5EN5D

Apo structure of bacterial efflux pump.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
161
structure length
161
Chain Sequence
HHHHHGSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Multidrug efflux pump subunit AcrB,Multidrug efflux pump sub
publication title Molecular basis for inhibition of AcrB multidrug efflux pump by novel and powerful pyranopyridine derivatives.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
total genus 50
structure length 161
sequence length 161
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2015-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5en5D00
2ZGGA 5JMND 4N5QA 3V2OA 3V31A 1NFIE 2L6BA 3AJIA 1IXVA 4DUIA 1MYOA 5EILA 5CEAA 4OAVB 3LJNA 2DWZA 1BI7B 1YMPA 2B0OE 3DEOA 2DZOA 4HI9A 4O60A 2F37A 4F6RD 4LSZE 2QYJA 2XENA 4HB5A 4HRMB 4GPMA 3T9KA 2ETAA 1N11A 3UI2A 2RFMA 4BESA 2J8SD 4GMRA 2XEEA 4UUCA 1IHBA 2HE0A 4G8KA 2BKKB 4RLYA 4U95D 3UXGA 5EIBE 3TWSA 3B95A 3V79K 4QFVA 2ETCA 2V4HC 5BXUA 4YDWA 1BU9A 2VGEA 3NOCD 3SO8A 3C5RA 3EHQA 1K1BA 5EYPF 2PNNA 3ZNGA 1BLXB 1MX4A 4HQDA 4DX6D 2RFAA 5JA4D 3TWXA 5HKPA 1D9SA 1K1AA 3AAAC 3ZU7B 4YDYA 4DX2A 3TWUA 2XEHA 4BSZB 5KWDA 1OY3D 5KBAA 3ZUVB 2ETBA 4J7WA 4LNUD 4HNAD 1DCQA 1SVXA 1N0QA 1UOHA 3D9HA 4U8YD 4DX1A 3Q9NC 1YYHA 1K3ZD 4OAUC 4DRXE 1MX6A 5HRYA 1AP7A 3TWQA 2ZGDA 1IKND 2A5EA 5AARA 2QC9A 4A63B 2P2CP 3TWRA 1G3NB 5ENQD 5AQBA 5AAOA 4HBDA 1BI8B 3JXIA 5ENPD 3TWWA 3ZKJA 1TR4A 4O1PA 5AQ9A 2Y0BG 1N0RA 4HI8A 1QYMA 4HRNA 5CECB 4LG6A 2JABA 4K5BA 5CERB 4B93B 2KBXA 4K5CA 3V30A 4BETA 4DX5D 1A5EA 1MJ0A 5EIDA 4J8YA 4NIKA 4G8LA 2KXPC 2XZTG 5CBNA 2XZDG 1AWCB 4Z68A 5ENOD 5AQAA 4ZHBA 5FINA 1YCSB 5AQ7A 4K5AB 3J5QB 5KNGA 4ATZD 1MX2A 2F8XK 4HLLA 3F6QA 4HRLA 4CZ2D 3EHRA 4TUMA 4JB8P 4U96D 3HRAA 4C48B 4ZFHA 3TWVA 2FO1E 2V5QC 5ENSD 3NOGD 5D66A 3T8KA 3IXEA 4DX7D 3TWTA 3B7BA 5ITZF 1DC2A 5KNHD 4O1OA 3JXJA 2DZNA 1WG0A 5FIOA 1OT8A 2AJAA 3JUEA 3DEPA 3NBNB 3V2XA 4U8VD 3KEAA 2DVWA 3EU9A 4QQIA 4F1PA 3W9GA 5EN5D 3W9FA 3J5PA 4BERA 5ENRD 4BEPA 1WDYA 2MYOA 2Y1LE 1BD8A 5ENTD 5HS0A 5AN8A 1SW6A 4CYMD 5CEDB 1S70B 2BKGA 3Q9UC 5EYLA 2F8YA 2NYJA 5CBOA 5BXOA 3HG0D 3UTMA
chains in the Genus database with same CATH superfamily
2P9LG 3S7FA 3AS5A 3HXBA 1TEZA 3L82A 4DI4A 4OAVB 3LY9A 2YHEA 4K03A 4XI0A 3JCKC 1OCOE 2ZISA 2J07A 2Y3AA 1NP7A 3Q79A 2ETAA 3SD5A 2WXKA 3EUVA 2JLBA 3ZHEA 1UN8A 3V79K 2WXMA 2AVPA 3BG1B 4P29A 3PZ4A 2XRZA 3SQVA 5D0QD 1OWOA 3AS8A 3TWQA 3FU5A 3ZGQA 4U0UA 1KLXA 3QOUA 2I2OA 3FTUA 4B94A 3FTSA 1B89A 5G04J 1YA0A 2JEKA 2P9UG 2LXMA 4E6HA 3LJ3A 4Z68A 3UPVA 4AEZC 1HG5A 2ZIRA 3AS4A 2WXHA 3NB2A 3IEGA 2XPZA 1WG0A 3MKQA 3G2TA 3BUAA 2DCPA 4ANWA 2R05A 3ASOE 3FTWA 3CK9A 2VYIA 1HFAA 3V2OA 3CHOA 4N3AA 4CCAA 4DUIA 4LERA 4OYSA 4A3TA 2I9CA 2X6HA 2J49A 2WXOA 3KS2A 3E32A 1MQSA 3UM2A 2NXPA 1EPUA 2H6GA 2YHCA 4WUYA 4F6RD 5LFAA 4GPKA 1P5QA 4HOSA 2HM8A 3PZ2A 2P9IG 2J8SD 4KYOB 3CK8A 4MBGA 4Y6CA 3QK0A 1SZAA 3S7BA 2OOEA 3ZVVA 3ZNGA 1MX4A 4ANXA 1X5BA 2RFAA 5JA4D 3TWXA 3ABME 1H19A 3D9NA 3Q47B 4J6IA 4MRUA 4TUUA 4BFRA 3LKUA 2FULA 2QC9A 4ACKA 5FTPA 1KT0A 2EIKE 2J9QA 3ML9A 4BETA 1UN9A 4BX8A 1IQRA 2LXLA 4GB9A 4XZ4A 1NA3A 1YCSB 4ATZD 2LNIA 4HLLA 1H2UA 1IQUA 4HRLA 4LRZA 3ABLE 4ME2A 3QWWA 4EBAA 4A1SA 3CVPA 3DEPA 3EU9A 3I4RB 3W9GA 3J5PA 2PM7A 5CCMA 4BEPA 1Z3YA 2GRPB 2Y1LE 3VTYA 5CEDB 4XIFA 2KZTA 4EZJA 4I43A 4C0MA 2VSOE 2XCBA 3CVQA 4U04A 2F37A 4F53A 3T5XA 1N4RA 4GMRA 4WNDA 3UUXA 2EINE 4M3OA 4OVUA 4I9EA 3TG4A 3ONKA 4YDWA 4GTOA 2J4DA 5FJYA 3QJZA 2CG3A 4DX2A 1LF8A 2L0TB 2XEHA 4FHJA 1OY3D 2I1JA 2ETBA 1SQMA 4HNAD 4NACA 1N0QA 3BU8A 3SBSA 1MX6A 2KC7A 4KVMA 4A63B 4I6EA 2WXLA 3AU4A 4O1PA 4U63A 3I4GA 3PZ1A 1O1TA 3DRAA 3C72A 4K5CA 4PS7A 2KCKA 4KBQA 2BEDA 4UI9J 2FF4A 2XGOA 2KATA 1MZCA 4I9CA 4YDOA 2WQ7A 2HYZA 4ZHBA 3MA5A 4F1SA 3RSEG 3HXFA 3UT7A 5JJ6A 4N3BA 3CKCA 3FEXA 3CVNA 1RZ4A 1W3BA 5EX0A 4JA7A 2WB2A 1JCQA 3W9FA 1U2VG 3PNTB 4BERA 5DBKA 1BD8A 3SY2A 2CFUA 1SW6A 4G26A 2MHKA 4D10C 1KZPA 4DJAA 3E4BA 2VSYA 5ANLA 1EF1C 4N5QA 4LNGA 4HLEA 2LUHA 2L0IA 5KJKA 5KJLA 2GRMA 2J09A 4O60A 2DZOA 5BPPA 1H2TC 3PEUB 4HB5A 4GPMA 2XEEA 3C3RA 3CR3A 1IHBA 2XGSA 1LTXA 5CCLA 3ASNE 1HE8A 4A3VA 5BUZA 4N2QA 4JXTA 3NZSA 2WXQA 2QYUA 3E30A 3ZPJA 2IEJA 4GZCA 5HRYA 4W9RA 2X6JA 5E75A 4J8DA 3FFLA 3CGHA 1TR4A 5D2MC 3SGHA 4LG6A 3FHEA 1HXIA 4GCNA 3CIAA 3URZA 1E7UA 2PQRA 5BW8C 5G05J 3C3QA 1AWCB 3CQCB 3PNLB 1EDUA 2DYSE 3PEVB 5AQ7A 3WXXA 5KNGA 3EJNA 5A7DB 3ZXSA 3T8KA 3MX3A 3Q7AA 2WXGA 4NQ0A 4HVBA 3LEWA 4GTRA 4LCTA 3PRZA 1O1RA 1OCCE 5BXOA 1N4PA 4LNBA 1KT1A 4UWLA 2CHXA 3QWPA 5EKQD 4EPZA 4XX5A 5ENNA 3DEOA 5T8IA 2A4ZA 3DBSA 3UKUG 3IHVA 5A6CA 4F3VA 5BV0A 4G8KA 2BKKB 1BU9A 4KZ0A 3EHQA 2XCCA 2R03A 4YDYA 1FVFA 4B0ZA 3KAEA 2E2EA 2VQ2A 3Q75A 2WXIA 5AQBA 3L6AA 3TG5A 4XI9A 5CECB 3CHRA 4DX5D 3V30A 3D9LA 3U64A 2WXRA 1XNFA 2WMNA 3R9MA 2H6FA 2ZXWE 3UX4A 3L22A 1HG2A 4K5AB 3CV0A 4B89A 5KJNA 2FO1E 4ZFHA 3FH7A 3FEYA 3JQ0A 5DIZA 4GTQA 3Q78A 4LUNU 4BTBA 1S64A 1VDYA 4DK5A 2F8YA 3FUEA 1U3DA 2BTDA 1DNPA 5C1DA 1NFIE 3MV3B 1IXVA 5CEAA 4U8HA 2EIME 2J08A 2DWZA 1INZA 3Q4AB 4ANVA 4N5CA 3B7RL 3R7RA 4FC8A 2QYJA 2XENA 1Y8MA 3T9KA 1JPLA 3TAXA 2XS8A 2ILRA 2H6IA 3UXGA 5FQ6A 4RVBA 4HORA 3ML8A 4MS6A 3OAWA 5JHAA 1N52A 3KSQA 3QNKA 3FUIA 3LY7A 2PM6A 1D9SA 3TWUA 3VLEA 3WG7E 5ARGA 5KWDA 4J7WA 1V55E 4GAAA 5D0OD 2P9NG 1TNBA 4KT6B 5BNWA 4XKBA 3PUJA 4CRWA 3L9TA 2WM9A 4K5BA 3S7JA 2GRQB 4HOTA 2KBXA 1JCSA 4JHKA 4UI9K 2KCVA 4J8YA 4UI9C 2KXPC 1UJKA 3R9AB 3RRMB 1Z6TA 2IO2C 4L23A 4GU5A 3EIQC 3FH5A 3FUHA 3ESLA 4KMOA 3IXEA 1IHGA 2UY1A 1HS6A 3S2AA 4DX7D 3E33A 4UWFA 4GYWA 3UIPC 1V54E 3ISMC 2PL2A 2IQCA 4U8VD 4F1PA 3FU0A 1TN8A 3D9OA 4ACLA 4E85A 2OVFA 1OWPA 4TXQA 2X6KA 1A17A 3ZN3A 1MYOA 3CSTA 2XPIA 5ARFA 3ULQA 4URKA 3FUMA 4B8AA 4BY6A 2GRNB 4JW1A 3BEEA 2YQ8A 1HZ4A 3NOCD 4DI3A 4R7LA 2B6CA 4L7TA 2IFUA 3CK7A 4GCOA 4CGWA 3R7QA 3CKBA 3RO3A 4G25A 3TWRA 4PH4B 3HXDA 3G2UA 3HVEB 3PE3A 4BT9A 2JABA 1U3CA 5HI7A 4GA1A 5LOZA 4AIFA 2ZU6B 4L1BA 3MEKA 3ZW3A 3RRNB 3NAWA 1D8DA 2XZTG 2XZDG 5G05C 5AQAA 1K8KG 2IJGX 3K9IA 2AXVA 4TXRA 5AENA 4CZ2D 5CRUA 4U96D 3UM0A 5D66A 2IY0C 1H2VC 3ZYQA 1KPSB 1TN6A 3DPDA 5FIOA 1OT8A 3KEAA 4QQIA 5FQ8A 3L16A 5EN5D 1TNYA 2IF4A 4EECA 3QARA 3CVLA 5AN8A 4CYMD 4G11A 3ZYMA 3PDNA 1PAQA 3V31A 4HOQA 2L6BA 1HX8A 4I6GA 3Q7FA 3D9PA 2OV8A 4V3IA 3NF1A 3CVWA 3B7TA 1E96B 3P2BA 4FLBA 3MYVA 2IU1A 5AYWD 2P9SG 4NRHB 3IV0A 2V4HC 4IYPA 4GA2A 2PNNA 5IY5E 2LAHA 1TYQG 4IRUA 4G24A 1OWNA 3ZUVB 2WQ6A 4DX1A 2HR2A 1FCHA 3TJPA 4UQZA 3BQOA 3CQGB 2XQ0A 3ZKJA 5AQ9A 3CLJA 4A1GA 2VTBB 3O4ZA 5B3SE 2R5SA 2XS1A 4EHMA 3HIZA 1OWMA 1IYGA 1QNFA 5LP0A 1TJCA 3SHFA 5CBNA 1ELKA 4U7EB 2OCCE 2BUGA 2EQXA 1PC2A 1MX2A 2F8XK 3ULYA 4EQFA 2LAIA 4AVXA 5ENSD 3NOGD 3ESKA 4ABNA 4H7YA 3EIJA 5G55A 4FHKA 3UQ3A 3APDA 1OWLA 3UKRG 4FJYA 3ZHEB 2MYOA 3LPZA 3Q9UC 4WWPA 1FVHA 1KZOA 3VLFA 1QBQA 2MOWA 3I3NA 4HI9A 3GZ2A 5CRVA 4AP2A 4WWNA 2VGXA 2VSXE 3AG3E 3PS6A 1BPOA 4GTVA 4RLYA 4U95D 5T3RA 4B8CB 4CT0A 2DIWA 4KZCA 3C5RA 1BLXB 3FTYA 3LVQE 3E34A 4DX6D 3ZU7B 1TJFA 4YDEA 3TGOA 4U8YD 2AW6A 2GRLA 1IKND 2A5EA 4JHJA 4ATGA 3TWWA 1N0RA 3T8MA 4AJWA 4J0UA 2HO1A 1FPPA 1H0AA 2I6HA 3MKQB 1E8WA 4A55A 2V8SE 1LD7A 4N39A 3QWVA 5CHEE 5FQ7A 3FUKA 2X6FA 2C0LA 2GGFA 2R17C 3IKOB 4EZKA 1A5EA 2V5QC 3TWTA 4UWKA 3ENEA 4EBAG 3PZ3A 2CHWA 3FDHA 3JXJA 5BV1A 3FWVA 4JZYA 3JUEA 2DVWA 4ILGA 4GZ6A 1H6PA 5ENRD 4RG9A 3LXUX 3IBEA 2BKGA 4JC8A 4L9PA 1DVPA 4J8EA 2C0MA 2WXNA 1JCRA 1ELRA 4JA9A 3FY4A 4U07A 3JQ1A 3MZLB 1OCZE 3SBTB 3OTNA 2L6JA 3SI5A 1N95A 3TXNA 4JEUA 2RKKA 5BXUA 5KJMA 3GZ1A 3HHMA 2FEZA 3U9WA 4OVVA 4LNUD 1DCQA 4DLQA 1TNZA 1K3ZD 5AARA 3Q49B 3RO2A 3KD7A 5KCMA 1S0PA 2EILE 2FI7A 3AG4E 3LVRE 4FU3A 2LSUA 3HVEA 3U3WA 3PREA 4GA0A 3ZRHA 4N2SA 1O1SA 3CEQA 2QZAA 1ELWA 4JVSA 3D9MA 4CEMA 2P9KG 4YNDA 4C48B 4LEUA 1N9AA 1DC2A 4FULA 4GMJA 4RSYA 4YVQC 1N4QA 2F0YA 4U0SA 2DYRE 1E8XA 2AJAA 3VTXA 1N4SA 2WVIA 3LCAA 3QB2A 1MHQA 1OCRE 5ENTD 3CVXA 5FZSA 3C3OA 3DPYA 2WXFA 1BI7B 3G2SA 4ANUA 3TL5A 2UWJG 3SF4A 2YINA 1RW2A 2QY7A 4IULA 4GMLA 5EIBE 4FADA 3X2QE 1LD8A 2PQNA 1Q2ZA 3N71A 1ZBPA 2OEWA 3U66A 5FQ4A 1WAO1 5T4YA 3RK6A 1H6OA 4GYOA 2V5FA 2M63A 1AP7A 4I2WA 2IONA 3ASGA 2KCLA 1DCEA 1S63A 1BI8B 3UINC 2Y0BG 4HI8A 1FT1A 3DWLG 4DPRA 5J08A 3T5VA 3ZIMA 3JUIA 5LCWJ 3DXKG 3FTVA 3D9JA 1EYHA 1XGWA 1MJ0A 5EIDA 4BSXA 3UMVA 3PH0C 5LX8A 1JWFA 3EHMA 3G2VA 1Z3XA 1X81A 5A23A 1HU3A 1TNUA 4TUMA 3TWVA 4GYYA 3B7UX 3L17A 5KNHD 4O1OA 4RQIA 2DZNA 3UT4A 1E8ZA 5G2NA 2I1KA 3C98A 4FP7A 4Q94A 3GW4A 1H6KA 2RG8A 2RD0A 2ZGGA 1WY6A 2VJ8A 3QDNA 2B0OE 2OEVA 4AM9A 3GYZA 4FA6A 1N11A 2P9PG 5FT9A 4APOA 2HE0A 2LO6A 3TWSA 4GTMA 3SZ7A 1K1BA 5EYPF 5AIJA 3CVYA 4MLPA 3QC1A 4BT8A 4HFGA 4BSZB 3PUKA 1SVXA 1O5MA 3D9HA 3Q9NC 3G2WA 2AWIA 3UM1A 1JUQA 2P2CP 5AAOA 3D3MA 3JXIA 3ABKE 4CT4A 4JHRA 5CERB 3CVVA 4B93B 3SFYA 3EDTB 4CDRA 2GRRB 4NIKA 2Y4TA 3B13A 4ILHB 2X38A 3NZUA 4IN3B 4GTPA 3LS8A 3ULEG 3EHRA 3PE4A 3SFXA 2WMOA 4FJZA 4I1OB 5CMWA 3B7SA 3CVUA 3QKYA 3CHMA 3NBNB 3DSXA 2OVBA 3HDXA 3APFA 2J4BA 1S70B 4UQXA 4GZ5A 3FUJA 3HG0D 1UG3A 2CHZA 4G23A 4K0RA 5AJLA 5EILA 5B1AE 2IOSA 4G2VA 3ZFWA 2VGYA 4HXIA 3RJVA 3LY8A 3FU3A 5FWQA 2Y4UA 4L2YA 4QFVA 5JHBA 2C2LA 3MJWA 3ZYLA 4HQDA 1N94A 4M7CA 4CGVA 1TN7A 5BT1A 3APCA 3DSVA 3Q15A 5B1BE 3CSFA 1YYHA 4UWHA 3U4TA 4DRXE 2ZGDA 3DSUA 3O48A 4HBDA 4MKTA 4J8FA 3D9IA 3FULA 3OXFA 3L13A 4AV7A 4NURA 4O6FA 4I1MA 3DSWA 3UIOC 1E90A 2PZIA 2NSZA 2XHEA 2R02A 3KSLA 3J5QB 1UJJA 2A5UA 3CHSA 4PS3A 3HRAA 3IHYA 1QZ2A 2XEVA 2VSNA 3RU0A 2L9BA 3P1UA 1WDYA 3VLDA 2CG2A 3I5PA 3FU6A 2X6IA 3RIBA 3UTMA 3V2XA 2LSVA 4Q69A 2MRIA 3ASFA 4TXPA 5JMND 3FUFA 3LYAA 3RRUA 3SFZA 3HXCA 1UW4B 2V0PA 5AJDA 4HRMB 1FT2A 4ILIA 3LDZA 3FUNA 1SA5A 3RKVA 4APFA 2VGEA 1L5JA 3HYMB 4G1TA 4TV3A 4C9BB 4JEHA 4GTSA 2NC9A 3TXMA 3Q5MA 2QFCA 3RAUA 3L08A 2AXZA 5HKPA 1K1AA 3KEZA 5FZRA 4EZLA 2IO3C 5KBAA 1SZ9A 4KXKB 5H7PA 5JJTA 4BWRA 1G3NB 1E8YA 4TRQA 3OXLA 4I1AA 2UY1B 4GTTA 2EIJE 3DSSA 4I6JA 5LCWC 2P58C 4JL0A 3L54A 3ZEFA 1N54A 4AY5A 4UQYA 3AU5A 3D9KA 2WPVA 5FINA 4WNGA 3FTZA 2GROB 4JB8P 3PZDA 1HO8A 5ITZF 4HS2A 4Y6WA 4I17A 4GZ3A 4AOFA 4JPSA 2BF0X 1E7VA 5HS0A 4H7XA 4PS8A 2KM4A 4J8SA 3AJIA 4GZDA 4CDMA 3LJNA 4XE0A 1YMPA 1PY1A 2GW1A 3DXMG 4LSZE 3UI2A 4F7AA 4JD2G 5C2YA 2DBAA 3SO8A 5G04C 3MKRA 4XEIG 4RG6A 4BX9A 2CFZA 3AAAC 1NL4A 1WM5A 2R2LA 4OAUC 3Q73A 5JJ7A 1Z5SC 5FZQA 1GW6A 5ENQD 3PVLA 1HH8A 1JWGA 3CHQA 1QYMA 4XKCA 3NQPA 3MGBA 3DSTA 3ZYKA 3ZXPA 4L2LA 4X8QA 1Y6IA 4G8LA 3AG1E 5M72A 3GZSA 3B7BA 4AY6A 4I2ZA 5EDSA 5EX3A 3FTXA 2ONDA 4C0EA 3SNXA 2X3MA 3EHNA 3ASDA 3JYSA 5EYLA 1ZU2A 2KZTB 2NYJA 5CBOA 2Q7FA 1OUVA 3AG2E 2IOLA 2FBNA 3UM3A 3S7DA 4DLOA 2RFMA 4WNEA 4BESA 4UUCA 3UT8A 4UWGA 2WQHA 1TNOA 2E0IA 3B95A 2ETCA 2V4LA 3FH8A 3MV2B 3ONLA 4AXHA 1NZNA 2YNQA 4PUCA 5HQ8A 4WNFA 3OXGA 3FP3A 4PDXA 2AXUA 1OXJA 2H6HA 1UOHA 2WXPA 2XRYA 1QQEA 3QAQA 1SA4A 3EU5A 4Q96A 5ENPD 4N3CA 1NA0A 4HRNA 1HF8A 4WWOA 2XPYA 4U0ZA 4HOUA 5ENOD 2R59A 5E76A 1D8EA 3F6QA 3BG0B 2FO7A 5CMYA 2Y69E 5ANRA 3ASHA 2VTBA 3FUDA 4FLHA 2VGXB 5J90A 1ZB1A 3E37A 4BTAA 4KVOA 3HXEA 3CHPA 2XGMA 2WXJA 4WAFA 1NI1A 4YVOA 4CDNA 3MCXA
chains in the Genus database with same CATH topology
2ZGGA 5JMND 4N5QA 3V2OA 3V31A 1NFIE 2L6BA 3AJIA 1IXVA 4DUIA 1MYOA 5EILA 5CEAA 4OAVB 3LJNA 2DWZA 1BI7B 1YMPA 2B0OE 3DEOA 2DZOA 4HI9A 4O60A 2F37A 4F6RD 4LSZE 2QYJA 2XENA 4HB5A 4HRMB 4GPMA 3T9KA 2ETAA 1N11A 3UI2A 2RFMA 4BESA 2J8SD 4GMRA 2XEEA 4UUCA 1IHBA 2HE0A 4G8KA 2BKKB 4RLYA 4U95D 3UXGA 5EIBE 3TWSA 3B95A 3V79K 4QFVA 2ETCA 2V4HC 5BXUA 4YDWA 1BU9A 2VGEA 3NOCD 3SO8A 3C5RA 3EHQA 1K1BA 5EYPF 2PNNA 3ZNGA 1BLXB 1MX4A 4HQDA 4DX6D 2RFAA 5JA4D 3TWXA 5HKPA 1D9SA 1K1AA 3AAAC 3ZU7B 4YDYA 4DX2A 3TWUA 2XEHA 4BSZB 5KWDA 1OY3D 5KBAA 3ZUVB 2ETBA 4J7WA 4LNUD 4HNAD 1DCQA 1SVXA 1N0QA 1UOHA 3D9HA 4U8YD 4DX1A 3Q9NC 1YYHA 1K3ZD 4OAUC 4DRXE 1MX6A 5HRYA 1AP7A 3TWQA 2ZGDA 1IKND 2A5EA 5AARA 2QC9A 4A63B 2P2CP 3TWRA 1G3NB 5ENQD 5AQBA 5AAOA 4HBDA 1BI8B 3JXIA 5ENPD 3TWWA 3ZKJA 1TR4A 4O1PA 5AQ9A 2Y0BG 1N0RA 4HI8A 1QYMA 4HRNA 5CECB 4LG6A 2JABA 4K5BA 5CERB 4B93B 2KBXA 4K5CA 3V30A 4BETA 4DX5D 1A5EA 1MJ0A 5EIDA 4J8YA 4NIKA 4G8LA 2KXPC 2XZTG 5CBNA 2XZDG 1AWCB 4Z68A 5ENOD 5AQAA 4ZHBA 5FINA 1YCSB 5AQ7A 4K5AB 3J5QB 5KNGA 4ATZD 1MX2A 2F8XK 4HLLA 3F6QA 4HRLA 4CZ2D 3EHRA 4TUMA 4JB8P 4U96D 3HRAA 4C48B 4ZFHA 3TWVA 2FO1E 2V5QC 5ENSD 3NOGD 5D66A 3T8KA 3IXEA 4DX7D 3TWTA 3B7BA 5ITZF 1DC2A 5KNHD 4O1OA 3JXJA 2DZNA 1WG0A 5FIOA 1OT8A 2AJAA 3JUEA 3DEPA 3NBNB 3V2XA 4U8VD 3KEAA 2DVWA 3EU9A 4QQIA 4F1PA 3W9GA 5EN5D 3W9FA 3J5PA 4BERA 5ENRD 4BEPA 1WDYA 2MYOA 2Y1LE 1BD8A 5ENTD 5HS0A 5AN8A 1SW6A 4CYMD 5CEDB 1S70B 2BKGA 3Q9UC 5EYLA 2F8YA 2NYJA 5CBOA 5BXOA 3HG0D 3UTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZGG A;  5JMN D;  4N5Q A;  3V2O A;  3V31 A;  1NFI E;  2L6B A;  3AJI A;  1IXV A;  4DUI A;  1MYO A;  5EIL A;  5CEA A;  4OAV B;  3LJN A;  2DWZ A;  1BI7 B;  1YMP A;  2B0O E;  3DEO A;  2DZO A;  4HI9 A;  4O60 A;  2F37 A;  4F6R D;  4LSZ E;  2QYJ A;  2XEN A;  4HB5 A;  4HRM B;  4GPM A;  3T9K A;  2ETA A;  1N11 A;  3UI2 A;  2RFM A;  4BES A;  2J8S D;  4GMR A;  2XEE A;  4UUC A;  1IHB A;  2HE0 A;  4G8K A;  2BKK B;  4RLY A;  4U95 D;  3UXG A;  5EIB E;  3TWS A;  3B95 A;  3V79 K;  4QFV A;  2ETC A;  2V4H C;  5BXU A;  4YDW A;  1BU9 A;  2VGE A;  3NOC D;  3SO8 A;  3C5R A;  3EHQ A;  1K1B A;  5EYP F;  2PNN A;  3ZNG A;  1BLX B;  1MX4 A;  4HQD A;  4DX6 D;  2RFA A;  5JA4 D;  3TWX A;  5HKP A;  1D9S A;  1K1A A;  3AAA C;  3ZU7 B;  4YDY A;  4DX2 A;  3TWU A;  2XEH A;  4BSZ B;  5KWD A;  1OY3 D;  5KBA A;  3ZUV B;  2ETB A;  4J7W A;  4LNU D;  4HNA D;  1DCQ A;  1SVX A;  1N0Q A;  1UOH A;  3D9H A;  4U8Y D;  4DX1 A;  3Q9N C;  1YYH A;  1K3Z D;  4OAU C;  4DRX E;  1MX6 A;  5HRY A;  1AP7 A;  3TWQ A;  2ZGD A;  1IKN D;  2A5E A;  5AAR A;  2QC9 A;  4A63 B;  2P2C P;  3TWR A;  1G3N B;  5ENQ D;  5AQB A;  5AAO A;  4HBD A;  1BI8 B;  3JXI A;  5ENP D;  3TWW A;  3ZKJ A;  1TR4 A;  4O1P A;  5AQ9 A;  2Y0B G;  1N0R A;  4HI8 A;  1QYM A;  4HRN A;  5CEC B;  4LG6 A;  2JAB A;  4K5B A;  5CER B;  4B93 B;  2KBX A;  4K5C A;  3V30 A;  4BET A;  4DX5 D;  1A5E A;  1MJ0 A;  5EID A;  4J8Y A;  4NIK A;  4G8L A;  2KXP C;  2XZT G;  5CBN A;  2XZD G;  1AWC B;  4Z68 A;  5ENO D;  5AQA A;  4ZHB A;  5FIN A;  1YCS B;  5AQ7 A;  4K5A B;  3J5Q B;  5KNG A;  4ATZ D;  1MX2 A;  2F8X K;  4HLL A;  3F6Q A;  4HRL A;  4CZ2 D;  3EHR A;  4TUM A;  4JB8 P;  4U96 D;  3HRA A;  4C48 B;  4ZFH A;  3TWV A;  2FO1 E;  2V5Q C;  5ENS D;  3NOG D;  5D66 A;  3T8K A;  3IXE A;  4DX7 D;  3TWT A;  3B7B A;  5ITZ F;  1DC2 A;  5KNH D;  4O1O A;  3JXJ A;  2DZN A;  1WG0 A;  5FIO A;  1OT8 A;  2AJA A;  3JUE A;  3DEP A;  3NBN B;  3V2X A;  4U8V D;  3KEA A;  2DVW A;  3EU9 A;  4QQI A;  4F1P A;  3W9G A;  5EN5 D;  3W9F A;  3J5P A;  4BER A;  5ENR D;  4BEP A;  1WDY A;  2MYO A;  2Y1L E;  1BD8 A;  5ENT D;  5HS0 A;  5AN8 A;  1SW6 A;  4CYM D;  5CED B;  1S70 B;  2BKG A;  3Q9U C;  5EYL A;  2F8Y A;  2NYJ A;  5CBO A;  5BXO A;  3HG0 D;  3UTM A; 
#chains in the Genus database with same CATH topology
 2P9L G;  3S7F A;  3AS5 A;  3HXB A;  1TEZ A;  3L82 A;  4DI4 A;  4OAV B;  3LY9 A;  2YHE A;  4K03 A;  4XI0 A;  3JCK C;  1OCO E;  2ZIS A;  2J07 A;  2Y3A A;  1NP7 A;  3Q79 A;  2ETA A;  3SD5 A;  2WXK A;  3EUV A;  2JLB A;  3ZHE A;  1UN8 A;  3V79 K;  2WXM A;  2AVP A;  3BG1 B;  4P29 A;  3PZ4 A;  2XRZ A;  3SQV A;  5D0Q D;  1OWO A;  3AS8 A;  3TWQ A;  3FU5 A;  3ZGQ A;  4U0U A;  1KLX A;  3QOU A;  2I2O A;  3FTU A;  4B94 A;  3FTS A;  1B89 A;  5G04 J;  1YA0 A;  2JEK A;  2P9U G;  2LXM A;  4E6H A;  3LJ3 A;  4Z68 A;  3UPV A;  4AEZ C;  1HG5 A;  2ZIR A;  3AS4 A;  2WXH A;  3NB2 A;  3IEG A;  2XPZ A;  1WG0 A;  3MKQ A;  3G2T A;  3BUA A;  2DCP A;  4ANW A;  2R05 A;  3ASO E;  3FTW A;  3CK9 A;  2VYI A;  1HFA A;  3V2O A;  3CHO A;  4N3A A;  4CCA A;  4DUI A;  4LER A;  4OYS A;  4A3T A;  2I9C A;  2X6H A;  2J49 A;  2WXO A;  3KS2 A;  3E32 A;  1MQS A;  3UM2 A;  2NXP A;  1EPU A;  2H6G A;  2YHC A;  4WUY A;  4F6R D;  5LFA A;  4GPK A;  1P5Q A;  4HOS A;  2HM8 A;  3PZ2 A;  2P9I G;  2J8S D;  4KYO B;  3CK8 A;  4MBG A;  4Y6C A;  3QK0 A;  1SZA A;  3S7B A;  2OOE A;  3ZVV A;  3ZNG A;  1MX4 A;  4ANX A;  1X5B A;  2RFA A;  5JA4 D;  3TWX A;  3ABM E;  1H19 A;  3D9N A;  3Q47 B;  4J6I A;  4MRU A;  4TUU A;  4BFR A;  3LKU A;  2FUL A;  2QC9 A;  4ACK A;  5FTP A;  1KT0 A;  2EIK E;  2J9Q A;  3ML9 A;  4BET A;  1UN9 A;  4BX8 A;  1IQR A;  2LXL A;  4GB9 A;  4XZ4 A;  1NA3 A;  1YCS B;  4ATZ D;  2LNI A;  4HLL A;  1H2U A;  1IQU A;  4HRL A;  4LRZ A;  3ABL E;  4ME2 A;  3QWW A;  4EBA A;  4A1S A;  3CVP A;  3DEP A;  3EU9 A;  3I4R B;  3W9G A;  3J5P A;  2PM7 A;  5CCM A;  4BEP A;  1Z3Y A;  2GRP B;  2Y1L E;  3VTY A;  5CED B;  4XIF A;  2KZT A;  4EZJ A;  4I43 A;  4C0M A;  2VSO E;  2XCB A;  3CVQ A;  4U04 A;  2F37 A;  4F53 A;  3T5X A;  1N4R A;  4GMR A;  4WND A;  3UUX A;  2EIN E;  4M3O A;  4OVU A;  4I9E A;  3TG4 A;  3ONK A;  4YDW A;  4GTO A;  2J4D A;  5FJY A;  3QJZ A;  2CG3 A;  4DX2 A;  1LF8 A;  2L0T B;  2XEH A;  4FHJ A;  1OY3 D;  2I1J A;  2ETB A;  1SQM A;  4HNA D;  4NAC A;  1N0Q A;  3BU8 A;  3SBS A;  1MX6 A;  2KC7 A;  4KVM A;  4A63 B;  4I6E A;  2WXL A;  3AU4 A;  4O1P A;  4U63 A;  3I4G A;  3PZ1 A;  1O1T A;  3DRA A;  3C72 A;  4K5C A;  4PS7 A;  2KCK A;  4KBQ A;  2BED A;  4UI9 J;  2FF4 A;  2XGO A;  2KAT A;  1MZC A;  4I9C A;  4YDO A;  2WQ7 A;  2HYZ A;  4ZHB A;  3MA5 A;  4F1S A;  3RSE G;  3HXF A;  3UT7 A;  5JJ6 A;  4N3B A;  3CKC A;  3FEX A;  3CVN A;  1RZ4 A;  1W3B A;  5EX0 A;  4JA7 A;  2WB2 A;  1JCQ A;  3W9F A;  1U2V G;  3PNT B;  4BER A;  5DBK A;  1BD8 A;  3SY2 A;  2CFU A;  1SW6 A;  4G26 A;  2MHK A;  4D10 C;  1KZP A;  4DJA A;  3E4B A;  2VSY A;  5ANL A;  1EF1 C;  4N5Q A;  4LNG A;  4HLE A;  2LUH A;  2L0I A;  5KJK A;  5KJL A;  2GRM A;  2J09 A;  4O60 A;  2DZO A;  5BPP A;  1H2T C;  3PEU B;  4HB5 A;  4GPM A;  2XEE A;  3C3R A;  3CR3 A;  1IHB A;  2XGS A;  1LTX A;  5CCL A;  3ASN E;  1HE8 A;  4A3V A;  5BUZ A;  4N2Q A;  4JXT A;  3NZS A;  2WXQ A;  2QYU A;  3E30 A;  3ZPJ A;  2IEJ A;  4GZC A;  5HRY A;  4W9R A;  2X6J A;  5E75 A;  4J8D A;  3FFL A;  3CGH A;  1TR4 A;  5D2M C;  3SGH A;  4LG6 A;  3FHE A;  1HXI A;  4GCN A;  3CIA A;  3URZ A;  1E7U A;  2PQR A;  5BW8 C;  5G05 J;  3C3Q A;  1AWC B;  3CQC B;  3PNL B;  1EDU A;  2DYS E;  3PEV B;  5AQ7 A;  3WXX A;  5KNG A;  3EJN A;  5A7D B;  3ZXS A;  3T8K A;  3MX3 A;  3Q7A A;  2WXG A;  4NQ0 A;  4HVB A;  3LEW A;  4GTR A;  4LCT A;  3PRZ A;  1O1R A;  1OCC E;  5BXO A;  1N4P A;  4LNB A;  1KT1 A;  4UWL A;  2CHX A;  3QWP A;  5EKQ D;  4EPZ A;  4XX5 A;  5ENN A;  3DEO A;  5T8I A;  2A4Z A;  3DBS A;  3UKU G;  3IHV A;  5A6C A;  4F3V A;  5BV0 A;  4G8K A;  2BKK B;  1BU9 A;  4KZ0 A;  3EHQ A;  2XCC A;  2R03 A;  4YDY A;  1FVF A;  4B0Z A;  3KAE A;  2E2E A;  2VQ2 A;  3Q75 A;  2WXI A;  5AQB A;  3L6A A;  3TG5 A;  4XI9 A;  5CEC B;  3CHR A;  4DX5 D;  3V30 A;  3D9L A;  3U64 A;  2WXR A;  1XNF A;  2WMN A;  3R9M A;  2H6F A;  2ZXW E;  3UX4 A;  3L22 A;  1HG2 A;  4K5A B;  3CV0 A;  4B89 A;  5KJN A;  2FO1 E;  4ZFH A;  3FH7 A;  3FEY A;  3JQ0 A;  5DIZ A;  4GTQ A;  3Q78 A;  4LUN U;  4BTB A;  1S64 A;  1VDY A;  4DK5 A;  2F8Y A;  3FUE A;  1U3D A;  2BTD A;  1DNP A;  5C1D A;  1NFI E;  3MV3 B;  1IXV A;  5CEA A;  4U8H A;  2EIM E;  2J08 A;  2DWZ A;  1INZ A;  3Q4A B;  4ANV A;  4N5C A;  3B7R L;  3R7R A;  4FC8 A;  2QYJ A;  2XEN A;  1Y8M A;  3T9K A;  1JPL A;  3TAX A;  2XS8 A;  2ILR A;  2H6I A;  3UXG A;  5FQ6 A;  4RVB A;  4HOR A;  3ML8 A;  4MS6 A;  3OAW A;  5JHA A;  1N52 A;  3KSQ A;  3QNK A;  3FUI A;  3LY7 A;  2PM6 A;  1D9S A;  3TWU A;  3VLE A;  3WG7 E;  5ARG A;  5KWD A;  4J7W A;  1V55 E;  4GAA A;  5D0O D;  2P9N G;  1TNB A;  4KT6 B;  5BNW A;  4XKB A;  3PUJ A;  4CRW A;  3L9T A;  2WM9 A;  4K5B A;  3S7J A;  2GRQ B;  4HOT A;  2KBX A;  1JCS A;  4JHK A;  4UI9 K;  2KCV A;  4J8Y A;  4UI9 C;  2KXP C;  1UJK A;  3R9A B;  3RRM B;  1Z6T A;  2IO2 C;  4L23 A;  4GU5 A;  3EIQ C;  3FH5 A;  3FUH A;  3ESL A;  4KMO A;  3IXE A;  1IHG A;  2UY1 A;  1HS6 A;  3S2A A;  4DX7 D;  3E33 A;  4UWF A;  4GYW A;  3UIP C;  1V54 E;  3ISM C;  2PL2 A;  2IQC A;  4U8V D;  4F1P A;  3FU0 A;  1TN8 A;  3D9O A;  4ACL A;  4E85 A;  2OVF A;  1OWP A;  4TXQ A;  2X6K A;  1A17 A;  3ZN3 A;  1MYO A;  3CST A;  2XPI A;  5ARF A;  3ULQ A;  4URK A;  3FUM A;  4B8A A;  4BY6 A;  2GRN B;  4JW1 A;  3BEE A;  2YQ8 A;  1HZ4 A;  3NOC D;  4DI3 A;  4R7L A;  2B6C A;  4L7T A;  2IFU A;  3CK7 A;  4GCO A;  4CGW A;  3R7Q A;  3CKB A;  3RO3 A;  4G25 A;  3TWR A;  4PH4 B;  3HXD A;  3G2U A;  3HVE B;  3PE3 A;  4BT9 A;  2JAB A;  1U3C A;  5HI7 A;  4GA1 A;  5LOZ A;  4AIF A;  2ZU6 B;  4L1B A;  3MEK A;  3ZW3 A;  3RRN B;  3NAW A;  1D8D A;  2XZT G;  2XZD G;  5G05 C;  5AQA A;  1K8K G;  2IJG X;  3K9I A;  2AXV A;  4TXR A;  5AEN A;  4CZ2 D;  5CRU A;  4U96 D;  3UM0 A;  5D66 A;  2IY0 C;  1H2V C;  3ZYQ A;  1KPS B;  1TN6 A;  3DPD A;  5FIO A;  1OT8 A;  3KEA A;  4QQI A;  5FQ8 A;  3L16 A;  5EN5 D;  1TNY A;  2IF4 A;  4EEC A;  3QAR A;  3CVL A;  5AN8 A;  4CYM D;  4G11 A;  3ZYM A;  3PDN A;  1PAQ A;  3V31 A;  4HOQ A;  2L6B A;  1HX8 A;  4I6G A;  3Q7F A;  3D9P A;  2OV8 A;  4V3I A;  3NF1 A;  3CVW A;  3B7T A;  1E96 B;  3P2B A;  4FLB A;  3MYV A;  2IU1 A;  5AYW D;  2P9S G;  4NRH B;  3IV0 A;  2V4H C;  4IYP A;  4GA2 A;  2PNN A;  5IY5 E;  2LAH A;  1TYQ G;  4IRU A;  4G24 A;  1OWN A;  3ZUV B;  2WQ6 A;  4DX1 A;  2HR2 A;  1FCH A;  3TJP A;  4UQZ A;  3BQO A;  3CQG B;  2XQ0 A;  3ZKJ A;  5AQ9 A;  3CLJ A;  4A1G A;  2VTB B;  3O4Z A;  5B3S E;  2R5S A;  2XS1 A;  4EHM A;  3HIZ A;  1OWM A;  1IYG A;  1QNF A;  5LP0 A;  1TJC A;  3SHF A;  5CBN A;  1ELK A;  4U7E B;  2OCC E;  2BUG A;  2EQX A;  1PC2 A;  1MX2 A;  2F8X K;  3ULY A;  4EQF A;  2LAI A;  4AVX A;  5ENS D;  3NOG D;  3ESK A;  4ABN A;  4H7Y A;  3EIJ A;  5G55 A;  4FHK A;  3UQ3 A;  3APD A;  1OWL A;  3UKR G;  4FJY A;  3ZHE B;  2MYO A;  3LPZ A;  3Q9U C;  4WWP A;  1FVH A;  1KZO A;  3VLF A;  1QBQ A;  2MOW A;  3I3N A;  4HI9 A;  3GZ2 A;  5CRV A;  4AP2 A;  4WWN A;  2VGX A;  2VSX E;  3AG3 E;  3PS6 A;  1BPO A;  4GTV A;  4RLY A;  4U95 D;  5T3R A;  4B8C B;  4CT0 A;  2DIW A;  4KZC A;  3C5R A;  1BLX B;  3FTY A;  3LVQ E;  3E34 A;  4DX6 D;  3ZU7 B;  1TJF A;  4YDE A;  3TGO A;  4U8Y D;  2AW6 A;  2GRL A;  1IKN D;  2A5E A;  4JHJ A;  4ATG A;  3TWW A;  1N0R A;  3T8M A;  4AJW A;  4J0U A;  2HO1 A;  1FPP A;  1H0A A;  2I6H A;  3MKQ B;  1E8W A;  4A55 A;  2V8S E;  1LD7 A;  4N39 A;  3QWV A;  5CHE E;  5FQ7 A;  3FUK A;  2X6F A;  2C0L A;  2GGF A;  2R17 C;  3IKO B;  4EZK A;  1A5E A;  2V5Q C;  3TWT A;  4UWK A;  3ENE A;  4EBA G;  3PZ3 A;  2CHW A;  3FDH A;  3JXJ A;  5BV1 A;  3FWV A;  4JZY A;  3JUE A;  2DVW A;  4ILG A;  4GZ6 A;  1H6P A;  5ENR D;  4RG9 A;  3LXU X;  3IBE A;  2BKG A;  4JC8 A;  4L9P A;  1DVP A;  4J8E A;  2C0M A;  2WXN A;  1JCR A;  1ELR A;  4JA9 A;  3FY4 A;  4U07 A;  3JQ1 A;  3MZL B;  1OCZ E;  3SBT B;  3OTN A;  2L6J A;  3SI5 A;  1N95 A;  3TXN A;  4JEU A;  2RKK A;  5BXU A;  5KJM A;  3GZ1 A;  3HHM A;  2FEZ A;  3U9W A;  4OVV A;  4LNU D;  1DCQ A;  4DLQ A;  1TNZ A;  1K3Z D;  5AAR A;  3Q49 B;  3RO2 A;  3KD7 A;  5KCM A;  1S0P A;  2EIL E;  2FI7 A;  3AG4 E;  3LVR E;  4FU3 A;  2LSU A;  3HVE A;  3U3W A;  3PRE A;  4GA0 A;  3ZRH A;  4N2S A;  1O1S A;  3CEQ A;  2QZA A;  1ELW A;  4JVS A;  3D9M A;  4CEM A;  2P9K G;  4YND A;  4C48 B;  4LEU A;  1N9A A;  1DC2 A;  4FUL A;  4GMJ A;  4RSY A;  4YVQ C;  1N4Q A;  2F0Y A;  4U0S A;  2DYR E;  1E8X A;  2AJA A;  3VTX A;  1N4S A;  2WVI A;  3LCA A;  3QB2 A;  1MHQ A;  1OCR E;  5ENT D;  3CVX A;  5FZS A;  3C3O A;  3DPY A;  2WXF A;  1BI7 B;  3G2S A;  4ANU A;  3TL5 A;  2UWJ G;  3SF4 A;  2YIN A;  1RW2 A;  2QY7 A;  4IUL A;  4GML A;  5EIB E;  4FAD A;  3X2Q E;  1LD8 A;  2PQN A;  1Q2Z A;  3N71 A;  1ZBP A;  2OEW A;  3U66 A;  5FQ4 A;  1WAO 1;  5T4Y A;  3RK6 A;  1H6O A;  4GYO A;  2V5F A;  2M63 A;  1AP7 A;  4I2W A;  2ION A;  3ASG A;  2KCL A;  1DCE A;  1S63 A;  1BI8 B;  3UIN C;  2Y0B G;  4HI8 A;  1FT1 A;  3DWL G;  4DPR A;  5J08 A;  3T5V A;  3ZIM A;  3JUI A;  5LCW J;  3DXK G;  3FTV A;  3D9J A;  1EYH A;  1XGW A;  1MJ0 A;  5EID A;  4BSX A;  3UMV A;  3PH0 C;  5LX8 A;  1JWF A;  3EHM A;  3G2V A;  1Z3X A;  1X81 A;  5A23 A;  1HU3 A;  1TNU A;  4TUM A;  3TWV A;  4GYY A;  3B7U X;  3L17 A;  5KNH D;  4O1O A;  4RQI A;  2DZN A;  3UT4 A;  1E8Z A;  5G2N A;  2I1K A;  3C98 A;  4FP7 A;  4Q94 A;  3GW4 A;  1H6K A;  2RG8 A;  2RD0 A;  2ZGG A;  1WY6 A;  2VJ8 A;  3QDN A;  2B0O E;  2OEV A;  4AM9 A;  3GYZ A;  4FA6 A;  1N11 A;  2P9P G;  5FT9 A;  4APO A;  2HE0 A;  2LO6 A;  3TWS A;  4GTM A;  3SZ7 A;  1K1B A;  5EYP F;  5AIJ A;  3CVY A;  4MLP A;  3QC1 A;  4BT8 A;  4HFG A;  4BSZ B;  3PUK A;  1SVX A;  1O5M A;  3D9H A;  3Q9N C;  3G2W A;  2AWI A;  3UM1 A;  1JUQ A;  2P2C P;  5AAO A;  3D3M A;  3JXI A;  3ABK E;  4CT4 A;  4JHR A;  5CER B;  3CVV A;  4B93 B;  3SFY A;  3EDT B;  4CDR A;  2GRR B;  4NIK A;  2Y4T A;  3B13 A;  4ILH B;  2X38 A;  3NZU A;  4IN3 B;  4GTP A;  3LS8 A;  3ULE G;  3EHR A;  3PE4 A;  3SFX A;  2WMO A;  4FJZ A;  4I1O B;  5CMW A;  3B7S A;  3CVU A;  3QKY A;  3CHM A;  3NBN B;  3DSX A;  2OVB A;  3HDX A;  3APF A;  2J4B A;  1S70 B;  4UQX A;  4GZ5 A;  3FUJ A;  3HG0 D;  1UG3 A;  2CHZ A;  4G23 A;  4K0R A;  5AJL A;  5EIL A;  5B1A E;  2IOS A;  4G2V A;  3ZFW A;  2VGY A;  4HXI A;  3RJV A;  3LY8 A;  3FU3 A;  5FWQ A;  2Y4U A;  4L2Y A;  4QFV A;  5JHB A;  2C2L A;  3MJW A;  3ZYL A;  4HQD A;  1N94 A;  4M7C A;  4CGV A;  1TN7 A;  5BT1 A;  3APC A;  3DSV A;  3Q15 A;  5B1B E;  3CSF A;  1YYH A;  4UWH A;  3U4T A;  4DRX E;  2ZGD A;  3DSU A;  3O48 A;  4HBD A;  4MKT A;  4J8F A;  3D9I A;  3FUL A;  3OXF A;  3L13 A;  4AV7 A;  4NUR A;  4O6F A;  4I1M A;  3DSW A;  3UIO C;  1E90 A;  2PZI A;  2NSZ A;  2XHE A;  2R02 A;  3KSL A;  3J5Q B;  1UJJ A;  2A5U A;  3CHS A;  4PS3 A;  3HRA A;  3IHY A;  1QZ2 A;  2XEV A;  2VSN A;  3RU0 A;  2L9B A;  3P1U A;  1WDY A;  3VLD A;  2CG2 A;  3I5P A;  3FU6 A;  2X6I A;  3RIB A;  3UTM A;  3V2X A;  2LSV A;  4Q69 A;  2MRI A;  3ASF A;  4TXP A;  5JMN D;  3FUF A;  3LYA A;  3RRU A;  3SFZ A;  3HXC A;  1UW4 B;  2V0P A;  5AJD A;  4HRM B;  1FT2 A;  4ILI A;  3LDZ A;  3FUN A;  1SA5 A;  3RKV A;  4APF A;  2VGE A;  1L5J A;  3HYM B;  4G1T A;  4TV3 A;  4C9B B;  4JEH A;  4GTS A;  2NC9 A;  3TXM A;  3Q5M A;  2QFC A;  3RAU A;  3L08 A;  2AXZ A;  5HKP A;  1K1A A;  3KEZ A;  5FZR A;  4EZL A;  2IO3 C;  5KBA A;  1SZ9 A;  4KXK B;  5H7P A;  5JJT A;  4BWR A;  1G3N B;  1E8Y A;  4TRQ A;  3OXL A;  4I1A A;  2UY1 B;  4GTT A;  2EIJ E;  3DSS A;  4I6J A;  5LCW C;  2P58 C;  4JL0 A;  3L54 A;  3ZEF A;  1N54 A;  4AY5 A;  4UQY A;  3AU5 A;  3D9K A;  2WPV A;  5FIN A;  4WNG A;  3FTZ A;  2GRO B;  4JB8 P;  3PZD A;  1HO8 A;  5ITZ F;  4HS2 A;  4Y6W A;  4I17 A;  4GZ3 A;  4AOF A;  4JPS A;  2BF0 X;  1E7V A;  5HS0 A;  4H7X A;  4PS8 A;  2KM4 A;  4J8S A;  3AJI A;  4GZD A;  4CDM A;  3LJN A;  4XE0 A;  1YMP A;  1PY1 A;  2GW1 A;  3DXM G;  4LSZ E;  3UI2 A;  4F7A A;  4JD2 G;  5C2Y A;  2DBA A;  3SO8 A;  5G04 C;  3MKR A;  4XEI G;  4RG6 A;  4BX9 A;  2CFZ A;  3AAA C;  1NL4 A;  1WM5 A;  2R2L A;  4OAU C;  3Q73 A;  5JJ7 A;  1Z5S C;  5FZQ A;  1GW6 A;  5ENQ D;  3PVL A;  1HH8 A;  1JWG A;  3CHQ A;  1QYM A;  4XKC A;  3NQP A;  3MGB A;  3DST A;  3ZYK A;  3ZXP A;  4L2L A;  4X8Q A;  1Y6I A;  4G8L A;  3AG1 E;  5M72 A;  3GZS A;  3B7B A;  4AY6 A;  4I2Z A;  5EDS A;  5EX3 A;  3FTX A;  2OND A;  4C0E A;  3SNX A;  2X3M A;  3EHN A;  3ASD A;  3JYS A;  5EYL A;  1ZU2 A;  2KZT B;  2NYJ A;  5CBO A;  2Q7F A;  1OUV A;  3AG2 E;  2IOL A;  2FBN A;  3UM3 A;  3S7D A;  4DLO A;  2RFM A;  4WNE A;  4BES A;  4UUC A;  3UT8 A;  4UWG A;  2WQH A;  1TNO A;  2E0I A;  3B95 A;  2ETC A;  2V4L A;  3FH8 A;  3MV2 B;  3ONL A;  4AXH A;  1NZN A;  2YNQ A;  4PUC A;  5HQ8 A;  4WNF A;  3OXG A;  3FP3 A;  4PDX A;  2AXU A;  1OXJ A;  2H6H A;  1UOH A;  2WXP A;  2XRY A;  1QQE A;  3QAQ A;  1SA4 A;  3EU5 A;  4Q96 A;  5ENP D;  4N3C A;  1NA0 A;  4HRN A;  1HF8 A;  4WWO A;  2XPY A;  4U0Z A;  4HOU A;  5ENO D;  2R59 A;  5E76 A;  1D8E A;  3F6Q A;  3BG0 B;  2FO7 A;  5CMY A;  2Y69 E;  5ANR A;  3ASH A;  2VTB A;  3FUD A;  4FLH A;  2VGX B;  5J90 A;  1ZB1 A;  3E37 A;  4BTA A;  4KVO A;  3HXE A;  3CHP A;  2XGM A;  2WXJ A;  4WAF A;  1NI1 A;  4YVO A;  4CDN A;  3MCX A; 
#chains in the Genus database with same CATH homology
 2ZGG A;  5JMN D;  4N5Q A;  3V2O A;  3V31 A;  1NFI E;  2L6B A;  3AJI A;  1IXV A;  4DUI A;  1MYO A;  5EIL A;  5CEA A;  4OAV B;  3LJN A;  2DWZ A;  1BI7 B;  1YMP A;  2B0O E;  3DEO A;  2DZO A;  4HI9 A;  4O60 A;  2F37 A;  4F6R D;  4LSZ E;  2QYJ A;  2XEN A;  4HB5 A;  4HRM B;  4GPM A;  3T9K A;  2ETA A;  1N11 A;  3UI2 A;  2RFM A;  4BES A;  2J8S D;  4GMR A;  2XEE A;  4UUC A;  1IHB A;  2HE0 A;  4G8K A;  2BKK B;  4RLY A;  4U95 D;  3UXG A;  5EIB E;  3TWS A;  3B95 A;  3V79 K;  4QFV A;  2ETC A;  2V4H C;  5BXU A;  4YDW A;  1BU9 A;  2VGE A;  3NOC D;  3SO8 A;  3C5R A;  3EHQ A;  1K1B A;  5EYP F;  2PNN A;  3ZNG A;  1BLX B;  1MX4 A;  4HQD A;  4DX6 D;  2RFA A;  5JA4 D;  3TWX A;  5HKP A;  1D9S A;  1K1A A;  3AAA C;  3ZU7 B;  4YDY A;  4DX2 A;  3TWU A;  2XEH A;  4BSZ B;  5KWD A;  1OY3 D;  5KBA A;  3ZUV B;  2ETB A;  4J7W A;  4LNU D;  4HNA D;  1DCQ A;  1SVX A;  1N0Q A;  1UOH A;  3D9H A;  4U8Y D;  4DX1 A;  3Q9N C;  1YYH A;  1K3Z D;  4OAU C;  4DRX E;  1MX6 A;  5HRY A;  1AP7 A;  3TWQ A;  2ZGD A;  1IKN D;  2A5E A;  5AAR A;  2QC9 A;  4A63 B;  2P2C P;  3TWR A;  1G3N B;  5ENQ D;  5AQB A;  5AAO A;  4HBD A;  1BI8 B;  3JXI A;  5ENP D;  3TWW A;  3ZKJ A;  1TR4 A;  4O1P A;  5AQ9 A;  2Y0B G;  1N0R A;  4HI8 A;  1QYM A;  4HRN A;  5CEC B;  4LG6 A;  2JAB A;  4K5B A;  5CER B;  4B93 B;  2KBX A;  4K5C A;  3V30 A;  4BET A;  4DX5 D;  1A5E A;  1MJ0 A;  5EID A;  4J8Y A;  4NIK A;  4G8L A;  2KXP C;  2XZT G;  5CBN A;  2XZD G;  1AWC B;  4Z68 A;  5ENO D;  5AQA A;  4ZHB A;  5FIN A;  1YCS B;  5AQ7 A;  4K5A B;  3J5Q B;  5KNG A;  4ATZ D;  1MX2 A;  2F8X K;  4HLL A;  3F6Q A;  4HRL A;  4CZ2 D;  3EHR A;  4TUM A;  4JB8 P;  4U96 D;  3HRA A;  4C48 B;  4ZFH A;  3TWV A;  2FO1 E;  2V5Q C;  5ENS D;  3NOG D;  5D66 A;  3T8K A;  3IXE A;  4DX7 D;  3TWT A;  3B7B A;  5ITZ F;  1DC2 A;  5KNH D;  4O1O A;  3JXJ A;  2DZN A;  1WG0 A;  5FIO A;  1OT8 A;  2AJA A;  3JUE A;  3DEP A;  3NBN B;  3V2X A;  4U8V D;  3KEA A;  2DVW A;  3EU9 A;  4QQI A;  4F1P A;  3W9G A;  5EN5 D;  3W9F A;  3J5P A;  4BER A;  5ENR D;  4BEP A;  1WDY A;  2MYO A;  2Y1L E;  1BD8 A;  5ENT D;  5HS0 A;  5AN8 A;  1SW6 A;  4CYM D;  5CED B;  1S70 B;  2BKG A;  3Q9U C;  5EYL A;  2F8Y A;  2NYJ A;  5CBO A;  5BXO A;  3HG0 D;  3UTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...