2YINA

Structure of the complex between dock2 and rac1.
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
425
structure length
411
Chain Sequence
SKDNRMSCTVNLLNFYKDNNREEMYIRYLYKLRDLHLDCDNYTEAAYTLLLHTWLLKWSDEQTHRQLKETLYETIIGYFDKGKMWEEAISLCKELAEQYEMEIFDYELLSQNLIQQAKFYESIMKILRPKPDYFAVGYYGQGFPSFLRNKVFIYRGKEYERREDFQMQLMTQFPNAEKMNTTSAPGDDVKNAPGQYIQCFTVQPVLDEHPRFKNKPVPDQIINFYKSNYVQRFHYSRPVRRGTVDPENEFASMWIERTSFVTAYKLPGILRWFEVVHMSQTTISPLENAIETMSTANEKILMMINQYQSDETLPINPLSMLLNGIVDPAVMGGFAKYEKAFFTEEYVRDHPEDQDKLTHLKDLIAWQIPFLGAGIKIHEKRVSDNLRPFHDRMEECFKNLKMKVEKEYGVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Multiple Factors Confer Specific Cdc42 and Rac Protein Activation by Dedicator of Cytokinesis (Dock) Nucleotide Exchange Factors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords DEDICATOR OF CYTOKINESIS PROTEIN 2
total genus 132
structure length 411
sequence length 425
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.740 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2yinA03
1.25.40.410 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2yinA01
3B13A 2WMOA 2YINA 3VHLA 2WM9A 2WMNA
chains in the Genus database with same CATH superfamily
2Y48B 4DIDB 4LFBT 3TLTA 2WU2A 4IE0A 4U33A 5C2YA 4F53A 2A2FX 5B1AE 5EN5D 4QXBB 2VQ2A 3VR9A 2M6BA 3VRAA 5HWXA 2XPIA 3PDNA 2JMKA 4AVXA 3AG4E 4AISA 2VJ8A 1UCUA 4UWHA 5EX3A 3I0OA 4H9OC 2DNXA 3QB5K 5FZRA 1WDYA 2EILE 4TNVA 4G1TA 4J8SA 5B3SE 2AXZA 5A7DB 2AVPA 4L2YA 2FJDA 3C72A 3SQVA 3AE1A 1MHQA 3RAUA 4YT0A 1UJKA 2HO1A 4ZXLA 1TN7A 2PFVA 2Q9QD 1A17A 4JV5T 1KZOA 3GZSA 4H9RC 2MOZA 5C8YE 2CPTA 3X2QE 2VURA 3WXXA 4XKBA 2FF4A 5LGNB 4DR4T 2WXHA 4AY5A 1IHGA 3ABME 3QC9A 4UUCA 4I9CA 4UWGA 2VSYA 4EB6E 4GA1A 3RJVA 2A9UA 1HNXT 2BF0X 5LA6E 1IKND 2XS8A 1MJ0A 5L3BB 4CT0A 2XASB 4IDZA 4PFOA 1HZ4A 4MBGA 3DSXA 4JEHA 2LSYA 3WAKA 1MQSA 1WY6A 3ZT5A 4CT4A 3IA3A 4IULA 1FJGT 4HGAA 4LF7T 1FVHA 4AOFA 4OFZA 1D0ZA 4ZI7E 2WM9A 2LRLA 1Z6TA 5CRVA 5G04J 5AQPB 2X0LB 3F2EA 3MJXA 4CZZB 4CI2B 2VASA 1ELRA 4A97A 1HTJF 2DHRA 3ZMUB 3P4QA 4LUNU 1JNZA 2ZIRA 4B3TT 4GZCA 2RD0A 5L3FB 1WM5A 2E2EA 1QSDA 3KV6A 2WXJA 1E8WA 3AA1B 3L6AA 3B7TA 4ISSA 3DSVA 4CGWA 1A5EA 1G8XA 4TXQA 3UUXA 5AQTB 4CEMA 3DTOA 4CDNA 2EIKE 4QXCB 5FYMA 3C98A 3Q15A 3P4PA 1HS6A 3Q5EA 4UV8B 1KNZA 2AXVA 3IXEA 2HYZA 4NUVA 4BT8A 2MBGA 3SZ7A 1SW6A 3UINC 2K9AA 4AKIA 1OCCE 1O1TA 3NKZA 2WDVA 3PJAA 4I9EA 2KZTB 5ITZF 1WAO1 3L54A 3QOFA 4ILGA 4GYRA 2KWHA 1LRZA 1T8BA 3JXIA 4IDQA 2XS1A 4UELA 2W62A 5AQKB 2XHEA 1UN9A 3ENEA 5CBOA 4UVBB 4M1PA 3TLWA 4J0UA 4Z90A 1W9RA 3C4XA 3ZYMA 5ENNA 5FY1A 3BQKA 1ZV4X 4X1IE 3OJAA 4FJOA 3PVLA 5AQJB 5ARGA 3RRCA 1XNFA 4FHKA 3DBSA 1OEDA 2XAGB 4X20E 4IE6A 1N0QA 2VWAA 2P2CP 5J08A 2A72A 2WQ7A 3AE7A 4YSXA 4NXNT 3KBUA 2J9QA 4G25A 3TL5A 1E2AA 3I9WA 1OT8A 2C5JA 1YMPA 4DR1T 4G8KA 2BVLA 4WWPA 3LY7A 1D1BA 3OTOT 4JUYA 3QDNA 3UQ3A 4N5CA 3AXJA 3QNUA 1EZ3A 4DI3A 2DI4A 4ILBA 1ZBPA 4GTOA 4HRMB 3KEZA 4TXRA 5CECB 4FADA 4BX9A 3DSUA 2YQ8A 4ZS3A 3LVQE 3LK3B 3EIJA 3PE4A 4RVBA 5JMND 2Y69E 3FTZA 2D9DA 2DWGA 3PS6A 3U66A 4JA9A 2QVAA 2WDRA 2WXPA 4KBMB 4QWNB 4IDNA 3E4BA 2RA1A 5KCMA 4LF5T 3S7BA 1EYHA 2D2SA 2W63A 2D0UA 5ARFA 3JXJA 2HR2A 2BVMA 3HI2A 2V7MA 3UU5A 2ZM0A 3UT4A 1LTXA 2L6BA 4CRWA 4DV2T 3RF1A 3FEYA 2H6GA 3QWVA 3GN5B 3TXNA 2XQ6A 2L3LA 3RKGA 4X66T 2L9QA 4TV3A 4KX6A 3D9JA 4EOZB 5FQ6A 1J5ET 5E0OA 1N4PA 1D8EA 4BEPA 5ENQD 2MYOA 4IIJE 1N4RA 3UUNA 4CI3B 3TWTA 4N78D 2LJLA 3EABA 2VVSA 2HH7A 4HWIB 3ULEG 3ANWB 5LYJE 3PUJA 4DR3T 1Y01A 4KI0F 1N34T 3CVLA 3PREA 5JR9A 4KZCA 4GCNA 4HI8A 3SFEA 2KNDA 3ASNE 3C50A 2CFZA 3C51A 2V6XA 3UU4A 3CHPA 1W0AA 3CR3A 3NZPA 2HE0A 5F8PA 3LJNA 1WCRA 3G2VA 1IHBA 5HEGA 3PURA 2P9IG 5T8IA 1OEDB 3JC6D 5CGMA 4H63V 4N3AA 3T1HT 1UK5A 2H7VC 4GPKA 2BZBA 5LOVE 3P7IA 5AQUB 4XEIG 4NACA 2E9XD 5M72A 2F4VT 3UT8A 1H0AA 2YNQA 1H2TC 4ZFHA 4FU3A 1HF8A 4IGUA 4W9RA 4FI5A 2UXBT 2X9HA 2XY8B 3AG1E 5DQWA 1FMVA 3D9LA 3ASDA 3FBZA 3N9QA 3A7MA 3EHMA 3UX4A 3TWVA 4K0UA 5KDMC 4PJLA 3S7FA 2NP9A 5AQOB 4NURA 3AXJB 3EDTB 3LG7A 2E5VA 2X67A 2DWZA 3AS4A 5LXTE 1SE7A 1KLXA 2DYRE 3FTWA 4UVAB 3KAEA 3Q5MA 3H3AA 3R7RA 1SA0E 4F1SA 4V1Av 4O60A 3CK8A 4B8AA 4EBAG 4B0ZA 2V8SV 1KNPA 3KV9A 4DLQA 3APFA 4XZCA 3P2BA 5FINA 3B7SA 3DSWA 1OWPA 2X68A 3SFDA 3PH0C 4JI7T 1N33T 3CK9A 1NP7A 5AJLA 3ZMZB 2IC6A 2BKPA 3CVQA 3GN5A 5C2TA 3B7BA 2CA5A 4PW8A 1MX4A 2CBJA 3DPDA 5ABEA 3RRNB 2QRXA 2IONA 4A63B 2W4XA 3NZQA 4GK5E 1U3DA 5CERB 3ANWA 3PRZA 3KBTA 4WYVA 4AEZC 3ZKRA 2CRBA 1AP7A 5FNVE 2VSXE 3CVNA 4E7SA 4WZXA 2KWIB 2QA7A 4TUMA 4H9QC 3L13A 2X9WA 3JCFA 4XX5A 2Y3AA 4MLKA 4QX8B 4U74A 5BXOA 4EAHA 2X66A 1UX4A 2KT9A 4KT6B 2KZ7B 3P1UA 2ZLYA 3AG2E 1CHUA 2ODVA 4YSZA 3N9OA 3R9MA 3P50A 2XPKA 4AI6A 4KYOB 4L0RA 4GPMA 3CVRA 3PUGA 2F0YA 2HN2A 4HE8A 3ZYLA 1OWLA 5HXSA 5BT1A 5L3EB 3OTNA 4U95D 4LSZE 4TWHA 2M6IA 4YDYA 3RU0A 2GW1A 4K0RA 3W9GA 1KNRA 2I1KA 1SA5A 1X5BA 2EHOC 1AJ3A 4F1PA 2X3MA 1YXRA 1O3XA 1T72A 4L9PA 2HPLA 3HKBE 3Q49B 3MA9A 3T8MA 3AJIA 4DV4T 1W0BA 2W00A 5CBNA 4UEMA 4GTRA 3MJWA 2DCFA 4RSYA 3AAEB 5L3CB 2IOLA 2IU1A 3ZXSA 2YK0A 3P4WA 3TAXA 3HYMB 4ILHB 3T1YT 3L3PA 3LJ3A 3ONLC 2Q9QB 2KCKA 3KV5A 3K3QC 3B13A 2V5FA 4ZZBA 3OAWA 2Y6XA 1JCQA 3TLVA 4DV5T 3PEVB 2KM4A 2UXNB 2LRKA 2CLYC 2R05A 1N36T 4UI9C 4UF0B 2ILRA 4JD2G 2P9SG 2E0IA 2JJ9A 5F3JA 2LAHA 4NPPA 4N3CA 4BESA 4OAVB 3V31A 2DLRA 2MRIA 4N5QA 5FXXA 1MIVA 4GMLA 4ZS2A 3NOCD 3I9YA 1WR0A 3TLUA 4J8DA 4CXWA 3T8KA 5JHAA 4U2ZA 1QBQA 1JPLA 2RFMA 4A1SA 4P0BA 4AXPA 1BR4A 5FVKA 2J47A 2P9LG 3SBSA 2R2LA 4K03A 1NZNA 1UURA 3I3NA 1ZOYA 2YOEA 1NENA 5D0OD 3CHQA 2BKKB 3ZKJA 3LY8A 5BUZA 1NA3A 4H7YA 3LPZA 1KZPA 5FJYA 5FXVA 4FHJA 5EIDA 5HKPA 1HX1B 4F7AA 4ABNA 3FULA 2PNNA 4XE0A 3SY2A 3D9IA 5D66A 4FP7A 5DBKA 2YDQA 4GTMA 3NWIA 4ANUA 3FU3A 4PJJA 3UU8A 1MZCA 4AJWA 3PUWF 1GW6A 2XEEA 4DPRA 2VGYA 3NRXA 2WXRA 2MAWA 2XSAA 2C0SA 3GWHA 5H7PA 3ZW3A 3CHRA 3UI2A 1XDOA 4DV1T 3D9OA 4O2AE 2QZAA 3U78A 1K3ZD 1BI8B 4U0UA 4EZKA 4L7TA 2UUAT 3FB2A 4XIFA 1U5PA 2QY7A 4GZDA 1H6PA 3VU7H 2D5UA 2C0MA 5JRCB 3ZCIA 3GZ2A 5H6RB 4R7LA 4ATZD 2XEVA 2ZU6B 2JQKA 4Z91A 4AQGA 2GROB 3Q2MA 2I59A 3PUQA 1XGWA 4ZI3D 3PNTB 3ZHEA 2P9NG 5JJ7A 4KVOA 5A6CA 1I94T 3BQLA 4YTPA 2RG8A 3C3RA 4CQIA 3Q4AB 5BR8T 4HFBA 1E96B 4P1NA 3SO8A 4EZHA 5CHEE 4GAAA 1BR2A 5AARA 4U0ZA 4DV7T 3L39A 3E34A 3MKDA 2NYJA 1MMAA 3S2AA 3LJCA 5ETWA 1IBKT 1OCRE 3UTKA 4U31A 2WXQA 2UU9T 4N39A 3RIAA 1YKEB 4PS8A 4U8HA 5LOZA 1MX6A 3FHNA 4B3ST 5HXCA 2IAKA 4EYYR 4YFSA 3SNXA 3ISMC 3DRAA 4TWDA 2C5KT 4DX6D 3V2XA 4TRQA 4O4IE 3T5XA 3CMLA 5AQHB 2IO3C 3VHLA 2K24A 2LM9A 1DCQA 2W66A 4UWKA 5FWQA 3Q9DA 4TX5A 3FXDB 3IHRA 3Q7AA 1UJJA 2DBAA 2R59A 3CEQA 4U2YA 3DEOA 4WWOA 2KXPC 4NIQA 3AVRA 4ZI2C 4DJAA 2XSBA 4HI9A 4BAYB 5L3DB 2BKNA 4G26A 2IHR1 2WU5A 3AE5A 4IHJE 2IOSA 1D0YA 2LNIA 1SHZC 3CHSA 3SF4A 4B94A 2EINE 2LO6A 4HWHA 2LHRA 4JZYA 4ZEYA 4GIWA 4U07A 2V26A 1FT2A 2A3DA 2X9YA 4MLPA 4GYYA 3GYZA 3EI0A 4ILCA 4ISTA 4JYAT 2ES0A 1L5JA 3UM1A 1M7KA 2WB5A 4DV0T 3RX6A 4K5BA 2VK9A 3CKBA 4P29A 1S0PA 4U96D 2LKHA 2HPJA 3WAJA 1KFYA 4YXDA 2CXLA 3JADA 3L08A 3CX6B 3PTRB 3ZIMA 4GKJT 1T98A 2V1DB 5ABFA 4B93B 5DJQC 3MKQB 2YU1A 3ULYA 3QWWA 3R7QA 3CIRA 5D2MC 3UTMA 3DSTA 4I1MA 4DR7T 1NAFA 4F3VA 2PZIA 5GONE 2BUGA 2IEJA 4ADZA 1E7VA 3FU5A 4HRLA 2YKSA 3HXCA 4PK4A 2LXLA 3MCXA 2CFUA 2E8IA 2OVBA 4QH4A 2QYUA 1PAQA 3UU6A 4O4JE 4GTVA 3FUDA 4JEUB 4GCOA 4AQFA 3CKCA 2KINB 4U7IA 4CI1B 3PUVF 2I2OA 3VLFA 1Z3YA 4LFAT 3FTVA 1YKHB 2F8YA 3T9KA 5B1BE 3ZPOA 1UG3A 2FUPA 3ETUA 3ZC0A 1LD8A 3CHOA 5G55A 2I6HA 1U3CA 4A55A 3LVRE 3CVWA 2XAFB 5CB4E 5FIOA 4MS6A 3PUAA 4FLBA 3TWQA 4HRNA 4HLLA 2WMOA 5KNHD 2AW6A 4WW0A 5D0QD 3KSQA 2V0PA 5ENSD 3BG0B 4NUUA 2J1DG 5KXJA 5LP0A 4QH5A 4YHHT 4GA0A 4I2WA 4C48B 4DO0A 3Q7FA 4IE5A 3B95A 2IJGX 4WAFA 1UGOA 3U3WA 5BW8C 1E8ZA 2Q7FA 1IZNB 2WXKA 2CWOA 4HWCA 4LF6T 2LT3A 3P8CD 4IREA 4O4HE 4HFCA 4DR2T 1OY3D 3HXBA 4BERA 2LSUA 3VR8A 3UUXB 3D0TA 2ZISA 3CV0A 4QKNA 3EUHA 1DVPA 3QB2A 5J2UE 4H9PC 3PJAJ 5JDMA 3TWXA 3FZFB 2V5CA 1PY1A 1Z5SC 1ELWA 1TJCA 4EECA 3SS1A 2WP9A 2DL1A 2J08A 1Y6IA 4Y6WA 2XQ9A 1WLXA 2CM0A 4OVUA 3JUEA 1TR4A 2VGXA 2LLYA 4F6RC 2XJ7A 3ZSSA 3BEEA 3QUJA 3NB2A 5IY5E 2GRQB 2Z6EA 1BR1A 2EHOA 1IXVA 1TN6A 3AEDA 1M62A 2WPVA 2Q9QA 3ZN1B 2WSSV 3WI3A 5AQIB 4IL9A 3UU3A 3Q75A 2OEVA 4HWDA 1N11A 4TNWA 4HFIA 2ACXA 4LF4T 4ILUA 1E8YA 4PK5A 4JBWF 5JDQA 4DLOA 2YDSA 1YQ3A 4YJ3E 5HEOA 1HNZT 4PAGA 5ABGA 2NXPA 4GZ6A 1K8KG 2UXCT 4BJNA 4LEUA 1V55E 4COFA 3CHMA 3BUAA 3D3MA 3EJNA 5FZSA 2R17C 3FH8A 3MA5A 4JC8A 4EXTA 2FO7A 2CEAA 5EKQD 2NWBA 4H9NC 5FL1A 1O1SA 3IHVA 1S35A 4X62T 3D9HA 3V30A 5AQRB 4HOTA 3LBXB 5ABHA 3ULQA 5AQGB 2Y0BG 3DEPA 2Q9QC 2H7OA 4DR6T 4DRXE 3SBTB 2XM1A 3CSFA 4O8SA 3AEAA 4WWNA 2KATA 2EHOD 4ANVA 5LP6E 4E7ZA 5AQFB 2K48A 3UFEA 3RHWA 3MKRA 1US7B 3N2GE 5ADXL 2V7KA 2KMFA 1JUQA 3Q5DA 2WWVA 2NC9A 2VSOE 4WNFA 3G2SA 3J7Yq 4IN3B 4ACKA 3RRWA 4MFRA 1NWMX 3J5QB 4YVOA 2PM6A 5HEHA 3ONJA 4B6XA 5E75A 2NW8A 4IDOA 3O48A 3FTSA 4MHCA 4WNKA 4GU5A 5IUXA 1D8DA 4YY3T 3SFYA 1IAPA 4HKAA 5CCLA 3VTXA 2BS2A 2N1GA 1QUUA 2JABA 3L17A 4HS2A 2P9KG 3F31A 3L16A 2X6FA 3Q78A 5F5WA 2C0LA 3OVUA 2R02A 4Z68A 3HA4A 3B7RL 1XWMA 3BK9A 2MTQA 2WVIA 3VLEA 2IUBA 5C1DA 4JI2T 3I4GA 3O4ZA 1W3BA 1IBLT 4FULA 4ILAA 1DU2A 4PJMA 4FLHA 4L1BA 3EUVA 1UUSA 1R8IA 1DNPA 2GK9A 3J5PA 1FT1A 3MZLB 3IBEA 4DUYT 5FP3A 4PJNA 1OEDE 4LERA 2WCAA 4KXKB 3CGHA 4TUUA 3TWRA 4UI9J 4XBFB 3AE3A 2KBXA 5CFBA 1Z8UA 2M67A 3A5XA 3OKQA 2PQNA 2RP4A 4H63H 5AQLB 4U7YA 3PZ3A 3LSVA 4WNDA 2WXOA 1MIYA 2W61A 3IEEA 4UR9A 4HOSA 3FDHA 3RYIE 3FUMA 1J1JA 2VTBB 4JI8T 2C5IT 1OWNA 1HG2A 2FBWA 2V4LA 4G24A 3ZJ1A 3TXMA 3ZFWA 3OYXA 2XZDG 2QFCA 2CHXA 3FWVA 4IDPA 1TNOA 4OVVA 4APFA 4JVSA 3R9AB 1FEWA 4C91A 4JI5T 3NF1A 5EZYE 4TUYE 4EEDA 3MYVA 2GRLA 2X6JA 3ONLA 4N2QA 4BSXA 3LFMA 1HH8A 4JHJA 4HFHA 3VKHA 3L8RA 1KPSB 1AWCB 3G2TA 3CPZA 2NW9A 3UM0A 4B89A 3DJBA 5FTPA 4B3RT 3CVUA 3AA0B 4U3CA 4CXXA 4PDXA 3FXEB 5CEDB 3RYCE 4DV3T 4ERRA 2KSRA 2WXIA 3HL6A 3PE0A 3ABVA 2ZM8A 4YVQC 4UQYA 4E6HA 3AA7B 2W67A 2NR4A 4I43B 5TAOA 3RC8A 3MV3B 3ZLIA 2VKOA 4U8YD 1OCZE 3QKYA 4GYOA 2CWYA 4C0MA 4NRHB 1BD8A 2L0IA 4BFRA 4KVMA 4J6IA 4A5XA 3U9WA 3AAIA 2KZTA 5FXZA 5G04C 3KVAA 4C90A 4CZ2D 2J4DA 2LOSA 2X6HA 4CGVA 3FP3A 3URZA 3UKRG 1VCTA 5EK3A 1E7PA 4LFCT 3TWWA 4OYJA 5EYLA 4IE4A 3G06A 1DC2A 5EK4A 1IJ5A 2OEWA 4IE7A 2OOEA 5HCJA 3TWUA 3LDZA 4JLEA 4ME2A 3QC1A 3TG5A 4GMRA 4ATGA 4X5TA 4BTBA 2CMRA 1ELKA 5JREA 2NOXA 3IKOB 5LX8A 4EPZA 2R6GF 3CX7B 1VRBA 4GA2A 5CEAA 2AWIA 3Q79A 3EHQA 2PJQA 4WBOA 3NBNB 4AP2A 4RLYA 2XZTG 5LG3A 1HU3A 3AAAB 4A3TA 5HXEA 5G05C 2AXUA 3K9IA 2VTBA 4M7CA 2BG9B 2XRZA 2B1EA 4I6JA 3APDA 3QJZA 3UM2A 1WRDA 4YHJA 1N52A 4X8QA 1MMGA 4X1YE 5AQNB 3SFXA 2CXDA 2XRYA 1QLBA 3AECA 3ASHA 2V7JA 1YW0A 2G0UA 3PU3A 2WQHA 5LBMA 4DK5A 3T8OA 1E90A 3ASFA 3D9MA 3DSSA 4O1OA 2DWKA 1HS7A 3E37A 5BV0A 1MYOA 1MNDA 3PZ1A 4AKGA 3I5PA 3ZN0B 3MKQA 3AS8A 4AKRB 3KDSE 4LF9T 1S64A 4GK0E 2L9BA 4QXHB 1X81A 3UKUG 4PNIA 1HE8A 3G2UA 1LVFA 1O5MA 3ZU7B 3PUXF 3AA6B 4BT9A 4G23A 3BG1B 1EF1C 4KMOA 4O6FA 2C2LA 2CHZA 3NAWA 3NZSA 4A56A 2VGXB 2XAQB 3PDYA 4OYKA 1LF8A 3PNLB 3S7JA 2ACZA 3TGOA 4I2ZA 4U0SA 2LSJA 5DABA 2JQHA 3Q9UC 3FHEA 1FCHA 5LCWJ 3ZMTB 2V7IA 4JI3T 4DX2A 2L0TB 1P5QA 4RQIA 3CLJA 5G05J 4U63A 2YEVC 2LE8A 4JHRA 5AIJA 3FUNA 1ZKEA 2H6IA 4ANXA 1DCEA 2WXFA 3IBPA 4O4LE 5FZQA 2BTDA 4U7EB 4DNDA 4H9SE 1TNBA 5FY0A 1HXIA 3BU8A 1QZ2A 4JHKA 3E30A 1NEKA 3K3NA 4YTNA 3UXGA 3HG0D 3NQPA 4DBQA 5JR9B 3UUBA 3MACA 2F37A 3PUKA 3RO2A 1INZA 4I1AA 4KBQA 3L22A 4OHFA 2LEHA 4X64T 2B0OE 2K5BB 3FU6A 4WUYA 3ABKE 3RK6A 4B3MT 3ZC1A 2UUCT 2CE7A 5L47A 1EPUA 4PFPA 3QK6A 3AU5A 3SFZA 3D9KA 5BXUA 4HN9A 3EDUA 2ZGGA 3QK0A 4BA9A 4XKCA 2XENA 3PUZF 3ML8A 3JQ0A 5E76A 3OPCA 4HNAD 2CG2A 3FUKA 4JEHB 3AE4A 4DR5T 2X0HA 4LMKA 3ZHEB 1JNRA 2LSVA 3RQWA 5LCWC 4NXMT 3F57A 2LXMA 2ZM6T 2XPZA 2LAIA 4PS7A 4P0AA 2OVFA 4MKTA 4JI1T 3UQ4A 4U04A 3PEUB 3G2WA 5EDSA 3EVYA 2AE9A 3CK6A 2UY1A 2DZNA 1B7TA 2BS3A 4EYUA 3PZDA 5L4EA 5AAOA 3K8PC 4KZ0A 3HR0A 2BDEA 1WR6A 3MXZA 4U72A 5A1LA 2PQRA 4GTSA 3TJPA 4AV7A 5LNKA 1XDPA 3N9NA 3E33A 4AKLA 1IYGA 4G63A 1YYHA 4HFDA 3RO3A 4TV9E 3NRYA 3PUSA 3RSEG 3E08A 1ZEEA 5ANLA 2JLBA 5HCMA 2WQ6A 2Y8DA 2PBIA 3MV2B 4TWFA 2H89A 3IHYA 1TNZA 1PC2A 2HHHT 2BEDA 2ZM2A 2BKGA 3M65A 1NFIE 2YHEA 2A5EA 1UW4B 2BG9A 1H2VC 3CIAA 3B5MA 2FJEA 1N32T 4JI6T 2WZIA 2FBNA 4J8YA 1IBMT 1BU9A 4I6EA 4JEUA 3B7UX 4GTTA 2GRMA 3ZGQA 3ZYQA 1OWMA 2A5UA 3AS5A 4HFGA 4HB5A 3FZMB 3SRZA 3P4SA 3RRMB 4ANWA 3AEFA 1J5WA 5FQ4A 2YDRA 4DV6T 1Q2ZA 3I4RB 4LRZA 3LK2B 5AENA 3UULA 1YCSB 1YA0A 5FKYA 4KMCA 3ZUVB 4G11A 4HEAA 4MRUA 5LJNA 4I6GA 2OCCE 3C4WA 2ETCA 3O1IA 2VSNA 1H19A 4BSZB 4EQFA 3FZKB 5KX5E 2BBJA 2FJAA 4UVCB 3GW4A 2UXDT 3H3MA 2XAJB 3JCKC 3C64A 2IF4A 3CVXA 4Q96A 4IL4A 3CWZB 3EHNA 2F8XK 3QARA 2DCPA 3HXEA 3HXDA 4G8LA 2J4GA 5ABFB 4GTQA 4AKHA 1VDYA 1KK7A 1G73A 5KWDA 2BG9E 2HN1A 2XPYA 2R03A 2EIJE 2LHNA 3FFLA 3ZT6A 4D10C 1BLXB 1KF6A 4N2SA 3P4RA 3UIOC 3UPVA 1OUVA 1KT1A 2ODUA 2UY1B 3UM3A 3C3QA 1I6ZA 4YSYA 2CG3A 3FZLB 3EU5A 4KUMB 3VRBA 2B6CA 4X65T 5M4YA 3ZEFB 3CX8B 4NQ0A 2J49A 4QFVA 4K0KT 3FUJA 3E0ZA 3K1SA 4ILIA 4APOA 5HAXA 5AQ9A 2WZHA 2PG8A 2CHWA 4ZI3C 4EIWA 1SVXA 1TNYA 3PZ2A 3WG7E 3HVEB 3PU8A 4BY6A 2DIWA 3QAQA 2YU2A 4L2LA 3S4UA 4BTAA 3R6NA 5J0ZA 1LD7A 3TLSA 4Q69A 2WB2A 4WBNE 2XAHB 3ZXPA 1JWFA 3CQCB 5ANRA 2EIME 4BX8A 4JL0A 2AJAA 2GRPB 1H2UA 3QNKA 3SOLA 3UT7A 2GRRB 1N0RA 1HNWT 3ZCJA 5LHGB 1QQEA 3LK42 2J62A 4X1KE 4ZZCA 4A3VA 5JDGA 2P9PG 4I43A 2VVNA 3EAMA 4DBRA 2PM7A 4WNGA 5JA4D 4TZ4C 3N71A 4H7XA 4EBAA 2SPCA 2V4HC 2WXLA 3ASOE 2XQ0A 2BS4A 5FVLA 5LBQB 3Q73A 3FBLA 2WY2A 1WFDA 2WBLA 5A23A 3GMIA 3U4TA 2JIWA 3ONXA 5J1GA 1TYQG 3AAAC 4G2VA 3ZYKA 4O1PA 2E9XB 4DX1A 3HIZA 1RW2A 3VKGA 2Y4UA 3ESKA 3ASGA 4CXYA 4QX7B 4AQYT 2JMHA 2JRKA 3O9XA 4UQXA 1IQRA 3LY9A 1FIOA 2IIUA 2BG9C 4N3BA 5BV1A 2P58C 5ENOD 5HQ8A 2QGSA 3VTYA 4QHOA 1BI7B 2P9BA 3ZT7A 1XNQT 3AE6A 1H7CA 4LCTA 3EHZA 1N9AA 2Y4TA 2HM8A 3RRUA 3B57A 2BBHA 3BQIA 3OBVE 3RIFA 2H6HA 3HHMA 3L82A 3RC3A 2GGFA 4I50E 5HS0A 5CCMA 1UN8A 4QQIA 5AQQB 2YHCA 4A1GA 4OK0A 2IQCA 3PUYF 3Q47B 4EHMA 3NOGD 4BETA 1IQUA 2XZEA 4DUZT 5JJ6A 4EZLA 3FZHB 1ZP0A 3RYHE 4K5AB 5JH7E 2LM2A 2VQET 4ZOLE 2WWUA 1U4QA 3SHFA 3HVEA 3CVVA 1D0XA 4EGWA 2W0GA 1CUNA 2WXMA 3Q5XA 2KXPB 1NA0A 3RIUA 4JI0T 2XQ8A 2XQAA 4J8EA 4DMWA 3LBXA 1HR0T 2MOWA 5FL0A 1ZHCA 1JWGA 2FO1E 1FMWA 2WS3A 3EIQC 3RH3A 3N5LA 3FU0A 2KC7A 3AB3B 5KJKA 1D1CA 3KV4A 1N54A 1H6KA 2JQ9A 5LG4A 4I4TE 4UI9K 3ZN3A 1JCRA 5CJ5A 3AG3E 4HXIA 4CCAA 3KVBA 3QB5A 4UWLA 1HFAA 3FTUA 3F6QA 5KJMA 4YDEA 3EU9A 3W15B 2E9XA 2XGSA 1Z3XA 4FJZA 2WQYA 5IHYA 1MIWA 4P09A 3JQ1A 2QC9A 3I1AA 2RFAA 3RIUC 2DVWA 5T4YA 3ZEFA 3NBXX 3OXFA 4EV6A 3U64A 4Y6CA 1O1RA 2ZMAA 4J2CA 2V6YB 2PTFA 1SUMB 4JI4T 2IY0C 4CYMD 5AN8A 3SD5A 2XQ3A 5JR9C 3DXMG 2H88A 1VOMA 2YINA 4G2AA 2ETBA 4WNEA 3AVSA 4CN4A 5HEUA 1ZU2A 4AQFC 1OCOE 4M3OA 1E7UA 5KNGA 2NTXA 1QNFA 4I0UA 1G3NB 2X6KA 5JHBA 4JXTA 4RG6A 2OA5A 3HKDE 3O1HA 4XAXB 4HOQA 4LMJA 2NSZA 3DXKG 1K1BA 5FQ8A 4F6RD 3GA8A 4ZHBA 4GYSA 4PUCA 2LSIA 3T5VA 5L3GB 1VCSA 3KSLA 5AYWD 3MK7C 2MYSA 4GB9A 5AQ7A 4GZ3A 4OAUC 2BKOA 3HRAA 2A4ZA 2L6JA 1TEZA 5AQVB 4ASKA 5JDLA 5EYPF 2VKJA 4DVDA 2IFUA 1HG5A 2N9DA 5JTGA 2CHOA 2LUHA 1OWAA 4YJ2E 2X0YA 3AU4A 2XUEA 3OXGA 2IMLA 3FUEA 3MGBA 2VL8A 3DWLG 1X9BA 2LSKA 3M3ZB 2EQXA 5AJDA 5ENRD 3RIBA 4UF0A 4FA6A 3J9X1 3AE2A 4IT4A 3DP7A 4CDMA 1TN8A 4B8CB 4GZ5A 4O2BE 1Y64B 2JPFA 4MALA 3V5UA 3W9FA 3N2OA 4L23A 3KINB 1KT0A 5JRCA 3N9MA 4TXPA 5HEJA 3LDQB 4EZJA 1YD8G 1H6OA 3QOUA 4IYPA 5LHHB 2RPAA 2V6YA 5LHIB 4MBQA 4GMJA 4BJMA 2FULA 5AQSB 3HKCE 3EHRA 2QYWA 2VB6A 1Y8MA 3UT5E 2UWJG 3HXFA 4DMVA 4JA7A 2DZOA 4IRUA 4HLEA 2JQQA 5HI7A 3LS8A 1OXJA 3ZMSB 1BPOA 4LNBA 4XZ4A 5FY7A 5LCYA 1SQMA 2E5LT 2VL0A 3PZ4A 1XMQT 3IF8B 2V7LA 4Q25A 5L2LA 5LMUT 1N95A 5FT9A 3AEGA 5KJNA 5IYZE 2FEZA 4E85A 4YDWA 3S7DA 3FEXA 2CCQA 3LKUA 1QYMA 5CRUA 5KBAA 3I0QA 3N2KE 1TNUA 4PH4B 3JAEA 2VYIA 3KD7A 3V5SA 2KLQA 4OX9T 1LKXA 3OYZA 4FJYA 1WG0A 1KEYA 4YTMA 4CDRA 4TN7B 3V79K 3CKDA 4L9IA 2J8SD 3FUHA 2NTYA 3Q5WA 4LF8T 1OXZA 1WYCA 2LOPA 2V5DA 5LGUB 3L09A 1UX5A 4JW1A 4GKKT 4HTEA 2XM2A 3O4XE 2H3RA 2LSGA 3E22E 3NVOA 4F8HA 3PE3A 3UQ7A 4HBDA 5FMNA 5LMNT 2V5QC 5EILA 4AY6A 3D9NA 2IO2C 1Z0PA 3FUIA 3FH7A 1X79A 4I1OB 3JAFA 4EZ4A 3AE9A 2J09A 4JB8P 3L9TA 2X38A 2E2AA 3FY4A 5T3RA 3UUMA 5CMYA 2I9CA 5AQBA 4V3IA 2I0MA 1NL4A 2ZGDA 3AEEA 5KMGP 3C3OA 3ZVVA 1S63A 2MHKA 4AIUA 2IC9A 3LYAA 4GOUA 2KCLA 4AIFA 5H6QB 1S70B 3E32A 3EDVA 3SWHA 3IEGA 2FJBA 3A8YC 1JCSA 5JDNA 4EEBA 5EK2A 4DUIA 4CN1A 3TG4A 5JJTA 4HFEA 4PS3A 5EX0A 1E1HB 1GQEA 3TWSA 4J7WA 5AFUL 1E8XA 3ETVA 3SGHA 5L4HA 4UXNB 1D1AA 4HFVA 1YQ4A 2XQ7A 4UWFA 5J90A 2ETAA 5J2TE 1N4SA 2IW5B 3ZJ2A 2NW7A 2I1JA 2WDQA 4ZI2D 5CA0E 3K3OA 3ABLE 1FPPA 2W2UA 4PK6A 4KHPT 5JDHA 3KS2A 4GTPA 2LKGA 4GYWA 5LJMA 2UUBT 3O1JA 4KP3C 3RLFF 2K3WA 5CA1E 3LXUX 2GRNB 4ANJA 5EIBE 5ENTD 5FXWA 1MMDA 4URKA 1TJFA 1SZ9A 1SZAA 3ONKA 4C9BB 4LNUD 3VLDA 1RZ4A 2IDOB 3ML9A 1T7SA 4HOUA 3V2OA 5CMWA 2QYJA 5BMVE 4YDOA 2WAUA 5JQGE 3ZPJA 3CVYA 3N9LA 4HORA 3ESLA 1OWOA 3UMVA 2Y1LE 4OYSA 1IJ6A 3AE8A 4XI9A 3H37A 5DIZA 2X51A 2JEKA 4U8VD 3UIPC 2XQ4A 4HQDA 1XMOT 4LNGA 3LEWA 3JC6C 1N4QA 3Q9NC 1OEDC 2OLTA 3RKOA 3BQOA 4FC8A 1V54E 2H6FA 2DYSE 3GZ1A 4ACLA 2E9XC 3KFWX 4LMLA 3HDXA 1HO8A 3IV0A 1MNEA 1WYBA 3PV0F 3OXLA 3HKEE 4I17A 3MX3A 2J4BA 1MMNA 5G2NA 5IWAT 3FH5A 3DPYA 4YNDA 3KEAA 5ENPD 5HYAA 4LG6A 3QWPA 3JYSA 2KCVA 3RYFE 2CLYB 5LGTB 1FVFA 3X1DA 4RG9A 5KJLA 2YN6A 3U3IA 3FTXA 3JUIA 5HXRA 1S94A 4JPSA 3R84B 2V8SE 3RQUA 4DI4A 3UFGA 1D9SA 4AXHA 1ZB1A 3MEKA 5C3JA 1W09A 2M63A 2WXGA 1U2VG 3CQGB 2XQ5A 1UOHA 2VGEA 5HWYA 2XGOA 5BPPA 3CQXC 2X6IA 5HRYA 3MZKB 4QH1A 2VKDA 2VKHA 2EHOB 1XZYA 3ZNGA 4AM9A 3CVPA 2RKKA 1HX8A 4Q94A 3TKLB 5AQMB 2CXFA 3RKVA 3C5RA 3SI5A 2FI7A 2XGMA 2XEHA 4KHZF 4TV8E 4UV9B 2XTLA 3ZRHA 4UQZA 1MX2A 4DX7D 4YLHA 4J8FA 1N94A 5LFAA 1BR0A 2B76A 3AEBA 2ONDA 1V9DA 3CSTA 3ZSTA 2CBIA 4NIKA 2R5SA 1L0VA 5HXHA 5JVDE 1EDUA 2PL2A 4XI0A 3RGLA 3D9PA 2WMNA 3FTYA 3ZMVB 1LVKA 2OV9A 2XCBA 1XNRT 2X9XA 4K5CA 4UIGA 2VQFT 4L5GA 1B89A 4I55E 4Z8XA 2XCCA 2CHNA 2XHEB 2J07A 2UXXB 3RPUA 2AXDS 4ZHQE 3N9PA 2P9UG 4C0EA 3NZUA 1K1AA 4DX5D 1NI1A 5DQVA 2OV8A 2ZXWE 3CK7A 3LCAA 4HWFA 2WXNA 3APCA 2XQYA 5JDFA 5BNWA 1SA4A 4CN6A 3C4ZA 5AQAA 3C98B 2N2NA 5FQ7A 4HVBA 3FUFA 2D0TA 5LB7B 4BWRA 2L8KA 1HCIA 2MPKA 3RI5A 4A98A
chains in the Genus database with same CATH topology
2Y48B 4IE0A 5C2YA 4F53A 2A2FX 4QXBB 2VQ2A 3PDNA 5HWXA 2XPIA 2JMKA 4AVXA 2VJ8A 1UCUA 4UWHA 5EX3A 3I0OA 4H9OC 2DNXA 5FZRA 4G1TA 4J8SA 2AXZA 5A7DB 2AVPA 4L2YA 1MHQA 1UJKA 2HO1A 2PFVA 2Q9QD 1A17A 3GZSA 4H9RC 2MOZA 5C8YE 3WXXA 4XKBA 2FF4A 5LGNB 2WXHA 4AY5A 1IHGA 3QC9A 4I9CA 4UWGA 2VSYA 4EB6E 4GA1A 3RJVA 2BF0X 5LA6E 5L3BB 4CT0A 2XASB 4IDZA 4PFOA 1HZ4A 4JEHA 2LSYA 3WAKA 1MQSA 1WY6A 4CT4A 4IULA 4HGAA 1FVHA 4AOFA 4OFZA 1D0ZA 4ZI7E 2WM9A 1Z6TA 5G04J 2X0LB 3F2EA 3MJXA 4CZZB 4CI2B 2VASA 1ELRA 1HTJF 2DHRA 3ZMUB 4LUNU 4GZCA 2RD0A 5L3FB 1WM5A 2E2EA 1QSDA 3KV6A 2WXJA 1E8WA 3AA1B 3L6AA 3B7TA 4ISSA 4CGWA 1G8XA 3UUXA 4CEMA 3DTOA 4CDNA 4QXCB 5FYMA 3C98A 3Q15A 1HS6A 4UV8B 1KNZA 2AXVA 2HYZA 4NUVA 4BT8A 2MBGA 3SZ7A 2K9AA 4AKIA 4I9EA 2KZTB 1WAO1 3L54A 4ILGA 4GYRA 2KWHA 1LRZA 4UELA 2W62A 2XHEA 1UN9A 3ENEA 4UVBB 4M1PA 4J0UA 3C4XA 3ZYMA 5ENNA 5FY1A 3BQKA 1ZV4X 4X1IE 3OJAA 4FJOA 3PVLA 5ARGA 3RRCA 1XNFA 4FHKA 3DBSA 2XAGB 4X20E 4IE6A 2VWAA 5J08A 2A72A 2WQ7A 3TL5A 2J9QA 3KBUA 4G25A 3I9WA 2C5JA 4WWPA 2BVLA 3LY7A 1D1BA 4JUYA 3QDNA 3UQ3A 4N5CA 1EZ3A 4DI3A 2DI4A 1ZBPA 3KEZA 4FADA 4BX9A 2YQ8A 4ZS3A 3LVQE 3LK3B 3EIJA 3PE4A 4RVBA 3FTZA 2DWGA 3PS6A 3U66A 4JA9A 2WXPA 4KBMB 4QWNB 3E4BA 2RA1A 5KCMA 3S7BA 1EYHA 2D2SA 2W63A 2D0UA 5ARFA 2HR2A 2BVMA 3HI2A 2V7MA 3UT4A 2ZM0A 4CRWA 3FEYA 3QWVA 3GN5B 3TXNA 2L3LA 2L9QA 4TV3A 3D9JA 5FQ6A 4EOZB 5E0OA 4IIJE 3UUNA 4CI3B 4N78D 2LJLA 2HH7A 3ANWB 5LYJE 3PUJA 3CVLA 3PREA 5JR9A 4KZCA 4GCNA 2KNDA 3C50A 2CFZA 3C51A 3CHPA 3CR3A 3NZPA 5F8PA 3G2VA 3PURA 5T8IA 3JC6D 4H63V 4N3AA 2H7VC 4GPKA 2BZBA 5LOVE 3P7IA 4NACA 2E9XD 5M72A 3UT8A 1H0AA 2YNQA 1H2TC 4FU3A 1HF8A 4IGUA 4W9RA 4FI5A 2X9HA 5DQWA 1FMVA 3D9LA 3ASDA 3FBZA 3N9QA 3EHMA 3UX4A 4K0UA 5KDMC 4PJLA 3S7FA 2NP9A 4NURA 3EDTB 3LG7A 2X67A 3AS4A 5LXTE 1KLXA 3FTWA 4UVAB 3KAEA 3Q5MA 3H3AA 3R7RA 1SA0E 4F1SA 4V1Av 3CK8A 4B8AA 4EBAG 4B0ZA 3KV9A 4DLQA 3APFA 4XZCA 3P2BA 3B7SA 1OWPA 2X68A 3PH0C 3CK9A 1NP7A 5AJLA 3ZMZB 2IC6A 3CVQA 3GN5A 2CA5A 4PW8A 3DPDA 3RRNB 2IONA 3NZQA 4GK5E 1U3DA 3ANWA 3PRZA 3KBTA 4AEZC 5FNVE 2VSXE 3CVNA 4E7SA 2KWIB 2QA7A 4H9QC 3L13A 2X9WA 4XX5A 2Y3AA 4MLKA 4QX8B 4U74A 4EAHA 2X66A 1UX4A 2KT9A 4KT6B 2KZ7B 3P1UA 2ZLYA 2ODVA 3N9OA 4AI6A 4KYOB 4L0RA 3CVRA 3PUGA 4HE8A 3ZYLA 1OWLA 5HXSA 5BT1A 5L3EB 3OTNA 3RU0A 2GW1A 4K0RA 2I1KA 1X5BA 2EHOC 1AJ3A 2X3MA 1O3XA 2HPLA 3HKBE 3Q49B 3MA9A 3T8MA 2W00A 4UEMA 3MJWA 2DCFA 4RSYA 3AAEB 5L3CB 2IOLA 2IU1A 3ZXSA 2YK0A 3TAXA 3HYMB 4ILHB 3L3PA 3LJ3A 2Q9QB 2KCKA 3KV5A 3K3QC 3B13A 2V5FA 3OAWA 2Y6XA 3PEVB 2KM4A 2UXNB 2CLYC 4UI9C 4UF0B 2ILRA 2E0IA 2JJ9A 5F3JA 2LAHA 4N3CA 2DLRA 2MRIA 5FXXA 1MIVA 4GMLA 4ZS2A 3I9YA 4J8DA 4CXWA 5JHAA 1JPLA 4A1SA 4P0BA 4AXPA 1BR4A 3SBSA 4K03A 1NZNA 3I3NA 5D0OD 3CHQA 5BUZA 3LY8A 1NA3A 4H7YA 3LPZA 5FJYA 5FXVA 4FHJA 4F7AA 4ABNA 3FULA 4XE0A 3D9IA 4FP7A 5DBKA 4ANUA 3FU3A 4PJJA 4AJWA 4DPRA 1GW6A 2VGYA 3NRXA 2WXRA 2C0SA 3GWHA 3ZW3A 3CHRA 3D9OA 4O2AE 3U78A 4U0UA 4EZKA 4L7TA 4XIFA 3FB2A 1U5PA 2QY7A 4GZDA 3VU7H 2D5UA 2C0MA 5JRCB 3ZCIA 3GZ2A 5H6RB 4R7LA 2XEVA 2ZU6B 4AQGA 3Q2MA 2I59A 3PUQA 1XGWA 4ZI3D 3PNTB 3ZHEA 5JJ7A 4KVOA 5A6CA 3BQLA 2RG8A 4CQIA 3Q4AB 1E96B 4EZHA 5CHEE 4GAAA 1BR2A 4U0ZA 3MKDA 1MMAA 3S2AA 3LJCA 5ETWA 3UTKA 2WXQA 4N39A 1YKEB 4PS8A 4U8HA 5LOZA 3FHNA 5HXCA 2IAKA 4EYYR 4YFSA 3SNXA 2C5KT 4TRQA 4O4IE 3T5XA 3CMLA 3VHLA 2K24A 2LM9A 4UWKA 5FWQA 3Q9DA 4TX5A 3FXDB 3IHRA 1UJJA 2DBAA 2R59A 3CEQA 4WWOA 3AVRA 4ZI2C 4DJAA 4BAYB 5L3DB 4G26A 4IHJE 2IOSA 1D0YA 2LNIA 1SHZC 3CHSA 3SF4A 4B94A 2LO6A 4JZYA 2LHRA 4GIWA 4U07A 2V26A 2A3DA 2X9YA 4MLPA 4GYYA 3GYZA 4ISTA 2ES0A 1L5JA 3RX6A 2VK9A 3CKBA 4P29A 1S0PA 2HPJA 3WAJA 2CXLA 3L08A 3CX6B 3PTRB 3ZIMA 1T98A 2V1DB 5DJQC 3MKQB 2YU1A 3QWWA 3R7QA 4I1MA 4F3VA 1NAFA 2PZIA 5GONE 2BUGA 4ADZA 1E7VA 3FU5A 4PK4A 3MCXA 2CFUA 2E8IA 2OVBA 1PAQA 4O4JE 3FUDA 4JEUB 4GCOA 4AQFA 3CKCA 2KINB 4CI1B 2I2OA 3VLFA 1Z3YA 3FTVA 1YKHB 3ZPOA 1UG3A 3ETUA 3ZC0A 5G55A 3CHOA 2I6HA 1U3CA 4A55A 3LVRE 3CVWA 2XAFB 5CB4E 4MS6A 3PUAA 4FLBA 2WMOA 2AW6A 4WW0A 5D0QD 2V0PA 3BG0B 4NUUA 2J1DG 5LP0A 4GA0A 4I2WA 4DO0A 4IE5A 2IJGX 4WAFA 3U3WA 5BW8C 1E8ZA 2Q7FA 1IZNB 2WXKA 2CWOA 2LT3A 3P8CD 4O4HE 2LSUA 3UUXB 3D0TA 3CV0A 4QKNA 3EUHA 1DVPA 3QB2A 5J2UE 4H9PC 5JDMA 1PY1A 1ELWA 1TJCA 4EECA 3SS1A 2J08A 1Y6IA 4Y6WA 1WLXA 2CM0A 4OVUA 2VGXA 4F6RC 3BEEA 3QUJA 2Z6EA 1BR1A 2EHOA 2WPVA 2Q9QA 3ZN1B 2WSSV 3WI3A 2ACXA 4ILUA 1E8YA 4PK5A 5JDQA 4DLOA 4YJ3E 2NXPA 4PAGA 4GZ6A 4BJNA 4LEUA 3CHMA 3D3MA 3EJNA 5FZSA 4JC8A 2R17C 3MA5A 3FH8A 4EXTA 2FO7A 2CEAA 5EKQD 2NWBA 4H9NC 3IHVA 1S35A 4HOTA 3LBXB 3ULQA 2Q9QC 2H7OA 3SBTB 3CSFA 4O8SA 4WWNA 2KATA 2EHOD 4ANVA 5LP6E 4E7ZA 2K48A 3UFEA 3MKRA 1US7B 3N2GE 5ADXL 2V7KA 2KMFA 1JUQA 2NC9A 2VSOE 4WNFA 3G2SA 3J7Yq 4IN3B 4ACKA 3RRWA 4MFRA 1NWMX 4YVOA 2PM6A 4B6XA 5E75A 2NW8A 3O48A 3FTSA 4MHCA 4WNKA 4GU5A 1IAPA 4HKAA 5CCLA 3VTXA 3L17A 2N1GA 1QUUA 4HS2A 3F31A 3L16A 2X6FA 2C0LA 3HA4A 3B7RL 3BK9A 2MTQA 2WVIA 3VLEA 5C1DA 3I4GA 3O4ZA 1W3BA 4FULA 4PJMA 4FLHA 4L1BA 1DNPA 2GK9A 3MZLB 3IBEA 5FP3A 4PJNA 4LERA 4KXKB 3CGHA 4TUUA 4UI9J 4XBFB 2M67A 3A5XA 3OKQA 2PQNA 2RP4A 4H63H 4WNDA 2WXOA 1MIYA 2W61A 3IEEA 4HOSA 3FDHA 3RYIE 3FUMA 2VTBB 2C5IT 1OWNA 1HG2A 2V4LA 3TXMA 4G24A 3ZJ1A 3ZFWA 3OYXA 2QFCA 2CHXA 3FWVA 4OVVA 4APFA 4JVSA 3R9AB 1FEWA 4C91A 3NF1A 5EZYE 4TUYE 3MYVA 2GRLA 2X6JA 3ONLA 4N2QA 4BSXA 3LFMA 1HH8A 4JHJA 3VKHA 3G2TA 3CPZA 2NW9A 4B89A 3DJBA 5FTPA 3CVUA 3AA0B 4CXXA 4PDXA 3FXEB 3RYCE 4ERRA 2WXIA 3HL6A 3PE0A 2ZM8A 4YVQC 4UQYA 4E6HA 3AA7B 4I43B 5TAOA 3RC8A 3MV3B 3ZLIA 2VKOA 3QKYA 4GYOA 2CWYA 4C0MA 4NRHB 2L0IA 4BFRA 4KVMA 4J6IA 3U9WA 3AAIA 2KZTA 5FXZA 5G04C 3KVAA 4C90A 2J4DA 2LOSA 2X6HA 4CGVA 3FP3A 3URZA 5EK3A 4OYJA 4IE4A 5EK4A 1IJ5A 4IE7A 2OOEA 3LDZA 4JLEA 4ME2A 3QC1A 3TG5A 4ATGA 4BTBA 2CMRA 1ELKA 5JREA 2NOXA 3IKOB 5LX8A 4EPZA 3CX7B 1VRBA 4GA2A 2AWIA 2PJQA 4WBOA 4AP2A 1HU3A 3AAAB 4A3TA 5HXEA 5G05C 2AXUA 3K9IA 2VTBA 2XRZA 2B1EA 4I6JA 3APDA 3QJZA 1WRDA 4YHJA 1N52A 1MMGA 4X1YE 2CXDA 2XRYA 3ASHA 2V7JA 1YW0A 2G0UA 3PU3A 2WQHA 5LBMA 4DK5A 3T8OA 1E90A 3ASFA 3D9MA 2DWKA 1HS7A 5BV0A 1MNDA 4AKGA 3I5PA 3MKQA 3ZN0B 3AS8A 4AKRB 3KDSE 2L9BA 4GK0E 4QXHB 4PNIA 1HE8A 3G2UA 1LVFA 3AA6B 4BT9A 4G23A 3BG1B 1EF1C 4KMOA 4O6FA 2C2LA 2CHZA 3NZSA 4A56A 2VGXB 2XAQB 3PDYA 4OYKA 1LF8A 3PNLB 3S7JA 3TGOA 4I2ZA 4U0SA 2LSJA 5DABA 3FHEA 1FCHA 5LCWJ 3ZMTB 2V7IA 2L0TB 1P5QA 3CLJA 5G05J 4U63A 2YEVC 2LE8A 4JHRA 5AIJA 3FUNA 1ZKEA 4ANXA 2WXFA 3IBPA 4O4LE 5FZQA 2BTDA 4DNDA 4H9SE 5FY0A 1HXIA 1QZ2A 4JHKA 3K3NA 3NQPA 4DBQA 5JR9B 3MACA 3PUKA 1INZA 3RO2A 4I1AA 4KBQA 3L22A 4OHFA 2LEHA 2K5BB 3FU6A 4WUYA 3RK6A 3ZC1A 2CE7A 1EPUA 4PFPA 3QK6A 3AU5A 3SFZA 3D9KA 4HN9A 3EDUA 3QK0A 4BA9A 4XKCA 3ML8A 3JQ0A 5E76A 2CG2A 3FUKA 4JEHB 3ZHEB 2LSVA 5LCWC 3F57A 2XPZA 4PS7A 2LAIA 4P0AA 2OVFA 4MKTA 4U04A 3PEUB 3G2WA 5EDSA 3EVYA 2UY1A 1B7TA 4EYUA 3PZDA 3K8PC 4KZ0A 3HR0A 2BDEA 1WR6A 3MXZA 4U72A 5A1LA 2PQRA 3TJPA 4AV7A 5LNKA 3N9NA 4AKLA 1IYGA 4G63A 3RO3A 4TV9E 3NRYA 3PUSA 3E08A 1ZEEA 5ANLA 2JLBA 2WQ6A 2Y8DA 2PBIA 3MV2B 3IHYA 1PC2A 2ZM2A 3M65A 2YHEA 1UW4B 1H2VC 3CIAA 2FBNA 4I6EA 4JEUA 3B7UX 2GRMA 3ZGQA 3ZYQA 1OWMA 2A5UA 3AS5A 4HFGA 3SRZA 3RRMB 4ANWA 5FQ4A 3I4RB 4LRZA 3LK2B 5AENA 3UULA 1YA0A 4KMCA 4G11A 4HEAA 4MRUA 5LJNA 4I6GA 3C4WA 2VSNA 3O1IA 1H19A 4EQFA 5KX5E 4UVCB 3GW4A 2XAJB 3JCKC 3C64A 2IF4A 3CVXA 4Q96A 3CWZB 3EHNA 3QARA 2DCPA 4AKHA 1VDYA 1KK7A 1G73A 2XPYA 2LHNA 3FFLA 4D10C 4N2SA 3UPVA 1OUVA 1KT1A 2ODUA 2UY1B 2CG3A 4KUMB 5M4YA 3ZEFB 3CX8B 4NQ0A 2J49A 4QFVA 3FUJA 3E0ZA 4ILIA 4APOA 5HAXA 2CHWA 2PG8A 4ZI3C 4EIWA 3HVEB 3PU8A 4BY6A 2DIWA 3QAQA 2YU2A 4L2LA 3S4UA 4BTAA 3R6NA 4Q69A 2WB2A 4WBNE 2XAHB 1JWFA 3CQCB 5ANRA 4BX8A 4JL0A 1H2UA 3QNKA 3SOLA 3UT7A 3ZCJA 5LHGB 1QQEA 3LK42 4X1KE 4A3VA 5JDGA 4I43A 4DBRA 2PM7A 4WNGA 4TZ4C 3N71A 4H7XA 4EBAA 2SPCA 2WXLA 2XQ0A 5LBQB 3FBLA 2WBLA 5A23A 3GMIA 3U4TA 3ONXA 5J1GA 4G2VA 3ZYKA 2E9XB 3HIZA 2Y4UA 3VKGA 3ESKA 3ASGA 4CXYA 4QX7B 2JMHA 2JRKA 3O9XA 4UQXA 1IQRA 3LY9A 1FIOA 4N3BA 5BV1A 2P58C 5HQ8A 2QGSA 3VTYA 4QHOA 2P9BA 1H7CA 4LCTA 2Y4TA 2HM8A 3RRUA 3B57A 3OBVE 3BQIA 3HHMA 3RC3A 2GGFA 4I50E 5CCMA 1UN8A 2YHCA 4A1GA 4OK0A 2IQCA 3Q47B 1IQUA 5JJ6A 4EZLA 3RYHE 5JH7E 4ZOLE 2WWUA 1U4QA 3SHFA 3HVEA 3CVVA 1D0XA 2W0GA 1CUNA 2WXMA 3Q5XA 2KXPB 1NA0A 4J8EA 4DMWA 3LBXA 2MOWA 1ZHCA 1JWGA 1FMWA 3EIQC 3RH3A 3N5LA 3FU0A 2KC7A 3AB3B 5KJKA 1D1CA 3KV4A 1N54A 1H6KA 5LG4A 4I4TE 4UI9K 3ZN3A 4HXIA 4CCAA 3KVBA 4UWLA 1HFAA 3FTUA 5KJMA 3W15B 2E9XA 2XGSA 1Z3XA 4FJZA 5IHYA 1MIWA 4P09A 3JQ1A 3I1AA 5T4YA 3ZEFA 3NBXX 3OXFA 3U64A 4Y6CA 2ZMAA 4J2CA 3SD5A 5JR9C 1VOMA 2YINA 4G2AA 4WNEA 3AVSA 1ZU2A 4AQFC 4M3OA 1E7UA 2NTXA 1QNFA 2X6KA 5JHBA 4JXTA 4RG6A 2OA5A 3HKDE 3O1HA 4XAXB 4HOQA 2NSZA 5FQ8A 3GA8A 4GYSA 4PUCA 2LSIA 3T5VA 5L3GB 5AYWD 3MK7C 2MYSA 4GB9A 4GZ3A 2A4ZA 2L6JA 1TEZA 4ASKA 5JDLA 2VKJA 4DVDA 2IFUA 1HG5A 2N9DA 1OWAA 4YJ2E 3AU4A 2XUEA 3OXGA 3FUEA 3MGBA 2VL8A 2LSKA 2EQXA 5AJDA 3RIBA 4UF0A 4FA6A 3J9X1 3DP7A 4CDMA 4B8CB 4GZ5A 4O2BE 1Y64B 2JPFA 4MALA 3V5UA 3N2OA 4L23A 3KINB 1KT0A 5JRCA 3N9MA 4EZJA 1YD8G 3QOUA 4IYPA 5LHHB 4GMJA 5LHIB 4MBQA 4BJMA 2FULA 3HKCE 2VB6A 1Y8MA 3UT5E 2UWJG 4DMVA 4JA7A 4IRUA 4HLEA 2JQQA 5HI7A 3LS8A 3ZMSB 1BPOA 4XZ4A 5FY7A 5LCYA 1SQMA 3IF8B 2V7LA 5L2LA 5FT9A 5KJNA 5IYZE 2FEZA 4E85A 3S7DA 3FEXA 2CCQA 3LKUA 3I0QA 3N2KE 4PH4B 2VYIA 3KD7A 3V5SA 2KLQA 1LKXA 3OYZA 4FJYA 4CDRA 4TN7B 3CKDA 4L9IA 3FUHA 2NTYA 3Q5WA 1OXZA 1WYCA 2LOPA 5LGUB 3L09A 1UX5A 4JW1A 4HTEA 3O4XE 2H3RA 2LSGA 3E22E 3PE3A 5FMNA 4AY6A 3D9NA 1Z0PA 3FUIA 3FH7A 1X79A 4I1OB 4EZ4A 2J09A 2X38A 3FY4A 5T3RA 3UUMA 5CMYA 2I9CA 4V3IA 5KMGP 3ZVVA 2MHKA 3LYAA 2IC9A 4GOUA 2KCLA 4AIFA 5H6QB 3EDVA 3SWHA 3IEGA 5JDNA 5EK2A 3TG4A 5JJTA 4PS3A 5EX0A 1E1HB 5AFUL 1E8XA 3ETVA 3SGHA 4UXNB 1D1AA 4HFVA 4UWFA 5J90A 5J2TE 2IW5B 3ZJ2A 2NW7A 2I1JA 4ZI2D 5CA0E 3K3OA 4PK6A 5JDHA 3KS2A 4GYWA 3O1JA 5LJMA 4KP3C 5CA1E 3LXUX 4ANJA 5FXWA 1MMDA 4URKA 1TJFA 1SZ9A 1SZAA 3ONKA 4C9BB 3VLDA 3ML9A 4HOUA 5CMWA 5BMVE 2WAUA 5JQGE 3ZPJA 3CVYA 3N9LA 4HORA 3ESLA 1OWOA 3UMVA 4OYSA 1IJ6A 4XI9A 3H37A 5DIZA 2X51A 2JEKA 3LEWA 3JC6C 3RKOA 4FC8A 3GZ1A 4ACLA 2E9XC 3KFWX 3HDXA 1HO8A 3IV0A 1MNEA 1WYBA 3OXLA 4I17A 3HKEE 3MX3A 2J4BA 1MMNA 5G2NA 3FH5A 4YNDA 5HYAA 3QWPA 3JYSA 2KCVA 3RYFE 2CLYB 5LGTB 1FVFA 4RG9A 5KJLA 3U3IA 3FTXA 3JUIA 5HXRA 1S94A 4JPSA 3R84B 2V8SE 4DI4A 4AXHA 3MEKA 2M63A 2WXGA 3CQGB 5HWYA 2XGOA 5BPPA 3CQXC 2X6IA 3MZKB 2VKDA 2VKHA 2EHOB 4AM9A 3CVPA 1HX8A 4Q94A 3TKLB 2CXFA 3RKVA 3SI5A 2FI7A 2XGMA 4TV8E 4UV9B 2XTLA 3ZRHA 4UQZA 4YLHA 4J8FA 5LFAA 1BR0A 2ONDA 1V9DA 3CSTA 2R5SA 5HXHA 5JVDE 1EDUA 2PL2A 4XI0A 3D9PA 2WMNA 3FTYA 3ZMVB 1LVKA 2XCBA 2X9XA 4UIGA 4L5GA 1B89A 4I55E 4Z8XA 2XCCA 2XHEB 2J07A 2UXXB 3RPUA 4ZHQE 3N9PA 4C0EA 3NZUA 5DQVA 2OV8A 3CK7A 3LCAA 2WXNA 3APCA 2XQYA 5JDFA 5BNWA 3C4ZA 3C98B 2N2NA 5FQ7A 4HVBA 3FUFA 2D0TA 4BWRA 2L8KA 1HCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B13 A;  2WMO A;  2YIN A;  3VHL A;  2WM9 A;  2WMN A; 
#chains in the Genus database with same CATH topology
 2Y48 B;  4DID B;  4LFB T;  3TLT A;  2WU2 A;  4IE0 A;  4U33 A;  5C2Y A;  4F53 A;  2A2F X;  5B1A E;  5EN5 D;  4QXB B;  2VQ2 A;  3VR9 A;  2M6B A;  3VRA A;  5HWX A;  2XPI A;  3PDN A;  2JMK A;  4AVX A;  3AG4 E;  4AIS A;  2VJ8 A;  1UCU A;  4UWH A;  5EX3 A;  3I0O A;  4H9O C;  2DNX A;  3QB5 K;  5FZR A;  1WDY A;  2EIL E;  4TNV A;  4G1T A;  4J8S A;  5B3S E;  2AXZ A;  5A7D B;  2AVP A;  4L2Y A;  2FJD A;  3C72 A;  3SQV A;  3AE1 A;  1MHQ A;  3RAU A;  4YT0 A;  1UJK A;  2HO1 A;  4ZXL A;  1TN7 A;  2PFV A;  2Q9Q D;  1A17 A;  4JV5 T;  1KZO A;  3GZS A;  4H9R C;  2MOZ A;  5C8Y E;  2CPT A;  3X2Q E;  2VUR A;  3WXX A;  4XKB A;  2FF4 A;  5LGN B;  4DR4 T;  2WXH A;  4AY5 A;  1IHG A;  3ABM E;  3QC9 A;  4UUC A;  4I9C A;  4UWG A;  2VSY A;  4EB6 E;  4GA1 A;  3RJV A;  2A9U A;  1HNX T;  2BF0 X;  5LA6 E;  1IKN D;  2XS8 A;  1MJ0 A;  5L3B B;  4CT0 A;  2XAS B;  4IDZ A;  4PFO A;  1HZ4 A;  4MBG A;  3DSX A;  4JEH A;  2LSY A;  3WAK A;  1MQS A;  1WY6 A;  3ZT5 A;  4CT4 A;  3IA3 A;  4IUL A;  1FJG T;  4HGA A;  4LF7 T;  1FVH A;  4AOF A;  4OFZ A;  1D0Z A;  4ZI7 E;  2WM9 A;  2LRL A;  1Z6T A;  5CRV A;  5G04 J;  5AQP B;  2X0L B;  3F2E A;  3MJX A;  4CZZ B;  4CI2 B;  2VAS A;  1ELR A;  4A97 A;  1HTJ F;  2DHR A;  3ZMU B;  3P4Q A;  4LUN U;  1JNZ A;  2ZIR A;  4B3T T;  4GZC A;  2RD0 A;  5L3F B;  1WM5 A;  2E2E A;  1QSD A;  3KV6 A;  2WXJ A;  1E8W A;  3AA1 B;  3L6A A;  3B7T A;  4ISS A;  3DSV A;  4CGW A;  1A5E A;  1G8X A;  4TXQ A;  3UUX A;  5AQT B;  4CEM A;  3DTO A;  4CDN A;  2EIK E;  4QXC B;  5FYM A;  3C98 A;  3Q15 A;  3P4P A;  1HS6 A;  3Q5E A;  4UV8 B;  1KNZ A;  2AXV A;  3IXE A;  2HYZ A;  4NUV A;  4BT8 A;  2MBG A;  3SZ7 A;  1SW6 A;  3UIN C;  2K9A A;  4AKI A;  1OCC E;  1O1T A;  3NKZ A;  2WDV A;  3PJA A;  4I9E A;  2KZT B;  5ITZ F;  1WAO 1;  3L54 A;  3QOF A;  4ILG A;  4GYR A;  2KWH A;  1LRZ A;  1T8B A;  3JXI A;  4IDQ A;  2XS1 A;  4UEL A;  2W62 A;  5AQK B;  2XHE A;  1UN9 A;  3ENE A;  5CBO A;  4UVB B;  4M1P A;  3TLW A;  4J0U A;  4Z90 A;  1W9R A;  3C4X A;  3ZYM A;  5ENN A;  5FY1 A;  3BQK A;  1ZV4 X;  4X1I E;  3OJA A;  4FJO A;  3PVL A;  5AQJ B;  5ARG A;  3RRC A;  1XNF A;  4FHK A;  3DBS A;  1OED A;  2XAG B;  4X20 E;  4IE6 A;  1N0Q A;  2VWA A;  2P2C P;  5J08 A;  2A72 A;  2WQ7 A;  3AE7 A;  4YSX A;  4NXN T;  3KBU A;  2J9Q A;  4G25 A;  3TL5 A;  1E2A A;  3I9W A;  1OT8 A;  2C5J A;  1YMP A;  4DR1 T;  4G8K A;  2BVL A;  4WWP A;  3LY7 A;  1D1B A;  3OTO T;  4JUY A;  3QDN A;  3UQ3 A;  4N5C A;  3AXJ A;  3QNU A;  1EZ3 A;  4DI3 A;  2DI4 A;  4ILB A;  1ZBP A;  4GTO A;  4HRM B;  3KEZ A;  4TXR A;  5CEC B;  4FAD A;  4BX9 A;  3DSU A;  2YQ8 A;  4ZS3 A;  3LVQ E;  3LK3 B;  3EIJ A;  3PE4 A;  4RVB A;  5JMN D;  2Y69 E;  3FTZ A;  2D9D A;  2DWG A;  3PS6 A;  3U66 A;  4JA9 A;  2QVA A;  2WDR A;  2WXP A;  4KBM B;  4QWN B;  4IDN A;  3E4B A;  2RA1 A;  5KCM A;  4LF5 T;  3S7B A;  1EYH A;  2D2S A;  2W63 A;  2D0U A;  5ARF A;  3JXJ A;  2HR2 A;  2BVM A;  3HI2 A;  2V7M A;  3UU5 A;  2ZM0 A;  3UT4 A;  1LTX A;  2L6B A;  4CRW A;  4DV2 T;  3RF1 A;  3FEY A;  2H6G A;  3QWV A;  3GN5 B;  3TXN A;  2XQ6 A;  2L3L A;  3RKG A;  4X66 T;  2L9Q A;  4TV3 A;  4KX6 A;  3D9J A;  4EOZ B;  5FQ6 A;  1J5E T;  5E0O A;  1N4P A;  1D8E A;  4BEP A;  5ENQ D;  2MYO A;  4IIJ E;  1N4R A;  3UUN A;  4CI3 B;  3TWT A;  4N78 D;  2LJL A;  3EAB A;  2VVS A;  2HH7 A;  4HWI B;  3ULE G;  3ANW B;  5LYJ E;  3PUJ A;  4DR3 T;  1Y01 A;  4KI0 F;  1N34 T;  3CVL A;  3PRE A;  5JR9 A;  4KZC A;  4GCN A;  4HI8 A;  3SFE A;  2KND A;  3ASN E;  3C50 A;  2CFZ A;  3C51 A;  2V6X A;  3UU4 A;  3CHP A;  1W0A A;  3CR3 A;  3NZP A;  2HE0 A;  5F8P A;  3LJN A;  1WCR A;  3G2V A;  1IHB A;  5HEG A;  3PUR A;  2P9I G;  5T8I A;  1OED B;  3JC6 D;  5CGM A;  4H63 V;  4N3A A;  3T1H T;  1UK5 A;  2H7V C;  4GPK A;  2BZB A;  5LOV E;  3P7I A;  5AQU B;  4XEI G;  4NAC A;  2E9X D;  5M72 A;  2F4V T;  3UT8 A;  1H0A A;  2YNQ A;  1H2T C;  4ZFH A;  4FU3 A;  1HF8 A;  4IGU A;  4W9R A;  4FI5 A;  2UXB T;  2X9H A;  2XY8 B;  3AG1 E;  5DQW A;  1FMV A;  3D9L A;  3ASD A;  3FBZ A;  3N9Q A;  3A7M A;  3EHM A;  3UX4 A;  3TWV A;  4K0U A;  5KDM C;  4PJL A;  3S7F A;  2NP9 A;  5AQO B;  4NUR A;  3AXJ B;  3EDT B;  3LG7 A;  2E5V A;  2X67 A;  2DWZ A;  3AS4 A;  5LXT E;  1SE7 A;  1KLX A;  2DYR E;  3FTW A;  4UVA B;  3KAE A;  3Q5M A;  3H3A A;  3R7R A;  1SA0 E;  4F1S A;  4V1A v;  4O60 A;  3CK8 A;  4B8A A;  4EBA G;  4B0Z A;  2V8S V;  1KNP A;  3KV9 A;  4DLQ A;  3APF A;  4XZC A;  3P2B A;  5FIN A;  3B7S A;  3DSW A;  1OWP A;  2X68 A;  3SFD A;  3PH0 C;  4JI7 T;  1N33 T;  3CK9 A;  1NP7 A;  5AJL A;  3ZMZ B;  2IC6 A;  2BKP A;  3CVQ A;  3GN5 A;  5C2T A;  3B7B A;  2CA5 A;  4PW8 A;  1MX4 A;  2CBJ A;  3DPD A;  5ABE A;  3RRN B;  2QRX A;  2ION A;  4A63 B;  2W4X A;  3NZQ A;  4GK5 E;  1U3D A;  5CER B;  3ANW A;  3PRZ A;  3KBT A;  4WYV A;  4AEZ C;  3ZKR A;  2CRB A;  1AP7 A;  5FNV E;  2VSX E;  3CVN A;  4E7S A;  4WZX A;  2KWI B;  2QA7 A;  4TUM A;  4H9Q C;  3L13 A;  2X9W A;  3JCF A;  4XX5 A;  2Y3A A;  4MLK A;  4QX8 B;  4U74 A;  5BXO A;  4EAH A;  2X66 A;  1UX4 A;  2KT9 A;  4KT6 B;  2KZ7 B;  3P1U A;  2ZLY A;  3AG2 E;  1CHU A;  2ODV A;  4YSZ A;  3N9O A;  3R9M A;  3P50 A;  2XPK A;  4AI6 A;  4KYO B;  4L0R A;  4GPM A;  3CVR A;  3PUG A;  2F0Y A;  2HN2 A;  4HE8 A;  3ZYL A;  1OWL A;  5HXS A;  5BT1 A;  5L3E B;  3OTN A;  4U95 D;  4LSZ E;  4TWH A;  2M6I A;  4YDY A;  3RU0 A;  2GW1 A;  4K0R A;  3W9G A;  1KNR A;  2I1K A;  1SA5 A;  1X5B A;  2EHO C;  1AJ3 A;  4F1P A;  2X3M A;  1YXR A;  1O3X A;  1T72 A;  4L9P A;  2HPL A;  3HKB E;  3Q49 B;  3MA9 A;  3T8M A;  3AJI A;  4DV4 T;  1W0B A;  2W00 A;  5CBN A;  4UEM A;  4GTR A;  3MJW A;  2DCF A;  4RSY A;  3AAE B;  5L3C B;  2IOL A;  2IU1 A;  3ZXS A;  2YK0 A;  3P4W A;  3TAX A;  3HYM B;  4ILH B;  3T1Y T;  3L3P A;  3LJ3 A;  3ONL C;  2Q9Q B;  2KCK A;  3KV5 A;  3K3Q C;  3B13 A;  2V5F A;  4ZZB A;  3OAW A;  2Y6X A;  1JCQ A;  3TLV A;  4DV5 T;  3PEV B;  2KM4 A;  2UXN B;  2LRK A;  2CLY C;  2R05 A;  1N36 T;  4UI9 C;  4UF0 B;  2ILR A;  4JD2 G;  2P9S G;  2E0I A;  2JJ9 A;  5F3J A;  2LAH A;  4NPP A;  4N3C A;  4BES A;  4OAV B;  3V31 A;  2DLR A;  2MRI A;  4N5Q A;  5FXX A;  1MIV A;  4GML A;  4ZS2 A;  3NOC D;  3I9Y A;  1WR0 A;  3TLU A;  4J8D A;  4CXW A;  3T8K A;  5JHA A;  4U2Z A;  1QBQ A;  1JPL A;  2RFM A;  4A1S A;  4P0B A;  4AXP A;  1BR4 A;  5FVK A;  2J47 A;  2P9L G;  3SBS A;  2R2L A;  4K03 A;  1NZN A;  1UUR A;  3I3N A;  1ZOY A;  2YOE A;  1NEN A;  5D0O D;  3CHQ A;  2BKK B;  3ZKJ A;  3LY8 A;  5BUZ A;  1NA3 A;  4H7Y A;  3LPZ A;  1KZP A;  5FJY A;  5FXV A;  4FHJ A;  5EID A;  5HKP A;  1HX1 B;  4F7A A;  4ABN A;  3FUL A;  2PNN A;  4XE0 A;  3SY2 A;  3D9I A;  5D66 A;  4FP7 A;  5DBK A;  2YDQ A;  4GTM A;  3NWI A;  4ANU A;  3FU3 A;  4PJJ A;  3UU8 A;  1MZC A;  4AJW A;  3PUW F;  1GW6 A;  2XEE A;  4DPR A;  2VGY A;  3NRX A;  2WXR A;  2MAW A;  2XSA A;  2C0S A;  3GWH A;  5H7P A;  3ZW3 A;  3CHR A;  3UI2 A;  1XDO A;  4DV1 T;  3D9O A;  4O2A E;  2QZA A;  3U78 A;  1K3Z D;  1BI8 B;  4U0U A;  4EZK A;  4L7T A;  2UUA T;  3FB2 A;  4XIF A;  1U5P A;  2QY7 A;  4GZD A;  1H6P A;  3VU7 H;  2D5U A;  2C0M A;  5JRC B;  3ZCI A;  3GZ2 A;  5H6R B;  4R7L A;  4ATZ D;  2XEV A;  2ZU6 B;  2JQK A;  4Z91 A;  4AQG A;  2GRO B;  3Q2M A;  2I59 A;  3PUQ A;  1XGW A;  4ZI3 D;  3PNT B;  3ZHE A;  2P9N G;  5JJ7 A;  4KVO A;  5A6C A;  1I94 T;  3BQL A;  4YTP A;  2RG8 A;  3C3R A;  4CQI A;  3Q4A B;  5BR8 T;  4HFB A;  1E96 B;  4P1N A;  3SO8 A;  4EZH A;  5CHE E;  4GAA A;  1BR2 A;  5AAR A;  4U0Z A;  4DV7 T;  3L39 A;  3E34 A;  3MKD A;  2NYJ A;  1MMA A;  3S2A A;  3LJC A;  5ETW A;  1IBK T;  1OCR E;  3UTK A;  4U31 A;  2WXQ A;  2UU9 T;  4N39 A;  3RIA A;  1YKE B;  4PS8 A;  4U8H A;  5LOZ A;  1MX6 A;  3FHN A;  4B3S T;  5HXC A;  2IAK A;  4EYY R;  4YFS A;  3SNX A;  3ISM C;  3DRA A;  4TWD A;  2C5K T;  4DX6 D;  3V2X A;  4TRQ A;  4O4I E;  3T5X A;  3CML A;  5AQH B;  2IO3 C;  3VHL A;  2K24 A;  2LM9 A;  1DCQ A;  2W66 A;  4UWK A;  5FWQ A;  3Q9D A;  4TX5 A;  3FXD B;  3IHR A;  3Q7A A;  1UJJ A;  2DBA A;  2R59 A;  3CEQ A;  4U2Y A;  3DEO A;  4WWO A;  2KXP C;  4NIQ A;  3AVR A;  4ZI2 C;  4DJA A;  2XSB A;  4HI9 A;  4BAY B;  5L3D B;  2BKN A;  4G26 A;  2IHR 1;  2WU5 A;  3AE5 A;  4IHJ E;  2IOS A;  1D0Y A;  2LNI A;  1SHZ C;  3CHS A;  3SF4 A;  4B94 A;  2EIN E;  2LO6 A;  4HWH A;  2LHR A;  4JZY A;  4ZEY A;  4GIW A;  4U07 A;  2V26 A;  1FT2 A;  2A3D A;  2X9Y A;  4MLP A;  4GYY A;  3GYZ A;  3EI0 A;  4ILC A;  4IST A;  4JYA T;  2ES0 A;  1L5J A;  3UM1 A;  1M7K A;  2WB5 A;  4DV0 T;  3RX6 A;  4K5B A;  2VK9 A;  3CKB A;  4P29 A;  1S0P A;  4U96 D;  2LKH A;  2HPJ A;  3WAJ A;  1KFY A;  4YXD A;  2CXL A;  3JAD A;  3L08 A;  3CX6 B;  3PTR B;  3ZIM A;  4GKJ T;  1T98 A;  2V1D B;  5ABF A;  4B93 B;  5DJQ C;  3MKQ B;  2YU1 A;  3ULY A;  3QWW A;  3R7Q A;  3CIR A;  5D2M C;  3UTM A;  3DST A;  4I1M A;  4DR7 T;  1NAF A;  4F3V A;  2PZI A;  5GON E;  2BUG A;  2IEJ A;  4ADZ A;  1E7V A;  3FU5 A;  4HRL A;  2YKS A;  3HXC A;  4PK4 A;  2LXL A;  3MCX A;  2CFU A;  2E8I A;  2OVB A;  4QH4 A;  2QYU A;  1PAQ A;  3UU6 A;  4O4J E;  4GTV A;  3FUD A;  4JEU B;  4GCO A;  4AQF A;  3CKC A;  2KIN B;  4U7I A;  4CI1 B;  3PUV F;  2I2O A;  3VLF A;  1Z3Y A;  4LFA T;  3FTV A;  1YKH B;  2F8Y A;  3T9K A;  5B1B E;  3ZPO A;  1UG3 A;  2FUP A;  3ETU A;  3ZC0 A;  1LD8 A;  3CHO A;  5G55 A;  2I6H A;  1U3C A;  4A55 A;  3LVR E;  3CVW A;  2XAF B;  5CB4 E;  5FIO A;  4MS6 A;  3PUA A;  4FLB A;  3TWQ A;  4HRN A;  4HLL A;  2WMO A;  5KNH D;  2AW6 A;  4WW0 A;  5D0Q D;  3KSQ A;  2V0P A;  5ENS D;  3BG0 B;  4NUU A;  2J1D G;  5KXJ A;  5LP0 A;  4QH5 A;  4YHH T;  4GA0 A;  4I2W A;  4C48 B;  4DO0 A;  3Q7F A;  4IE5 A;  3B95 A;  2IJG X;  4WAF A;  1UGO A;  3U3W A;  5BW8 C;  1E8Z A;  2Q7F A;  1IZN B;  2WXK A;  2CWO A;  4HWC A;  4LF6 T;  2LT3 A;  3P8C D;  4IRE A;  4O4H E;  4HFC A;  4DR2 T;  1OY3 D;  3HXB A;  4BER A;  2LSU A;  3VR8 A;  3UUX B;  3D0T A;  2ZIS A;  3CV0 A;  4QKN A;  3EUH A;  1DVP A;  3QB2 A;  5J2U E;  4H9P C;  3PJA J;  5JDM A;  3TWX A;  3FZF B;  2V5C A;  1PY1 A;  1Z5S C;  1ELW A;  1TJC A;  4EEC A;  3SS1 A;  2WP9 A;  2DL1 A;  2J08 A;  1Y6I A;  4Y6W A;  2XQ9 A;  1WLX A;  2CM0 A;  4OVU A;  3JUE A;  1TR4 A;  2VGX A;  2LLY A;  4F6R C;  2XJ7 A;  3ZSS A;  3BEE A;  3QUJ A;  3NB2 A;  5IY5 E;  2GRQ B;  2Z6E A;  1BR1 A;  2EHO A;  1IXV A;  1TN6 A;  3AED A;  1M62 A;  2WPV A;  2Q9Q A;  3ZN1 B;  2WSS V;  3WI3 A;  5AQI B;  4IL9 A;  3UU3 A;  3Q75 A;  2OEV A;  4HWD A;  1N11 A;  4TNW A;  4HFI A;  2ACX A;  4LF4 T;  4ILU A;  1E8Y A;  4PK5 A;  4JBW F;  5JDQ A;  4DLO A;  2YDS A;  1YQ3 A;  4YJ3 E;  5HEO A;  1HNZ T;  4PAG A;  5ABG A;  2NXP A;  4GZ6 A;  1K8K G;  2UXC T;  4BJN A;  4LEU A;  1V55 E;  4COF A;  3CHM A;  3BUA A;  3D3M A;  3EJN A;  5FZS A;  2R17 C;  3FH8 A;  3MA5 A;  4JC8 A;  4EXT A;  2FO7 A;  2CEA A;  5EKQ D;  2NWB A;  4H9N C;  5FL1 A;  1O1S A;  3IHV A;  1S35 A;  4X62 T;  3D9H A;  3V30 A;  5AQR B;  4HOT A;  3LBX B;  5ABH A;  3ULQ A;  5AQG B;  2Y0B G;  3DEP A;  2Q9Q C;  2H7O A;  4DR6 T;  4DRX E;  3SBT B;  2XM1 A;  3CSF A;  4O8S A;  3AEA A;  4WWN A;  2KAT A;  2EHO D;  4ANV A;  5LP6 E;  4E7Z A;  5AQF B;  2K48 A;  3UFE A;  3RHW A;  3MKR A;  1US7 B;  3N2G E;  5ADX L;  2V7K A;  2KMF A;  1JUQ A;  3Q5D A;  2WWV A;  2NC9 A;  2VSO E;  4WNF A;  3G2S A;  3J7Y q;  4IN3 B;  4ACK A;  3RRW A;  4MFR A;  1NWM X;  3J5Q B;  4YVO A;  2PM6 A;  5HEH A;  3ONJ A;  4B6X A;  5E75 A;  2NW8 A;  4IDO A;  3O48 A;  3FTS A;  4MHC A;  4WNK A;  4GU5 A;  5IUX A;  1D8D A;  4YY3 T;  3SFY A;  1IAP A;  4HKA A;  5CCL A;  3VTX A;  2BS2 A;  2N1G A;  1QUU A;  2JAB A;  3L17 A;  4HS2 A;  2P9K G;  3F31 A;  3L16 A;  2X6F A;  3Q78 A;  5F5W A;  2C0L A;  3OVU A;  2R02 A;  4Z68 A;  3HA4 A;  3B7R L;  1XWM A;  3BK9 A;  2MTQ A;  2WVI A;  3VLE A;  2IUB A;  5C1D A;  4JI2 T;  3I4G A;  3O4Z A;  1W3B A;  1IBL T;  4FUL A;  4ILA A;  1DU2 A;  4PJM A;  4FLH A;  4L1B A;  3EUV A;  1UUS A;  1R8I A;  1DNP A;  2GK9 A;  3J5P A;  1FT1 A;  3MZL B;  3IBE A;  4DUY T;  5FP3 A;  4PJN A;  1OED E;  4LER A;  2WCA A;  4KXK B;  3CGH A;  4TUU A;  3TWR A;  4UI9 J;  4XBF B;  3AE3 A;  2KBX A;  5CFB A;  1Z8U A;  2M67 A;  3A5X A;  3OKQ A;  2PQN A;  2RP4 A;  4H63 H;  5AQL B;  4U7Y A;  3PZ3 A;  3LSV A;  4WND A;  2WXO A;  1MIY A;  2W61 A;  3IEE A;  4UR9 A;  4HOS A;  3FDH A;  3RYI E;  3FUM A;  1J1J A;  2VTB B;  4JI8 T;  2C5I T;  1OWN A;  1HG2 A;  2FBW A;  2V4L A;  4G24 A;  3ZJ1 A;  3TXM A;  3ZFW A;  3OYX A;  2XZD G;  2QFC A;  2CHX A;  3FWV A;  4IDP A;  1TNO A;  4OVV A;  4APF A;  4JVS A;  3R9A B;  1FEW A;  4C91 A;  4JI5 T;  3NF1 A;  5EZY E;  4TUY E;  4EED A;  3MYV A;  2GRL A;  2X6J A;  3ONL A;  4N2Q A;  4BSX A;  3LFM A;  1HH8 A;  4JHJ A;  4HFH A;  3VKH A;  3L8R A;  1KPS B;  1AWC B;  3G2T A;  3CPZ A;  2NW9 A;  3UM0 A;  4B89 A;  3DJB A;  5FTP A;  4B3R T;  3CVU A;  3AA0 B;  4U3C A;  4CXX A;  4PDX A;  3FXE B;  5CED B;  3RYC E;  4DV3 T;  4ERR A;  2KSR A;  2WXI A;  3HL6 A;  3PE0 A;  3ABV A;  2ZM8 A;  4YVQ C;  4UQY A;  4E6H A;  3AA7 B;  2W67 A;  2NR4 A;  4I43 B;  5TAO A;  3RC8 A;  3MV3 B;  3ZLI A;  2VKO A;  4U8Y D;  1OCZ E;  3QKY A;  4GYO A;  2CWY A;  4C0M A;  4NRH B;  1BD8 A;  2L0I A;  4BFR A;  4KVM A;  4J6I A;  4A5X A;  3U9W A;  3AAI A;  2KZT A;  5FXZ A;  5G04 C;  3KVA A;  4C90 A;  4CZ2 D;  2J4D A;  2LOS A;  2X6H A;  4CGV A;  3FP3 A;  3URZ A;  3UKR G;  1VCT A;  5EK3 A;  1E7P A;  4LFC T;  3TWW A;  4OYJ A;  5EYL A;  4IE4 A;  3G06 A;  1DC2 A;  5EK4 A;  1IJ5 A;  2OEW A;  4IE7 A;  2OOE A;  5HCJ A;  3TWU A;  3LDZ A;  4JLE A;  4ME2 A;  3QC1 A;  3TG5 A;  4GMR A;  4ATG A;  4X5T A;  4BTB A;  2CMR A;  1ELK A;  5JRE A;  2NOX A;  3IKO B;  5LX8 A;  4EPZ A;  2R6G F;  3CX7 B;  1VRB A;  4GA2 A;  5CEA A;  2AWI A;  3Q79 A;  3EHQ A;  2PJQ A;  4WBO A;  3NBN B;  4AP2 A;  4RLY A;  2XZT G;  5LG3 A;  1HU3 A;  3AAA B;  4A3T A;  5HXE A;  5G05 C;  2AXU A;  3K9I A;  2VTB A;  4M7C A;  2BG9 B;  2XRZ A;  2B1E A;  4I6J A;  3APD A;  3QJZ A;  3UM2 A;  1WRD A;  4YHJ A;  1N52 A;  4X8Q A;  1MMG A;  4X1Y E;  5AQN B;  3SFX A;  2CXD A;  2XRY A;  1QLB A;  3AEC A;  3ASH A;  2V7J A;  1YW0 A;  2G0U A;  3PU3 A;  2WQH A;  5LBM A;  4DK5 A;  3T8O A;  1E90 A;  3ASF A;  3D9M A;  3DSS A;  4O1O A;  2DWK A;  1HS7 A;  3E37 A;  5BV0 A;  1MYO A;  1MND A;  3PZ1 A;  4AKG A;  3I5P A;  3ZN0 B;  3MKQ A;  3AS8 A;  4AKR B;  3KDS E;  4LF9 T;  1S64 A;  4GK0 E;  2L9B A;  4QXH B;  1X81 A;  3UKU G;  4PNI A;  1HE8 A;  3G2U A;  1LVF A;  1O5M A;  3ZU7 B;  3PUX F;  3AA6 B;  4BT9 A;  4G23 A;  3BG1 B;  1EF1 C;  4KMO A;  4O6F A;  2C2L A;  2CHZ A;  3NAW A;  3NZS A;  4A56 A;  2VGX B;  2XAQ B;  3PDY A;  4OYK A;  1LF8 A;  3PNL B;  3S7J A;  2ACZ A;  3TGO A;  4I2Z A;  4U0S A;  2LSJ A;  5DAB A;  2JQH A;  3Q9U C;  3FHE A;  1FCH A;  5LCW J;  3ZMT B;  2V7I A;  4JI3 T;  4DX2 A;  2L0T B;  1P5Q A;  4RQI A;  3CLJ A;  5G05 J;  4U63 A;  2YEV C;  2LE8 A;  4JHR A;  5AIJ A;  3FUN A;  1ZKE A;  2H6I A;  4ANX A;  1DCE A;  2WXF A;  3IBP A;  4O4L E;  5FZQ A;  2BTD A;  4U7E B;  4DND A;  4H9S E;  1TNB A;  5FY0 A;  1HXI A;  3BU8 A;  1QZ2 A;  4JHK A;  3E30 A;  1NEK A;  3K3N A;  4YTN A;  3UXG A;  3HG0 D;  3NQP A;  4DBQ A;  5JR9 B;  3UUB A;  3MAC A;  2F37 A;  3PUK A;  3RO2 A;  1INZ A;  4I1A A;  4KBQ A;  3L22 A;  4OHF A;  2LEH A;  4X64 T;  2B0O E;  2K5B B;  3FU6 A;  4WUY A;  3ABK E;  3RK6 A;  4B3M T;  3ZC1 A;  2UUC T;  2CE7 A;  5L47 A;  1EPU A;  4PFP A;  3QK6 A;  3AU5 A;  3SFZ A;  3D9K A;  5BXU A;  4HN9 A;  3EDU A;  2ZGG A;  3QK0 A;  4BA9 A;  4XKC A;  2XEN A;  3PUZ F;  3ML8 A;  3JQ0 A;  5E76 A;  3OPC A;  4HNA D;  2CG2 A;  3FUK A;  4JEH B;  3AE4 A;  4DR5 T;  2X0H A;  4LMK A;  3ZHE B;  1JNR A;  2LSV A;  3RQW A;  5LCW C;  4NXM T;  3F57 A;  2LXM A;  2ZM6 T;  2XPZ A;  2LAI A;  4PS7 A;  4P0A A;  2OVF A;  4MKT A;  4JI1 T;  3UQ4 A;  4U04 A;  3PEU B;  3G2W A;  5EDS A;  3EVY A;  2AE9 A;  3CK6 A;  2UY1 A;  2DZN A;  1B7T A;  2BS3 A;  4EYU A;  3PZD A;  5L4E A;  5AAO A;  3K8P C;  4KZ0 A;  3HR0 A;  2BDE A;  1WR6 A;  3MXZ A;  4U72 A;  5A1L A;  2PQR A;  4GTS A;  3TJP A;  4AV7 A;  5LNK A;  1XDP A;  3N9N A;  3E33 A;  4AKL A;  1IYG A;  4G63 A;  1YYH A;  4HFD A;  3RO3 A;  4TV9 E;  3NRY A;  3PUS A;  3RSE G;  3E08 A;  1ZEE A;  5ANL A;  2JLB A;  5HCM A;  2WQ6 A;  2Y8D A;  2PBI A;  3MV2 B;  4TWF A;  2H89 A;  3IHY A;  1TNZ A;  1PC2 A;  2HHH T;  2BED A;  2ZM2 A;  2BKG A;  3M65 A;  1NFI E;  2YHE A;  2A5E A;  1UW4 B;  2BG9 A;  1H2V C;  3CIA A;  3B5M A;  2FJE A;  1N32 T;  4JI6 T;  2WZI A;  2FBN A;  4J8Y A;  1IBM T;  1BU9 A;  4I6E A;  4JEU A;  3B7U X;  4GTT A;  2GRM A;  3ZGQ A;  3ZYQ A;  1OWM A;  2A5U A;  3AS5 A;  4HFG A;  4HB5 A;  3FZM B;  3SRZ A;  3P4S A;  3RRM B;  4ANW A;  3AEF A;  1J5W A;  5FQ4 A;  2YDR A;  4DV6 T;  1Q2Z A;  3I4R B;  4LRZ A;  3LK2 B;  5AEN A;  3UUL A;  1YCS B;  1YA0 A;  5FKY A;  4KMC A;  3ZUV B;  4G11 A;  4HEA A;  4MRU A;  5LJN A;  4I6G A;  2OCC E;  3C4W A;  2ETC A;  3O1I A;  2VSN A;  1H19 A;  4BSZ B;  4EQF A;  3FZK B;  5KX5 E;  2BBJ A;  2FJA A;  4UVC B;  3GW4 A;  2UXD T;  3H3M A;  2XAJ B;  3JCK C;  3C64 A;  2IF4 A;  3CVX A;  4Q96 A;  4IL4 A;  3CWZ B;  3EHN A;  2F8X K;  3QAR A;  2DCP A;  3HXE A;  3HXD A;  4G8L A;  2J4G A;  5ABF B;  4GTQ A;  4AKH A;  1VDY A;  1KK7 A;  1G73 A;  5KWD A;  2BG9 E;  2HN1 A;  2XPY A;  2R03 A;  2EIJ E;  2LHN A;  3FFL A;  3ZT6 A;  4D10 C;  1BLX B;  1KF6 A;  4N2S A;  3P4R A;  3UIO C;  3UPV A;  1OUV A;  1KT1 A;  2ODU A;  2UY1 B;  3UM3 A;  3C3Q A;  1I6Z A;  4YSY A;  2CG3 A;  3FZL B;  3EU5 A;  4KUM B;  3VRB A;  2B6C A;  4X65 T;  5M4Y A;  3ZEF B;  3CX8 B;  4NQ0 A;  2J49 A;  4QFV A;  4K0K T;  3FUJ A;  3E0Z A;  3K1S A;  4ILI A;  4APO A;  5HAX A;  5AQ9 A;  2WZH A;  2PG8 A;  2CHW A;  4ZI3 C;  4EIW A;  1SVX A;  1TNY A;  3PZ2 A;  3WG7 E;  3HVE B;  3PU8 A;  4BY6 A;  2DIW A;  3QAQ A;  2YU2 A;  4L2L A;  3S4U A;  4BTA A;  3R6N A;  5J0Z A;  1LD7 A;  3TLS A;  4Q69 A;  2WB2 A;  4WBN E;  2XAH B;  3ZXP A;  1JWF A;  3CQC B;  5ANR A;  2EIM E;  4BX8 A;  4JL0 A;  2AJA A;  2GRP B;  1H2U A;  3QNK A;  3SOL A;  3UT7 A;  2GRR B;  1N0R A;  1HNW T;  3ZCJ A;  5LHG B;  1QQE A;  3LK4 2;  2J62 A;  4X1K E;  4ZZC A;  4A3V A;  5JDG A;  2P9P G;  4I43 A;  2VVN A;  3EAM A;  4DBR A;  2PM7 A;  4WNG A;  5JA4 D;  4TZ4 C;  3N71 A;  4H7X A;  4EBA A;  2SPC A;  2V4H C;  2WXL A;  3ASO E;  2XQ0 A;  2BS4 A;  5FVL A;  5LBQ B;  3Q73 A;  3FBL A;  2WY2 A;  1WFD A;  2WBL A;  5A23 A;  3GMI A;  3U4T A;  2JIW A;  3ONX A;  5J1G A;  1TYQ G;  3AAA C;  4G2V A;  3ZYK A;  4O1P A;  2E9X B;  4DX1 A;  3HIZ A;  1RW2 A;  3VKG A;  2Y4U A;  3ESK A;  3ASG A;  4CXY A;  4QX7 B;  4AQY T;  2JMH A;  2JRK A;  3O9X A;  4UQX A;  1IQR A;  3LY9 A;  1FIO A;  2IIU A;  2BG9 C;  4N3B A;  5BV1 A;  2P58 C;  5ENO D;  5HQ8 A;  2QGS A;  3VTY A;  4QHO A;  1BI7 B;  2P9B A;  3ZT7 A;  1XNQ T;  3AE6 A;  1H7C A;  4LCT A;  3EHZ A;  1N9A A;  2Y4T A;  2HM8 A;  3RRU A;  3B57 A;  2BBH A;  3BQI A;  3OBV E;  3RIF A;  2H6H A;  3HHM A;  3L82 A;  3RC3 A;  2GGF A;  4I50 E;  5HS0 A;  5CCM A;  1UN8 A;  4QQI A;  5AQQ B;  2YHC A;  4A1G A;  4OK0 A;  2IQC A;  3PUY F;  3Q47 B;  4EHM A;  3NOG D;  4BET A;  1IQU A;  2XZE A;  4DUZ T;  5JJ6 A;  4EZL A;  3FZH B;  1ZP0 A;  3RYH E;  4K5A B;  5JH7 E;  2LM2 A;  2VQE T;  4ZOL E;  2WWU A;  1U4Q A;  3SHF A;  3HVE A;  3CVV A;  1D0X A;  4EGW A;  2W0G A;  1CUN A;  2WXM A;  3Q5X A;  2KXP B;  1NA0 A;  3RIU A;  4JI0 T;  2XQ8 A;  2XQA A;  4J8E A;  4DMW A;  3LBX A;  1HR0 T;  2MOW A;  5FL0 A;  1ZHC A;  1JWG A;  2FO1 E;  1FMW A;  2WS3 A;  3EIQ C;  3RH3 A;  3N5L A;  3FU0 A;  2KC7 A;  3AB3 B;  5KJK A;  1D1C A;  3KV4 A;  1N54 A;  1H6K A;  2JQ9 A;  5LG4 A;  4I4T E;  4UI9 K;  3ZN3 A;  1JCR A;  5CJ5 A;  3AG3 E;  4HXI A;  4CCA A;  3KVB A;  3QB5 A;  4UWL A;  1HFA A;  3FTU A;  3F6Q A;  5KJM A;  4YDE A;  3EU9 A;  3W15 B;  2E9X A;  2XGS A;  1Z3X A;  4FJZ A;  2WQY A;  5IHY A;  1MIW A;  4P09 A;  3JQ1 A;  2QC9 A;  3I1A A;  2RFA A;  3RIU C;  2DVW A;  5T4Y A;  3ZEF A;  3NBX X;  3OXF A;  4EV6 A;  3U64 A;  4Y6C A;  1O1R A;  2ZMA A;  4J2C A;  2V6Y B;  2PTF A;  1SUM B;  4JI4 T;  2IY0 C;  4CYM D;  5AN8 A;  3SD5 A;  2XQ3 A;  5JR9 C;  3DXM G;  2H88 A;  1VOM A;  2YIN A;  4G2A A;  2ETB A;  4WNE A;  3AVS A;  4CN4 A;  5HEU A;  1ZU2 A;  4AQF C;  1OCO E;  4M3O A;  1E7U A;  5KNG A;  2NTX A;  1QNF A;  4I0U A;  1G3N B;  2X6K A;  5JHB A;  4JXT A;  4RG6 A;  2OA5 A;  3HKD E;  3O1H A;  4XAX B;  4HOQ A;  4LMJ A;  2NSZ A;  3DXK G;  1K1B A;  5FQ8 A;  4F6R D;  3GA8 A;  4ZHB A;  4GYS A;  4PUC A;  2LSI A;  3T5V A;  5L3G B;  1VCS A;  3KSL A;  5AYW D;  3MK7 C;  2MYS A;  4GB9 A;  5AQ7 A;  4GZ3 A;  4OAU C;  2BKO A;  3HRA A;  2A4Z A;  2L6J A;  1TEZ A;  5AQV B;  4ASK A;  5JDL A;  5EYP F;  2VKJ A;  4DVD A;  2IFU A;  1HG5 A;  2N9D A;  5JTG A;  2CHO A;  2LUH A;  1OWA A;  4YJ2 E;  2X0Y A;  3AU4 A;  2XUE A;  3OXG A;  2IML A;  3FUE A;  3MGB A;  2VL8 A;  3DWL G;  1X9B A;  2LSK A;  3M3Z B;  2EQX A;  5AJD A;  5ENR D;  3RIB A;  4UF0 A;  4FA6 A;  3J9X 1;  3AE2 A;  4IT4 A;  3DP7 A;  4CDM A;  1TN8 A;  4B8C B;  4GZ5 A;  4O2B E;  1Y64 B;  2JPF A;  4MAL A;  3V5U A;  3W9F A;  3N2O A;  4L23 A;  3KIN B;  1KT0 A;  5JRC A;  3N9M A;  4TXP A;  5HEJ A;  3LDQ B;  4EZJ A;  1YD8 G;  1H6O A;  3QOU A;  4IYP A;  5LHH B;  2RPA A;  2V6Y A;  5LHI B;  4MBQ A;  4GMJ A;  4BJM A;  2FUL A;  5AQS B;  3HKC E;  3EHR A;  2QYW A;  2VB6 A;  1Y8M A;  3UT5 E;  2UWJ G;  3HXF A;  4DMV A;  4JA7 A;  2DZO A;  4IRU A;  4HLE A;  2JQQ A;  5HI7 A;  3LS8 A;  1OXJ A;  3ZMS B;  1BPO A;  4LNB A;  4XZ4 A;  5FY7 A;  5LCY A;  1SQM A;  2E5L T;  2VL0 A;  3PZ4 A;  1XMQ T;  3IF8 B;  2V7L A;  4Q25 A;  5L2L A;  5LMU T;  1N95 A;  5FT9 A;  3AEG A;  5KJN A;  5IYZ E;  2FEZ A;  4E85 A;  4YDW A;  3S7D A;  3FEX A;  2CCQ A;  3LKU A;  1QYM A;  5CRU A;  5KBA A;  3I0Q A;  3N2K E;  1TNU A;  4PH4 B;  3JAE A;  2VYI A;  3KD7 A;  3V5S A;  2KLQ A;  4OX9 T;  1LKX A;  3OYZ A;  4FJY A;  1WG0 A;  1KEY A;  4YTM A;  4CDR A;  4TN7 B;  3V79 K;  3CKD A;  4L9I A;  2J8S D;  3FUH A;  2NTY A;  3Q5W A;  4LF8 T;  1OXZ A;  1WYC A;  2LOP A;  2V5D A;  5LGU B;  3L09 A;  1UX5 A;  4JW1 A;  4GKK T;  4HTE A;  2XM2 A;  3O4X E;  2H3R A;  2LSG A;  3E22 E;  3NVO A;  4F8H A;  3PE3 A;  3UQ7 A;  4HBD A;  5FMN A;  5LMN T;  2V5Q C;  5EIL A;  4AY6 A;  3D9N A;  2IO2 C;  1Z0P A;  3FUI A;  3FH7 A;  1X79 A;  4I1O B;  3JAF A;  4EZ4 A;  3AE9 A;  2J09 A;  4JB8 P;  3L9T A;  2X38 A;  2E2A A;  3FY4 A;  5T3R A;  3UUM A;  5CMY A;  2I9C A;  5AQB A;  4V3I A;  2I0M A;  1NL4 A;  2ZGD A;  3AEE A;  5KMG P;  3C3O A;  3ZVV A;  1S63 A;  2MHK A;  4AIU A;  2IC9 A;  3LYA A;  4GOU A;  2KCL A;  4AIF A;  5H6Q B;  1S70 B;  3E32 A;  3EDV A;  3SWH A;  3IEG A;  2FJB A;  3A8Y C;  1JCS A;  5JDN A;  4EEB A;  5EK2 A;  4DUI A;  4CN1 A;  3TG4 A;  5JJT A;  4HFE A;  4PS3 A;  5EX0 A;  1E1H B;  1GQE A;  3TWS A;  4J7W A;  5AFU L;  1E8X A;  3ETV A;  3SGH A;  5L4H A;  4UXN B;  1D1A A;  4HFV A;  1YQ4 A;  2XQ7 A;  4UWF A;  5J90 A;  2ETA A;  5J2T E;  1N4S A;  2IW5 B;  3ZJ2 A;  2NW7 A;  2I1J A;  2WDQ A;  4ZI2 D;  5CA0 E;  3K3O A;  3ABL E;  1FPP A;  2W2U A;  4PK6 A;  4KHP T;  5JDH A;  3KS2 A;  4GTP A;  2LKG A;  4GYW A;  5LJM A;  2UUB T;  3O1J A;  4KP3 C;  3RLF F;  2K3W A;  5CA1 E;  3LXU X;  2GRN B;  4ANJ A;  5EIB E;  5ENT D;  5FXW A;  1MMD A;  4URK A;  1TJF A;  1SZ9 A;  1SZA A;  3ONK A;  4C9B B;  4LNU D;  3VLD A;  1RZ4 A;  2IDO B;  3ML9 A;  1T7S A;  4HOU A;  3V2O A;  5CMW A;  2QYJ A;  5BMV E;  4YDO A;  2WAU A;  5JQG E;  3ZPJ A;  3CVY A;  3N9L A;  4HOR A;  3ESL A;  1OWO A;  3UMV A;  2Y1L E;  4OYS A;  1IJ6 A;  3AE8 A;  4XI9 A;  3H37 A;  5DIZ A;  2X51 A;  2JEK A;  4U8V D;  3UIP C;  2XQ4 A;  4HQD A;  1XMO T;  4LNG A;  3LEW A;  3JC6 C;  1N4Q A;  3Q9N C;  1OED C;  2OLT A;  3RKO A;  3BQO A;  4FC8 A;  1V54 E;  2H6F A;  2DYS E;  3GZ1 A;  4ACL A;  2E9X C;  3KFW X;  4LML A;  3HDX A;  1HO8 A;  3IV0 A;  1MNE A;  1WYB A;  3PV0 F;  3OXL A;  3HKE E;  4I17 A;  3MX3 A;  2J4B A;  1MMN A;  5G2N A;  5IWA T;  3FH5 A;  3DPY A;  4YND A;  3KEA A;  5ENP D;  5HYA A;  4LG6 A;  3QWP A;  3JYS A;  2KCV A;  3RYF E;  2CLY B;  5LGT B;  1FVF A;  3X1D A;  4RG9 A;  5KJL A;  2YN6 A;  3U3I A;  3FTX A;  3JUI A;  5HXR A;  1S94 A;  4JPS A;  3R84 B;  2V8S E;  3RQU A;  4DI4 A;  3UFG A;  1D9S A;  4AXH A;  1ZB1 A;  3MEK A;  5C3J A;  1W09 A;  2M63 A;  2WXG A;  1U2V G;  3CQG B;  2XQ5 A;  1UOH A;  2VGE A;  5HWY A;  2XGO A;  5BPP A;  3CQX C;  2X6I A;  5HRY A;  3MZK B;  4QH1 A;  2VKD A;  2VKH A;  2EHO B;  1XZY A;  3ZNG A;  4AM9 A;  3CVP A;  2RKK A;  1HX8 A;  4Q94 A;  3TKL B;  5AQM B;  2CXF A;  3RKV A;  3C5R A;  3SI5 A;  2FI7 A;  2XGM A;  2XEH A;  4KHZ F;  4TV8 E;  4UV9 B;  2XTL A;  3ZRH A;  4UQZ A;  1MX2 A;  4DX7 D;  4YLH A;  4J8F A;  1N94 A;  5LFA A;  1BR0 A;  2B76 A;  3AEB A;  2OND A;  1V9D A;  3CST A;  3ZST A;  2CBI A;  4NIK A;  2R5S A;  1L0V A;  5HXH A;  5JVD E;  1EDU A;  2PL2 A;  4XI0 A;  3RGL A;  3D9P A;  2WMN A;  3FTY A;  3ZMV B;  1LVK A;  2OV9 A;  2XCB A;  1XNR T;  2X9X A;  4K5C A;  4UIG A;  2VQF T;  4L5G A;  1B89 A;  4I55 E;  4Z8X A;  2XCC A;  2CHN A;  2XHE B;  2J07 A;  2UXX B;  3RPU A;  2AXD S;  4ZHQ E;  3N9P A;  2P9U G;  4C0E A;  3NZU A;  1K1A A;  4DX5 D;  1NI1 A;  5DQV A;  2OV8 A;  2ZXW E;  3CK7 A;  3LCA A;  4HWF A;  2WXN A;  3APC A;  2XQY A;  5JDF A;  5BNW A;  1SA4 A;  4CN6 A;  3C4Z A;  5AQA A;  3C98 B;  2N2N A;  5FQ7 A;  4HVB A;  3FUF A;  2D0T A;  5LB7 B;  4BWR A;  2L8K A;  1HCI A;  2MPK A;  3RI5 A;  4A98 A; 
#chains in the Genus database with same CATH homology
 2Y48 B;  4IE0 A;  5C2Y A;  4F53 A;  2A2F X;  4QXB B;  2VQ2 A;  3PDN A;  5HWX A;  2XPI A;  2JMK A;  4AVX A;  2VJ8 A;  1UCU A;  4UWH A;  5EX3 A;  3I0O A;  4H9O C;  2DNX A;  5FZR A;  4G1T A;  4J8S A;  2AXZ A;  5A7D B;  2AVP A;  4L2Y A;  1MHQ A;  1UJK A;  2HO1 A;  2PFV A;  2Q9Q D;  1A17 A;  3GZS A;  4H9R C;  2MOZ A;  5C8Y E;  3WXX A;  4XKB A;  2FF4 A;  5LGN B;  2WXH A;  4AY5 A;  1IHG A;  3QC9 A;  4I9C A;  4UWG A;  2VSY A;  4EB6 E;  4GA1 A;  3RJV A;  2BF0 X;  5LA6 E;  5L3B B;  4CT0 A;  2XAS B;  4IDZ A;  4PFO A;  1HZ4 A;  4JEH A;  2LSY A;  3WAK A;  1MQS A;  1WY6 A;  4CT4 A;  4IUL A;  4HGA A;  1FVH A;  4AOF A;  4OFZ A;  1D0Z A;  4ZI7 E;  2WM9 A;  1Z6T A;  5G04 J;  2X0L B;  3F2E A;  3MJX A;  4CZZ B;  4CI2 B;  2VAS A;  1ELR A;  1HTJ F;  2DHR A;  3ZMU B;  4LUN U;  4GZC A;  2RD0 A;  5L3F B;  1WM5 A;  2E2E A;  1QSD A;  3KV6 A;  2WXJ A;  1E8W A;  3AA1 B;  3L6A A;  3B7T A;  4ISS A;  4CGW A;  1G8X A;  3UUX A;  4CEM A;  3DTO A;  4CDN A;  4QXC B;  5FYM A;  3C98 A;  3Q15 A;  1HS6 A;  4UV8 B;  1KNZ A;  2AXV A;  2HYZ A;  4NUV A;  4BT8 A;  2MBG A;  3SZ7 A;  2K9A A;  4AKI A;  4I9E A;  2KZT B;  1WAO 1;  3L54 A;  4ILG A;  4GYR A;  2KWH A;  1LRZ A;  4UEL A;  2W62 A;  2XHE A;  1UN9 A;  3ENE A;  4UVB B;  4M1P A;  4J0U A;  3C4X A;  3ZYM A;  5ENN A;  5FY1 A;  3BQK A;  1ZV4 X;  4X1I E;  3OJA A;  4FJO A;  3PVL A;  5ARG A;  3RRC A;  1XNF A;  4FHK A;  3DBS A;  2XAG B;  4X20 E;  4IE6 A;  2VWA A;  5J08 A;  2A72 A;  2WQ7 A;  3TL5 A;  2J9Q A;  3KBU A;  4G25 A;  3I9W A;  2C5J A;  4WWP A;  2BVL A;  3LY7 A;  1D1B A;  4JUY A;  3QDN A;  3UQ3 A;  4N5C A;  1EZ3 A;  4DI3 A;  2DI4 A;  1ZBP A;  3KEZ A;  4FAD A;  4BX9 A;  2YQ8 A;  4ZS3 A;  3LVQ E;  3LK3 B;  3EIJ A;  3PE4 A;  4RVB A;  3FTZ A;  2DWG A;  3PS6 A;  3U66 A;  4JA9 A;  2WXP A;  4KBM B;  4QWN B;  3E4B A;  2RA1 A;  5KCM A;  3S7B A;  1EYH A;  2D2S A;  2W63 A;  2D0U A;  5ARF A;  2HR2 A;  2BVM A;  3HI2 A;  2V7M A;  3UT4 A;  2ZM0 A;  4CRW A;  3FEY A;  3QWV A;  3GN5 B;  3TXN A;  2L3L A;  2L9Q A;  4TV3 A;  3D9J A;  5FQ6 A;  4EOZ B;  5E0O A;  4IIJ E;  3UUN A;  4CI3 B;  4N78 D;  2LJL A;  2HH7 A;  3ANW B;  5LYJ E;  3PUJ A;  3CVL A;  3PRE A;  5JR9 A;  4KZC A;  4GCN A;  2KND A;  3C50 A;  2CFZ A;  3C51 A;  3CHP A;  3CR3 A;  3NZP A;  5F8P A;  3G2V A;  3PUR A;  5T8I A;  3JC6 D;  4H63 V;  4N3A A;  2H7V C;  4GPK A;  2BZB A;  5LOV E;  3P7I A;  4NAC A;  2E9X D;  5M72 A;  3UT8 A;  1H0A A;  2YNQ A;  1H2T C;  4FU3 A;  1HF8 A;  4IGU A;  4W9R A;  4FI5 A;  2X9H A;  5DQW A;  1FMV A;  3D9L A;  3ASD A;  3FBZ A;  3N9Q A;  3EHM A;  3UX4 A;  4K0U A;  5KDM C;  4PJL A;  3S7F A;  2NP9 A;  4NUR A;  3EDT B;  3LG7 A;  2X67 A;  3AS4 A;  5LXT E;  1KLX A;  3FTW A;  4UVA B;  3KAE A;  3Q5M A;  3H3A A;  3R7R A;  1SA0 E;  4F1S A;  4V1A v;  3CK8 A;  4B8A A;  4EBA G;  4B0Z A;  3KV9 A;  4DLQ A;  3APF A;  4XZC A;  3P2B A;  3B7S A;  1OWP A;  2X68 A;  3PH0 C;  3CK9 A;  1NP7 A;  5AJL A;  3ZMZ B;  2IC6 A;  3CVQ A;  3GN5 A;  2CA5 A;  4PW8 A;  3DPD A;  3RRN B;  2ION A;  3NZQ A;  4GK5 E;  1U3D A;  3ANW A;  3PRZ A;  3KBT A;  4AEZ C;  5FNV E;  2VSX E;  3CVN A;  4E7S A;  2KWI B;  2QA7 A;  4H9Q C;  3L13 A;  2X9W A;  4XX5 A;  2Y3A A;  4MLK A;  4QX8 B;  4U74 A;  4EAH A;  2X66 A;  1UX4 A;  2KT9 A;  4KT6 B;  2KZ7 B;  3P1U A;  2ZLY A;  2ODV A;  3N9O A;  4AI6 A;  4KYO B;  4L0R A;  3CVR A;  3PUG A;  4HE8 A;  3ZYL A;  1OWL A;  5HXS A;  5BT1 A;  5L3E B;  3OTN A;  3RU0 A;  2GW1 A;  4K0R A;  2I1K A;  1X5B A;  2EHO C;  1AJ3 A;  2X3M A;  1O3X A;  2HPL A;  3HKB E;  3Q49 B;  3MA9 A;  3T8M A;  2W00 A;  4UEM A;  3MJW A;  2DCF A;  4RSY A;  3AAE B;  5L3C B;  2IOL A;  2IU1 A;  3ZXS A;  2YK0 A;  3TAX A;  3HYM B;  4ILH B;  3L3P A;  3LJ3 A;  2Q9Q B;  2KCK A;  3KV5 A;  3K3Q C;  3B13 A;  2V5F A;  3OAW A;  2Y6X A;  3PEV B;  2KM4 A;  2UXN B;  2CLY C;  4UI9 C;  4UF0 B;  2ILR A;  2E0I A;  2JJ9 A;  5F3J A;  2LAH A;  4N3C A;  2DLR A;  2MRI A;  5FXX A;  1MIV A;  4GML A;  4ZS2 A;  3I9Y A;  4J8D A;  4CXW A;  5JHA A;  1JPL A;  4A1S A;  4P0B A;  4AXP A;  1BR4 A;  3SBS A;  4K03 A;  1NZN A;  3I3N A;  5D0O D;  3CHQ A;  5BUZ A;  3LY8 A;  1NA3 A;  4H7Y A;  3LPZ A;  5FJY A;  5FXV A;  4FHJ A;  4F7A A;  4ABN A;  3FUL A;  4XE0 A;  3D9I A;  4FP7 A;  5DBK A;  4ANU A;  3FU3 A;  4PJJ A;  4AJW A;  4DPR A;  1GW6 A;  2VGY A;  3NRX A;  2WXR A;  2C0S A;  3GWH A;  3ZW3 A;  3CHR A;  3D9O A;  4O2A E;  3U78 A;  4U0U A;  4EZK A;  4L7T A;  4XIF A;  3FB2 A;  1U5P A;  2QY7 A;  4GZD A;  3VU7 H;  2D5U A;  2C0M A;  5JRC B;  3ZCI A;  3GZ2 A;  5H6R B;  4R7L A;  2XEV A;  2ZU6 B;  4AQG A;  3Q2M A;  2I59 A;  3PUQ A;  1XGW A;  4ZI3 D;  3PNT B;  3ZHE A;  5JJ7 A;  4KVO A;  5A6C A;  3BQL A;  2RG8 A;  4CQI A;  3Q4A B;  1E96 B;  4EZH A;  5CHE E;  4GAA A;  1BR2 A;  4U0Z A;  3MKD A;  1MMA A;  3S2A A;  3LJC A;  5ETW A;  3UTK A;  2WXQ A;  4N39 A;  1YKE B;  4PS8 A;  4U8H A;  5LOZ A;  3FHN A;  5HXC A;  2IAK A;  4EYY R;  4YFS A;  3SNX A;  2C5K T;  4TRQ A;  4O4I E;  3T5X A;  3CML A;  3VHL A;  2K24 A;  2LM9 A;  4UWK A;  5FWQ A;  3Q9D A;  4TX5 A;  3FXD B;  3IHR A;  1UJJ A;  2DBA A;  2R59 A;  3CEQ A;  4WWO A;  3AVR A;  4ZI2 C;  4DJA A;  4BAY B;  5L3D B;  4G26 A;  4IHJ E;  2IOS A;  1D0Y A;  2LNI A;  1SHZ C;  3CHS A;  3SF4 A;  4B94 A;  2LO6 A;  4JZY A;  2LHR A;  4GIW A;  4U07 A;  2V26 A;  2A3D A;  2X9Y A;  4MLP A;  4GYY A;  3GYZ A;  4IST A;  2ES0 A;  1L5J A;  3RX6 A;  2VK9 A;  3CKB A;  4P29 A;  1S0P A;  2HPJ A;  3WAJ A;  2CXL A;  3L08 A;  3CX6 B;  3PTR B;  3ZIM A;  1T98 A;  2V1D B;  5DJQ C;  3MKQ B;  2YU1 A;  3QWW A;  3R7Q A;  4I1M A;  4F3V A;  1NAF A;  2PZI A;  5GON E;  2BUG A;  4ADZ A;  1E7V A;  3FU5 A;  4PK4 A;  3MCX A;  2CFU A;  2E8I A;  2OVB A;  1PAQ A;  4O4J E;  3FUD A;  4JEU B;  4GCO A;  4AQF A;  3CKC A;  2KIN B;  4CI1 B;  2I2O A;  3VLF A;  1Z3Y A;  3FTV A;  1YKH B;  3ZPO A;  1UG3 A;  3ETU A;  3ZC0 A;  5G55 A;  3CHO A;  2I6H A;  1U3C A;  4A55 A;  3LVR E;  3CVW A;  2XAF B;  5CB4 E;  4MS6 A;  3PUA A;  4FLB A;  2WMO A;  2AW6 A;  4WW0 A;  5D0Q D;  2V0P A;  3BG0 B;  4NUU A;  2J1D G;  5LP0 A;  4GA0 A;  4I2W A;  4DO0 A;  4IE5 A;  2IJG X;  4WAF A;  3U3W A;  5BW8 C;  1E8Z A;  2Q7F A;  1IZN B;  2WXK A;  2CWO A;  2LT3 A;  3P8C D;  4O4H E;  2LSU A;  3UUX B;  3D0T A;  3CV0 A;  4QKN A;  3EUH A;  1DVP A;  3QB2 A;  5J2U E;  4H9P C;  5JDM A;  1PY1 A;  1ELW A;  1TJC A;  4EEC A;  3SS1 A;  2J08 A;  1Y6I A;  4Y6W A;  1WLX A;  2CM0 A;  4OVU A;  2VGX A;  4F6R C;  3BEE A;  3QUJ A;  2Z6E A;  1BR1 A;  2EHO A;  2WPV A;  2Q9Q A;  3ZN1 B;  2WSS V;  3WI3 A;  2ACX A;  4ILU A;  1E8Y A;  4PK5 A;  5JDQ A;  4DLO A;  4YJ3 E;  2NXP A;  4PAG A;  4GZ6 A;  4BJN A;  4LEU A;  3CHM A;  3D3M A;  3EJN A;  5FZS A;  4JC8 A;  2R17 C;  3MA5 A;  3FH8 A;  4EXT A;  2FO7 A;  2CEA A;  5EKQ D;  2NWB A;  4H9N C;  3IHV A;  1S35 A;  4HOT A;  3LBX B;  3ULQ A;  2Q9Q C;  2H7O A;  3SBT B;  3CSF A;  4O8S A;  4WWN A;  2KAT A;  2EHO D;  4ANV A;  5LP6 E;  4E7Z A;  2K48 A;  3UFE A;  3MKR A;  1US7 B;  3N2G E;  5ADX L;  2V7K A;  2KMF A;  1JUQ A;  2NC9 A;  2VSO E;  4WNF A;  3G2S A;  3J7Y q;  4IN3 B;  4ACK A;  3RRW A;  4MFR A;  1NWM X;  4YVO A;  2PM6 A;  4B6X A;  5E75 A;  2NW8 A;  3O48 A;  3FTS A;  4MHC A;  4WNK A;  4GU5 A;  1IAP A;  4HKA A;  5CCL A;  3VTX A;  3L17 A;  2N1G A;  1QUU A;  4HS2 A;  3F31 A;  3L16 A;  2X6F A;  2C0L A;  3HA4 A;  3B7R L;  3BK9 A;  2MTQ A;  2WVI A;  3VLE A;  5C1D A;  3I4G A;  3O4Z A;  1W3B A;  4FUL A;  4PJM A;  4FLH A;  4L1B A;  1DNP A;  2GK9 A;  3MZL B;  3IBE A;  5FP3 A;  4PJN A;  4LER A;  4KXK B;  3CGH A;  4TUU A;  4UI9 J;  4XBF B;  2M67 A;  3A5X A;  3OKQ A;  2PQN A;  2RP4 A;  4H63 H;  4WND A;  2WXO A;  1MIY A;  2W61 A;  3IEE A;  4HOS A;  3FDH A;  3RYI E;  3FUM A;  2VTB B;  2C5I T;  1OWN A;  1HG2 A;  2V4L A;  3TXM A;  4G24 A;  3ZJ1 A;  3ZFW A;  3OYX A;  2QFC A;  2CHX A;  3FWV A;  4OVV A;  4APF A;  4JVS A;  3R9A B;  1FEW A;  4C91 A;  3NF1 A;  5EZY E;  4TUY E;  3MYV A;  2GRL A;  2X6J A;  3ONL A;  4N2Q A;  4BSX A;  3LFM A;  1HH8 A;  4JHJ A;  3VKH A;  3G2T A;  3CPZ A;  2NW9 A;  4B89 A;  3DJB A;  5FTP A;  3CVU A;  3AA0 B;  4CXX A;  4PDX A;  3FXE B;  3RYC E;  4ERR A;  2WXI A;  3HL6 A;  3PE0 A;  2ZM8 A;  4YVQ C;  4UQY A;  4E6H A;  3AA7 B;  4I43 B;  5TAO A;  3RC8 A;  3MV3 B;  3ZLI A;  2VKO A;  3QKY A;  4GYO A;  2CWY A;  4C0M A;  4NRH B;  2L0I A;  4BFR A;  4KVM A;  4J6I A;  3U9W A;  3AAI A;  2KZT A;  5FXZ A;  5G04 C;  3KVA A;  4C90 A;  2J4D A;  2LOS A;  2X6H A;  4CGV A;  3FP3 A;  3URZ A;  5EK3 A;  4OYJ A;  4IE4 A;  5EK4 A;  1IJ5 A;  4IE7 A;  2OOE A;  3LDZ A;  4JLE A;  4ME2 A;  3QC1 A;  3TG5 A;  4ATG A;  4BTB A;  2CMR A;  1ELK A;  5JRE A;  2NOX A;  3IKO B;  5LX8 A;  4EPZ A;  3CX7 B;  1VRB A;  4GA2 A;  2AWI A;  2PJQ A;  4WBO A;  4AP2 A;  1HU3 A;  3AAA B;  4A3T A;  5HXE A;  5G05 C;  2AXU A;  3K9I A;  2VTB A;  2XRZ A;  2B1E A;  4I6J A;  3APD A;  3QJZ A;  1WRD A;  4YHJ A;  1N52 A;  1MMG A;  4X1Y E;  2CXD A;  2XRY A;  3ASH A;  2V7J A;  1YW0 A;  2G0U A;  3PU3 A;  2WQH A;  5LBM A;  4DK5 A;  3T8O A;  1E90 A;  3ASF A;  3D9M A;  2DWK A;  1HS7 A;  5BV0 A;  1MND A;  4AKG A;  3I5P A;  3MKQ A;  3ZN0 B;  3AS8 A;  4AKR B;  3KDS E;  2L9B A;  4GK0 E;  4QXH B;  4PNI A;  1HE8 A;  3G2U A;  1LVF A;  3AA6 B;  4BT9 A;  4G23 A;  3BG1 B;  1EF1 C;  4KMO A;  4O6F A;  2C2L A;  2CHZ A;  3NZS A;  4A56 A;  2VGX B;  2XAQ B;  3PDY A;  4OYK A;  1LF8 A;  3PNL B;  3S7J A;  3TGO A;  4I2Z A;  4U0S A;  2LSJ A;  5DAB A;  3FHE A;  1FCH A;  5LCW J;  3ZMT B;  2V7I A;  2L0T B;  1P5Q A;  3CLJ A;  5G05 J;  4U63 A;  2YEV C;  2LE8 A;  4JHR A;  5AIJ A;  3FUN A;  1ZKE A;  4ANX A;  2WXF A;  3IBP A;  4O4L E;  5FZQ A;  2BTD A;  4DND A;  4H9S E;  5FY0 A;  1HXI A;  1QZ2 A;  4JHK A;  3K3N A;  3NQP A;  4DBQ A;  5JR9 B;  3MAC A;  3PUK A;  1INZ A;  3RO2 A;  4I1A A;  4KBQ A;  3L22 A;  4OHF A;  2LEH A;  2K5B B;  3FU6 A;  4WUY A;  3RK6 A;  3ZC1 A;  2CE7 A;  1EPU A;  4PFP A;  3QK6 A;  3AU5 A;  3SFZ A;  3D9K A;  4HN9 A;  3EDU A;  3QK0 A;  4BA9 A;  4XKC A;  3ML8 A;  3JQ0 A;  5E76 A;  2CG2 A;  3FUK A;  4JEH B;  3ZHE B;  2LSV A;  5LCW C;  3F57 A;  2XPZ A;  4PS7 A;  2LAI A;  4P0A A;  2OVF A;  4MKT A;  4U04 A;  3PEU B;  3G2W A;  5EDS A;  3EVY A;  2UY1 A;  1B7T A;  4EYU A;  3PZD A;  3K8P C;  4KZ0 A;  3HR0 A;  2BDE A;  1WR6 A;  3MXZ A;  4U72 A;  5A1L A;  2PQR A;  3TJP A;  4AV7 A;  5LNK A;  3N9N A;  4AKL A;  1IYG A;  4G63 A;  3RO3 A;  4TV9 E;  3NRY A;  3PUS A;  3E08 A;  1ZEE A;  5ANL A;  2JLB A;  2WQ6 A;  2Y8D A;  2PBI A;  3MV2 B;  3IHY A;  1PC2 A;  2ZM2 A;  3M65 A;  2YHE A;  1UW4 B;  1H2V C;  3CIA A;  2FBN A;  4I6E A;  4JEU A;  3B7U X;  2GRM A;  3ZGQ A;  3ZYQ A;  1OWM A;  2A5U A;  3AS5 A;  4HFG A;  3SRZ A;  3RRM B;  4ANW A;  5FQ4 A;  3I4R B;  4LRZ A;  3LK2 B;  5AEN A;  3UUL A;  1YA0 A;  4KMC A;  4G11 A;  4HEA A;  4MRU A;  5LJN A;  4I6G A;  3C4W A;  2VSN A;  3O1I A;  1H19 A;  4EQF A;  5KX5 E;  4UVC B;  3GW4 A;  2XAJ B;  3JCK C;  3C64 A;  2IF4 A;  3CVX A;  4Q96 A;  3CWZ B;  3EHN A;  3QAR A;  2DCP A;  4AKH A;  1VDY A;  1KK7 A;  1G73 A;  2XPY A;  2LHN A;  3FFL A;  4D10 C;  4N2S A;  3UPV A;  1OUV A;  1KT1 A;  2ODU A;  2UY1 B;  2CG3 A;  4KUM B;  5M4Y A;  3ZEF B;  3CX8 B;  4NQ0 A;  2J49 A;  4QFV A;  3FUJ A;  3E0Z A;  4ILI A;  4APO A;  5HAX A;  2CHW A;  2PG8 A;  4ZI3 C;  4EIW A;  3HVE B;  3PU8 A;  4BY6 A;  2DIW A;  3QAQ A;  2YU2 A;  4L2L A;  3S4U A;  4BTA A;  3R6N A;  4Q69 A;  2WB2 A;  4WBN E;  2XAH B;  1JWF A;  3CQC B;  5ANR A;  4BX8 A;  4JL0 A;  1H2U A;  3QNK A;  3SOL A;  3UT7 A;  3ZCJ A;  5LHG B;  1QQE A;  3LK4 2;  4X1K E;  4A3V A;  5JDG A;  4I43 A;  4DBR A;  2PM7 A;  4WNG A;  4TZ4 C;  3N71 A;  4H7X A;  4EBA A;  2SPC A;  2WXL A;  2XQ0 A;  5LBQ B;  3FBL A;  2WBL A;  5A23 A;  3GMI A;  3U4T A;  3ONX A;  5J1G A;  4G2V A;  3ZYK A;  2E9X B;  3HIZ A;  2Y4U A;  3VKG A;  3ESK A;  3ASG A;  4CXY A;  4QX7 B;  2JMH A;  2JRK A;  3O9X A;  4UQX A;  1IQR A;  3LY9 A;  1FIO A;  4N3B A;  5BV1 A;  2P58 C;  5HQ8 A;  2QGS A;  3VTY A;  4QHO A;  2P9B A;  1H7C A;  4LCT A;  2Y4T A;  2HM8 A;  3RRU A;  3B57 A;  3OBV E;  3BQI A;  3HHM A;  3RC3 A;  2GGF A;  4I50 E;  5CCM A;  1UN8 A;  2YHC A;  4A1G A;  4OK0 A;  2IQC A;  3Q47 B;  1IQU A;  5JJ6 A;  4EZL A;  3RYH E;  5JH7 E;  4ZOL E;  2WWU A;  1U4Q A;  3SHF A;  3HVE A;  3CVV A;  1D0X A;  2W0G A;  1CUN A;  2WXM A;  3Q5X A;  2KXP B;  1NA0 A;  4J8E A;  4DMW A;  3LBX A;  2MOW A;  1ZHC A;  1JWG A;  1FMW A;  3EIQ C;  3RH3 A;  3N5L A;  3FU0 A;  2KC7 A;  3AB3 B;  5KJK A;  1D1C A;  3KV4 A;  1N54 A;  1H6K A;  5LG4 A;  4I4T E;  4UI9 K;  3ZN3 A;  4HXI A;  4CCA A;  3KVB A;  4UWL A;  1HFA A;  3FTU A;  5KJM A;  3W15 B;  2E9X A;  2XGS A;  1Z3X A;  4FJZ A;  5IHY A;  1MIW A;  4P09 A;  3JQ1 A;  3I1A A;  5T4Y A;  3ZEF A;  3NBX X;  3OXF A;  3U64 A;  4Y6C A;  2ZMA A;  4J2C A;  3SD5 A;  5JR9 C;  1VOM A;  2YIN A;  4G2A A;  4WNE A;  3AVS A;  1ZU2 A;  4AQF C;  4M3O A;  1E7U A;  2NTX A;  1QNF A;  2X6K A;  5JHB A;  4JXT A;  4RG6 A;  2OA5 A;  3HKD E;  3O1H A;  4XAX B;  4HOQ A;  2NSZ A;  5FQ8 A;  3GA8 A;  4GYS A;  4PUC A;  2LSI A;  3T5V A;  5L3G B;  5AYW D;  3MK7 C;  2MYS A;  4GB9 A;  4GZ3 A;  2A4Z A;  2L6J A;  1TEZ A;  4ASK A;  5JDL A;  2VKJ A;  4DVD A;  2IFU A;  1HG5 A;  2N9D A;  1OWA A;  4YJ2 E;  3AU4 A;  2XUE A;  3OXG A;  3FUE A;  3MGB A;  2VL8 A;  2LSK A;  2EQX A;  5AJD A;  3RIB A;  4UF0 A;  4FA6 A;  3J9X 1;  3DP7 A;  4CDM A;  4B8C B;  4GZ5 A;  4O2B E;  1Y64 B;  2JPF A;  4MAL A;  3V5U A;  3N2O A;  4L23 A;  3KIN B;  1KT0 A;  5JRC A;  3N9M A;  4EZJ A;  1YD8 G;  3QOU A;  4IYP A;  5LHH B;  4GMJ A;  5LHI B;  4MBQ A;  4BJM A;  2FUL A;  3HKC E;  2VB6 A;  1Y8M A;  3UT5 E;  2UWJ G;  4DMV A;  4JA7 A;  4IRU A;  4HLE A;  2JQQ A;  5HI7 A;  3LS8 A;  3ZMS B;  1BPO A;  4XZ4 A;  5FY7 A;  5LCY A;  1SQM A;  3IF8 B;  2V7L A;  5L2L A;  5FT9 A;  5KJN A;  5IYZ E;  2FEZ A;  4E85 A;  3S7D A;  3FEX A;  2CCQ A;  3LKU A;  3I0Q A;  3N2K E;  4PH4 B;  2VYI A;  3KD7 A;  3V5S A;  2KLQ A;  1LKX A;  3OYZ A;  4FJY A;  4CDR A;  4TN7 B;  3CKD A;  4L9I A;  3FUH A;  2NTY A;  3Q5W A;  1OXZ A;  1WYC A;  2LOP A;  5LGU B;  3L09 A;  1UX5 A;  4JW1 A;  4HTE A;  3O4X E;  2H3R A;  2LSG A;  3E22 E;  3PE3 A;  5FMN A;  4AY6 A;  3D9N A;  1Z0P A;  3FUI A;  3FH7 A;  1X79 A;  4I1O B;  4EZ4 A;  2J09 A;  2X38 A;  3FY4 A;  5T3R A;  3UUM A;  5CMY A;  2I9C A;  4V3I A;  5KMG P;  3ZVV A;  2MHK A;  3LYA A;  2IC9 A;  4GOU A;  2KCL A;  4AIF A;  5H6Q B;  3EDV A;  3SWH A;  3IEG A;  5JDN A;  5EK2 A;  3TG4 A;  5JJT A;  4PS3 A;  5EX0 A;  1E1H B;  5AFU L;  1E8X A;  3ETV A;  3SGH A;  4UXN B;  1D1A A;  4HFV A;  4UWF A;  5J90 A;  5J2T E;  2IW5 B;  3ZJ2 A;  2NW7 A;  2I1J A;  4ZI2 D;  5CA0 E;  3K3O A;  4PK6 A;  5JDH A;  3KS2 A;  4GYW A;  3O1J A;  5LJM A;  4KP3 C;  5CA1 E;  3LXU X;  4ANJ A;  5FXW A;  1MMD A;  4URK A;  1TJF A;  1SZ9 A;  1SZA A;  3ONK A;  4C9B B;  3VLD A;  3ML9 A;  4HOU A;  5CMW A;  5BMV E;  2WAU A;  5JQG E;  3ZPJ A;  3CVY A;  3N9L A;  4HOR A;  3ESL A;  1OWO A;  3UMV A;  4OYS A;  1IJ6 A;  4XI9 A;  3H37 A;  5DIZ A;  2X51 A;  2JEK A;  3LEW A;  3JC6 C;  3RKO A;  4FC8 A;  3GZ1 A;  4ACL A;  2E9X C;  3KFW X;  3HDX A;  1HO8 A;  3IV0 A;  1MNE A;  1WYB A;  3OXL A;  4I17 A;  3HKE E;  3MX3 A;  2J4B A;  1MMN A;  5G2N A;  3FH5 A;  4YND A;  5HYA A;  3QWP A;  3JYS A;  2KCV A;  3RYF E;  2CLY B;  5LGT B;  1FVF A;  4RG9 A;  5KJL A;  3U3I A;  3FTX A;  3JUI A;  5HXR A;  1S94 A;  4JPS A;  3R84 B;  2V8S E;  4DI4 A;  4AXH A;  3MEK A;  2M63 A;  2WXG A;  3CQG B;  5HWY A;  2XGO A;  5BPP A;  3CQX C;  2X6I A;  3MZK B;  2VKD A;  2VKH A;  2EHO B;  4AM9 A;  3CVP A;  1HX8 A;  4Q94 A;  3TKL B;  2CXF A;  3RKV A;  3SI5 A;  2FI7 A;  2XGM A;  4TV8 E;  4UV9 B;  2XTL A;  3ZRH A;  4UQZ A;  4YLH A;  4J8F A;  5LFA A;  1BR0 A;  2OND A;  1V9D A;  3CST A;  2R5S A;  5HXH A;  5JVD E;  1EDU A;  2PL2 A;  4XI0 A;  3D9P A;  2WMN A;  3FTY A;  3ZMV B;  1LVK A;  2XCB A;  2X9X A;  4UIG A;  4L5G A;  1B89 A;  4I55 E;  4Z8X A;  2XCC A;  2XHE B;  2J07 A;  2UXX B;  3RPU A;  4ZHQ E;  3N9P A;  4C0E A;  3NZU A;  5DQV A;  2OV8 A;  3CK7 A;  3LCA A;  2WXN A;  3APC A;  2XQY A;  5JDF A;  5BNW A;  3C4Z A;  3C98 B;  2N2N A;  5FQ7 A;  4HVB A;  3FUF A;  2D0T A;  4BWR A;  2L8K A;  1HCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...