5EN5D

Apo structure of bacterial efflux pump.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
161
structure length
161
Chain Sequence
HHHHHGSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug efflux pump subunit AcrB,Multidrug efflux pump sub
publication title Molecular basis for inhibition of AcrB multidrug efflux pump by novel and powerful pyranopyridine derivatives.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Transport protein
total genus 50
structure length 161
sequence length 161
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2015-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5en5D00
4UUCA 5ENRD 3DEOA 4BESA 5AAOA 5ITZF 4U95D 1N0QA 2HE0A 2J8SD 3JUEA 3W9GA 2QC9A 1IXVA 5CERB 1BI8B 3V31A 2Y0BG 1NFIE 1MJ0A 4LNUD 1YCSB 1N11A 2B0OE 2DWZA 2PNNA 3EHQA 4LG6A 4N5QA 5EILA 3JXJA 3JXIA 5EIDA 3IXEA 3F6QA 5CBNA 2NYJA 4BETA 5HKPA 3J5PA 3TWWA 4O1OA 3TWQA 5CEAA 5HS0A 5KBAA 1K1BA 4HI9A 3W9FA 3T9KA 1AWCB 3AJIA 4LSZE 4F1PA 3V2OA 5KNGA 1MYOA 1DCQA 3EU9A 3TWVA 2DZNA 3HRAA 5FIOA 3ZKJA 4HRNA 1QYMA 2XEHA 1K1AA 2V4HC 4HRMB 4OAUC 4DX5D 4HQDA 5EYPF 4U96D 4ZHBA 1MX2A 2RFAA 1IKND 2AJAA 3EHRA 3V30A 1N0RA 3HG0D 4J8YA 3ZU7B 1DC2A 3SO8A 2ETAA 1SW6A 4Z68A 5ENOD 4HI8A 3TWXA 1A5EA 3TWSA 4G8KA 4A63B 4HLLA 4BERA 4BSZB 2FO1E 2V5QC 5KWDA 5ENSD 3B95A 3UI2A 4QFVA 4ZFHA 4HNAD 5JMND 4HB5A 1AP7A 4RLYA 4DX7D 3D9HA 1WDYA 4ATZD 5ENPD 1MX4A 3J5QB 2ZGGA 3KEAA 3UTMA 4CYMD 5BXUA 2DZOA 3AAAC 2KBXA 5EN5D 4U8VD 2ETBA 2MYOA 3C5RA 2XZDG 5ENQD 5AARA 4CZ2D 1MX6A 4K5CA 2L6BA 2XZTG 5ENTD 5BXOA 3ZNGA 5CEDB 5AQBA 5AQ7A 5JA4D 1BU9A 3ZUVB 2ETCA 1TR4A 4TUMA 3TWUA 2Y1LE 4J7WA 4OAVB 1BLXB 1WG0A 4K5BA 2XENA 5KNHD 4YDWA 3UXGA 4YDYA 2KXPC 4NIKA 2F8XK 1S70B 5CBOA 5D66A 4U8YD 2F37A 4B93B 4O1PA 2F8YA 4C48B 2BKGA 2JABA 4DX1A 5AN8A 4QQIA 4DUIA 3V79K 2QYJA 5HRYA 1G3NB 3TWTA 4K5AB 2XEEA 1IHBA 1OT8A 3NOGD 4BEPA 4G8LA 4GPMA 4DX2A 2P2CP 1SVXA 4DRXE 3Q9UC 3NBNB 1YYHA 2VGEA 3T8KA 2A5EA 1BD8A 4O60A 3B7BA 5FINA 2ZGDA 4GMRA 5EYLA 4HBDA 2DVWA 2BKKB 1YMPA 2RFMA 3DEPA 4JB8P 4F6RD 3V2XA 5AQAA 4DX6D 1BI7B 1OY3D 3LJNA 3TWRA 5EIBE 1K3ZD 1UOHA 5AQ9A 3Q9NC 3NOCD 5CECB 1D9SA 4HRLA
chains in the Genus database with same CATH superfamily
2WPVA 3JUEA 1QQEA 3NF1A 1BI8B 5M72A 3S7BA 2EIJE 2OEVA 2GGFA 4IYPA 5G04J 3RRMB 5HS0A 4AOFA 2BF0X 3W9FA 3PUJA 5EDSA 3D9NA 3CHOA 1ELKA 3UINC 1LTXA 3R9AB 3EHNA 5DIZA 3QWWA 3L22A 4ANWA 3BEEA 4BTBA 3EHRA 2R03A 3V30A 3HG0D 4URKA 5CHEE 2Y4TA 1QZ2A 4AJWA 5J90A 2VGXA 4QFVA 3UT8A 3Q4AB 2WXPA 2JEKA 3KEAA 3L9TA 4RG6A 5ENTD 1Z3YA 1OCOE 2OCCE 4KBQA 3LCAA 4UWKA 3QOUA 3CVNA 3RJVA 2BTDA 2HM8A 2L6JA 5AYWD 3CSFA 4DRXE 4UWHA 3AU4A 1HZ4A 2I1KA 2VGEA 2A5EA 4CDNA 4JZYA 4PS7A 4A3TA 3PZ2A 3CIAA 2WMNA 4ACKA 3Q7AA 4J6IA 4FLHA 4CRWA 1OWMA 3HIZA 3LYAA 1D9SA 4I2WA 4BESA 3TXMA 4I6EA 3PNLB 4LNUD 2VJ8A 4N5QA 4XKCA 1HS6A 2GRPB 3Q47B 4N3CA 2KZTA 1TJFA 3AS5A 3CV0A 2A5UA 2DYSE 1QYMA 2P9PG 3NZSA 3E33A 2C0MA 2CHXA 1H2TC 4FHJA 3SQVA 4A63B 3FUMA 1HXIA 3B95A 3DXMG 4GZ5A 3CVPA 1X81A 2IY0C 5BUZA 2WQ7A 2BUGA 1JWFA 3LXUX 5JA4D 3NAWA 3FP3A 3FUDA 5FZQA 2QY7A 2LO6A 2XGMA 3D9LA 2YINA 1GW6A 3Q7FA 3ZYQA 1TN7A 3EIQC 4BT9A 4Q69A 2EIKE 1IHBA 3IHYA 5ARGA 1MQSA 3DRAA 1NI1A 3HVEB 3D3MA 3CVUA 2UY1B 4B89A 4H7XA 4XKBA 4AY5A 4DX6D 4TXRA 1BI7B 4L2LA 1OXJA 3LY9A 4OVUA 3GYZA 3D9PA 2BEDA 1NFIE 1YCSB 4LG6A 3EHQA 2HYZA 5FJYA 2VTBB 1TJCA 3HXCA 1TNZA 4WUYA 3FTYA 3RU0A 3VLFA 2XEHA 4HQDA 5A7DB 3QWVA 3RRUA 3E4BA 3FU6A 4OVVA 4G8KA 3LVRE 4WNEA 3PRZA 5KWDA 4BTAA 5ENSD 5FZRA 5JMND 1MHQA 3SI5A 4HS2A 3UTMA 3SNXA 3N71A 3AAAC 4UWLA 3AG4E 3PZ1A 2J4DA 4U8HA 3CKBA 4I1OB 5EX0A 5KJMA 1U2VG 3U9WA 1MZCA 3VLDA 3ZYKA 2OV8A 4DX1A 1E8YA 2EIME 1ZB1A 2PM7A 4BEPA 3K9IA 4GPMA 1SVXA 1TN8A 2AXZA 4MBGA 4AIFA 4AVXA 4O60A 2KC7A 2DVWA 4F6RD 4UI9C 4UWFA 3JQ0A 2Y4UA 2IOSA 3Q75A 3Q15A 1EF1C 5CERB 2Y0BG 1A5EA 2WXNA 2B0OE 5EILA 3S7DA 3UUXA 4BETA 3P1UA 4HI9A 4I1AA 4KZ0A 2LAHA 4NRHB 3L17A 3X2QE 1MYOA 3TWVA 2L0TB 1H6PA 2V0PA 3MGBA 3ZKJA 4A1GA 1UJKA 2X6HA 2QFCA 3L13A 4B94A 4GB9A 3HXBA 1O5MA 1YA0A 5BPPA 2LAIA 2B6CA 5B1BE 4DI4A 5LCWC 5JHBA 2FBNA 2LSUA 1NA0A 2WM9A 1UJJA 2IU1A 4U0SA 3ZXPA 4B0ZA 1RZ4A 4U8VD 5B1AE 5AARA 2PL2A 3D9IA 3G2SA 3T8MA 3ABKE 2ZXWE 3BG1B 3UXGA 2AWIA 4EHMA 4U8YD 3SBTB 1E90A 3ZPJA 3ZRHA 3PEUB 3ZXSA 2JLBA 1ELRA 3FWVA 1OT8A 4DX2A 2WXMA 2C0LA 1LD7A 2QYUA 3MEKA 5HI7A 1D8DA 5FQ7A 1JCQA 2GROB 4UQXA 3JCKC 3MYVA 1QBQA 1SZAA 3ESLA 3DPYA 5B3SE 4L7TA 5ENRD 2J8SD 3QB2A 2H6FA 1NP7A 3S7FA 3T9KA 3MKQA 1KLXA 4RQIA 2WXHA 4AP2A 1HH8A 3ML8A 1SZ9A 3UM3A 4YDOA 4RVBA 2M63A 4JVSA 3C3OA 4KVOA 3UT4A 1PY1A 3TWSA 4CDRA 3FHEA 2FO1E 5JJ7A 3PZ4A 3NZUA 4CT4A 4JHKA 4CYMD 3FY4A 3QK0A 4J0UA 4L9PA 1KT1A 3ASNE 3WXXA 1N95A 2GRQB 2MYOA 3KSLA 3ZFWA 2R05A 5ENQD 3ASFA 3LEWA 4XX5A 5CEDB 4ANVA 2ETCA 3LDZA 5FTPA 2LSVA 3EDTB 4TUUA 1SQMA 1BLXB 4Q96A 5CBOA 4RSYA 3MCXA 1HO8A 2JABA 4GTPA 3LVQE 3ASOE 4GTVA 3BQOA 2J08A 3E30A 3ZYLA 3FU5A 4HOSA 1JPLA 3B7TA 4JD2G 3HXFA 4GAAA 1OCCE 3KAEA 3NQPA 4LNBA 3FUJA 4GCOA 1K3ZD 4G1TA 3NOCD 1BPOA 1NL4A 3DEOA 1X5BA 2HE0A 1H0AA 2P9NG 1LD8A 1L5JA 2PNNA 1WAO1 3ASGA 3SFXA 3MKRA 4WNGA 3HYMB 4O1OA 5KJLA 4LSZE 2IQCA 2RG8A 3ZW3A 3D9OA 4GTQA 4C0MA 3T5VA 3FUFA 4DX5D 2RKKA 3FU0A 2HO1A 4GTRA 1UG3A 2AJAA 2HR2A 1OWLA 4EECA 1O1RA 3FULA 3VTXA 1INZA 4HLLA 1EDUA 3QARA 3UI2A 2FO7A 4APFA 4DX7D 4LEUA 1FT1A 3Q5MA 1RW2A 3MA5A 4FJZA 4JC8A 3UKUG 2R2LA 2UWJG 4V3IA 3RSEG 4G24A 1S70B 3QJZA 3ML9A 2V4LA 4C48B 5E76A 2VYIA 1UN9A 5HRYA 4FULA 3QNKA 3U66A 4XI9A 1S64A 4I2ZA 4GPKA 3OXFA 4G2VA 2H6IA 3I4GA 4UWGA 1UN8A 1HU3A 3S2AA 3ZYMA 3U3WA 5JJ6A 2L9BA 4WWPA 3DBSA 3PZDA 4Y6WA 4FLBA 5LX8A 1TNUA 2YNQA 2XPYA 3L08A 1V54E 5AJDA 4DJAA 3MZLB 5ANRA 4FC8A 1S0PA 4ATGA 2DBAA 5FT9A 2WXIA 5EIDA 5CBNA 5G55A 4WNDA 3B7RL 3TWWA 1AWCB 3SZ7A 2F0YA 4GZ3A 1TNOA 2WXJA 4HRMB 3JYSA 4J8FA 4LUNU 4XI0A 1OWPA 1ELWA 1ZU2A 2P9LG 2X6KA 2XRZA 5KCMA 1LF8A 5ENOD 3DPDA 1EYHA 4I6JA 4TRQA 4G26A 4ANUA 4CDMA 4YVOA 2WB2A 1TYQG 4P29A 4PUCA 2EINE 4TV3A 3BG0B 4XZ4A 1W3BA 4CZ2D 1JWGA 2L6BA 2A4ZA 2VQ2A 3UT7A 3QC1A 4PS3A 3AS8A 2IO3C 3C3QA 2PQRA 3HXDA 5KNHD 4YDWA 3E37A 3PE3A 3CVQA 4JPSA 1PC2A 4JA7A 4D10C 3Q73A 3PS6A 2NXPA 3NBNB 3CGHA 4GTSA 4JXTA 2FULA 2L0IA 5AENA 3L54A 1IQRA 4JB8P 3DEPA 3AG2E 3TWRA 4U07A 4U04A 3ZEFA 4Q94A 4NACA 4DK5A 4J8DA 2DYRE 4K0RA 1N11A 1NA3A 4EBAG 2OVFA 3CHPA 5HKPA 1Z5SC 4GZ6A 2J07A 5CRUA 5FWQA 4GYWA 3FDHA 4LCTA 4OAUC 2V4HC 3UM1A 3MV2B 1KT0A 5EYPF 4GTTA 2WXFA 2YHCA 2GRRB 3L82A 4J8YA 3FH8A 1SW6A 4APOA 4GTOA 2IEJA 2WVIA 4HI8A 4BERA 2H6GA 3IBEA 3B13A 5FZSA 1JCSA 4ZFHA 3UKRG 1Z6TA 1WDYA 2R17C 1Z3XA 2KBXA 3APDA 5AQBA 4IN3B 3RRNB 3JQ1A 2Y1LE 4J7WA 3CK7A 3HDXA 3ENEA 4JW1A 4X8QA 2F8YA 3AU5A 3SF4A 2LNIA 2J9QA 3TJPA 2C2LA 3I5PA 3FH5A 4G8LA 4AEZC 4HORA 4ABNA 3LY7A 2P9KG 4XEIG 3QWPA 5CRVA 2I1JA 4HBDA 2RFMA 3ZHEA 3MX3A 1HG5A 3EJNA 1K8KG 5EIBE 4KT6B 1Q2ZA 1HX8A 2AVPA 3L6AA 4UI9J 5ITZF 1N0QA 4L1BA 3V31A 3EHMA 2WXRA 4XE0A 3JXIA 4B8AA 3OTNA 3CHRA 3J5PA 1O1SA 3TWQA 4B8CB 1K1BA 1HE8A 4HOUA 4EBAA 4G23A 4YNDA 4F3VA 4G25A 3FH7A 1KZPA 3CVWA 3PVLA 2IONA 2J09A 4U96D 1QNFA 1N0RA 2VGXB 3O48A 4I17A 3SFZA 3QAQA 3RO2A 2NC9A 5LCWJ 3AG3E 3C3RA 3ZIMA 2DZOA 2ETBA 3C5RA 5BXOA 1MX6A 4DI3A 4FADA 2VSXE 4TXPA 1BU9A 4UQZA 5LOZA 4ILGA 4JEUA 2OVBA 2ILRA 5DBKA 1H6OA 2EQXA 3PDNA 5A23A 5ENNA 3L16A 5G05C 4PS8A 1E8ZA 1S63A 2LXMA 4LNGA 4DLOA 2CG2A 2FI7A 4J8SA 3Q49B 3CK8A 1YYHA 4GMLA 3ULEG 1PAQA 1OY3D 3LJNA 1DVPA 3IHVA 5D0QD 2GW1A 5AQ9A 3SY2A 5D2MC 2PM6A 4AV7A 3PE4A 2KZTB 3FTZA 3PEVB 5KBAA 4BT8A 4F1PA 2DIWA 3V2OA 3VTYA 2MHKA 4YVQC 5FIOA 3G2UA 3CHMA 1H19A 4ZHBA 1KPSB 3FTVA 3Q78A 4N3BA 2R59A 1A17A 4KYOB 2CHZA 3B7SA 3GZSA 3ASHA 2PQNA 3O4ZA 2VSYA 1V55E 4ATZD 5ENPD 1N4QA 2XPIA 3J5QB 4CEMA 2ZGGA 5E75A 3D9KA 3C98A 5EN5D 4EZJA 4OAVB 2DCPA 2WXLA 4MRUA 4EZKA 4DLQA 4I1MA 5AIJA 4AM9A 1SA5A 3NOGD 1U3DA 3R7RA 4KVMA 3BU8A 3DSWA 4FU3A 2WXKA 3HVEA 5J08A 4HRLA 3D9MA 3FFLA 4GA1A 3CQCB 3SBSA 2DWZA 3CLJA 4HVBA 5FQ8A 3UMVA 3RKVA 2CG3A 3QKYA 3LY8A 1KZOA 5KNGA 2VTBA 2J49A 1TN6A 2AW6A 4K03A 3ASDA 1IKND 1NZNA 3ZGQA 2CFUA 2NSZA 3CHSA 4BSZB 5BV0A 4HB5A 1AP7A 4RLYA 2WQHA 3U4TA 5T3RA 5BXUA 2XZDG 4GU5A 4HLEA 4FJYA 2LUHA 2V5FA 3ZNGA 3DXKG 4CGWA 3E34A 1DCEA 4JA9A 2OEWA 4BWRA 3RIBA 4NIKA 4B93B 4O1PA 1HFAA 3CR3A 3PZ3A 4U0UA 4BX8A 4EPZA 4DUIA 3FTUA 3V79K 2QYJA 2AXUA 2WXGA 3EIJA 4E6HA 4A55A 2KCVA 3OXGA 1WM5A 4M7CA 4KMOA 3T8KA 4NQ0A 5FINA 2ZGDA 1FT2A 4NURA 3CSTA 5EYLA 3EUVA 2BKKB 1N4SA 3V2XA 2XHEA 4WWNA 5FQ6A 2X38A 5G04C 5A6CA 3CVVA 1MJ0A 3CQGB 3JXJA 1JUQA 3IXEA 1TNYA 3KS2A 4I9CA 2NYJA 3EU5A 2XCBA 4GZDA 2ONDA 5KJKA 2RD0A 4BFRA 2XS1A 3ZN3A 4GA0A 3IKOB 1DCQA 2Q7FA 5CCLA 4MS6A 2E2EA 3FUNA 3TGOA 3AG1E 3AS4A 3FTWA 1MX2A 3ZU7B 5BNWA 1DC2A 3SO8A 4C9BB 1IHGA 2Y3AA 1E8WA 3OAWA 4LRZA 3DSXA 2WXQA 4HNAD 3RO3A 1E8XA 1TEZA 4UQYA 3B7UX 1E96B 4GYOA 1O1TA 3T5XA 1H2UA 3G2WA 2Y69E 5CCMA 2I2OA 5BV1A 3TWUA 4N2SA 1N4PA 2XPZA 3FEXA 1WY6A 2XS8A 4KXKB 3SFYA 4GMJA 5AN8A 4QQIA 3KEZA 4CGVA 5LP0A 2P9UG 3TWTA 1OUVA 4GA2A 3FTXA 3DSVA 4LERA 2IJGX 3Q9UC 4FHKA 4I6GA 2FF4A 2MOWA 4GMRA 2P9IG 1YMPA 4N3AA 2X6JA 5AQAA 1H6KA 1UOHA 1Y6IA 4FP7A 3SD5A 4R7LA 3QDNA 5AAOA 2YQ8A 2J4BA 4ME2A 4U95D 3SHFA 3HHMA 5BW8C 3MKQB 1ZBPA 3DWLG 5CMYA 2VSNA 4PH4B 4U0ZA 4HXIA 1Y8MA 3ABLE 2XGOA 5EX3A 3CK9A 4EZLA 3FU3A 2ZIRA 3ISMC 3S7JA 3PNTB 2ZU6B 3ONKA 1FVFA 3ABME 3P2BA 3NB2A 1DNPA 3OXLA 4BY6A 4GTMA 3DSSA 3FUKA 2VGYA 4TUMA 1FPPA 4K5BA 2F8XK 1OWNA 5D66A 1H2VC 2F37A 3BUAA 2GRLA 2KCKA 1G3NB 4K5AB 4M3OA 4JL0A 2XGSA 5C1DA 3KD7A 3ESKA 4JHRA 1EPUA 3PH0C 4TXQA 2IFUA 3CKCA 4WWOA 2IO2C 4H7YA 4L2YA 3TWXA 3APCA 3ULYA 4UUCA 1HG2A 3CHQA 3UPVA 2P58C 2KM4A 3TG4A 4EQFA 5CEAA 4A3VA 1OCRE 4UI9K 4KZCA 3CVXA 3AJIA 3UM2A 5G2NA 3EU9A 3HXEA 3HRAA 3PUKA 4W9RA 1IQUA 1OCZE 3UIOC 3DSUA 5D0OD 2WXOA 2IF4A 4U7EB 1FVHA 5JHAA 3D9HA 2KCLA 2XRYA 5H7PA 3CVLA 4FA6A 4E85A 2E0IA 4ANXA 3SGHA 4JEHA 2H6HA 1E7UA 5T8IA 1TR4A 2X6IA 1WG0A 5FQ4A 4N5CA 4JHJA 4DPRA 4WNFA 3RK6A 3ONLA 3LS8A 1D8EA 4BSXA 5G05J 4BX9A 3E32A 2WQ6A 2GRNB 2AXVA 3G2VA 3WG7E 4GYYA 4F53A 4XIFA 4J8EA 1SA4A 3Q9NC 1N4RA 4MKTA 3JUIA 1OWOA 5EKQD 1IXVA 1XNFA 4YDEA 4IULA 2OOEA 2VSOE 3D9JA 5ARFA 3FEYA 2EILE 3IV0A 2CHWA 3FTSA 1UW4B 2MRIA 3TL5A 2XQ0A 1U3CA 2DZNA 3LJ3A 4I9EA 3GZ2A 1K1AA 1IYGA 1VDYA 4Y6CA 2PZIA 3LKUA 2KATA 2ETAA 2GRMA 3KSQA 2X3MA 4L23A 5AJLA 3R9MA 3UX4A 4OYSA 4U63A 4K5CA 3Q79A 4CT0A 3UIPC 3ZVVA 3ZUVB 2XCCA 2FEZA 4ACLA 4YDYA 2KXPC 5C2YA 2R02A 3R7QA 4IRUA 4HFGA 3TAXA 2BKGA 3CVYA 2XEEA 1N9AA 2P2CP 4ILHB 4HOQA 4GZCA 2CFZA 3GW4A 1BD8A 4WAFA 1TNBA 2LXLA 4A1SA 4GCNA 3FUEA 4CCAA 5CECB 2P9SG 4F7AA 3W9GA 1FCHA 2QC9A 3ULQA 3UM0A 2IOLA 3FUHA 3F6QA 3UQ3A 5JJTA 4PDXA 1JCRA 3TXNA 4HOTA 3MV3B 2UY1A 4HRNA 4RG9A 4I43A 3TG5A 1B89A 2YHEA 2V8SE 4C0EA 5T4YA 2RFAA 2XEVA 1HF8A 3RAUA 3MJWA 3URZA 4Z68A 5KJNA 2QZAA 2V5QC 2R5SA 1N94A 2WMOA 1MX4A 3VLEA 3IEGA 2XZTG 3DSTA 4N2QA 4ILIA 1N54A 3I3NA 5AQ7A 5BT1A 4O6FA 4N39A 3U64A 4MLPA 2XENA 3CEQA 5HQ8A 3FUIA 1N52A 3G2TA 2ZISA 4AY6A 3LPZA 5IY5E 3C72A 3PREA 4F1SA 1P5QA 3ZHEB 1E7VA 3APFA 3B7BA 3I4RB 2X6FA 1XGWA 5CMWA 4G11A 5LFAA 4AXHA 2I9CA 5ANLA 2I6HA 3GZ1A
chains in the Genus database with same CATH topology
4UUCA 5ENRD 3DEOA 4BESA 5AAOA 5ITZF 4U95D 1N0QA 2HE0A 2J8SD 3JUEA 3W9GA 2QC9A 1IXVA 5CERB 1BI8B 3V31A 2Y0BG 1NFIE 1MJ0A 4LNUD 1YCSB 1N11A 2B0OE 2DWZA 2PNNA 3EHQA 4LG6A 4N5QA 5EILA 3JXJA 3JXIA 5EIDA 3IXEA 3F6QA 5CBNA 2NYJA 4BETA 5HKPA 3J5PA 3TWWA 4O1OA 3TWQA 5CEAA 5HS0A 5KBAA 1K1BA 4HI9A 3W9FA 3T9KA 1AWCB 3AJIA 4LSZE 4F1PA 3V2OA 5KNGA 1MYOA 1DCQA 3EU9A 3TWVA 2DZNA 3HRAA 5FIOA 3ZKJA 4HRNA 1QYMA 2XEHA 1K1AA 2V4HC 4HRMB 4OAUC 4DX5D 4HQDA 5EYPF 4U96D 4ZHBA 1MX2A 2RFAA 1IKND 2AJAA 3EHRA 3V30A 1N0RA 3HG0D 4J8YA 3ZU7B 1DC2A 3SO8A 2ETAA 1SW6A 4Z68A 5ENOD 4HI8A 3TWXA 1A5EA 3TWSA 4G8KA 4A63B 4HLLA 4BERA 4BSZB 2FO1E 2V5QC 5KWDA 5ENSD 3B95A 3UI2A 4QFVA 4ZFHA 4HNAD 5JMND 4HB5A 1AP7A 4RLYA 4DX7D 3D9HA 1WDYA 4ATZD 5ENPD 1MX4A 3J5QB 2ZGGA 3KEAA 3UTMA 4CYMD 5BXUA 2DZOA 3AAAC 2KBXA 5EN5D 4U8VD 2ETBA 2MYOA 3C5RA 2XZDG 5ENQD 5AARA 4CZ2D 1MX6A 4K5CA 2L6BA 2XZTG 5ENTD 5BXOA 3ZNGA 5CEDB 5AQBA 5AQ7A 5JA4D 1BU9A 3ZUVB 2ETCA 1TR4A 4TUMA 3TWUA 2Y1LE 4J7WA 4OAVB 1BLXB 1WG0A 4K5BA 2XENA 5KNHD 4YDWA 3UXGA 4YDYA 2KXPC 4NIKA 2F8XK 1S70B 5CBOA 5D66A 4U8YD 2F37A 4B93B 4O1PA 2F8YA 4C48B 2BKGA 2JABA 4DX1A 5AN8A 4QQIA 4DUIA 3V79K 2QYJA 5HRYA 1G3NB 3TWTA 4K5AB 2XEEA 1IHBA 1OT8A 3NOGD 4BEPA 4G8LA 4GPMA 4DX2A 2P2CP 1SVXA 4DRXE 3Q9UC 3NBNB 1YYHA 2VGEA 3T8KA 2A5EA 1BD8A 4O60A 3B7BA 5FINA 2ZGDA 4GMRA 5EYLA 4HBDA 2DVWA 2BKKB 1YMPA 2RFMA 3DEPA 4JB8P 4F6RD 3V2XA 5AQAA 4DX6D 1BI7B 1OY3D 3LJNA 3TWRA 5EIBE 1K3ZD 1UOHA 5AQ9A 3Q9NC 3NOCD 5CECB 1D9SA 4HRLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UUC A;  5ENR D;  3DEO A;  4BES A;  5AAO A;  5ITZ F;  4U95 D;  1N0Q A;  2HE0 A;  2J8S D;  3JUE A;  3W9G A;  2QC9 A;  1IXV A;  5CER B;  1BI8 B;  3V31 A;  2Y0B G;  1NFI E;  1MJ0 A;  4LNU D;  1YCS B;  1N11 A;  2B0O E;  2DWZ A;  2PNN A;  3EHQ A;  4LG6 A;  4N5Q A;  5EIL A;  3JXJ A;  3JXI A;  5EID A;  3IXE A;  3F6Q A;  5CBN A;  2NYJ A;  4BET A;  5HKP A;  3J5P A;  3TWW A;  4O1O A;  3TWQ A;  5CEA A;  5HS0 A;  5KBA A;  1K1B A;  4HI9 A;  3W9F A;  3T9K A;  1AWC B;  3AJI A;  4LSZ E;  4F1P A;  3V2O A;  5KNG A;  1MYO A;  1DCQ A;  3EU9 A;  3TWV A;  2DZN A;  3HRA A;  5FIO A;  3ZKJ A;  4HRN A;  1QYM A;  2XEH A;  1K1A A;  2V4H C;  4HRM B;  4OAU C;  4DX5 D;  4HQD A;  5EYP F;  4U96 D;  4ZHB A;  1MX2 A;  2RFA A;  1IKN D;  2AJA A;  3EHR A;  3V30 A;  1N0R A;  3HG0 D;  4J8Y A;  3ZU7 B;  1DC2 A;  3SO8 A;  2ETA A;  1SW6 A;  4Z68 A;  5ENO D;  4HI8 A;  3TWX A;  1A5E A;  3TWS A;  4G8K A;  4A63 B;  4HLL A;  4BER A;  4BSZ B;  2FO1 E;  2V5Q C;  5KWD A;  5ENS D;  3B95 A;  3UI2 A;  4QFV A;  4ZFH A;  4HNA D;  5JMN D;  4HB5 A;  1AP7 A;  4RLY A;  4DX7 D;  3D9H A;  1WDY A;  4ATZ D;  5ENP D;  1MX4 A;  3J5Q B;  2ZGG A;  3KEA A;  3UTM A;  4CYM D;  5BXU A;  2DZO A;  3AAA C;  2KBX A;  5EN5 D;  4U8V D;  2ETB A;  2MYO A;  3C5R A;  2XZD G;  5ENQ D;  5AAR A;  4CZ2 D;  1MX6 A;  4K5C A;  2L6B A;  2XZT G;  5ENT D;  5BXO A;  3ZNG A;  5CED B;  5AQB A;  5AQ7 A;  5JA4 D;  1BU9 A;  3ZUV B;  2ETC A;  1TR4 A;  4TUM A;  3TWU A;  2Y1L E;  4J7W A;  4OAV B;  1BLX B;  1WG0 A;  4K5B A;  2XEN A;  5KNH D;  4YDW A;  3UXG A;  4YDY A;  2KXP C;  4NIK A;  2F8X K;  1S70 B;  5CBO A;  5D66 A;  4U8Y D;  2F37 A;  4B93 B;  4O1P A;  2F8Y A;  4C48 B;  2BKG A;  2JAB A;  4DX1 A;  5AN8 A;  4QQI A;  4DUI A;  3V79 K;  2QYJ A;  5HRY A;  1G3N B;  3TWT A;  4K5A B;  2XEE A;  1IHB A;  1OT8 A;  3NOG D;  4BEP A;  4G8L A;  4GPM A;  4DX2 A;  2P2C P;  1SVX A;  4DRX E;  3Q9U C;  3NBN B;  1YYH A;  2VGE A;  3T8K A;  2A5E A;  1BD8 A;  4O60 A;  3B7B A;  5FIN A;  2ZGD A;  4GMR A;  5EYL A;  4HBD A;  2DVW A;  2BKK B;  1YMP A;  2RFM A;  3DEP A;  4JB8 P;  4F6R D;  3V2X A;  5AQA A;  4DX6 D;  1BI7 B;  1OY3 D;  3LJN A;  3TWR A;  5EIB E;  1K3Z D;  1UOH A;  5AQ9 A;  3Q9N C;  3NOC D;  5CEC B;  1D9S A;  4HRL A; 
#chains in the Genus database with same CATH topology
 2WPV A;  3JUE A;  1QQE A;  3NF1 A;  1BI8 B;  5M72 A;  3S7B A;  2EIJ E;  2OEV A;  2GGF A;  4IYP A;  5G04 J;  3RRM B;  5HS0 A;  4AOF A;  2BF0 X;  3W9F A;  3PUJ A;  5EDS A;  3D9N A;  3CHO A;  1ELK A;  3UIN C;  1LTX A;  3R9A B;  3EHN A;  5DIZ A;  3QWW A;  3L22 A;  4ANW A;  3BEE A;  4BTB A;  3EHR A;  2R03 A;  3V30 A;  3HG0 D;  4URK A;  5CHE E;  2Y4T A;  1QZ2 A;  4AJW A;  5J90 A;  2VGX A;  4QFV A;  3UT8 A;  3Q4A B;  2WXP A;  2JEK A;  3KEA A;  3L9T A;  4RG6 A;  5ENT D;  1Z3Y A;  1OCO E;  2OCC E;  4KBQ A;  3LCA A;  4UWK A;  3QOU A;  3CVN A;  3RJV A;  2BTD A;  2HM8 A;  2L6J A;  5AYW D;  3CSF A;  4DRX E;  4UWH A;  3AU4 A;  1HZ4 A;  2I1K A;  2VGE A;  2A5E A;  4CDN A;  4JZY A;  4PS7 A;  4A3T A;  3PZ2 A;  3CIA A;  2WMN A;  4ACK A;  3Q7A A;  4J6I A;  4FLH A;  4CRW A;  1OWM A;  3HIZ A;  3LYA A;  1D9S A;  4I2W A;  4BES A;  3TXM A;  4I6E A;  3PNL B;  4LNU D;  2VJ8 A;  4N5Q A;  4XKC A;  1HS6 A;  2GRP B;  3Q47 B;  4N3C A;  2KZT A;  1TJF A;  3AS5 A;  3CV0 A;  2A5U A;  2DYS E;  1QYM A;  2P9P G;  3NZS A;  3E33 A;  2C0M A;  2CHX A;  1H2T C;  4FHJ A;  3SQV A;  4A63 B;  3FUM A;  1HXI A;  3B95 A;  3DXM G;  4GZ5 A;  3CVP A;  1X81 A;  2IY0 C;  5BUZ A;  2WQ7 A;  2BUG A;  1JWF A;  3LXU X;  5JA4 D;  3NAW A;  3FP3 A;  3FUD A;  5FZQ A;  2QY7 A;  2LO6 A;  2XGM A;  3D9L A;  2YIN A;  1GW6 A;  3Q7F A;  3ZYQ A;  1TN7 A;  3EIQ C;  4BT9 A;  4Q69 A;  2EIK E;  1IHB A;  3IHY A;  5ARG A;  1MQS A;  3DRA A;  1NI1 A;  3HVE B;  3D3M A;  3CVU A;  2UY1 B;  4B89 A;  4H7X A;  4XKB A;  4AY5 A;  4DX6 D;  4TXR A;  1BI7 B;  4L2L A;  1OXJ A;  3LY9 A;  4OVU A;  3GYZ A;  3D9P A;  2BED A;  1NFI E;  1YCS B;  4LG6 A;  3EHQ A;  2HYZ A;  5FJY A;  2VTB B;  1TJC A;  3HXC A;  1TNZ A;  4WUY A;  3FTY A;  3RU0 A;  3VLF A;  2XEH A;  4HQD A;  5A7D B;  3QWV A;  3RRU A;  3E4B A;  3FU6 A;  4OVV A;  4G8K A;  3LVR E;  4WNE A;  3PRZ A;  5KWD A;  4BTA A;  5ENS D;  5FZR A;  5JMN D;  1MHQ A;  3SI5 A;  4HS2 A;  3UTM A;  3SNX A;  3N71 A;  3AAA C;  4UWL A;  3AG4 E;  3PZ1 A;  2J4D A;  4U8H A;  3CKB A;  4I1O B;  5EX0 A;  5KJM A;  1U2V G;  3U9W A;  1MZC A;  3VLD A;  3ZYK A;  2OV8 A;  4DX1 A;  1E8Y A;  2EIM E;  1ZB1 A;  2PM7 A;  4BEP A;  3K9I A;  4GPM A;  1SVX A;  1TN8 A;  2AXZ A;  4MBG A;  4AIF A;  4AVX A;  4O60 A;  2KC7 A;  2DVW A;  4F6R D;  4UI9 C;  4UWF A;  3JQ0 A;  2Y4U A;  2IOS A;  3Q75 A;  3Q15 A;  1EF1 C;  5CER B;  2Y0B G;  1A5E A;  2WXN A;  2B0O E;  5EIL A;  3S7D A;  3UUX A;  4BET A;  3P1U A;  4HI9 A;  4I1A A;  4KZ0 A;  2LAH A;  4NRH B;  3L17 A;  3X2Q E;  1MYO A;  3TWV A;  2L0T B;  1H6P A;  2V0P A;  3MGB A;  3ZKJ A;  4A1G A;  1UJK A;  2X6H A;  2QFC A;  3L13 A;  4B94 A;  4GB9 A;  3HXB A;  1O5M A;  1YA0 A;  5BPP A;  2LAI A;  2B6C A;  5B1B E;  4DI4 A;  5LCW C;  5JHB A;  2FBN A;  2LSU A;  1NA0 A;  2WM9 A;  1UJJ A;  2IU1 A;  4U0S A;  3ZXP A;  4B0Z A;  1RZ4 A;  4U8V D;  5B1A E;  5AAR A;  2PL2 A;  3D9I A;  3G2S A;  3T8M A;  3ABK E;  2ZXW E;  3BG1 B;  3UXG A;  2AWI A;  4EHM A;  4U8Y D;  3SBT B;  1E90 A;  3ZPJ A;  3ZRH A;  3PEU B;  3ZXS A;  2JLB A;  1ELR A;  3FWV A;  1OT8 A;  4DX2 A;  2WXM A;  2C0L A;  1LD7 A;  2QYU A;  3MEK A;  5HI7 A;  1D8D A;  5FQ7 A;  1JCQ A;  2GRO B;  4UQX A;  3JCK C;  3MYV A;  1QBQ A;  1SZA A;  3ESL A;  3DPY A;  5B3S E;  4L7T A;  5ENR D;  2J8S D;  3QB2 A;  2H6F A;  1NP7 A;  3S7F A;  3T9K A;  3MKQ A;  1KLX A;  4RQI A;  2WXH A;  4AP2 A;  1HH8 A;  3ML8 A;  1SZ9 A;  3UM3 A;  4YDO A;  4RVB A;  2M63 A;  4JVS A;  3C3O A;  4KVO A;  3UT4 A;  1PY1 A;  3TWS A;  4CDR A;  3FHE A;  2FO1 E;  5JJ7 A;  3PZ4 A;  3NZU A;  4CT4 A;  4JHK A;  4CYM D;  3FY4 A;  3QK0 A;  4J0U A;  4L9P A;  1KT1 A;  3ASN E;  3WXX A;  1N95 A;  2GRQ B;  2MYO A;  3KSL A;  3ZFW A;  2R05 A;  5ENQ D;  3ASF A;  3LEW A;  4XX5 A;  5CED B;  4ANV A;  2ETC A;  3LDZ A;  5FTP A;  2LSV A;  3EDT B;  4TUU A;  1SQM A;  1BLX B;  4Q96 A;  5CBO A;  4RSY A;  3MCX A;  1HO8 A;  2JAB A;  4GTP A;  3LVQ E;  3ASO E;  4GTV A;  3BQO A;  2J08 A;  3E30 A;  3ZYL A;  3FU5 A;  4HOS A;  1JPL A;  3B7T A;  4JD2 G;  3HXF A;  4GAA A;  1OCC E;  3KAE A;  3NQP A;  4LNB A;  3FUJ A;  4GCO A;  1K3Z D;  4G1T A;  3NOC D;  1BPO A;  1NL4 A;  3DEO A;  1X5B A;  2HE0 A;  1H0A A;  2P9N G;  1LD8 A;  1L5J A;  2PNN A;  1WAO 1;  3ASG A;  3SFX A;  3MKR A;  4WNG A;  3HYM B;  4O1O A;  5KJL A;  4LSZ E;  2IQC A;  2RG8 A;  3ZW3 A;  3D9O A;  4GTQ A;  4C0M A;  3T5V A;  3FUF A;  4DX5 D;  2RKK A;  3FU0 A;  2HO1 A;  4GTR A;  1UG3 A;  2AJA A;  2HR2 A;  1OWL A;  4EEC A;  1O1R A;  3FUL A;  3VTX A;  1INZ A;  4HLL A;  1EDU A;  3QAR A;  3UI2 A;  2FO7 A;  4APF A;  4DX7 D;  4LEU A;  1FT1 A;  3Q5M A;  1RW2 A;  3MA5 A;  4FJZ A;  4JC8 A;  3UKU G;  2R2L A;  2UWJ G;  4V3I A;  3RSE G;  4G24 A;  1S70 B;  3QJZ A;  3ML9 A;  2V4L A;  4C48 B;  5E76 A;  2VYI A;  1UN9 A;  5HRY A;  4FUL A;  3QNK A;  3U66 A;  4XI9 A;  1S64 A;  4I2Z A;  4GPK A;  3OXF A;  4G2V A;  2H6I A;  3I4G A;  4UWG A;  1UN8 A;  1HU3 A;  3S2A A;  3ZYM A;  3U3W A;  5JJ6 A;  2L9B A;  4WWP A;  3DBS A;  3PZD A;  4Y6W A;  4FLB A;  5LX8 A;  1TNU A;  2YNQ A;  2XPY A;  3L08 A;  1V54 E;  5AJD A;  4DJA A;  3MZL B;  5ANR A;  4FC8 A;  1S0P A;  4ATG A;  2DBA A;  5FT9 A;  2WXI A;  5EID A;  5CBN A;  5G55 A;  4WND A;  3B7R L;  3TWW A;  1AWC B;  3SZ7 A;  2F0Y A;  4GZ3 A;  1TNO A;  2WXJ A;  4HRM B;  3JYS A;  4J8F A;  4LUN U;  4XI0 A;  1OWP A;  1ELW A;  1ZU2 A;  2P9L G;  2X6K A;  2XRZ A;  5KCM A;  1LF8 A;  5ENO D;  3DPD A;  1EYH A;  4I6J A;  4TRQ A;  4G26 A;  4ANU A;  4CDM A;  4YVO A;  2WB2 A;  1TYQ G;  4P29 A;  4PUC A;  2EIN E;  4TV3 A;  3BG0 B;  4XZ4 A;  1W3B A;  4CZ2 D;  1JWG A;  2L6B A;  2A4Z A;  2VQ2 A;  3UT7 A;  3QC1 A;  4PS3 A;  3AS8 A;  2IO3 C;  3C3Q A;  2PQR A;  3HXD A;  5KNH D;  4YDW A;  3E37 A;  3PE3 A;  3CVQ A;  4JPS A;  1PC2 A;  4JA7 A;  4D10 C;  3Q73 A;  3PS6 A;  2NXP A;  3NBN B;  3CGH A;  4GTS A;  4JXT A;  2FUL A;  2L0I A;  5AEN A;  3L54 A;  1IQR A;  4JB8 P;  3DEP A;  3AG2 E;  3TWR A;  4U07 A;  4U04 A;  3ZEF A;  4Q94 A;  4NAC A;  4DK5 A;  4J8D A;  2DYR E;  4K0R A;  1N11 A;  1NA3 A;  4EBA G;  2OVF A;  3CHP A;  5HKP A;  1Z5S C;  4GZ6 A;  2J07 A;  5CRU A;  5FWQ A;  4GYW A;  3FDH A;  4LCT A;  4OAU C;  2V4H C;  3UM1 A;  3MV2 B;  1KT0 A;  5EYP F;  4GTT A;  2WXF A;  2YHC A;  2GRR B;  3L82 A;  4J8Y A;  3FH8 A;  1SW6 A;  4APO A;  4GTO A;  2IEJ A;  2WVI A;  4HI8 A;  4BER A;  2H6G A;  3IBE A;  3B13 A;  5FZS A;  1JCS A;  4ZFH A;  3UKR G;  1Z6T A;  1WDY A;  2R17 C;  1Z3X A;  2KBX A;  3APD A;  5AQB A;  4IN3 B;  3RRN B;  3JQ1 A;  2Y1L E;  4J7W A;  3CK7 A;  3HDX A;  3ENE A;  4JW1 A;  4X8Q A;  2F8Y A;  3AU5 A;  3SF4 A;  2LNI A;  2J9Q A;  3TJP A;  2C2L A;  3I5P A;  3FH5 A;  4G8L A;  4AEZ C;  4HOR A;  4ABN A;  3LY7 A;  2P9K G;  4XEI G;  3QWP A;  5CRV A;  2I1J A;  4HBD A;  2RFM A;  3ZHE A;  3MX3 A;  1HG5 A;  3EJN A;  1K8K G;  5EIB E;  4KT6 B;  1Q2Z A;  1HX8 A;  2AVP A;  3L6A A;  4UI9 J;  5ITZ F;  1N0Q A;  4L1B A;  3V31 A;  3EHM A;  2WXR A;  4XE0 A;  3JXI A;  4B8A A;  3OTN A;  3CHR A;  3J5P A;  1O1S A;  3TWQ A;  4B8C B;  1K1B A;  1HE8 A;  4HOU A;  4EBA A;  4G23 A;  4YND A;  4F3V A;  4G25 A;  3FH7 A;  1KZP A;  3CVW A;  3PVL A;  2ION A;  2J09 A;  4U96 D;  1QNF A;  1N0R A;  2VGX B;  3O48 A;  4I17 A;  3SFZ A;  3QAQ A;  3RO2 A;  2NC9 A;  5LCW J;  3AG3 E;  3C3R A;  3ZIM A;  2DZO A;  2ETB A;  3C5R A;  5BXO A;  1MX6 A;  4DI3 A;  4FAD A;  2VSX E;  4TXP A;  1BU9 A;  4UQZ A;  5LOZ A;  4ILG A;  4JEU A;  2OVB A;  2ILR A;  5DBK A;  1H6O A;  2EQX A;  3PDN A;  5A23 A;  5ENN A;  3L16 A;  5G05 C;  4PS8 A;  1E8Z A;  1S63 A;  2LXM A;  4LNG A;  4DLO A;  2CG2 A;  2FI7 A;  4J8S A;  3Q49 B;  3CK8 A;  1YYH A;  4GML A;  3ULE G;  1PAQ A;  1OY3 D;  3LJN A;  1DVP A;  3IHV A;  5D0Q D;  2GW1 A;  5AQ9 A;  3SY2 A;  5D2M C;  2PM6 A;  4AV7 A;  3PE4 A;  2KZT B;  3FTZ A;  3PEV B;  5KBA A;  4BT8 A;  4F1P A;  2DIW A;  3V2O A;  3VTY A;  2MHK A;  4YVQ C;  5FIO A;  3G2U A;  3CHM A;  1H19 A;  4ZHB A;  1KPS B;  3FTV A;  3Q78 A;  4N3B A;  2R59 A;  1A17 A;  4KYO B;  2CHZ A;  3B7S A;  3GZS A;  3ASH A;  2PQN A;  3O4Z A;  2VSY A;  1V55 E;  4ATZ D;  5ENP D;  1N4Q A;  2XPI A;  3J5Q B;  4CEM A;  2ZGG A;  5E75 A;  3D9K A;  3C98 A;  5EN5 D;  4EZJ A;  4OAV B;  2DCP A;  2WXL A;  4MRU A;  4EZK A;  4DLQ A;  4I1M A;  5AIJ A;  4AM9 A;  1SA5 A;  3NOG D;  1U3D A;  3R7R A;  4KVM A;  3BU8 A;  3DSW A;  4FU3 A;  2WXK A;  3HVE A;  5J08 A;  4HRL A;  3D9M A;  3FFL A;  4GA1 A;  3CQC B;  3SBS A;  2DWZ A;  3CLJ A;  4HVB A;  5FQ8 A;  3UMV A;  3RKV A;  2CG3 A;  3QKY A;  3LY8 A;  1KZO A;  5KNG A;  2VTB A;  2J49 A;  1TN6 A;  2AW6 A;  4K03 A;  3ASD A;  1IKN D;  1NZN A;  3ZGQ A;  2CFU A;  2NSZ A;  3CHS A;  4BSZ B;  5BV0 A;  4HB5 A;  1AP7 A;  4RLY A;  2WQH A;  3U4T A;  5T3R A;  5BXU A;  2XZD G;  4GU5 A;  4HLE A;  4FJY A;  2LUH A;  2V5F A;  3ZNG A;  3DXK G;  4CGW A;  3E34 A;  1DCE A;  4JA9 A;  2OEW A;  4BWR A;  3RIB A;  4NIK A;  4B93 B;  4O1P A;  1HFA A;  3CR3 A;  3PZ3 A;  4U0U A;  4BX8 A;  4EPZ A;  4DUI A;  3FTU A;  3V79 K;  2QYJ A;  2AXU A;  2WXG A;  3EIJ A;  4E6H A;  4A55 A;  2KCV A;  3OXG A;  1WM5 A;  4M7C A;  4KMO A;  3T8K A;  4NQ0 A;  5FIN A;  2ZGD A;  1FT2 A;  4NUR A;  3CST A;  5EYL A;  3EUV A;  2BKK B;  1N4S A;  3V2X A;  2XHE A;  4WWN A;  5FQ6 A;  2X38 A;  5G04 C;  5A6C A;  3CVV A;  1MJ0 A;  3CQG B;  3JXJ A;  1JUQ A;  3IXE A;  1TNY A;  3KS2 A;  4I9C A;  2NYJ A;  3EU5 A;  2XCB A;  4GZD A;  2OND A;  5KJK A;  2RD0 A;  4BFR A;  2XS1 A;  3ZN3 A;  4GA0 A;  3IKO B;  1DCQ A;  2Q7F A;  5CCL A;  4MS6 A;  2E2E A;  3FUN A;  3TGO A;  3AG1 E;  3AS4 A;  3FTW A;  1MX2 A;  3ZU7 B;  5BNW A;  1DC2 A;  3SO8 A;  4C9B B;  1IHG A;  2Y3A A;  1E8W A;  3OAW A;  4LRZ A;  3DSX A;  2WXQ A;  4HNA D;  3RO3 A;  1E8X A;  1TEZ A;  4UQY A;  3B7U X;  1E96 B;  4GYO A;  1O1T A;  3T5X A;  1H2U A;  3G2W A;  2Y69 E;  5CCM A;  2I2O A;  5BV1 A;  3TWU A;  4N2S A;  1N4P A;  2XPZ A;  3FEX A;  1WY6 A;  2XS8 A;  4KXK B;  3SFY A;  4GMJ A;  5AN8 A;  4QQI A;  3KEZ A;  4CGV A;  5LP0 A;  2P9U G;  3TWT A;  1OUV A;  4GA2 A;  3FTX A;  3DSV A;  4LER A;  2IJG X;  3Q9U C;  4FHK A;  4I6G A;  2FF4 A;  2MOW A;  4GMR A;  2P9I G;  1YMP A;  4N3A A;  2X6J A;  5AQA A;  1H6K A;  1UOH A;  1Y6I A;  4FP7 A;  3SD5 A;  4R7L A;  3QDN A;  5AAO A;  2YQ8 A;  2J4B A;  4ME2 A;  4U95 D;  3SHF A;  3HHM A;  5BW8 C;  3MKQ B;  1ZBP A;  3DWL G;  5CMY A;  2VSN A;  4PH4 B;  4U0Z A;  4HXI A;  1Y8M A;  3ABL E;  2XGO A;  5EX3 A;  3CK9 A;  4EZL A;  3FU3 A;  2ZIR A;  3ISM C;  3S7J A;  3PNT B;  2ZU6 B;  3ONK A;  1FVF A;  3ABM E;  3P2B A;  3NB2 A;  1DNP A;  3OXL A;  4BY6 A;  4GTM A;  3DSS A;  3FUK A;  2VGY A;  4TUM A;  1FPP A;  4K5B A;  2F8X K;  1OWN A;  5D66 A;  1H2V C;  2F37 A;  3BUA A;  2GRL A;  2KCK A;  1G3N B;  4K5A B;  4M3O A;  4JL0 A;  2XGS A;  5C1D A;  3KD7 A;  3ESK A;  4JHR A;  1EPU A;  3PH0 C;  4TXQ A;  2IFU A;  3CKC A;  4WWO A;  2IO2 C;  4H7Y A;  4L2Y A;  3TWX A;  3APC A;  3ULY A;  4UUC A;  1HG2 A;  3CHQ A;  3UPV A;  2P58 C;  2KM4 A;  3TG4 A;  4EQF A;  5CEA A;  4A3V A;  1OCR E;  4UI9 K;  4KZC A;  3CVX A;  3AJI A;  3UM2 A;  5G2N A;  3EU9 A;  3HXE A;  3HRA A;  3PUK A;  4W9R A;  1IQU A;  1OCZ E;  3UIO C;  3DSU A;  5D0O D;  2WXO A;  2IF4 A;  4U7E B;  1FVH A;  5JHA A;  3D9H A;  2KCL A;  2XRY A;  5H7P A;  3CVL A;  4FA6 A;  4E85 A;  2E0I A;  4ANX A;  3SGH A;  4JEH A;  2H6H A;  1E7U A;  5T8I A;  1TR4 A;  2X6I A;  1WG0 A;  5FQ4 A;  4N5C A;  4JHJ A;  4DPR A;  4WNF A;  3RK6 A;  3ONL A;  3LS8 A;  1D8E A;  4BSX A;  5G05 J;  4BX9 A;  3E32 A;  2WQ6 A;  2GRN B;  2AXV A;  3G2V A;  3WG7 E;  4GYY A;  4F53 A;  4XIF A;  4J8E A;  1SA4 A;  3Q9N C;  1N4R A;  4MKT A;  3JUI A;  1OWO A;  5EKQ D;  1IXV A;  1XNF A;  4YDE A;  4IUL A;  2OOE A;  2VSO E;  3D9J A;  5ARF A;  3FEY A;  2EIL E;  3IV0 A;  2CHW A;  3FTS A;  1UW4 B;  2MRI A;  3TL5 A;  2XQ0 A;  1U3C A;  2DZN A;  3LJ3 A;  4I9E A;  3GZ2 A;  1K1A A;  1IYG A;  1VDY A;  4Y6C A;  2PZI A;  3LKU A;  2KAT A;  2ETA A;  2GRM A;  3KSQ A;  2X3M A;  4L23 A;  5AJL A;  3R9M A;  3UX4 A;  4OYS A;  4U63 A;  4K5C A;  3Q79 A;  4CT0 A;  3UIP C;  3ZVV A;  3ZUV B;  2XCC A;  2FEZ A;  4ACL A;  4YDY A;  2KXP C;  5C2Y A;  2R02 A;  3R7Q A;  4IRU A;  4HFG A;  3TAX A;  2BKG A;  3CVY A;  2XEE A;  1N9A A;  2P2C P;  4ILH B;  4HOQ A;  4GZC A;  2CFZ A;  3GW4 A;  1BD8 A;  4WAF A;  1TNB A;  2LXL A;  4A1S A;  4GCN A;  3FUE A;  4CCA A;  5CEC B;  2P9S G;  4F7A A;  3W9G A;  1FCH A;  2QC9 A;  3ULQ A;  3UM0 A;  2IOL A;  3FUH A;  3F6Q A;  3UQ3 A;  5JJT A;  4PDX A;  1JCR A;  3TXN A;  4HOT A;  3MV3 B;  2UY1 A;  4HRN A;  4RG9 A;  4I43 A;  3TG5 A;  1B89 A;  2YHE A;  2V8S E;  4C0E A;  5T4Y A;  2RFA A;  2XEV A;  1HF8 A;  3RAU A;  3MJW A;  3URZ A;  4Z68 A;  5KJN A;  2QZA A;  2V5Q C;  2R5S A;  1N94 A;  2WMO A;  1MX4 A;  3VLE A;  3IEG A;  2XZT G;  3DST A;  4N2Q A;  4ILI A;  1N54 A;  3I3N A;  5AQ7 A;  5BT1 A;  4O6F A;  4N39 A;  3U64 A;  4MLP A;  2XEN A;  3CEQ A;  5HQ8 A;  3FUI A;  1N52 A;  3G2T A;  2ZIS A;  4AY6 A;  3LPZ A;  5IY5 E;  3C72 A;  3PRE A;  4F1S A;  1P5Q A;  3ZHE B;  1E7V A;  3APF A;  3B7B A;  3I4R B;  2X6F A;  1XGW A;  5CMW A;  4G11 A;  5LFA A;  4AXH A;  2I9C A;  5ANL A;  2I6H A;  3GZ1 A; 
#chains in the Genus database with same CATH homology
 4UUC A;  5ENR D;  3DEO A;  4BES A;  5AAO A;  5ITZ F;  4U95 D;  1N0Q A;  2HE0 A;  2J8S D;  3JUE A;  3W9G A;  2QC9 A;  1IXV A;  5CER B;  1BI8 B;  3V31 A;  2Y0B G;  1NFI E;  1MJ0 A;  4LNU D;  1YCS B;  1N11 A;  2B0O E;  2DWZ A;  2PNN A;  3EHQ A;  4LG6 A;  4N5Q A;  5EIL A;  3JXJ A;  3JXI A;  5EID A;  3IXE A;  3F6Q A;  5CBN A;  2NYJ A;  4BET A;  5HKP A;  3J5P A;  3TWW A;  4O1O A;  3TWQ A;  5CEA A;  5HS0 A;  5KBA A;  1K1B A;  4HI9 A;  3W9F A;  3T9K A;  1AWC B;  3AJI A;  4LSZ E;  4F1P A;  3V2O A;  5KNG A;  1MYO A;  1DCQ A;  3EU9 A;  3TWV A;  2DZN A;  3HRA A;  5FIO A;  3ZKJ A;  4HRN A;  1QYM A;  2XEH A;  1K1A A;  2V4H C;  4HRM B;  4OAU C;  4DX5 D;  4HQD A;  5EYP F;  4U96 D;  4ZHB A;  1MX2 A;  2RFA A;  1IKN D;  2AJA A;  3EHR A;  3V30 A;  1N0R A;  3HG0 D;  4J8Y A;  3ZU7 B;  1DC2 A;  3SO8 A;  2ETA A;  1SW6 A;  4Z68 A;  5ENO D;  4HI8 A;  3TWX A;  1A5E A;  3TWS A;  4G8K A;  4A63 B;  4HLL A;  4BER A;  4BSZ B;  2FO1 E;  2V5Q C;  5KWD A;  5ENS D;  3B95 A;  3UI2 A;  4QFV A;  4ZFH A;  4HNA D;  5JMN D;  4HB5 A;  1AP7 A;  4RLY A;  4DX7 D;  3D9H A;  1WDY A;  4ATZ D;  5ENP D;  1MX4 A;  3J5Q B;  2ZGG A;  3KEA A;  3UTM A;  4CYM D;  5BXU A;  2DZO A;  3AAA C;  2KBX A;  5EN5 D;  4U8V D;  2ETB A;  2MYO A;  3C5R A;  2XZD G;  5ENQ D;  5AAR A;  4CZ2 D;  1MX6 A;  4K5C A;  2L6B A;  2XZT G;  5ENT D;  5BXO A;  3ZNG A;  5CED B;  5AQB A;  5AQ7 A;  5JA4 D;  1BU9 A;  3ZUV B;  2ETC A;  1TR4 A;  4TUM A;  3TWU A;  2Y1L E;  4J7W A;  4OAV B;  1BLX B;  1WG0 A;  4K5B A;  2XEN A;  5KNH D;  4YDW A;  3UXG A;  4YDY A;  2KXP C;  4NIK A;  2F8X K;  1S70 B;  5CBO A;  5D66 A;  4U8Y D;  2F37 A;  4B93 B;  4O1P A;  2F8Y A;  4C48 B;  2BKG A;  2JAB A;  4DX1 A;  5AN8 A;  4QQI A;  4DUI A;  3V79 K;  2QYJ A;  5HRY A;  1G3N B;  3TWT A;  4K5A B;  2XEE A;  1IHB A;  1OT8 A;  3NOG D;  4BEP A;  4G8L A;  4GPM A;  4DX2 A;  2P2C P;  1SVX A;  4DRX E;  3Q9U C;  3NBN B;  1YYH A;  2VGE A;  3T8K A;  2A5E A;  1BD8 A;  4O60 A;  3B7B A;  5FIN A;  2ZGD A;  4GMR A;  5EYL A;  4HBD A;  2DVW A;  2BKK B;  1YMP A;  2RFM A;  3DEP A;  4JB8 P;  4F6R D;  3V2X A;  5AQA A;  4DX6 D;  1BI7 B;  1OY3 D;  3LJN A;  3TWR A;  5EIB E;  1K3Z D;  1UOH A;  5AQ9 A;  3Q9N C;  3NOC D;  5CEC B;  1D9S A;  4HRL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...