94A 3HL6A 1VRBA 2JABA 3N2OA 2R05A 4GTVA 1V54E 4IDNA 1KK7A 4GZDA 4JA9A 4WAFA 3NKZA 5KJKA 1D8EA 4ADZA 5AQJB 3K3QC 2P2CP 5H6RB 4A5XA 3DXMG 3ZMSB 5JA4D 2FULA 4JXTA 4PH4B 2OA5A 4AV7A 4DR7T 5AIJA 4ZI2D 3FFLA 4KP3C 4UVAB 1X81A 3C51A 3FUIA 1QBQA 3H37A 4DUIA 1IZNB 5AQTB 5F3JA 2CE7A 3CSTA 3UUXA 2W67A 4U7YA 2ZLYA 2GRNB 5D0QD 3RIFA 2DI4A 3HR0A 3CMLA 5LMUT 4XKBA 4GA1A 4YT0A 1O1RA 3CWZB 1MIVA 3Q78A 2ODUA 2L3LA 1QNFA 2J4GA 2KSRA 1JCSA 2C0MA 3PUVF 5TAOA 4ANJA 4AP2A 2NTYA 3RC8A 2KCKA 3L54A 4XE0A 4EZLA 3B95A 4PJNA 5C3JA 1NZNA 3DPYA 2FF4A 5FXVA 3SNXA 3UU6A 5CECB 2DZOA 3FU5A 4I9CA 4EIWA 2CFZA 2V5FA 2XGOA 3AJIA 4HKAA 1SA4A 2ES0A 3MV3B 4KZCA 3EHZA 2LSIA 4IE6A 2XPKA 4O2BE 3HVEB 2YHCA 3UUMA 5CA1E 1W0BA 3P4RA 2WPVA 3N9OA 2RPAA 4TV9E 3CHOA 4R7LA 5CA0E 3UM1A 3A8YC 4P0AA 2NYJA 3EIQC 4MLPA 5BNWA 2X6FA 4ZS3A 5HAXA 3Q7FA 2H6GA 5AQLB 2V0PA 2WZIA 3JUEA 3QC1A 3IF8B 4GK0E 3X1DA 4JEHB 3FTUA 4K5CA 4I43B 2ACXA 3IEEA 4KVOA 5AJLA 3C64A 2Q9QB 5C1DA 2CMRA 5C2YA 3C3QA 3NZQA 2BS2A 2JRKA 3V2OA 1S35A 3IKOB 3E4BA 2X67A 4M1PA 1MJ0A 3JQ1A 3NBNB 2EHOB 1WR6A 4TUYE 1ZHCA 3NBXX 2NC9A 2XQ7A 2XQ0A 5JMND 4KHZF 4O4JE 1E1HB 5FVLA 2WXPA 4JD2G 3ZKJA 5HXRA 1CUNA 2CPTA 2CG3A 4H63H 3IEGA 3KSQA 3AEDA 1VCTA 1HCIA 2V4LA 5A6CA 2LO6A 3ZKRA 1VOMA 4PAGA 4UI9J 2CCQA 5KX5E 4E7ZA 4HFHA 4J2CA 3W9GA 3N9LA 1HX8A 2V6YB 5LBMA 2DLRA 1OWLA 3C4WA 3SFEA 4N2SA 2H6FA 1PY1A 3AG2E 3NZPA 4G2AA 1XMOT 4B8CB 4J6IA 5ANRA 4ILGA 5AQSB 1ELKA 1JNZA 5JDFA 4O4LE 2UY1B 4UUCA 4QH4A 2MOZA 5JHAA 2YK0A 1IHGA 5FL0A 4TV3A 2LSUA 4X64T 4IRUA 1UURA 2XPZA 3RK6A 4HFEA 4L9IA 1OWOA 3V2XA 4C9BB 4EB6E 2XJ7A 5BV0A 1NAFA 4U2ZA 2R59A 3N9PA 4AEZC 5FZQA 5CGMA 3H3AA 4KHPT 2E8IA 1YA0A 3ONLA 3O4XE 5F8PA 4IDPA 5KBAA 2HM8A 3FXEB 1MMDA 2UXBT 2MPKA 3EUHA 3AA6B 1X79A 5T4YA 5FP3A 5IHYA 5HXEA 4PS7A 1EPUA 3KINB 3MGBA 3MK7C 1AWCB 2KT9A 5AQQB 2MYOA 3GMIA 3E22E 3LBXB 1M62A 5HS0A 5FXWA 4YSZA 1E7UA 4RG9A 3OYZA 2NOXA 4ZXLA 2KWHA 3PDNA 1WY6A 5ENSD 3FTXA 3Q79A 4HOTA 3J9X1 4GA0A 5CJ5A 2XM1A 4BERA 1LVFA 4DBRA 1EDUA 2FJDA 4O4HE 3CVVA 3NQPA 2V5CA 3MKQB 1H2UA 3QOFA 1BLXB 2L6BA 3UU5A 3LY9A 3HKCE 4NXNT 2KC7A 3IV0A 5LJNA 5DABA 4J8SA 1RZ4A 1H6PA 4I1AA 2PQRA 2LSYA 3AE8A 1QYMA 1DVPA 2VGXA 1WYCA 3UI2A 3PEVB 4JW1A 4H7YA 3EHMA 3PNTB 4PS8A 4GTSA 4HTEA 2BKGA 1WLXA 5LJMA 4YSXA 3ZYLA 3T9KA 4TNVA 5LG3A 4GMJA 4AVXA 2WQ7A 4V1Av 2DYSE 3UTMA 4WNGA 5LYJE 3GYZA 2J49A 4LF9T 1S63A 2RP4A 2N1GA 3G2SA 5G04J 2C2LA 3FTWA 4UWHA 4FU3A 2WM9A 1JCQA 4PJMA 3AA0B 3RKVA 2Q9QC 5HCMA 4YTNA 3RSEG 3V5SA 3EHNA 1T7SA 2FJBA 2XGMA 4ILIA 4N3CA 3CHQA 4GZ3A 5AJDA 1UOHA 5KDMC 4IN3B 5FYMA 2FI7A 3U9WA 1N0RA 3D3MA 4YY3T 4GPMA 1QZ2A 4HRLA 4GMLA 4HOQA 3NRXA 4L2YA 4G63A 1WRDA 3VTXA 1BPOA 3S2AA 4JEUA 1HZ4A 3L3PA 2P58C 3SFDA 2AVPA 2JEKA 1SUMB 3FULA 2XZEA 3NVOA 5ABFB 5FY1A 3J5PA 4GYOA 4CZ2D 4DLQA 3OJAA 1TJFA 3NOGD 3GZ1A 4C91A 4FLBA 4PW8A 3UTKA 4Q25A 3CPZA 4Q96A 2WQYA 4HFVA 4H63V 4BY6A 4YVQC 4U7IA 2VGYA 4GZCA 3B7SA 2P9BA 1E2AA 2YINA 2JIWA 1E90A 3CVUA 5B3SE 3PUSA 5KNGA 4EPZA 3C50A 5KJMA 2WU2A 4EBAG 3GA8A 4FULA 4GTMA 5AYWD 3QWPA 3W9FA 4ILBA 3D9HA 4JYAT 3NOCD 2LT3A 2LSJA 3FUEA 5FXXA 3S4UA 2CXLA 2I9CA 3D9LA 3CQGB 4AXHA 1MMGA 2AE9A 5IY5E 1E7PA 4LRZA 4WZXA 5G2NA 5ENOD 3HXEA 5L3DB 2KZTB 5FINA 2OEVA 3LVQE 5FZRA 3ZRHA 2AXUA 3T8KA 4YTPA 1TNYA 3DXKG 2IC9A 1MIWA 1BR4A 4U07A 4U0ZA 5KCMA 2L9QA 4DV6T 3FH7A 4A63B 3TWVA 1XZYA 2GRRB 5L4HA 3ZXPA 2KINB 1XGWA 2E5LT 4I4TE 2M6BA 3AS4A 3ULQA 4EXTA 2KWIB 4B6XA 4AY5A 4G23A 2K24A 5G04C 3AA7B 5EX0A 3QWVA 3SFYA 3L82A 3PE0A 3RRWA 3AE9A 2V5QC 2X51A 4Z8XA 3KVBA 3EDTB 3QKYA 4PFPA 4GCNA 4WUYA 4HGAA 4OFZA 2W2UA 3A7MA 3N9NA 4TWHA 1FMVA 3NWIA 4D10C 2H3RA 5E75A 4DUZT 2CRBA 3VHLA 3WG7E 2LAIA 5LHHB 4WWPA 1SW6A 4FHJA 4I17A 1OEDC 5HEGA 4WWNA 1WG0A 4WBNE 2VASA 3RLFF 1D0ZA 3IHRA 5LNKA 3AVSA 3OXFA 4JEUB 5ABFA 4YXDA 2IF4A 3HKEE 2XEEA 4GYWA 3CQCB 3FZKB 4U63A 4DO0A 4LFCT 3VLEA 4JC8A 1X5BA 2J62A 2JMHA 2QA7A 3P4PA 5JQGE 1W09A 1MZCA 2XENA 3PVLA 4HB5A 2LLYA 2KCVA 2W4XA 2XEVA 2R03A 5AQRB 3SRZA 4CT0A 3TG5A 3PUYF 2ZIRA 2IY0C 1JUQA 1FIOA 4HN9A 3E0ZA 2LXMA 5A7DB 5AN8A 3BK9A 2NW8A 4N78D 4G24A 3R84B 2IOLA 5LCWJ 2HR2A 2Y4UA 4YDWA 1Q2ZA 4DMWA 2LHNA 4U96D 4H9SE 5EIBE 2IC6A 3MXZA 3PDYA 4I0UA 4LNBA 2CFUA 1NP7A 4E7SA 3D9NA 5D2MC 4BT9A 3Q7AA 4IDQA 5KNHD 1SA0E 2WDVA 4G8KA 4MKTA 2X6HA 1O3XA 3MZLB 3R9AB 1NL4A 5CEAA 3U3WA 3CVPA 3CHMA 1S94A 1U5PA 2CEAA 1UUSA 3VTYA 2PJQA 4U7EB 3T5XA 2ILRA 1LD7A 2MRIA 2K9AA 2IJGX 3ZT5A 3CEQA 3B7BA 1K1AA 2KNDA 3HKDE 4JI5T 4BJMA 3UKUG 2GRPB 5BT1A 2WB2A 2DWGA 2HYZA 4F6RC 3WAJA 1OT8A 4HORA 1IHBA 4IHJE 4AKRB 2V26A 4GYSA 3FU6A 3L39A 2VTBA 4A97A 2I1KA 3NB2A 3Q2MA 5IUXA 1TJCA 2VKJA 4B89A 2CXFA 5AQHB 2LJLA 4PNIA 3RU0A 3I0OA 2YU2A 2Y8DA 4DV2T 3WXXA 3ZXSA 3PJAJ 2FO1E 4PDXA 4UV8B 3QARA 4KXKB 4LNUD 1N36T 3P4SA 1N0QA 3KBUA 4O2AE 3K3NA 4AY6A 2WY2A 2QGSA 3ABVA 4ZI3D 2IU1A 2PQNA 4MLKA 5FQ4A 5KJNA 1ZU2A 3T8OA 3C3RA 3RYHE 5LCWC 3LPZA 3VLDA 3PUKA 4FHKA 5BXUA 2DZNA 2X0LB 1BR0A 2LM2A 3Q9DA 4ZI2C 4LF7T 3ZN3A 3WI3A 4HE8A 1ZEEA 4M7CA 4KBMB 3UIOC 3PUGA 4QX8B 3EAMA 4IGUA 2XQ4A 2RG8A 2X0YA 2UUCT 3LDQB 4GB9A 1US7B 5FTPA 3KV5A 5J90A 3FU3A 1RW2A 3MA9A 2EIME 5JJ6A 2Y6XA 3Q4AB 3JAFA 4U33A 2EHOC 4NQ0A 4DV3T 2VVSA 2BF0X 3G06A 1Z8UA 2PBIA 2XQ6A 3PUQA 4QH5A 3AEFA 2DBAA 3LG7A 5M72A 2VQ2A 3ASOE 1Z6TA 3CVRA 1LF8A 1I6ZA 2NP9A 3FUKA 1H7CA 3TWWA 1ZOYA 2NSZA 2JQ9A 1FJGT 1KPSB 3C3OA 3LVRE 1E8XA 1OY3D 4I50E 5JR9A 4IULA 4AOFA 4G1TA 4QWNB 4RVBA 2R17C 4JPSA 3OYXA 4HWHA 5HXSA 4K0UA 2DL1A 3ZPOA 3UU4A 3LY8A 3IHVA 4AIUA 1N33T 3RF1A 1Y64B 3GW4A 3ZUVB 4ACKA 2VTBB 2IOSA 3U66A 3UUBA 3UIPC 5EK2A 2PFVA 5HEJA 4L0RA 4GTQA 3QK6A 1UW4B 4DK5A 2VJ8A 1TNUA 5D0OD 1XDPA 3UFEA 3R7RA 5HCJA 5LOVE 2ZM6T 1MNEA 4BX9A 4TNWA 3VKGA 3I0QA 3OTNA 4Z91A 1SZAA 5JDLA 4BEPA 5IWAT 1OCRE 3VR8A 3AB3B 2P9IG 2QY7A 2XZDG 1K1BA 5ABGA 2J47A 5B1AE 3RYFE 2PM6A 1HE8A 4O1PA 3TGOA 2LSVA 4B8AA 4UI9K 4GKKT 3BUAA 3EHRA 4UF0B 4YJ3E 4EAHA 3LJ3A 4AM9A 4NURA 3ZSSA 3ONXA 2CM0A 1VDYA 4HWDA 3BG1B 5BW8C 4DI4A 2YDQA 4KZ0A 2P9NG 2VSNA 1WR0A 4TXQA 1YYHA 3CVNA 4HFGA 5CERB 4PK6A 3VKHA 3CGHA 2BKNA 5CCMA 3KEAA 3ZPJA 2Y48B 4ZOLE 1OEDE 4AXPA 4X1KE 1H6OA 4E6HA 4X20E 1IQUA 3CHRA 3LKUA 5LB7B 2VVNA 4GAAA 4L1BA 4JUYA 4JI8T 3OXGA 3ZMZB 2GGFA 3FP3A 4CXXA 2IEJA 3ZW3A 2PZIA 4DV7T 3G2VA 1EYHA 1D1AA 2X38A 5JDNA 3ZT6A 3S7JA 3QAQA 2X6JA 2BBHA 4OHFA 4IIJE 2WVIA 3MX3A 4A1GA 2J1DG 1H2TC 3LK3B 4O4IE 2FO7A 3KEZA 3CK9A 1HO8A 3RYIE 1A17A 1TNZA 5FZSA 4QH1A 5LMNT 4JA7A 4CN4A 1MMAA 4ASKA 4L7TA 2DWKA 3N2GE 5JHBA 3FDHA 4CCAA 3AEAA 1KNPA 1WYBA 3AAAB 3K9IA 5HXHA 4QX7B 4HRNA 4MFRA 1Y6IA 1SVXA 3AVRA 4JEHA 5FIOA 3CX6B 3KV6A 3PZ3A 3T8MA 3SGHA 4U72A 3TAXA 1AP7A 2E9XC 3RIAA 1D1CA 4JZYA 3LYAA 3JAEA 3ZC1A 3NRYA 2ZMAA 2L9BA 2HE0A 1YW0A 2P9SG 2MYSA 1U3DA 3ASHA 3RH3A 1Z3YA 2Y3AA 4DJAA 5CMYA 2V6XA 4GIWA 3AEBA 4N3BA 2X3MA 3DJBA 5ETWA 3FHNA 4U0SA 4UQZA 3ZCJA 3DSWA 1U3CA 4XAXB 1KT0A 3KAEA 4ATZD 4QKNA 5JJTA 1MMNA 2MBGA 5FXZA 4UVCB 5AQPB 5ENRD 2XQYA 3FTYA 4IE0A 5FVKA 3ASNE 3N2KE 4U0UA 3TWSA 3HG0D 1NA0A 5LBQB 1E96B 2X66A 4COFA 5A1LA 4LFBT 5JVDE 3ZYKA 2B6CA 1OEDA 2WSSV 3HXBA 3FUFA 4GU5A 1LD8A 1QLBA 2ZM8A 2AXVA 4P0BA 3PUXF 2HO1A 2LHRA 3UT4A 3RAUA 3DSSA 1N4RA 2E0IA 2D9DA 2W66A 3H3MA 1TNOA 3DSXA 3P7IA 4TN7B 3MV2B 3ONJA 4ZI3C 5EYPF 5L3FB 1KLXA 3V30A 5AQ9A 3KDSE 1ZBPA 4ZS2A 3SWHA 3BQKA 2WMNA 2F8XK 3C4ZA 4NXMT 1HG5A 2F8YA 2YDSA 4F7AA 3HA4A 3I4GA 5FQ8A 4FADA 5JRCB 4NUVA 2XQAA 3PZ1A 3PEUB 3G2TA 4EZ4A 2H7VC 2W62A 1LVKA 2WXLA 4ZEYA 3HXCA 1E8ZA 2OLTA 4HLLA 4HRMB 1A5EA 3L6AA 3R6NA 3CVYA 2XCBA 2W0GA 4ZHQE 3PH0C 4URKA 4V3IA 1Z5SC 1HF8A 1HNZT 4CQIA 3AE1A 4UWKA 3CX8B 1N32T 2XAJB 4CDRA 3ASFA 4BA9A 2ZM2A 3C4XA 4PUCA 4LERA 2UWJG 2HPJA 4JHKA 3GWHA 1S0PA 1YXRA 2XQ8A 4A3TA 2B76A 4P09A 1EF1C 1SA5A 2ZGDA 1J1JA 3AECA 3TLSA 5FQ6A 2XS8A 4PJJA 3PV0F 4X8QA 3G2UA 3KD7A 4UR9A 3MACA 4GKJT 3P4WA 5F5WA 1B89A 3SI5A 1IAPA 5ENNA 4WW0A 3RI5A 2B1EA 3JYSA 3VU7H 2BEDA 1H0AA 2R2LA 2FJEA 2OV9A 4UWLA 1DC2A 1OCCE 4PK4A 2IUBA 4BTAA 3HYMB 4JI3T 2SPCA 4DR4T 3EABA 3SHFA 2RD0A 4DBQA 4HOUA 5FY7A 2LEHA 3FBLA 3JQ0A 1PAQA 4XI9A 1OEDB 4DX2A 4Y6CA 2GRLA 4UF0A 3MA5A 4DIDB 5CRUA 4G2VA 4FLHA 4OVVA 4DNDA 2BS4A 2JJ9A 5T3RA 4LMKA 3Q5EA 3AE6A 2E2AA 2WDRA 3L09A 3ABLE 3AU5A 3M3ZB 2CBIA 4CI2B 1WFDA 4ZZCA 1J5ET 1KF6A 4GTPA 4FP7A 2PTFA 4EQFA 3Q15A 4EZHA 3EIJA 4NRHB 3I3NA 1AJ3A 2YOEA 2CXDA 3G2WA 2P9KG 2ZGGA 2J07A 2I6HA 2OOEA 4K5BA 3ETVA 3PE3A 4QFVA 1KNRA 3A5XA 2IO2C 3UMVA 2J4BA 3AS5A 4J8DA 2MOWA 2Z6EA 5ANLA 4HVBA 4IE7A 4UWFA 5FL1A 3FXDB 1H2VC 4DLOA 4NIKA 5LP6E 3MJXA 3E33A 4ILAA 2LUHA 5AQFB 4I6EA 2OCCE 5JDQA 4F1SA 2WCAA 1LRZA 4HXIA 4XKCA 3ZYQA 2BG9E 2H6IA 2V1DB 5ENQD 5DIZA 4DR2T 4LEUA 2XCCA 1E8WA 4I2ZA 1R8IA 1YQ3A 5AQUB 2W00A 2MTQA 4JI6T 4ILCA 4WWOA 3O9XA 3EDUA 2ZXWE 2A3DA 4DR6T 3Q75A 3S7DA 1OXZA 2NW9A 4EEDA 1YCSB 3UX4A 2VKHA 4YHJA 4CT4A 4FJZA 5ENPD 5LHIB 5AFUL 3D9MA 2PL2A 3FH8A 3F31A 4XEIG 4HFIA 1W3BA 2C0LA 2VWAA 4APOA 3IBPA 2JQHA 1NWMX 3UT8A 3ZSTA 3ZCIA 3ZJ2A 3HHMA 3D9IA 4LF8T 4TUUA 1Y01A 5HXCA 4H9PC 4DV5T 3Q5DA 3KFWX 4C0MA 1MX6A 2L0IA 1W0AA 4HI8A 2CHNA 4L23A 2ODVA 3AG1E 3MCXA 2JPFA 3IHYA 4B3RT 2VYIA 4LUNU 5GONE 4XZCA 3Q5WA 2R5SA 3U78A 3ONLC 1UJKA 4EYUA 5BR8T 5FQ7A 4UVBB 3ANWB 1S64A 3N5LA 2V8SE 2LSGA 3CVXA 2R02A 3PZ2A 2M67A 3FWVA 4U74A 2WZHA 5HEHA 2BVMA 4LMLA 3L22A 3C98A 1D0YA 2DIWA 3UUXB 3T1HT 2FUPA 1IKND 2DWZA 3CV0A 3KV4A 2KBXA 1D1BA 5ARGA 2ZISA 3TJPA 1Z3XA 3RIUA 3CK8A 2AXDS 5CFBA 4KYOB 2XSAA 4HWIB 3BG0B 1B7TA 2BZBA 2H89A 1ZKEA 4ZI7E 2N2NA 3QB2A 2G0UA 2BG9B 4F53A 3FY4A 3QOUA 3MZKB 2VKDA 4TWDA 1V55E 3EVYA 3PRZA 1NENA 2VQET 2NWBA 2LAHA 4P1NA 2OEWA 4G26A 4I2WA 4IYPA 1WAO1 2X9XA 3J7Yq 2AW6A 3TG4A 3RRNB 4AI6A 1IYGA 3OPCA 2Q9QD 2XS1A 5E76A 4RLYA 3VR9A 4DRXE 3PJAA 2EILE 1OXJA 2LE8A 5AQOB 1FPPA 1KEYA 2Y4TA 5J1GA 2WB5A 1DU2A 2C5IT 4OX9T 4X1YE 5A23A 1SQMA 2JQQA 3E08A 1OWNA 4U8YD 3ULEG 3I1AA 3AAAC 4LFAT 2WXKA 5JREA 4H9OC 3ABME 3UM3A 3AXJB 3FZLB 4BSXA 1WDYA 5FJYA 2V4HC 4BFRA 4EYYR 1FCHA 3NZUA 2C5JA 2AJAA 4W9RA 2X68A 4GMRA 3PS6A 3D9OA 4EHMA 1VCSA 3ML8A 3OKQA 4ANWA 4AQYT 2RA1A 2UY1A 4L2LA 2YNQA 4UV9B 4JI4T 3ML9A 2BS3A 4OYKA 2CHWA 2P9UG 5B1BE 3EI0A 5EN5D 4ERRA 2WXGA 3GZSA 3QDNA 2LNIA 3PE4A 3ZMTB 3VRAA 4IREA 2XSBA 1E8YA 3ZMUB 4I1MA 3F57A 2EIJE 3LEWA 3QK0A 4KVMA 4BSZB 3CQXC 3ZVVA 3B7RL 4WNKA 3R7QA 1M7KA 5CBNA 2HN2A 2QFCA 2GW1A 4RQIA 2VSYA 4TWFA 3UQ7A 3AAIA 2H6HA 2XQ9A 2WXOA 5IYZE 2QYWA 4YVOA 3CKCA 4MS6A 1YKEB 4A55A 1HH8A 3ZLIA 3CIRA 4K0KT 1HU3A 2KM4A 2WAUA 4O8SA 3AG4E 4LSZE 3UPVA 3Q73A 2WWUA 2CA5A 5H6QB 1ELRA 4WNEA 5EKQD 3CKBA 3UU8A 3C72A 3ZHEA 4I43A 1UG3A 1JCRA 3EDVA 4GOUA 2XHEB 5LGTB 3MKDA 3AEGA 1JWGA 4FC8A 4O6FA 4I55E 4FI5A 3RC3A 1ELWA 2XQ5A 3PTRB 3UU3A 2JLBA 3FUJA 1DCEA 3RKGA 2CG2A 3AS8A 2BG9A 3IBEA 3LXUX 4EBAA 4BJNA 1MIYA 4ANXA 3CVWA 5ITZF 3L16A 2BKOA 2GRQB 1HG2A 3ZGQA 4MALA 3V31A 4ZZBA 2L6JA 4AISA 2GRMA 4DPRA 3Q5XA 4UWGA 5LGNB 4GPKA 4JV5T 3ULYA 3O1IA 3N9MA 5DJQC 4C48B 4WBOA 4YSYA 4MRUA 3FZFB 2E9XD 2F37A 1HXIA 5FT9A 1N9AA 5JR9B 4HBDA 3TWQA 4OAUC 3QNUA 1BD8A 3HI2A 4JI2T 4LF6T 3O1HA 2EIKE 3O1JA 4ME2A 5J2TE 2KXPB 3R9MA 4DVDA 2PNNA 3FZMB 3PNLB 2L8KA 1HNWT 1JNRA 3Q47B 3RHWA 3RO3A 2IAKA 2Q7FA 4YTMA 1G73A 5BMVE 1UN9A 3B7TA 3E32A 3QC9A 3C5RA 4PFOA 3UUNA 4C90A 2WQ6A 1TEZA 2V7IA 4HI9A 3SD5A 3CVLA 4XIFA 4AJWA 5JRCA 5AQIB 2QC9A 4AIFA 1BI7B 3BU8A 1CHUA 2V7JA 1YKHB 4HLEA 2BBJA 1W9RA 1L5JA 2HN1A 3VLFA 4X5TA 4BT8A 3ESLA 4XI0A 2CHOA 2EQXA 2XPIA 3B5MA 3FUMA 4OYSA 2X0HA 4NACA 4DV4T 4GTTA 2WXHA 3UM0A 3RRCA 1HR0T 3EJNA 4HWFA 2BUGA 3EHQA 2CBJA 3V79K 4FA6A 2IFUA 2LM9A 4YJ2E 3FEYA 1GQEA 2YHEA 3SBSA 4U31A 2K5BB 1GW6A 1QQEA 1LTXA 4K03A 1LKXA 3JCFA 2A4ZA 3PU3A 3ETUA 3IA3A 2UU9T 2XEHA 2IQCA 2I1JA 1HTJF 1HNXT 5EK3A 3SQVA 4BETA 2CLYC 3TXNA 2FBNA 4ABNA 5D66A 3SZ7A 5DBKA 3MKQA 4ACLA 1U4QA 2BDEA 3FZHB 3LS8A 3HXFA 2VB6A 3FEXA 5EX3A 3RPUA 4X1IE 4K5AB 2CWYA 2WXJA 2PG8A 1BI8B 4N5CA 4GZ5A 4Y6WA 4LF5T 3PZDA 4O1OA 4CXWA 3LSVA 3JUIA 5DQVA 3ZU7B 3HRAA 2WXMA 5HWYA 3K3OA 3KSLA 1MYOA 2V7MA 1N52A 4FJOA 2DCPA 4L9PA 4KI0F 4WNFA 4MBGA 2R6GF 4HWCA 3Q9UC 2XGSA 4N2QA 1UX5A 3PUJA 4IL4A 4ISSA 2IONA 4QQIA 5JTGA 5HRYA 4H9RC 2KLQA 1T98A 5LG4A 1QUUA 5HYAA 3URZA 2PM7A 2ETCA 1YMPA 2NW7A 1P5QA 3GN5B 5AQMB 2F0YA 3DSUA 3L13A 3TWXA 2XQ3A 5L3BB 3SS1A 5LA6E 1XNQT 3E37A 1N95A 1ZV4X 2W61A 5EZYE 4AQFA 2A5UA 5CEDB 1XDOA 4EGWA 4AKIA 1BU9A 2OVFA 3B13A 3FBZA 4MBQA 3CKDA 1MX4A 4NPPA 4UI9C 3DRAA 1T72A 2M6IA 1TNBA 5KMGP 2KATA 2V8SV 5HKPA 3EU9A 3I4RB 1MHQA 2VK9A 3FU0A 3UINC 3LBXA 3TWRA 4KMOA 4CGWA 4AQFC 2QYJA 3M65A 1O1SA 1HFAA 2OV8A 4LCTA 4JI0T 4HQDA 5LCYA 1N11A 4UQYA 1UK5A 4OYJA 4CZZB 3GN5A 3ANWA 1K8KG 4FJYA 4GYYA 3AG3E 3J5QB 1OCZE 2W63A 1D8DA 1FT1A 2Q9QA 3D0TA 3QNKA 3LJCA 4ISTA 4HFBA 4BWRA 3KVAA 3ZYMA 3NAWA 4XBFB 4ATGA 1FMWA 2VL8A 3EU5A 3FUDA 4IE5A 5CRVA 3S7FA 2V7KA 5M4YA 5HQ8A 1NA3A 5HI7A 1TYQG 4CEMA 2XASB 1N4PA 2M63A 4GTRA 5L3CB 1UCUA 1DNPA 4DMVA 3DPDA 3OXLA 1UX4A 4DX7D 1JWFA 3RIBA 3UT5E 4JVSA 4UXNB 3CK7A 3FUNA 2KMFA 4AKLA 1SE7A 3CLJA 1DCQA 1I94T 5L47A 1MQSA 4N39A 4OAVB 5DQWA 3QB5K 3Q5MA 3F2EA 2VQFT 1XNRT 4B3TT 2XAGB 1WM5A 2LOSA 4EEBA 2B0OE 3L17A 4YDYA 3MEKA 4J0UA 2UXXB 1OWPA 2VGEA 3SY2A 4JI1T 3ZC0A 4CDNA 5AARA 2YKSA 4P29A 4U04A 4PJLA 2XHEA 2XAFB 4PS3A 4X62T 4C0EA 2H88A 2WWVA 4K0RA 3SFZA 3ZT7A 2LXLA 2V7LA 5G05C 1G3NB 4GA2A 3FUHA 2RKKA 3PURA 3UXGA 3P50A 4QXCB 2IMLA 3LDZA 2X9WA 3U64A 3AU4A 3NF1A 3RO2A 3RYCE 2WXRA 3ZFWA 4ILUA 3LFMA 4XZ4A 3K1SA 4TUMA 1KNZA 2XRYA 4CN6A 4KBQA 5JDGA 3DEPA 3VRBA 4APFA 4EZJA 1O5MA 2YQ8A 5LXTE 3I9YA 5AQGB 4DI3A 4BESA 4DR1T 4F3VA 2I2OA 5G05J 4A98A 4Z90A 3MYVA 4JHRA 4U2YA 2XTLA 4OK0A 4DV1T 3DWLG 4M3OA 2WQHA 1BR1A 3MJWA 4YDEA 1XMQT 2P9PG 2DCFA 3ZN1B 2KXPC 2A72A 4RG6A 4GTOA 5CMWA 3ZEFB 1IXVA 3PUAA 2WS3A 2YN6A 4IT4A 4G11A 3IXEA 2CHXA 2LOPA 2HH7A 5C8YE 5JR9C 3UT7A 2AXZA 2IHR1 1YQ4A 2Y0BG 5FWQA 2N9DA 4IDZA 3KV9A 4UQXA 4DX1A 5FY0A 2WXIA 3UFGA 1NFIE 3QUJA 1UN8A 3LCAA 3SOLA 4EECA 1TN8A 4B0ZA 2X9YA 5LFAA 3AE3A 4LG6A 3CHSA 3UM2A 3TL5A 2WDQA 4TX5A 3RIUC 4AQGA 3LK42 4CI3B 1MX2A 1V9DA 5CBOA 3U4TA 5JJ7A 5LGUB 4EV6A 3D9PA 2EINE 2UXNB 2D5UA 3SF4A 1IJ6A 3P4QA 4GK5E 5C2TA 3ZJ1A 4CDMA 2FBWA 4TXRA 4U8VD 3AXJA 3TLWA 4Z68A 5E0OA 2J8SD 2AWIA 2WBLA 5ADXL 2GK9A 2NXPA 4LF4T 3QWWA 3S7BA 1IJ5A 5J08A 2J08A 5L3EB 5CCLA 2C0SA 1SHZC 5EILA 3QB5A 3SO8A 2DVWA 2VSXE 1ZP0A 4GCOA 2E9XA 1N54A 3UULA 2C5KT 2XPYA 3I9WA 2LRKA 3FTSA 5AAOA 2QRXA 3P1UA 1NEKA 4HNAD 2FJAA 2J09A 4YHHT 2LRLA 1XWMA 5KJLA 5ABHA 2KZ7B 2UXDT 1L0VA 4DR5T 3DSTA 2A5EA 5LOZA 3RKOA 4X65T 3B7UX 5BUZA 4PK5A 4A3VA 4BTBA 1QSDA 5L2LA 2I0MA 4I6JA 1OCOE 2E5VA 3CX7B 4B93B 3UQ4A 2QZAA 3CHPA 4B94A 3DP7A 3ASDA 1UJJA 4I6GA 4GYRA 4YLHA 1TN7A 3JC6D 3GZ2A 3BQOA 4ILHB 4KT6B 2VSOE 3QJZA 3K8PC 3E30A 4JHJA 3ZMVB 3TWUA 2ZM0A 3CSFA 4A1SA 5HEOA 2A2FX 2IDOB 4J8EA 2WXQA 4HS2A 3ZIMA 4KUMB 1H6KA 3RRUA 4BX8A 2EHOA 4DX6D 3HIZA 2ZU6B 2H7OA 2YU1A 3ABKE 3RGLA 2XY8B 2HHHT 4CRWA 3X2QE 1JPLA 5HWXA 1N4QA 3O48A 1IBKT 3RJVA 2IW5B 4YDOA 5KWDA 4BAYB 3L9TA 4LNGA 1BR2A 3V5UA 3SBTB 3JXIA 1SZ9A 5L3GB 5LP0A 4H7XA 1G8XA 2A9UA 4H9NC 2X6KA 3RX6A 4WNDA 1KFYA 3UQ3A 2BG9C 3BQIA 4DX5D 5FKYA 2YEVC 2ONDA 4F1PA 5EIDA 4JLEA 3DBSA 2K3WA 2K48A 2HPLA 5JDHA 3RRMB 4H9QC 2VURA 4YFSA 5JDMA 3ZN0B 2F4VT 1E7VA 3AA1B 2X9HA 3OVUA 4QHOA 1IBLT 1TR4A 2XAQB 5EDSA 3ZHEB 5G55A 3RQUA 3DEOA 1PC2A 2UUBT 1U2VG 3N9QA 3CR3A 4X66T 2BKPA 5HEUA 5CB4E 3OTOT 1XNFA 2MHKA 3O4ZA 4HEAA 1HS7A 2BVLA 4JBWF 1IBMT 4U8HA 2MAWA 4OVUA 5H7PA 3JC6C 3PUWF 1KZOA 3AE7A 2XM2A 4J7WA 3Q49B 4I9EA 2UUAT 2BTDA 2J4DA 3TKLB 3DSVA 3FH5A 1IQRA 4U3CA 4QXBB 3HXDA 3N71A 1UGOA 4WYVA 2JQKA 3T5VA 2RFAA 2D0UA 4J8YA 3TLVA 1WCRA 2VL0A 2ETBA 3FTVA 4TRQA 5FNVE 3HVEA 3ZNGA 3MKRA 3NZSA 4TXPA 2I59A 1N34T 1FVHA 4TV8E 4UIGA 4J8FA 1H19A 4UELA 4I1OB 4L5GA 3JADA 1TN6A 1Y8MA 4IDOA 3D9KA 3JXJA 4CXYA 3Q9NC 2UXCT 5AQ7A 4XX5A 4JL0A 4GZ6A 2X6IA 3UKRG 3ZEFA 1EZ3A 5ENTD 2XAHB 2IIUA 2E2EA 3F6QA 3CVQA 3PREA 3HDXA 1HS6A 1D9SA 3D9JA 2WP9A 3TWTA 2DHRA 1FEWA 2D0TA 3FB2A 5T8IA 5BXOA 1X9BA 5BPPA 2VGXB 4KX6A 2QVAA 1T8BA 2LSKA 5EK4A 5JH7E 2J9QA 4U95D 5CHEE 2DYRE 4B3MT 3FTZA 4AKGA 2V5DA 1FVFA 3AEEA 2OVBA 2KCLA 3JCKC 5BV1A 4JI7T 3W15B 2QYUA 3I5PA 5ABEA 4JB8P 5AQNB 4O60A 1OWAA 1Z0PA 3PZ4A 4F6RD 4HFDA 4IL9A 1OUVA 2FEZA 3EUVA 2RFMA 3T1YT 4HOSA 2Y1LE 5J0ZA 4DV0T 4A56A 2NTXA 5AQBA 1O1TA 2WXNA 4NUUA 2WMOA 2LKGA 1HX1B 3KS2A 3KBTA 4NIQA 1S70B 4N5QA 1INZA 3CIAA 3C98B 2LKHA 3RQWA 3SFXA 1J5WA 4G8LA 5AENA 3AE2A 3HKBE 3TLTA 3CK6A 3APCA 4EZKA 5J2UE 4MHCA 2CLYB 3B57A 2CWOA 3LY7A 3AE5A 4Q69A 4CI1B 5L4EA 5KXJA 3ONKA 4F8HA 2Y69E 3OAWA 2WXFA 4ANUA 2KZTA 5AQVB 2P9LG 2ETAA 3TXMA 3APFA 2D2SA 5ARFA 2VKOA 4ZFHA 1NI1A 4HFCA 5FMNA 3DTOA 2L0TB 4KMCA 1OWMA 3LK2B 2XUEA 1KZPA 3BEEA 4E85A 1KT1A 3TLUA 1FT2A 1K3ZD 4CYMD 3FHEA 4CGVA 2IO3C 4TZ4C 4CN1A 5EYLA 3P8CD 4AKHA 4IE4A 5LX8A 2V6YA 3AAEB 4ZHBA 3AE4A 3ENEA 4EOZB 2NR4A 4N3AA 3PU8A 2DNXA 4LMJA 2CHZA 1N4SA 1ZB1A 1MNDA 4G25A 3BQLA 3ASGA 3E34A 5LHGB 4YNDA 2XZTG 3LJNA 5AQAA 2GROB 2XRZA 3WAKA 1YD8G 3PUZF 4UEMA 3P2BA 2JMKA 4QXHB 3ISMC 3ESKA 2ACZA 3OBVE 3APDA 3U3IA 3L8RA 2E9XB 1D0XA 5AQKB 2EHOD 1N94A 4B3ST 2BKKB 4RSYA 4ANVA 2WU5A
chains in the Genus database with same CATH topology
3L08A 4Q94A 3HL6A 1VRBA 3N2OA 1KK7A 4GZDA 4JA9A 4WAFA 5KJKA 4ADZA 3K3QC 5H6RB 3ZMSB 2FULA 4JXTA 4PH4B 2OA5A 4AV7A 5AIJA 4ZI2D 3FFLA 4KP3C 4UVAB 3C51A 3FUIA 3H37A 1IZNB 5F3JA 2CE7A 3CSTA 3UUXA 2ZLYA 5D0QD 2DI4A 3HR0A 3CMLA 4XKBA 4GA1A 3CWZB 1MIVA 2ODUA 2L3LA 1QNFA 2C0MA 5TAOA 4ANJA 4AP2A 2NTYA 3RC8A 2KCKA 3L54A 4XE0A 4EZLA 4PJNA 1NZNA 2FF4A 5FXVA 3SNXA 3FU5A 4I9CA 4EIWA 2CFZA 2V5FA 2XGOA 4HKAA 2ES0A 3MV3B 4KZCA 2LSIA 4IE6A 4O2BE 3HVEB 2YHCA 3UUMA 5CA1E 2WPVA 3N9OA 4TV9E 3CHOA 4R7LA 5CA0E 4P0AA 3EIQC 4MLPA 5BNWA 2X6FA 4ZS3A 5HAXA 2V0PA 3QC1A 3IF8B 4GK0E 4JEHB 3FTUA 4I43B 2ACXA 3IEEA 4KVOA 5AJLA 3C64A 2Q9QB 5C1DA 2CMRA 5C2YA 3NZQA 2JRKA 1S35A 3IKOB 3E4BA 2X67A 4M1PA 3JQ1A 2EHOB 1WR6A 4TUYE 1ZHCA 3NBXX 2NC9A 2XQ0A 4O4JE 1E1HB 2WXPA 5HXRA 1CUNA 2CG3A 4H63H 3IEGA 1HCIA 2V4LA 5A6CA 2LO6A 1VOMA 4PAGA 4UI9J 2CCQA 5KX5E 4E7ZA 4J2CA 3N9LA 1HX8A 5LBMA 2DLRA 1OWLA 3C4WA 4N2SA 1PY1A 3NZPA 4G2AA 4B8CB 4J6IA 5ANRA 4ILGA 1ELKA 5JDFA 4O4LE 2UY1B 2MOZA 5JHAA 2YK0A 1IHGA 4TV3A 2LSUA 4IRUA 3RK6A 2XPZA 4L9IA 1OWOA 4C9BB 4EB6E 5BV0A 1NAFA 2R59A 3N9PA 4AEZC 5FZQA 3H3AA 2E8IA 1YA0A 3ONLA 3O4XE 5F8PA 2HM8A 3FXEB 1MMDA 3EUHA 3AA6B 1X79A 5T4YA 5FP3A 5IHYA 5HXEA 4PS7A 1EPUA 3KINB 3MGBA 3MK7C 2KT9A 3GMIA 3E22E 3LBXB 5FXWA 1E7UA 4RG9A 3OYZA 2NOXA 2KWHA 3PDNA 1WY6A 3FTXA 4HOTA 3J9X1 4GA0A 1LVFA 4DBRA 1EDUA 4O4HE 3CVVA 3NQPA 3MKQB 1H2UA 3LY9A 3HKCE 2KC7A 3IV0A 5LJNA 5DABA 4J8SA 4I1AA 2PQRA 2LSYA 1DVPA 2VGXA 1WYCA 3PEVB 4JW1A 4H7YA 3EHMA 3PNTB 4PS8A 4HTEA 1WLXA 5LJMA 3ZYLA 4GMJA 4AVXA 2WQ7A 4V1Av 4WNGA 5LYJE 3GYZA 2J49A 2RP4A 2N1GA 3G2SA 5G04J 2C2LA 3FTWA 4UWHA 4FU3A 2WM9A 4PJMA 3AA0B 3RKVA 2Q9QC 3V5SA 3EHNA 4ILIA 2XGMA 4N3CA 3CHQA 4GZ3A 5AJDA 5KDMC 4IN3B 5FYMA 2FI7A 3U9WA 3D3MA 1QZ2A 4GMLA 4HOQA 3NRXA 4L2YA 4G63A 1WRDA 3VTXA 1BPOA 3S2AA 4JEUA 1HZ4A 3L3PA 2P58C 2AVPA 2JEKA 3FULA 4GYOA 5FY1A 4DLQA 3OJAA 1TJFA 3GZ1A 4C91A 4FLBA 4PW8A 3UTKA 3CPZA 4Q96A 4HFVA 4H63V 4BY6A 4YVQC 2VGYA 4GZCA 3B7SA 2P9BA 2YINA 1E90A 3CVUA 3PUSA 4EPZA 3C50A 5KJMA 4EBAG 3GA8A 4FULA 5AYWD 3QWPA 2LT3A 3FUEA 2LSJA 5FXXA 3S4UA 2CXLA 2I9CA 3D9LA 3CQGB 4AXHA 1MMGA 4LRZA 5G2NA 5L3DB 2KZTB 3LVQE 5FZRA 3ZRHA 2AXUA 2IC9A 1MIWA 1BR4A 4U07A 4U0ZA 5KCMA 2L9QA 3FH7A 2KINB 1XGWA 4I4TE 3ULQA 3AS4A 4EXTA 2KWIB 4B6XA 4AY5A 4G23A 2K24A 5G04C 3AA7B 5EX0A 3QWVA 3PE0A 3RRWA 2X51A 4Z8XA 3KVBA 3EDTB 3QKYA 4PFPA 4GCNA 4WUYA 4HGAA 4OFZA 3N9NA 1FMVA 4D10C 2H3RA 5E75A 3VHLA 2LAIA 5LHHB 4WWPA 4FHJA 4I17A 4WWNA 4WBNE 2VASA 1D0ZA 3IHRA 5LNKA 3AVSA 3OXFA 4JEUB 2IF4A 3HKEE 4GYWA 3CQCB 4U63A 4DO0A 3VLEA 4JC8A 1X5BA 2JMHA 2QA7A 5JQGE 3PVLA 2KCVA 2XEVA 3SRZA 4CT0A 3TG5A 1JUQA 1FIOA 4HN9A 3E0ZA 5A7DB 3BK9A 2NW8A 4N78D 4G24A 3R84B 2IOLA 5LCWJ 2HR2A 2Y4UA 4DMWA 2LHNA 4H9SE 2IC6A 3MXZA 3PDYA 2CFUA 1NP7A 4E7SA 3D9NA 4BT9A 1SA0E 4MKTA 2X6HA 1O3XA 3MZLB 3R9AB 3U3WA 3CVPA 3CHMA 1S94A 1U5PA 2CEAA 3VTYA 2PJQA 3T5XA 2ILRA 2MRIA 2K9AA 2IJGX 3CEQA 2KNDA 3HKDE 4BJMA 5BT1A 2WB2A 2DWGA 2HYZA 4F6RC 3WAJA 4HORA 4IHJE 4AKRB 2V26A 4GYSA 3FU6A 2VTBA 2I1KA 3Q2MA 1TJCA 2VKJA 4B89A 2CXFA 2LJLA 4PNIA 3RU0A 3I0OA 2YU2A 2Y8DA 3WXXA 3ZXSA 4PDXA 4UV8B 3QARA 4KXKB 3KBUA 4O2AE 3K3NA 4AY6A 2QGSA 4ZI3D 2IU1A 2PQNA 4MLKA 5FQ4A 5KJNA 1ZU2A 3T8OA 3RYHE 5LCWC 3LPZA 3VLDA 3PUKA 4FHKA 2X0LB 1BR0A 3Q9DA 4ZI2C 3ZN3A 3WI3A 4HE8A 1ZEEA 4KBMB 3PUGA 4QX8B 4IGUA 2RG8A 4GB9A 1US7B 5FTPA 3KV5A 5J90A 3FU3A 3MA9A 5JJ6A 2Y6XA 3Q4AB 4NQ0A 2EHOC 2BF0X 2PBIA 5M72A 3PUQA 2DBAA 3LG7A 2VQ2A 1Z6TA 3CVRA 1LF8A 2NP9A 3FUKA 1H7CA 2NSZA 3LVRE 1E8XA 4I50E 5JR9A 4IULA 4AOFA 4G1TA 4QWNB 4RVBA 2R17C 4JPSA 3OYXA 5HXSA 4K0UA 3ZPOA 3LY8A 3IHVA 1Y64B 3GW4A 4ACKA 2VTBB 2IOSA 3U66A 2PFVA 5EK2A 4L0RA 3QK6A 1UW4B 4DK5A 2VJ8A 5D0OD 3UFEA 3R7RA 5LOVE 1MNEA 4BX9A 3VKGA 3I0QA 3OTNA 1SZAA 5JDLA 3AB3B 2QY7A 3RYFE 2PM6A 1HE8A 3TGOA 2LSVA 4B8AA 4UI9K 4UF0B 4YJ3E 4EAHA 3LJ3A 4AM9A 4NURA 3ONXA 2CM0A 1VDYA 3BG1B 5BW8C 4DI4A 4KZ0A 2VSNA 3CVNA 4HFGA 4PK6A 3VKHA 3CGHA 5CCMA 3ZPJA 2Y48B 4ZOLE 4AXPA 4X1KE 4E6HA 4X20E 1IQUA 3CHRA 3LKUA 4GAAA 4L1BA 4JUYA 3OXGA 3ZMZB 2GGFA 3FP3A 4CXXA 3ZW3A 2PZIA 3G2VA 1EYHA 1D1AA 2X38A 5JDNA 3S7JA 3QAQA 2X6JA 4OHFA 4IIJE 2WVIA 3MX3A 4A1GA 2J1DG 1H2TC 3LK3B 4O4IE 2FO7A 3KEZA 3CK9A 1HO8A 3RYIE 1A17A 5FZSA 4JA7A 1MMAA 4ASKA 4L7TA 2DWKA 3N2GE 5JHBA 3FDHA 4CCAA 1WYBA 3K9IA 3AAAB 5HXHA 4QX7B 4MFRA 1Y6IA 3AVRA 4JEHA 3CX6B 3KV6A 3T8MA 3SGHA 4U72A 3TAXA 2E9XC 1D1CA 4JZYA 3LYAA 3ZC1A 3NRYA 2ZMAA 2L9BA 1YW0A 2MYSA 1U3DA 3ASHA 3RH3A 1Z3YA 2Y3AA 4DJAA 5CMYA 4GIWA 4N3BA 2X3MA 3DJBA 5ETWA 3FHNA 4U0SA 4UQZA 3ZCJA 1U3CA 4XAXB 1KT0A 3KAEA 5JJTA 4QKNA 1MMNA 2MBGA 5FXZA 4UVCB 2XQYA 3FTYA 4IE0A 3N2KE 4U0UA 1NA0A 5LBQB 1E96B 2X66A 5A1LA 5JVDE 3ZYKA 2WSSV 3FUFA 4GU5A 2ZM8A 2AXVA 4P0BA 2HO1A 2LHRA 3UT4A 2E0IA 3P7IA 4TN7B 3MV2B 4ZI3C 5L3FB 1KLXA 3KDSE 1ZBPA 4ZS2A 3SWHA 3BQKA 2WMNA 3C4ZA 1HG5A 4FADA 4F7AA 3HA4A 3I4GA 5FQ8A 5JRCB 4NUVA 3PEUB 3G2TA 4EZ4A 2H7VC 2W62A 1LVKA 2WXLA 1E8ZA 3L6AA 3R6NA 3CVYA 2XCBA 2W0GA 4ZHQE 3PH0C 4URKA 4V3IA 1HF8A 4CQIA 4UWKA 3CX8B 2XAJB 4CDRA 3ASFA 4BA9A 2ZM2A 3C4XA 4PUCA 4LERA 2UWJG 2HPJA 4JHKA 3GWHA 1S0PA 4A3TA 4P09A 1EF1C 5FQ6A 4PJJA 3G2UA 3KD7A 3MACA 1B89A 3SI5A 1IAPA 5ENNA 4WW0A 2B1EA 3JYSA 3VU7H 1H0AA 4UWLA 4PK4A 4BTAA 3HYMB 2SPCA 3SHFA 2RD0A 4DBQA 4HOUA 5FY7A 2LEHA 3FBLA 3JQ0A 1PAQA 4XI9A 4Y6CA 2GRLA 4UF0A 3MA5A 4G2VA 4FLHA 4OVVA 4DNDA 2JJ9A 5T3RA 3L09A 3AU5A 4CI2B 4FP7A 4EQFA 3Q15A 4EZHA 3EIJA 4NRHB 3I3NA 1AJ3A 2CXDA 3G2WA 2J07A 2I6HA 2OOEA 3ETVA 3PE3A 4QFVA 3A5XA 3UMVA 2J4BA 3AS5A 4J8DA 2MOWA 2Z6EA 5ANLA 4HVBA 4IE7A 4UWFA 3FXDB 1H2VC 4DLOA 5LP6E 3MJXA 4I6EA 5JDQA 4F1SA 1LRZA 4HXIA 4XKCA 3ZYQA 2V1DB 5DIZA 4LEUA 2XCCA 1E8WA 4I2ZA 2W00A 2MTQA 4WWOA 3O9XA 3EDUA 2A3DA 3S7DA 1OXZA 2NW9A 3UX4A 2VKHA 4YHJA 4CT4A 4FJZA 5LHIB 5AFUL 3D9MA 2PL2A 3FH8A 3F31A 1W3BA 2C0LA 2VWAA 4APOA 3IBPA 1NWMX 3UT8A 3ZCIA 3ZJ2A 3HHMA 3D9IA 4TUUA 5HXCA 4H9PC 4C0MA 3KFWX 2L0IA 4L23A 2ODVA 3MCXA 2JPFA 3IHYA 2VYIA 4LUNU 5GONE 4XZCA 3Q5WA 2R5SA 3U78A 1UJKA 4EYUA 5FQ7A 4UVBB 3ANWB 3N5LA 2V8SE 2LSGA 3CVXA 2M67A 3FWVA 4U74A 2BVMA 3L22A 3C98A 1D0YA 2DIWA 3UUXB 3CV0A 3KV4A 1D1BA 5ARGA 3TJPA 1Z3XA 3CK8A 4KYOB 3BG0B 1B7TA 2BZBA 1ZKEA 4ZI7E 2N2NA 3QB2A 2G0UA 4F53A 3FY4A 3QOUA 3MZKB 2VKDA 3PRZA 3EVYA 2NWBA 2LAHA 4G26A 4I2WA 4IYPA 1WAO1 2X9XA 3J7Yq 2AW6A 3TG4A 3RRNB 4AI6A 1IYGA 2Q9QD 5E76A 2LE8A 2Y4TA 5J1GA 2C5IT 4X1YE 5A23A 1SQMA 2JQQA 3E08A 1OWNA 3I1AA 2WXKA 5JREA 4H9OC 4BSXA 5FJYA 4BFRA 4EYYR 1FCHA 3NZUA 2C5JA 4W9RA 2X68A 3PS6A 3D9OA 3ML8A 3OKQA 4ANWA 2RA1A 2UY1A 4L2LA 2YNQA 4UV9B 3ML9A 4OYKA 2CHWA 4ERRA 2WXGA 3GZSA 3QDNA 2LNIA 3PE4A 3ZMTB 1E8YA 3ZMUB 4I1MA 3F57A 4KVMA 3LEWA 3QK0A 3CQXC 3ZVVA 3B7RL 4WNKA 3R7QA 2QFCA 2GW1A 2VSYA 3AAIA 2WXOA 5IYZE 4YVOA 3CKCA 4MS6A 1YKEB 4A55A 1HH8A 3ZLIA 2KM4A 1HU3A 2WAUA 4O8SA 3UPVA 4WNEA 2WWUA 2CA5A 5H6QB 1ELRA 5EKQD 3CKBA 3ZHEA 4I43A 1UG3A 3EDVA 4GOUA 2XHEB 5LGTB 3MKDA 1JWGA 4FC8A 4O6FA 4I55E 4FI5A 3RC3A 1ELWA 3PTRB 2JLBA 3FUJA 2CG2A 3AS8A 3IBEA 3LXUX 4EBAA 4BJNA 1MIYA 4ANXA 3CVWA 3L16A 1HG2A 3ZGQA 4MALA 2L6JA 2GRMA 4DPRA 3Q5XA 4UWGA 5LGNB 4GPKA 3O1IA 3N9MA 5DJQC 4WBOA 4MRUA 2E9XD 1HXIA 5FT9A 5JR9B 3HI2A 3O1HA 3O1JA 4ME2A 5J2TE 2KXPB 4DVDA 3PNLB 2L8KA 3Q47B 3RO3A 2IAKA 2Q7FA 1G73A 5BMVE 1UN9A 3B7TA 3QC9A 4PFOA 3UUNA 4C90A 2WQ6A 1TEZA 2V7IA 3SD5A 3CVLA 4XIFA 4AJWA 5JRCA 4AIFA 2V7JA 1YKHB 4HLEA 1L5JA 3VLFA 4BT8A 3ESLA 4XI0A 2EQXA 2XPIA 3FUMA 4OYSA 4NACA 2WXHA 3RRCA 3EJNA 2BUGA 4FA6A 2IFUA 2LM9A 4YJ2E 3FEYA 2YHEA 3SBSA 2K5BB 1GW6A 1QQEA 4K03A 1LKXA 2A4ZA 3PU3A 3ETUA 2IQCA 2I1JA 1HTJF 5EK3A 2CLYC 3TXNA 2FBNA 4ABNA 3SZ7A 5DBKA 3MKQA 4ACLA 1U4QA 2BDEA 3LS8A 2VB6A 3FEXA 5EX3A 3RPUA 4X1IE 2CWYA 2WXJA 2PG8A 4N5CA 4GZ5A 4Y6WA 3PZDA 4CXWA 3JUIA 5DQVA 2WXMA 5HWYA 3K3OA 2V7MA 1N52A 4FJOA 2DCPA 4WNFA 2XGSA 4N2QA 1UX5A 3PUJA 4ISSA 2IONA 4H9RC 2KLQA 1T98A 5LG4A 1QUUA 5HYAA 3URZA 2PM7A 2NW7A 1P5QA 3GN5B 3L13A 5L3BB 3SS1A 5LA6E 1ZV4X 2W61A 5EZYE 4AQFA 2A5UA 4AKIA 2OVFA 3B13A 3FBZA 4MBQA 3CKDA 4UI9C 5KMGP 2KATA 3I4RB 1MHQA 2VK9A 3FU0A 3LBXA 4KMOA 4CGWA 4AQFC 3M65A 1HFAA 2OV8A 4LCTA 5LCYA 4UQYA 4OYJA 4CZZB 3GN5A 3ANWA 4FJYA 4GYYA 2W63A 2Q9QA 3D0TA 3QNKA 3LJCA 4ISTA 4BWRA 3KVAA 3ZYMA 4XBFB 4ATGA 1FMWA 2VL8A 3FUDA 4IE5A 3S7FA 2V7KA 5M4YA 5HQ8A 1NA3A 5HI7A 4CEMA 2XASB 2M63A 5L3CB 1UCUA 1DNPA 4DMVA 3DPDA 3OXLA 1UX4A 1JWFA 3RIBA 3UT5E 4JVSA 4UXNB 3CK7A 3FUNA 2KMFA 4AKLA 3CLJA 1MQSA 4N39A 5DQWA 3Q5MA 3F2EA 2XAGB 1WM5A 2LOSA 3L17A 3MEKA 4J0UA 2UXXB 1OWPA 3ZC0A 4CDNA 4P29A 4U04A 4PJLA 2XHEA 2XAFB 4PS3A 4C0EA 4K0RA 3SFZA 2V7LA 5G05C 4GA2A 3FUHA 3PURA 4QXCB 3LDZA 2X9WA 3U64A 3AU4A 3NF1A 3RO2A 3RYCE 2WXRA 3ZFWA 4ILUA 3LFMA 4XZ4A 1KNZA 2XRYA 4KBQA 5JDGA 4APFA 4EZJA 2YQ8A 5LXTE 3I9YA 4DI3A 4F3VA 2I2OA 5G05J 3MYVA 4JHRA 2XTLA 4OK0A 4M3OA 2WQHA 1BR1A 3MJWA 2DCFA 3ZN1B 2A72A 4RG6A 5CMWA 3ZEFB 3PUAA 4G11A 2CHXA 2HH7A 2LOPA 5C8YE 5JR9C 3UT7A 2AXZA 5FWQA 2N9DA 4IDZA 3KV9A 4UQXA 5FY0A 2WXIA 3QUJA 1UN8A 3LCAA 3SOLA 4EECA 4B0ZA 2X9YA 5LFAA 3CHSA 3TL5A 4TX5A 4AQGA 3LK42 4CI3B 1V9DA 5JJ7A 3U4TA 5LGUB 3D9PA 2UXNB 2D5UA 3SF4A 1IJ6A 4GK5E 3ZJ1A 4CDMA 5E0OA 2AWIA 2WBLA 5ADXL 2GK9A 2NXPA 3QWWA 3S7BA 1IJ5A 5J08A 2J08A 5L3EB 5CCLA 2C0SA 1SHZC 2VSXE 4GCOA 2E9XA 1N54A 3UULA 2C5KT 2XPYA 3I9WA 3FTSA 3P1UA 2J09A 5KJLA 2KZ7B 5LOZA 3RKOA 3B7UX 5BUZA 4PK5A 4A3VA 4BTBA 1QSDA 5L2LA 4I6JA 3CX7B 3CHPA 4B94A 3DP7A 3ASDA 1UJJA 4I6GA 4GYRA 4YLHA 3JC6D 3GZ2A 4ILHB 4KT6B 2VSOE 3QJZA 3K8PC 4JHJA 3ZMVB 2ZM0A 3CSFA 4A1SA 2A2FX 4J8EA 2WXQA 4HS2A 3ZIMA 4KUMB 1H6KA 3RRUA 4BX8A 2EHOA 3HIZA 2ZU6B 2H7OA 2YU1A 4CRWA 1JPLA 5HWXA 3O48A 3RJVA 2IW5B 4BAYB 1BR2A 3V5UA 3SBTB 1SZ9A 5L3GB 5LP0A 4H7XA 1G8XA 4H9NC 2X6KA 3RX6A 4WNDA 3UQ3A 3BQIA 2YEVC 2ONDA 4JLEA 3DBSA 2K48A 2HPLA 5JDHA 3RRMB 4H9QC 4YFSA 5JDMA 3ZN0B 1E7VA 3AA1B 2X9HA 4QHOA 2XAQB 5EDSA 3ZHEB 5G55A 1PC2A 3N9QA 3CR3A 5CB4E 1XNFA 2MHKA 3O4ZA 4HEAA 1HS7A 2BVLA 4U8HA 4OVUA 3JC6C 3Q49B 4I9EA 2BTDA 2J4DA 3TKLB 3FH5A 1IQRA 4QXBB 3N71A 3T5VA 2D0UA 3FTVA 4TRQA 5FNVE 3HVEA 3MKRA 3NZSA 2I59A 1FVHA 4TV8E 4UIGA 4J8FA 1H19A 4UELA 4I1OB 4L5GA 1Y8MA 3D9KA 4CXYA 4XX5A 4JL0A 4GZ6A 2X6IA 3ZEFA 1EZ3A 2XAHB 2E2EA 3PREA 3CVQA 3HDXA 1HS6A 3D9JA 2DHRA 1FEWA 2D0TA 3FB2A 5T8IA 5BPPA 2VGXB 5EK4A 2LSKA 5JH7E 2J9QA 5CHEE 3FTZA 4AKGA 1FVFA 2OVBA 2KCLA 3JCKC 5BV1A 3W15B 3I5PA 1OWAA 1Z0PA 1OUVA 2FEZA 4HOSA 4A56A 2NTXA 2WXNA 4NUUA 2WMOA 3KS2A 3KBTA 1INZA 3CIAA 3C98B 5AENA 3HKBE 3APCA 4EZKA 5J2UE 4MHCA 2CLYB 3B57A 2CWOA 3LY7A 4Q69A 4CI1B 3ONKA 3OAWA 2WXFA 4ANUA 2KZTA 3TXMA 3APFA 2D2SA 5ARFA 2VKOA 5FMNA 3DTOA 2L0TB 4KMCA 1OWMA 3LK2B 2XUEA 3BEEA 4E85A 1KT1A 3FHEA 4CGVA 4TZ4C 3P8CD 4AKHA 4IE4A 5LX8A 3AAEB 3ENEA 4EOZB 4N3AA 3PU8A 2DNXA 2CHZA 4G25A 1MNDA 3BQLA 3ASGA 5LHGB 4YNDA 2XRZA 3WAKA 1YD8G 4UEMA 3P2BA 2JMKA 4QXHB 3ESKA 3OBVE 3APDA 3U3IA 2E9XB 1D0XA 2EHOD 4RSYA 4ANVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WMN A;  2WM9 A;  2WMO A;  2YIN A;  3B13 A;  3VHL A; 
#chains in the Genus database with same CATH topology
 2YDR A;  3L08 A;  4DR3 T;  4DUY T;  4Q94 A;  3HL6 A;  1VRB A;  2JAB A;  3N2O A;  2R05 A;  4GTV A;  1V54 E;  4IDN A;  1KK7 A;  4GZD A;  4JA9 A;  4WAF A;  3NKZ A;  5KJK A;  1D8E A;  4ADZ A;  5AQJ B;  3K3Q C;  2P2C P;  5H6R B;  4A5X A;  3DXM G;  3ZMS B;  5JA4 D;  2FUL A;  4JXT A;  4PH4 B;  2OA5 A;  4AV7 A;  4DR7 T;  5AIJ A;  4ZI2 D;  3FFL A;  4KP3 C;  4UVA B;  1X81 A;  3C51 A;  3FUI A;  1QBQ A;  3H37 A;  4DUI A;  1IZN B;  5AQT B;  5F3J A;  2CE7 A;  3CST A;  3UUX A;  2W67 A;  4U7Y A;  2ZLY A;  2GRN B;  5D0Q D;  3RIF A;  2DI4 A;  3HR0 A;  3CML A;  5LMU T;  4XKB A;  4GA1 A;  4YT0 A;  1O1R A;  3CWZ B;  1MIV A;  3Q78 A;  2ODU A;  2L3L A;  1QNF A;  2J4G A;  2KSR A;  1JCS A;  2C0M A;  3PUV F;  5TAO A;  4ANJ A;  4AP2 A;  2NTY A;  3RC8 A;  2KCK A;  3L54 A;  4XE0 A;  4EZL A;  3B95 A;  4PJN A;  5C3J A;  1NZN A;  3DPY A;  2FF4 A;  5FXV A;  3SNX A;  3UU6 A;  5CEC B;  2DZO A;  3FU5 A;  4I9C A;  4EIW A;  2CFZ A;  2V5F A;  2XGO A;  3AJI A;  4HKA A;  1SA4 A;  2ES0 A;  3MV3 B;  4KZC A;  3EHZ A;  2LSI A;  4IE6 A;  2XPK A;  4O2B E;  3HVE B;  2YHC A;  3UUM A;  5CA1 E;  1W0B A;  3P4R A;  2WPV A;  3N9O A;  2RPA A;  4TV9 E;  3CHO A;  4R7L A;  5CA0 E;  3UM1 A;  3A8Y C;  4P0A A;  2NYJ A;  3EIQ C;  4MLP A;  5BNW A;  2X6F A;  4ZS3 A;  5HAX A;  3Q7F A;  2H6G A;  5AQL B;  2V0P A;  2WZI A;  3JUE A;  3QC1 A;  3IF8 B;  4GK0 E;  3X1D A;  4JEH B;  3FTU A;  4K5C A;  4I43 B;  2ACX A;  3IEE A;  4KVO A;  5AJL A;  3C64 A;  2Q9Q B;  5C1D A;  2CMR A;  5C2Y A;  3C3Q A;  3NZQ A;  2BS2 A;  2JRK A;  3V2O A;  1S35 A;  3IKO B;  3E4B A;  2X67 A;  4M1P A;  1MJ0 A;  3JQ1 A;  3NBN B;  2EHO B;  1WR6 A;  4TUY E;  1ZHC A;  3NBX X;  2NC9 A;  2XQ7 A;  2XQ0 A;  5JMN D;  4KHZ F;  4O4J E;  1E1H B;  5FVL A;  2WXP A;  4JD2 G;  3ZKJ A;  5HXR A;  1CUN A;  2CPT A;  2CG3 A;  4H63 H;  3IEG A;  3KSQ A;  3AED A;  1VCT A;  1HCI A;  2V4L A;  5A6C A;  2LO6 A;  3ZKR A;  1VOM A;  4PAG A;  4UI9 J;  2CCQ A;  5KX5 E;  4E7Z A;  4HFH A;  4J2C A;  3W9G A;  3N9L A;  1HX8 A;  2V6Y B;  5LBM A;  2DLR A;  1OWL A;  3C4W A;  3SFE A;  4N2S A;  2H6F A;  1PY1 A;  3AG2 E;  3NZP A;  4G2A A;  1XMO T;  4B8C B;  4J6I A;  5ANR A;  4ILG A;  5AQS B;  1ELK A;  1JNZ A;  5JDF A;  4O4L E;  2UY1 B;  4UUC A;  4QH4 A;  2MOZ A;  5JHA A;  2YK0 A;  1IHG A;  5FL0 A;  4TV3 A;  2LSU A;  4X64 T;  4IRU A;  1UUR A;  2XPZ A;  3RK6 A;  4HFE A;  4L9I A;  1OWO A;  3V2X A;  4C9B B;  4EB6 E;  2XJ7 A;  5BV0 A;  1NAF A;  4U2Z A;  2R59 A;  3N9P A;  4AEZ C;  5FZQ A;  5CGM A;  3H3A A;  4KHP T;  2E8I A;  1YA0 A;  3ONL A;  3O4X E;  5F8P A;  4IDP A;  5KBA A;  2HM8 A;  3FXE B;  1MMD A;  2UXB T;  2MPK A;  3EUH A;  3AA6 B;  1X79 A;  5T4Y A;  5FP3 A;  5IHY A;  5HXE A;  4PS7 A;  1EPU A;  3KIN B;  3MGB A;  3MK7 C;  1AWC B;  2KT9 A;  5AQQ B;  2MYO A;  3GMI A;  3E22 E;  3LBX B;  1M62 A;  5HS0 A;  5FXW A;  4YSZ A;  1E7U A;  4RG9 A;  3OYZ A;  2NOX A;  4ZXL A;  2KWH A;  3PDN A;  1WY6 A;  5ENS D;  3FTX A;  3Q79 A;  4HOT A;  3J9X 1;  4GA0 A;  5CJ5 A;  2XM1 A;  4BER A;  1LVF A;  4DBR A;  1EDU A;  2FJD A;  4O4H E;  3CVV A;  3NQP A;  2V5C A;  3MKQ B;  1H2U A;  3QOF A;  1BLX B;  2L6B A;  3UU5 A;  3LY9 A;  3HKC E;  4NXN T;  2KC7 A;  3IV0 A;  5LJN A;  5DAB A;  4J8S A;  1RZ4 A;  1H6P A;  4I1A A;  2PQR A;  2LSY A;  3AE8 A;  1QYM A;  1DVP A;  2VGX A;  1WYC A;  3UI2 A;  3PEV B;  4JW1 A;  4H7Y A;  3EHM A;  3PNT B;  4PS8 A;  4GTS A;  4HTE A;  2BKG A;  1WLX A;  5LJM A;  4YSX A;  3ZYL A;  3T9K A;  4TNV A;  5LG3 A;  4GMJ A;  4AVX A;  2WQ7 A;  4V1A v;  2DYS E;  3UTM A;  4WNG A;  5LYJ E;  3GYZ A;  2J49 A;  4LF9 T;  1S63 A;  2RP4 A;  2N1G A;  3G2S A;  5G04 J;  2C2L A;  3FTW A;  4UWH A;  4FU3 A;  2WM9 A;  1JCQ A;  4PJM A;  3AA0 B;  3RKV A;  2Q9Q C;  5HCM A;  4YTN A;  3RSE G;  3V5S A;  3EHN A;  1T7S A;  2FJB A;  2XGM A;  4ILI A;  4N3C A;  3CHQ A;  4GZ3 A;  5AJD A;  1UOH A;  5KDM C;  4IN3 B;  5FYM A;  2FI7 A;  3U9W A;  1N0R A;  3D3M A;  4YY3 T;  4GPM A;  1QZ2 A;  4HRL A;  4GML A;  4HOQ A;  3NRX A;  4L2Y A;  4G63 A;  1WRD A;  3VTX A;  1BPO A;  3S2A A;  4JEU A;  1HZ4 A;  3L3P A;  2P58 C;  3SFD A;  2AVP A;  2JEK A;  1SUM B;  3FUL A;  2XZE A;  3NVO A;  5ABF B;  5FY1 A;  3J5P A;  4GYO A;  4CZ2 D;  4DLQ A;  3OJA A;  1TJF A;  3NOG D;  3GZ1 A;  4C91 A;  4FLB A;  4PW8 A;  3UTK A;  4Q25 A;  3CPZ A;  4Q96 A;  2WQY A;  4HFV A;  4H63 V;  4BY6 A;  4YVQ C;  4U7I A;  2VGY A;  4GZC A;  3B7S A;  2P9B A;  1E2A A;  2YIN A;  2JIW A;  1E90 A;  3CVU A;  5B3S E;  3PUS A;  5KNG A;  4EPZ A;  3C50 A;  5KJM A;  2WU2 A;  4EBA G;  3GA8 A;  4FUL A;  4GTM A;  5AYW D;  3QWP A;  3W9F A;  4ILB A;  3D9H A;  4JYA T;  3NOC D;  2LT3 A;  2LSJ A;  3FUE A;  5FXX A;  3S4U A;  2CXL A;  2I9C A;  3D9L A;  3CQG B;  4AXH A;  1MMG A;  2AE9 A;  5IY5 E;  1E7P A;  4LRZ A;  4WZX A;  5G2N A;  5ENO D;  3HXE A;  5L3D B;  2KZT B;  5FIN A;  2OEV A;  3LVQ E;  5FZR A;  3ZRH A;  2AXU A;  3T8K A;  4YTP A;  1TNY A;  3DXK G;  2IC9 A;  1MIW A;  1BR4 A;  4U07 A;  4U0Z A;  5KCM A;  2L9Q A;  4DV6 T;  3FH7 A;  4A63 B;  3TWV A;  1XZY A;  2GRR B;  5L4H A;  3ZXP A;  2KIN B;  1XGW A;  2E5L T;  4I4T E;  2M6B A;  3AS4 A;  3ULQ A;  4EXT A;  2KWI B;  4B6X A;  4AY5 A;  4G23 A;  2K24 A;  5G04 C;  3AA7 B;  5EX0 A;  3QWV A;  3SFY A;  3L82 A;  3PE0 A;  3RRW A;  3AE9 A;  2V5Q C;  2X51 A;  4Z8X A;  3KVB A;  3EDT B;  3QKY A;  4PFP A;  4GCN A;  4WUY A;  4HGA A;  4OFZ A;  2W2U A;  3A7M A;  3N9N A;  4TWH A;  1FMV A;  3NWI A;  4D10 C;  2H3R A;  5E75 A;  4DUZ T;  2CRB A;  3VHL A;  3WG7 E;  2LAI A;  5LHH B;  4WWP A;  1SW6 A;  4FHJ A;  4I17 A;  1OED C;  5HEG A;  4WWN A;  1WG0 A;  4WBN E;  2VAS A;  3RLF F;  1D0Z A;  3IHR A;  5LNK A;  3AVS A;  3OXF A;  4JEU B;  5ABF A;  4YXD A;  2IF4 A;  3HKE E;  2XEE A;  4GYW A;  3CQC B;  3FZK B;  4U63 A;  4DO0 A;  4LFC T;  3VLE A;  4JC8 A;  1X5B A;  2J62 A;  2JMH A;  2QA7 A;  3P4P A;  5JQG E;  1W09 A;  1MZC A;  2XEN A;  3PVL A;  4HB5 A;  2LLY A;  2KCV A;  2W4X A;  2XEV A;  2R03 A;  5AQR B;  3SRZ A;  4CT0 A;  3TG5 A;  3PUY F;  2ZIR A;  2IY0 C;  1JUQ A;  1FIO A;  4HN9 A;  3E0Z A;  2LXM A;  5A7D B;  5AN8 A;  3BK9 A;  2NW8 A;  4N78 D;  4G24 A;  3R84 B;  2IOL A;  5LCW J;  2HR2 A;  2Y4U A;  4YDW A;  1Q2Z A;  4DMW A;  2LHN A;  4U96 D;  4H9S E;  5EIB E;  2IC6 A;  3MXZ A;  3PDY A;  4I0U A;  4LNB A;  2CFU A;  1NP7 A;  4E7S A;  3D9N A;  5D2M C;  4BT9 A;  3Q7A A;  4IDQ A;  5KNH D;  1SA0 E;  2WDV A;  4G8K A;  4MKT A;  2X6H A;  1O3X A;  3MZL B;  3R9A B;  1NL4 A;  5CEA A;  3U3W A;  3CVP A;  3CHM A;  1S94 A;  1U5P A;  2CEA A;  1UUS A;  3VTY A;  2PJQ A;  4U7E B;  3T5X A;  2ILR A;  1LD7 A;  2MRI A;  2K9A A;  2IJG X;  3ZT5 A;  3CEQ A;  3B7B A;  1K1A A;  2KND A;  3HKD E;  4JI5 T;  4BJM A;  3UKU G;  2GRP B;  5BT1 A;  2WB2 A;  2DWG A;  2HYZ A;  4F6R C;  3WAJ A;  1OT8 A;  4HOR A;  1IHB A;  4IHJ E;  4AKR B;  2V26 A;  4GYS A;  3FU6 A;  3L39 A;  2VTB A;  4A97 A;  2I1K A;  3NB2 A;  3Q2M A;  5IUX A;  1TJC A;  2VKJ A;  4B89 A;  2CXF A;  5AQH B;  2LJL A;  4PNI A;  3RU0 A;  3I0O A;  2YU2 A;  2Y8D A;  4DV2 T;  3WXX A;  3ZXS A;  3PJA J;  2FO1 E;  4PDX A;  4UV8 B;  3QAR A;  4KXK B;  4LNU D;  1N36 T;  3P4S A;  1N0Q A;  3KBU A;  4O2A E;  3K3N A;  4AY6 A;  2WY2 A;  2QGS A;  3ABV A;  4ZI3 D;  2IU1 A;  2PQN A;  4MLK A;  5FQ4 A;  5KJN A;  1ZU2 A;  3T8O A;  3C3R A;  3RYH E;  5LCW C;  3LPZ A;  3VLD A;  3PUK A;  4FHK A;  5BXU A;  2DZN A;  2X0L B;  1BR0 A;  2LM2 A;  3Q9D A;  4ZI2 C;  4LF7 T;  3ZN3 A;  3WI3 A;  4HE8 A;  1ZEE A;  4M7C A;  4KBM B;  3UIO C;  3PUG A;  4QX8 B;  3EAM A;  4IGU A;  2XQ4 A;  2RG8 A;  2X0Y A;  2UUC T;  3LDQ B;  4GB9 A;  1US7 B;  5FTP A;  3KV5 A;  5J90 A;  3FU3 A;  1RW2 A;  3MA9 A;  2EIM E;  5JJ6 A;  2Y6X A;  3Q4A B;  3JAF A;  4U33 A;  2EHO C;  4NQ0 A;  4DV3 T;  2VVS A;  2BF0 X;  3G06 A;  1Z8U A;  2PBI A;  2XQ6 A;  3PUQ A;  4QH5 A;  3AEF A;  2DBA A;  3LG7 A;  5M72 A;  2VQ2 A;  3ASO E;  1Z6T A;  3CVR A;  1LF8 A;  1I6Z A;  2NP9 A;  3FUK A;  1H7C A;  3TWW A;  1ZOY A;  2NSZ A;  2JQ9 A;  1FJG T;  1KPS B;  3C3O A;  3LVR E;  1E8X A;  1OY3 D;  4I50 E;  5JR9 A;  4IUL A;  4AOF A;  4G1T A;  4QWN B;  4RVB A;  2R17 C;  4JPS A;  3OYX A;  4HWH A;  5HXS A;  4K0U A;  2DL1 A;  3ZPO A;  3UU4 A;  3LY8 A;  3IHV A;  4AIU A;  1N33 T;  3RF1 A;  1Y64 B;  3GW4 A;  3ZUV B;  4ACK A;  2VTB B;  2IOS A;  3U66 A;  3UUB A;  3UIP C;  5EK2 A;  2PFV A;  5HEJ A;  4L0R A;  4GTQ A;  3QK6 A;  1UW4 B;  4DK5 A;  2VJ8 A;  1TNU A;  5D0O D;  1XDP A;  3UFE A;  3R7R A;  5HCJ A;  5LOV E;  2ZM6 T;  1MNE A;  4BX9 A;  4TNW A;  3VKG A;  3I0Q A;  3OTN A;  4Z91 A;  1SZA A;  5JDL A;  4BEP A;  5IWA T;  1OCR E;  3VR8 A;  3AB3 B;  2P9I G;  2QY7 A;  2XZD G;  1K1B A;  5ABG A;  2J47 A;  5B1A E;  3RYF E;  2PM6 A;  1HE8 A;  4O1P A;  3TGO A;  2LSV A;  4B8A A;  4UI9 K;  4GKK T;  3BUA A;  3EHR A;  4UF0 B;  4YJ3 E;  4EAH A;  3LJ3 A;  4AM9 A;  4NUR A;  3ZSS A;  3ONX A;  2CM0 A;  1VDY A;  4HWD A;  3BG1 B;  5BW8 C;  4DI4 A;  2YDQ A;  4KZ0 A;  2P9N G;  2VSN A;  1WR0 A;  4TXQ A;  1YYH A;  3CVN A;  4HFG A;  5CER B;  4PK6 A;  3VKH A;  3CGH A;  2BKN A;  5CCM A;  3KEA A;  3ZPJ A;  2Y48 B;  4ZOL E;  1OED E;  4AXP A;  4X1K E;  1H6O A;  4E6H A;  4X20 E;  1IQU A;  3CHR A;  3LKU A;  5LB7 B;  2VVN A;  4GAA A;  4L1B A;  4JUY A;  4JI8 T;  3OXG A;  3ZMZ B;  2GGF A;  3FP3 A;  4CXX A;  2IEJ A;  3ZW3 A;  2PZI A;  4DV7 T;  3G2V A;  1EYH A;  1D1A A;  2X38 A;  5JDN A;  3ZT6 A;  3S7J A;  3QAQ A;  2X6J A;  2BBH A;  4OHF A;  4IIJ E;  2WVI A;  3MX3 A;  4A1G A;  2J1D G;  1H2T C;  3LK3 B;  4O4I E;  2FO7 A;  3KEZ A;  3CK9 A;  1HO8 A;  3RYI E;  1A17 A;  1TNZ A;  5FZS A;  4QH1 A;  5LMN T;  4JA7 A;  4CN4 A;  1MMA A;  4ASK A;  4L7T A;  2DWK A;  3N2G E;  5JHB A;  3FDH A;  4CCA A;  3AEA A;  1KNP A;  1WYB A;  3AAA B;  3K9I A;  5HXH A;  4QX7 B;  4HRN A;  4MFR A;  1Y6I A;  1SVX A;  3AVR A;  4JEH A;  5FIO A;  3CX6 B;  3KV6 A;  3PZ3 A;  3T8M A;  3SGH A;  4U72 A;  3TAX A;  1AP7 A;  2E9X C;  3RIA A;  1D1C A;  4JZY A;  3LYA A;  3JAE A;  3ZC1 A;  3NRY A;  2ZMA A;  2L9B A;  2HE0 A;  1YW0 A;  2P9S G;  2MYS A;  1U3D A;  3ASH A;  3RH3 A;  1Z3Y A;  2Y3A A;  4DJA A;  5CMY A;  2V6X A;  4GIW A;  3AEB A;  4N3B A;  2X3M A;  3DJB A;  5ETW A;  3FHN A;  4U0S A;  4UQZ A;  3ZCJ A;  3DSW A;  1U3C A;  4XAX B;  1KT0 A;  3KAE A;  4ATZ D;  4QKN A;  5JJT A;  1MMN A;  2MBG A;  5FXZ A;  4UVC B;  5AQP B;  5ENR D;  2XQY A;  3FTY A;  4IE0 A;  5FVK A;  3ASN E;  3N2K E;  4U0U A;  3TWS A;  3HG0 D;  1NA0 A;  5LBQ B;  1E96 B;  2X66 A;  4COF A;  5A1L A;  4LFB T;  5JVD E;  3ZYK A;  2B6C A;  1OED A;  2WSS V;  3HXB A;  3FUF A;  4GU5 A;  1LD8 A;  1QLB A;  2ZM8 A;  2AXV A;  4P0B A;  3PUX F;  2HO1 A;  2LHR A;  3UT4 A;  3RAU A;  3DSS A;  1N4R A;  2E0I A;  2D9D A;  2W66 A;  3H3M A;  1TNO A;  3DSX A;  3P7I A;  4TN7 B;  3MV2 B;  3ONJ A;  4ZI3 C;  5EYP F;  5L3F B;  1KLX A;  3V30 A;  5AQ9 A;  3KDS E;  1ZBP A;  4ZS2 A;  3SWH A;  3BQK A;  2WMN A;  2F8X K;  3C4Z A;  4NXM T;  1HG5 A;  2F8Y A;  2YDS A;  4F7A A;  3HA4 A;  3I4G A;  5FQ8 A;  4FAD A;  5JRC B;  4NUV A;  2XQA A;  3PZ1 A;  3PEU B;  3G2T A;  4EZ4 A;  2H7V C;  2W62 A;  1LVK A;  2WXL A;  4ZEY A;  3HXC A;  1E8Z A;  2OLT A;  4HLL A;  4HRM B;  1A5E A;  3L6A A;  3R6N A;  3CVY A;  2XCB A;  2W0G A;  4ZHQ E;  3PH0 C;  4URK A;  4V3I A;  1Z5S C;  1HF8 A;  1HNZ T;  4CQI A;  3AE1 A;  4UWK A;  3CX8 B;  1N32 T;  2XAJ B;  4CDR A;  3ASF A;  4BA9 A;  2ZM2 A;  3C4X A;  4PUC A;  4LER A;  2UWJ G;  2HPJ A;  4JHK A;  3GWH A;  1S0P A;  1YXR A;  2XQ8 A;  4A3T A;  2B76 A;  4P09 A;  1EF1 C;  1SA5 A;  2ZGD A;  1J1J A;  3AEC A;  3TLS A;  5FQ6 A;  2XS8 A;  4PJJ A;  3PV0 F;  4X8Q A;  3G2U A;  3KD7 A;  4UR9 A;  3MAC A;  4GKJ T;  3P4W A;  5F5W A;  1B89 A;  3SI5 A;  1IAP A;  5ENN A;  4WW0 A;  3RI5 A;  2B1E A;  3JYS A;  3VU7 H;  2BED A;  1H0A A;  2R2L A;  2FJE A;  2OV9 A;  4UWL A;  1DC2 A;  1OCC E;  4PK4 A;  2IUB A;  4BTA A;  3HYM B;  4JI3 T;  2SPC A;  4DR4 T;  3EAB A;  3SHF A;  2RD0 A;  4DBQ A;  4HOU A;  5FY7 A;  2LEH A;  3FBL A;  3JQ0 A;  1PAQ A;  4XI9 A;  1OED B;  4DX2 A;  4Y6C A;  2GRL A;  4UF0 A;  3MA5 A;  4DID B;  5CRU A;  4G2V A;  4FLH A;  4OVV A;  4DND A;  2BS4 A;  2JJ9 A;  5T3R A;  4LMK A;  3Q5E A;  3AE6 A;  2E2A A;  2WDR A;  3L09 A;  3ABL E;  3AU5 A;  3M3Z B;  2CBI A;  4CI2 B;  1WFD A;  4ZZC A;  1J5E T;  1KF6 A;  4GTP A;  4FP7 A;  2PTF A;  4EQF A;  3Q15 A;  4EZH A;  3EIJ A;  4NRH B;  3I3N A;  1AJ3 A;  2YOE A;  2CXD A;  3G2W A;  2P9K G;  2ZGG A;  2J07 A;  2I6H A;  2OOE A;  4K5B A;  3ETV A;  3PE3 A;  4QFV A;  1KNR A;  3A5X A;  2IO2 C;  3UMV A;  2J4B A;  3AS5 A;  4J8D A;  2MOW A;  2Z6E A;  5ANL A;  4HVB A;  4IE7 A;  4UWF A;  5FL1 A;  3FXD B;  1H2V C;  4DLO A;  4NIK A;  5LP6 E;  3MJX A;  3E33 A;  4ILA A;  2LUH A;  5AQF B;  4I6E A;  2OCC E;  5JDQ A;  4F1S A;  2WCA A;  1LRZ A;  4HXI A;  4XKC A;  3ZYQ A;  2BG9 E;  2H6I A;  2V1D B;  5ENQ D;  5DIZ A;  4DR2 T;  4LEU A;  2XCC A;  1E8W A;  4I2Z A;  1R8I A;  1YQ3 A;  5AQU B;  2W00 A;  2MTQ A;  4JI6 T;  4ILC A;  4WWO A;  3O9X A;  3EDU A;  2ZXW E;  2A3D A;  4DR6 T;  3Q75 A;  3S7D A;  1OXZ A;  2NW9 A;  4EED A;  1YCS B;  3UX4 A;  2VKH A;  4YHJ A;  4CT4 A;  4FJZ A;  5ENP D;  5LHI B;  5AFU L;  3D9M A;  2PL2 A;  3FH8 A;  3F31 A;  4XEI G;  4HFI A;  1W3B A;  2C0L A;  2VWA A;  4APO A;  3IBP A;  2JQH A;  1NWM X;  3UT8 A;  3ZST A;  3ZCI A;  3ZJ2 A;  3HHM A;  3D9I A;  4LF8 T;  4TUU A;  1Y01 A;  5HXC A;  4H9P C;  4DV5 T;  3Q5D A;  3KFW X;  4C0M A;  1MX6 A;  2L0I A;  1W0A A;  4HI8 A;  2CHN A;  4L23 A;  2ODV A;  3AG1 E;  3MCX A;  2JPF A;  3IHY A;  4B3R T;  2VYI A;  4LUN U;  5GON E;  4XZC A;  3Q5W A;  2R5S A;  3U78 A;  3ONL C;  1UJK A;  4EYU A;  5BR8 T;  5FQ7 A;  4UVB B;  3ANW B;  1S64 A;  3N5L A;  2V8S E;  2LSG A;  3CVX A;  2R02 A;  3PZ2 A;  2M67 A;  3FWV A;  4U74 A;  2WZH A;  5HEH A;  2BVM A;  4LML A;  3L22 A;  3C98 A;  1D0Y A;  2DIW A;  3UUX B;  3T1H T;  2FUP A;  1IKN D;  2DWZ A;  3CV0 A;  3KV4 A;  2KBX A;  1D1B A;  5ARG A;  2ZIS A;  3TJP A;  1Z3X A;  3RIU A;  3CK8 A;  2AXD S;  5CFB A;  4KYO B;  2XSA A;  4HWI B;  3BG0 B;  1B7T A;  2BZB A;  2H89 A;  1ZKE A;  4ZI7 E;  2N2N A;  3QB2 A;  2G0U A;  2BG9 B;  4F53 A;  3FY4 A;  3QOU A;  3MZK B;  2VKD A;  4TWD A;  1V55 E;  3EVY A;  3PRZ A;  1NEN A;  2VQE T;  2NWB A;  2LAH A;  4P1N A;  2OEW A;  4G26 A;  4I2W A;  4IYP A;  1WAO 1;  2X9X A;  3J7Y q;  2AW6 A;  3TG4 A;  3RRN B;  4AI6 A;  1IYG A;  3OPC A;  2Q9Q D;  2XS1 A;  5E76 A;  4RLY A;  3VR9 A;  4DRX E;  3PJA A;  2EIL E;  1OXJ A;  2LE8 A;  5AQO B;  1FPP A;  1KEY A;  2Y4T A;  5J1G A;  2WB5 A;  1DU2 A;  2C5I T;  4OX9 T;  4X1Y E;  5A23 A;  1SQM A;  2JQQ A;  3E08 A;  1OWN A;  4U8Y D;  3ULE G;  3I1A A;  3AAA C;  4LFA T;  2WXK A;  5JRE A;  4H9O C;  3ABM E;  3UM3 A;  3AXJ B;  3FZL B;  4BSX A;  1WDY A;  5FJY A;  2V4H C;  4BFR A;  4EYY R;  1FCH A;  3NZU A;  2C5J A;  2AJA A;  4W9R A;  2X68 A;  4GMR A;  3PS6 A;  3D9O A;  4EHM A;  1VCS A;  3ML8 A;  3OKQ A;  4ANW A;  4AQY T;  2RA1 A;  2UY1 A;  4L2L A;  2YNQ A;  4UV9 B;  4JI4 T;  3ML9 A;  2BS3 A;  4OYK A;  2CHW A;  2P9U G;  5B1B E;  3EI0 A;  5EN5 D;  4ERR A;  2WXG A;  3GZS A;  3QDN A;  2LNI A;  3PE4 A;  3ZMT B;  3VRA A;  4IRE A;  2XSB A;  1E8Y A;  3ZMU B;  4I1M A;  3F57 A;  2EIJ E;  3LEW A;  3QK0 A;  4KVM A;  4BSZ B;  3CQX C;  3ZVV A;  3B7R L;  4WNK A;  3R7Q A;  1M7K A;  5CBN A;  2HN2 A;  2QFC A;  2GW1 A;  4RQI A;  2VSY A;  4TWF A;  3UQ7 A;  3AAI A;  2H6H A;  2XQ9 A;  2WXO A;  5IYZ E;  2QYW A;  4YVO A;  3CKC A;  4MS6 A;  1YKE B;  4A55 A;  1HH8 A;  3ZLI A;  3CIR A;  4K0K T;  1HU3 A;  2KM4 A;  2WAU A;  4O8S A;  3AG4 E;  4LSZ E;  3UPV A;  3Q73 A;  2WWU A;  2CA5 A;  5H6Q B;  1ELR A;  4WNE A;  5EKQ D;  3CKB A;  3UU8 A;  3C72 A;  3ZHE A;  4I43 A;  1UG3 A;  1JCR A;  3EDV A;  4GOU A;  2XHE B;  5LGT B;  3MKD A;  3AEG A;  1JWG A;  4FC8 A;  4O6F A;  4I55 E;  4FI5 A;  3RC3 A;  1ELW A;  2XQ5 A;  3PTR B;  3UU3 A;  2JLB A;  3FUJ A;  1DCE A;  3RKG A;  2CG2 A;  3AS8 A;  2BG9 A;  3IBE A;  3LXU X;  4EBA A;  4BJN A;  1MIY A;  4ANX A;  3CVW A;  5ITZ F;  3L16 A;  2BKO A;  2GRQ B;  1HG2 A;  3ZGQ A;  4MAL A;  3V31 A;  4ZZB A;  2L6J A;  4AIS A;  2GRM A;  4DPR A;  3Q5X A;  4UWG A;  5LGN B;  4GPK A;  4JV5 T;  3ULY A;  3O1I A;  3N9M A;  5DJQ C;  4C48 B;  4WBO A;  4YSY A;  4MRU A;  3FZF B;  2E9X D;  2F37 A;  1HXI A;  5FT9 A;  1N9A A;  5JR9 B;  4HBD A;  3TWQ A;  4OAU C;  3QNU A;  1BD8 A;  3HI2 A;  4JI2 T;  4LF6 T;  3O1H A;  2EIK E;  3O1J A;  4ME2 A;  5J2T E;  2KXP B;  3R9M A;  4DVD A;  2PNN A;  3FZM B;  3PNL B;  2L8K A;  1HNW T;  1JNR A;  3Q47 B;  3RHW A;  3RO3 A;  2IAK A;  2Q7F A;  4YTM A;  1G73 A;  5BMV E;  1UN9 A;  3B7T A;  3E32 A;  3QC9 A;  3C5R A;  4PFO A;  3UUN A;  4C90 A;  2WQ6 A;  1TEZ A;  2V7I A;  4HI9 A;  3SD5 A;  3CVL A;  4XIF A;  4AJW A;  5JRC A;  5AQI B;  2QC9 A;  4AIF A;  1BI7 B;  3BU8 A;  1CHU A;  2V7J A;  1YKH B;  4HLE A;  2BBJ A;  1W9R A;  1L5J A;  2HN1 A;  3VLF A;  4X5T A;  4BT8 A;  3ESL A;  4XI0 A;  2CHO A;  2EQX A;  2XPI A;  3B5M A;  3FUM A;  4OYS A;  2X0H A;  4NAC A;  4DV4 T;  4GTT A;  2WXH A;  3UM0 A;  3RRC A;  1HR0 T;  3EJN A;  4HWF A;  2BUG A;  3EHQ A;  2CBJ A;  3V79 K;  4FA6 A;  2IFU A;  2LM9 A;  4YJ2 E;  3FEY A;  1GQE A;  2YHE A;  3SBS A;  4U31 A;  2K5B B;  1GW6 A;  1QQE A;  1LTX A;  4K03 A;  1LKX A;  3JCF A;  2A4Z A;  3PU3 A;  3ETU A;  3IA3 A;  2UU9 T;  2XEH A;  2IQC A;  2I1J A;  1HTJ F;  1HNX T;  5EK3 A;  3SQV A;  4BET A;  2CLY C;  3TXN A;  2FBN A;  4ABN A;  5D66 A;  3SZ7 A;  5DBK A;  3MKQ A;  4ACL A;  1U4Q A;  2BDE A;  3FZH B;  3LS8 A;  3HXF A;  2VB6 A;  3FEX A;  5EX3 A;  3RPU A;  4X1I E;  4K5A B;  2CWY A;  2WXJ A;  2PG8 A;  1BI8 B;  4N5C A;  4GZ5 A;  4Y6W A;  4LF5 T;  3PZD A;  4O1O A;  4CXW A;  3LSV A;  3JUI A;  5DQV A;  3ZU7 B;  3HRA A;  2WXM A;  5HWY A;  3K3O A;  3KSL A;  1MYO A;  2V7M A;  1N52 A;  4FJO A;  2DCP A;  4L9P A;  4KI0 F;  4WNF A;  4MBG A;  2R6G F;  4HWC A;  3Q9U C;  2XGS A;  4N2Q A;  1UX5 A;  3PUJ A;  4IL4 A;  4ISS A;  2ION A;  4QQI A;  5JTG A;  5HRY A;  4H9R C;  2KLQ A;  1T98 A;  5LG4 A;  1QUU A;  5HYA A;  3URZ A;  2PM7 A;  2ETC A;  1YMP A;  2NW7 A;  1P5Q A;  3GN5 B;  5AQM B;  2F0Y A;  3DSU A;  3L13 A;  3TWX A;  2XQ3 A;  5L3B B;  3SS1 A;  5LA6 E;  1XNQ T;  3E37 A;  1N95 A;  1ZV4 X;  2W61 A;  5EZY E;  4AQF A;  2A5U A;  5CED B;  1XDO A;  4EGW A;  4AKI A;  1BU9 A;  2OVF A;  3B13 A;  3FBZ A;  4MBQ A;  3CKD A;  1MX4 A;  4NPP A;  4UI9 C;  3DRA A;  1T72 A;  2M6I A;  1TNB A;  5KMG P;  2KAT A;  2V8S V;  5HKP A;  3EU9 A;  3I4R B;  1MHQ A;  2VK9 A;  3FU0 A;  3UIN C;  3LBX A;  3TWR A;  4KMO A;  4CGW A;  4AQF C;  2QYJ A;  3M65 A;  1O1S A;  1HFA A;  2OV8 A;  4LCT A;  4JI0 T;  4HQD A;  5LCY A;  1N11 A;  4UQY A;  1UK5 A;  4OYJ A;  4CZZ B;  3GN5 A;  3ANW A;  1K8K G;  4FJY A;  4GYY A;  3AG3 E;  3J5Q B;  1OCZ E;  2W63 A;  1D8D A;  1FT1 A;  2Q9Q A;  3D0T A;  3QNK A;  3LJC A;  4IST A;  4HFB A;  4BWR A;  3KVA A;  3ZYM A;  3NAW A;  4XBF B;  4ATG A;  1FMW A;  2VL8 A;  3EU5 A;  3FUD A;  4IE5 A;  5CRV A;  3S7F A;  2V7K A;  5M4Y A;  5HQ8 A;  1NA3 A;  5HI7 A;  1TYQ G;  4CEM A;  2XAS B;  1N4P A;  2M63 A;  4GTR A;  5L3C B;  1UCU A;  1DNP A;  4DMV A;  3DPD A;  3OXL A;  1UX4 A;  4DX7 D;  1JWF A;  3RIB A;  3UT5 E;  4JVS A;  4UXN B;  3CK7 A;  3FUN A;  2KMF A;  4AKL A;  1SE7 A;  3CLJ A;  1DCQ A;  1I94 T;  5L47 A;  1MQS A;  4N39 A;  4OAV B;  5DQW A;  3QB5 K;  3Q5M A;  3F2E A;  2VQF T;  1XNR T;  4B3T T;  2XAG B;  1WM5 A;  2LOS A;  4EEB A;  2B0O E;  3L17 A;  4YDY A;  3MEK A;  4J0U A;  2UXX B;  1OWP A;  2VGE A;  3SY2 A;  4JI1 T;  3ZC0 A;  4CDN A;  5AAR A;  2YKS A;  4P29 A;  4U04 A;  4PJL A;  2XHE A;  2XAF B;  4PS3 A;  4X62 T;  4C0E A;  2H88 A;  2WWV A;  4K0R A;  3SFZ A;  3ZT7 A;  2LXL A;  2V7L A;  5G05 C;  1G3N B;  4GA2 A;  3FUH A;  2RKK A;  3PUR A;  3UXG A;  3P50 A;  4QXC B;  2IML A;  3LDZ A;  2X9W A;  3U64 A;  3AU4 A;  3NF1 A;  3RO2 A;  3RYC E;  2WXR A;  3ZFW A;  4ILU A;  3LFM A;  4XZ4 A;  3K1S A;  4TUM A;  1KNZ A;  2XRY A;  4CN6 A;  4KBQ A;  5JDG A;  3DEP A;  3VRB A;  4APF A;  4EZJ A;  1O5M A;  2YQ8 A;  5LXT E;  3I9Y A;  5AQG B;  4DI3 A;  4BES A;  4DR1 T;  4F3V A;  2I2O A;  5G05 J;  4A98 A;  4Z90 A;  3MYV A;  4JHR A;  4U2Y A;  2XTL A;  4OK0 A;  4DV1 T;  3DWL G;  4M3O A;  2WQH A;  1BR1 A;  3MJW A;  4YDE A;  1XMQ T;  2P9P G;  2DCF A;  3ZN1 B;  2KXP C;  2A72 A;  4RG6 A;  4GTO A;  5CMW A;  3ZEF B;  1IXV A;  3PUA A;  2WS3 A;  2YN6 A;  4IT4 A;  4G11 A;  3IXE A;  2CHX A;  2LOP A;  2HH7 A;  5C8Y E;  5JR9 C;  3UT7 A;  2AXZ A;  2IHR 1;  1YQ4 A;  2Y0B G;  5FWQ A;  2N9D A;  4IDZ A;  3KV9 A;  4UQX A;  4DX1 A;  5FY0 A;  2WXI A;  3UFG A;  1NFI E;  3QUJ A;  1UN8 A;  3LCA A;  3SOL A;  4EEC A;  1TN8 A;  4B0Z A;  2X9Y A;  5LFA A;  3AE3 A;  4LG6 A;  3CHS A;  3UM2 A;  3TL5 A;  2WDQ A;  4TX5 A;  3RIU C;  4AQG A;  3LK4 2;  4CI3 B;  1MX2 A;  1V9D A;  5CBO A;  3U4T A;  5JJ7 A;  5LGU B;  4EV6 A;  3D9P A;  2EIN E;  2UXN B;  2D5U A;  3SF4 A;  1IJ6 A;  3P4Q A;  4GK5 E;  5C2T A;  3ZJ1 A;  4CDM A;  2FBW A;  4TXR A;  4U8V D;  3AXJ A;  3TLW A;  4Z68 A;  5E0O A;  2J8S D;  2AWI A;  2WBL A;  5ADX L;  2GK9 A;  2NXP A;  4LF4 T;  3QWW A;  3S7B A;  1IJ5 A;  5J08 A;  2J08 A;  5L3E B;  5CCL A;  2C0S A;  1SHZ C;  5EIL A;  3QB5 A;  3SO8 A;  2DVW A;  2VSX E;  1ZP0 A;  4GCO A;  2E9X A;  1N54 A;  3UUL A;  2C5K T;  2XPY A;  3I9W A;  2LRK A;  3FTS A;  5AAO A;  2QRX A;  3P1U A;  1NEK A;  4HNA D;  2FJA A;  2J09 A;  4YHH T;  2LRL A;  1XWM A;  5KJL A;  5ABH A;  2KZ7 B;  2UXD T;  1L0V A;  4DR5 T;  3DST A;  2A5E A;  5LOZ A;  3RKO A;  4X65 T;  3B7U X;  5BUZ A;  4PK5 A;  4A3V A;  4BTB A;  1QSD A;  5L2L A;  2I0M A;  4I6J A;  1OCO E;  2E5V A;  3CX7 B;  4B93 B;  3UQ4 A;  2QZA A;  3CHP A;  4B94 A;  3DP7 A;  3ASD A;  1UJJ A;  4I6G A;  4GYR A;  4YLH A;  1TN7 A;  3JC6 D;  3GZ2 A;  3BQO A;  4ILH B;  4KT6 B;  2VSO E;  3QJZ A;  3K8P C;  3E30 A;  4JHJ A;  3ZMV B;  3TWU A;  2ZM0 A;  3CSF A;  4A1S A;  5HEO A;  2A2F X;  2IDO B;  4J8E A;  2WXQ A;  4HS2 A;  3ZIM A;  4KUM B;  1H6K A;  3RRU A;  4BX8 A;  2EHO A;  4DX6 D;  3HIZ A;  2ZU6 B;  2H7O A;  2YU1 A;  3ABK E;  3RGL A;  2XY8 B;  2HHH T;  4CRW A;  3X2Q E;  1JPL A;  5HWX A;  1N4Q A;  3O48 A;  1IBK T;  3RJV A;  2IW5 B;  4YDO A;  5KWD A;  4BAY B;  3L9T A;  4LNG A;  1BR2 A;  3V5U A;  3SBT B;  3JXI A;  1SZ9 A;  5L3G B;  5LP0 A;  4H7X A;  1G8X A;  2A9U A;  4H9N C;  2X6K A;  3RX6 A;  4WND A;  1KFY A;  3UQ3 A;  2BG9 C;  3BQI A;  4DX5 D;  5FKY A;  2YEV C;  2OND A;  4F1P A;  5EID A;  4JLE A;  3DBS A;  2K3W A;  2K48 A;  2HPL A;  5JDH A;  3RRM B;  4H9Q C;  2VUR A;  4YFS A;  5JDM A;  3ZN0 B;  2F4V T;  1E7V A;  3AA1 B;  2X9H A;  3OVU A;  4QHO A;  1IBL T;  1TR4 A;  2XAQ B;  5EDS A;  3ZHE B;  5G55 A;  3RQU A;  3DEO A;  1PC2 A;  2UUB T;  1U2V G;  3N9Q A;  3CR3 A;  4X66 T;  2BKP A;  5HEU A;  5CB4 E;  3OTO T;  1XNF A;  2MHK A;  3O4Z A;  4HEA A;  1HS7 A;  2BVL A;  4JBW F;  1IBM T;  4U8H A;  2MAW A;  4OVU A;  5H7P A;  3JC6 C;  3PUW F;  1KZO A;  3AE7 A;  2XM2 A;  4J7W A;  3Q49 B;  4I9E A;  2UUA T;  2BTD A;  2J4D A;  3TKL B;  3DSV A;  3FH5 A;  1IQR A;  4U3C A;  4QXB B;  3HXD A;  3N71 A;  1UGO A;  4WYV A;  2JQK A;  3T5V A;  2RFA A;  2D0U A;  4J8Y A;  3TLV A;  1WCR A;  2VL0 A;  2ETB A;  3FTV A;  4TRQ A;  5FNV E;  3HVE A;  3ZNG A;  3MKR A;  3NZS A;  4TXP A;  2I59 A;  1N34 T;  1FVH A;  4TV8 E;  4UIG A;  4J8F A;  1H19 A;  4UEL A;  4I1O B;  4L5G A;  3JAD A;  1TN6 A;  1Y8M A;  4IDO A;  3D9K A;  3JXJ A;  4CXY A;  3Q9N C;  2UXC T;  5AQ7 A;  4XX5 A;  4JL0 A;  4GZ6 A;  2X6I A;  3UKR G;  3ZEF A;  1EZ3 A;  5ENT D;  2XAH B;  2IIU A;  2E2E A;  3F6Q A;  3CVQ A;  3PRE A;  3HDX A;  1HS6 A;  1D9S A;  3D9J A;  2WP9 A;  3TWT A;  2DHR A;  1FEW A;  2D0T A;  3FB2 A;  5T8I A;  5BXO A;  1X9B A;  5BPP A;  2VGX B;  4KX6 A;  2QVA A;  1T8B A;  2LSK A;  5EK4 A;  5JH7 E;  2J9Q A;  4U95 D;  5CHE E;  2DYR E;  4B3M T;  3FTZ A;  4AKG A;  2V5D A;  1FVF A;  3AEE A;  2OVB A;  2KCL A;  3JCK C;  5BV1 A;  4JI7 T;  3W15 B;  2QYU A;  3I5P A;  5ABE A;  4JB8 P;  5AQN B;  4O60 A;  1OWA A;  1Z0P A;  3PZ4 A;  4F6R D;  4HFD A;  4IL9 A;  1OUV A;  2FEZ A;  3EUV A;  2RFM A;  3T1Y T;  4HOS A;  2Y1L E;  5J0Z A;  4DV0 T;  4A56 A;  2NTX A;  5AQB A;  1O1T A;  2WXN A;  4NUU A;  2WMO A;  2LKG A;  1HX1 B;  3KS2 A;  3KBT A;  4NIQ A;  1S70 B;  4N5Q A;  1INZ A;  3CIA A;  3C98 B;  2LKH A;  3RQW A;  3SFX A;  1J5W A;  4G8L A;  5AEN A;  3AE2 A;  3HKB E;  3TLT A;  3CK6 A;  3APC A;  4EZK A;  5J2U E;  4MHC A;  2CLY B;  3B57 A;  2CWO A;  3LY7 A;  3AE5 A;  4Q69 A;  4CI1 B;  5L4E A;  5KXJ A;  3ONK A;  4F8H A;  2Y69 E;  3OAW A;  2WXF A;  4ANU A;  2KZT A;  5AQV B;  2P9L G;  2ETA A;  3TXM A;  3APF A;  2D2S A;  5ARF A;  2VKO A;  4ZFH A;  1NI1 A;  4HFC A;  5FMN A;  3DTO A;  2L0T B;  4KMC A;  1OWM A;  3LK2 B;  2XUE A;  1KZP A;  3BEE A;  4E85 A;  1KT1 A;  3TLU A;  1FT2 A;  1K3Z D;  4CYM D;  3FHE A;  4CGV A;  2IO3 C;  4TZ4 C;  4CN1 A;  5EYL A;  3P8C D;  4AKH A;  4IE4 A;  5LX8 A;  2V6Y A;  3AAE B;  4ZHB A;  3AE4 A;  3ENE A;  4EOZ B;  2NR4 A;  4N3A A;  3PU8 A;  2DNX A;  4LMJ A;  2CHZ A;  1N4S A;  1ZB1 A;  1MND A;  4G25 A;  3BQL A;  3ASG A;  3E34 A;  5LHG B;  4YND A;  2XZT G;  3LJN A;  5AQA A;  2GRO B;  2XRZ A;  3WAK A;  1YD8 G;  3PUZ F;  4UEM A;  3P2B A;  2JMK A;  4QXH B;  3ISM C;  3ESK A;  2ACZ A;  3OBV E;  3APD A;  3U3I A;  3L8R A;  2E9X B;  1D0X A;  5AQK B;  2EHO D;  1N94 A;  4B3S T;  2BKK B;  4RSY A;  4ANV A;  2WU5 A; 
#chains in the Genus database with same CATH homology
 3L08 A;  4Q94 A;  3HL6 A;  1VRB A;  3N2O A;  1KK7 A;  4GZD A;  4JA9 A;  4WAF A;  5KJK A;  4ADZ A;  3K3Q C;  5H6R B;  3ZMS B;  2FUL A;  4JXT A;  4PH4 B;  2OA5 A;  4AV7 A;  5AIJ A;  4ZI2 D;  3FFL A;  4KP3 C;  4UVA B;  3C51 A;  3FUI A;  3H37 A;  1IZN B;  5F3J A;  2CE7 A;  3CST A;  3UUX A;  2ZLY A;  5D0Q D;  2DI4 A;  3HR0 A;  3CML A;  4XKB A;  4GA1 A;  3CWZ B;  1MIV A;  2ODU A;  2L3L A;  1QNF A;  2C0M A;  5TAO A;  4ANJ A;  4AP2 A;  2NTY A;  3RC8 A;  2KCK A;  3L54 A;  4XE0 A;  4EZL A;  4PJN A;  1NZN A;  2FF4 A;  5FXV A;  3SNX A;  3FU5 A;  4I9C A;  4EIW A;  2CFZ A;  2V5F A;  2XGO A;  4HKA A;  2ES0 A;  3MV3 B;  4KZC A;  2LSI A;  4IE6 A;  4O2B E;  3HVE B;  2YHC A;  3UUM A;  5CA1 E;  2WPV A;  3N9O A;  4TV9 E;  3CHO A;  4R7L A;  5CA0 E;  4P0A A;  3EIQ C;  4MLP A;  5BNW A;  2X6F A;  4ZS3 A;  5HAX A;  2V0P A;  3QC1 A;  3IF8 B;  4GK0 E;  4JEH B;  3FTU A;  4I43 B;  2ACX A;  3IEE A;  4KVO A;  5AJL A;  3C64 A;  2Q9Q B;  5C1D A;  2CMR A;  5C2Y A;  3NZQ A;  2JRK A;  1S35 A;  3IKO B;  3E4B A;  2X67 A;  4M1P A;  3JQ1 A;  2EHO B;  1WR6 A;  4TUY E;  1ZHC A;  3NBX X;  2NC9 A;  2XQ0 A;  4O4J E;  1E1H B;  2WXP A;  5HXR A;  1CUN A;  2CG3 A;  4H63 H;  3IEG A;  1HCI A;  2V4L A;  5A6C A;  2LO6 A;  1VOM A;  4PAG A;  4UI9 J;  2CCQ A;  5KX5 E;  4E7Z A;  4J2C A;  3N9L A;  1HX8 A;  5LBM A;  2DLR A;  1OWL A;  3C4W A;  4N2S A;  1PY1 A;  3NZP A;  4G2A A;  4B8C B;  4J6I A;  5ANR A;  4ILG A;  1ELK A;  5JDF A;  4O4L E;  2UY1 B;  2MOZ A;  5JHA A;  2YK0 A;  1IHG A;  4TV3 A;  2LSU A;  4IRU A;  3RK6 A;  2XPZ A;  4L9I A;  1OWO A;  4C9B B;  4EB6 E;  5BV0 A;  1NAF A;  2R59 A;  3N9P A;  4AEZ C;  5FZQ A;  3H3A A;  2E8I A;  1YA0 A;  3ONL A;  3O4X E;  5F8P A;  2HM8 A;  3FXE B;  1MMD A;  3EUH A;  3AA6 B;  1X79 A;  5T4Y A;  5FP3 A;  5IHY A;  5HXE A;  4PS7 A;  1EPU A;  3KIN B;  3MGB A;  3MK7 C;  2KT9 A;  3GMI A;  3E22 E;  3LBX B;  5FXW A;  1E7U A;  4RG9 A;  3OYZ A;  2NOX A;  2KWH A;  3PDN A;  1WY6 A;  3FTX A;  4HOT A;  3J9X 1;  4GA0 A;  1LVF A;  4DBR A;  1EDU A;  4O4H E;  3CVV A;  3NQP A;  3MKQ B;  1H2U A;  3LY9 A;  3HKC E;  2KC7 A;  3IV0 A;  5LJN A;  5DAB A;  4J8S A;  4I1A A;  2PQR A;  2LSY A;  1DVP A;  2VGX A;  1WYC A;  3PEV B;  4JW1 A;  4H7Y A;  3EHM A;  3PNT B;  4PS8 A;  4HTE A;  1WLX A;  5LJM A;  3ZYL A;  4GMJ A;  4AVX A;  2WQ7 A;  4V1A v;  4WNG A;  5LYJ E;  3GYZ A;  2J49 A;  2RP4 A;  2N1G A;  3G2S A;  5G04 J;  2C2L A;  3FTW A;  4UWH A;  4FU3 A;  2WM9 A;  4PJM A;  3AA0 B;  3RKV A;  2Q9Q C;  3V5S A;  3EHN A;  4ILI A;  2XGM A;  4N3C A;  3CHQ A;  4GZ3 A;  5AJD A;  5KDM C;  4IN3 B;  5FYM A;  2FI7 A;  3U9W A;  3D3M A;  1QZ2 A;  4GML A;  4HOQ A;  3NRX A;  4L2Y A;  4G63 A;  1WRD A;  3VTX A;  1BPO A;  3S2A A;  4JEU A;  1HZ4 A;  3L3P A;  2P58 C;  2AVP A;  2JEK A;  3FUL A;  4GYO A;  5FY1 A;  4DLQ A;  3OJA A;  1TJF A;  3GZ1 A;  4C91 A;  4FLB A;  4PW8 A;  3UTK A;  3CPZ A;  4Q96 A;  4HFV A;  4H63 V;  4BY6 A;  4YVQ C;  2VGY A;  4GZC A;  3B7S A;  2P9B A;  2YIN A;  1E90 A;  3CVU A;  3PUS A;  4EPZ A;  3C50 A;  5KJM A;  4EBA G;  3GA8 A;  4FUL A;  5AYW D;  3QWP A;  2LT3 A;  3FUE A;  2LSJ A;  5FXX A;  3S4U A;  2CXL A;  2I9C A;  3D9L A;  3CQG B;  4AXH A;  1MMG A;  4LRZ A;  5G2N A;  5L3D B;  2KZT B;  3LVQ E;  5FZR A;  3ZRH A;  2AXU A;  2IC9 A;  1MIW A;  1BR4 A;  4U07 A;  4U0Z A;  5KCM A;  2L9Q A;  3FH7 A;  2KIN B;  1XGW A;  4I4T E;  3ULQ A;  3AS4 A;  4EXT A;  2KWI B;  4B6X A;  4AY5 A;  4G23 A;  2K24 A;  5G04 C;  3AA7 B;  5EX0 A;  3QWV A;  3PE0 A;  3RRW A;  2X51 A;  4Z8X A;  3KVB A;  3EDT B;  3QKY A;  4PFP A;  4GCN A;  4WUY A;  4HGA A;  4OFZ A;  3N9N A;  1FMV A;  4D10 C;  2H3R A;  5E75 A;  3VHL A;  2LAI A;  5LHH B;  4WWP A;  4FHJ A;  4I17 A;  4WWN A;  4WBN E;  2VAS A;  1D0Z A;  3IHR A;  5LNK A;  3AVS A;  3OXF A;  4JEU B;  2IF4 A;  3HKE E;  4GYW A;  3CQC B;  4U63 A;  4DO0 A;  3VLE A;  4JC8 A;  1X5B A;  2JMH A;  2QA7 A;  5JQG E;  3PVL A;  2KCV A;  2XEV A;  3SRZ A;  4CT0 A;  3TG5 A;  1JUQ A;  1FIO A;  4HN9 A;  3E0Z A;  5A7D B;  3BK9 A;  2NW8 A;  4N78 D;  4G24 A;  3R84 B;  2IOL A;  5LCW J;  2HR2 A;  2Y4U A;  4DMW A;  2LHN A;  4H9S E;  2IC6 A;  3MXZ A;  3PDY A;  2CFU A;  1NP7 A;  4E7S A;  3D9N A;  4BT9 A;  1SA0 E;  4MKT A;  2X6H A;  1O3X A;  3MZL B;  3R9A B;  3U3W A;  3CVP A;  3CHM A;  1S94 A;  1U5P A;  2CEA A;  3VTY A;  2PJQ A;  3T5X A;  2ILR A;  2MRI A;  2K9A A;  2IJG X;  3CEQ A;  2KND A;  3HKD E;  4BJM A;  5BT1 A;  2WB2 A;  2DWG A;  2HYZ A;  4F6R C;  3WAJ A;  4HOR A;  4IHJ E;  4AKR B;  2V26 A;  4GYS A;  3FU6 A;  2VTB A;  2I1K A;  3Q2M A;  1TJC A;  2VKJ A;  4B89 A;  2CXF A;  2LJL A;  4PNI A;  3RU0 A;  3I0O A;  2YU2 A;  2Y8D A;  3WXX A;  3ZXS A;  4PDX A;  4UV8 B;  3QAR A;  4KXK B;  3KBU A;  4O2A E;  3K3N A;  4AY6 A;  2QGS A;  4ZI3 D;  2IU1 A;  2PQN A;  4MLK A;  5FQ4 A;  5KJN A;  1ZU2 A;  3T8O A;  3RYH E;  5LCW C;  3LPZ A;  3VLD A;  3PUK A;  4FHK A;  2X0L B;  1BR0 A;  3Q9D A;  4ZI2 C;  3ZN3 A;  3WI3 A;  4HE8 A;  1ZEE A;  4KBM B;  3PUG A;  4QX8 B;  4IGU A;  2RG8 A;  4GB9 A;  1US7 B;  5FTP A;  3KV5 A;  5J90 A;  3FU3 A;  3MA9 A;  5JJ6 A;  2Y6X A;  3Q4A B;  4NQ0 A;  2EHO C;  2BF0 X;  2PBI A;  5M72 A;  3PUQ A;  2DBA A;  3LG7 A;  2VQ2 A;  1Z6T A;  3CVR A;  1LF8 A;  2NP9 A;  3FUK A;  1H7C A;  2NSZ A;  3LVR E;  1E8X A;  4I50 E;  5JR9 A;  4IUL A;  4AOF A;  4G1T A;  4QWN B;  4RVB A;  2R17 C;  4JPS A;  3OYX A;  5HXS A;  4K0U A;  3ZPO A;  3LY8 A;  3IHV A;  1Y64 B;  3GW4 A;  4ACK A;  2VTB B;  2IOS A;  3U66 A;  2PFV A;  5EK2 A;  4L0R A;  3QK6 A;  1UW4 B;  4DK5 A;  2VJ8 A;  5D0O D;  3UFE A;  3R7R A;  5LOV E;  1MNE A;  4BX9 A;  3VKG A;  3I0Q A;  3OTN A;  1SZA A;  5JDL A;  3AB3 B;  2QY7 A;  3RYF E;  2PM6 A;  1HE8 A;  3TGO A;  2LSV A;  4B8A A;  4UI9 K;  4UF0 B;  4YJ3 E;  4EAH A;  3LJ3 A;  4AM9 A;  4NUR A;  3ONX A;  2CM0 A;  1VDY A;  3BG1 B;  5BW8 C;  4DI4 A;  4KZ0 A;  2VSN A;  3CVN A;  4HFG A;  4PK6 A;  3VKH A;  3CGH A;  5CCM A;  3ZPJ A;  2Y48 B;  4ZOL E;  4AXP A;  4X1K E;  4E6H A;  4X20 E;  1IQU A;  3CHR A;  3LKU A;  4GAA A;  4L1B A;  4JUY A;  3OXG A;  3ZMZ B;  2GGF A;  3FP3 A;  4CXX A;  3ZW3 A;  2PZI A;  3G2V A;  1EYH A;  1D1A A;  2X38 A;  5JDN A;  3S7J A;  3QAQ A;  2X6J A;  4OHF A;  4IIJ E;  2WVI A;  3MX3 A;  4A1G A;  2J1D G;  1H2T C;  3LK3 B;  4O4I E;  2FO7 A;  3KEZ A;  3CK9 A;  1HO8 A;  3RYI E;  1A17 A;  5FZS A;  4JA7 A;  1MMA A;  4ASK A;  4L7T A;  2DWK A;  3N2G E;  5JHB A;  3FDH A;  4CCA A;  1WYB A;  3K9I A;  3AAA B;  5HXH A;  4QX7 B;  4MFR A;  1Y6I A;  3AVR A;  4JEH A;  3CX6 B;  3KV6 A;  3T8M A;  3SGH A;  4U72 A;  3TAX A;  2E9X C;  1D1C A;  4JZY A;  3LYA A;  3ZC1 A;  3NRY A;  2ZMA A;  2L9B A;  1YW0 A;  2MYS A;  1U3D A;  3ASH A;  3RH3 A;  1Z3Y A;  2Y3A A;  4DJA A;  5CMY A;  4GIW A;  4N3B A;  2X3M A;  3DJB A;  5ETW A;  3FHN A;  4U0S A;  4UQZ A;  3ZCJ A;  1U3C A;  4XAX B;  1KT0 A;  3KAE A;  5JJT A;  4QKN A;  1MMN A;  2MBG A;  5FXZ A;  4UVC B;  2XQY A;  3FTY A;  4IE0 A;  3N2K E;  4U0U A;  1NA0 A;  5LBQ B;  1E96 B;  2X66 A;  5A1L A;  5JVD E;  3ZYK A;  2WSS V;  3FUF A;  4GU5 A;  2ZM8 A;  2AXV A;  4P0B A;  2HO1 A;  2LHR A;  3UT4 A;  2E0I A;  3P7I A;  4TN7 B;  3MV2 B;  4ZI3 C;  5L3F B;  1KLX A;  3KDS E;  1ZBP A;  4ZS2 A;  3SWH A;  3BQK A;  2WMN A;  3C4Z A;  1HG5 A;  4FAD A;  4F7A A;  3HA4 A;  3I4G A;  5FQ8 A;  5JRC B;  4NUV A;  3PEU B;  3G2T A;  4EZ4 A;  2H7V C;  2W62 A;  1LVK A;  2WXL A;  1E8Z A;  3L6A A;  3R6N A;  3CVY A;  2XCB A;  2W0G A;  4ZHQ E;  3PH0 C;  4URK A;  4V3I A;  1HF8 A;  4CQI A;  4UWK A;  3CX8 B;  2XAJ B;  4CDR A;  3ASF A;  4BA9 A;  2ZM2 A;  3C4X A;  4PUC A;  4LER A;  2UWJ G;  2HPJ A;  4JHK A;  3GWH A;  1S0P A;  4A3T A;  4P09 A;  1EF1 C;  5FQ6 A;  4PJJ A;  3G2U A;  3KD7 A;  3MAC A;  1B89 A;  3SI5 A;  1IAP A;  5ENN A;  4WW0 A;  2B1E A;  3JYS A;  3VU7 H;  1H0A A;  4UWL A;  4PK4 A;  4BTA A;  3HYM B;  2SPC A;  3SHF A;  2RD0 A;  4DBQ A;  4HOU A;  5FY7 A;  2LEH A;  3FBL A;  3JQ0 A;  1PAQ A;  4XI9 A;  4Y6C A;  2GRL A;  4UF0 A;  3MA5 A;  4G2V A;  4FLH A;  4OVV A;  4DND A;  2JJ9 A;  5T3R A;  3L09 A;  3AU5 A;  4CI2 B;  4FP7 A;  4EQF A;  3Q15 A;  4EZH A;  3EIJ A;  4NRH B;  3I3N A;  1AJ3 A;  2CXD A;  3G2W A;  2J07 A;  2I6H A;  2OOE A;  3ETV A;  3PE3 A;  4QFV A;  3A5X A;  3UMV A;  2J4B A;  3AS5 A;  4J8D A;  2MOW A;  2Z6E A;  5ANL A;  4HVB A;  4IE7 A;  4UWF A;  3FXD B;  1H2V C;  4DLO A;  5LP6 E;  3MJX A;  4I6E A;  5JDQ A;  4F1S A;  1LRZ A;  4HXI A;  4XKC A;  3ZYQ A;  2V1D B;  5DIZ A;  4LEU A;  2XCC A;  1E8W A;  4I2Z A;  2W00 A;  2MTQ A;  4WWO A;  3O9X A;  3EDU A;  2A3D A;  3S7D A;  1OXZ A;  2NW9 A;  3UX4 A;  2VKH A;  4YHJ A;  4CT4 A;  4FJZ A;  5LHI B;  5AFU L;  3D9M A;  2PL2 A;  3FH8 A;  3F31 A;  1W3B A;  2C0L A;  2VWA A;  4APO A;  3IBP A;  1NWM X;  3UT8 A;  3ZCI A;  3ZJ2 A;  3HHM A;  3D9I A;  4TUU A;  5HXC A;  4H9P C;  4C0M A;  3KFW X;  2L0I A;  4L23 A;  2ODV A;  3MCX A;  2JPF A;  3IHY A;  2VYI A;  4LUN U;  5GON E;  4XZC A;  3Q5W A;  2R5S A;  3U78 A;  1UJK A;  4EYU A;  5FQ7 A;  4UVB B;  3ANW B;  3N5L A;  2V8S E;  2LSG A;  3CVX A;  2M67 A;  3FWV A;  4U74 A;  2BVM A;  3L22 A;  3C98 A;  1D0Y A;  2DIW A;  3UUX B;  3CV0 A;  3KV4 A;  1D1B A;  5ARG A;  3TJP A;  1Z3X A;  3CK8 A;  4KYO B;  3BG0 B;  1B7T A;  2BZB A;  1ZKE A;  4ZI7 E;  2N2N A;  3QB2 A;  2G0U A;  4F53 A;  3FY4 A;  3QOU A;  3MZK B;  2VKD A;  3PRZ A;  3EVY A;  2NWB A;  2LAH A;  4G26 A;  4I2W A;  4IYP A;  1WAO 1;  2X9X A;  3J7Y q;  2AW6 A;  3TG4 A;  3RRN B;  4AI6 A;  1IYG A;  2Q9Q D;  5E76 A;  2LE8 A;  2Y4T A;  5J1G A;  2C5I T;  4X1Y E;  5A23 A;  1SQM A;  2JQQ A;  3E08 A;  1OWN A;  3I1A A;  2WXK A;  5JRE A;  4H9O C;  4BSX A;  5FJY A;  4BFR A;  4EYY R;  1FCH A;  3NZU A;  2C5J A;  4W9R A;  2X68 A;  3PS6 A;  3D9O A;  3ML8 A;  3OKQ A;  4ANW A;  2RA1 A;  2UY1 A;  4L2L A;  2YNQ A;  4UV9 B;  3ML9 A;  4OYK A;  2CHW A;  4ERR A;  2WXG A;  3GZS A;  3QDN A;  2LNI A;  3PE4 A;  3ZMT B;  1E8Y A;  3ZMU B;  4I1M A;  3F57 A;  4KVM A;  3LEW A;  3QK0 A;  3CQX C;  3ZVV A;  3B7R L;  4WNK A;  3R7Q A;  2QFC A;  2GW1 A;  2VSY A;  3AAI A;  2WXO A;  5IYZ E;  4YVO A;  3CKC A;  4MS6 A;  1YKE B;  4A55 A;  1HH8 A;  3ZLI A;  2KM4 A;  1HU3 A;  2WAU A;  4O8S A;  3UPV A;  4WNE A;  2WWU A;  2CA5 A;  5H6Q B;  1ELR A;  5EKQ D;  3CKB A;  3ZHE A;  4I43 A;  1UG3 A;  3EDV A;  4GOU A;  2XHE B;  5LGT B;  3MKD A;  1JWG A;  4FC8 A;  4O6F A;  4I55 E;  4FI5 A;  3RC3 A;  1ELW A;  3PTR B;  2JLB A;  3FUJ A;  2CG2 A;  3AS8 A;  3IBE A;  3LXU X;  4EBA A;  4BJN A;  1MIY A;  4ANX A;  3CVW A;  3L16 A;  1HG2 A;  3ZGQ A;  4MAL A;  2L6J A;  2GRM A;  4DPR A;  3Q5X A;  4UWG A;  5LGN B;  4GPK A;  3O1I A;  3N9M A;  5DJQ C;  4WBO A;  4MRU A;  2E9X D;  1HXI A;  5FT9 A;  5JR9 B;  3HI2 A;  3O1H A;  3O1J A;  4ME2 A;  5J2T E;  2KXP B;  4DVD A;  3PNL B;  2L8K A;  3Q47 B;  3RO3 A;  2IAK A;  2Q7F A;  1G73 A;  5BMV E;  1UN9 A;  3B7T A;  3QC9 A;  4PFO A;  3UUN A;  4C90 A;  2WQ6 A;  1TEZ A;  2V7I A;  3SD5 A;  3CVL A;  4XIF A;  4AJW A;  5JRC A;  4AIF A;  2V7J A;  1YKH B;  4HLE A;  1L5J A;  3VLF A;  4BT8 A;  3ESL A;  4XI0 A;  2EQX A;  2XPI A;  3FUM A;  4OYS A;  4NAC A;  2WXH A;  3RRC A;  3EJN A;  2BUG A;  4FA6 A;  2IFU A;  2LM9 A;  4YJ2 E;  3FEY A;  2YHE A;  3SBS A;  2K5B B;  1GW6 A;  1QQE A;  4K03 A;  1LKX A;  2A4Z A;  3PU3 A;  3ETU A;  2IQC A;  2I1J A;  1HTJ F;  5EK3 A;  2CLY C;  3TXN A;  2FBN A;  4ABN A;  3SZ7 A;  5DBK A;  3MKQ A;  4ACL A;  1U4Q A;  2BDE A;  3LS8 A;  2VB6 A;  3FEX A;  5EX3 A;  3RPU A;  4X1I E;  2CWY A;  2WXJ A;  2PG8 A;  4N5C A;  4GZ5 A;  4Y6W A;  3PZD A;  4CXW A;  3JUI A;  5DQV A;  2WXM A;  5HWY A;  3K3O A;  2V7M A;  1N52 A;  4FJO A;  2DCP A;  4WNF A;  2XGS A;  4N2Q A;  1UX5 A;  3PUJ A;  4ISS A;  2ION A;  4H9R C;  2KLQ A;  1T98 A;  5LG4 A;  1QUU A;  5HYA A;  3URZ A;  2PM7 A;  2NW7 A;  1P5Q A;  3GN5 B;  3L13 A;  5L3B B;  3SS1 A;  5LA6 E;  1ZV4 X;  2W61 A;  5EZY E;  4AQF A;  2A5U A;  4AKI A;  2OVF A;  3B13 A;  3FBZ A;  4MBQ A;  3CKD A;  4UI9 C;  5KMG P;  2KAT A;  3I4R B;  1MHQ A;  2VK9 A;  3FU0 A;  3LBX A;  4KMO A;  4CGW A;  4AQF C;  3M65 A;  1HFA A;  2OV8 A;  4LCT A;  5LCY A;  4UQY A;  4OYJ A;  4CZZ B;  3GN5 A;  3ANW A;  4FJY A;  4GYY A;  2W63 A;  2Q9Q A;  3D0T A;  3QNK A;  3LJC A;  4IST A;  4BWR A;  3KVA A;  3ZYM A;  4XBF B;  4ATG A;  1FMW A;  2VL8 A;  3FUD A;  4IE5 A;  3S7F A;  2V7K A;  5M4Y A;  5HQ8 A;  1NA3 A;  5HI7 A;  4CEM A;  2XAS B;  2M63 A;  5L3C B;  1UCU A;  1DNP A;  4DMV A;  3DPD A;  3OXL A;  1UX4 A;  1JWF A;  3RIB A;  3UT5 E;  4JVS A;  4UXN B;  3CK7 A;  3FUN A;  2KMF A;  4AKL A;  3CLJ A;  1MQS A;  4N39 A;  5DQW A;  3Q5M A;  3F2E A;  2XAG B;  1WM5 A;  2LOS A;  3L17 A;  3MEK A;  4J0U A;  2UXX B;  1OWP A;  3ZC0 A;  4CDN A;  4P29 A;  4U04 A;  4PJL A;  2XHE A;  2XAF B;  4PS3 A;  4C0E A;  4K0R A;  3SFZ A;  2V7L A;  5G05 C;  4GA2 A;  3FUH A;  3PUR A;  4QXC B;  3LDZ A;  2X9W A;  3U64 A;  3AU4 A;  3NF1 A;  3RO2 A;  3RYC E;  2WXR A;  3ZFW A;  4ILU A;  3LFM A;  4XZ4 A;  1KNZ A;  2XRY A;  4KBQ A;  5JDG A;  4APF A;  4EZJ A;  2YQ8 A;  5LXT E;  3I9Y A;  4DI3 A;  4F3V A;  2I2O A;  5G05 J;  3MYV A;  4JHR A;  2XTL A;  4OK0 A;  4M3O A;  2WQH A;  1BR1 A;  3MJW A;  2DCF A;  3ZN1 B;  2A72 A;  4RG6 A;  5CMW A;  3ZEF B;  3PUA A;  4G11 A;  2CHX A;  2HH7 A;  2LOP A;  5C8Y E;  5JR9 C;  3UT7 A;  2AXZ A;  5FWQ A;  2N9D A;  4IDZ A;  3KV9 A;  4UQX A;  5FY0 A;  2WXI A;  3QUJ A;  1UN8 A;  3LCA A;  3SOL A;  4EEC A;  4B0Z A;  2X9Y A;  5LFA A;  3CHS A;  3TL5 A;  4TX5 A;  4AQG A;  3LK4 2;  4CI3 B;  1V9D A;  5JJ7 A;  3U4T A;  5LGU B;  3D9P A;  2UXN B;  2D5U A;  3SF4 A;  1IJ6 A;  4GK5 E;  3ZJ1 A;  4CDM A;  5E0O A;  2AWI A;  2WBL A;  5ADX L;  2GK9 A;  2NXP A;  3QWW A;  3S7B A;  1IJ5 A;  5J08 A;  2J08 A;  5L3E B;  5CCL A;  2C0S A;  1SHZ C;  2VSX E;  4GCO A;  2E9X A;  1N54 A;  3UUL A;  2C5K T;  2XPY A;  3I9W A;  3FTS A;  3P1U A;  2J09 A;  5KJL A;  2KZ7 B;  5LOZ A;  3RKO A;  3B7U X;  5BUZ A;  4PK5 A;  4A3V A;  4BTB A;  1QSD A;  5L2L A;  4I6J A;  3CX7 B;  3CHP A;  4B94 A;  3DP7 A;  3ASD A;  1UJJ A;  4I6G A;  4GYR A;  4YLH A;  3JC6 D;  3GZ2 A;  4ILH B;  4KT6 B;  2VSO E;  3QJZ A;  3K8P C;  4JHJ A;  3ZMV B;  2ZM0 A;  3CSF A;  4A1S A;  2A2F X;  4J8E A;  2WXQ A;  4HS2 A;  3ZIM A;  4KUM B;  1H6K A;  3RRU A;  4BX8 A;  2EHO A;  3HIZ A;  2ZU6 B;  2H7O A;  2YU1 A;  4CRW A;  1JPL A;  5HWX A;  3O48 A;  3RJV A;  2IW5 B;  4BAY B;  1BR2 A;  3V5U A;  3SBT B;  1SZ9 A;  5L3G B;  5LP0 A;  4H7X A;  1G8X A;  4H9N C;  2X6K A;  3RX6 A;  4WND A;  3UQ3 A;  3BQI A;  2YEV C;  2OND A;  4JLE A;  3DBS A;  2K48 A;  2HPL A;  5JDH A;  3RRM B;  4H9Q C;  4YFS A;  5JDM A;  3ZN0 B;  1E7V A;  3AA1 B;  2X9H A;  4QHO A;  2XAQ B;  5EDS A;  3ZHE B;  5G55 A;  1PC2 A;  3N9Q A;  3CR3 A;  5CB4 E;  1XNF A;  2MHK A;  3O4Z A;  4HEA A;  1HS7 A;  2BVL A;  4U8H A;  4OVU A;  3JC6 C;  3Q49 B;  4I9E A;  2BTD A;  2J4D A;  3TKL B;  3FH5 A;  1IQR A;  4QXB B;  3N71 A;  3T5V A;  2D0U A;  3FTV A;  4TRQ A;  5FNV E;  3HVE A;  3MKR A;  3NZS A;  2I59 A;  1FVH A;  4TV8 E;  4UIG A;  4J8F A;  1H19 A;  4UEL A;  4I1O B;  4L5G A;  1Y8M A;  3D9K A;  4CXY A;  4XX5 A;  4JL0 A;  4GZ6 A;  2X6I A;  3ZEF A;  1EZ3 A;  2XAH B;  2E2E A;  3PRE A;  3CVQ A;  3HDX A;  1HS6 A;  3D9J A;  2DHR A;  1FEW A;  2D0T A;  3FB2 A;  5T8I A;  5BPP A;  2VGX B;  5EK4 A;  2LSK A;  5JH7 E;  2J9Q A;  5CHE E;  3FTZ A;  4AKG A;  1FVF A;  2OVB A;  2KCL A;  3JCK C;  5BV1 A;  3W15 B;  3I5P A;  1OWA A;  1Z0P A;  1OUV A;  2FEZ A;  4HOS A;  4A56 A;  2NTX A;  2WXN A;  4NUU A;  2WMO A;  3KS2 A;  3KBT A;  1INZ A;  3CIA A;  3C98 B;  5AEN A;  3HKB E;  3APC A;  4EZK A;  5J2U E;  4MHC A;  2CLY B;  3B57 A;  2CWO A;  3LY7 A;  4Q69 A;  4CI1 B;  3ONK A;  3OAW A;  2WXF A;  4ANU A;  2KZT A;  3TXM A;  3APF A;  2D2S A;  5ARF A;  2VKO A;  5FMN A;  3DTO A;  2L0T B;  4KMC A;  1OWM A;  3LK2 B;  2XUE A;  3BEE A;  4E85 A;  1KT1 A;  3FHE A;  4CGV A;  4TZ4 C;  3P8C D;  4AKH A;  4IE4 A;  5LX8 A;  3AAE B;  3ENE A;  4EOZ B;  4N3A A;  3PU8 A;  2DNX A;  2CHZ A;  4G25 A;  1MND A;  3BQL A;  3ASG A;  5LHG B;  4YND A;  2XRZ A;  3WAK A;  1YD8 G;  4UEM A;  3P2B A;  2JMK A;  4QXH B;  3ESK A;  3OBV E;  3APD A;  3U3I A;  2E9X B;  1D0X A;  2EHO D;  4RSY A;  4ANV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...