2YINA

Structure of the complex between dock2 and rac1.
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
425
structure length
411
Chain Sequence
SKDNRMSCTVNLLNFYKDNNREEMYIRYLYKLRDLHLDCDNYTEAAYTLLLHTWLLKWSDEQTHRQLKETLYETIIGYFDKGKMWEEAISLCKELAEQYEMEIFDYELLSQNLIQQAKFYESIMKILRPKPDYFAVGYYGQGFPSFLRNKVFIYRGKEYERREDFQMQLMTQFPNAEKMNTTSAPGDDVKNAPGQYIQCFTVQPVLDEHPRFKNKPVPDQIINFYKSNYVQRFHYSRPVRRGTVDPENEFASMWIERTSFVTAYKLPGILRWFEVVHMSQTTISPLENAIETMSTANEKILMMINQYQSDETLPINPLSMLLNGIVDPAVMGGFAKYEKAFFTEEYVRDHPEDQDKLTHLKDLIAWQIPFLGAGIKIHEKRVSDNLRPFHDRMEECFKNLKMKVEKEYGVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Apoptosis
molecule keywords DEDICATOR OF CYTOKINESIS PROTEIN 2
publication title Multiple Factors Confer Specific Cdc42 and Rac Protein Activation by Dedicator of Cytokinesis (Dock) Nucleotide Exchange Factors.
pubmed doi rcsb
source organism Homo sapiens
total genus 132
structure length 411
sequence length 425
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.740 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2yinA03
1.25.40.410 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2yinA01
2WMOA 2WMNA 3B13A 3VHLA 2WM9A 2YINA
chains in the Genus database with same CATH superfamily
4Y6CA 2XAHB 1US7B 3UUXA 3RKVA 5G2NA 4N5QA 1MX2A 3B7UX 4CT0A 3ULYA 1IKND 3UI2A 2E5LT 1LF8A 4ISSA 2L9BA 2KBXA 4IE0A 2JQHA 4PJNA 4EEBA 4GK0E 5JDQA 3FTSA 4MS6A 4YHHT 2BG9E 3P4SA 5B1BE 1JCQA 3MZKB 3OTOT 1XDOA 4EZ4A 2KCLA 4ZI2C 4AI6A 3H3AA 2EIJE 4ILIA 5KCMA 4EGWA 3OVUA 4DV7T 2A5UA 2ONDA 4JEUB 4JZYA 3T1HT 4U04A 4YY3T 2BF0X 3MJWA 2KC7A 4B3ST 1OCOE 3FTZA 1OXZA 4BA9A 3RIAA 3RO2A 1WY6A 3HXDA 4U74A 4GZ5A 2NWBA 5CA0E 4Q96A 5AQ7A 4AM9A 1D8EA 3SI5A 4A55A 3FZMB 3VHLA 1KFYA 4IL4A 4HRMB 1XZYA 5H7PA 3AAEB 2H6GA 3UT5E 3AXJA 4DO0A 4LG6A 1IBLT 3RIUC 3PUWF 3SBTB 1LD8A 3DEOA 3FU5A 3NOGD 3PUZF 1N32T 3NZSA 2JPFA 3ZUVB 1K3ZD 4I1OB 2XEVA 5LJNA 1BU9A 4X65T 3MA9A 1NFIE 5FQ8A 4TN7B 2WXHA 1H0AA 4ADZA 3UM2A 3FBLA 2UY1A 5FNVE 2EIME 2BEDA 2I1JA 2XAFB 1N4SA 3UXGA 2H6FA 4URKA 3D0TA 3ASFA 4G2AA 4FP7A 3E0ZA 2OV9A 3NOCD 3UKUG 3AS5A 5ABFA 3ZMVB 2W00A 2QA7A 2WDQA 2VVNA 4YDWA 2GGFA 4O2AE 3P1UA 2LE8A 4FU3A 3UKRG 3KV9A 2BTDA 3EDTB 5HXCA 1HH8A 2X0LB 4LMLA 5ABHA 5JVDE 4AKGA 4C0EA 2YN6A 1N36T 2VTBB 3NQPA 2AXDS 4Z90A 4L1BA 4JI2T 2QFCA 2XZDG 4U8HA 5DABA 4UV9B 3CQGB 3C3RA 2MOZA 4F3VA 4IE7A 2J4GA 4I9EA 2XHEA 4CN4A 5CFBA 4GYSA 4AKLA 2DBAA 2VQET 2AJAA 1GQEA 3Q2MA 1PY1A 3J5QB 3LDZA 4JA9A 3TLTA 2ZXWE 1WDYA 2A4ZA 3I9WA 5A1LA 2FJDA 2FUPA 5JR9A 4DK5A 4LEUA 3PREA 4J0UA 1MQSA 3SF4A 3ULQA 2WSSV 2X51A 3O1JA 4AEZC 3E22E 1YKHB 3APFA 2WU5A 3OAWA 2ACXA 1YXRA 2YU1A 3IA3A 3B7SA 1WRDA 4KHZF 1U3DA 2WXLA 2MYOA 3PZ3A 5ABGA 1EYHA 4K03A 5LP6E 3FU6A 3ONXA 3UQ3A 1TEZA 4CN6A 3PDNA 1Y8MA 2B76A 3L22A 4PS8A 4CGVA 4HQDA 2P9SG 2HN1A 3O9XA 1KT0A 2V5QC 3J5PA 1OWMA 2LT3A 4N78D 3IHVA 3IF8B 1IYGA 3X1DA 3QK0A 1YA0A 5AQJB 3TLUA 4ILGA 4NXMT 3TWVA 2WDRA 1H7CA 2CG3A 3VTXA 1E8ZA 3ONLA 2I2OA 3VRAA 1SW6A 4GTTA 1OWAA 5ABEA 4J8YA 1UW4B 3FUEA 3G2WA 4ZI2D 4N2SA 1V55E 3FH8A 2X9YA 2LUHA 5AQOB 2FEZA 3JAFA 4N3CA 2C2LA 2X6KA 4EHMA 2CMRA 3I0OA 4YXDA 5BPPA 1DCQA 3AVRA 4EV6A 4HLLA 4GK5E 3GN5B 2CFUA 3ENEA 4ATZD 3JYSA 5FVKA 4L5GA 2IDOB 4GA2A 5ENPD 3BG1B 4ANWA 2HPJA 2D9DA 2FO7A 2WQ6A 4GKJT 3HVEA 2UUBT 3BG0B 4GTMA 4DX5D 3AU4A 5AFUL 2CG2A 4IDPA 3QWWA 3SBSA 4H63V 4IL9A 2BVLA 1PAQA 2LM2A 4ZI3C 4ZZBA 3EHRA 3A5XA 4IDZA 1O3XA 1YQ4A 4X66T 3R9AB 3FH5A 2ZGGA 4ZXLA 2RFAA 1IHBA 2ZU6B 1NA3A 1ZKEA 4HFVA 5D66A 3AEDA 3IKOB 4BSXA 4ISTA 3RRNB 4WNGA 4AQFA 2WZHA 4DV6T 4CI2B 1UJJA 2V5FA 5LMUT 3L6AA 1T7SA 4HB5A 4DRXE 4HVBA 1MNDA 3T1YT 4GKKT 3RJVA 3HXEA 2UUAT 2VWAA 4Q25A 5HAXA 5D0OD 4BWRA 2YNQA 3ZRHA 4XZCA 4UUCA 2Y0BG 4UWKA 4O8SA 3FEYA 4CXXA 1YW0A 2LAHA 4DBQA 5CECB 1SA4A 3VKGA 3Q7AA 1YQ3A 5HCMA 5AQFB 4TV9E 1JCSA 3CVXA 4J8EA 2VKHA 1G3NB 3LVQE 3KDSE 4I0UA 2L0TB 5JHAA 3N2OA 3TJPA 2H3RA 2D5UA 3MXZA 2H7VC 4ILCA 3F57A 1EZ3A 1DCEA 2I9CA 2YOEA 5J08A 2CHZA 1MIYA 4M7CA 3O4XE 4G2VA 4BEPA 5EK3A 4HOSA 4EAHA 2VSOE 4LF7T 5G05J 3I0QA 5IHYA 4P0AA 2X68A 3DSXA 4KUMB 1DU2A 1S0PA 5LMNT 5G05C 1D1CA 1T8BA 2WP9A 3PU8A 5HWYA 5IYZE 3NB2A 4CXYA 4A3TA 4JHJA 2L9QA 3ZGQA 4B8CB 5KJNA 3ZSSA 3H3MA 4N2QA 4QXHB 4J6IA 4TZ4C 3KBTA 3PZ4A 3DSVA 2MBGA 2J07A 3OYXA 2MPKA 1AJ3A 5DBKA 2EIKE 4ZS2A 2J49A 2QY7A 4JI0T 2WXFA 3CKCA 3AE4A 4TWDA 3NAWA 3FZFB 4HFIA 1HCIA 4KP3C 3FEXA 4ABNA 1Y64B 4XBFB 4IE5A 1MNEA 1MIWA 4IDQA 2X67A 3HRAA 3NRXA 3FUNA 3GYZA 4EYYR 3BU8A 3FULA 4X5TA 5HXRA 3K1SA 2XQ6A 4CEMA 3WI3A 2XQ5A 3CPZA 4NUVA 2PTFA 3DSWA 1QNFA 3ZSTA 4GTVA 3N9QA 1X5BA 4AOFA 5BNWA 3RGLA 3UUMA 4K0RA 1DNPA 4UWLA 1N54A 2FBWA 4HKAA 4WNFA 3CVNA 2J47A 4XI9A 4C0MA 3JQ1A 2JIWA 4HFGA 2IFUA 2E9XB 2D2SA 5CRUA 3V5SA 3OYZA 5ETWA 4PJJA 2Y4TA 3CK7A 4BT8A 3CHQA 4WUYA 5HRYA 2L8KA 1BR1A 3N9PA 4B3TT 4ZFHA 3IBPA 3PURA 4BFRA 3N9MA 2R05A 3OXGA 3V2OA 3CR3A 3SQVA 4EECA 4OYJA 2YDRA 4EZJA 3DSUA 4MBGA 3ZJ1A 3FHNA 2F37A 2A72A 1YCSB 3PUAA 5KX5E 4KXKB 5FT9A 4B93B 1ZHCA 3GZSA 1S63A 2CHOA 2CPTA 4G23A 2Y48B 4PJMA 5CERB 5LCYA 1NWMX 4ZI3D 2CA5A 1LVKA 3CGHA 4GTQA 4U31A 5HEHA 2AVPA 2XM2A 3TXMA 2VVSA 3AA7B 1FIOA 2QYWA 3DSTA 1Y01A 4X8QA 5GONE 3UM3A 4YVOA 4HWFA 4BX9A 4TNWA 2LKHA 3GMIA 2AWIA 5FP3A 5L3FB 3RX6A 5E75A 4WWOA 4HGAA 3UT4A 5EX0A 2VSYA 4LUNU 2X38A 4X64T 1FVHA 1U3CA 4HRLA 5CRVA 2LNIA 4ANUA 5LJMA 3IEEA 2J9QA 1NP7A 3D9JA 4ILHB 3L16A 1JNZA 1W3BA 3AE2A 3PEVB 2GROB 1VOMA 2AXZA 2R17C 2XZTG 2M67A 3KV6A 3GZ1A 5KXJA 2XJ7A 3SO8A 5JA4D 2PZIA 5AQRB 2DYRE 3EVYA 3ZU7B 5AQUB 3TXNA 5HKPA 5LGTB 1HS6A 5KJMA 2ZIRA 3U3WA 4TWFA 1UG3A 4U3CA 3WG7E 4ANVA 4I55E 3T5VA 4IE4A 3VLEA 2YEVC 2XQ9A 1XNFA 4GIWA 1K8KG 2HE0A 3LJNA 1YYHA 3NVOA 1A17A 4OVVA 1MIVA 2GW1A 5EKQD 3KV4A 4GU5A 1KNRA 4GTOA 3UUBA 4AIFA 5FXVA 3KBUA 5ANRA 3UUXB 4HI8A 5HXSA 4CCAA 2H88A 1NAFA 3ZMTB 5EZYE 5H6QB 4UQXA 3MGBA 1KT1A 3Q4AB 4LMKA 5FQ6A 4HXIA 5AIJA 1L5JA 4F53A 5LBQB 2ZGDA 2BKPA 4EOZB 5JDGA 1E2AA 1XGWA 1N33T 3ZC0A 1Z8UA 3QJZA 5DIZA 3ML8A 3KD7A 4EQFA 5IY5E 1TJCA 3HI2A 2DVWA 1D0XA 4AVXA 1HE8A 3T8MA 2BKGA 2E9XC 4QH1A 1TNYA 3IHYA 1Z5SC 2R59A 5AYWD 2EILE 2CWOA 2XTLA 2WMOA 2V4LA 3FTUA 1E1HB 3NZPA 3FWVA 4TRQA 2PBIA 3W9FA 4JEHB 3D9NA 3OXFA 3FBZA 2YQ8A 2LOSA 3AE5A 3EUHA 2WB5A 2VYIA 4XIFA 3C4ZA 2V7IA 5LFAA 3SFDA 1TJFA 2BKOA 4DUYT 1AWCB 3Q5XA 4CQIA 2V5DA 2XGMA 2LSIA 5DQVA 1S70B 4FLHA 3Q49B 4WNKA 2W61A 3CX7B 3RIBA 1HXIA 2LOPA 5AN8A 3RAUA 3R84B 2XM1A 3PZ2A 3QDNA 2ZM2A 4AIUA 2JRKA 1A5EA 3NZUA 4M1PA 2J4DA 2Y1LE 4QKNA 2LSGA 5AQQB 5HYAA 1MJ0A 4N5CA 4G26A 3ZNGA 3LKUA 2B0OE 4U07A 2UY1B 2Q9QA 5AARA 1KNPA 2J09A 2W67A 5HQ8A 4BX8A 4QH4A 2VGYA 4TUMA 4EBAG 2NTYA 2KCVA 2HR2A 3C5RA 4LERA 1MHQA 4I2ZA 3CHPA 3M3ZB 5CBOA 1HNXT 1ZP0A 1EF1C 1H6PA 3UTMA 3FTXA 3UU6A 4O1OA 3S7DA 4G8KA 1KK7A 2MRIA 3LSVA 3SFZA 2NP9A 3CSFA 1S64A 3PUGA 3JCKC 3ZEFA 3PV0F 4N39A 3QUJA 3NKZA 1HTJF 1HFAA 5L2LA 4DR1T 4U2YA 3HXBA 4H7XA 5HEUA 2XHEB 4XE0A 4BESA 1ELWA 4H9PC 3Q5MA 2B6CA 4I1AA 4JPSA 1MMGA 3AB3B 2KMFA 3JQ0A 4EZKA 5LHHB 1FT2A 5JR9B 3AA0B 2E8IA 4YTPA 1VCTA 2L3LA 4JD2G 4F7AA 4HORA 3Q73A 2CWYA 2WXPA 2YDQA 3UU3A 1IZNB 1YMPA 2K48A 4DIDB 4KI0F 3E34A 5AQHB 2IMLA 3M65A 1V9DA 4GPKA 3O48A 3FZLB 2AXUA 2GRRB 5JMND 2GRNB 4DX6D 5FXZA 2DYSE 2MOWA 2NXPA 2LSKA 4K5AB 2QYUA 3E37A 3UT8A 4GYOA 4LFAT 2ACZA 2ZMAA 1HZ4A 1QZ2A 4YLHA 4UF0A 3QAQA 4HTEA 4FHKA 4WWPA 1KZPA 3D9IA 2BKNA 4OFZA 3OKQA 3RYIE 3MYVA 2IC9A 4C90A 2P9UG 3D9HA 4L23A 5LGNB 2CEAA 3K3OA 1Y6IA 3AU5A 2RA1A 4UVCB 3PU3A 5JDNA 4L0RA 2F4VT 5EX3A 2X0YA 1FMWA 3FY4A 5BXUA 4G25A 4N3BA 4YTNA 1XWMA 2HPLA 5JJ6A 2I59A 2E9XD 3Q7FA 3TLVA 5L3DB 5T8IA 4OVUA 3ZT6A 1O1SA 2XAGB 3LK2B 1XMQT 2PM6A 5AQSB 2RG8A 2VJ8A 5FMNA 3ZKJA 5C2TA 4I6EA 3CVRA 5FZSA 1NL4A 4JI4T 4I2WA 2FULA 4YJ2E 1KEYA 3KVAA 1HO8A 1W0BA 1TN6A 3OPCA 2EINE 5FKYA 1CUNA 3HIZA 1UN8A 2CM0A 4NUUA 1WFDA 1OCZE 4DV2T 3S2AA 2IOLA 3RLFF 3HVEB 4HWIB 3O1HA 4BETA 4UVAB 5CCLA 2X9XA 4ILBA 3FHEA 4MALA 1E7VA 2V8SE 1V54E 3DPDA 2N1GA 1J5ET 2IU1A 4MRUA 3ZXSA 2P9KG 2J8SD 3FTYA 1UGOA 4HWHA 4NIQA 4QH5A 3TLSA 4MBQA 5CGMA 5BR8T 1TNZA 3RQWA 4B3MT 3E08A 2L6JA 2OLTA 3BEEA 2J1DG 2CXLA 1NZNA 1UK5A 2I0MA 5JREA 4DVDA 4UELA 4O2BE 4U0ZA 3RI5A 5JTGA 1I94T 1P5QA 3TAXA 3TWRA 2ZM8A 2C0SA 3AEAA 4DV5T 1K1AA 1TNUA 1UOHA 1IQRA 2F8XK 2WXKA 1IJ5A 2XQYA 5HEGA 5EIBE 5M72A 5FZRA 4ZS3A 3Q9UC 3HXCA 2R02A 2UWJG 2K9AA 2WS3A 3Q9DA 5AQKB 3AG2E 3HYMB 2P58C 4GYWA 2LRLA 4H9RC 4L2LA 1KF6A 3LYAA 3AAAB 2MAWA 5JR9C 4HNAD 3KSQA 4PFPA 3O1IA 4RSYA 2V7KA 4UIGA 3UIOC 3ZJ2A 1E96B 2KWHA 3C4XA 2XQ3A 4GMLA 1J5WA 3ASOE 4JI3T 4I17A 2CHXA 3CHMA 4MKTA 2XEEA 4WZXA 3CMLA 4A98A 3GW4A 5EYLA 3RC8A 3DEPA 3FUFA 4DV3T 4A56A 3RYCE 1HU3A 2PQRA 4U63A 3Q75A 2MTQA 4V1Av 2GRPB 3V2XA 4ZHBA 1OWNA 5FJYA 3DTOA 1KZOA 5ENTD 5AQIB 4WWNA 5AQPB 4YNDA 1HNZT 2WWUA 2P9BA 2PFVA 4DMVA 3A8YC 4AQGA 2JEKA 3ZYQA 5KWDA 4RG6A 3C4WA 2KATA 3V79K 3RSEG 3DRAA 1Z3YA 3ONLC 4B3RT 2V1DB 4I4TE 4OAVB 3UQ7A 4X1KE 3PS6A 1X81A 3K9IA 3PUJA 2XY8B 1MZCA 3EIJA 3PH0C 2L6BA 1Z0PA 3EDUA 3B95A 2JLBA 5CMWA 1XNRT 2BZBA 3HA4A 5A6CA 5HEJA 2NYJA 4EBAA 2UXBT 3KVBA 4LNUD 3ZIMA 5BV1A 1E8YA 3BUAA 2LXMA 4UI9C 1WR0A 4IE6A 4ACKA 3L09A 2KWIB 2UXXB 1HF8A 3PZDA 4L2YA 2ES0A 4BT9A 2XSBA 3G2VA 4PK5A 3HR0A 2GRMA 3AA6B 4CI3B 2OVBA 5CHEE 4P29A 2F8YA 4WBOA 4DMWA 4DPRA 3KEAA 1JWFA 1UJKA 4ASKA 2WVIA 5G04C 1E7UA 3PZ1A 5LOZA 4RG9A 3LY9A 3RKGA 2HO1A 1N11A 4APOA 3P4QA 2NW8A 3LEWA 3U78A 2OCCE 4O4HE 2D0TA 2XENA 1Q2ZA 3WAKA 3NF1A 4DLQA 3PUXF 4AQFC 2IQCA 5EK4A 2AW6A 4HN9A 2N9DA 2ZLYA 3CVUA 2R03A 3CVWA 3CHSA 3LY8A 4Z8XA 5E76A 4X20E 2JQQA 1MYOA 4GPMA 3SS1A 4BJMA 3MKRA 1D9SA 1G73A 2IUBA 4E7ZA 2VB6A 2UUCT 3FTVA 4PFOA 3ML9A 3VRBA 5FY0A 4O4LE 3RH3A 3ZMUB 4IDOA 3FP3A 3FUIA 2GRLA 4YDYA 3U9WA 3Q5EA 2DLRA 4PK4A 3VLDA 1EPUA 2V0PA 4GTPA 2YU2A 2JQKA 2JMHA 4O4JE 1QYMA 2K24A 1M7KA 3VR9A 3EAMA 1Z6TA 3JC6C 3AAAC 4O4IE 3RRWA 4JI5T 1E8WA 2FO1E 3VU7H 2LLYA 4R7LA 3ABKE 5CMYA 3UINC 4UXNB 2XPZA 4LF6T 2E5VA 2PL2A 2E2AA 5FXXA 4BTAA 4XEIG 4I6GA 4H63H 3A7MA 2ZM6T 5TAOA 1G8XA 3N2GE 3R9MA 3SFXA 3EHQA 3J7Yq 2YK0A 3CQXC 5CEAA 4GB9A 4HEAA 1U5PA 1B89A 5EYPF 3RC3A 4GCNA 3SWHA 5JRCA 2H6HA 4WNEA 3IV0A 1JWGA 4HRNA 4TWHA 3LDQB 4UR9A 2XAJB 3EJNA 1H19A 2VGXA 2X6IA 3SHFA 4HOTA 3PTRB 4J8SA 3FUHA 5CBNA 1M62A 2DIWA 2W62A 2EHOA 4EPZA 2XRYA 3QB2A 2G0UA 2YHEA 4CZZB 3MKQA 2FJEA 2BKKB 2CBIA 5HI7A 5A7DB 2ZISA 2VSNA 1IBKT 3CHOA 3G2TA 4ANJA 4QHOA 4UVBB 3IXEA 4PUCA 3CX8B 1KNZA 4IDNA 2FJAA 1EDUA 5JDFA 5LX8A 2QGSA 4JLEA 1OT8A 3PJAJ 4QQIA 2BDEA 2RFMA 5FL0A 4YFSA 3PNLB 2CXFA 3BQOA 2V6YA 4H7YA 3AJIA 4HOQA 5FZQA 5KDMC 3HDXA 5HEOA 2XAQB 3ZMSB 1LKXA 5HS0A 3KINB 3EDVA 2CBJA 4Q69A 3AEFA 5AAOA 3L39A 5CB4E 3ABVA 3C3OA 5BV0A 3CEQA 4FLBA 3AE9A 1N9AA 4U8VD 2QZAA 3DSSA 3C64A 4YSXA 2UXCT 3RRCA 2J4BA 1FEWA 2C5IT 1ELKA 2NTXA 3ZPOA 5LHGB 4I9CA 2VURA 1DC2A 4E85A 4H9QC 5DJQC 4YSYA 3N9LA 3RYHE 4DUIA 3IBEA 4P1NA 4YVQC 3MA5A 1FMVA 1ZV4X 5B1AE 3WAJA 3E30A 4BERA 3E33A 4JI8T 4PH4B 3UU4A 4QFVA 2LHRA 2XCBA 5FXWA 2LSVA 4N3AA 3P8CD 3DBSA 3QKYA 5JDLA 3C51A 3N2KE 3CK9A 4JB8P 2KINB 1BLXB 3RU0A 3DXKG 5EK2A 3KS2A 3B57A 4U0UA 3B5MA 3JAEA 2ODVA 1H2VC 3IEGA 2BBJA 2LJLA 3P4PA 3JXIA 1HG5A 3DWLG 3I4RB 2C5JA 3BQKA 4G8LA 1N4PA 3R7QA 3G06A 2DZOA 4TXQA 5E0OA 1OEDA 3ZN1B 4QWNB 4U7IA 3I5PA 2RD0A 5D2MC 2Q9QB 3EUVA 4ATGA 4UWGA 5L3EB 4TXPA 2WMNA 4DV1T 5ADXL 3ZC1A 1S35A 2LAIA 4OHFA 5KJLA 4OAUC 4P0BA 5FIOA 4KVOA 3QC9A 1XMOT 2FF4A 5L4HA 2ETCA 4JI7T 4ZHQE 1N94A 3C3QA 2UU9T 3JCFA 4PJLA 1D1BA 3UQ4A 3T9KA 4ZEYA 5LB7B 3UIPC 4CRWA 2KLQA 3TG5A 2NSZA 4KBMB 4DBRA 5ENNA 3JC6D 2CLYB 3TWSA 4K0UA 2KXPB 3EABA 4CDMA 2V7MA 2CHNA 3PUQA 2V26A 3ZEFB 4TXRA 5C3JA 4GCOA 3RPUA 3L08A 5ENOD 1N95A 4FI5A 3OXLA 1FVFA 1QBQA 5L3CB 3SY2A 2ODUA 1SUMB 4EXTA 3C50A 1ZBPA 2IJGX 4CT4A 4D10C 1HNWT 4WYVA 4KHPT 4ANXA 5CCMA 4AISA 4V3IA 4CDRA 2BG9A 4JHRA 2OV8A 4CYMD 3P4WA 1MMNA 3MJXA 4DR4T 1RZ4A 4NACA 4EIWA 2AE9A 1LRZA 4IIJE 2WXQA 4OYSA 2VKOA 4QXBB 2QYJA 3TWWA 2IC6A 2GRQB 2WZIA 1L0VA 2OOEA 3WXXA 1J1JA 4LMJA 4GZ6A 3HG0D 4CZ2D 4DX1A 4IRUA 3UT7A 2CXDA 3W15B 4CN1A 3HKBE 3SRZA 3V5UA 5LGUB 4GYYA 3I1AA 1O5MA 2VK9A 4RQIA 2H89A 5ARFA 3AA1B 2DI4A 5JDMA 1D0YA 3AXJB 3QNUA 2L0IA 3NWIA 3LBXA 5EILA 5AQ9A 4ERRA 3URZA 4JUYA 4IULA 5C8YE 3L82A 3ZYLA 4GZCA 2KCKA 2HH7A 4UF0B 2KZTA 3P4RA 1ZEEA 5ENSD 2X0HA 5AENA 5AQTB 3S7JA 1OEDE 3TWQA 5ENRD 3FZHB 1VRBA 1FJGT 1FT1A 1TR4A 4KT6B 3T5XA 5ABFB 2PNNA 2Y4UA 5JH7E 2VSXE 4J8DA 1BR2A 3D9MA 3G2UA 2LKGA 3FUDA 1ZOYA 5FQ7A 5A23A 2W4XA 2PG8A 4E7SA 4NIKA 2VQFT 2X6HA 2V8SV 3EIQC 1UCUA 4Z91A 3S4UA 4IT4A 4ILUA 3LFMA 3G2SA 5AQMB 4GYRA 1WM5A 2CFZA 3HXFA 2HN2A 3CVVA 5L3GB 4COFA 4HOUA 2VGEA 5CA1E 2YKSA 3AS4A 3TWUA 4G11A 2UXNB 3CKDA 5J90A 5AQGB 2Q9QC 2H7OA 2DHRA 5T4YA 4GTRA 2WXOA 4BY6A 5B3SE 2XUEA 2KSRA 1LVFA 3ANWA 2BBHA 5FY7A 3AE6A 4GMJA 4AXHA 4EZLA 3RIUA 4KZ0A 3Q5WA 2WB2A 3U3IA 4APFA 2WU2A 4GA1A 2V7LA 2W0GA 2XZEA 3FFLA 3QWVA 3Q79A 4MHCA 2CLYC 2DCFA 4IREA 2KXPC 2LO6A 3L8RA 4Y6WA 2VKJA 3R7RA 3RO3A 2XASB 3FUJA 3O4ZA 4U2ZA 4JEHA 4L7TA 4LFBT 3AVSA 3ABLE 2VL0A 4DR3T 3Q9NC 4QXCB 4G1TA 4J8FA 2LHNA 3RF1A 4I43A 4J2CA 3KEZA 3L13A 3LG7A 3U66A 2P2CP 3C98A 3AE7A 5FYMA 5LCWJ 3PE4A 4PK6A 2DL1A 2IF4A 2R6GF 5JJTA 5J2TE 4AV7A 3UTKA 5LCWC 3E4BA 3U64A 1ZB1A 3ZHEA 5F3JA 2DWGA 5KBAA 2WDVA 5HWXA 2MHKA 3U4TA 4ACLA 4E6HA 5FQ4A 4MLPA 2R2LA 3ZCIA 3GZ2A 4IHJE 1MX4A 2FI7A 1N0RA 5LBMA 4AY6A 4A5XA 3AECA 2IY0C 1O1TA 1UUSA 3L9TA 2WAUA 4A3VA 3TL5A 3L54A 1QSDA 1N34T 1OWPA 4B89A 2JJ9A 1W09A 5LOVE 3QOUA 3RK6A 1SZ9A 1OUVA 2C5KT 1UX4A 1IXVA 4YDEA 3ZFWA 2QC9A 3V31A 5L47A 3HKDE 3ZT5A 1HX1B 3NRYA 3B7TA 4G24A 5G55A 3D9LA 5C2YA 3UMVA 2PQNA 3CLJA 4KZCA 3CWZB 3K8PC 3IHRA 1LTXA 4AXPA 3LY7A 4DJAA 2WQHA 2QRXA 4XI0A 4KMCA 3CVYA 3EHZA 3AEEA 3N5LA 5FTPA 2LSUA 2R5SA 1OXJA 3AEGA 3ETUA 2CCQA 3VKHA 4JEUA 3AG3E 3TGOA 2PJQA 5LHIB 1WYCA 2X6JA 1UURA 1BR0A 3QWPA 4EYUA 2V6XA 3ASNE 5LG4A 4F6RC 2BVMA 1ZU2A 4B94A 3ZYMA 4LNGA 1SQMA 4TNVA 2XCCA 3HHMA 3PUKA 2OA5A 3PEUB 3K3NA 2X66A 1N4RA 4KVMA 4TUUA 3AE3A 2LRKA 3HKEE 3KAEA 2MYSA 1TN8A 4K0KT 4H9OC 1NI1A 2LXLA 3FXEB 3Q5DA 2UXDT 4LFCT 3LCAA 4UV8B 4YSZA 3T8KA 2LM9A 2XS1A 2IO2C 1WR6A 3ISMC 2C0LA 3TG4A 5EN5D 2NW7A 3AG4E 4H9NC 1H2TC 5JDHA 3E32A 2WXIA 2NW9A 4AKRB 1BI8B 5JJ7A 4U8YD 3QNKA 2XSAA 3FB2A 3SFEA 1B7TA 3C72A 4EEDA 2CE7A 4RVBA 2ETAA 3VTYA 5JHBA 2VL8A 1BD8A 3HKCE 4HBDA 5LXTE 2HM8A 3ABME 1TNBA 4LRZA 2Q9QD 1SA0E 2Y69E 3D9KA 5T3RA 2FBNA 2YDSA 2XEHA 3ZW3A 3EHMA 4JL0A 4BAYB 4PDXA 4OK0A 3KSLA 4LF4T 1KPSB 3CVLA 3FH7A 2Q7FA 3PRZA 2E2EA 4FC8A 1WCRA 1HR0T 3ASGA 3TWTA 4KBQA 4YJ3E 2EQXA 2OEVA 3JADA 2XPIA 3PDYA 2VTBA 3APDA 3EU5A 3S7FA 4DNDA 2K3WA 5KNGA 1H6KA 1T98A 3LJCA 1QUUA 3UPVA 3TWXA 4GMRA 4A1SA 3ZVVA 3RYFE 4CI1B 3AEBA 1IQUA 1SVXA 3ULEG 2KT9A 1WLXA 3RKOA 3PE3A 5AQLB 4BSZB 3QB5K 1MMDA 3ZN3A 4O6FA 2WXGA 5JRCB 3N71A 3NZQA 4UI9J 5D0QD 3SD5A 1OCCE 4GA0A 1WAO1 4NPPA 2YINA 3CIAA 3B7RL 5H6RB 2WQ7A 3RQUA 3N9NA 3ZMZB 3MZLB 4HWDA 2WXRA 4UQZA 2VKDA 2J08A 2P9IG 2VGXB 4U33A 1OWLA 2Y3AA 1AP7A 5KJKA 4U7YA 5J0ZA 1YKEB 2EHOB 2OEWA 5CEDB 3MKQB 5G04J 3MX3A 3MK7C 1RW2A 2WXJA 1CHUA 2RPAA 5LYJE 1D8DA 3QOFA 1NENA 2A5EA 2P9PG 2DWKA 4I6JA 4XKBA 3D9OA 1KLXA 2ZM0A 2LSYA 4X1YE 1INZA 1R8IA 2HYZA 4O1PA 4UQYA 5ARGA 3Q78A 4BJNA 2WQYA 2V6YB 2XGSA 5L3BB 1IJ6A 4LNBA 3B7BA 2IEJA 4DR2T 5LP0A 4PS7A 4U7EB 4FHJA 5LG3A 3Q47B 4HWCA 3UFEA 1JPLA 1E8XA 3F2EA 4GTSA 3FZKB 2C0MA 4JI1T 4IN3B 2BS4A 3RRMB 3OJAA 3CK8A 1Z3XA 5M4YA 3ONKA 2XPKA 2DWZA 4FULA 4O60A 3ZXPA 1IHGA 2DZNA 2H6IA 1BR4A 4ZOLE 5FINA 5EDSA 4NQ0A 3CV0A 4UEMA 1OCRE 2KM4A 3ASDA 2DNXA 3PUSA 3CVQA 3AS8A 1X79A 5ITZF 2LEHA 2SPCA 4WBNE 2W63A 2NOXA 2RKKA 1N52A 1OY3D 4FJZA 2BS2A 4F6RD 3GN5A 1N4QA 4M3OA 1BI7B 3JUIA 4C9BB 4HE8A 4K5BA 2IHR1 2I6HA 4QX7B 4EB6E 2IAKA 1JNRA 5LNKA 1OWOA 4NURA 2RP4A 3DPYA 1W0AA 3PUVF 4DV0T 1IAPA 1DVPA 4DV4T 3BK9A 5F5WA 1SA5A 2WXNA 4NRHB 3MEKA 5C1DA 4ILAA 4A1GA 1W9RA 5AQVB 1FCHA 2X9WA 3TKLB 2KNDA 3PNTB 3ZKRA 5HXHA 3CVPA 3FUKA 2Y8DA 3CQCB 3Q15A 2M6IA 4LSZE 3UU8A 5FY1A 4PW8A 3PJAA 3ZN0B 3MV2B 5DQWA 4U72A 4YTMA 4XKCA 4OYKA 4C91A 4AJWA 4JXTA 4H9SE 3DP7A 5BMVE 5KMGP 3MCXA 3D3MA 1OEDB 4OX9T 2KZ7B 3JXJA 1D1AA 2A3DA 2VQ2A 3ZLIA 4KX6A 3BQIA 3JUEA 4DX7D 4W9RA 3FXDB 2ETBA 3MV3B 5ENQD 3DJBA 4Q94A 2V5CA 3P7IA 2V7JA 3APCA 4X1IE 5BUZA 2LSJA 3LVRE 2D0UA 3UM1A 4B8AA 2XQ0A 2WXMA 3RHWA 4JHKA 1BPOA 4JV5T 1HG2A 2ILRA 1ELRA 4JBWF 1SE7A 3W9GA 2WPVA 4QX8B 2XQ4A 2IW5B 3KV5A 4MFRA 4U95D 2XPYA 3D9PA 3AE8A 5CJ5A 2BS3A 2WBLA 3RIFA 3ASHA 4DR7T 1JCRA 2EHOC 1HX8A 2YHCA 1TNOA 3AG1E 4MLKA 4FADA 4KMOA 2X6FA 1SZAA 2K5BB 3VR8A 5J2UE 4B0ZA 1UN9A 5HCJA 1U2VG 4JYAT 2J62A 3MACA 4A97A 4DR5T 3UUNA 2Y6XA 4UWFA 3B13A 2BG9B 5BW8C 2WWVA 2A2FX 1K1BA 3S7BA 3P2BA 4HFBA 3OTNA 4K5CA 3H37A 3KFWX 4L9IA 1T72A 3TLWA 2P9LG 4LCTA 5AQAA 4PNIA 4HS2A 3OBVE 3L3PA 3P50A 4NXNT 1TYQG 4F8HA 4GOUA 4TX5A 4KYOB 1TN7A 3AE1A 2IIUA 1U4QA 1NEKA 2CHWA 5EIDA 2QVAA 3LBXB 2JMKA 3FUMA 1FPPA 5AJLA 4GAAA 1YD8G 4IGUA 1IBMT 1H6OA 2WM9A 3CX6B 5AQNB 3ESKA 1WYBA 4PS3A 4YT0A 3UFGA 3DXMG 2KZTB 3NBNB 3F31A 3PE0A 1N0QA 3BQLA 4AP2A 3ZPJA 3N9OA 2E0IA 1VCSA 4AY5A 3MKDA 3R6NA 2GK9A 1UX5A 1XNQT 3SFYA 5BT1A 4XAXB 4L9PA 4JA7A 4AKIA 4G63A 3VLFA 4GZ3A 5ANLA 2E9XA 4JI6T 5FWQA 4RLYA 3SZ7A 2N2NA 3GWHA 4AKHA 3QARA 4LF5T 3UULA 4YHJA 1MX6A 3EHNA 1QQEA 4B6XA 4LF9T 3NBXX 3ESLA 4JW1A 3K3QC 1E7PA 4JVSA 5BXOA 4DI3A 4HFCA 3CKBA 4TV3A 4FA6A 5IWAT 4DX2A 4JC8A 3SOLA 2XQ8A 4TV8E 4HLEA 2BUGA 2WCAA 2IONA 4LF8T 1OEDC 2DCPA 2IOSA 4FJYA 2OVFA 3GA8A 3T8OA 3QB5A 2HHHT 3EI0A 3LPZA 3FDHA 3AAIA 1I6ZA 5FVLA 1D0ZA 5IUXA 3J9X1 1QLBA 1O1RA 5KNHD 3ANWB 2CRBA 2X3MA 4WW0A 2Z6EA 5LA6E 4ZZCA 4XX5A 1HS7A 3ONJA 3QC1A 4YDOA 4AQYT 2W2UA 1JUQA 1VDYA 2V4HC 2XQAA 2NC9A 2XS8A 1X9BA 4WNDA 1S94A 2M63A 3FTWA 3QK6A 2JQ9A 4EZHA 4ZI7E 5AQBA 4TUYE 4U96D 3CHRA 4WAFA 3I4GA 4X62T 4Z68A 3I9YA 4UI9K 1H2UA 1WG0A 1GW6A 5JQGE 1XDPA 3I3NA 1SHZC 1PC2A 2PM7A 3F6QA 1NA0A 4ME2A 4I43B 3L17A 2JABA 3LS8A 3FU0A 3LXUX 2A9UA 2X9HA 1E90A 3ZCJA 3HL6A 2AXVA 2M6BA 3SNXA 3RRUA 4P09A 4HFHA 5FL1A 2IO3C 3C98B 3EU9A 4C48B 2F0YA 3PUYF 3FU3A 4HFDA 2BG9C 4J7WA 2VASA 4PAGA 3UU5A 4A63B 4F1SA 5L4EA 4DUZT 2NR4A 3CSTA 3ZHEB 2B1EA 1LD7A 2FJBA 2I1KA 2XQ7A 4DLOA 4I50E 2P9NG 3LJ3A 4GZDA 4CDNA 3PVLA 4UWHA 3SGHA 4IYPA 5AJDA 4XZ4A 4BTBA 2EHOD 3ZT7A 4I1MA 1MMAA 3CK6A 4FJOA 2W66A 3ZYKA 4U0SA 3V30A 2XGOA 3LK3B 4CXWA 5F8PA 5J1GA 3CIRA 2WY2A 3X2QE 4DR6T 3UM0A 3LK42 4CGWA 5HXEA 4HI9A 4DI4A 3ETVA 4F1PA 4HFEA 3UX4A 2XRZA
chains in the Genus database with same CATH topology
4Y6CA 2XAHB 1US7B 3UUXA 3RKVA 5G2NA 3B7UX 4CT0A 1LF8A 4ISSA 2L9BA 4IE0A 4PJNA 4GK0E 5JDQA 3FTSA 4MS6A 3MZKB 4EZ4A 2KCLA 4ZI2C 4AI6A 3H3AA 4ILIA 5KCMA 2A5UA 2ONDA 4JEUB 4JZYA 4U04A 2BF0X 3MJWA 2KC7A 3FTZA 1OXZA 4BA9A 3RO2A 1WY6A 4U74A 4GZ5A 2NWBA 5CA0E 4Q96A 4AM9A 3SI5A 4A55A 3VHLA 3AAEB 3UT5E 4DO0A 3SBTB 3FU5A 3NZSA 2JPFA 4I1OB 2XEVA 5LJNA 3MA9A 5FQ8A 4TN7B 2WXHA 1H0AA 4ADZA 3FBLA 2UY1A 5FNVE 2I1JA 2XAFB 4URKA 3D0TA 3ASFA 4G2AA 4FP7A 3E0ZA 3AS5A 3ZMVB 2W00A 2QA7A 2GGFA 4O2AE 3P1UA 2LE8A 4FU3A 3KV9A 2BTDA 3EDTB 5HXCA 1HH8A 2X0LB 5JVDE 4AKGA 4C0EA 2VTBB 3NQPA 4L1BA 2QFCA 4U8HA 5DABA 4UV9B 3CQGB 4F3VA 2MOZA 4IE7A 4I9EA 2XHEA 4GYSA 4AKLA 2DBAA 3Q2MA 1PY1A 3LDZA 4JA9A 2A4ZA 3I9WA 5A1LA 5JR9A 4DK5A 4LEUA 3PREA 4J0UA 1MQSA 3SF4A 3ULQA 2WSSV 2X51A 3O1JA 4AEZC 3E22E 1YKHB 3APFA 3OAWA 2ACXA 2YU1A 3B7SA 1WRDA 1U3DA 2WXLA 1EYHA 4K03A 5LP6E 3FU6A 3ONXA 3UQ3A 1TEZA 3PDNA 1Y8MA 3L22A 4PS8A 4CGVA 3O9XA 1KT0A 1OWMA 2LT3A 4N78D 3IHVA 3IF8B 1IYGA 3QK0A 1YA0A 4ILGA 1H7CA 2CG3A 3VTXA 1E8ZA 3ONLA 2I2OA 1OWAA 1UW4B 3FUEA 3G2WA 4ZI2D 4N2SA 3FH8A 2X9YA 2FEZA 4N3CA 2C2LA 2X6KA 2CMRA 3I0OA 5BPPA 3AVRA 4GK5E 3GN5B 2CFUA 3ENEA 3JYSA 4L5GA 4GA2A 3BG1B 4ANWA 2HPJA 2FO7A 2WQ6A 3HVEA 3BG0B 3AU4A 5AFUL 2CG2A 3QWWA 3SBSA 4H63V 2BVLA 1PAQA 4ZI3C 3A5XA 4IDZA 1O3XA 3R9AB 3FH5A 2ZU6B 1NA3A 1ZKEA 4HFVA 3IKOB 4BSXA 4ISTA 3RRNB 4WNGA 4AQFA 4CI2B 1UJJA 2V5FA 3L6AA 4HVBA 1MNDA 3RJVA 2VWAA 5HAXA 5D0OD 4BWRA 2YNQA 3ZRHA 4XZCA 4UWKA 4O8SA 3FEYA 4CXXA 1YW0A 2LAHA 4DBQA 3VKGA 4TV9E 3CVXA 4J8EA 2VKHA 3LVQE 3KDSE 2L0TB 5JHAA 3N2OA 3TJPA 2H3RA 2D5UA 3MXZA 2H7VC 3F57A 1EZ3A 2I9CA 5J08A 2CHZA 1MIYA 3O4XE 4G2VA 5EK3A 4HOSA 4EAHA 2VSOE 5G05J 3I0QA 5IHYA 4P0AA 2X68A 4KUMB 1S0PA 5G05C 1D1CA 3PU8A 5HWYA 5IYZE 4A3TA 4CXYA 4JHJA 2L9QA 3ZGQA 4B8CB 5KJNA 4N2QA 4QXHB 4J6IA 4TZ4C 3KBTA 2MBGA 2J07A 3OYXA 1AJ3A 5DBKA 4ZS2A 2J49A 2QY7A 2WXFA 3CKCA 1HCIA 4KP3C 3FEXA 4ABNA 1Y64B 4XBFB 4IE5A 1MNEA 1MIWA 2X67A 3NRXA 3FUNA 3GYZA 4EYYR 3FULA 5HXRA 4CEMA 3WI3A 3CPZA 4NUVA 1QNFA 3N9QA 1X5BA 4AOFA 5BNWA 3UUMA 4K0RA 1DNPA 4UWLA 1N54A 4HKAA 4WNFA 3CVNA 4XI9A 4C0MA 3JQ1A 4HFGA 2IFUA 2E9XB 2D2SA 3V5SA 3OYZA 5ETWA 4PJJA 2Y4TA 3CK7A 4BT8A 3CHQA 4WUYA 2L8KA 1BR1A 3N9PA 3IBPA 3PURA 4BFRA 3N9MA 3OXGA 3CR3A 4EECA 4OYJA 4EZJA 3ZJ1A 3FHNA 2A72A 3PUAA 5KX5E 4KXKB 5FT9A 1ZHCA 3GZSA 4G23A 2Y48B 4PJMA 5LCYA 1NWMX 4ZI3D 2CA5A 1LVKA 3CGHA 2AVPA 3TXMA 3AA7B 1FIOA 5GONE 4YVOA 4BX9A 2AWIA 3GMIA 5FP3A 5L3FB 3RX6A 5E75A 4WWOA 4HGAA 3UT4A 5EX0A 2VSYA 4LUNU 2X38A 1FVHA 1U3CA 2LNIA 4ANUA 5LJMA 3IEEA 2J9QA 1NP7A 3D9JA 4ILHB 3L16A 1W3BA 3PEVB 1VOMA 2AXZA 2R17C 2M67A 3KV6A 3GZ1A 2PZIA 3EVYA 3TXNA 5LGTB 1HS6A 5KJMA 3U3WA 1UG3A 4ANVA 4I55E 3T5VA 4IE4A 3VLEA 2YEVC 1XNFA 4GIWA 1A17A 4OVVA 1MIVA 2GW1A 5EKQD 3KV4A 4GU5A 4AIFA 5FXVA 3KBUA 5ANRA 3UUXB 4CCAA 5HXSA 1NAFA 3ZMTB 5EZYE 5H6QB 4UQXA 3MGBA 1KT1A 3Q4AB 5FQ6A 4HXIA 5AIJA 1L5JA 4F53A 5LBQB 4EOZB 5JDGA 1XGWA 3ZC0A 3QJZA 5DIZA 3ML8A 3KD7A 4EQFA 1TJCA 3HI2A 1D0XA 4AVXA 1HE8A 3T8MA 2E9XC 3IHYA 2R59A 5AYWD 2CWOA 2XTLA 2WMOA 2V4LA 3FTUA 1E1HB 3NZPA 3FWVA 4TRQA 2PBIA 4JEHB 3D9NA 3OXFA 3FBZA 2YQ8A 2LOSA 3EUHA 2VYIA 4XIFA 3C4ZA 2V7IA 5LFAA 1TJFA 3Q5XA 4CQIA 2XGMA 2LSIA 5DQVA 4FLHA 3Q49B 4WNKA 2W61A 3CX7B 3RIBA 1HXIA 2LOPA 3R84B 3QDNA 2ZM2A 2JRKA 3NZUA 4M1PA 2J4DA 4QKNA 2LSGA 5HYAA 4N5CA 4G26A 3LKUA 4U07A 2UY1B 2Q9QA 2J09A 5HQ8A 4BX8A 2VGYA 4EBAG 2NTYA 2KCVA 2HR2A 4LERA 1MHQA 4I2ZA 3CHPA 1EF1C 3FTXA 3S7DA 1KK7A 2MRIA 3SFZA 2NP9A 3CSFA 3PUGA 3JCKC 3ZEFA 4N39A 3QUJA 1HTJF 1HFAA 5L2LA 4H7XA 2XHEB 4XE0A 1ELWA 4H9PC 3Q5MA 4I1AA 4JPSA 1MMGA 3AB3B 2KMFA 3JQ0A 4EZKA 5LHHB 5JR9B 3AA0B 2E8IA 2L3LA 4F7AA 4HORA 2CWYA 2WXPA 1IZNB 2K48A 3M65A 4GPKA 1V9DA 3O48A 2AXUA 5FXZA 2MOWA 2NXPA 2LSKA 3UT8A 4GYOA 2ZMAA 1HZ4A 1QZ2A 4YLHA 4UF0A 3QAQA 4HTEA 4FHKA 4WWPA 3D9IA 4OFZA 3OKQA 3RYIE 3MYVA 2IC9A 4C90A 4L23A 5LGNB 2CEAA 3K3OA 1Y6IA 3AU5A 2RA1A 4UVCB 3PU3A 5JDNA 4L0RA 5EX3A 1FMWA 3FY4A 4G25A 4N3BA 2HPLA 5JJ6A 2I59A 2E9XD 5L3DB 5T8IA 4OVUA 2XAGB 3LK2B 2PM6A 2RG8A 2VJ8A 5FMNA 4I6EA 3CVRA 5FZSA 4I2WA 2FULA 4YJ2E 3KVAA 1HO8A 1CUNA 3HIZA 1UN8A 2CM0A 4NUUA 3S2AA 2IOLA 3HVEB 3O1HA 4UVAB 5CCLA 2X9XA 3FHEA 4MALA 1E7VA 2V8SE 3DPDA 2N1GA 2IU1A 4MRUA 3ZXSA 3FTYA 4MBQA 3E08A 2L6JA 3BEEA 2J1DG 2CXLA 1NZNA 5JREA 4DVDA 4UELA 4O2BE 4U0ZA 3TAXA 1P5QA 2ZM8A 2C0SA 1IQRA 2WXKA 1IJ5A 2XQYA 5M72A 5FZRA 4ZS3A 2UWJG 3HYMB 2K9AA 3Q9DA 2P58C 4GYWA 4H9RC 4L2LA 3LYAA 3AAAB 5JR9C 4PFPA 3O1IA 4RSYA 2V7KA 4UIGA 3ZJ2A 1E96B 2KWHA 3C4XA 4GMLA 4I17A 2CHXA 3CHMA 4MKTA 3CMLA 3GW4A 3RC8A 3FUFA 4A56A 3RYCE 1HU3A 2PQRA 4U63A 2MTQA 4V1Av 1OWNA 5FJYA 3DTOA 4WWNA 4YNDA 2WWUA 2P9BA 2PFVA 4DMVA 4AQGA 2JEKA 3ZYQA 4RG6A 3C4WA 2KATA 1Z3YA 2V1DB 4I4TE 4X1KE 3PS6A 3K9IA 3PUJA 3PH0C 3EIJA 1Z0PA 3EDUA 2JLBA 5CMWA 2BZBA 3HA4A 5A6CA 4EBAA 3KVBA 3ZIMA 5BV1A 1E8YA 4UI9C 4IE6A 4ACKA 3L09A 2KWIB 2UXXB 1HF8A 3PZDA 4L2YA 2ES0A 4BT9A 3G2VA 4PK5A 3HR0A 2GRMA 3AA6B 4CI3B 2OVBA 5CHEE 4P29A 4WBOA 4DMWA 4DPRA 1JWFA 1UJKA 4ASKA 2WVIA 5G04C 1E7UA 5LOZA 4RG9A 3LY9A 2HO1A 4APOA 2NW8A 3LEWA 3U78A 4O4HE 2D0TA 4DLQA 3WAKA 3NF1A 4AQFC 2IQCA 5EK4A 2AW6A 4HN9A 2N9DA 2ZLYA 3CVUA 3CVWA 3CHSA 3LY8A 4Z8XA 5E76A 4X20E 2JQQA 3SS1A 3MKRA 4BJMA 1G73A 4E7ZA 3ML9A 2VB6A 3FTVA 4PFOA 5FY0A 4O4LE 3RH3A 3ZMUB 3FP3A 3FUIA 2GRLA 3U9WA 2DLRA 4PK4A 3VLDA 1EPUA 2V0PA 2YU2A 2JMHA 4O4JE 1Z6TA 2K24A 3JC6C 4O4IE 3RRWA 1E8WA 3VU7H 4R7LA 5CMYA 4UXNB 2XPZA 2PL2A 5FXXA 4BTAA 4I6GA 4H63H 5TAOA 1G8XA 3N2GE 3J7Yq 2YK0A 3CQXC 4GB9A 4HEAA 1U5PA 1B89A 3RC3A 4GCNA 3SWHA 5JRCA 4WNEA 3IV0A 1JWGA 2XAJB 3EJNA 1H19A 2VGXA 2X6IA 3SHFA 4HOTA 3PTRB 4J8SA 3FUHA 2DIWA 2W62A 2EHOA 4EPZA 2XRYA 3QB2A 2G0UA 2YHEA 4CZZB 3MKQA 5HI7A 5A7DB 3G2TA 2VSNA 3CHOA 4ANJA 4QHOA 4UVBB 4PUCA 3CX8B 1KNZA 1EDUA 5JDFA 5LX8A 2QGSA 4JLEA 2BDEA 4YFSA 3PNLB 2CXFA 4H7YA 4HOQA 5FZQA 5KDMC 3HDXA 2XAQB 3ZMSB 1LKXA 3KINB 3EDVA 4Q69A 5CB4E 5BV0A 3CEQA 4FLBA 3C64A 3RRCA 2J4BA 1FEWA 2C5IT 1ELKA 2NTXA 3ZPOA 5LHGB 4I9CA 4E85A 4H9QC 5DJQC 3N9LA 3RYHE 3IBEA 4YVQC 3MA5A 1FMVA 1ZV4X 3WAJA 4PH4B 4QFVA 2LHRA 2XCBA 5FXWA 2LSVA 4N3AA 3P8CD 3DBSA 3QKYA 5JDLA 3C51A 3N2KE 3CK9A 2KINB 3RU0A 5EK2A 3KS2A 3B57A 4U0UA 2ODVA 1H2VC 3IEGA 2LJLA 1HG5A 3I4RB 2C5JA 3BQKA 3R7QA 5E0OA 3ZN1B 4QWNB 3I5PA 2RD0A 2Q9QB 4ATGA 4UWGA 5L3EB 2WMNA 5ADXL 3ZC1A 1S35A 2LAIA 4OHFA 5KJLA 4P0BA 4KVOA 3QC9A 2FF4A 4ZHQE 4PJLA 1D1BA 4CRWA 2KLQA 3TG5A 2NSZA 4KBMB 4DBRA 5ENNA 3JC6D 2CLYB 4K0UA 2KXPB 4CDMA 2V7MA 3PUQA 2V26A 3ZEFB 4GCOA 3RPUA 3L08A 4FI5A 3OXLA 1FVFA 5L3CB 2ODUA 4EXTA 3C50A 1ZBPA 2IJGX 4CT4A 4D10C 4ANXA 5CCMA 4V3IA 4CDRA 4JHRA 2OV8A 1MMNA 3MJXA 4NACA 4EIWA 4IIJE 1LRZA 2WXQA 4OYSA 2VKOA 4QXBB 2IC6A 3WXXA 2OOEA 4GZ6A 4IRUA 3UT7A 2CXDA 3W15B 3HKBE 3SRZA 3V5UA 5LGUB 4GYYA 3I1AA 2VK9A 5ARFA 3AA1B 2DI4A 5JDMA 1D0YA 2L0IA 3LBXA 4ERRA 3URZA 4JUYA 4IULA 5C8YE 3ZYLA 4GZCA 2KCKA 2HH7A 4UF0B 2KZTA 1ZEEA 5AENA 3S7JA 1VRBA 4KT6B 3T5XA 2Y4UA 5JH7E 2VSXE 4J8DA 1BR2A 3D9MA 3G2UA 3FUDA 5FQ7A 5A23A 2PG8A 4E7SA 2X6HA 3EIQC 1UCUA 3S4UA 4ILUA 3LFMA 3G2SA 4GYRA 1WM5A 2CFZA 3CVVA 5L3GB 4HOUA 5CA1E 3AS4A 4G11A 2UXNB 3CKDA 5J90A 2Q9QC 2H7OA 2DHRA 5T4YA 4BY6A 2WXOA 2XUEA 1LVFA 3ANWA 5FY7A 4GMJA 4AXHA 4EZLA 4KZ0A 3Q5WA 2WB2A 3U3IA 4APFA 4GA1A 2V7LA 2W0GA 3FFLA 3QWVA 4MHCA 2CLYC 2DCFA 2LO6A 4Y6WA 2VKJA 3R7RA 3RO3A 2XASB 3FUJA 3O4ZA 4JEHA 4L7TA 3AVSA 4G1TA 4QXCB 4J8FA 2LHNA 4I43A 4J2CA 3KEZA 3L13A 3LG7A 3U66A 3C98A 5FYMA 5LCWJ 3PE4A 4PK6A 2IF4A 5JJTA 5J2TE 4AV7A 3UTKA 5LCWC 3E4BA 3U64A 3ZHEA 5F3JA 2DWGA 5HWXA 2MHKA 3U4TA 4E6HA 4ACLA 5FQ4A 4MLPA 3ZCIA 3GZ2A 4IHJE 2FI7A 5LBMA 4AY6A 2WAUA 4A3VA 3TL5A 3L54A 1QSDA 1OWPA 4B89A 2JJ9A 3QOUA 5LOVE 3RK6A 1SZ9A 1OUVA 2C5KT 1UX4A 3ZFWA 3HKDE 3NRYA 3B7TA 4G24A 5G55A 3D9LA 5C2YA 3UMVA 2PQNA 3CLJA 4KZCA 3CWZB 3K8PC 3IHRA 4AXPA 3LY7A 4DJAA 2WQHA 4XI0A 4KMCA 3CVYA 3N5LA 5FTPA 2LSUA 2R5SA 3ETUA 2CCQA 3VKHA 4JEUA 3TGOA 2PJQA 5LHIB 1WYCA 2X6JA 1BR0A 3QWPA 4EYUA 5LG4A 4F6RC 2BVMA 1ZU2A 4B94A 3ZYMA 1SQMA 3HHMA 2XCCA 3PUKA 2OA5A 3PEUB 3K3NA 2X66A 4KVMA 4TUUA 3HKEE 3KAEA 2MYSA 4H9OC 3FXEB 3LCAA 4UV8B 2LM9A 1WR6A 2C0LA 3TG4A 2NW7A 4H9NC 1H2TC 5JDHA 2WXIA 2NW9A 4AKRB 5JJ7A 3QNKA 3FB2A 1B7TA 2CE7A 4RVBA 3VTYA 5JHBA 2VL8A 3HKCE 5LXTE 2HM8A 4LRZA 2Q9QD 1SA0E 3D9KA 5T3RA 2FBNA 3ZW3A 3EHMA 4JL0A 4BAYB 4PDXA 4OK0A 3CVLA 3FH7A 2Q7FA 3PRZA 2E2EA 4FC8A 3ASGA 4KBQA 4YJ3E 2EQXA 2XPIA 3PDYA 2VTBA 3APDA 3S7FA 4DNDA 1H6KA 1T98A 3LJCA 1QUUA 3UPVA 4A1SA 3ZVVA 3RYFE 4CI1B 1IQUA 2KT9A 1WLXA 3RKOA 3PE3A 1MMDA 3ZN3A 4O6FA 2WXGA 5JRCB 3N71A 3NZQA 4UI9J 5D0QD 3SD5A 4GA0A 1WAO1 2YINA 3CIAA 3B7RL 5H6RB 2WQ7A 3N9NA 3ZMZB 3MZLB 2WXRA 4UQZA 2VKDA 2J08A 2VGXB 1OWLA 2Y3AA 5KJKA 1YKEB 2EHOB 3MKQB 5G04J 3MX3A 3MK7C 2WXJA 5LYJE 2DWKA 4I6JA 4XKBA 3D9OA 1KLXA 2ZM0A 2LSYA 4X1YE 1INZA 2HYZA 4UQYA 5ARGA 4BJNA 2XGSA 5L3BB 1IJ6A 5LP0A 4PS7A 4FHJA 3Q47B 3UFEA 1JPLA 1E8XA 3F2EA 2C0MA 4IN3B 3RRMB 3OJAA 3CK8A 1Z3XA 5M4YA 3ONKA 4FULA 1IHGA 1BR4A 4ZOLE 5EDSA 4NQ0A 3CV0A 4UEMA 2KM4A 3ASDA 2DNXA 3PUSA 3CVQA 3AS8A 1X79A 2LEHA 2SPCA 4WBNE 2W63A 2NOXA 1N52A 4FJZA 3GN5A 4M3OA 4C9BB 3JUIA 4HE8A 2I6HA 4QX7B 4EB6E 2IAKA 5LNKA 1OWOA 4NURA 2RP4A 1IAPA 1DVPA 3BK9A 2WXNA 4NRHB 3MEKA 5C1DA 4A1GA 1FCHA 2X9WA 3TKLB 2KNDA 3PNTB 5HXHA 3CVPA 3FUKA 2Y8DA 3CQCB 3Q15A 5FY1A 4PW8A 3ZN0B 3MV2B 5DQWA 4U72A 4XKCA 4OYKA 4C91A 4AJWA 4JXTA 3MCXA 4H9SE 3DP7A 5BMVE 5KMGP 3D3MA 2KZ7B 1D1AA 2A3DA 2VQ2A 3ZLIA 3BQIA 4W9RA 3FXDB 3MV3B 3DJBA 4Q94A 3P7IA 2V7JA 3APCA 4X1IE 5BUZA 3LVRE 2LSJA 2D0UA 4B8AA 2XQ0A 2WXMA 4JHKA 1BPOA 1HG2A 2ILRA 1ELRA 2WPVA 4QX8B 2IW5B 3KV5A 4MFRA 2XPYA 3D9PA 2WBLA 3ASHA 2EHOC 1HX8A 2YHCA 4MLKA 4FADA 4KMOA 2X6FA 1SZAA 2K5BB 5J2UE 4B0ZA 1UN9A 3MACA 3UUNA 2Y6XA 4UWFA 3B13A 5BW8C 2A2FX 3S7BA 3P2BA 3OTNA 4LCTA 3H37A 3KFWX 4L9IA 4PNIA 4HS2A 3OBVE 3L3PA 4GOUA 4TX5A 4KYOB 1U4QA 2CHWA 3LBXB 2JMKA 3FUMA 5AJLA 4GAAA 1YD8G 4IGUA 2WM9A 3CX6B 3ESKA 1WYBA 4PS3A 2KZTB 3F31A 3PE0A 3BQLA 4AP2A 3ZPJA 3N9OA 2E0IA 4AY5A 3MKDA 3R6NA 2GK9A 1UX5A 5BT1A 4XAXB 4JA7A 4AKIA 4G63A 3VLFA 4GZ3A 5ANLA 2E9XA 5FWQA 3SZ7A 2N2NA 3GWHA 4AKHA 3QARA 3UULA 4YHJA 3EHNA 1QQEA 4B6XA 3NBXX 3ESLA 4JW1A 3K3QC 4JVSA 4DI3A 3CKBA 4TV3A 4FA6A 4JC8A 3SOLA 4TV8E 4HLEA 2BUGA 2IONA 2DCPA 2IOSA 4FJYA 2OVFA 3GA8A 3T8OA 3LPZA 3FDHA 3AAIA 1D0ZA 3J9X1 3ANWB 2X3MA 4WW0A 2Z6EA 5LA6E 4XX5A 1HS7A 3QC1A 1JUQA 1VDYA 2NC9A 4WNDA 1S94A 2M63A 3FTWA 3QK6A 4EZHA 4ZI7E 4TUYE 3CHRA 4WAFA 3I4GA 3I9YA 4UI9K 1H2UA 1GW6A 5JQGE 3I3NA 1SHZC 1PC2A 2PM7A 1NA0A 4ME2A 4I43B 3L17A 3LS8A 3LXUX 3FU0A 2X9HA 1E90A 3ZCJA 3HL6A 2AXVA 3SNXA 3RRUA 4P09A 3C98B 3FU3A 2VASA 4PAGA 4F1SA 3CSTA 3ZHEB 2B1EA 2I1KA 4DLOA 4I50E 3LJ3A 4GZDA 4CDNA 3PVLA 4UWHA 3SGHA 4IYPA 5AJDA 4XZ4A 4BTBA 2EHOD 4I1MA 1MMAA 4FJOA 3ZYKA 4U0SA 2XGOA 3LK3B 4CXWA 5F8PA 5J1GA 4CGWA 3LK42 5HXEA 4DI4A 3ETVA 3UX4A 2XRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WMO A;  2WMN A;  3B13 A;  3VHL A;  2WM9 A;  2YIN A; 
#chains in the Genus database with same CATH topology
 4Y6C A;  2XAH B;  1US7 B;  3UUX A;  3RKV A;  5G2N A;  4N5Q A;  1MX2 A;  3B7U X;  4CT0 A;  3ULY A;  1IKN D;  3UI2 A;  2E5L T;  1LF8 A;  4ISS A;  2L9B A;  2KBX A;  4IE0 A;  2JQH A;  4PJN A;  4EEB A;  4GK0 E;  5JDQ A;  3FTS A;  4MS6 A;  4YHH T;  2BG9 E;  3P4S A;  5B1B E;  1JCQ A;  3MZK B;  3OTO T;  1XDO A;  4EZ4 A;  2KCL A;  4ZI2 C;  4AI6 A;  3H3A A;  2EIJ E;  4ILI A;  5KCM A;  4EGW A;  3OVU A;  4DV7 T;  2A5U A;  2OND A;  4JEU B;  4JZY A;  3T1H T;  4U04 A;  4YY3 T;  2BF0 X;  3MJW A;  2KC7 A;  4B3S T;  1OCO E;  3FTZ A;  1OXZ A;  4BA9 A;  3RIA A;  3RO2 A;  1WY6 A;  3HXD A;  4U74 A;  4GZ5 A;  2NWB A;  5CA0 E;  4Q96 A;  5AQ7 A;  4AM9 A;  1D8E A;  3SI5 A;  4A55 A;  3FZM B;  3VHL A;  1KFY A;  4IL4 A;  4HRM B;  1XZY A;  5H7P A;  3AAE B;  2H6G A;  3UT5 E;  3AXJ A;  4DO0 A;  4LG6 A;  1IBL T;  3RIU C;  3PUW F;  3SBT B;  1LD8 A;  3DEO A;  3FU5 A;  3NOG D;  3PUZ F;  1N32 T;  3NZS A;  2JPF A;  3ZUV B;  1K3Z D;  4I1O B;  2XEV A;  5LJN A;  1BU9 A;  4X65 T;  3MA9 A;  1NFI E;  5FQ8 A;  4TN7 B;  2WXH A;  1H0A A;  4ADZ A;  3UM2 A;  3FBL A;  2UY1 A;  5FNV E;  2EIM E;  2BED A;  2I1J A;  2XAF B;  1N4S A;  3UXG A;  2H6F A;  4URK A;  3D0T A;  3ASF A;  4G2A A;  4FP7 A;  3E0Z A;  2OV9 A;  3NOC D;  3UKU G;  3AS5 A;  5ABF A;  3ZMV B;  2W00 A;  2QA7 A;  2WDQ A;  2VVN A;  4YDW A;  2GGF A;  4O2A E;  3P1U A;  2LE8 A;  4FU3 A;  3UKR G;  3KV9 A;  2BTD A;  3EDT B;  5HXC A;  1HH8 A;  2X0L B;  4LML A;  5ABH A;  5JVD E;  4AKG A;  4C0E A;  2YN6 A;  1N36 T;  2VTB B;  3NQP A;  2AXD S;  4Z90 A;  4L1B A;  4JI2 T;  2QFC A;  2XZD G;  4U8H A;  5DAB A;  4UV9 B;  3CQG B;  3C3R A;  2MOZ A;  4F3V A;  4IE7 A;  2J4G A;  4I9E A;  2XHE A;  4CN4 A;  5CFB A;  4GYS A;  4AKL A;  2DBA A;  2VQE T;  2AJA A;  1GQE A;  3Q2M A;  1PY1 A;  3J5Q B;  3LDZ A;  4JA9 A;  3TLT A;  2ZXW E;  1WDY A;  2A4Z A;  3I9W A;  5A1L A;  2FJD A;  2FUP A;  5JR9 A;  4DK5 A;  4LEU A;  3PRE A;  4J0U A;  1MQS A;  3SF4 A;  3ULQ A;  2WSS V;  2X51 A;  3O1J A;  4AEZ C;  3E22 E;  1YKH B;  3APF A;  2WU5 A;  3OAW A;  2ACX A;  1YXR A;  2YU1 A;  3IA3 A;  3B7S A;  1WRD A;  4KHZ F;  1U3D A;  2WXL A;  2MYO A;  3PZ3 A;  5ABG A;  1EYH A;  4K03 A;  5LP6 E;  3FU6 A;  3ONX A;  3UQ3 A;  1TEZ A;  4CN6 A;  3PDN A;  1Y8M A;  2B76 A;  3L22 A;  4PS8 A;  4CGV A;  4HQD A;  2P9S G;  2HN1 A;  3O9X A;  1KT0 A;  2V5Q C;  3J5P A;  1OWM A;  2LT3 A;  4N78 D;  3IHV A;  3IF8 B;  1IYG A;  3X1D A;  3QK0 A;  1YA0 A;  5AQJ B;  3TLU A;  4ILG A;  4NXM T;  3TWV A;  2WDR A;  1H7C A;  2CG3 A;  3VTX A;  1E8Z A;  3ONL A;  2I2O A;  3VRA A;  1SW6 A;  4GTT A;  1OWA A;  5ABE A;  4J8Y A;  1UW4 B;  3FUE A;  3G2W A;  4ZI2 D;  4N2S A;  1V55 E;  3FH8 A;  2X9Y A;  2LUH A;  5AQO B;  2FEZ A;  3JAF A;  4N3C A;  2C2L A;  2X6K A;  4EHM A;  2CMR A;  3I0O A;  4YXD A;  5BPP A;  1DCQ A;  3AVR A;  4EV6 A;  4HLL A;  4GK5 E;  3GN5 B;  2CFU A;  3ENE A;  4ATZ D;  3JYS A;  5FVK A;  4L5G A;  2IDO B;  4GA2 A;  5ENP D;  3BG1 B;  4ANW A;  2HPJ A;  2D9D A;  2FO7 A;  2WQ6 A;  4GKJ T;  3HVE A;  2UUB T;  3BG0 B;  4GTM A;  4DX5 D;  3AU4 A;  5AFU L;  2CG2 A;  4IDP A;  3QWW A;  3SBS A;  4H63 V;  4IL9 A;  2BVL A;  1PAQ A;  2LM2 A;  4ZI3 C;  4ZZB A;  3EHR A;  3A5X A;  4IDZ A;  1O3X A;  1YQ4 A;  4X66 T;  3R9A B;  3FH5 A;  2ZGG A;  4ZXL A;  2RFA A;  1IHB A;  2ZU6 B;  1NA3 A;  1ZKE A;  4HFV A;  5D66 A;  3AED A;  3IKO B;  4BSX A;  4IST A;  3RRN B;  4WNG A;  4AQF A;  2WZH A;  4DV6 T;  4CI2 B;  1UJJ A;  2V5F A;  5LMU T;  3L6A A;  1T7S A;  4HB5 A;  4DRX E;  4HVB A;  1MND A;  3T1Y T;  4GKK T;  3RJV A;  3HXE A;  2UUA T;  2VWA A;  4Q25 A;  5HAX A;  5D0O D;  4BWR A;  2YNQ A;  3ZRH A;  4XZC A;  4UUC A;  2Y0B G;  4UWK A;  4O8S A;  3FEY A;  4CXX A;  1YW0 A;  2LAH A;  4DBQ A;  5CEC B;  1SA4 A;  3VKG A;  3Q7A A;  1YQ3 A;  5HCM A;  5AQF B;  4TV9 E;  1JCS A;  3CVX A;  4J8E A;  2VKH A;  1G3N B;  3LVQ E;  3KDS E;  4I0U A;  2L0T B;  5JHA A;  3N2O A;  3TJP A;  2H3R A;  2D5U A;  3MXZ A;  2H7V C;  4ILC A;  3F57 A;  1EZ3 A;  1DCE A;  2I9C A;  2YOE A;  5J08 A;  2CHZ A;  1MIY A;  4M7C A;  3O4X E;  4G2V A;  4BEP A;  5EK3 A;  4HOS A;  4EAH A;  2VSO E;  4LF7 T;  5G05 J;  3I0Q A;  5IHY A;  4P0A A;  2X68 A;  3DSX A;  4KUM B;  1DU2 A;  1S0P A;  5LMN T;  5G05 C;  1D1C A;  1T8B A;  2WP9 A;  3PU8 A;  5HWY A;  5IYZ E;  3NB2 A;  4CXY A;  4A3T A;  4JHJ A;  2L9Q A;  3ZGQ A;  4B8C B;  5KJN A;  3ZSS A;  3H3M A;  4N2Q A;  4QXH B;  4J6I A;  4TZ4 C;  3KBT A;  3PZ4 A;  3DSV A;  2MBG A;  2J07 A;  3OYX A;  2MPK A;  1AJ3 A;  5DBK A;  2EIK E;  4ZS2 A;  2J49 A;  2QY7 A;  4JI0 T;  2WXF A;  3CKC A;  3AE4 A;  4TWD A;  3NAW A;  3FZF B;  4HFI A;  1HCI A;  4KP3 C;  3FEX A;  4ABN A;  1Y64 B;  4XBF B;  4IE5 A;  1MNE A;  1MIW A;  4IDQ A;  2X67 A;  3HRA A;  3NRX A;  3FUN A;  3GYZ A;  4EYY R;  3BU8 A;  3FUL A;  4X5T A;  5HXR A;  3K1S A;  2XQ6 A;  4CEM A;  3WI3 A;  2XQ5 A;  3CPZ A;  4NUV A;  2PTF A;  3DSW A;  1QNF A;  3ZST A;  4GTV A;  3N9Q A;  1X5B A;  4AOF A;  5BNW A;  3RGL A;  3UUM A;  4K0R A;  1DNP A;  4UWL A;  1N54 A;  2FBW A;  4HKA A;  4WNF A;  3CVN A;  2J47 A;  4XI9 A;  4C0M A;  3JQ1 A;  2JIW A;  4HFG A;  2IFU A;  2E9X B;  2D2S A;  5CRU A;  3V5S A;  3OYZ A;  5ETW A;  4PJJ A;  2Y4T A;  3CK7 A;  4BT8 A;  3CHQ A;  4WUY A;  5HRY A;  2L8K A;  1BR1 A;  3N9P A;  4B3T T;  4ZFH A;  3IBP A;  3PUR A;  4BFR A;  3N9M A;  2R05 A;  3OXG A;  3V2O A;  3CR3 A;  3SQV A;  4EEC A;  4OYJ A;  2YDR A;  4EZJ A;  3DSU A;  4MBG A;  3ZJ1 A;  3FHN A;  2F37 A;  2A72 A;  1YCS B;  3PUA A;  5KX5 E;  4KXK B;  5FT9 A;  4B93 B;  1ZHC A;  3GZS A;  1S63 A;  2CHO A;  2CPT A;  4G23 A;  2Y48 B;  4PJM A;  5CER B;  5LCY A;  1NWM X;  4ZI3 D;  2CA5 A;  1LVK A;  3CGH A;  4GTQ A;  4U31 A;  5HEH A;  2AVP A;  2XM2 A;  3TXM A;  2VVS A;  3AA7 B;  1FIO A;  2QYW A;  3DST A;  1Y01 A;  4X8Q A;  5GON E;  3UM3 A;  4YVO A;  4HWF A;  4BX9 A;  4TNW A;  2LKH A;  3GMI A;  2AWI A;  5FP3 A;  5L3F B;  3RX6 A;  5E75 A;  4WWO A;  4HGA A;  3UT4 A;  5EX0 A;  2VSY A;  4LUN U;  2X38 A;  4X64 T;  1FVH A;  1U3C A;  4HRL A;  5CRV A;  2LNI A;  4ANU A;  5LJM A;  3IEE A;  2J9Q A;  1NP7 A;  3D9J A;  4ILH B;  3L16 A;  1JNZ A;  1W3B A;  3AE2 A;  3PEV B;  2GRO B;  1VOM A;  2AXZ A;  2R17 C;  2XZT G;  2M67 A;  3KV6 A;  3GZ1 A;  5KXJ A;  2XJ7 A;  3SO8 A;  5JA4 D;  2PZI A;  5AQR B;  2DYR E;  3EVY A;  3ZU7 B;  5AQU B;  3TXN A;  5HKP A;  5LGT B;  1HS6 A;  5KJM A;  2ZIR A;  3U3W A;  4TWF A;  1UG3 A;  4U3C A;  3WG7 E;  4ANV A;  4I55 E;  3T5V A;  4IE4 A;  3VLE A;  2YEV C;  2XQ9 A;  1XNF A;  4GIW A;  1K8K G;  2HE0 A;  3LJN A;  1YYH A;  3NVO A;  1A17 A;  4OVV A;  1MIV A;  2GW1 A;  5EKQ D;  3KV4 A;  4GU5 A;  1KNR A;  4GTO A;  3UUB A;  4AIF A;  5FXV A;  3KBU A;  5ANR A;  3UUX B;  4HI8 A;  5HXS A;  4CCA A;  2H88 A;  1NAF A;  3ZMT B;  5EZY E;  5H6Q B;  4UQX A;  3MGB A;  1KT1 A;  3Q4A B;  4LMK A;  5FQ6 A;  4HXI A;  5AIJ A;  1L5J A;  4F53 A;  5LBQ B;  2ZGD A;  2BKP A;  4EOZ B;  5JDG A;  1E2A A;  1XGW A;  1N33 T;  3ZC0 A;  1Z8U A;  3QJZ A;  5DIZ A;  3ML8 A;  3KD7 A;  4EQF A;  5IY5 E;  1TJC A;  3HI2 A;  2DVW A;  1D0X A;  4AVX A;  1HE8 A;  3T8M A;  2BKG A;  2E9X C;  4QH1 A;  1TNY A;  3IHY A;  1Z5S C;  2R59 A;  5AYW D;  2EIL E;  2CWO A;  2XTL A;  2WMO A;  2V4L A;  3FTU A;  1E1H B;  3NZP A;  3FWV A;  4TRQ A;  2PBI A;  3W9F A;  4JEH B;  3D9N A;  3OXF A;  3FBZ A;  2YQ8 A;  2LOS A;  3AE5 A;  3EUH A;  2WB5 A;  2VYI A;  4XIF A;  3C4Z A;  2V7I A;  5LFA A;  3SFD A;  1TJF A;  2BKO A;  4DUY T;  1AWC B;  3Q5X A;  4CQI A;  2V5D A;  2XGM A;  2LSI A;  5DQV A;  1S70 B;  4FLH A;  3Q49 B;  4WNK A;  2W61 A;  3CX7 B;  3RIB A;  1HXI A;  2LOP A;  5AN8 A;  3RAU A;  3R84 B;  2XM1 A;  3PZ2 A;  3QDN A;  2ZM2 A;  4AIU A;  2JRK A;  1A5E A;  3NZU A;  4M1P A;  2J4D A;  2Y1L E;  4QKN A;  2LSG A;  5AQQ B;  5HYA A;  1MJ0 A;  4N5C A;  4G26 A;  3ZNG A;  3LKU A;  2B0O E;  4U07 A;  2UY1 B;  2Q9Q A;  5AAR A;  1KNP A;  2J09 A;  2W67 A;  5HQ8 A;  4BX8 A;  4QH4 A;  2VGY A;  4TUM A;  4EBA G;  2NTY A;  2KCV A;  2HR2 A;  3C5R A;  4LER A;  1MHQ A;  4I2Z A;  3CHP A;  3M3Z B;  5CBO A;  1HNX T;  1ZP0 A;  1EF1 C;  1H6P A;  3UTM A;  3FTX A;  3UU6 A;  4O1O A;  3S7D A;  4G8K A;  1KK7 A;  2MRI A;  3LSV A;  3SFZ A;  2NP9 A;  3CSF A;  1S64 A;  3PUG A;  3JCK C;  3ZEF A;  3PV0 F;  4N39 A;  3QUJ A;  3NKZ A;  1HTJ F;  1HFA A;  5L2L A;  4DR1 T;  4U2Y A;  3HXB A;  4H7X A;  5HEU A;  2XHE B;  4XE0 A;  4BES A;  1ELW A;  4H9P C;  3Q5M A;  2B6C A;  4I1A A;  4JPS A;  1MMG A;  3AB3 B;  2KMF A;  3JQ0 A;  4EZK A;  5LHH B;  1FT2 A;  5JR9 B;  3AA0 B;  2E8I A;  4YTP A;  1VCT A;  2L3L A;  4JD2 G;  4F7A A;  4HOR A;  3Q73 A;  2CWY A;  2WXP A;  2YDQ A;  3UU3 A;  1IZN B;  1YMP A;  2K48 A;  4DID B;  4KI0 F;  3E34 A;  5AQH B;  2IML A;  3M65 A;  1V9D A;  4GPK A;  3O48 A;  3FZL B;  2AXU A;  2GRR B;  5JMN D;  2GRN B;  4DX6 D;  5FXZ A;  2DYS E;  2MOW A;  2NXP A;  2LSK A;  4K5A B;  2QYU A;  3E37 A;  3UT8 A;  4GYO A;  4LFA T;  2ACZ A;  2ZMA A;  1HZ4 A;  1QZ2 A;  4YLH A;  4UF0 A;  3QAQ A;  4HTE A;  4FHK A;  4WWP A;  1KZP A;  3D9I A;  2BKN A;  4OFZ A;  3OKQ A;  3RYI E;  3MYV A;  2IC9 A;  4C90 A;  2P9U G;  3D9H A;  4L23 A;  5LGN B;  2CEA A;  3K3O A;  1Y6I A;  3AU5 A;  2RA1 A;  4UVC B;  3PU3 A;  5JDN A;  4L0R A;  2F4V T;  5EX3 A;  2X0Y A;  1FMW A;  3FY4 A;  5BXU A;  4G25 A;  4N3B A;  4YTN A;  1XWM A;  2HPL A;  5JJ6 A;  2I59 A;  2E9X D;  3Q7F A;  3TLV A;  5L3D B;  5T8I A;  4OVU A;  3ZT6 A;  1O1S A;  2XAG B;  3LK2 B;  1XMQ T;  2PM6 A;  5AQS B;  2RG8 A;  2VJ8 A;  5FMN A;  3ZKJ A;  5C2T A;  4I6E A;  3CVR A;  5FZS A;  1NL4 A;  4JI4 T;  4I2W A;  2FUL A;  4YJ2 E;  1KEY A;  3KVA A;  1HO8 A;  1W0B A;  1TN6 A;  3OPC A;  2EIN E;  5FKY A;  1CUN A;  3HIZ A;  1UN8 A;  2CM0 A;  4NUU A;  1WFD A;  1OCZ E;  4DV2 T;  3S2A A;  2IOL A;  3RLF F;  3HVE B;  4HWI B;  3O1H A;  4BET A;  4UVA B;  5CCL A;  2X9X A;  4ILB A;  3FHE A;  4MAL A;  1E7V A;  2V8S E;  1V54 E;  3DPD A;  2N1G A;  1J5E T;  2IU1 A;  4MRU A;  3ZXS A;  2P9K G;  2J8S D;  3FTY A;  1UGO A;  4HWH A;  4NIQ A;  4QH5 A;  3TLS A;  4MBQ A;  5CGM A;  5BR8 T;  1TNZ A;  3RQW A;  4B3M T;  3E08 A;  2L6J A;  2OLT A;  3BEE A;  2J1D G;  2CXL A;  1NZN A;  1UK5 A;  2I0M A;  5JRE A;  4DVD A;  4UEL A;  4O2B E;  4U0Z A;  3RI5 A;  5JTG A;  1I94 T;  1P5Q A;  3TAX A;  3TWR A;  2ZM8 A;  2C0S A;  3AEA A;  4DV5 T;  1K1A A;  1TNU A;  1UOH A;  1IQR A;  2F8X K;  2WXK A;  1IJ5 A;  2XQY A;  5HEG A;  5EIB E;  5M72 A;  5FZR A;  4ZS3 A;  3Q9U C;  3HXC A;  2R02 A;  2UWJ G;  2K9A A;  2WS3 A;  3Q9D A;  5AQK B;  3AG2 E;  3HYM B;  2P58 C;  4GYW A;  2LRL A;  4H9R C;  4L2L A;  1KF6 A;  3LYA A;  3AAA B;  2MAW A;  5JR9 C;  4HNA D;  3KSQ A;  4PFP A;  3O1I A;  4RSY A;  2V7K A;  4UIG A;  3UIO C;  3ZJ2 A;  1E96 B;  2KWH A;  3C4X A;  2XQ3 A;  4GML A;  1J5W A;  3ASO E;  4JI3 T;  4I17 A;  2CHX A;  3CHM A;  4MKT A;  2XEE A;  4WZX A;  3CML A;  4A98 A;  3GW4 A;  5EYL A;  3RC8 A;  3DEP A;  3FUF A;  4DV3 T;  4A56 A;  3RYC E;  1HU3 A;  2PQR A;  4U63 A;  3Q75 A;  2MTQ A;  4V1A v;  2GRP B;  3V2X A;  4ZHB A;  1OWN A;  5FJY A;  3DTO A;  1KZO A;  5ENT D;  5AQI B;  4WWN A;  5AQP B;  4YND A;  1HNZ T;  2WWU A;  2P9B A;  2PFV A;  4DMV A;  3A8Y C;  4AQG A;  2JEK A;  3ZYQ A;  5KWD A;  4RG6 A;  3C4W A;  2KAT A;  3V79 K;  3RSE G;  3DRA A;  1Z3Y A;  3ONL C;  4B3R T;  2V1D B;  4I4T E;  4OAV B;  3UQ7 A;  4X1K E;  3PS6 A;  1X81 A;  3K9I A;  3PUJ A;  2XY8 B;  1MZC A;  3EIJ A;  3PH0 C;  2L6B A;  1Z0P A;  3EDU A;  3B95 A;  2JLB A;  5CMW A;  1XNR T;  2BZB A;  3HA4 A;  5A6C A;  5HEJ A;  2NYJ A;  4EBA A;  2UXB T;  3KVB A;  4LNU D;  3ZIM A;  5BV1 A;  1E8Y A;  3BUA A;  2LXM A;  4UI9 C;  1WR0 A;  4IE6 A;  4ACK A;  3L09 A;  2KWI B;  2UXX B;  1HF8 A;  3PZD A;  4L2Y A;  2ES0 A;  4BT9 A;  2XSB A;  3G2V A;  4PK5 A;  3HR0 A;  2GRM A;  3AA6 B;  4CI3 B;  2OVB A;  5CHE E;  4P29 A;  2F8Y A;  4WBO A;  4DMW A;  4DPR A;  3KEA A;  1JWF A;  1UJK A;  4ASK A;  2WVI A;  5G04 C;  1E7U A;  3PZ1 A;  5LOZ A;  4RG9 A;  3LY9 A;  3RKG A;  2HO1 A;  1N11 A;  4APO A;  3P4Q A;  2NW8 A;  3LEW A;  3U78 A;  2OCC E;  4O4H E;  2D0T A;  2XEN A;  1Q2Z A;  3WAK A;  3NF1 A;  4DLQ A;  3PUX F;  4AQF C;  2IQC A;  5EK4 A;  2AW6 A;  4HN9 A;  2N9D A;  2ZLY A;  3CVU A;  2R03 A;  3CVW A;  3CHS A;  3LY8 A;  4Z8X A;  5E76 A;  4X20 E;  2JQQ A;  1MYO A;  4GPM A;  3SS1 A;  4BJM A;  3MKR A;  1D9S A;  1G73 A;  2IUB A;  4E7Z A;  2VB6 A;  2UUC T;  3FTV A;  4PFO A;  3ML9 A;  3VRB A;  5FY0 A;  4O4L E;  3RH3 A;  3ZMU B;  4IDO A;  3FP3 A;  3FUI A;  2GRL A;  4YDY A;  3U9W A;  3Q5E A;  2DLR A;  4PK4 A;  3VLD A;  1EPU A;  2V0P A;  4GTP A;  2YU2 A;  2JQK A;  2JMH A;  4O4J E;  1QYM A;  2K24 A;  1M7K A;  3VR9 A;  3EAM A;  1Z6T A;  3JC6 C;  3AAA C;  4O4I E;  3RRW A;  4JI5 T;  1E8W A;  2FO1 E;  3VU7 H;  2LLY A;  4R7L A;  3ABK E;  5CMY A;  3UIN C;  4UXN B;  2XPZ A;  4LF6 T;  2E5V A;  2PL2 A;  2E2A A;  5FXX A;  4BTA A;  4XEI G;  4I6G A;  4H63 H;  3A7M A;  2ZM6 T;  5TAO A;  1G8X A;  3N2G E;  3R9M A;  3SFX A;  3EHQ A;  3J7Y q;  2YK0 A;  3CQX C;  5CEA A;  4GB9 A;  4HEA A;  1U5P A;  1B89 A;  5EYP F;  3RC3 A;  4GCN A;  3SWH A;  5JRC A;  2H6H A;  4WNE A;  3IV0 A;  1JWG A;  4HRN A;  4TWH A;  3LDQ B;  4UR9 A;  2XAJ B;  3EJN A;  1H19 A;  2VGX A;  2X6I A;  3SHF A;  4HOT A;  3PTR B;  4J8S A;  3FUH A;  5CBN A;  1M62 A;  2DIW A;  2W62 A;  2EHO A;  4EPZ A;  2XRY A;  3QB2 A;  2G0U A;  2YHE A;  4CZZ B;  3MKQ A;  2FJE A;  2BKK B;  2CBI A;  5HI7 A;  5A7D B;  2ZIS A;  2VSN A;  1IBK T;  3CHO A;  3G2T A;  4ANJ A;  4QHO A;  4UVB B;  3IXE A;  4PUC A;  3CX8 B;  1KNZ A;  4IDN A;  2FJA A;  1EDU A;  5JDF A;  5LX8 A;  2QGS A;  4JLE A;  1OT8 A;  3PJA J;  4QQI A;  2BDE A;  2RFM A;  5FL0 A;  4YFS A;  3PNL B;  2CXF A;  3BQO A;  2V6Y A;  4H7Y A;  3AJI A;  4HOQ A;  5FZQ A;  5KDM C;  3HDX A;  5HEO A;  2XAQ B;  3ZMS B;  1LKX A;  5HS0 A;  3KIN B;  3EDV A;  2CBJ A;  4Q69 A;  3AEF A;  5AAO A;  3L39 A;  5CB4 E;  3ABV A;  3C3O A;  5BV0 A;  3CEQ A;  4FLB A;  3AE9 A;  1N9A A;  4U8V D;  2QZA A;  3DSS A;  3C64 A;  4YSX A;  2UXC T;  3RRC A;  2J4B A;  1FEW A;  2C5I T;  1ELK A;  2NTX A;  3ZPO A;  5LHG B;  4I9C A;  2VUR A;  1DC2 A;  4E85 A;  4H9Q C;  5DJQ C;  4YSY A;  3N9L A;  3RYH E;  4DUI A;  3IBE A;  4P1N A;  4YVQ C;  3MA5 A;  1FMV A;  1ZV4 X;  5B1A E;  3WAJ A;  3E30 A;  4BER A;  3E33 A;  4JI8 T;  4PH4 B;  3UU4 A;  4QFV A;  2LHR A;  2XCB A;  5FXW A;  2LSV A;  4N3A A;  3P8C D;  3DBS A;  3QKY A;  5JDL A;  3C51 A;  3N2K E;  3CK9 A;  4JB8 P;  2KIN B;  1BLX B;  3RU0 A;  3DXK G;  5EK2 A;  3KS2 A;  3B57 A;  4U0U A;  3B5M A;  3JAE A;  2ODV A;  1H2V C;  3IEG A;  2BBJ A;  2LJL A;  3P4P A;  3JXI A;  1HG5 A;  3DWL G;  3I4R B;  2C5J A;  3BQK A;  4G8L A;  1N4P A;  3R7Q A;  3G06 A;  2DZO A;  4TXQ A;  5E0O A;  1OED A;  3ZN1 B;  4QWN B;  4U7I A;  3I5P A;  2RD0 A;  5D2M C;  2Q9Q B;  3EUV A;  4ATG A;  4UWG A;  5L3E B;  4TXP A;  2WMN A;  4DV1 T;  5ADX L;  3ZC1 A;  1S35 A;  2LAI A;  4OHF A;  5KJL A;  4OAU C;  4P0B A;  5FIO A;  4KVO A;  3QC9 A;  1XMO T;  2FF4 A;  5L4H A;  2ETC A;  4JI7 T;  4ZHQ E;  1N94 A;  3C3Q A;  2UU9 T;  3JCF A;  4PJL A;  1D1B A;  3UQ4 A;  3T9K A;  4ZEY A;  5LB7 B;  3UIP C;  4CRW A;  2KLQ A;  3TG5 A;  2NSZ A;  4KBM B;  4DBR A;  5ENN A;  3JC6 D;  2CLY B;  3TWS A;  4K0U A;  2KXP B;  3EAB A;  4CDM A;  2V7M A;  2CHN A;  3PUQ A;  2V26 A;  3ZEF B;  4TXR A;  5C3J A;  4GCO A;  3RPU A;  3L08 A;  5ENO D;  1N95 A;  4FI5 A;  3OXL A;  1FVF A;  1QBQ A;  5L3C B;  3SY2 A;  2ODU A;  1SUM B;  4EXT A;  3C50 A;  1ZBP A;  2IJG X;  4CT4 A;  4D10 C;  1HNW T;  4WYV A;  4KHP T;  4ANX A;  5CCM A;  4AIS A;  4V3I A;  4CDR A;  2BG9 A;  4JHR A;  2OV8 A;  4CYM D;  3P4W A;  1MMN A;  3MJX A;  4DR4 T;  1RZ4 A;  4NAC A;  4EIW A;  2AE9 A;  1LRZ A;  4IIJ E;  2WXQ A;  4OYS A;  2VKO A;  4QXB B;  2QYJ A;  3TWW A;  2IC6 A;  2GRQ B;  2WZI A;  1L0V A;  2OOE A;  3WXX A;  1J1J A;  4LMJ A;  4GZ6 A;  3HG0 D;  4CZ2 D;  4DX1 A;  4IRU A;  3UT7 A;  2CXD A;  3W15 B;  4CN1 A;  3HKB E;  3SRZ A;  3V5U A;  5LGU B;  4GYY A;  3I1A A;  1O5M A;  2VK9 A;  4RQI A;  2H89 A;  5ARF A;  3AA1 B;  2DI4 A;  5JDM A;  1D0Y A;  3AXJ B;  3QNU A;  2L0I A;  3NWI A;  3LBX A;  5EIL A;  5AQ9 A;  4ERR A;  3URZ A;  4JUY A;  4IUL A;  5C8Y E;  3L82 A;  3ZYL A;  4GZC A;  2KCK A;  2HH7 A;  4UF0 B;  2KZT A;  3P4R A;  1ZEE A;  5ENS D;  2X0H A;  5AEN A;  5AQT B;  3S7J A;  1OED E;  3TWQ A;  5ENR D;  3FZH B;  1VRB A;  1FJG T;  1FT1 A;  1TR4 A;  4KT6 B;  3T5X A;  5ABF B;  2PNN A;  2Y4U A;  5JH7 E;  2VSX E;  4J8D A;  1BR2 A;  3D9M A;  3G2U A;  2LKG A;  3FUD A;  1ZOY A;  5FQ7 A;  5A23 A;  2W4X A;  2PG8 A;  4E7S A;  4NIK A;  2VQF T;  2X6H A;  2V8S V;  3EIQ C;  1UCU A;  4Z91 A;  3S4U A;  4IT4 A;  4ILU A;  3LFM A;  3G2S A;  5AQM B;  4GYR A;  1WM5 A;  2CFZ A;  3HXF A;  2HN2 A;  3CVV A;  5L3G B;  4COF A;  4HOU A;  2VGE A;  5CA1 E;  2YKS A;  3AS4 A;  3TWU A;  4G11 A;  2UXN B;  3CKD A;  5J90 A;  5AQG B;  2Q9Q C;  2H7O A;  2DHR A;  5T4Y A;  4GTR A;  2WXO A;  4BY6 A;  5B3S E;  2XUE A;  2KSR A;  1LVF A;  3ANW A;  2BBH A;  5FY7 A;  3AE6 A;  4GMJ A;  4AXH A;  4EZL A;  3RIU A;  4KZ0 A;  3Q5W A;  2WB2 A;  3U3I A;  4APF A;  2WU2 A;  4GA1 A;  2V7L A;  2W0G A;  2XZE A;  3FFL A;  3QWV A;  3Q79 A;  4MHC A;  2CLY C;  2DCF A;  4IRE A;  2KXP C;  2LO6 A;  3L8R A;  4Y6W A;  2VKJ A;  3R7R A;  3RO3 A;  2XAS B;  3FUJ A;  3O4Z A;  4U2Z A;  4JEH A;  4L7T A;  4LFB T;  3AVS A;  3ABL E;  2VL0 A;  4DR3 T;  3Q9N C;  4QXC B;  4G1T A;  4J8F A;  2LHN A;  3RF1 A;  4I43 A;  4J2C A;  3KEZ A;  3L13 A;  3LG7 A;  3U66 A;  2P2C P;  3C98 A;  3AE7 A;  5FYM A;  5LCW J;  3PE4 A;  4PK6 A;  2DL1 A;  2IF4 A;  2R6G F;  5JJT A;  5J2T E;  4AV7 A;  3UTK A;  5LCW C;  3E4B A;  3U64 A;  1ZB1 A;  3ZHE A;  5F3J A;  2DWG A;  5KBA A;  2WDV A;  5HWX A;  2MHK A;  3U4T A;  4ACL A;  4E6H A;  5FQ4 A;  4MLP A;  2R2L A;  3ZCI A;  3GZ2 A;  4IHJ E;  1MX4 A;  2FI7 A;  1N0R A;  5LBM A;  4AY6 A;  4A5X A;  3AEC A;  2IY0 C;  1O1T A;  1UUS A;  3L9T A;  2WAU A;  4A3V A;  3TL5 A;  3L54 A;  1QSD A;  1N34 T;  1OWP A;  4B89 A;  2JJ9 A;  1W09 A;  5LOV E;  3QOU A;  3RK6 A;  1SZ9 A;  1OUV A;  2C5K T;  1UX4 A;  1IXV A;  4YDE A;  3ZFW A;  2QC9 A;  3V31 A;  5L47 A;  3HKD E;  3ZT5 A;  1HX1 B;  3NRY A;  3B7T A;  4G24 A;  5G55 A;  3D9L A;  5C2Y A;  3UMV A;  2PQN A;  3CLJ A;  4KZC A;  3CWZ B;  3K8P C;  3IHR A;  1LTX A;  4AXP A;  3LY7 A;  4DJA A;  2WQH A;  2QRX A;  4XI0 A;  4KMC A;  3CVY A;  3EHZ A;  3AEE A;  3N5L A;  5FTP A;  2LSU A;  2R5S A;  1OXJ A;  3AEG A;  3ETU A;  2CCQ A;  3VKH A;  4JEU A;  3AG3 E;  3TGO A;  2PJQ A;  5LHI B;  1WYC A;  2X6J A;  1UUR A;  1BR0 A;  3QWP A;  4EYU A;  2V6X A;  3ASN E;  5LG4 A;  4F6R C;  2BVM A;  1ZU2 A;  4B94 A;  3ZYM A;  4LNG A;  1SQM A;  4TNV A;  2XCC A;  3HHM A;  3PUK A;  2OA5 A;  3PEU B;  3K3N A;  2X66 A;  1N4R A;  4KVM A;  4TUU A;  3AE3 A;  2LRK A;  3HKE E;  3KAE A;  2MYS A;  1TN8 A;  4K0K T;  4H9O C;  1NI1 A;  2LXL A;  3FXE B;  3Q5D A;  2UXD T;  4LFC T;  3LCA A;  4UV8 B;  4YSZ A;  3T8K A;  2LM9 A;  2XS1 A;  2IO2 C;  1WR6 A;  3ISM C;  2C0L A;  3TG4 A;  5EN5 D;  2NW7 A;  3AG4 E;  4H9N C;  1H2T C;  5JDH A;  3E32 A;  2WXI A;  2NW9 A;  4AKR B;  1BI8 B;  5JJ7 A;  4U8Y D;  3QNK A;  2XSA A;  3FB2 A;  3SFE A;  1B7T A;  3C72 A;  4EED A;  2CE7 A;  4RVB A;  2ETA A;  3VTY A;  5JHB A;  2VL8 A;  1BD8 A;  3HKC E;  4HBD A;  5LXT E;  2HM8 A;  3ABM E;  1TNB A;  4LRZ A;  2Q9Q D;  1SA0 E;  2Y69 E;  3D9K A;  5T3R A;  2FBN A;  2YDS A;  2XEH A;  3ZW3 A;  3EHM A;  4JL0 A;  4BAY B;  4PDX A;  4OK0 A;  3KSL A;  4LF4 T;  1KPS B;  3CVL A;  3FH7 A;  2Q7F A;  3PRZ A;  2E2E A;  4FC8 A;  1WCR A;  1HR0 T;  3ASG A;  3TWT A;  4KBQ A;  4YJ3 E;  2EQX A;  2OEV A;  3JAD A;  2XPI A;  3PDY A;  2VTB A;  3APD A;  3EU5 A;  3S7F A;  4DND A;  2K3W A;  5KNG A;  1H6K A;  1T98 A;  3LJC A;  1QUU A;  3UPV A;  3TWX A;  4GMR A;  4A1S A;  3ZVV A;  3RYF E;  4CI1 B;  3AEB A;  1IQU A;  1SVX A;  3ULE G;  2KT9 A;  1WLX A;  3RKO A;  3PE3 A;  5AQL B;  4BSZ B;  3QB5 K;  1MMD A;  3ZN3 A;  4O6F A;  2WXG A;  5JRC B;  3N71 A;  3NZQ A;  4UI9 J;  5D0Q D;  3SD5 A;  1OCC E;  4GA0 A;  1WAO 1;  4NPP A;  2YIN A;  3CIA A;  3B7R L;  5H6R B;  2WQ7 A;  3RQU A;  3N9N A;  3ZMZ B;  3MZL B;  4HWD A;  2WXR A;  4UQZ A;  2VKD A;  2J08 A;  2P9I G;  2VGX B;  4U33 A;  1OWL A;  2Y3A A;  1AP7 A;  5KJK A;  4U7Y A;  5J0Z A;  1YKE B;  2EHO B;  2OEW A;  5CED B;  3MKQ B;  5G04 J;  3MX3 A;  3MK7 C;  1RW2 A;  2WXJ A;  1CHU A;  2RPA A;  5LYJ E;  1D8D A;  3QOF A;  1NEN A;  2A5E A;  2P9P G;  2DWK A;  4I6J A;  4XKB A;  3D9O A;  1KLX A;  2ZM0 A;  2LSY A;  4X1Y E;  1INZ A;  1R8I A;  2HYZ A;  4O1P A;  4UQY A;  5ARG A;  3Q78 A;  4BJN A;  2WQY A;  2V6Y B;  2XGS A;  5L3B B;  1IJ6 A;  4LNB A;  3B7B A;  2IEJ A;  4DR2 T;  5LP0 A;  4PS7 A;  4U7E B;  4FHJ A;  5LG3 A;  3Q47 B;  4HWC A;  3UFE A;  1JPL A;  1E8X A;  3F2E A;  4GTS A;  3FZK B;  2C0M A;  4JI1 T;  4IN3 B;  2BS4 A;  3RRM B;  3OJA A;  3CK8 A;  1Z3X A;  5M4Y A;  3ONK A;  2XPK A;  2DWZ A;  4FUL A;  4O60 A;  3ZXP A;  1IHG A;  2DZN A;  2H6I A;  1BR4 A;  4ZOL E;  5FIN A;  5EDS A;  4NQ0 A;  3CV0 A;  4UEM A;  1OCR E;  2KM4 A;  3ASD A;  2DNX A;  3PUS A;  3CVQ A;  3AS8 A;  1X79 A;  5ITZ F;  2LEH A;  2SPC A;  4WBN E;  2W63 A;  2NOX A;  2RKK A;  1N52 A;  1OY3 D;  4FJZ A;  2BS2 A;  4F6R D;  3GN5 A;  1N4Q A;  4M3O A;  1BI7 B;  3JUI A;  4C9B B;  4HE8 A;  4K5B A;  2IHR 1;  2I6H A;  4QX7 B;  4EB6 E;  2IAK A;  1JNR A;  5LNK A;  1OWO A;  4NUR A;  2RP4 A;  3DPY A;  1W0A A;  3PUV F;  4DV0 T;  1IAP A;  1DVP A;  4DV4 T;  3BK9 A;  5F5W A;  1SA5 A;  2WXN A;  4NRH B;  3MEK A;  5C1D A;  4ILA A;  4A1G A;  1W9R A;  5AQV B;  1FCH A;  2X9W A;  3TKL B;  2KND A;  3PNT B;  3ZKR A;  5HXH A;  3CVP A;  3FUK A;  2Y8D A;  3CQC B;  3Q15 A;  2M6I A;  4LSZ E;  3UU8 A;  5FY1 A;  4PW8 A;  3PJA A;  3ZN0 B;  3MV2 B;  5DQW A;  4U72 A;  4YTM A;  4XKC A;  4OYK A;  4C91 A;  4AJW A;  4JXT A;  4H9S E;  3DP7 A;  5BMV E;  5KMG P;  3MCX A;  3D3M A;  1OED B;  4OX9 T;  2KZ7 B;  3JXJ A;  1D1A A;  2A3D A;  2VQ2 A;  3ZLI A;  4KX6 A;  3BQI A;  3JUE A;  4DX7 D;  4W9R A;  3FXD B;  2ETB A;  3MV3 B;  5ENQ D;  3DJB A;  4Q94 A;  2V5C A;  3P7I A;  2V7J A;  3APC A;  4X1I E;  5BUZ A;  2LSJ A;  3LVR E;  2D0U A;  3UM1 A;  4B8A A;  2XQ0 A;  2WXM A;  3RHW A;  4JHK A;  1BPO A;  4JV5 T;  1HG2 A;  2ILR A;  1ELR A;  4JBW F;  1SE7 A;  3W9G A;  2WPV A;  4QX8 B;  2XQ4 A;  2IW5 B;  3KV5 A;  4MFR A;  4U95 D;  2XPY A;  3D9P A;  3AE8 A;  5CJ5 A;  2BS3 A;  2WBL A;  3RIF A;  3ASH A;  4DR7 T;  1JCR A;  2EHO C;  1HX8 A;  2YHC A;  1TNO A;  3AG1 E;  4MLK A;  4FAD A;  4KMO A;  2X6F A;  1SZA A;  2K5B B;  3VR8 A;  5J2U E;  4B0Z A;  1UN9 A;  5HCJ A;  1U2V G;  4JYA T;  2J62 A;  3MAC A;  4A97 A;  4DR5 T;  3UUN A;  2Y6X A;  4UWF A;  3B13 A;  2BG9 B;  5BW8 C;  2WWV A;  2A2F X;  1K1B A;  3S7B A;  3P2B A;  4HFB A;  3OTN A;  4K5C A;  3H37 A;  3KFW X;  4L9I A;  1T72 A;  3TLW A;  2P9L G;  4LCT A;  5AQA A;  4PNI A;  4HS2 A;  3OBV E;  3L3P A;  3P50 A;  4NXN T;  1TYQ G;  4F8H A;  4GOU A;  4TX5 A;  4KYO B;  1TN7 A;  3AE1 A;  2IIU A;  1U4Q A;  1NEK A;  2CHW A;  5EID A;  2QVA A;  3LBX B;  2JMK A;  3FUM A;  1FPP A;  5AJL A;  4GAA A;  1YD8 G;  4IGU A;  1IBM T;  1H6O A;  2WM9 A;  3CX6 B;  5AQN B;  3ESK A;  1WYB A;  4PS3 A;  4YT0 A;  3UFG A;  3DXM G;  2KZT B;  3NBN B;  3F31 A;  3PE0 A;  1N0Q A;  3BQL A;  4AP2 A;  3ZPJ A;  3N9O A;  2E0I A;  1VCS A;  4AY5 A;  3MKD A;  3R6N A;  2GK9 A;  1UX5 A;  1XNQ T;  3SFY A;  5BT1 A;  4XAX B;  4L9P A;  4JA7 A;  4AKI A;  4G63 A;  3VLF A;  4GZ3 A;  5ANL A;  2E9X A;  4JI6 T;  5FWQ A;  4RLY A;  3SZ7 A;  2N2N A;  3GWH A;  4AKH A;  3QAR A;  4LF5 T;  3UUL A;  4YHJ A;  1MX6 A;  3EHN A;  1QQE A;  4B6X A;  4LF9 T;  3NBX X;  3ESL A;  4JW1 A;  3K3Q C;  1E7P A;  4JVS A;  5BXO A;  4DI3 A;  4HFC A;  3CKB A;  4TV3 A;  4FA6 A;  5IWA T;  4DX2 A;  4JC8 A;  3SOL A;  2XQ8 A;  4TV8 E;  4HLE A;  2BUG A;  2WCA A;  2ION A;  4LF8 T;  1OED C;  2DCP A;  2IOS A;  4FJY A;  2OVF A;  3GA8 A;  3T8O A;  3QB5 A;  2HHH T;  3EI0 A;  3LPZ A;  3FDH A;  3AAI A;  1I6Z A;  5FVL A;  1D0Z A;  5IUX A;  3J9X 1;  1QLB A;  1O1R A;  5KNH D;  3ANW B;  2CRB A;  2X3M A;  4WW0 A;  2Z6E A;  5LA6 E;  4ZZC A;  4XX5 A;  1HS7 A;  3ONJ A;  3QC1 A;  4YDO A;  4AQY T;  2W2U A;  1JUQ A;  1VDY A;  2V4H C;  2XQA A;  2NC9 A;  2XS8 A;  1X9B A;  4WND A;  1S94 A;  2M63 A;  3FTW A;  3QK6 A;  2JQ9 A;  4EZH A;  4ZI7 E;  5AQB A;  4TUY E;  4U96 D;  3CHR A;  4WAF A;  3I4G A;  4X62 T;  4Z68 A;  3I9Y A;  4UI9 K;  1H2U A;  1WG0 A;  1GW6 A;  5JQG E;  1XDP A;  3I3N A;  1SHZ C;  1PC2 A;  2PM7 A;  3F6Q A;  1NA0 A;  4ME2 A;  4I43 B;  3L17 A;  2JAB A;  3LS8 A;  3FU0 A;  3LXU X;  2A9U A;  2X9H A;  1E90 A;  3ZCJ A;  3HL6 A;  2AXV A;  2M6B A;  3SNX A;  3RRU A;  4P09 A;  4HFH A;  5FL1 A;  2IO3 C;  3C98 B;  3EU9 A;  4C48 B;  2F0Y A;  3PUY F;  3FU3 A;  4HFD A;  2BG9 C;  4J7W A;  2VAS A;  4PAG A;  3UU5 A;  4A63 B;  4F1S A;  5L4E A;  4DUZ T;  2NR4 A;  3CST A;  3ZHE B;  2B1E A;  1LD7 A;  2FJB A;  2I1K A;  2XQ7 A;  4DLO A;  4I50 E;  2P9N G;  3LJ3 A;  4GZD A;  4CDN A;  3PVL A;  4UWH A;  3SGH A;  4IYP A;  5AJD A;  4XZ4 A;  4BTB A;  2EHO D;  3ZT7 A;  4I1M A;  1MMA A;  3CK6 A;  4FJO A;  2W66 A;  3ZYK A;  4U0S A;  3V30 A;  2XGO A;  3LK3 B;  4CXW A;  5F8P A;  5J1G A;  3CIR A;  2WY2 A;  3X2Q E;  4DR6 T;  3UM0 A;  3LK4 2;  4CGW A;  5HXE A;  4HI9 A;  4DI4 A;  3ETV A;  4F1P A;  4HFE A;  3UX4 A;  2XRZ A; 
#chains in the Genus database with same CATH homology
 4Y6C A;  2XAH B;  1US7 B;  3UUX A;  3RKV A;  5G2N A;  3B7U X;  4CT0 A;  1LF8 A;  4ISS A;  2L9B A;  4IE0 A;  4PJN A;  4GK0 E;  5JDQ A;  3FTS A;  4MS6 A;  3MZK B;  4EZ4 A;  2KCL A;  4ZI2 C;  4AI6 A;  3H3A A;  4ILI A;  5KCM A;  2A5U A;  2OND A;  4JEU B;  4JZY A;  4U04 A;  2BF0 X;  3MJW A;  2KC7 A;  3FTZ A;  1OXZ A;  4BA9 A;  3RO2 A;  1WY6 A;  4U74 A;  4GZ5 A;  2NWB A;  5CA0 E;  4Q96 A;  4AM9 A;  3SI5 A;  4A55 A;  3VHL A;  3AAE B;  3UT5 E;  4DO0 A;  3SBT B;  3FU5 A;  3NZS A;  2JPF A;  4I1O B;  2XEV A;  5LJN A;  3MA9 A;  5FQ8 A;  4TN7 B;  2WXH A;  1H0A A;  4ADZ A;  3FBL A;  2UY1 A;  5FNV E;  2I1J A;  2XAF B;  4URK A;  3D0T A;  3ASF A;  4G2A A;  4FP7 A;  3E0Z A;  3AS5 A;  3ZMV B;  2W00 A;  2QA7 A;  2GGF A;  4O2A E;  3P1U A;  2LE8 A;  4FU3 A;  3KV9 A;  2BTD A;  3EDT B;  5HXC A;  1HH8 A;  2X0L B;  5JVD E;  4AKG A;  4C0E A;  2VTB B;  3NQP A;  4L1B A;  2QFC A;  4U8H A;  5DAB A;  4UV9 B;  3CQG B;  4F3V A;  2MOZ A;  4IE7 A;  4I9E A;  2XHE A;  4GYS A;  4AKL A;  2DBA A;  3Q2M A;  1PY1 A;  3LDZ A;  4JA9 A;  2A4Z A;  3I9W A;  5A1L A;  5JR9 A;  4DK5 A;  4LEU A;  3PRE A;  4J0U A;  1MQS A;  3SF4 A;  3ULQ A;  2WSS V;  2X51 A;  3O1J A;  4AEZ C;  3E22 E;  1YKH B;  3APF A;  3OAW A;  2ACX A;  2YU1 A;  3B7S A;  1WRD A;  1U3D A;  2WXL A;  1EYH A;  4K03 A;  5LP6 E;  3FU6 A;  3ONX A;  3UQ3 A;  1TEZ A;  3PDN A;  1Y8M A;  3L22 A;  4PS8 A;  4CGV A;  3O9X A;  1KT0 A;  1OWM A;  2LT3 A;  4N78 D;  3IHV A;  3IF8 B;  1IYG A;  3QK0 A;  1YA0 A;  4ILG A;  1H7C A;  2CG3 A;  3VTX A;  1E8Z A;  3ONL A;  2I2O A;  1OWA A;  1UW4 B;  3FUE A;  3G2W A;  4ZI2 D;  4N2S A;  3FH8 A;  2X9Y A;  2FEZ A;  4N3C A;  2C2L A;  2X6K A;  2CMR A;  3I0O A;  5BPP A;  3AVR A;  4GK5 E;  3GN5 B;  2CFU A;  3ENE A;  3JYS A;  4L5G A;  4GA2 A;  3BG1 B;  4ANW A;  2HPJ A;  2FO7 A;  2WQ6 A;  3HVE A;  3BG0 B;  3AU4 A;  5AFU L;  2CG2 A;  3QWW A;  3SBS A;  4H63 V;  2BVL A;  1PAQ A;  4ZI3 C;  3A5X A;  4IDZ A;  1O3X A;  3R9A B;  3FH5 A;  2ZU6 B;  1NA3 A;  1ZKE A;  4HFV A;  3IKO B;  4BSX A;  4IST A;  3RRN B;  4WNG A;  4AQF A;  4CI2 B;  1UJJ A;  2V5F A;  3L6A A;  4HVB A;  1MND A;  3RJV A;  2VWA A;  5HAX A;  5D0O D;  4BWR A;  2YNQ A;  3ZRH A;  4XZC A;  4UWK A;  4O8S A;  3FEY A;  4CXX A;  1YW0 A;  2LAH A;  4DBQ A;  3VKG A;  4TV9 E;  3CVX A;  4J8E A;  2VKH A;  3LVQ E;  3KDS E;  2L0T B;  5JHA A;  3N2O A;  3TJP A;  2H3R A;  2D5U A;  3MXZ A;  2H7V C;  3F57 A;  1EZ3 A;  2I9C A;  5J08 A;  2CHZ A;  1MIY A;  3O4X E;  4G2V A;  5EK3 A;  4HOS A;  4EAH A;  2VSO E;  5G05 J;  3I0Q A;  5IHY A;  4P0A A;  2X68 A;  4KUM B;  1S0P A;  5G05 C;  1D1C A;  3PU8 A;  5HWY A;  5IYZ E;  4A3T A;  4CXY A;  4JHJ A;  2L9Q A;  3ZGQ A;  4B8C B;  5KJN A;  4N2Q A;  4QXH B;  4J6I A;  4TZ4 C;  3KBT A;  2MBG A;  2J07 A;  3OYX A;  1AJ3 A;  5DBK A;  4ZS2 A;  2J49 A;  2QY7 A;  2WXF A;  3CKC A;  1HCI A;  4KP3 C;  3FEX A;  4ABN A;  1Y64 B;  4XBF B;  4IE5 A;  1MNE A;  1MIW A;  2X67 A;  3NRX A;  3FUN A;  3GYZ A;  4EYY R;  3FUL A;  5HXR A;  4CEM A;  3WI3 A;  3CPZ A;  4NUV A;  1QNF A;  3N9Q A;  1X5B A;  4AOF A;  5BNW A;  3UUM A;  4K0R A;  1DNP A;  4UWL A;  1N54 A;  4HKA A;  4WNF A;  3CVN A;  4XI9 A;  4C0M A;  3JQ1 A;  4HFG A;  2IFU A;  2E9X B;  2D2S A;  3V5S A;  3OYZ A;  5ETW A;  4PJJ A;  2Y4T A;  3CK7 A;  4BT8 A;  3CHQ A;  4WUY A;  2L8K A;  1BR1 A;  3N9P A;  3IBP A;  3PUR A;  4BFR A;  3N9M A;  3OXG A;  3CR3 A;  4EEC A;  4OYJ A;  4EZJ A;  3ZJ1 A;  3FHN A;  2A72 A;  3PUA A;  5KX5 E;  4KXK B;  5FT9 A;  1ZHC A;  3GZS A;  4G23 A;  2Y48 B;  4PJM A;  5LCY A;  1NWM X;  4ZI3 D;  2CA5 A;  1LVK A;  3CGH A;  2AVP A;  3TXM A;  3AA7 B;  1FIO A;  5GON E;  4YVO A;  4BX9 A;  2AWI A;  3GMI A;  5FP3 A;  5L3F B;  3RX6 A;  5E75 A;  4WWO A;  4HGA A;  3UT4 A;  5EX0 A;  2VSY A;  4LUN U;  2X38 A;  1FVH A;  1U3C A;  2LNI A;  4ANU A;  5LJM A;  3IEE A;  2J9Q A;  1NP7 A;  3D9J A;  4ILH B;  3L16 A;  1W3B A;  3PEV B;  1VOM A;  2AXZ A;  2R17 C;  2M67 A;  3KV6 A;  3GZ1 A;  2PZI A;  3EVY A;  3TXN A;  5LGT B;  1HS6 A;  5KJM A;  3U3W A;  1UG3 A;  4ANV A;  4I55 E;  3T5V A;  4IE4 A;  3VLE A;  2YEV C;  1XNF A;  4GIW A;  1A17 A;  4OVV A;  1MIV A;  2GW1 A;  5EKQ D;  3KV4 A;  4GU5 A;  4AIF A;  5FXV A;  3KBU A;  5ANR A;  3UUX B;  4CCA A;  5HXS A;  1NAF A;  3ZMT B;  5EZY E;  5H6Q B;  4UQX A;  3MGB A;  1KT1 A;  3Q4A B;  5FQ6 A;  4HXI A;  5AIJ A;  1L5J A;  4F53 A;  5LBQ B;  4EOZ B;  5JDG A;  1XGW A;  3ZC0 A;  3QJZ A;  5DIZ A;  3ML8 A;  3KD7 A;  4EQF A;  1TJC A;  3HI2 A;  1D0X A;  4AVX A;  1HE8 A;  3T8M A;  2E9X C;  3IHY A;  2R59 A;  5AYW D;  2CWO A;  2XTL A;  2WMO A;  2V4L A;  3FTU A;  1E1H B;  3NZP A;  3FWV A;  4TRQ A;  2PBI A;  4JEH B;  3D9N A;  3OXF A;  3FBZ A;  2YQ8 A;  2LOS A;  3EUH A;  2VYI A;  4XIF A;  3C4Z A;  2V7I A;  5LFA A;  1TJF A;  3Q5X A;  4CQI A;  2XGM A;  2LSI A;  5DQV A;  4FLH A;  3Q49 B;  4WNK A;  2W61 A;  3CX7 B;  3RIB A;  1HXI A;  2LOP A;  3R84 B;  3QDN A;  2ZM2 A;  2JRK A;  3NZU A;  4M1P A;  2J4D A;  4QKN A;  2LSG A;  5HYA A;  4N5C A;  4G26 A;  3LKU A;  4U07 A;  2UY1 B;  2Q9Q A;  2J09 A;  5HQ8 A;  4BX8 A;  2VGY A;  4EBA G;  2NTY A;  2KCV A;  2HR2 A;  4LER A;  1MHQ A;  4I2Z A;  3CHP A;  1EF1 C;  3FTX A;  3S7D A;  1KK7 A;  2MRI A;  3SFZ A;  2NP9 A;  3CSF A;  3PUG A;  3JCK C;  3ZEF A;  4N39 A;  3QUJ A;  1HTJ F;  1HFA A;  5L2L A;  4H7X A;  2XHE B;  4XE0 A;  1ELW A;  4H9P C;  3Q5M A;  4I1A A;  4JPS A;  1MMG A;  3AB3 B;  2KMF A;  3JQ0 A;  4EZK A;  5LHH B;  5JR9 B;  3AA0 B;  2E8I A;  2L3L A;  4F7A A;  4HOR A;  2CWY A;  2WXP A;  1IZN B;  2K48 A;  3M65 A;  4GPK A;  1V9D A;  3O48 A;  2AXU A;  5FXZ A;  2MOW A;  2NXP A;  2LSK A;  3UT8 A;  4GYO A;  2ZMA A;  1HZ4 A;  1QZ2 A;  4YLH A;  4UF0 A;  3QAQ A;  4HTE A;  4FHK A;  4WWP A;  3D9I A;  4OFZ A;  3OKQ A;  3RYI E;  3MYV A;  2IC9 A;  4C90 A;  4L23 A;  5LGN B;  2CEA A;  3K3O A;  1Y6I A;  3AU5 A;  2RA1 A;  4UVC B;  3PU3 A;  5JDN A;  4L0R A;  5EX3 A;  1FMW A;  3FY4 A;  4G25 A;  4N3B A;  2HPL A;  5JJ6 A;  2I59 A;  2E9X D;  5L3D B;  5T8I A;  4OVU A;  2XAG B;  3LK2 B;  2PM6 A;  2RG8 A;  2VJ8 A;  5FMN A;  4I6E A;  3CVR A;  5FZS A;  4I2W A;  2FUL A;  4YJ2 E;  3KVA A;  1HO8 A;  1CUN A;  3HIZ A;  1UN8 A;  2CM0 A;  4NUU A;  3S2A A;  2IOL A;  3HVE B;  3O1H A;  4UVA B;  5CCL A;  2X9X A;  3FHE A;  4MAL A;  1E7V A;  2V8S E;  3DPD A;  2N1G A;  2IU1 A;  4MRU A;  3ZXS A;  3FTY A;  4MBQ A;  3E08 A;  2L6J A;  3BEE A;  2J1D G;  2CXL A;  1NZN A;  5JRE A;  4DVD A;  4UEL A;  4O2B E;  4U0Z A;  3TAX A;  1P5Q A;  2ZM8 A;  2C0S A;  1IQR A;  2WXK A;  1IJ5 A;  2XQY A;  5M72 A;  5FZR A;  4ZS3 A;  2UWJ G;  3HYM B;  2K9A A;  3Q9D A;  2P58 C;  4GYW A;  4H9R C;  4L2L A;  3LYA A;  3AAA B;  5JR9 C;  4PFP A;  3O1I A;  4RSY A;  2V7K A;  4UIG A;  3ZJ2 A;  1E96 B;  2KWH A;  3C4X A;  4GML A;  4I17 A;  2CHX A;  3CHM A;  4MKT A;  3CML A;  3GW4 A;  3RC8 A;  3FUF A;  4A56 A;  3RYC E;  1HU3 A;  2PQR A;  4U63 A;  2MTQ A;  4V1A v;  1OWN A;  5FJY A;  3DTO A;  4WWN A;  4YND A;  2WWU A;  2P9B A;  2PFV A;  4DMV A;  4AQG A;  2JEK A;  3ZYQ A;  4RG6 A;  3C4W A;  2KAT A;  1Z3Y A;  2V1D B;  4I4T E;  4X1K E;  3PS6 A;  3K9I A;  3PUJ A;  3PH0 C;  3EIJ A;  1Z0P A;  3EDU A;  2JLB A;  5CMW A;  2BZB A;  3HA4 A;  5A6C A;  4EBA A;  3KVB A;  3ZIM A;  5BV1 A;  1E8Y A;  4UI9 C;  4IE6 A;  4ACK A;  3L09 A;  2KWI B;  2UXX B;  1HF8 A;  3PZD A;  4L2Y A;  2ES0 A;  4BT9 A;  3G2V A;  4PK5 A;  3HR0 A;  2GRM A;  3AA6 B;  4CI3 B;  2OVB A;  5CHE E;  4P29 A;  4WBO A;  4DMW A;  4DPR A;  1JWF A;  1UJK A;  4ASK A;  2WVI A;  5G04 C;  1E7U A;  5LOZ A;  4RG9 A;  3LY9 A;  2HO1 A;  4APO A;  2NW8 A;  3LEW A;  3U78 A;  4O4H E;  2D0T A;  4DLQ A;  3WAK A;  3NF1 A;  4AQF C;  2IQC A;  5EK4 A;  2AW6 A;  4HN9 A;  2N9D A;  2ZLY A;  3CVU A;  3CVW A;  3CHS A;  3LY8 A;  4Z8X A;  5E76 A;  4X20 E;  2JQQ A;  3SS1 A;  3MKR A;  4BJM A;  1G73 A;  4E7Z A;  3ML9 A;  2VB6 A;  3FTV A;  4PFO A;  5FY0 A;  4O4L E;  3RH3 A;  3ZMU B;  3FP3 A;  3FUI A;  2GRL A;  3U9W A;  2DLR A;  4PK4 A;  3VLD A;  1EPU A;  2V0P A;  2YU2 A;  2JMH A;  4O4J E;  1Z6T A;  2K24 A;  3JC6 C;  4O4I E;  3RRW A;  1E8W A;  3VU7 H;  4R7L A;  5CMY A;  4UXN B;  2XPZ A;  2PL2 A;  5FXX A;  4BTA A;  4I6G A;  4H63 H;  5TAO A;  1G8X A;  3N2G E;  3J7Y q;  2YK0 A;  3CQX C;  4GB9 A;  4HEA A;  1U5P A;  1B89 A;  3RC3 A;  4GCN A;  3SWH A;  5JRC A;  4WNE A;  3IV0 A;  1JWG A;  2XAJ B;  3EJN A;  1H19 A;  2VGX A;  2X6I A;  3SHF A;  4HOT A;  3PTR B;  4J8S A;  3FUH A;  2DIW A;  2W62 A;  2EHO A;  4EPZ A;  2XRY A;  3QB2 A;  2G0U A;  2YHE A;  4CZZ B;  3MKQ A;  5HI7 A;  5A7D B;  3G2T A;  2VSN A;  3CHO A;  4ANJ A;  4QHO A;  4UVB B;  4PUC A;  3CX8 B;  1KNZ A;  1EDU A;  5JDF A;  5LX8 A;  2QGS A;  4JLE A;  2BDE A;  4YFS A;  3PNL B;  2CXF A;  4H7Y A;  4HOQ A;  5FZQ A;  5KDM C;  3HDX A;  2XAQ B;  3ZMS B;  1LKX A;  3KIN B;  3EDV A;  4Q69 A;  5CB4 E;  5BV0 A;  3CEQ A;  4FLB A;  3C64 A;  3RRC A;  2J4B A;  1FEW A;  2C5I T;  1ELK A;  2NTX A;  3ZPO A;  5LHG B;  4I9C A;  4E85 A;  4H9Q C;  5DJQ C;  3N9L A;  3RYH E;  3IBE A;  4YVQ C;  3MA5 A;  1FMV A;  1ZV4 X;  3WAJ A;  4PH4 B;  4QFV A;  2LHR A;  2XCB A;  5FXW A;  2LSV A;  4N3A A;  3P8C D;  3DBS A;  3QKY A;  5JDL A;  3C51 A;  3N2K E;  3CK9 A;  2KIN B;  3RU0 A;  5EK2 A;  3KS2 A;  3B57 A;  4U0U A;  2ODV A;  1H2V C;  3IEG A;  2LJL A;  1HG5 A;  3I4R B;  2C5J A;  3BQK A;  3R7Q A;  5E0O A;  3ZN1 B;  4QWN B;  3I5P A;  2RD0 A;  2Q9Q B;  4ATG A;  4UWG A;  5L3E B;  2WMN A;  5ADX L;  3ZC1 A;  1S35 A;  2LAI A;  4OHF A;  5KJL A;  4P0B A;  4KVO A;  3QC9 A;  2FF4 A;  4ZHQ E;  4PJL A;  1D1B A;  4CRW A;  2KLQ A;  3TG5 A;  2NSZ A;  4KBM B;  4DBR A;  5ENN A;  3JC6 D;  2CLY B;  4K0U A;  2KXP B;  4CDM A;  2V7M A;  3PUQ A;  2V26 A;  3ZEF B;  4GCO A;  3RPU A;  3L08 A;  4FI5 A;  3OXL A;  1FVF A;  5L3C B;  2ODU A;  4EXT A;  3C50 A;  1ZBP A;  2IJG X;  4CT4 A;  4D10 C;  4ANX A;  5CCM A;  4V3I A;  4CDR A;  4JHR A;  2OV8 A;  1MMN A;  3MJX A;  4NAC A;  4EIW A;  4IIJ E;  1LRZ A;  2WXQ A;  4OYS A;  2VKO A;  4QXB B;  2IC6 A;  3WXX A;  2OOE A;  4GZ6 A;  4IRU A;  3UT7 A;  2CXD A;  3W15 B;  3HKB E;  3SRZ A;  3V5U A;  5LGU B;  4GYY A;  3I1A A;  2VK9 A;  5ARF A;  3AA1 B;  2DI4 A;  5JDM A;  1D0Y A;  2L0I A;  3LBX A;  4ERR A;  3URZ A;  4JUY A;  4IUL A;  5C8Y E;  3ZYL A;  4GZC A;  2KCK A;  2HH7 A;  4UF0 B;  2KZT A;  1ZEE A;  5AEN A;  3S7J A;  1VRB A;  4KT6 B;  3T5X A;  2Y4U A;  5JH7 E;  2VSX E;  4J8D A;  1BR2 A;  3D9M A;  3G2U A;  3FUD A;  5FQ7 A;  5A23 A;  2PG8 A;  4E7S A;  2X6H A;  3EIQ C;  1UCU A;  3S4U A;  4ILU A;  3LFM A;  3G2S A;  4GYR A;  1WM5 A;  2CFZ A;  3CVV A;  5L3G B;  4HOU A;  5CA1 E;  3AS4 A;  4G11 A;  2UXN B;  3CKD A;  5J90 A;  2Q9Q C;  2H7O A;  2DHR A;  5T4Y A;  4BY6 A;  2WXO A;  2XUE A;  1LVF A;  3ANW A;  5FY7 A;  4GMJ A;  4AXH A;  4EZL A;  4KZ0 A;  3Q5W A;  2WB2 A;  3U3I A;  4APF A;  4GA1 A;  2V7L A;  2W0G A;  3FFL A;  3QWV A;  4MHC A;  2CLY C;  2DCF A;  2LO6 A;  4Y6W A;  2VKJ A;  3R7R A;  3RO3 A;  2XAS B;  3FUJ A;  3O4Z A;  4JEH A;  4L7T A;  3AVS A;  4G1T A;  4QXC B;  4J8F A;  2LHN A;  4I43 A;  4J2C A;  3KEZ A;  3L13 A;  3LG7 A;  3U66 A;  3C98 A;  5FYM A;  5LCW J;  3PE4 A;  4PK6 A;  2IF4 A;  5JJT A;  5J2T E;  4AV7 A;  3UTK A;  5LCW C;  3E4B A;  3U64 A;  3ZHE A;  5F3J A;  2DWG A;  5HWX A;  2MHK A;  3U4T A;  4E6H A;  4ACL A;  5FQ4 A;  4MLP A;  3ZCI A;  3GZ2 A;  4IHJ E;  2FI7 A;  5LBM A;  4AY6 A;  2WAU A;  4A3V A;  3TL5 A;  3L54 A;  1QSD A;  1OWP A;  4B89 A;  2JJ9 A;  3QOU A;  5LOV E;  3RK6 A;  1SZ9 A;  1OUV A;  2C5K T;  1UX4 A;  3ZFW A;  3HKD E;  3NRY A;  3B7T A;  4G24 A;  5G55 A;  3D9L A;  5C2Y A;  3UMV A;  2PQN A;  3CLJ A;  4KZC A;  3CWZ B;  3K8P C;  3IHR A;  4AXP A;  3LY7 A;  4DJA A;  2WQH A;  4XI0 A;  4KMC A;  3CVY A;  3N5L A;  5FTP A;  2LSU A;  2R5S A;  3ETU A;  2CCQ A;  3VKH A;  4JEU A;  3TGO A;  2PJQ A;  5LHI B;  1WYC A;  2X6J A;  1BR0 A;  3QWP A;  4EYU A;  5LG4 A;  4F6R C;  2BVM A;  1ZU2 A;  4B94 A;  3ZYM A;  1SQM A;  3HHM A;  2XCC A;  3PUK A;  2OA5 A;  3PEU B;  3K3N A;  2X66 A;  4KVM A;  4TUU A;  3HKE E;  3KAE A;  2MYS A;  4H9O C;  3FXE B;  3LCA A;  4UV8 B;  2LM9 A;  1WR6 A;  2C0L A;  3TG4 A;  2NW7 A;  4H9N C;  1H2T C;  5JDH A;  2WXI A;  2NW9 A;  4AKR B;  5JJ7 A;  3QNK A;  3FB2 A;  1B7T A;  2CE7 A;  4RVB A;  3VTY A;  5JHB A;  2VL8 A;  3HKC E;  5LXT E;  2HM8 A;  4LRZ A;  2Q9Q D;  1SA0 E;  3D9K A;  5T3R A;  2FBN A;  3ZW3 A;  3EHM A;  4JL0 A;  4BAY B;  4PDX A;  4OK0 A;  3CVL A;  3FH7 A;  2Q7F A;  3PRZ A;  2E2E A;  4FC8 A;  3ASG A;  4KBQ A;  4YJ3 E;  2EQX A;  2XPI A;  3PDY A;  2VTB A;  3APD A;  3S7F A;  4DND A;  1H6K A;  1T98 A;  3LJC A;  1QUU A;  3UPV A;  4A1S A;  3ZVV A;  3RYF E;  4CI1 B;  1IQU A;  2KT9 A;  1WLX A;  3RKO A;  3PE3 A;  1MMD A;  3ZN3 A;  4O6F A;  2WXG A;  5JRC B;  3N71 A;  3NZQ A;  4UI9 J;  5D0Q D;  3SD5 A;  4GA0 A;  1WAO 1;  2YIN A;  3CIA A;  3B7R L;  5H6R B;  2WQ7 A;  3N9N A;  3ZMZ B;  3MZL B;  2WXR A;  4UQZ A;  2VKD A;  2J08 A;  2VGX B;  1OWL A;  2Y3A A;  5KJK A;  1YKE B;  2EHO B;  3MKQ B;  5G04 J;  3MX3 A;  3MK7 C;  2WXJ A;  5LYJ E;  2DWK A;  4I6J A;  4XKB A;  3D9O A;  1KLX A;  2ZM0 A;  2LSY A;  4X1Y E;  1INZ A;  2HYZ A;  4UQY A;  5ARG A;  4BJN A;  2XGS A;  5L3B B;  1IJ6 A;  5LP0 A;  4PS7 A;  4FHJ A;  3Q47 B;  3UFE A;  1JPL A;  1E8X A;  3F2E A;  2C0M A;  4IN3 B;  3RRM B;  3OJA A;  3CK8 A;  1Z3X A;  5M4Y A;  3ONK A;  4FUL A;  1IHG A;  1BR4 A;  4ZOL E;  5EDS A;  4NQ0 A;  3CV0 A;  4UEM A;  2KM4 A;  3ASD A;  2DNX A;  3PUS A;  3CVQ A;  3AS8 A;  1X79 A;  2LEH A;  2SPC A;  4WBN E;  2W63 A;  2NOX A;  1N52 A;  4FJZ A;  3GN5 A;  4M3O A;  4C9B B;  3JUI A;  4HE8 A;  2I6H A;  4QX7 B;  4EB6 E;  2IAK A;  5LNK A;  1OWO A;  4NUR A;  2RP4 A;  1IAP A;  1DVP A;  3BK9 A;  2WXN A;  4NRH B;  3MEK A;  5C1D A;  4A1G A;  1FCH A;  2X9W A;  3TKL B;  2KND A;  3PNT B;  5HXH A;  3CVP A;  3FUK A;  2Y8D A;  3CQC B;  3Q15 A;  5FY1 A;  4PW8 A;  3ZN0 B;  3MV2 B;  5DQW A;  4U72 A;  4XKC A;  4OYK A;  4C91 A;  4AJW A;  4JXT A;  3MCX A;  4H9S E;  3DP7 A;  5BMV E;  5KMG P;  3D3M A;  2KZ7 B;  1D1A A;  2A3D A;  2VQ2 A;  3ZLI A;  3BQI A;  4W9R A;  3FXD B;  3MV3 B;  3DJB A;  4Q94 A;  3P7I A;  2V7J A;  3APC A;  4X1I E;  5BUZ A;  3LVR E;  2LSJ A;  2D0U A;  4B8A A;  2XQ0 A;  2WXM A;  4JHK A;  1BPO A;  1HG2 A;  2ILR A;  1ELR A;  2WPV A;  4QX8 B;  2IW5 B;  3KV5 A;  4MFR A;  2XPY A;  3D9P A;  2WBL A;  3ASH A;  2EHO C;  1HX8 A;  2YHC A;  4MLK A;  4FAD A;  4KMO A;  2X6F A;  1SZA A;  2K5B B;  5J2U E;  4B0Z A;  1UN9 A;  3MAC A;  3UUN A;  2Y6X A;  4UWF A;  3B13 A;  5BW8 C;  2A2F X;  3S7B A;  3P2B A;  3OTN A;  4LCT A;  3H37 A;  3KFW X;  4L9I A;  4PNI A;  4HS2 A;  3OBV E;  3L3P A;  4GOU A;  4TX5 A;  4KYO B;  1U4Q A;  2CHW A;  3LBX B;  2JMK A;  3FUM A;  5AJL A;  4GAA A;  1YD8 G;  4IGU A;  2WM9 A;  3CX6 B;  3ESK A;  1WYB A;  4PS3 A;  2KZT B;  3F31 A;  3PE0 A;  3BQL A;  4AP2 A;  3ZPJ A;  3N9O A;  2E0I A;  4AY5 A;  3MKD A;  3R6N A;  2GK9 A;  1UX5 A;  5BT1 A;  4XAX B;  4JA7 A;  4AKI A;  4G63 A;  3VLF A;  4GZ3 A;  5ANL A;  2E9X A;  5FWQ A;  3SZ7 A;  2N2N A;  3GWH A;  4AKH A;  3QAR A;  3UUL A;  4YHJ A;  3EHN A;  1QQE A;  4B6X A;  3NBX X;  3ESL A;  4JW1 A;  3K3Q C;  4JVS A;  4DI3 A;  3CKB A;  4TV3 A;  4FA6 A;  4JC8 A;  3SOL A;  4TV8 E;  4HLE A;  2BUG A;  2ION A;  2DCP A;  2IOS A;  4FJY A;  2OVF A;  3GA8 A;  3T8O A;  3LPZ A;  3FDH A;  3AAI A;  1D0Z A;  3J9X 1;  3ANW B;  2X3M A;  4WW0 A;  2Z6E A;  5LA6 E;  4XX5 A;  1HS7 A;  3QC1 A;  1JUQ A;  1VDY A;  2NC9 A;  4WND A;  1S94 A;  2M63 A;  3FTW A;  3QK6 A;  4EZH A;  4ZI7 E;  4TUY E;  3CHR A;  4WAF A;  3I4G A;  3I9Y A;  4UI9 K;  1H2U A;  1GW6 A;  5JQG E;  3I3N A;  1SHZ C;  1PC2 A;  2PM7 A;  1NA0 A;  4ME2 A;  4I43 B;  3L17 A;  3LS8 A;  3LXU X;  3FU0 A;  2X9H A;  1E90 A;  3ZCJ A;  3HL6 A;  2AXV A;  3SNX A;  3RRU A;  4P09 A;  3C98 B;  3FU3 A;  2VAS A;  4PAG A;  4F1S A;  3CST A;  3ZHE B;  2B1E A;  2I1K A;  4DLO A;  4I50 E;  3LJ3 A;  4GZD A;  4CDN A;  3PVL A;  4UWH A;  3SGH A;  4IYP A;  5AJD A;  4XZ4 A;  4BTB A;  2EHO D;  4I1M A;  1MMA A;  4FJO A;  3ZYK A;  4U0S A;  2XGO A;  3LK3 B;  4CXW A;  5F8P A;  5J1G A;  4CGW A;  3LK4 2;  5HXE A;  4DI4 A;  3ETV A;  3UX4 A;  2XRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...