2YINA

Structure of the complex between dock2 and rac1.
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
425
structure length
411
Chain Sequence
SKDNRMSCTVNLLNFYKDNNREEMYIRYLYKLRDLHLDCDNYTEAAYTLLLHTWLLKWSDEQTHRQLKETLYETIIGYFDKGKMWEEAISLCKELAEQYEMEIFDYELLSQNLIQQAKFYESIMKILRPKPDYFAVGYYGQGFPSFLRNKVFIYRGKEYERREDFQMQLMTQFPNAEKMNTTSAPGDDVKNAPGQYIQCFTVQPVLDEHPRFKNKPVPDQIINFYKSNYVQRFHYSRPVRRGTVDPENEFASMWIERTSFVTAYKLPGILRWFEVVHMSQTTISPLENAIETMSTANEKILMMINQYQSDETLPINPLSMLLNGIVDPAVMGGFAKYEKAFFTEEYVRDHPEDQDKLTHLKDLIAWQIPFLGAGIKIHEKRVSDNLRPFHDRMEECFKNLKMKVEKEYGVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DEDICATOR OF CYTOKINESIS PROTEIN 2
publication title Multiple Factors Confer Specific Cdc42 and Rac Protein Activation by Dedicator of Cytokinesis (Dock) Nucleotide Exchange Factors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 132
structure length 411
sequence length 425
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.740 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2yinA03
1.25.40.410 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2yinA01
3B13A 2WMNA 2WM9A 2YINA 2WMOA 3VHLA
chains in the Genus database with same CATH superfamily
3CHOA 3RKVA 2OV8A 2KZTB 4TNWA 3VR9A 2VGEA 3H3MA 3ZMUB 1Y01A 4TZ4C 2IF4A 2L9BA 3B7BA 3VLDA 2WXPA 5ABHA 4YDYA 2LSYA 2P58C 2EILE 3ENEA 1SUMB 4CI3B 2A3DA 4Z8XA 5AQTB 4CRWA 3CVVA 2M63A 4JV5T 5ENQD 1BD8A 1RZ4A 2X6KA 4JI2T 3EIQC 2VGXB 2ODUA 5KNGA 3AG1E 1BR0A 4G2AA 1OCOE 2ZU6B 4X65T 3UQ7A 5HXCA 5HXRA 4X62T 5LGUB 3ZYLA 3FEXA 4IDZA 1ZBPA 1JWFA 1JCQA 3EJNA 4LF9T 5FY0A 3OBVE 4M3OA 1TYQG 5F3JA 3DEPA 3U9WA 4JI7T 4GTPA 5EIDA 2UU9T 4B6XA 3ZUVB 3HKBE 2YINA 4X5TA 4JB8P 4WNKA 3U3IA 3V5SA 2J4GA 5FY7A 4GCNA 5BT1A 5EDSA 4LF8T 4OAUC 3GN5B 3CSTA 3ZMZB 2MOZA 3J5PA 2C5KT 1MMDA 2XGOA 1T72A 3UFGA 3CVQA 4N5CA 3D9MA 5CHEE 1Z3XA 2PFVA 5AQBA 2XJ7A 3T5XA 3TWVA 2WXHA 3QK0A 4IDQA 2R02A 3URZA 2FJEA 4CN1A 3F2EA 1N34T 4Z91A 3BU8A 1PAQA 3RGLA 4XZ4A 3B7TA 1S94A 4U3CA 4AKIA 4ILCA 1N4PA 2X6FA 4GPKA 2IHR1 4GMRA 3CV0A 4GTVA 4OK0A 3R7QA 2J4BA 5FWQA 2P9NG 3PUQA 2J47A 3UU4A 2CMRA 1EZ3A 2VKJA 3DWLG 2VSOE 2KT9A 1O1SA 1ZU2A 3V31A 3UMVA 3AS4A 4V1Av 2LXLA 2PBIA 4YVQC 5LG4A 3CVXA 5H7PA 3ZYKA 4GAAA 2HN1A 4F6RC 2W0GA 4HE8A 1SQMA 3UT8A 2V4HC 4ATGA 3NZQA 1YD8G 1V54E 4X1YE 3Q5DA 3UUMA 1E90A 3ZCJA 4DIDB 2IMLA 2CHZA 2DCFA 2XQYA 3CHSA 3L82A 1D0YA 1XMOT 2H6HA 3AG4E 4BWRA 3ESKA 4U2ZA 3KDSE 1KNRA 3ZEFB 2FEZA 1LTXA 4G2VA 3D3MA 5BNWA 2IC9A 1OCCE 1FCHA 4DO0A 4H63H 4DR4T 2BS2A 5LHIB 4BT9A 3RRNB 3UUBA 5L3CB 3OXGA 1UN8A 4DX6D 3R9AB 3RKGA 3Q75A 2EHOA 2PQRA 3Q78A 3P50A 5HEHA 3Q5EA 2WS3A 5JHAA 4ZZBA 3UM2A 5C2TA 1H6PA 2JABA 4WBNE 2WQ6A 4JI1T 2WVIA 4QXHB 3AU4A 2N1GA 2NXPA 3S7DA 1DNPA 2WXMA 2E2AA 2J4DA 3UIPC 2QGSA 4ZI3D 3QAQA 1AWCB 1D8EA 3RSEG 2QYUA 2X3MA 2IUBA 3NQPA 5DJQC 1OEDB 4NUUA 2K9AA 3P4SA 3ZVVA 3RO2A 4RQIA 4UI9C 5IWAT 2WXJA 3FZKB 2ZM2A 2X6JA 4CEMA 4K0UA 3TWWA 2LJLA 5ADXL 1QSDA 2VURA 4K5AB 4HOUA 1TNYA 3PUAA 4EXTA 3X2QE 4UI9J 4G26A 1W9RA 4PH4B 1FVHA 4LNBA 3OJAA 2WDRA 3A5XA 3RAUA 2XQ3A 2DHRA 2QC9A 3GA8A 1BPOA 1QYMA 4KI0F 2I2OA 1WY6A 4KMOA 4ILUA 4I43A 4N3BA 2MHKA 5FXWA 3VU7H 2L6BA 1SZAA 1O1RA 2AW6A 3O1JA 4A97A 3ZKRA 4HFHA 3KEZA 4KYOB 5CBNA 1HNXT 3FBZA 3BQOA 3RHWA 4LFAT 1H6OA 4DX7D 5FNVE 2E9XC 3AE8A 5DABA 2X68A 5KCMA 5HEGA 4R7LA 4RVBA 4UQYA 1ZKEA 1H6KA 3MA5A 2PJQA 1H0AA 3JAEA 3UM0A 4GA0A 4UQXA 1N9AA 3ZN1B 2G0UA 3OPCA 4W9RA 4HFGA 2VL8A 4A98A 4DR7T 3B95A 4KBQA 2AXUA 2C0SA 2WP9A 5LHGB 1KZPA 1JNRA 2LUHA 2PQNA 3QJZA 3AE6A 4Y6WA 4AJWA 3FZMB 3UM3A 3ASDA 2V6YB 4QX8B 2UXNB 5J08A 3B5MA 2NC9A 3PDNA 2W00A 3J9X1 4N3CA 1MHQA 1IQRA 2LKGA 1N4RA 2DLRA 3DJBA 4U2YA 5LA6E 1SVXA 4HWDA 2UXBT 4P0AA 3V30A 3ZMTB 4AQGA 3L39A 2GRPB 4TV3A 1AP7A 1INZA 5LJNA 3BG0B 3CX7B 3ZC1A 2QRXA 1QNFA 3PUVF 3QNKA 1UJJA 3PZDA 4C9BB 4B3ST 1WDYA 2CXLA 1TN6A 1WCRA 4JLEA 4HWFA 3N9NA 4O4HE 3SD5A 5C1DA 3JCKC 4H9PC 1E1HB 5A6CA 1J5WA 2CHWA 3EHRA 1UX4A 1S70B 1VCTA 2AWIA 1IXVA 3HRAA 1VRBA 2D2SA 3UI2A 4HNAD 3N71A 5HS0A 4GKKT 4A1SA 3HVEB 5FMNA 2XAQB 4OVVA 4GZ3A 2XAFB 2W4XA 2WB5A 3B7UX 3AEFA 1WR0A 3P8CD 4B8CB 3CVWA 5L3GB 4YHHT 2K3WA 5KBAA 5BV0A 2HPJA 4B93B 3EDTB 1UW4B 3ZSSA 3TWUA 2LEHA 2QVAA 3N9MA 3WI3A 4ZOLE 4YSXA 3TWRA 1OWAA 2FJBA 4BAYB 3UT5E 1JUQA 3MKRA 4KXKB 2NOXA 4C91A 1WR6A 4AY5A 3IHYA 4X1KE 1QLBA 5JVDE 1LD7A 1IYGA 3EU9A 3GYZA 2P9KG 5ENOD 2H7OA 2LSJA 4JBWF 3P4QA 3V79K 3RC3A 1SW6A 5ABFA 2VL0A 4DMWA 2OLTA 4DX2A 4RSYA 2BKNA 3ZN3A 4OVUA 2BKOA 5D66A 1TNZA 2XQ0A 4ABNA 3ML9A 5LGTB 2XS1A 4IN3B 3ZC0A 1FJGT 3AU5A 4JEHB 3QWWA 2VQFT 4HVBA 3L08A 4UWHA 4FC8A 5FYMA 2ZGGA 3CHMA 4BERA 2JLBA 4HB5A 5ITZF 2R6GF 4AOFA 3S7JA 4DVDA 5KX5E 5JHBA 4ZS3A 3T5VA 5HWXA 4UVAB 1G73A 3ZYMA 4ME2A 4LNGA 5HAXA 1D8DA 2GRNB 4U8YD 4NACA 4FADA 4XKCA 2KINB 3RIBA 1W0AA 5LBQB 3G2WA 3BUAA 3PUGA 3FH5A 2BG9E 1UUSA 1WAO1 2DBAA 4LF5T 2X9WA 5JQGE 5CJ5A 3EI0A 2HE0A 3ONXA 2B0OE 5D0OD 3FBLA 5G05C 5JTGA 3CVPA 3PDYA 2HR2A 3N9QA 4IREA 3L17A 4KVMA 5H6RB 4J8SA 4MLKA 2WPVA 3APFA 2Y69E 1FMWA 4COFA 2P9SG 5FT9A 2I6HA 4F8HA 4GTRA 5KJKA 3C4XA 5G05J 4XAXB 1WRDA 1LVKA 3P4RA 3CHQA 4URKA 5JDNA 3CKCA 4IGUA 4JVSA 2XGSA 2C0MA 5LB7B 3Q9DA 1I6ZA 3RRMB 2XGMA 2CRBA 4UWFA 1J5ET 2ACZA 1N4QA 3ZW3A 3UTMA 4HFEA 3HXFA 5JDQA 2E9XB 4AKHA 5IUXA 3S4UA 3TLWA 2XQ6A 4L23A 5C3JA 3JXIA 2YHCA 2MYOA 5T4YA 2XPZA 2VKDA 3RI5A 4O1OA 4KMCA 1S35A 1N4SA 3I3NA 4RG9A 3NKZA 1NP7A 4BJNA 5JDGA 1IBKT 3LY9A 5C2YA 4DV7T 3RIUA 1SA0E 2XRYA 5AQFB 5EILA 1IJ5A 3FU6A 3RIAA 2JQKA 2FI7A 4N5QA 4DV3T 4PK4A 4MKTA 3DPYA 3NB2A 5LCWC 3CWZB 5AQSB 2KLQA 4H9SE 1L0VA 3U3WA 4IE4A 4O2BE 4I55E 5LG3A 3LSVA 4DX5D 4HKAA 3QC9A 5AQHB 2B6CA 4DUIA 3CMLA 1O3XA 2CWYA 4U33A 2IU1A 4TWDA 4L5GA 2XQAA 5LCWJ 3AA1B 5HCJA 4JXTA 5A7DB 1HXIA 2BS4A 1CUNA 2I0MA 4J2CA 4JA7A 2V6XA 5AAOA 2R2LA 4HRMB 4AKGA 3EAMA 3QARA 2KATA 4BJMA 2X9HA 1WYCA 2WXNA 2HN2A 4GK0E 5FXVA 3MKQA 4DR2T 1A5EA 2WB2A 3GZ1A 2V5FA 4JZYA 4L9IA 2XEVA 3J5QB 3PU3A 3DPDA 3SF4A 2AVPA 4I50E 5LOZA 2YOEA 3TLTA 5JDLA 5AQLB 4EZJA 3MK7C 2NYJA 4ISSA 5LNKA 1KNZA 5LMNT 4MHCA 2W61A 3Q4AB 4IIJE 1B7TA 4UV9B 2H6GA 4F3VA 4LF6T 1FPPA 3RK6A 4XIFA 1CHUA 3R6NA 2KM4A 3FHNA 3AS8A 3RPUA 3F6QA 4C90A 4DI3A 4AM9A 4YTMA 2X66A 2CLYC 2XASB 1DCQA 2XCBA 3FUHA 5ABFB 4GK5E 3KINB 4U7EB 5IYZE 3LVQE 4ERRA 4HLEA 4CQIA 4HLLA 1N36T 2I9CA 4HWIB 2BF0X 3Q9UC 3WAJA 3DSTA 5M4YA 4EIWA 4I9CA 3JCFA 2XCCA 2E0IA 2LSUA 2V8SE 3Q73A 4YNDA 5EKQD 3GMIA 2XM1A 4KX6A 3ASOE 4EZHA 1KFYA 1OEDC 4YSZA 4ATZD 2OEWA 1GQEA 4JHKA 2IQCA 4UELA 2V4LA 3RX6A 4EBAA 1MIVA 5JJTA 4MFRA 2HHHT 4HWHA 3WXXA 3VTYA 1D0ZA 2NR4A 4KT6B 5HXSA 3ZHEB 2V7MA 3BQLA 3CX8B 2PM7A 2WMNA 2BZBA 4DBQA 1NENA 5EX0A 2CFZA 4GZCA 3D9HA 3ZMVB 3L22A 4J7WA 2DZOA 4FU3A 2WQHA 3ZRHA 2JQQA 2WCAA 4IDPA 1BI7B 1UJKA 1NEKA 3AG3E 3K9IA 2UUAT 2EIKE 2KWHA 3PEUB 4CN6A 3JYSA 1I94T 4TRQA 3GWHA 5E76A 3FULA 3HL6A 1IBMT 2XEEA 2VVNA 2H88A 3C4WA 2BVLA 5LFAA 4GYYA 2CBJA 3ESLA 1S63A 2JJ9A 4YSYA 3AB3B 3MX3A 1FEWA 1H7CA 1Z0PA 1IHBA 2FJDA 4DV0T 4AISA 2ZM8A 3BK9A 3AE9A 3MCXA 3O48A 5CA0E 3CQCB 2CEAA 1N0QA 3HI2A 3K3QC 4C0MA 3KBTA 1HG5A 2VTBA 3JC6C 4CXYA 5FZSA 4J8EA 1IHGA 3C4ZA 4BY6A 4KHPT 4N2SA 2BKPA 3N2KE 2KSRA 3G2VA 4HGAA 3KV6A 5LOVE 3GZSA 2OCCE 3UIOC 3PREA 3TWXA 3O4XE 2WXRA 2EQXA 3ABME 4L7TA 4ILGA 3NBNB 4J8FA 3VTXA 3ML8A 2UWJG 2BG9A 1PC2A 2X6IA 2IOSA 4TUMA 5CCMA 5D0QD 5BMVE 5AQOB 3B7RL 2VJ8A 1HTJF 4MRUA 4DR3T 3T9KA 2LM9A 4N78D 2XQ4A 1HZ4A 4ZS2A 5HXEA 4GA1A 5AQPB 4LEUA 1E8ZA 4X20E 2F0YA 4U0UA 4DLQA 2XSBA 1X5BA 3AAIA 4IDNA 3ULEG 1S64A 2FBNA 5AQNB 3RRCA 4GTOA 3UT4A 4AVXA 3CVYA 4LMKA 1LD8A 2AXDS 2MYSA 3I0QA 4GYSA 3FU5A 1SHZC 3OKQA 1S0PA 1HNWT 4U96D 2XZEA 2V7IA 2YKSA 4UV8B 1OWLA 4HFVA 3KBUA 2OVFA 3CK8A 3AAEB 2OVBA 1VCSA 3AEBA 3JADA 3UQ4A 3G2SA 4KVOA 5CEAA 4B94A 5CCLA 2OA5A 2XSAA 2YDRA 5AQUB 3C98B 4TUYE 4XX5A 4CXXA 3ABKE 5BV1A 4ZFHA 4UVCB 4DR5T 2IJGX 4GB9A 5JMND 4ANJA 3UUNA 1HX1B 1TR4A 4PS8A 3FZLB 2V5CA 4U8VD 2QYWA 3MKDA 2XPKA 4NPPA 5LCYA 3CEQA 2IAKA 3OXFA 1N33T 1BR1A 2EHOC 2I1KA 2XZDG 2NP9A 3MXZA 3SFZA 2XTLA 3AEDA 3D9OA 2VYIA 1HH8A 2CLYB 5FY1A 2CBIA 4JYAT 5T8IA 3FDHA 3ZU7B 4DUZT 3JQ0A 2VB6A 3KV5A 3MZKB 5C8YE 4JL0A 1HU3A 3DTOA 4PS7A 5JDMA 4XZCA 3C3OA 2YHEA 4A5XA 3T8OA 1RW2A 1NAFA 4IE5A 1NWMX 3LKUA 3LXUX 2DWZA 4U8HA 4FLBA 1BI8B 4GZ6A 4PFPA 5BPPA 1HS6A 5B1BE 3AXJB 3N9PA 5JJ7A 3FZFB 4UEMA 2ZM6T 3C72A 2L0IA 2JQHA 3PUYF 4AQFA 3ASGA 1MJ0A 3WG7E 2DCPA 4TX5A 5FL1A 3U78A 4DV2T 5D2MC 3NZUA 3O1HA 1OT8A 4NQ0A 3QOFA 3K1SA 3KFWX 2LO6A 4DLOA 3ZKJA 5JRCA 4B8AA 1X9BA 4HRNA 2UXXB 3ISMC 5B1AE 3HR0A 4TUUA 2WMOA 2PTFA 2H6FA 4G11A 3Q2MA 4DUYT 4C48B 5HXHA 2XQ9A 4WWOA 5EK3A 1YYHA 3FFLA 2LE8A 3QB2A 3LK42 4ILBA 2VSXE 2WU2A 2VK9A 4ZI2C 4DV6T 2V7LA 4UXNB 4HFCA 3UKRG 3RJVA 1MIYA 2V8SV 4U63A 1EYHA 5AQKB 3CVRA 4O60A 2VWAA 2EIME 4DPRA 2VTBB 3LY7A 4DV1T 2LOPA 3SO8A 4WNGA 2JIWA 2XHEA 3PE4A 3SY2A 1MNEA 3B13A 4LRZA 3TL5A 4CT0A 2B1EA 2VASA 3VKHA 4LERA 1D0XA 4DV4T 1PY1A 4XI0A 5KWDA 3L13A 4IT4A 3SGHA 2ETBA 2DYRE 4X8QA 2E9XD 3RQUA 4AI6A 2J1DG 1N95A 2BG9B 3RKOA 3EDUA 4K5BA 3EHZA 3OYXA 5HKPA 3ZNGA 2J8SD 3CK7A 2E5VA 5ABGA 3LS8A 4GMJA 3DRAA 5H6QB 5FIOA 4PJLA 3JAFA 3CPZA 4EEDA 3CVLA 4IE6A 3FUMA 4HTEA 4QWNB 2NTXA 3HKDE 5FKYA 2ZGDA 1ELRA 1MMNA 1YXRA 5FP3A 3ZLIA 1MQSA 4EZLA 1IZNB 4JI8T 2F4VT 2P9LG 4HXIA 3RYIE 4DK5A 3ZPJA 2DL1A 4KP3C 1R8IA 1KT1A 2RKKA 3ZFWA 3J7Yq 5AJLA 1V9DA 5EN5D 4I6GA 1D1AA 4CXWA 3D9JA 3PUXF 3B7SA 3P4PA 4DV5T 1SA5A 5BXUA 2FBWA 2H3RA 3EABA 3UM1A 3CQGB 4TN7B 3FEYA 4D10C 3JUIA 2DZNA 4RG6A 5LHHB 3TWSA 4QKNA 3Q5MA 2C0LA 2Y6XA 2Q9QD 1TNUA 2E5LT 2IO2C 4WWPA 3C3QA 4BESA 4G1TA 1MX4A 2CWOA 2H7VC 1OCRE 4TXQA 3ZGQA 4APFA 4YHJA 2LRKA 3E30A 4ADZA 1ELKA 3TLUA 2KWIB 1KZOA 4MBGA 5J1GA 4GIWA 3PJAA 2K24A 3TLSA 2XAJB 4UQZA 5JDHA 2R03A 3SWHA 3ASNE 4QFVA 5FZRA 2XAHB 3PUWF 3D9NA 3HA4A 2P9UG 4L2YA 4BTAA 4HFBA 4EYYR 2LHNA 4EPZA 1XNRT 3ANWA 5JREA 3PZ3A 2L9QA 3M65A 3VRBA 4L1BA 4YJ2E 4FI5A 2EHOB 3T8MA 3SS1A 3L9TA 5FQ8A 2LRLA 4IE7A 3AS5A 2LSGA 2SPCA 1EF1C 3MA9A 2XEHA 2VKHA 3IEEA 1LF8A 2PL2A 3BQKA 2BTDA 3ULQA 1A17A 4PS3A 2GW1A 2A5UA 2GRRB 3FTXA 4UI9K 4B0ZA 5AQQB 2X9YA 2A9UA 1WG0A 2BKKB 4PAGA 1J1JA 2AXZA 3DP7A 2XUEA 4GYRA 4B89A 1WFDA 2JRKA 2CE7A 3IKOB 3L8RA 5AQIB 3KEAA 3HKEE 3Q15A 4CT4A 3UU6A 1EPUA 1HF8A 1XWMA 4IDOA 5DQWA 5F8PA 2D0TA 4A1GA 3K3OA 5KMGP 4PFOA 3EHMA 2WBLA 4CCAA 2CXDA 5HWYA 4FJYA 2LT3A 2V5DA 2HH7A 1ELWA 5LMUT 4EZKA 3QC1A 5JR9A 3A8YC 1QQEA 2KCVA 3V5UA 1SE7A 2RPAA 5JRCB 4I0UA 2IONA 4QH4A 2YK0A 4NIKA 2F8YA 5BUZA 1E7UA 4LFCT 4BETA 3UUXA 2YDQA 3RQWA 5G04C 2J62A 3FUEA 4U07A 3AA6B 2WQYA 3AEAA 1WM5A 4BSXA 4WW0A 4WYVA 4ZI7E 3LFMA 4Z90A 1JPLA 4I43B 2WXIA 4HBDA 4HOSA 2X0HA 4JI6T 4JUYA 2RG8A 3GZ2A 5G04J 1KEYA 4JW1A 4J6IA 2KNDA 4OYKA 4U0ZA 3PH0C 3FTVA 2P9PG 5AJDA 2M6IA 4K0RA 3UTKA 2NW8A 1UX5A 5FXXA 3PV0F 4LMJA 1OCZE 4GCOA 1YA0A 4MLPA 4NXMT 4A55A 2JPFA 3AE5A 2LKHA 5JJ6A 5BW8C 3ZIMA 2KC7A 4LCTA 4EYUA 4JI0T 1FMVA 4YVOA 3Q79A 3Q9NC 4TXPA 3TJPA 4KUMB 3RIUC 5LJMA 1N52A 2F37A 2NTYA 1T7SA 1U3DA 3CK9A 3SZ7A 4EECA 3ZPOA 4WWNA 1MYOA 4E6HA 1NL4A 3MEKA 3U64A 4FJOA 4PNIA 3I4RB 3UU8A 3IF8B 1L5JA 1V55E 2MRIA 5AQAA 4QXCB 2X51A 3V2OA 5ARFA 2IDOB 1ZV4X 3SFEA 3PZ4A 2RA1A 1H2TC 3P2BA 3NAWA 4HN9A 3CQXC 3ULYA 3O9XA 5LX8A 2GGFA 3CSFA 5DIZA 1NI1A 1JNZA 2YN6A 4Q25A 3GW4A 4DR1T 4AIFA 1TN8A 3MV2B 5ENSD 3OVUA 3RU0A 3SBSA 4ASKA 5DBKA 2XPIA 1UURA 2XQ7A 3C64A 1JWGA 2GK9A 4X64T 3APDA 3PUKA 3K8PC 4Z68A 2V7JA 2GRQB 3E37A 1O5MA 2MAWA 4FULA 5HEOA 2WWVA 5L4HA 3LBXA 3P4WA 2QYJA 2KCKA 3FTUA 4WBOA 4OX9T 3Q49B 4ANXA 1OY3D 2VKOA 2X9XA 1QZ2A 5TAOA 2H6IA 2XPYA 3UXGA 3TAXA 3D9PA 3DSXA 2JMHA 4LFBT 5CA1E 2W67A 3PE3A 4HQDA 3O1IA 3EDVA 4EOZB 3EUVA 3ZXSA 3L54A 4P09A 1HCIA 1OXJA 3PE0A 1U2VG 2Z6EA 4YT0A 4AKRB 4M1PA 4NXNT 3SFDA 4IL9A 4CGWA 1ZOYA 4I6JA 4JHRA 5J0ZA 2ZIRA 2AXVA 3L6AA 2IOLA 2WDQA 4H9RC 2XQ5A 1BR4A 3ZJ2A 1YQ3A 4TXRA 1UGOA 3FTWA 4EZ4A 2EINE 3HG0D 4YDWA 3JXJA 3HXBA 5A1LA 4U31A 4DI4A 3G06A 2CXFA 2BUGA 3S7BA 2Y8DA 3ABLE 3KV9A 2N9DA 3AE2A 3MZLB 3EHQA 5ABEA 3PTRB 2IO3C 5IY5E 3ZT5A 1N0RA 3QDNA 3KD7A 4WUYA 4U95D 5HI7A 3F31A 2OOEA 5L3FB 3HDXA 5L3BB 4GKJT 2WY2A 5JDFA 4FLHA 4BX8A 4HWCA 2J09A 3SHFA 1W3BA 4I2WA 4H7YA 3AEGA 4L0RA 5LXTE 1OUVA 3G2UA 5FJYA 3QK6A 4EEBA 4I6EA 4GMLA 1FIOA 3E08A 4FJZA 3AA0B 2LNIA 1XDOA 4ILIA 2C2LA 3ETVA 4GA2A 3PURA 2ZM0A 1D1CA 5FTPA 4EHMA 1NFIE 2ETCA 5FQ6A 1W0BA 3R84B 3UUXB 5AARA 3QB5K 4APOA 5A23A 1YKEB 3ZMSB 3ZT7A 2CHOA 3AA7B 5JA4D 1DVPA 2B76A 3N5LA 4EQFA 5GONE 4G23A 3WAKA 4OYSA 1BR2A 4Y6CA 3FXEB 2XAGB 3E32A 4YLHA 1LVFA 1MX2A 3I9WA 4UVBB 1TJFA 4EAHA 4HFDA 4O1PA 5EYPF 2V0PA 2HO1A 2CHXA 3FU0A 4ZXLA 4PJJA 4ZEYA 2E8IA 3LCAA 2L8KA 4YY3T 4O4LE 1HS7A 3FUIA 4PW8A 2CG2A 3LYAA 3R9MA 2QY7A 1HG2A 5FQ4A 4XKBA 4QQIA 5EIBE 2IC6A 4HI8A 3UPVA 5M72A 2CFUA 2YQ8A 4KZ0A 1B89A 5LP0A 2ACXA 1HX8A 3Q7FA 3AEEA 1NA0A 3OXLA 1NA3A 4U74A 3I4GA 5LGNB 4IYPA 2BKGA 1Z3YA 3O4ZA 2BG9C 5CMYA 2CHNA 2E2EA 2WXQA 3IHVA 3UT7A 3H37A 2P9BA 1BU9A 3ONKA 3JC6D 2ZXWE 2V1DB 4DMVA 5ENNA 2MPKA 3CK6A 2L0TB 3Q7AA 3VKGA 2IW5B 3EUHA 3TXMA 5CERB 3I0OA 4UUCA 1DC2A 1UG3A 5L2LA 4EGWA 3W9FA 1Y64B 4GPMA 4GTQA 2X6HA 3RO3A 2DIWA 1W09A 3F57A 4K0KT 2JQ9A 3BG1B 4I1OB 3AECA 3EHNA 3PZ1A 4O6FA 1H2VC 4YDOA 4JI4T 3NOCD 5JH7E 2PNNA 3ZJ1A 4XEIG 4UR9A 2X0LB 2V6YA 4IE0A 5EK4A 4RLYA 4UF0A 2Q7FA 2QZAA 1US7B 3C3RA 2LSKA 1YQ4A 4I2ZA 4XE0A 3LBXB 3FTZA 1M62A 2J07A 2AJAA 3KVBA 4WNDA 3MKQB 3FUFA 3CVUA 4OYJA 4JI3T 5EZYE 3RYHE 4DJAA 3ASFA 3P1UA 5EK2A 4DNDA 4HI9A 2KZ7B 2YU2A 4WNFA 2PG8A 3AJIA 5CB4E 1LRZA 5J2UE 3CX6B 3NWIA 3IV0A 1H2UA 3EU5A 3S7FA 4NIQA 1VDYA 4N3AA 1TN7A 2A72A 4UWGA 1D1BA 5L3DB 3RLFF 3Q47B 2AE9A 3NF1A 4JA9A 3W9GA 3QWVA 1MZCA 4HEAA 4AXPA 3NZPA 2LAIA 3D9IA 3NVOA 3SNXA 2LSVA 4MS6A 2D5UA 2R17C 3HVEA 1UK5A 4F6RD 3PNTB 3PRZA 5IHYA 5CRUA 3W15B 5T3RA 3TG5A 4CGVA 2UY1A 4NRHB 1TJCA 3UU3A 3RIFA 3R7RA 5AIJA 3TKLB 5FQ7A 3Q5XA 3KSLA 4FHJA 1ZHCA 3DEOA 5B3SE 3Q5WA 2BBHA 4HFIA 5HRYA 3QWPA 4CDNA 5KJMA 3MGBA 3PNLB 5FINA 1MMGA 2CPTA 2EHOD 2V26A 2WZIA 3VRAA 4LG6A 3I1AA 4PDXA 1XNFA 5E0OA 4G63A 1WYBA 3MACA 5AQ9A 4TWHA 4C0EA 5CECB 4I1MA 1P5QA 5ANRA 4AQFC 4ZI3C 2P9IG 2LAHA 1DCEA 4G25A 3SFXA 3UINC 4ACKA 1Y8MA 4OAVB 2YNQA 5CBOA 2WAUA 3ZYQA 1T8BA 1IAPA 4JHJA 3E33A 2D0UA 4CI1B 5E75A 5CEDB 4JEHA 2FO1E 2NW7A 2IY0C 4A3TA 3TWQA 3ASHA 3MJXA 3UX4A 3KSQA 4IULA 3B57A 3T1YT 4LNUD 2OEVA 4IHJE 4YFSA 2WQ7A 3QOUA 3E4BA 5AQ7A 2OV9A 1N32T 4U7IA 1X81A 3CIAA 2XENA 3MJWA 5EX3A 1FT1A 1N11A 4JC8A 3FHEA 2R5SA 4ISTA 1BLXB 3C50A 3IHRA 3L09A 2H89A 2KCLA 4CZ2D 2ZMAA 2IIUA 4MALA 3SBTB 4CI2B 1O1TA 2HYZA 4YTPA 4H9QC 2W63A 3MYVA 4F7AA 4K5CA 3AG2E 4O4JE 4PK5A 3RYFE 2VVSA 5FVLA 3AAAC 3JQ1A 4IL4A 4ILHB 1MIWA 3DSWA 2LM2A 3ONLC 2Y4TA 4H9OC 3UULA 2CA5A 4N39A 1E8YA 3E22E 5L3EB 1LKXA 4ZI2D 1K8KG 2R59A 2QA7A 3ONLA 5CGMA 3OTNA 3E0ZA 3DSSA 4DRXE 2IEJA 5FL0A 3EIJA 2XY8B 4LF4T 1TNOA 3TXNA 4CZZB 3LVRE 2UUBT 3FUNA 3PUSA 4GTMA 3LJCA 3N9OA 5AYWD 2HPLA 4TV8E 2FJAA 2FF4A 2L6JA 3FTYA 1E7PA 1K1AA 2FULA 3QUJA 2LXMA 1Z8UA 3FY4A 4JPSA 2E9XA 3NOGD 4AIUA 2GRLA 3DSVA 4JD2G 3N2GE 3DXMG 4NUVA 3LDZA 4XI9A 4FHKA 3I5PA 2XM2A 3VLEA 3ZN0B 4GU5A 5FXZA 5AQMB 1E8WA 5BXOA 1UN9A 2BEDA 3PVLA 4GZDA 1H19A 3FXDB 3FUJA 4NURA 4P0BA 1YW0A 3CHPA 1AJ3A 4F1PA 5CFBA 4UF0B 3L3PA 1FVFA 1G3NB 4KBMB 3LG7A 5HEUA 4UIGA 5HEJA 1NZNA 3FH7A 4IRUA 2KMFA 4A56A 1Z5SC 2PM6A 3L16A 3HIZA 4PK6A 2RD0A 2ETAA 2WXLA 3RYCE 3UQ3A 3FU3A 3KAEA 2WM9A 1Q2ZA 4GYOA 4ACLA 5AQJB 4GOUA 1KT0A 2VQET 2LLYA 4AEZC 5HCMA 4EV6A 2Q9QC 1QUUA 2BVMA 3IXEA 5J2TE 2JEKA 4BSZB 2VSYA 3SFYA 2A4ZA 4ZHQE 3T8KA 1HNZT 4X1IE 5G55A 4A63B 2Q9QA 2MOWA 1MNDA 4BA9A 2WXFA 2ONDA 4WAFA 2CG3A 3RH3A 2WDVA 3T1HT 2VGYA 4KHZF 3V2XA 2LSIA 3D9KA 4GZ5A 3PJAJ 3KV4A 1MX6A 1WLXA 2Y0BG 4AQYT 1OEDE 2PZIA 4J0UA 3DBSA 2UY1B 2XQ8A 4WZXA 2L3LA 4TNVA 2KXPC 4CYMD 5KNHD 2N2NA 4QH1A 5FZQA 4LMLA 4BEPA 5CRVA 3SI5A 2C5JA 4ANUA 3QNUA 2M67A 4O4IE 2W62A 2A2FX 4G8KA 4EBAG 3FWVA 3HHMA 2BBJA 2LOSA 2CM0A 5LP6E 4P1NA 1N54A 4U7YA 3DXKG 5AN8A 2C5IT 4I9EA 4CN4A 3PZ2A 4J8YA 4BFRA 3ZT6A 3EVYA 1XDPA 2XS8A 4AV7A 2K48A 2DYSE 3X1DA 5JR9C 1YCSB 3MV3B 4YJ3E 4BX9A 1VOMA 5HQ8A 4YDEA 4DBRA 3M3ZB 2CCQA 2XRZA 2MTQA 3CKDA 4AY6A 3IBPA 3KVAA 2NSZA 3NRXA 4EB6E 1UCUA 1E7VA 4B3RT 4DX1A 4Q69A 1OWNA 2XZTG 2DWGA 1N94A 3TG4A 1UOHA 4PJMA 4PJNA 3AE4A 2UUCT 3SQVA 5KJNA 1JCRA 4E85A 4XBFB 1XNQT 2YEVC 2Y4UA 5J90A 4HOQA 3CR3A 5F5WA 4YTNA 3LJ3A 4JEUA 2I59A 3ZHEA 5AQGB 1KNPA 2IFUA 4F1SA 1IKND 4F53A 2J9QA 1OWOA 2QFCA 2W66A 4QH5A 3LY8A 2FO7A 4CDRA 4HS2A 4B3TT 2ODVA 2WXGA 1OXZA 5CMWA 1SZ9A 3LK2B 3AAAB 2XHEB 5ARGA 3S2AA 3BQIA 4B3MT 3HKCE 1SA4A 3RF1A 4TWFA 3AVSA 2KZTA 3E34A 4GTTA 1K3ZD 4QHOA 1E8XA 5AQRB 4U04A 2X0YA 4A3VA 5ENPD 3NBXX 3U4TA 5ENRD 4ILAA 3P7IA 4M7CA 3QB5A 4HRLA 2VGXA 4DR6T 4J8DA 4L2LA 4JI5T 1T98A 3PUJA 2DNXA 4BT8A 3FP3A 3H3AA 4U0SA 5KDMC 1IJ6A 2VSNA 4LUNU 1Z6TA 5ENTD 1HO8A 2UXDT 2RFAA 3CKBA 5EYLA 5KXJA 3HXCA 3FUKA 5KJLA 4H63V 1OWPA 2YDSA 3CHRA 2BS3A 4H9NC 1GW6A 2P2CP 4G24A 4ZHBA 2NWBA 5LBMA 1E96B 3LK3B 5ANLA 3UKUG 4FP7A 3CIRA 1HE8A 3FZHB 2I1JA 2JMKA 2FUPA 4CDMA 4V3IA 5AENA 3AE1A 5AQVB 3FB2A 2K5BB 5L47A 3GN5A 3RRWA 4QXBB 1U5PA 4UWLA 3TGOA 1KLXA 4P29A 2WXKA 5G2NA 4E7SA 2GROB 2ILRA 1TEZA 2Y48B 4I1AA 3QKYA 2J08A 2W2UA 4WNEA 3UFEA 3ZXPA 1KK7A 2RFMA 1U3CA 4MBQA 3ZSTA 4OHFA 4AXHA 3PS6A 4O2AE 3K3NA 2D9DA 3SOLA 4I17A 1TNBA 2HM8A 3RRUA 3VHLA 2Q9QB 2X38A 3G2TA 3PU8A 1ZP0A 3C5RA 3TWTA 1M7KA 3VR8A 2ZLYA 4G8LA 4HORA 3D0TA 2VQ2A 3LDQB 3CVNA 3AVRA 3ETUA 3N9LA 2DI4A 2Y1LE 3AE7A 4ANVA 3ANWB 1YKHB 4FA6A 3PUZF 3BEEA 1XMQT 1Y6IA 2Y3AA 3C51A 3C98A 4I4TE 2J49A 1E2AA 3LPZA 3JUEA 3IEGA 2WU5A 2V7KA 2ES0A 2KXPB 4X66T 5DQVA 4ANWA 1QBQA 1KF6A 2EIJE 4U72A 3ZEFA 4QX7B 1MMAA 3I9YA 3IA3A 4E7ZA 4GYWA 3DSUA 2WZHA 3U66A 4KZCA 2BDEA 3NZSA 3A7MA 2WXOA 1K1BA 1ZEEA 4ZZCA 2YU1A 1XGWA 3TLVA 1IBLT 2LHRA 5FVKA 3PEVB 5L4EA 2M6BA 3HXEA 3HXDA 1G8XA 3OAWA 5BR8T 1OWMA 2NW9A 3SRZA 2GRMA 1U4QA 3OYZA 3FTSA 5LYJE 2A5EA 5HYAA 5JR9B 4K03A 1HFAA 1DU2A 5AFUL 2DVWA 4TV9E 1X79A 3AE3A 4Q94A 4O8SA 4AP2A 2DWKA 1IQUA 1YMPA 2R05A 3NRYA 4Q96A 3CLJA 4YXDA 1JCSA 3HYMB 5ETWA 3IBEA 2WSSV 2UXCT 1FT2A 1HR0T 3AXJA 3ABVA 2RP4A 2MBGA 4PUCA 1OEDA 3FH8A 1XZYA 3UU5A 3FUDA 3ZCIA 4AKLA 1ZB1A 4BTBA 2F8XK 4JEUB 2ZISA 4H7XA 1EDUA 3N2OA 4HOTA 3CGHA 4L9PA 4UWKA 1KPSB 3LJNA 2X67A 3ONJA 2KBXA 4LSZE 1D9SA 3KS2A 3RC8A 2WWUA 4N2QA 3OTOT 3D9LA 4GTSA 3LEWA 2V5QC 3VLFA 4LF7T 3APCA 4OFZA
chains in the Genus database with same CATH topology
3CHOA 3RKVA 2OV8A 2KZTB 3ZMUB 2IF4A 4TZ4C 2L9BA 3VLDA 2WXPA 2LSYA 2P58C 3ENEA 4CI3B 2A3DA 4Z8XA 4CRWA 3CVVA 2M63A 2X6KA 3EIQC 2VGXB 2ODUA 1BR0A 4G2AA 2ZU6B 5HXCA 5HXRA 5LGUB 3ZYLA 3FEXA 4IDZA 1ZBPA 1JWFA 3EJNA 5FY0A 3OBVE 4M3OA 5F3JA 3U9WA 4B6XA 3HKBE 2YINA 4WNKA 3U3IA 3V5SA 5FY7A 4GCNA 5BT1A 5EDSA 3GN5B 3CSTA 3ZMZB 2MOZA 2C5KT 1MMDA 2XGOA 3CVQA 4N5CA 3D9MA 5CHEE 1Z3XA 2PFVA 3T5XA 2WXHA 3QK0A 3URZA 3F2EA 1PAQA 4XZ4A 3B7TA 1S94A 4AKIA 4GPKA 2X6FA 3CV0A 4OK0A 3R7QA 2J4BA 5FWQA 3PUQA 2CMRA 1EZ3A 2VKJA 2VSOE 2KT9A 1ZU2A 3UMVA 3AS4A 4V1Av 2PBIA 4YVQC 5LG4A 3CVXA 3ZYKA 4GAAA 4F6RC 2W0GA 4HE8A 1SQMA 3UT8A 4ATGA 3NZQA 1YD8G 4X1YE 1E90A 3UUMA 3ZCJA 2CHZA 2DCFA 2XQYA 3CHSA 1D0YA 4BWRA 3ESKA 3KDSE 3ZEFB 2FEZA 4G2VA 3D3MA 5BNWA 2IC9A 1FCHA 4DO0A 4H63H 5LHIB 4BT9A 3RRNB 5L3CB 3OXGA 1UN8A 3R9AB 2EHOA 2PQRA 5JHAA 4WBNE 2WQ6A 2WVIA 4QXHB 3AU4A 2N1GA 2NXPA 3S7DA 1DNPA 2WXMA 2J4DA 2QGSA 4ZI3D 3QAQA 2X3MA 3NQPA 5DJQC 4NUUA 2K9AA 3ZVVA 3RO2A 4UI9C 2WXJA 2ZM2A 2X6JA 4CEMA 4K0UA 2LJLA 5ADXL 1QSDA 4HOUA 3PUAA 4EXTA 4UI9J 4G26A 4PH4B 1FVHA 3OJAA 3A5XA 2DHRA 3GA8A 1BPOA 2I2OA 1WY6A 4KMOA 4ILUA 4I43A 4N3BA 2MHKA 5FXWA 3VU7H 1SZAA 2AW6A 3O1JA 3KEZA 4KYOB 3FBZA 5FNVE 2E9XC 5DABA 2X68A 5KCMA 4R7LA 4RVBA 4UQYA 1ZKEA 1H6KA 3MA5A 2PJQA 1H0AA 4GA0A 4UQXA 3ZN1B 2G0UA 4W9RA 4HFGA 2VL8A 4KBQA 2AXUA 2C0SA 5LHGB 2PQNA 3QJZA 4Y6WA 4AJWA 3ASDA 4QX8B 2UXNB 5J08A 2NC9A 3PDNA 2W00A 3J9X1 4N3CA 1MHQA 1IQRA 2DLRA 3DJBA 5LA6E 4P0AA 3ZMTB 4AQGA 4TV3A 1INZA 5LJNA 3BG0B 3CX7B 3ZC1A 1QNFA 3QNKA 1UJJA 3PZDA 4C9BB 2CXLA 4JLEA 3N9NA 4O4HE 3SD5A 5C1DA 3JCKC 4H9PC 1E1HB 5A6CA 2CHWA 1UX4A 2AWIA 1VRBA 2D2SA 3N71A 4A1SA 3HVEB 5FMNA 2XAQB 4OVVA 4GZ3A 2XAFB 3B7UX 3P8CD 4B8CB 3CVWA 5L3GB 5BV0A 2HPJA 3EDTB 1UW4B 2LEHA 3N9MA 3WI3A 4ZOLE 1OWAA 4BAYB 4KXKB 3UT5E 1JUQA 3MKRA 2NOXA 4C91A 1WR6A 4AY5A 3IHYA 4X1KE 5JVDE 1IYGA 3GYZA 2H7OA 2LSJA 3RC3A 4DMWA 4RSYA 3ZN3A 4OVUA 2XQ0A 4ABNA 3ML9A 5LGTB 4IN3B 3ZC0A 3AU5A 4JEHB 3QWWA 4HVBA 3L08A 4UWHA 4FC8A 5FYMA 3CHMA 2JLBA 4AOFA 3S7JA 4DVDA 5KX5E 5JHBA 4ZS3A 3T5VA 5HWXA 4UVAB 1G73A 3ZYMA 4ME2A 5HAXA 4NACA 4FADA 4XKCA 2KINB 3RIBA 5LBQB 3G2WA 3PUGA 3FH5A 1WAO1 2DBAA 2X9WA 5JQGE 3ONXA 5D0OD 3FBLA 5G05C 3CVPA 3PDYA 2HR2A 3N9QA 3L17A 4KVMA 5H6RB 4J8SA 4MLKA 2WPVA 3APFA 1FMWA 5FT9A 2I6HA 5KJKA 3C4XA 5G05J 4XAXB 1WRDA 1LVKA 4URKA 3CHQA 5JDNA 3CKCA 4IGUA 4JVSA 2XGSA 2C0MA 3Q9DA 3RRMB 2XGMA 4UWFA 3ZW3A 5JDQA 2E9XB 4AKHA 3S4UA 4L23A 2YHCA 5T4YA 2XPZA 2VKDA 4KMCA 1S35A 3I3NA 4RG9A 1NP7A 4BJNA 5JDGA 3LY9A 5C2YA 1SA0E 2XRYA 1IJ5A 3FU6A 2FI7A 4PK4A 4MKTA 5LCWC 3CWZB 2KLQA 4H9SE 3U3WA 4IE4A 4O2BE 4I55E 4HKAA 3QC9A 3CMLA 1O3XA 2CWYA 2IU1A 4L5GA 5LCWJ 3AA1B 4JXTA 5A7DB 1HXIA 1CUNA 4J2CA 4JA7A 4AKGA 3QARA 2KATA 4BJMA 2X9HA 1WYCA 2WXNA 4GK0E 5FXVA 3MKQA 2WB2A 3GZ1A 2V5FA 4JZYA 4L9IA 2XEVA 3PU3A 3DPDA 3SF4A 2AVPA 4I50E 5LOZA 5JDLA 4EZJA 3MK7C 4ISSA 5LNKA 1KNZA 4MHCA 2W61A 3Q4AB 4IIJE 1B7TA 4UV9B 4F3VA 3RK6A 4XIFA 3R6NA 2KM4A 3FHNA 3AS8A 3RPUA 4DI3A 4C90A 4AM9A 2X66A 2CLYC 2XASB 2XCBA 3FUHA 4GK5E 3KINB 5IYZE 3LVQE 4ERRA 4HLEA 4CQIA 2I9CA 2BF0X 3WAJA 5M4YA 4EIWA 4I9CA 2XCCA 2E0IA 2LSUA 2V8SE 4YNDA 5EKQD 3GMIA 4EZHA 4JHKA 2IQCA 4UELA 2V4LA 3RX6A 4EBAA 1MIVA 5JJTA 4MFRA 3WXXA 3VTYA 1D0ZA 4KT6B 5HXSA 3ZHEB 2V7MA 3BQLA 3CX8B 2PM7A 2WMNA 2BZBA 4DBQA 5EX0A 2CFZA 4GZCA 3ZMVB 3L22A 4FU3A 2WQHA 3ZRHA 2JQQA 1UJKA 3K9IA 2KWHA 3PEUB 3JYSA 4TRQA 3GWHA 5E76A 3FULA 3HL6A 3C4WA 2BVLA 5LFAA 4GYYA 3ESLA 2JJ9A 3AB3B 3MX3A 1FEWA 1H7CA 1Z0PA 2ZM8A 3BK9A 3MCXA 3O48A 5CA0E 3CQCB 2CEAA 3HI2A 3K3QC 4C0MA 3KBTA 1HG5A 2VTBA 3JC6C 4CXYA 5FZSA 4J8EA 1IHGA 3C4ZA 4BY6A 4N2SA 3N2KE 3G2VA 4HGAA 3KV6A 5LOVE 3GZSA 3PREA 3O4XE 2WXRA 2EQXA 4L7TA 4ILGA 4J8FA 3VTXA 3ML8A 2UWJG 1PC2A 2X6IA 2IOSA 5CCMA 5D0QD 5BMVE 3B7RL 2VJ8A 1HTJF 4MRUA 2LM9A 4N78D 1HZ4A 4ZS2A 5HXEA 4GA1A 4LEUA 1E8ZA 4X20E 4U0UA 4DLQA 1X5BA 3AAIA 2FBNA 3RRCA 3UT4A 4AVXA 3CVYA 3I0QA 2MYSA 4GYSA 3FU5A 1SHZC 3OKQA 1S0PA 2V7IA 4UV8B 1OWLA 4HFVA 3KBUA 2OVFA 3CK8A 3AAEB 2OVBA 3G2SA 4KVOA 4B94A 5CCLA 2OA5A 3C98B 4TUYE 4XX5A 4CXXA 5BV1A 4UVCB 2IJGX 4GB9A 4ANJA 3UUNA 4PS8A 5LCYA 3MKDA 3CEQA 2IAKA 3OXFA 1BR1A 2EHOC 2I1KA 2NP9A 3MXZA 3SFZA 2XTLA 3D9OA 2VYIA 1HH8A 2CLYB 5FY1A 5T8IA 3FDHA 3JQ0A 2VB6A 3KV5A 3MZKB 5C8YE 4JL0A 1HU3A 3DTOA 4PS7A 5JDMA 4XZCA 2YHEA 3T8OA 1NAFA 4IE5A 1NWMX 3LKUA 3LXUX 4U8HA 4FLBA 4GZ6A 4PFPA 5BPPA 1HS6A 3N9PA 5JJ7A 4UEMA 2L0IA 4AQFA 3ASGA 2DCPA 4TX5A 3U78A 3NZUA 3O1HA 4NQ0A 3KFWX 2LO6A 4DLOA 5JRCA 4B8AA 2UXXB 3HR0A 4TUUA 2WMOA 4G11A 3Q2MA 5HXHA 4WWOA 5EK3A 3FFLA 2LE8A 3QB2A 3LK42 2VSXE 4ZI2C 2VK9A 2V7LA 4UXNB 3RJVA 1MIYA 4U63A 1EYHA 3CVRA 2VWAA 4DPRA 2VTBB 3LY7A 2LOPA 4WNGA 2XHEA 3PE4A 1MNEA 3B13A 4LRZA 3TL5A 4CT0A 2B1EA 2VASA 3VKHA 4LERA 1D0XA 1PY1A 4XI0A 3L13A 3SGHA 2E9XD 4AI6A 2J1DG 3RKOA 3EDUA 3OYXA 3CK7A 3LS8A 4GMJA 5H6QB 4PJLA 3CPZA 3CVLA 4IE6A 3FUMA 4HTEA 4QWNB 2NTXA 3HKDE 1ELRA 1MMNA 5FP3A 3ZLIA 1MQSA 4EZLA 1IZNB 4HXIA 3RYIE 4DK5A 3ZPJA 4KP3C 1KT1A 3ZFWA 3J7Yq 5AJLA 1V9DA 4I6GA 1D1AA 4CXWA 3D9JA 3B7SA 2H3RA 3CQGB 4TN7B 3FEYA 4D10C 3JUIA 4RG6A 5LHHB 4QKNA 3Q5MA 2C0LA 2Y6XA 2Q9QD 4WWPA 4G1TA 2CWOA 2H7VC 3ZGQA 4APFA 4YHJA 4ADZA 1ELKA 2KWIB 5J1GA 4GIWA 2K24A 2XAJB 4UQZA 5JDHA 3SWHA 4QFVA 5FZRA 2XAHB 3D9NA 3HA4A 4L2YA 4BTAA 4EYYR 2LHNA 4EPZA 3ANWA 5JREA 2L9QA 3M65A 4L1BA 4YJ2E 4FI5A 2EHOB 3T8MA 3SS1A 5FQ8A 4IE7A 3AS5A 2LSGA 2SPCA 1EF1C 3MA9A 2VKHA 3IEEA 1LF8A 2PL2A 3BQKA 2BTDA 3ULQA 1A17A 4PS3A 2GW1A 2A5UA 3FTXA 4UI9K 4B0ZA 2X9YA 4PAGA 2AXZA 3DP7A 2XUEA 4GYRA 4B89A 2JRKA 2CE7A 3IKOB 3Q15A 3HKEE 4CT4A 1EPUA 1HF8A 5DQWA 5F8PA 2D0TA 4A1GA 3K3OA 5KMGP 4PFOA 3EHMA 2WBLA 4CCAA 2CXDA 5HWYA 4FJYA 2LT3A 2HH7A 1ELWA 4EZKA 3QC1A 5JR9A 1QQEA 2KCVA 3V5UA 5JRCB 2IONA 2YK0A 5BUZA 1E7UA 3UUXA 5G04C 3FUEA 4U07A 3AA6B 1WM5A 4BSXA 4WW0A 4HOSA 4ZI7E 3LFMA 1JPLA 4I43B 2WXIA 4JUYA 2RG8A 3GZ2A 5G04J 4JW1A 4J6IA 2KNDA 4OYKA 4U0ZA 3PH0C 3FTVA 5AJDA 4K0RA 3UTKA 2NW8A 1UX5A 5FXXA 4GCOA 1YA0A 4MLPA 4A55A 2JPFA 5BW8C 5JJ6A 3ZIMA 2KC7A 4LCTA 4EYUA 1FMVA 4YVOA 3TJPA 4KUMB 5LJMA 1N52A 2NTYA 1U3DA 3CK9A 3SZ7A 4EECA 3ZPOA 4WWNA 4E6HA 3MEKA 3U64A 4FJOA 4PNIA 3I4RB 1L5JA 3IF8B 2MRIA 4QXCB 2X51A 5ARFA 1ZV4X 2RA1A 1H2TC 3P2BA 4HN9A 3CQXC 3O9XA 5LX8A 2GGFA 3CSFA 5DIZA 3GW4A 4AIFA 3MV2B 3RU0A 3SBSA 4ASKA 5DBKA 2XPIA 3C64A 1JWGA 2GK9A 3APDA 3PUKA 3K8PC 2V7JA 4FULA 3LBXA 2KCKA 3FTUA 4WBOA 3Q49B 4ANXA 2VKOA 2X9XA 1QZ2A 5TAOA 2XPYA 3TAXA 3D9PA 2JMHA 5CA1E 3PE3A 3O1IA 3EDVA 4EOZB 3ZXSA 3L54A 4P09A 1HCIA 3PE0A 2Z6EA 4AKRB 4M1PA 4CGWA 4I6JA 4JHRA 2AXVA 3L6AA 2IOLA 4H9RC 1BR4A 3ZJ2A 3FTWA 4EZ4A 5A1LA 4DI4A 2CXFA 2BUGA 3S7BA 2Y8DA 3KV9A 2N9DA 3MZLB 3PTRB 3QDNA 3KD7A 4WUYA 5HI7A 3F31A 2OOEA 5L3FB 3HDXA 5L3BB 5JDFA 4FLHA 4BX8A 2J09A 3SHFA 1W3BA 4I2WA 4H7YA 4L0RA 5LXTE 1OUVA 3G2UA 5FJYA 3QK6A 4I6EA 4GMLA 1FIOA 3E08A 4FJZA 3AA0B 2LNIA 4ILIA 2C2LA 3ETVA 4GA2A 3PURA 2ZM0A 1D1CA 5FTPA 5FQ6A 3R84B 3UUXB 4APOA 5A23A 1YKEB 3ZMSB 3AA7B 1DVPA 3N5LA 4EQFA 5GONE 4G23A 3WAKA 4OYSA 1BR2A 4Y6CA 3FXEB 2XAGB 4YLHA 1LVFA 3I9WA 4UVBB 1TJFA 4EAHA 2V0PA 2HO1A 2CHXA 3FU0A 4PJJA 2E8IA 3LCAA 2L8KA 1HS7A 4O4LE 3FUIA 4PW8A 2CG2A 3LYAA 2QY7A 1HG2A 5FQ4A 4XKBA 2IC6A 3UPVA 5M72A 2CFUA 2YQ8A 4KZ0A 1B89A 5LP0A 2ACXA 1HX8A 1NA0A 3OXLA 1NA3A 4U74A 3I4GA 5LGNB 4IYPA 1Z3YA 3O4ZA 5CMYA 3IHVA 2E2EA 2WXQA 3UT7A 3H37A 2P9BA 3ONKA 3JC6D 5ENNA 2V1DB 4DMVA 2L0TB 3VKGA 2IW5B 3EUHA 3TXMA 3I0OA 1UG3A 5L2LA 1Y64B 2X6HA 3RO3A 2DIWA 3F57A 3BG1B 4I1OB 3EHNA 4O6FA 1H2VC 5JH7E 3ZJ1A 2X0LB 4IE0A 5EK4A 4UF0A 2Q7FA 1US7B 2LSKA 4I2ZA 4XE0A 3LBXB 3FTZA 2J07A 3KVBA 4WNDA 3MKQB 3FUFA 3CVUA 4OYJA 5EZYE 3RYHE 4DJAA 3ASFA 3P1UA 5EK2A 4DNDA 2KZ7B 2YU2A 4WNFA 2PG8A 5CB4E 1LRZA 5J2UE 3CX6B 3IV0A 1H2UA 3S7FA 1VDYA 4N3AA 2A72A 4UWGA 1D1BA 5L3DB 3Q47B 3NF1A 4JA9A 3QWVA 4HEAA 4AXPA 3NZPA 2LAIA 3D9IA 3SNXA 2LSVA 4MS6A 2D5UA 2R17C 3HVEA 3PNTB 3PRZA 5IHYA 3W15B 5T3RA 3TG5A 4CGVA 2UY1A 4NRHB 1TJCA 3R7RA 5AIJA 3TKLB 5FQ7A 3Q5XA 4FHJA 1ZHCA 3Q5WA 3QWPA 4CDNA 5KJMA 3MGBA 3PNLB 1MMGA 2EHOD 2V26A 3I1AA 4PDXA 1XNFA 5E0OA 4G63A 1WYBA 3MACA 4C0EA 4I1MA 1P5QA 5ANRA 4AQFC 4ZI3C 2LAHA 4G25A 4ACKA 1Y8MA 2YNQA 2WAUA 3ZYQA 1IAPA 4JHJA 2D0UA 4CI1B 5E75A 4JEHA 2NW7A 4A3TA 3ASHA 3MJXA 3UX4A 4IULA 3B57A 2WQ7A 4IHJE 4YFSA 3QOUA 3E4BA 3CIAA 3MJWA 5EX3A 4JC8A 3FHEA 2R5SA 4ISTA 3C50A 3IHRA 3L09A 2KCLA 2ZMAA 4MALA 3SBTB 4CI2B 3MYVA 2HYZA 4F7AA 4H9QC 2W63A 4O4JE 4PK5A 3RYFE 3JQ1A 4ILHB 1MIWA 2Y4TA 4H9OC 3UULA 2CA5A 4N39A 1E8YA 3E22E 5L3EB 1LKXA 2R59A 4ZI2D 2QA7A 3ONLA 3OTNA 3E0ZA 3EIJA 3TXNA 4CZZB 3LVRE 3FUNA 3PUSA 3LJCA 3N9OA 5AYWD 2HPLA 4TV8E 2FF4A 2L6JA 3FTYA 2FULA 3QUJA 3FY4A 4JPSA 2E9XA 2GRLA 3N2GE 4NUVA 3LDZA 4XI9A 4FHKA 3I5PA 3VLEA 3ZN0B 4GU5A 5FXZA 1E8WA 1UN9A 3PVLA 4GZDA 1H19A 3FXDB 3FUJA 4NURA 4P0BA 1YW0A 3CHPA 1AJ3A 4UF0B 3L3PA 1FVFA 4KBMB 3LG7A 4UIGA 1NZNA 3FH7A 4IRUA 2KMFA 4A56A 2PM6A 3L16A 3HIZA 4PK6A 2RD0A 2WXLA 3RYCE 3UQ3A 3FU3A 3KAEA 2WM9A 4GYOA 4ACLA 4GOUA 1KT0A 4AEZC 2Q9QC 1QUUA 2BVMA 5J2TE 2JEKA 2VSYA 2A4ZA 4ZHQE 4X1IE 5G55A 2Q9QA 2MOWA 1MNDA 4BA9A 2WXFA 2ONDA 4WAFA 2CG3A 3RH3A 2VGYA 2LSIA 3D9KA 4GZ5A 3KV4A 1WLXA 4J0UA 2PZIA 3DBSA 2UY1B 2L3LA 2N2NA 5FZQA 3SI5A 2C5JA 4ANUA 2M67A 4O4IE 2W62A 2A2FX 4EBAG 3FWVA 3HHMA 2LOSA 2CM0A 5LP6E 1N54A 2C5IT 4I9EA 4BFRA 3EVYA 4AV7A 2K48A 5JR9C 3MV3B 4YJ3E 4BX9A 1VOMA 5HQ8A 4DBRA 2CCQA 2XRZA 2MTQA 3CKDA 4AY6A 3IBPA 3KVAA 2NSZA 3NRXA 4EB6E 1UCUA 1E7VA 4Q69A 1OWNA 2DWGA 3TG4A 4PJMA 4PJNA 5KJNA 4E85A 4XBFB 2YEVC 2Y4UA 5J90A 4HOQA 3CR3A 3LJ3A 4JEUA 2I59A 3ZHEA 2IFUA 4F1SA 4F53A 2J9QA 1OWOA 2QFCA 3LY8A 2FO7A 4CDRA 4HS2A 2ODVA 2WXGA 1OXZA 5CMWA 1SZ9A 3LK2B 3AAAB 2XHEB 5ARGA 3S2AA 3BQIA 3HKCE 3AVSA 2KZTA 4QHOA 1E8XA 4U04A 4A3VA 3NBXX 3U4TA 3P7IA 2VGXA 4J8DA 4L2LA 1T98A 3PUJA 2DNXA 4BT8A 3FP3A 3H3AA 4U0SA 5KDMC 1IJ6A 2VSNA 4LUNU 1Z6TA 1HO8A 3CKBA 5KJLA 3FUKA 4H63V 1OWPA 3CHRA 4H9NC 1GW6A 4G24A 2NWBA 5LBMA 1E96B 3LK3B 5ANLA 4FP7A 1HE8A 2I1JA 2JMKA 4CDMA 4V3IA 5AENA 3FB2A 2K5BB 3GN5A 3RRWA 4QXBB 1U5PA 4UWLA 3TGOA 1KLXA 4P29A 2WXKA 5G2NA 4E7SA 2ILRA 1TEZA 2Y48B 4I1AA 3QKYA 2J08A 4WNEA 3UFEA 1KK7A 1U3CA 4MBQA 4OHFA 4AXHA 3PS6A 4O2AE 3K3NA 3SOLA 4I17A 2HM8A 3RRUA 3VHLA 2Q9QB 2X38A 3G2TA 3PU8A 2ZLYA 4HORA 3D0TA 2VQ2A 3CVNA 3AVRA 3ETUA 3N9LA 2DI4A 4ANVA 3ANWB 1YKHB 4FA6A 3BEEA 1Y6IA 2Y3AA 3C51A 3C98A 4I4TE 2J49A 3LPZA 3IEGA 2V7KA 2ES0A 2KXPB 5DQVA 4ANWA 4U72A 3ZEFA 4QX7B 1MMAA 3I9YA 4E7ZA 4GYWA 3U66A 4KZCA 2BDEA 3NZSA 2WXOA 1ZEEA 2YU1A 1XGWA 2LHRA 3PEVB 1G8XA 3OAWA 1OWMA 2NW9A 3SRZA 2GRMA 1U4QA 3OYZA 3FTSA 5LYJE 5HYAA 5JR9B 4K03A 1HFAA 5AFUL 4TV9E 1X79A 4Q94A 4O8SA 4AP2A 2DWKA 1IQUA 3NRYA 4Q96A 3CLJA 3HYMB 5ETWA 3IBEA 2WSSV 2RP4A 2MBGA 4PUCA 3FH8A 3FUDA 3ZCIA 4AKLA 4BTBA 4JEUB 4H7XA 1EDUA 3N2OA 4HOTA 3CGHA 4UWKA 2X67A 3KS2A 3RC8A 2WWUA 4N2QA 3D9LA 3LEWA 3VLFA 3APCA 4OFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B13 A;  2WMN A;  2WM9 A;  2YIN A;  2WMO A;  3VHL A; 
#chains in the Genus database with same CATH topology
 3CHO A;  3RKV A;  2OV8 A;  2KZT B;  4TNW A;  3VR9 A;  2VGE A;  3H3M A;  3ZMU B;  1Y01 A;  4TZ4 C;  2IF4 A;  2L9B A;  3B7B A;  3VLD A;  2WXP A;  5ABH A;  4YDY A;  2LSY A;  2P58 C;  2EIL E;  3ENE A;  1SUM B;  4CI3 B;  2A3D A;  4Z8X A;  5AQT B;  4CRW A;  3CVV A;  2M63 A;  4JV5 T;  5ENQ D;  1BD8 A;  1RZ4 A;  2X6K A;  4JI2 T;  3EIQ C;  2VGX B;  2ODU A;  5KNG A;  3AG1 E;  1BR0 A;  4G2A A;  1OCO E;  2ZU6 B;  4X65 T;  3UQ7 A;  5HXC A;  5HXR A;  4X62 T;  5LGU B;  3ZYL A;  3FEX A;  4IDZ A;  1ZBP A;  1JWF A;  1JCQ A;  3EJN A;  4LF9 T;  5FY0 A;  3OBV E;  4M3O A;  1TYQ G;  5F3J A;  3DEP A;  3U9W A;  4JI7 T;  4GTP A;  5EID A;  2UU9 T;  4B6X A;  3ZUV B;  3HKB E;  2YIN A;  4X5T A;  4JB8 P;  4WNK A;  3U3I A;  3V5S A;  2J4G A;  5FY7 A;  4GCN A;  5BT1 A;  5EDS A;  4LF8 T;  4OAU C;  3GN5 B;  3CST A;  3ZMZ B;  2MOZ A;  3J5P A;  2C5K T;  1MMD A;  2XGO A;  1T72 A;  3UFG A;  3CVQ A;  4N5C A;  3D9M A;  5CHE E;  1Z3X A;  2PFV A;  5AQB A;  2XJ7 A;  3T5X A;  3TWV A;  2WXH A;  3QK0 A;  4IDQ A;  2R02 A;  3URZ A;  2FJE A;  4CN1 A;  3F2E A;  1N34 T;  4Z91 A;  3BU8 A;  1PAQ A;  3RGL A;  4XZ4 A;  3B7T A;  1S94 A;  4U3C A;  4AKI A;  4ILC A;  1N4P A;  2X6F A;  4GPK A;  2IHR 1;  4GMR A;  3CV0 A;  4GTV A;  4OK0 A;  3R7Q A;  2J4B A;  5FWQ A;  2P9N G;  3PUQ A;  2J47 A;  3UU4 A;  2CMR A;  1EZ3 A;  2VKJ A;  3DWL G;  2VSO E;  2KT9 A;  1O1S A;  1ZU2 A;  3V31 A;  3UMV A;  3AS4 A;  4V1A v;  2LXL A;  2PBI A;  4YVQ C;  5LG4 A;  3CVX A;  5H7P A;  3ZYK A;  4GAA A;  2HN1 A;  4F6R C;  2W0G A;  4HE8 A;  1SQM A;  3UT8 A;  2V4H C;  4ATG A;  3NZQ A;  1YD8 G;  1V54 E;  4X1Y E;  3Q5D A;  3UUM A;  1E90 A;  3ZCJ A;  4DID B;  2IML A;  2CHZ A;  2DCF A;  2XQY A;  3CHS A;  3L82 A;  1D0Y A;  1XMO T;  2H6H A;  3AG4 E;  4BWR A;  3ESK A;  4U2Z A;  3KDS E;  1KNR A;  3ZEF B;  2FEZ A;  1LTX A;  4G2V A;  3D3M A;  5BNW A;  2IC9 A;  1OCC E;  1FCH A;  4DO0 A;  4H63 H;  4DR4 T;  2BS2 A;  5LHI B;  4BT9 A;  3RRN B;  3UUB A;  5L3C B;  3OXG A;  1UN8 A;  4DX6 D;  3R9A B;  3RKG A;  3Q75 A;  2EHO A;  2PQR A;  3Q78 A;  3P50 A;  5HEH A;  3Q5E A;  2WS3 A;  5JHA A;  4ZZB A;  3UM2 A;  5C2T A;  1H6P A;  2JAB A;  4WBN E;  2WQ6 A;  4JI1 T;  2WVI A;  4QXH B;  3AU4 A;  2N1G A;  2NXP A;  3S7D A;  1DNP A;  2WXM A;  2E2A A;  2J4D A;  3UIP C;  2QGS A;  4ZI3 D;  3QAQ A;  1AWC B;  1D8E A;  3RSE G;  2QYU A;  2X3M A;  2IUB A;  3NQP A;  5DJQ C;  1OED B;  4NUU A;  2K9A A;  3P4S A;  3ZVV A;  3RO2 A;  4RQI A;  4UI9 C;  5IWA T;  2WXJ A;  3FZK B;  2ZM2 A;  2X6J A;  4CEM A;  4K0U A;  3TWW A;  2LJL A;  5ADX L;  1QSD A;  2VUR A;  4K5A B;  4HOU A;  1TNY A;  3PUA A;  4EXT A;  3X2Q E;  4UI9 J;  4G26 A;  1W9R A;  4PH4 B;  1FVH A;  4LNB A;  3OJA A;  2WDR A;  3A5X A;  3RAU A;  2XQ3 A;  2DHR A;  2QC9 A;  3GA8 A;  1BPO A;  1QYM A;  4KI0 F;  2I2O A;  1WY6 A;  4KMO A;  4ILU A;  4I43 A;  4N3B A;  2MHK A;  5FXW A;  3VU7 H;  2L6B A;  1SZA A;  1O1R A;  2AW6 A;  3O1J A;  4A97 A;  3ZKR A;  4HFH A;  3KEZ A;  4KYO B;  5CBN A;  1HNX T;  3FBZ A;  3BQO A;  3RHW A;  4LFA T;  1H6O A;  4DX7 D;  5FNV E;  2E9X C;  3AE8 A;  5DAB A;  2X68 A;  5KCM A;  5HEG A;  4R7L A;  4RVB A;  4UQY A;  1ZKE A;  1H6K A;  3MA5 A;  2PJQ A;  1H0A A;  3JAE A;  3UM0 A;  4GA0 A;  4UQX A;  1N9A A;  3ZN1 B;  2G0U A;  3OPC A;  4W9R A;  4HFG A;  2VL8 A;  4A98 A;  4DR7 T;  3B95 A;  4KBQ A;  2AXU A;  2C0S A;  2WP9 A;  5LHG B;  1KZP A;  1JNR A;  2LUH A;  2PQN A;  3QJZ A;  3AE6 A;  4Y6W A;  4AJW A;  3FZM B;  3UM3 A;  3ASD A;  2V6Y B;  4QX8 B;  2UXN B;  5J08 A;  3B5M A;  2NC9 A;  3PDN A;  2W00 A;  3J9X 1;  4N3C A;  1MHQ A;  1IQR A;  2LKG A;  1N4R A;  2DLR A;  3DJB A;  4U2Y A;  5LA6 E;  1SVX A;  4HWD A;  2UXB T;  4P0A A;  3V30 A;  3ZMT B;  4AQG A;  3L39 A;  2GRP B;  4TV3 A;  1AP7 A;  1INZ A;  5LJN A;  3BG0 B;  3CX7 B;  3ZC1 A;  2QRX A;  1QNF A;  3PUV F;  3QNK A;  1UJJ A;  3PZD A;  4C9B B;  4B3S T;  1WDY A;  2CXL A;  1TN6 A;  1WCR A;  4JLE A;  4HWF A;  3N9N A;  4O4H E;  3SD5 A;  5C1D A;  3JCK C;  4H9P C;  1E1H B;  5A6C A;  1J5W A;  2CHW A;  3EHR A;  1UX4 A;  1S70 B;  1VCT A;  2AWI A;  1IXV A;  3HRA A;  1VRB A;  2D2S A;  3UI2 A;  4HNA D;  3N71 A;  5HS0 A;  4GKK T;  4A1S A;  3HVE B;  5FMN A;  2XAQ B;  4OVV A;  4GZ3 A;  2XAF B;  2W4X A;  2WB5 A;  3B7U X;  3AEF A;  1WR0 A;  3P8C D;  4B8C B;  3CVW A;  5L3G B;  4YHH T;  2K3W A;  5KBA A;  5BV0 A;  2HPJ A;  4B93 B;  3EDT B;  1UW4 B;  3ZSS A;  3TWU A;  2LEH A;  2QVA A;  3N9M A;  3WI3 A;  4ZOL E;  4YSX A;  3TWR A;  1OWA A;  2FJB A;  4BAY B;  3UT5 E;  1JUQ A;  3MKR A;  4KXK B;  2NOX A;  4C91 A;  1WR6 A;  4AY5 A;  3IHY A;  4X1K E;  1QLB A;  5JVD E;  1LD7 A;  1IYG A;  3EU9 A;  3GYZ A;  2P9K G;  5ENO D;  2H7O A;  2LSJ A;  4JBW F;  3P4Q A;  3V79 K;  3RC3 A;  1SW6 A;  5ABF A;  2VL0 A;  4DMW A;  2OLT A;  4DX2 A;  4RSY A;  2BKN A;  3ZN3 A;  4OVU A;  2BKO A;  5D66 A;  1TNZ A;  2XQ0 A;  4ABN A;  3ML9 A;  5LGT B;  2XS1 A;  4IN3 B;  3ZC0 A;  1FJG T;  3AU5 A;  4JEH B;  3QWW A;  2VQF T;  4HVB A;  3L08 A;  4UWH A;  4FC8 A;  5FYM A;  2ZGG A;  3CHM A;  4BER A;  2JLB A;  4HB5 A;  5ITZ F;  2R6G F;  4AOF A;  3S7J A;  4DVD A;  5KX5 E;  5JHB A;  4ZS3 A;  3T5V A;  5HWX A;  4UVA B;  1G73 A;  3ZYM A;  4ME2 A;  4LNG A;  5HAX A;  1D8D A;  2GRN B;  4U8Y D;  4NAC A;  4FAD A;  4XKC A;  2KIN B;  3RIB A;  1W0A A;  5LBQ B;  3G2W A;  3BUA A;  3PUG A;  3FH5 A;  2BG9 E;  1UUS A;  1WAO 1;  2DBA A;  4LF5 T;  2X9W A;  5JQG E;  5CJ5 A;  3EI0 A;  2HE0 A;  3ONX A;  2B0O E;  5D0O D;  3FBL A;  5G05 C;  5JTG A;  3CVP A;  3PDY A;  2HR2 A;  3N9Q A;  4IRE A;  3L17 A;  4KVM A;  5H6R B;  4J8S A;  4MLK A;  2WPV A;  3APF A;  2Y69 E;  1FMW A;  4COF A;  2P9S G;  5FT9 A;  2I6H A;  4F8H A;  4GTR A;  5KJK A;  3C4X A;  5G05 J;  4XAX B;  1WRD A;  1LVK A;  3P4R A;  3CHQ A;  4URK A;  5JDN A;  3CKC A;  4IGU A;  4JVS A;  2XGS A;  2C0M A;  5LB7 B;  3Q9D A;  1I6Z A;  3RRM B;  2XGM A;  2CRB A;  4UWF A;  1J5E T;  2ACZ A;  1N4Q A;  3ZW3 A;  3UTM A;  4HFE A;  3HXF A;  5JDQ A;  2E9X B;  4AKH A;  5IUX A;  3S4U A;  3TLW A;  2XQ6 A;  4L23 A;  5C3J A;  3JXI A;  2YHC A;  2MYO A;  5T4Y A;  2XPZ A;  2VKD A;  3RI5 A;  4O1O A;  4KMC A;  1S35 A;  1N4S A;  3I3N A;  4RG9 A;  3NKZ A;  1NP7 A;  4BJN A;  5JDG A;  1IBK T;  3LY9 A;  5C2Y A;  4DV7 T;  3RIU A;  1SA0 E;  2XRY A;  5AQF B;  5EIL A;  1IJ5 A;  3FU6 A;  3RIA A;  2JQK A;  2FI7 A;  4N5Q A;  4DV3 T;  4PK4 A;  4MKT A;  3DPY A;  3NB2 A;  5LCW C;  3CWZ B;  5AQS B;  2KLQ A;  4H9S E;  1L0V A;  3U3W A;  4IE4 A;  4O2B E;  4I55 E;  5LG3 A;  3LSV A;  4DX5 D;  4HKA A;  3QC9 A;  5AQH B;  2B6C A;  4DUI A;  3CML A;  1O3X A;  2CWY A;  4U33 A;  2IU1 A;  4TWD A;  4L5G A;  2XQA A;  5LCW J;  3AA1 B;  5HCJ A;  4JXT A;  5A7D B;  1HXI A;  2BS4 A;  1CUN A;  2I0M A;  4J2C A;  4JA7 A;  2V6X A;  5AAO A;  2R2L A;  4HRM B;  4AKG A;  3EAM A;  3QAR A;  2KAT A;  4BJM A;  2X9H A;  1WYC A;  2WXN A;  2HN2 A;  4GK0 E;  5FXV A;  3MKQ A;  4DR2 T;  1A5E A;  2WB2 A;  3GZ1 A;  2V5F A;  4JZY A;  4L9I A;  2XEV A;  3J5Q B;  3PU3 A;  3DPD A;  3SF4 A;  2AVP A;  4I50 E;  5LOZ A;  2YOE A;  3TLT A;  5JDL A;  5AQL B;  4EZJ A;  3MK7 C;  2NYJ A;  4ISS A;  5LNK A;  1KNZ A;  5LMN T;  4MHC A;  2W61 A;  3Q4A B;  4IIJ E;  1B7T A;  4UV9 B;  2H6G A;  4F3V A;  4LF6 T;  1FPP A;  3RK6 A;  4XIF A;  1CHU A;  3R6N A;  2KM4 A;  3FHN A;  3AS8 A;  3RPU A;  3F6Q A;  4C90 A;  4DI3 A;  4AM9 A;  4YTM A;  2X66 A;  2CLY C;  2XAS B;  1DCQ A;  2XCB A;  3FUH A;  5ABF B;  4GK5 E;  3KIN B;  4U7E B;  5IYZ E;  3LVQ E;  4ERR A;  4HLE A;  4CQI A;  4HLL A;  1N36 T;  2I9C A;  4HWI B;  2BF0 X;  3Q9U C;  3WAJ A;  3DST A;  5M4Y A;  4EIW A;  4I9C A;  3JCF A;  2XCC A;  2E0I A;  2LSU A;  2V8S E;  3Q73 A;  4YND A;  5EKQ D;  3GMI A;  2XM1 A;  4KX6 A;  3ASO E;  4EZH A;  1KFY A;  1OED C;  4YSZ A;  4ATZ D;  2OEW A;  1GQE A;  4JHK A;  2IQC A;  4UEL A;  2V4L A;  3RX6 A;  4EBA A;  1MIV A;  5JJT A;  4MFR A;  2HHH T;  4HWH A;  3WXX A;  3VTY A;  1D0Z A;  2NR4 A;  4KT6 B;  5HXS A;  3ZHE B;  2V7M A;  3BQL A;  3CX8 B;  2PM7 A;  2WMN A;  2BZB A;  4DBQ A;  1NEN A;  5EX0 A;  2CFZ A;  4GZC A;  3D9H A;  3ZMV B;  3L22 A;  4J7W A;  2DZO A;  4FU3 A;  2WQH A;  3ZRH A;  2JQQ A;  2WCA A;  4IDP A;  1BI7 B;  1UJK A;  1NEK A;  3AG3 E;  3K9I A;  2UUA T;  2EIK E;  2KWH A;  3PEU B;  4CN6 A;  3JYS A;  1I94 T;  4TRQ A;  3GWH A;  5E76 A;  3FUL A;  3HL6 A;  1IBM T;  2XEE A;  2VVN A;  2H88 A;  3C4W A;  2BVL A;  5LFA A;  4GYY A;  2CBJ A;  3ESL A;  1S63 A;  2JJ9 A;  4YSY A;  3AB3 B;  3MX3 A;  1FEW A;  1H7C A;  1Z0P A;  1IHB A;  2FJD A;  4DV0 T;  4AIS A;  2ZM8 A;  3BK9 A;  3AE9 A;  3MCX A;  3O48 A;  5CA0 E;  3CQC B;  2CEA A;  1N0Q A;  3HI2 A;  3K3Q C;  4C0M A;  3KBT A;  1HG5 A;  2VTB A;  3JC6 C;  4CXY A;  5FZS A;  4J8E A;  1IHG A;  3C4Z A;  4BY6 A;  4KHP T;  4N2S A;  2BKP A;  3N2K E;  2KSR A;  3G2V A;  4HGA A;  3KV6 A;  5LOV E;  3GZS A;  2OCC E;  3UIO C;  3PRE A;  3TWX A;  3O4X E;  2WXR A;  2EQX A;  3ABM E;  4L7T A;  4ILG A;  3NBN B;  4J8F A;  3VTX A;  3ML8 A;  2UWJ G;  2BG9 A;  1PC2 A;  2X6I A;  2IOS A;  4TUM A;  5CCM A;  5D0Q D;  5BMV E;  5AQO B;  3B7R L;  2VJ8 A;  1HTJ F;  4MRU A;  4DR3 T;  3T9K A;  2LM9 A;  4N78 D;  2XQ4 A;  1HZ4 A;  4ZS2 A;  5HXE A;  4GA1 A;  5AQP B;  4LEU A;  1E8Z A;  4X20 E;  2F0Y A;  4U0U A;  4DLQ A;  2XSB A;  1X5B A;  3AAI A;  4IDN A;  3ULE G;  1S64 A;  2FBN A;  5AQN B;  3RRC A;  4GTO A;  3UT4 A;  4AVX A;  3CVY A;  4LMK A;  1LD8 A;  2AXD S;  2MYS A;  3I0Q A;  4GYS A;  3FU5 A;  1SHZ C;  3OKQ A;  1S0P A;  1HNW T;  4U96 D;  2XZE A;  2V7I A;  2YKS A;  4UV8 B;  1OWL A;  4HFV A;  3KBU A;  2OVF A;  3CK8 A;  3AAE B;  2OVB A;  1VCS A;  3AEB A;  3JAD A;  3UQ4 A;  3G2S A;  4KVO A;  5CEA A;  4B94 A;  5CCL A;  2OA5 A;  2XSA A;  2YDR A;  5AQU B;  3C98 B;  4TUY E;  4XX5 A;  4CXX A;  3ABK E;  5BV1 A;  4ZFH A;  4UVC B;  4DR5 T;  2IJG X;  4GB9 A;  5JMN D;  4ANJ A;  3UUN A;  1HX1 B;  1TR4 A;  4PS8 A;  3FZL B;  2V5C A;  4U8V D;  2QYW A;  3MKD A;  2XPK A;  4NPP A;  5LCY A;  3CEQ A;  2IAK A;  3OXF A;  1N33 T;  1BR1 A;  2EHO C;  2I1K A;  2XZD G;  2NP9 A;  3MXZ A;  3SFZ A;  2XTL A;  3AED A;  3D9O A;  2VYI A;  1HH8 A;  2CLY B;  5FY1 A;  2CBI A;  4JYA T;  5T8I A;  3FDH A;  3ZU7 B;  4DUZ T;  3JQ0 A;  2VB6 A;  3KV5 A;  3MZK B;  5C8Y E;  4JL0 A;  1HU3 A;  3DTO A;  4PS7 A;  5JDM A;  4XZC A;  3C3O A;  2YHE A;  4A5X A;  3T8O A;  1RW2 A;  1NAF A;  4IE5 A;  1NWM X;  3LKU A;  3LXU X;  2DWZ A;  4U8H A;  4FLB A;  1BI8 B;  4GZ6 A;  4PFP A;  5BPP A;  1HS6 A;  5B1B E;  3AXJ B;  3N9P A;  5JJ7 A;  3FZF B;  4UEM A;  2ZM6 T;  3C72 A;  2L0I A;  2JQH A;  3PUY F;  4AQF A;  3ASG A;  1MJ0 A;  3WG7 E;  2DCP A;  4TX5 A;  5FL1 A;  3U78 A;  4DV2 T;  5D2M C;  3NZU A;  3O1H A;  1OT8 A;  4NQ0 A;  3QOF A;  3K1S A;  3KFW X;  2LO6 A;  4DLO A;  3ZKJ A;  5JRC A;  4B8A A;  1X9B A;  4HRN A;  2UXX B;  3ISM C;  5B1A E;  3HR0 A;  4TUU A;  2WMO A;  2PTF A;  2H6F A;  4G11 A;  3Q2M A;  4DUY T;  4C48 B;  5HXH A;  2XQ9 A;  4WWO A;  5EK3 A;  1YYH A;  3FFL A;  2LE8 A;  3QB2 A;  3LK4 2;  4ILB A;  2VSX E;  2WU2 A;  2VK9 A;  4ZI2 C;  4DV6 T;  2V7L A;  4UXN B;  4HFC A;  3UKR G;  3RJV A;  1MIY A;  2V8S V;  4U63 A;  1EYH A;  5AQK B;  3CVR A;  4O60 A;  2VWA A;  2EIM E;  4DPR A;  2VTB B;  3LY7 A;  4DV1 T;  2LOP A;  3SO8 A;  4WNG A;  2JIW A;  2XHE A;  3PE4 A;  3SY2 A;  1MNE A;  3B13 A;  4LRZ A;  3TL5 A;  4CT0 A;  2B1E A;  2VAS A;  3VKH A;  4LER A;  1D0X A;  4DV4 T;  1PY1 A;  4XI0 A;  5KWD A;  3L13 A;  4IT4 A;  3SGH A;  2ETB A;  2DYR E;  4X8Q A;  2E9X D;  3RQU A;  4AI6 A;  2J1D G;  1N95 A;  2BG9 B;  3RKO A;  3EDU A;  4K5B A;  3EHZ A;  3OYX A;  5HKP A;  3ZNG A;  2J8S D;  3CK7 A;  2E5V A;  5ABG A;  3LS8 A;  4GMJ A;  3DRA A;  5H6Q B;  5FIO A;  4PJL A;  3JAF A;  3CPZ A;  4EED A;  3CVL A;  4IE6 A;  3FUM A;  4HTE A;  4QWN B;  2NTX A;  3HKD E;  5FKY A;  2ZGD A;  1ELR A;  1MMN A;  1YXR A;  5FP3 A;  3ZLI A;  1MQS A;  4EZL A;  1IZN B;  4JI8 T;  2F4V T;  2P9L G;  4HXI A;  3RYI E;  4DK5 A;  3ZPJ A;  2DL1 A;  4KP3 C;  1R8I A;  1KT1 A;  2RKK A;  3ZFW A;  3J7Y q;  5AJL A;  1V9D A;  5EN5 D;  4I6G A;  1D1A A;  4CXW A;  3D9J A;  3PUX F;  3B7S A;  3P4P A;  4DV5 T;  1SA5 A;  5BXU A;  2FBW A;  2H3R A;  3EAB A;  3UM1 A;  3CQG B;  4TN7 B;  3FEY A;  4D10 C;  3JUI A;  2DZN A;  4RG6 A;  5LHH B;  3TWS A;  4QKN A;  3Q5M A;  2C0L A;  2Y6X A;  2Q9Q D;  1TNU A;  2E5L T;  2IO2 C;  4WWP A;  3C3Q A;  4BES A;  4G1T A;  1MX4 A;  2CWO A;  2H7V C;  1OCR E;  4TXQ A;  3ZGQ A;  4APF A;  4YHJ A;  2LRK A;  3E30 A;  4ADZ A;  1ELK A;  3TLU A;  2KWI B;  1KZO A;  4MBG A;  5J1G A;  4GIW A;  3PJA A;  2K24 A;  3TLS A;  2XAJ B;  4UQZ A;  5JDH A;  2R03 A;  3SWH A;  3ASN E;  4QFV A;  5FZR A;  2XAH B;  3PUW F;  3D9N A;  3HA4 A;  2P9U G;  4L2Y A;  4BTA A;  4HFB A;  4EYY R;  2LHN A;  4EPZ A;  1XNR T;  3ANW A;  5JRE A;  3PZ3 A;  2L9Q A;  3M65 A;  3VRB A;  4L1B A;  4YJ2 E;  4FI5 A;  2EHO B;  3T8M A;  3SS1 A;  3L9T A;  5FQ8 A;  2LRL A;  4IE7 A;  3AS5 A;  2LSG A;  2SPC A;  1EF1 C;  3MA9 A;  2XEH A;  2VKH A;  3IEE A;  1LF8 A;  2PL2 A;  3BQK A;  2BTD A;  3ULQ A;  1A17 A;  4PS3 A;  2GW1 A;  2A5U A;  2GRR B;  3FTX A;  4UI9 K;  4B0Z A;  5AQQ B;  2X9Y A;  2A9U A;  1WG0 A;  2BKK B;  4PAG A;  1J1J A;  2AXZ A;  3DP7 A;  2XUE A;  4GYR A;  4B89 A;  1WFD A;  2JRK A;  2CE7 A;  3IKO B;  3L8R A;  5AQI B;  3KEA A;  3HKE E;  3Q15 A;  4CT4 A;  3UU6 A;  1EPU A;  1HF8 A;  1XWM A;  4IDO A;  5DQW A;  5F8P A;  2D0T A;  4A1G A;  3K3O A;  5KMG P;  4PFO A;  3EHM A;  2WBL A;  4CCA A;  2CXD A;  5HWY A;  4FJY A;  2LT3 A;  2V5D A;  2HH7 A;  1ELW A;  5LMU T;  4EZK A;  3QC1 A;  5JR9 A;  3A8Y C;  1QQE A;  2KCV A;  3V5U A;  1SE7 A;  2RPA A;  5JRC B;  4I0U A;  2ION A;  4QH4 A;  2YK0 A;  4NIK A;  2F8Y A;  5BUZ A;  1E7U A;  4LFC T;  4BET A;  3UUX A;  2YDQ A;  3RQW A;  5G04 C;  2J62 A;  3FUE A;  4U07 A;  3AA6 B;  2WQY A;  3AEA A;  1WM5 A;  4BSX A;  4WW0 A;  4WYV A;  4ZI7 E;  3LFM A;  4Z90 A;  1JPL A;  4I43 B;  2WXI A;  4HBD A;  4HOS A;  2X0H A;  4JI6 T;  4JUY A;  2RG8 A;  3GZ2 A;  5G04 J;  1KEY A;  4JW1 A;  4J6I A;  2KND A;  4OYK A;  4U0Z A;  3PH0 C;  3FTV A;  2P9P G;  5AJD A;  2M6I A;  4K0R A;  3UTK A;  2NW8 A;  1UX5 A;  5FXX A;  3PV0 F;  4LMJ A;  1OCZ E;  4GCO A;  1YA0 A;  4MLP A;  4NXM T;  4A55 A;  2JPF A;  3AE5 A;  2LKH A;  5JJ6 A;  5BW8 C;  3ZIM A;  2KC7 A;  4LCT A;  4EYU A;  4JI0 T;  1FMV A;  4YVO A;  3Q79 A;  3Q9N C;  4TXP A;  3TJP A;  4KUM B;  3RIU C;  5LJM A;  1N52 A;  2F37 A;  2NTY A;  1T7S A;  1U3D A;  3CK9 A;  3SZ7 A;  4EEC A;  3ZPO A;  4WWN A;  1MYO A;  4E6H A;  1NL4 A;  3MEK A;  3U64 A;  4FJO A;  4PNI A;  3I4R B;  3UU8 A;  3IF8 B;  1L5J A;  1V55 E;  2MRI A;  5AQA A;  4QXC B;  2X51 A;  3V2O A;  5ARF A;  2IDO B;  1ZV4 X;  3SFE A;  3PZ4 A;  2RA1 A;  1H2T C;  3P2B A;  3NAW A;  4HN9 A;  3CQX C;  3ULY A;  3O9X A;  5LX8 A;  2GGF A;  3CSF A;  5DIZ A;  1NI1 A;  1JNZ A;  2YN6 A;  4Q25 A;  3GW4 A;  4DR1 T;  4AIF A;  1TN8 A;  3MV2 B;  5ENS D;  3OVU A;  3RU0 A;  3SBS A;  4ASK A;  5DBK A;  2XPI A;  1UUR A;  2XQ7 A;  3C64 A;  1JWG A;  2GK9 A;  4X64 T;  3APD A;  3PUK A;  3K8P C;  4Z68 A;  2V7J A;  2GRQ B;  3E37 A;  1O5M A;  2MAW A;  4FUL A;  5HEO A;  2WWV A;  5L4H A;  3LBX A;  3P4W A;  2QYJ A;  2KCK A;  3FTU A;  4WBO A;  4OX9 T;  3Q49 B;  4ANX A;  1OY3 D;  2VKO A;  2X9X A;  1QZ2 A;  5TAO A;  2H6I A;  2XPY A;  3UXG A;  3TAX A;  3D9P A;  3DSX A;  2JMH A;  4LFB T;  5CA1 E;  2W67 A;  3PE3 A;  4HQD A;  3O1I A;  3EDV A;  4EOZ B;  3EUV A;  3ZXS A;  3L54 A;  4P09 A;  1HCI A;  1OXJ A;  3PE0 A;  1U2V G;  2Z6E A;  4YT0 A;  4AKR B;  4M1P A;  4NXN T;  3SFD A;  4IL9 A;  4CGW A;  1ZOY A;  4I6J A;  4JHR A;  5J0Z A;  2ZIR A;  2AXV A;  3L6A A;  2IOL A;  2WDQ A;  4H9R C;  2XQ5 A;  1BR4 A;  3ZJ2 A;  1YQ3 A;  4TXR A;  1UGO A;  3FTW A;  4EZ4 A;  2EIN E;  3HG0 D;  4YDW A;  3JXJ A;  3HXB A;  5A1L A;  4U31 A;  4DI4 A;  3G06 A;  2CXF A;  2BUG A;  3S7B A;  2Y8D A;  3ABL E;  3KV9 A;  2N9D A;  3AE2 A;  3MZL B;  3EHQ A;  5ABE A;  3PTR B;  2IO3 C;  5IY5 E;  3ZT5 A;  1N0R A;  3QDN A;  3KD7 A;  4WUY A;  4U95 D;  5HI7 A;  3F31 A;  2OOE A;  5L3F B;  3HDX A;  5L3B B;  4GKJ T;  2WY2 A;  5JDF A;  4FLH A;  4BX8 A;  4HWC A;  2J09 A;  3SHF A;  1W3B A;  4I2W A;  4H7Y A;  3AEG A;  4L0R A;  5LXT E;  1OUV A;  3G2U A;  5FJY A;  3QK6 A;  4EEB A;  4I6E A;  4GML A;  1FIO A;  3E08 A;  4FJZ A;  3AA0 B;  2LNI A;  1XDO A;  4ILI A;  2C2L A;  3ETV A;  4GA2 A;  3PUR A;  2ZM0 A;  1D1C A;  5FTP A;  4EHM A;  1NFI E;  2ETC A;  5FQ6 A;  1W0B A;  3R84 B;  3UUX B;  5AAR A;  3QB5 K;  4APO A;  5A23 A;  1YKE B;  3ZMS B;  3ZT7 A;  2CHO A;  3AA7 B;  5JA4 D;  1DVP A;  2B76 A;  3N5L A;  4EQF A;  5GON E;  4G23 A;  3WAK A;  4OYS A;  1BR2 A;  4Y6C A;  3FXE B;  2XAG B;  3E32 A;  4YLH A;  1LVF A;  1MX2 A;  3I9W A;  4UVB B;  1TJF A;  4EAH A;  4HFD A;  4O1P A;  5EYP F;  2V0P A;  2HO1 A;  2CHX A;  3FU0 A;  4ZXL A;  4PJJ A;  4ZEY A;  2E8I A;  3LCA A;  2L8K A;  4YY3 T;  4O4L E;  1HS7 A;  3FUI A;  4PW8 A;  2CG2 A;  3LYA A;  3R9M A;  2QY7 A;  1HG2 A;  5FQ4 A;  4XKB A;  4QQI A;  5EIB E;  2IC6 A;  4HI8 A;  3UPV A;  5M72 A;  2CFU A;  2YQ8 A;  4KZ0 A;  1B89 A;  5LP0 A;  2ACX A;  1HX8 A;  3Q7F A;  3AEE A;  1NA0 A;  3OXL A;  1NA3 A;  4U74 A;  3I4G A;  5LGN B;  4IYP A;  2BKG A;  1Z3Y A;  3O4Z A;  2BG9 C;  5CMY A;  2CHN A;  2E2E A;  2WXQ A;  3IHV A;  3UT7 A;  3H37 A;  2P9B A;  1BU9 A;  3ONK A;  3JC6 D;  2ZXW E;  2V1D B;  4DMV A;  5ENN A;  2MPK A;  3CK6 A;  2L0T B;  3Q7A A;  3VKG A;  2IW5 B;  3EUH A;  3TXM A;  5CER B;  3I0O A;  4UUC A;  1DC2 A;  1UG3 A;  5L2L A;  4EGW A;  3W9F A;  1Y64 B;  4GPM A;  4GTQ A;  2X6H A;  3RO3 A;  2DIW A;  1W09 A;  3F57 A;  4K0K T;  2JQ9 A;  3BG1 B;  4I1O B;  3AEC A;  3EHN A;  3PZ1 A;  4O6F A;  1H2V C;  4YDO A;  4JI4 T;  3NOC D;  5JH7 E;  2PNN A;  3ZJ1 A;  4XEI G;  4UR9 A;  2X0L B;  2V6Y A;  4IE0 A;  5EK4 A;  4RLY A;  4UF0 A;  2Q7F A;  2QZA A;  1US7 B;  3C3R A;  2LSK A;  1YQ4 A;  4I2Z A;  4XE0 A;  3LBX B;  3FTZ A;  1M62 A;  2J07 A;  2AJA A;  3KVB A;  4WND A;  3MKQ B;  3FUF A;  3CVU A;  4OYJ A;  4JI3 T;  5EZY E;  3RYH E;  4DJA A;  3ASF A;  3P1U A;  5EK2 A;  4DND A;  4HI9 A;  2KZ7 B;  2YU2 A;  4WNF A;  2PG8 A;  3AJI A;  5CB4 E;  1LRZ A;  5J2U E;  3CX6 B;  3NWI A;  3IV0 A;  1H2U A;  3EU5 A;  3S7F A;  4NIQ A;  1VDY A;  4N3A A;  1TN7 A;  2A72 A;  4UWG A;  1D1B A;  5L3D B;  3RLF F;  3Q47 B;  2AE9 A;  3NF1 A;  4JA9 A;  3W9G A;  3QWV A;  1MZC A;  4HEA A;  4AXP A;  3NZP A;  2LAI A;  3D9I A;  3NVO A;  3SNX A;  2LSV A;  4MS6 A;  2D5U A;  2R17 C;  3HVE A;  1UK5 A;  4F6R D;  3PNT B;  3PRZ A;  5IHY A;  5CRU A;  3W15 B;  5T3R A;  3TG5 A;  4CGV A;  2UY1 A;  4NRH B;  1TJC A;  3UU3 A;  3RIF A;  3R7R A;  5AIJ A;  3TKL B;  5FQ7 A;  3Q5X A;  3KSL A;  4FHJ A;  1ZHC A;  3DEO A;  5B3S E;  3Q5W A;  2BBH A;  4HFI A;  5HRY A;  3QWP A;  4CDN A;  5KJM A;  3MGB A;  3PNL B;  5FIN A;  1MMG A;  2CPT A;  2EHO D;  2V26 A;  2WZI A;  3VRA A;  4LG6 A;  3I1A A;  4PDX A;  1XNF A;  5E0O A;  4G63 A;  1WYB A;  3MAC A;  5AQ9 A;  4TWH A;  4C0E A;  5CEC B;  4I1M A;  1P5Q A;  5ANR A;  4AQF C;  4ZI3 C;  2P9I G;  2LAH A;  1DCE A;  4G25 A;  3SFX A;  3UIN C;  4ACK A;  1Y8M A;  4OAV B;  2YNQ A;  5CBO A;  2WAU A;  3ZYQ A;  1T8B A;  1IAP A;  4JHJ A;  3E33 A;  2D0U A;  4CI1 B;  5E75 A;  5CED B;  4JEH A;  2FO1 E;  2NW7 A;  2IY0 C;  4A3T A;  3TWQ A;  3ASH A;  3MJX A;  3UX4 A;  3KSQ A;  4IUL A;  3B57 A;  3T1Y T;  4LNU D;  2OEV A;  4IHJ E;  4YFS A;  2WQ7 A;  3QOU A;  3E4B A;  5AQ7 A;  2OV9 A;  1N32 T;  4U7I A;  1X81 A;  3CIA A;  2XEN A;  3MJW A;  5EX3 A;  1FT1 A;  1N11 A;  4JC8 A;  3FHE A;  2R5S A;  4IST A;  1BLX B;  3C50 A;  3IHR A;  3L09 A;  2H89 A;  2KCL A;  4CZ2 D;  2ZMA A;  2IIU A;  4MAL A;  3SBT B;  4CI2 B;  1O1T A;  2HYZ A;  4YTP A;  4H9Q C;  2W63 A;  3MYV A;  4F7A A;  4K5C A;  3AG2 E;  4O4J E;  4PK5 A;  3RYF E;  2VVS A;  5FVL A;  3AAA C;  3JQ1 A;  4IL4 A;  4ILH B;  1MIW A;  3DSW A;  2LM2 A;  3ONL C;  2Y4T A;  4H9O C;  3UUL A;  2CA5 A;  4N39 A;  1E8Y A;  3E22 E;  5L3E B;  1LKX A;  4ZI2 D;  1K8K G;  2R59 A;  2QA7 A;  3ONL A;  5CGM A;  3OTN A;  3E0Z A;  3DSS A;  4DRX E;  2IEJ A;  5FL0 A;  3EIJ A;  2XY8 B;  4LF4 T;  1TNO A;  3TXN A;  4CZZ B;  3LVR E;  2UUB T;  3FUN A;  3PUS A;  4GTM A;  3LJC A;  3N9O A;  5AYW D;  2HPL A;  4TV8 E;  2FJA A;  2FF4 A;  2L6J A;  3FTY A;  1E7P A;  1K1A A;  2FUL A;  3QUJ A;  2LXM A;  1Z8U A;  3FY4 A;  4JPS A;  2E9X A;  3NOG D;  4AIU A;  2GRL A;  3DSV A;  4JD2 G;  3N2G E;  3DXM G;  4NUV A;  3LDZ A;  4XI9 A;  4FHK A;  3I5P A;  2XM2 A;  3VLE A;  3ZN0 B;  4GU5 A;  5FXZ A;  5AQM B;  1E8W A;  5BXO A;  1UN9 A;  2BED A;  3PVL A;  4GZD A;  1H19 A;  3FXD B;  3FUJ A;  4NUR A;  4P0B A;  1YW0 A;  3CHP A;  1AJ3 A;  4F1P A;  5CFB A;  4UF0 B;  3L3P A;  1FVF A;  1G3N B;  4KBM B;  3LG7 A;  5HEU A;  4UIG A;  5HEJ A;  1NZN A;  3FH7 A;  4IRU A;  2KMF A;  4A56 A;  1Z5S C;  2PM6 A;  3L16 A;  3HIZ A;  4PK6 A;  2RD0 A;  2ETA A;  2WXL A;  3RYC E;  3UQ3 A;  3FU3 A;  3KAE A;  2WM9 A;  1Q2Z A;  4GYO A;  4ACL A;  5AQJ B;  4GOU A;  1KT0 A;  2VQE T;  2LLY A;  4AEZ C;  5HCM A;  4EV6 A;  2Q9Q C;  1QUU A;  2BVM A;  3IXE A;  5J2T E;  2JEK A;  4BSZ B;  2VSY A;  3SFY A;  2A4Z A;  4ZHQ E;  3T8K A;  1HNZ T;  4X1I E;  5G55 A;  4A63 B;  2Q9Q A;  2MOW A;  1MND A;  4BA9 A;  2WXF A;  2OND A;  4WAF A;  2CG3 A;  3RH3 A;  2WDV A;  3T1H T;  2VGY A;  4KHZ F;  3V2X A;  2LSI A;  3D9K A;  4GZ5 A;  3PJA J;  3KV4 A;  1MX6 A;  1WLX A;  2Y0B G;  4AQY T;  1OED E;  2PZI A;  4J0U A;  3DBS A;  2UY1 B;  2XQ8 A;  4WZX A;  2L3L A;  4TNV A;  2KXP C;  4CYM D;  5KNH D;  2N2N A;  4QH1 A;  5FZQ A;  4LML A;  4BEP A;  5CRV A;  3SI5 A;  2C5J A;  4ANU A;  3QNU A;  2M67 A;  4O4I E;  2W62 A;  2A2F X;  4G8K A;  4EBA G;  3FWV A;  3HHM A;  2BBJ A;  2LOS A;  2CM0 A;  5LP6 E;  4P1N A;  1N54 A;  4U7Y A;  3DXK G;  5AN8 A;  2C5I T;  4I9E A;  4CN4 A;  3PZ2 A;  4J8Y A;  4BFR A;  3ZT6 A;  3EVY A;  1XDP A;  2XS8 A;  4AV7 A;  2K48 A;  2DYS E;  3X1D A;  5JR9 C;  1YCS B;  3MV3 B;  4YJ3 E;  4BX9 A;  1VOM A;  5HQ8 A;  4YDE A;  4DBR A;  3M3Z B;  2CCQ A;  2XRZ A;  2MTQ A;  3CKD A;  4AY6 A;  3IBP A;  3KVA A;  2NSZ A;  3NRX A;  4EB6 E;  1UCU A;  1E7V A;  4B3R T;  4DX1 A;  4Q69 A;  1OWN A;  2XZT G;  2DWG A;  1N94 A;  3TG4 A;  1UOH A;  4PJM A;  4PJN A;  3AE4 A;  2UUC T;  3SQV A;  5KJN A;  1JCR A;  4E85 A;  4XBF B;  1XNQ T;  2YEV C;  2Y4U A;  5J90 A;  4HOQ A;  3CR3 A;  5F5W A;  4YTN A;  3LJ3 A;  4JEU A;  2I59 A;  3ZHE A;  5AQG B;  1KNP A;  2IFU A;  4F1S A;  1IKN D;  4F53 A;  2J9Q A;  1OWO A;  2QFC A;  2W66 A;  4QH5 A;  3LY8 A;  2FO7 A;  4CDR A;  4HS2 A;  4B3T T;  2ODV A;  2WXG A;  1OXZ A;  5CMW A;  1SZ9 A;  3LK2 B;  3AAA B;  2XHE B;  5ARG A;  3S2A A;  3BQI A;  4B3M T;  3HKC E;  1SA4 A;  3RF1 A;  4TWF A;  3AVS A;  2KZT A;  3E34 A;  4GTT A;  1K3Z D;  4QHO A;  1E8X A;  5AQR B;  4U04 A;  2X0Y A;  4A3V A;  5ENP D;  3NBX X;  3U4T A;  5ENR D;  4ILA A;  3P7I A;  4M7C A;  3QB5 A;  4HRL A;  2VGX A;  4DR6 T;  4J8D A;  4L2L A;  4JI5 T;  1T98 A;  3PUJ A;  2DNX A;  4BT8 A;  3FP3 A;  3H3A A;  4U0S A;  5KDM C;  1IJ6 A;  2VSN A;  4LUN U;  1Z6T A;  5ENT D;  1HO8 A;  2UXD T;  2RFA A;  3CKB A;  5EYL A;  5KXJ A;  3HXC A;  3FUK A;  5KJL A;  4H63 V;  1OWP A;  2YDS A;  3CHR A;  2BS3 A;  4H9N C;  1GW6 A;  2P2C P;  4G24 A;  4ZHB A;  2NWB A;  5LBM A;  1E96 B;  3LK3 B;  5ANL A;  3UKU G;  4FP7 A;  3CIR A;  1HE8 A;  3FZH B;  2I1J A;  2JMK A;  2FUP A;  4CDM A;  4V3I A;  5AEN A;  3AE1 A;  5AQV B;  3FB2 A;  2K5B B;  5L47 A;  3GN5 A;  3RRW A;  4QXB B;  1U5P A;  4UWL A;  3TGO A;  1KLX A;  4P29 A;  2WXK A;  5G2N A;  4E7S A;  2GRO B;  2ILR A;  1TEZ A;  2Y48 B;  4I1A A;  3QKY A;  2J08 A;  2W2U A;  4WNE A;  3UFE A;  3ZXP A;  1KK7 A;  2RFM A;  1U3C A;  4MBQ A;  3ZST A;  4OHF A;  4AXH A;  3PS6 A;  4O2A E;  3K3N A;  2D9D A;  3SOL A;  4I17 A;  1TNB A;  2HM8 A;  3RRU A;  3VHL A;  2Q9Q B;  2X38 A;  3G2T A;  3PU8 A;  1ZP0 A;  3C5R A;  3TWT A;  1M7K A;  3VR8 A;  2ZLY A;  4G8L A;  4HOR A;  3D0T A;  2VQ2 A;  3LDQ B;  3CVN A;  3AVR A;  3ETU A;  3N9L A;  2DI4 A;  2Y1L E;  3AE7 A;  4ANV A;  3ANW B;  1YKH B;  4FA6 A;  3PUZ F;  3BEE A;  1XMQ T;  1Y6I A;  2Y3A A;  3C51 A;  3C98 A;  4I4T E;  2J49 A;  1E2A A;  3LPZ A;  3JUE A;  3IEG A;  2WU5 A;  2V7K A;  2ES0 A;  2KXP B;  4X66 T;  5DQV A;  4ANW A;  1QBQ A;  1KF6 A;  2EIJ E;  4U72 A;  3ZEF A;  4QX7 B;  1MMA A;  3I9Y A;  3IA3 A;  4E7Z A;  4GYW A;  3DSU A;  2WZH A;  3U66 A;  4KZC A;  2BDE A;  3NZS A;  3A7M A;  2WXO A;  1K1B A;  1ZEE A;  4ZZC A;  2YU1 A;  1XGW A;  3TLV A;  1IBL T;  2LHR A;  5FVK A;  3PEV B;  5L4E A;  2M6B A;  3HXE A;  3HXD A;  1G8X A;  3OAW A;  5BR8 T;  1OWM A;  2NW9 A;  3SRZ A;  2GRM A;  1U4Q A;  3OYZ A;  3FTS A;  5LYJ E;  2A5E A;  5HYA A;  5JR9 B;  4K03 A;  1HFA A;  1DU2 A;  5AFU L;  2DVW A;  4TV9 E;  1X79 A;  3AE3 A;  4Q94 A;  4O8S A;  4AP2 A;  2DWK A;  1IQU A;  1YMP A;  2R05 A;  3NRY A;  4Q96 A;  3CLJ A;  4YXD A;  1JCS A;  3HYM B;  5ETW A;  3IBE A;  2WSS V;  2UXC T;  1FT2 A;  1HR0 T;  3AXJ A;  3ABV A;  2RP4 A;  2MBG A;  4PUC A;  1OED A;  3FH8 A;  1XZY A;  3UU5 A;  3FUD A;  3ZCI A;  4AKL A;  1ZB1 A;  4BTB A;  2F8X K;  4JEU B;  2ZIS A;  4H7X A;  1EDU A;  3N2O A;  4HOT A;  3CGH A;  4L9P A;  4UWK A;  1KPS B;  3LJN A;  2X67 A;  3ONJ A;  2KBX A;  4LSZ E;  1D9S A;  3KS2 A;  3RC8 A;  2WWU A;  4N2Q A;  3OTO T;  3D9L A;  4GTS A;  3LEW A;  2V5Q C;  3VLF A;  4LF7 T;  3APC A;  4OFZ A; 
#chains in the Genus database with same CATH homology
 3CHO A;  3RKV A;  2OV8 A;  2KZT B;  3ZMU B;  2IF4 A;  4TZ4 C;  2L9B A;  3VLD A;  2WXP A;  2LSY A;  2P58 C;  3ENE A;  4CI3 B;  2A3D A;  4Z8X A;  4CRW A;  3CVV A;  2M63 A;  2X6K A;  3EIQ C;  2VGX B;  2ODU A;  1BR0 A;  4G2A A;  2ZU6 B;  5HXC A;  5HXR A;  5LGU B;  3ZYL A;  3FEX A;  4IDZ A;  1ZBP A;  1JWF A;  3EJN A;  5FY0 A;  3OBV E;  4M3O A;  5F3J A;  3U9W A;  4B6X A;  3HKB E;  2YIN A;  4WNK A;  3U3I A;  3V5S A;  5FY7 A;  4GCN A;  5BT1 A;  5EDS A;  3GN5 B;  3CST A;  3ZMZ B;  2MOZ A;  2C5K T;  1MMD A;  2XGO A;  3CVQ A;  4N5C A;  3D9M A;  5CHE E;  1Z3X A;  2PFV A;  3T5X A;  2WXH A;  3QK0 A;  3URZ A;  3F2E A;  1PAQ A;  4XZ4 A;  3B7T A;  1S94 A;  4AKI A;  4GPK A;  2X6F A;  3CV0 A;  4OK0 A;  3R7Q A;  2J4B A;  5FWQ A;  3PUQ A;  2CMR A;  1EZ3 A;  2VKJ A;  2VSO E;  2KT9 A;  1ZU2 A;  3UMV A;  3AS4 A;  4V1A v;  2PBI A;  4YVQ C;  5LG4 A;  3CVX A;  3ZYK A;  4GAA A;  4F6R C;  2W0G A;  4HE8 A;  1SQM A;  3UT8 A;  4ATG A;  3NZQ A;  1YD8 G;  4X1Y E;  1E90 A;  3UUM A;  3ZCJ A;  2CHZ A;  2DCF A;  2XQY A;  3CHS A;  1D0Y A;  4BWR A;  3ESK A;  3KDS E;  3ZEF B;  2FEZ A;  4G2V A;  3D3M A;  5BNW A;  2IC9 A;  1FCH A;  4DO0 A;  4H63 H;  5LHI B;  4BT9 A;  3RRN B;  5L3C B;  3OXG A;  1UN8 A;  3R9A B;  2EHO A;  2PQR A;  5JHA A;  4WBN E;  2WQ6 A;  2WVI A;  4QXH B;  3AU4 A;  2N1G A;  2NXP A;  3S7D A;  1DNP A;  2WXM A;  2J4D A;  2QGS A;  4ZI3 D;  3QAQ A;  2X3M A;  3NQP A;  5DJQ C;  4NUU A;  2K9A A;  3ZVV A;  3RO2 A;  4UI9 C;  2WXJ A;  2ZM2 A;  2X6J A;  4CEM A;  4K0U A;  2LJL A;  5ADX L;  1QSD A;  4HOU A;  3PUA A;  4EXT A;  4UI9 J;  4G26 A;  4PH4 B;  1FVH A;  3OJA A;  3A5X A;  2DHR A;  3GA8 A;  1BPO A;  2I2O A;  1WY6 A;  4KMO A;  4ILU A;  4I43 A;  4N3B A;  2MHK A;  5FXW A;  3VU7 H;  1SZA A;  2AW6 A;  3O1J A;  3KEZ A;  4KYO B;  3FBZ A;  5FNV E;  2E9X C;  5DAB A;  2X68 A;  5KCM A;  4R7L A;  4RVB A;  4UQY A;  1ZKE A;  1H6K A;  3MA5 A;  2PJQ A;  1H0A A;  4GA0 A;  4UQX A;  3ZN1 B;  2G0U A;  4W9R A;  4HFG A;  2VL8 A;  4KBQ A;  2AXU A;  2C0S A;  5LHG B;  2PQN A;  3QJZ A;  4Y6W A;  4AJW A;  3ASD A;  4QX8 B;  2UXN B;  5J08 A;  2NC9 A;  3PDN A;  2W00 A;  3J9X 1;  4N3C A;  1MHQ A;  1IQR A;  2DLR A;  3DJB A;  5LA6 E;  4P0A A;  3ZMT B;  4AQG A;  4TV3 A;  1INZ A;  5LJN A;  3BG0 B;  3CX7 B;  3ZC1 A;  1QNF A;  3QNK A;  1UJJ A;  3PZD A;  4C9B B;  2CXL A;  4JLE A;  3N9N A;  4O4H E;  3SD5 A;  5C1D A;  3JCK C;  4H9P C;  1E1H B;  5A6C A;  2CHW A;  1UX4 A;  2AWI A;  1VRB A;  2D2S A;  3N71 A;  4A1S A;  3HVE B;  5FMN A;  2XAQ B;  4OVV A;  4GZ3 A;  2XAF B;  3B7U X;  3P8C D;  4B8C B;  3CVW A;  5L3G B;  5BV0 A;  2HPJ A;  3EDT B;  1UW4 B;  2LEH A;  3N9M A;  3WI3 A;  4ZOL E;  1OWA A;  4BAY B;  4KXK B;  3UT5 E;  1JUQ A;  3MKR A;  2NOX A;  4C91 A;  1WR6 A;  4AY5 A;  3IHY A;  4X1K E;  5JVD E;  1IYG A;  3GYZ A;  2H7O A;  2LSJ A;  3RC3 A;  4DMW A;  4RSY A;  3ZN3 A;  4OVU A;  2XQ0 A;  4ABN A;  3ML9 A;  5LGT B;  4IN3 B;  3ZC0 A;  3AU5 A;  4JEH B;  3QWW A;  4HVB A;  3L08 A;  4UWH A;  4FC8 A;  5FYM A;  3CHM A;  2JLB A;  4AOF A;  3S7J A;  4DVD A;  5KX5 E;  5JHB A;  4ZS3 A;  3T5V A;  5HWX A;  4UVA B;  1G73 A;  3ZYM A;  4ME2 A;  5HAX A;  4NAC A;  4FAD A;  4XKC A;  2KIN B;  3RIB A;  5LBQ B;  3G2W A;  3PUG A;  3FH5 A;  1WAO 1;  2DBA A;  2X9W A;  5JQG E;  3ONX A;  5D0O D;  3FBL A;  5G05 C;  3CVP A;  3PDY A;  2HR2 A;  3N9Q A;  3L17 A;  4KVM A;  5H6R B;  4J8S A;  4MLK A;  2WPV A;  3APF A;  1FMW A;  5FT9 A;  2I6H A;  5KJK A;  3C4X A;  5G05 J;  4XAX B;  1WRD A;  1LVK A;  4URK A;  3CHQ A;  5JDN A;  3CKC A;  4IGU A;  4JVS A;  2XGS A;  2C0M A;  3Q9D A;  3RRM B;  2XGM A;  4UWF A;  3ZW3 A;  5JDQ A;  2E9X B;  4AKH A;  3S4U A;  4L23 A;  2YHC A;  5T4Y A;  2XPZ A;  2VKD A;  4KMC A;  1S35 A;  3I3N A;  4RG9 A;  1NP7 A;  4BJN A;  5JDG A;  3LY9 A;  5C2Y A;  1SA0 E;  2XRY A;  1IJ5 A;  3FU6 A;  2FI7 A;  4PK4 A;  4MKT A;  5LCW C;  3CWZ B;  2KLQ A;  4H9S E;  3U3W A;  4IE4 A;  4O2B E;  4I55 E;  4HKA A;  3QC9 A;  3CML A;  1O3X A;  2CWY A;  2IU1 A;  4L5G A;  5LCW J;  3AA1 B;  4JXT A;  5A7D B;  1HXI A;  1CUN A;  4J2C A;  4JA7 A;  4AKG A;  3QAR A;  2KAT A;  4BJM A;  2X9H A;  1WYC A;  2WXN A;  4GK0 E;  5FXV A;  3MKQ A;  2WB2 A;  3GZ1 A;  2V5F A;  4JZY A;  4L9I A;  2XEV A;  3PU3 A;  3DPD A;  3SF4 A;  2AVP A;  4I50 E;  5LOZ A;  5JDL A;  4EZJ A;  3MK7 C;  4ISS A;  5LNK A;  1KNZ A;  4MHC A;  2W61 A;  3Q4A B;  4IIJ E;  1B7T A;  4UV9 B;  4F3V A;  3RK6 A;  4XIF A;  3R6N A;  2KM4 A;  3FHN A;  3AS8 A;  3RPU A;  4DI3 A;  4C90 A;  4AM9 A;  2X66 A;  2CLY C;  2XAS B;  2XCB A;  3FUH A;  4GK5 E;  3KIN B;  5IYZ E;  3LVQ E;  4ERR A;  4HLE A;  4CQI A;  2I9C A;  2BF0 X;  3WAJ A;  5M4Y A;  4EIW A;  4I9C A;  2XCC A;  2E0I A;  2LSU A;  2V8S E;  4YND A;  5EKQ D;  3GMI A;  4EZH A;  4JHK A;  2IQC A;  4UEL A;  2V4L A;  3RX6 A;  4EBA A;  1MIV A;  5JJT A;  4MFR A;  3WXX A;  3VTY A;  1D0Z A;  4KT6 B;  5HXS A;  3ZHE B;  2V7M A;  3BQL A;  3CX8 B;  2PM7 A;  2WMN A;  2BZB A;  4DBQ A;  5EX0 A;  2CFZ A;  4GZC A;  3ZMV B;  3L22 A;  4FU3 A;  2WQH A;  3ZRH A;  2JQQ A;  1UJK A;  3K9I A;  2KWH A;  3PEU B;  3JYS A;  4TRQ A;  3GWH A;  5E76 A;  3FUL A;  3HL6 A;  3C4W A;  2BVL A;  5LFA A;  4GYY A;  3ESL A;  2JJ9 A;  3AB3 B;  3MX3 A;  1FEW A;  1H7C A;  1Z0P A;  2ZM8 A;  3BK9 A;  3MCX A;  3O48 A;  5CA0 E;  3CQC B;  2CEA A;  3HI2 A;  3K3Q C;  4C0M A;  3KBT A;  1HG5 A;  2VTB A;  3JC6 C;  4CXY A;  5FZS A;  4J8E A;  1IHG A;  3C4Z A;  4BY6 A;  4N2S A;  3N2K E;  3G2V A;  4HGA A;  3KV6 A;  5LOV E;  3GZS A;  3PRE A;  3O4X E;  2WXR A;  2EQX A;  4L7T A;  4ILG A;  4J8F A;  3VTX A;  3ML8 A;  2UWJ G;  1PC2 A;  2X6I A;  2IOS A;  5CCM A;  5D0Q D;  5BMV E;  3B7R L;  2VJ8 A;  1HTJ F;  4MRU A;  2LM9 A;  4N78 D;  1HZ4 A;  4ZS2 A;  5HXE A;  4GA1 A;  4LEU A;  1E8Z A;  4X20 E;  4U0U A;  4DLQ A;  1X5B A;  3AAI A;  2FBN A;  3RRC A;  3UT4 A;  4AVX A;  3CVY A;  3I0Q A;  2MYS A;  4GYS A;  3FU5 A;  1SHZ C;  3OKQ A;  1S0P A;  2V7I A;  4UV8 B;  1OWL A;  4HFV A;  3KBU A;  2OVF A;  3CK8 A;  3AAE B;  2OVB A;  3G2S A;  4KVO A;  4B94 A;  5CCL A;  2OA5 A;  3C98 B;  4TUY E;  4XX5 A;  4CXX A;  5BV1 A;  4UVC B;  2IJG X;  4GB9 A;  4ANJ A;  3UUN A;  4PS8 A;  5LCY A;  3MKD A;  3CEQ A;  2IAK A;  3OXF A;  1BR1 A;  2EHO C;  2I1K A;  2NP9 A;  3MXZ A;  3SFZ A;  2XTL A;  3D9O A;  2VYI A;  1HH8 A;  2CLY B;  5FY1 A;  5T8I A;  3FDH A;  3JQ0 A;  2VB6 A;  3KV5 A;  3MZK B;  5C8Y E;  4JL0 A;  1HU3 A;  3DTO A;  4PS7 A;  5JDM A;  4XZC A;  2YHE A;  3T8O A;  1NAF A;  4IE5 A;  1NWM X;  3LKU A;  3LXU X;  4U8H A;  4FLB A;  4GZ6 A;  4PFP A;  5BPP A;  1HS6 A;  3N9P A;  5JJ7 A;  4UEM A;  2L0I A;  4AQF A;  3ASG A;  2DCP A;  4TX5 A;  3U78 A;  3NZU A;  3O1H A;  4NQ0 A;  3KFW X;  2LO6 A;  4DLO A;  5JRC A;  4B8A A;  2UXX B;  3HR0 A;  4TUU A;  2WMO A;  4G11 A;  3Q2M A;  5HXH A;  4WWO A;  5EK3 A;  3FFL A;  2LE8 A;  3QB2 A;  3LK4 2;  2VSX E;  4ZI2 C;  2VK9 A;  2V7L A;  4UXN B;  3RJV A;  1MIY A;  4U63 A;  1EYH A;  3CVR A;  2VWA A;  4DPR A;  2VTB B;  3LY7 A;  2LOP A;  4WNG A;  2XHE A;  3PE4 A;  1MNE A;  3B13 A;  4LRZ A;  3TL5 A;  4CT0 A;  2B1E A;  2VAS A;  3VKH A;  4LER A;  1D0X A;  1PY1 A;  4XI0 A;  3L13 A;  3SGH A;  2E9X D;  4AI6 A;  2J1D G;  3RKO A;  3EDU A;  3OYX A;  3CK7 A;  3LS8 A;  4GMJ A;  5H6Q B;  4PJL A;  3CPZ A;  3CVL A;  4IE6 A;  3FUM A;  4HTE A;  4QWN B;  2NTX A;  3HKD E;  1ELR A;  1MMN A;  5FP3 A;  3ZLI A;  1MQS A;  4EZL A;  1IZN B;  4HXI A;  3RYI E;  4DK5 A;  3ZPJ A;  4KP3 C;  1KT1 A;  3ZFW A;  3J7Y q;  5AJL A;  1V9D A;  4I6G A;  1D1A A;  4CXW A;  3D9J A;  3B7S A;  2H3R A;  3CQG B;  4TN7 B;  3FEY A;  4D10 C;  3JUI A;  4RG6 A;  5LHH B;  4QKN A;  3Q5M A;  2C0L A;  2Y6X A;  2Q9Q D;  4WWP A;  4G1T A;  2CWO A;  2H7V C;  3ZGQ A;  4APF A;  4YHJ A;  4ADZ A;  1ELK A;  2KWI B;  5J1G A;  4GIW A;  2K24 A;  2XAJ B;  4UQZ A;  5JDH A;  3SWH A;  4QFV A;  5FZR A;  2XAH B;  3D9N A;  3HA4 A;  4L2Y A;  4BTA A;  4EYY R;  2LHN A;  4EPZ A;  3ANW A;  5JRE A;  2L9Q A;  3M65 A;  4L1B A;  4YJ2 E;  4FI5 A;  2EHO B;  3T8M A;  3SS1 A;  5FQ8 A;  4IE7 A;  3AS5 A;  2LSG A;  2SPC A;  1EF1 C;  3MA9 A;  2VKH A;  3IEE A;  1LF8 A;  2PL2 A;  3BQK A;  2BTD A;  3ULQ A;  1A17 A;  4PS3 A;  2GW1 A;  2A5U A;  3FTX A;  4UI9 K;  4B0Z A;  2X9Y A;  4PAG A;  2AXZ A;  3DP7 A;  2XUE A;  4GYR A;  4B89 A;  2JRK A;  2CE7 A;  3IKO B;  3Q15 A;  3HKE E;  4CT4 A;  1EPU A;  1HF8 A;  5DQW A;  5F8P A;  2D0T A;  4A1G A;  3K3O A;  5KMG P;  4PFO A;  3EHM A;  2WBL A;  4CCA A;  2CXD A;  5HWY A;  4FJY A;  2LT3 A;  2HH7 A;  1ELW A;  4EZK A;  3QC1 A;  5JR9 A;  1QQE A;  2KCV A;  3V5U A;  5JRC B;  2ION A;  2YK0 A;  5BUZ A;  1E7U A;  3UUX A;  5G04 C;  3FUE A;  4U07 A;  3AA6 B;  1WM5 A;  4BSX A;  4WW0 A;  4HOS A;  4ZI7 E;  3LFM A;  1JPL A;  4I43 B;  2WXI A;  4JUY A;  2RG8 A;  3GZ2 A;  5G04 J;  4JW1 A;  4J6I A;  2KND A;  4OYK A;  4U0Z A;  3PH0 C;  3FTV A;  5AJD A;  4K0R A;  3UTK A;  2NW8 A;  1UX5 A;  5FXX A;  4GCO A;  1YA0 A;  4MLP A;  4A55 A;  2JPF A;  5BW8 C;  5JJ6 A;  3ZIM A;  2KC7 A;  4LCT A;  4EYU A;  1FMV A;  4YVO A;  3TJP A;  4KUM B;  5LJM A;  1N52 A;  2NTY A;  1U3D A;  3CK9 A;  3SZ7 A;  4EEC A;  3ZPO A;  4WWN A;  4E6H A;  3MEK A;  3U64 A;  4FJO A;  4PNI A;  3I4R B;  1L5J A;  3IF8 B;  2MRI A;  4QXC B;  2X51 A;  5ARF A;  1ZV4 X;  2RA1 A;  1H2T C;  3P2B A;  4HN9 A;  3CQX C;  3O9X A;  5LX8 A;  2GGF A;  3CSF A;  5DIZ A;  3GW4 A;  4AIF A;  3MV2 B;  3RU0 A;  3SBS A;  4ASK A;  5DBK A;  2XPI A;  3C64 A;  1JWG A;  2GK9 A;  3APD A;  3PUK A;  3K8P C;  2V7J A;  4FUL A;  3LBX A;  2KCK A;  3FTU A;  4WBO A;  3Q49 B;  4ANX A;  2VKO A;  2X9X A;  1QZ2 A;  5TAO A;  2XPY A;  3TAX A;  3D9P A;  2JMH A;  5CA1 E;  3PE3 A;  3O1I A;  3EDV A;  4EOZ B;  3ZXS A;  3L54 A;  4P09 A;  1HCI A;  3PE0 A;  2Z6E A;  4AKR B;  4M1P A;  4CGW A;  4I6J A;  4JHR A;  2AXV A;  3L6A A;  2IOL A;  4H9R C;  1BR4 A;  3ZJ2 A;  3FTW A;  4EZ4 A;  5A1L A;  4DI4 A;  2CXF A;  2BUG A;  3S7B A;  2Y8D A;  3KV9 A;  2N9D A;  3MZL B;  3PTR B;  3QDN A;  3KD7 A;  4WUY A;  5HI7 A;  3F31 A;  2OOE A;  5L3F B;  3HDX A;  5L3B B;  5JDF A;  4FLH A;  4BX8 A;  2J09 A;  3SHF A;  1W3B A;  4I2W A;  4H7Y A;  4L0R A;  5LXT E;  1OUV A;  3G2U A;  5FJY A;  3QK6 A;  4I6E A;  4GML A;  1FIO A;  3E08 A;  4FJZ A;  3AA0 B;  2LNI A;  4ILI A;  2C2L A;  3ETV A;  4GA2 A;  3PUR A;  2ZM0 A;  1D1C A;  5FTP A;  5FQ6 A;  3R84 B;  3UUX B;  4APO A;  5A23 A;  1YKE B;  3ZMS B;  3AA7 B;  1DVP A;  3N5L A;  4EQF A;  5GON E;  4G23 A;  3WAK A;  4OYS A;  1BR2 A;  4Y6C A;  3FXE B;  2XAG B;  4YLH A;  1LVF A;  3I9W A;  4UVB B;  1TJF A;  4EAH A;  2V0P A;  2HO1 A;  2CHX A;  3FU0 A;  4PJJ A;  2E8I A;  3LCA A;  2L8K A;  1HS7 A;  4O4L E;  3FUI A;  4PW8 A;  2CG2 A;  3LYA A;  2QY7 A;  1HG2 A;  5FQ4 A;  4XKB A;  2IC6 A;  3UPV A;  5M72 A;  2CFU A;  2YQ8 A;  4KZ0 A;  1B89 A;  5LP0 A;  2ACX A;  1HX8 A;  1NA0 A;  3OXL A;  1NA3 A;  4U74 A;  3I4G A;  5LGN B;  4IYP A;  1Z3Y A;  3O4Z A;  5CMY A;  3IHV A;  2E2E A;  2WXQ A;  3UT7 A;  3H37 A;  2P9B A;  3ONK A;  3JC6 D;  5ENN A;  2V1D B;  4DMV A;  2L0T B;  3VKG A;  2IW5 B;  3EUH A;  3TXM A;  3I0O A;  1UG3 A;  5L2L A;  1Y64 B;  2X6H A;  3RO3 A;  2DIW A;  3F57 A;  3BG1 B;  4I1O B;  3EHN A;  4O6F A;  1H2V C;  5JH7 E;  3ZJ1 A;  2X0L B;  4IE0 A;  5EK4 A;  4UF0 A;  2Q7F A;  1US7 B;  2LSK A;  4I2Z A;  4XE0 A;  3LBX B;  3FTZ A;  2J07 A;  3KVB A;  4WND A;  3MKQ B;  3FUF A;  3CVU A;  4OYJ A;  5EZY E;  3RYH E;  4DJA A;  3ASF A;  3P1U A;  5EK2 A;  4DND A;  2KZ7 B;  2YU2 A;  4WNF A;  2PG8 A;  5CB4 E;  1LRZ A;  5J2U E;  3CX6 B;  3IV0 A;  1H2U A;  3S7F A;  1VDY A;  4N3A A;  2A72 A;  4UWG A;  1D1B A;  5L3D B;  3Q47 B;  3NF1 A;  4JA9 A;  3QWV A;  4HEA A;  4AXP A;  3NZP A;  2LAI A;  3D9I A;  3SNX A;  2LSV A;  4MS6 A;  2D5U A;  2R17 C;  3HVE A;  3PNT B;  3PRZ A;  5IHY A;  3W15 B;  5T3R A;  3TG5 A;  4CGV A;  2UY1 A;  4NRH B;  1TJC A;  3R7R A;  5AIJ A;  3TKL B;  5FQ7 A;  3Q5X A;  4FHJ A;  1ZHC A;  3Q5W A;  3QWP A;  4CDN A;  5KJM A;  3MGB A;  3PNL B;  1MMG A;  2EHO D;  2V26 A;  3I1A A;  4PDX A;  1XNF A;  5E0O A;  4G63 A;  1WYB A;  3MAC A;  4C0E A;  4I1M A;  1P5Q A;  5ANR A;  4AQF C;  4ZI3 C;  2LAH A;  4G25 A;  4ACK A;  1Y8M A;  2YNQ A;  2WAU A;  3ZYQ A;  1IAP A;  4JHJ A;  2D0U A;  4CI1 B;  5E75 A;  4JEH A;  2NW7 A;  4A3T A;  3ASH A;  3MJX A;  3UX4 A;  4IUL A;  3B57 A;  2WQ7 A;  4IHJ E;  4YFS A;  3QOU A;  3E4B A;  3CIA A;  3MJW A;  5EX3 A;  4JC8 A;  3FHE A;  2R5S A;  4IST A;  3C50 A;  3IHR A;  3L09 A;  2KCL A;  2ZMA A;  4MAL A;  3SBT B;  4CI2 B;  3MYV A;  2HYZ A;  4F7A A;  4H9Q C;  2W63 A;  4O4J E;  4PK5 A;  3RYF E;  3JQ1 A;  4ILH B;  1MIW A;  2Y4T A;  4H9O C;  3UUL A;  2CA5 A;  4N39 A;  1E8Y A;  3E22 E;  5L3E B;  1LKX A;  2R59 A;  4ZI2 D;  2QA7 A;  3ONL A;  3OTN A;  3E0Z A;  3EIJ A;  3TXN A;  4CZZ B;  3LVR E;  3FUN A;  3PUS A;  3LJC A;  3N9O A;  5AYW D;  2HPL A;  4TV8 E;  2FF4 A;  2L6J A;  3FTY A;  2FUL A;  3QUJ A;  3FY4 A;  4JPS A;  2E9X A;  2GRL A;  3N2G E;  4NUV A;  3LDZ A;  4XI9 A;  4FHK A;  3I5P A;  3VLE A;  3ZN0 B;  4GU5 A;  5FXZ A;  1E8W A;  1UN9 A;  3PVL A;  4GZD A;  1H19 A;  3FXD B;  3FUJ A;  4NUR A;  4P0B A;  1YW0 A;  3CHP A;  1AJ3 A;  4UF0 B;  3L3P A;  1FVF A;  4KBM B;  3LG7 A;  4UIG A;  1NZN A;  3FH7 A;  4IRU A;  2KMF A;  4A56 A;  2PM6 A;  3L16 A;  3HIZ A;  4PK6 A;  2RD0 A;  2WXL A;  3RYC E;  3UQ3 A;  3FU3 A;  3KAE A;  2WM9 A;  4GYO A;  4ACL A;  4GOU A;  1KT0 A;  4AEZ C;  2Q9Q C;  1QUU A;  2BVM A;  5J2T E;  2JEK A;  2VSY A;  2A4Z A;  4ZHQ E;  4X1I E;  5G55 A;  2Q9Q A;  2MOW A;  1MND A;  4BA9 A;  2WXF A;  2OND A;  4WAF A;  2CG3 A;  3RH3 A;  2VGY A;  2LSI A;  3D9K A;  4GZ5 A;  3KV4 A;  1WLX A;  4J0U A;  2PZI A;  3DBS A;  2UY1 B;  2L3L A;  2N2N A;  5FZQ A;  3SI5 A;  2C5J A;  4ANU A;  2M67 A;  4O4I E;  2W62 A;  2A2F X;  4EBA G;  3FWV A;  3HHM A;  2LOS A;  2CM0 A;  5LP6 E;  1N54 A;  2C5I T;  4I9E A;  4BFR A;  3EVY A;  4AV7 A;  2K48 A;  5JR9 C;  3MV3 B;  4YJ3 E;  4BX9 A;  1VOM A;  5HQ8 A;  4DBR A;  2CCQ A;  2XRZ A;  2MTQ A;  3CKD A;  4AY6 A;  3IBP A;  3KVA A;  2NSZ A;  3NRX A;  4EB6 E;  1UCU A;  1E7V A;  4Q69 A;  1OWN A;  2DWG A;  3TG4 A;  4PJM A;  4PJN A;  5KJN A;  4E85 A;  4XBF B;  2YEV C;  2Y4U A;  5J90 A;  4HOQ A;  3CR3 A;  3LJ3 A;  4JEU A;  2I59 A;  3ZHE A;  2IFU A;  4F1S A;  4F53 A;  2J9Q A;  1OWO A;  2QFC A;  3LY8 A;  2FO7 A;  4CDR A;  4HS2 A;  2ODV A;  2WXG A;  1OXZ A;  5CMW A;  1SZ9 A;  3LK2 B;  3AAA B;  2XHE B;  5ARG A;  3S2A A;  3BQI A;  3HKC E;  3AVS A;  2KZT A;  4QHO A;  1E8X A;  4U04 A;  4A3V A;  3NBX X;  3U4T A;  3P7I A;  2VGX A;  4J8D A;  4L2L A;  1T98 A;  3PUJ A;  2DNX A;  4BT8 A;  3FP3 A;  3H3A A;  4U0S A;  5KDM C;  1IJ6 A;  2VSN A;  4LUN U;  1Z6T A;  1HO8 A;  3CKB A;  5KJL A;  3FUK A;  4H63 V;  1OWP A;  3CHR A;  4H9N C;  1GW6 A;  4G24 A;  2NWB A;  5LBM A;  1E96 B;  3LK3 B;  5ANL A;  4FP7 A;  1HE8 A;  2I1J A;  2JMK A;  4CDM A;  4V3I A;  5AEN A;  3FB2 A;  2K5B B;  3GN5 A;  3RRW A;  4QXB B;  1U5P A;  4UWL A;  3TGO A;  1KLX A;  4P29 A;  2WXK A;  5G2N A;  4E7S A;  2ILR A;  1TEZ A;  2Y48 B;  4I1A A;  3QKY A;  2J08 A;  4WNE A;  3UFE A;  1KK7 A;  1U3C A;  4MBQ A;  4OHF A;  4AXH A;  3PS6 A;  4O2A E;  3K3N A;  3SOL A;  4I17 A;  2HM8 A;  3RRU A;  3VHL A;  2Q9Q B;  2X38 A;  3G2T A;  3PU8 A;  2ZLY A;  4HOR A;  3D0T A;  2VQ2 A;  3CVN A;  3AVR A;  3ETU A;  3N9L A;  2DI4 A;  4ANV A;  3ANW B;  1YKH B;  4FA6 A;  3BEE A;  1Y6I A;  2Y3A A;  3C51 A;  3C98 A;  4I4T E;  2J49 A;  3LPZ A;  3IEG A;  2V7K A;  2ES0 A;  2KXP B;  5DQV A;  4ANW A;  4U72 A;  3ZEF A;  4QX7 B;  1MMA A;  3I9Y A;  4E7Z A;  4GYW A;  3U66 A;  4KZC A;  2BDE A;  3NZS A;  2WXO A;  1ZEE A;  2YU1 A;  1XGW A;  2LHR A;  3PEV B;  1G8X A;  3OAW A;  1OWM A;  2NW9 A;  3SRZ A;  2GRM A;  1U4Q A;  3OYZ A;  3FTS A;  5LYJ E;  5HYA A;  5JR9 B;  4K03 A;  1HFA A;  5AFU L;  4TV9 E;  1X79 A;  4Q94 A;  4O8S A;  4AP2 A;  2DWK A;  1IQU A;  3NRY A;  4Q96 A;  3CLJ A;  3HYM B;  5ETW A;  3IBE A;  2WSS V;  2RP4 A;  2MBG A;  4PUC A;  3FH8 A;  3FUD A;  3ZCI A;  4AKL A;  4BTB A;  4JEU B;  4H7X A;  1EDU A;  3N2O A;  4HOT A;  3CGH A;  4UWK A;  2X67 A;  3KS2 A;  3RC8 A;  2WWU A;  4N2Q A;  3D9L A;  3LEW A;  3VLF A;  3APC A;  4OFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...