5EN5D

Apo structure of bacterial efflux pump.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
161
structure length
161
Chain Sequence
b'HHHHHGSDLGKKLLEAARAGRDDEVRILMANGADVNAADVVGWTPLHLAAYWGHLEIVEVLLKNGADVNAYDTLGSTPLHLAAHFGHLEIVEVLLKNGADVNAKDDNGITPLHLAANRGHLEIVEVLLKYGADVNAQDKFGKTAFDISINNGNEDLAEILQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multidrug efflux pump subunit AcrB,Multidrug efflux pump sub
publication title Molecular basis for inhibition of AcrB multidrug efflux pump by novel and powerful pyranopyridine derivatives.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Transport protein
total genus 50
structure length 161
sequence length 161
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2015-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5en5D00
4HI8A 4DUIA 1D9SA 5ENOD 4B93B 3ZNGA 4GMRA 3TWWA 3JXJA 3V31A 3HRAA 2ZGDA 3TWSA 4U96D 1K1AA 5EYLA 5KBAA 4BERA 4RLYA 5AQ9A 4LG6A 4HRMB 2AJAA 5KWDA 3KEAA 3NOCD 4DX7D 2A5EA 3W9FA 4F1PA 1IHBA 3TWVA 1AP7A 3ZUVB 2QYJA 2F8XK 1OT8A 3J5QB 4BESA 3V2XA 1BI7B 1YMPA 3D9HA 4O1PA 4CZ2D 4HRLA 1QYMA 1MX4A 1DCQA 5ENPD 5CEAA 5AN8A 2V4HC 5EIBE 4CYMD 2BKGA 3HG0D 3TWRA 1DC2A 4J7WA 2XEEA 2FO1E 1IKND 2RFMA 5CEDB 2L6BA 1G3NB 5EYPF 3T8KA 4A63B 4ZFHA 5BXOA 5EIDA 1MJ0A 4OAVB 4HI9A 5CERB 1BU9A 4G8KA 3EHQA 5AARA 3ZKJA 4HNAD 4DX1A 4ZHBA 3DEPA 2J8SD 1BD8A 1WDYA 4NIKA 3NOGD 1SVXA 1WG0A 4DX6D 2ZGGA 1BLXB 3V79K 2XZTG 3EHRA 3DEOA 2KBXA 2F37A 2F8YA 2ETCA 2DZNA 4K5CA 4O1OA 2VGEA 4JB8P 5JMND 1K1BA 5KNHD 5EILA 1NFIE 4BETA 2MYOA 4QQIA 1N0QA 5D66A 4C48B 4LSZE 4DX5D 3NBNB 2V5QC 4HLLA 4QFVA 1YCSB 1MYOA 3J5PA 4BSZB 1S70B 2PNNA 4HB5A 3TWUA 1YYHA 5ITZF 3JXIA 3B95A 5FINA 2DWZA 5HRYA 4O60A 1N11A 4YDYA 5CBNA 3Q9UC 3W9GA 2DZOA 4YDWA 4UUCA 1K3ZD 3UTMA 5JA4D 4HRNA 4Z68A 5AQAA 3IXEA 2ETBA 2ETAA 2QC9A 1A5EA 1N0RA 4LNUD 2BKKB 5KNGA 4DX2A 3EU9A 5EN5D 2KXPC 4G8LA 5ENQD 3B7BA 4K5AB 5HS0A 4ATZD 2P2CP 2HE0A 1OY3D 1MX2A 3T9KA 2XENA 5AQ7A 3UXGA 1MX6A 2DVWA 3AAAC 4U8YD 1IXVA 5ENSD 3F6QA 5AQBA 4U8VD 1UOHA 4U95D 2B0OE 3ZU7B 4N5QA 2XEHA 5ENTD 4DRXE 4F6RD 5BXUA 3TWQA 3C5RA 5CECB 3TWTA 2XZDG 2Y1LE 4J8YA 4HBDA 4K5BA 5ENRD 4BEPA 2JABA 4OAUC 3SO8A 1AWCB 5FIOA 3AJIA 2Y0BG 4TUMA 1BI8B 2RFAA 1SW6A 3LJNA 3TWXA 5HKPA 3Q9NC 3UI2A 3V2OA 3V30A 2NYJA 1TR4A 3JUEA 4HQDA 5AAOA 4GPMA 5CBOA
chains in the Genus database with same CATH superfamily
3ASFA 3TWWA 4NACA 3BG1B 4JA7A 1A17A 5CCMA 3Q7AA 1E90A 4DX7D 5T3RA 2A5EA 3AS4A 4DJAA 3EDTB 2V4HC 3DPYA 3APFA 3HG0D 3SFXA 1MJ0A 3ONLA 4N2SA 3UM3A 3HXCA 2J8SD 4GCNA 4DX6D 3DSSA 1HF8A 4YDOA 3N71A 2PZIA 2ZIRA 1TJCA 2IONA 4BT8A 4GA1A 4BSZB 2DWZA 1TEZA 3ASGA 4ILHB 4GZCA 5FWQA 4G24A 4GMLA 4TUUA 4I6GA 4KVOA 4J8DA 3KEZA 4BFRA 3B7BA 5ANRA 1FPPA 3ZEFA 3T9KA 4GTTA 2IF4A 2RKKA 3KAEA 3B7RL 1QQEA 2Y4TA 5BXUA 4NURA 4WNGA 1JCQA 4J8YA 5KJLA 2V8SE 2XS1A 3U9WA 4Q69A 1AWCB 2WXKA 3U64A 2OVBA 4CDRA 3Q15A 2IOSA 4UQZA 4I2ZA 1KZOA 5KJKA 3V31A 2WXQA 3LYAA 4KZ0A 2L9BA 3VTYA 2DCPA 1UG3A 4KXKB 1S0PA 2F8XK 3Q73A 4K03A 5A23A 2GGFA 3TXMA 4U8HA 3D9HA 4O1PA 3SI5A 2PM7A 1DC2A 3R9AB 3TWRA 4FADA 2WXGA 2J09A 2PQRA 3LY8A 5JHAA 5CERB 3KD7A 3FUMA 4HLEA 4J8FA 4WNDA 4U04A 2E0IA 2XRZA 2L0TB 2CG3A 3HYMB 4PS8A 5B3SE 3B7TA 3LCAA 1OWLA 4G11A 3DPDA 4MRUA 2VSOE 4JD2G 4UWKA 1ELKA 1JPLA 3D9JA 4QFVA 3DXKG 2V4LA 4U7EB 5B1BE 2I6HA 3LVRE 3AU5A 3CV0A 1JUQA 4I6EA 5JJ6A 1MHQA 2XGOA 3L6AA 1N9AA 4JHKA 3VTXA 2KZTA 3E33A 5ENSD 3C3RA 4ACKA 4JHRA 1P5QA 3RRNB 4HFGA 3ZYLA 4XZ4A 4BEPA 4L1BA 5BW8C 4I43A 4GYYA 1HZ4A 1Q2ZA 1E8YA 2J08A 3ML9A 1OWOA 4HI8A 3VLDA 1OWPA 2C2LA 4WNEA 5KBAA 4G1TA 1O1RA 3UINC 3Q7FA 3TWVA 3FTYA 3ZUVB 1OT8A 2WXIA 3D9MA 2IU1A 1KT0A 3PS6A 3FTSA 4JZYA 2M63A 3RRUA 3OXLA 5CMYA 4HI9A 1TNYA 4HS2A 1JWFA 1EF1C 5CCLA 2YHEA 3PUJA 1WG0A 2RD0A 4RG6A 2J4DA 4U0SA 1Z6TA 2F37A 5AYWD 2DZNA 2R5SA 2P9NG 2LAIA 2X6JA 4QQIA 1EDUA 4HOSA 3ULEG 1MYOA 3J5PA 3U4TA 1YYHA 4KVMA 2KZTB 3CVYA 2FEZA 5M72A 4CRWA 1K3ZD 2P9UG 2OVFA 3EU9A 1KLXA 3CEQA 4GZDA 2PQNA 3O48A 2XPYA 1MX2A 5FZQA 1QBQA 3SFYA 3UXGA 3G2UA 4GPKA 4N5QA 3HVEA 2R2LA 3D9KA 4DI3A 4K5BA 4GYWA 4AP2A 5E75A 3UKUG 3DRAA 3ZYMA 2J4BA 2Y0BG 4HXIA 3R7RA 3IEGA 5J90A 1LF8A 4A1SA 5AJLA 4GMRA 4M3OA 3UPVA 4N2QA 4C0MA 3Q47B 3KEAA 5LOZA 1JCRA 4KBQA 3CR3A 3SBTB 2C0LA 2BTDA 1L5JA 2EIJE 4URKA 4FHJA 2XEEA 1B89A 2LSVA 3TGOA 2VQ2A 4MBGA 2ZGGA 2KC7A 2XPIA 3VLEA 4C0EA 1ELRA 1WM5A 4K5CA 4TXRA 3I4GA 1KZPA 4Q96A 5G2NA 3ZHEA 4BETA 3RSEG 1OWNA 3PE4A 3EIJA 5ARGA 3CIAA 3L08A 3PREA 3JXIA 4CEMA 5CBNA 2Y3AA 4JC8A 4PH4B 5FQ7A 3NZSA 3PNLB 3IXEA 2QC9A 4LUNU 4LNUD 3FU5A 1RW2A 3FH5A 1PAQA 3FWVA 3RK6A 2WXJA 2UY1A 4U8YD 3UMVA 2XEHA 3FEYA 2XZDG 4HBDA 3G2TA 4RQIA 5FIOA 2I1KA 2XRYA 4TUMA 3E37A 3V30A 3NF1A 1TR4A 1E96B 4GTQA 3JCKC 3IV0A 2X6FA 3Q5MA 1IHBA 3MCXA 4L2YA 2EINE 3HXEA 4XI9A 4AOFA 2QY7A 1V55E 1BI7B 1YMPA 1H2VC 2LAHA 2EIME 5EIBE 3Q75A 4BTBA 3ZHEB 3NB2A 5EX0A 3DEPA 4PUCA 2AWIA 2QFCA 3EHRA 4BTAA 5A6CA 3TJPA 3Q78A 2CG2A 3FUHA 4YVQC 2WQHA 2WXHA 2UY1B 4O60A 4YDWA 4WWPA 3U3WA 3GZ1A 3B13A 3T5VA 3ZRHA 3PUKA 2Y4UA 4DX2A 4OYSA 2P2CP 2GRNB 2VGXA 3GZSA 3PEUB 2DIWA 1MZCA 2EQXA 5ENRD 4MLPA 4GU5A 5BT1A 3UI2A 3Q9NC 3FUNA 4GPMA 4DUIA 5ENOD 1VDYA 3JXJA 5AIJA 2YINA 1O1SA 2CFZA 4U96D 1K1AA 5FZSA 4RVBA 3W9FA 3LY9A 4B0ZA 4WAFA 4GA2A 4AEZC 2L6JA 3JQ0A 4B89A 5AN8A 4I1MA 4J7WA 3G2VA 2XGMA 2NSZA 3MKQA 4ABNA 3PRZA 4IYPA 1HH8A 1BU9A 2ILRA 3HDXA 3EHQA 2J49A 3ZKJA 4DX1A 1OCZE 3L17A 2A4ZA 1D8DA 3TAXA 3V79K 4C9BB 3FHEA 2X38A 4RSYA 4A3TA 4RG9A 2EIKE 5KNHD 1NFIE 3NAWA 4C48B 1OCOE 3MZLB 4DX5D 2ZISA 3KSQA 2OEVA 2PNNA 2VGXB 4WUYA 4IULA 3SNXA 1N52A 3HXDA 4GMJA 3ZYQA 4IRUA 1DNPA 5AQAA 3E32A 1D8EA 5ENNA 3ZPJA 4XKBA 3S7BA 5ENQD 1O1TA 3LDZA 3OTNA 2YQ8A 1S64A 2XHEA 4HORA 1ELWA 3TWQA 3C5RA 3ONKA 4GTPA 3FH8A 3QARA 4Y6WA 3AU4A 4TXPA 3PZ1A 3SQVA 1LD8A 1TYQG 3MKQB 4J0UA 3LS8A 2VJ8A 2IJGX 2QYJA 4L9PA 3QWWA 2WMOA 4TRQA 2WXLA 1LD7A 2ZXWE 1IKND 5EYPF 2WMNA 4BSXA 3B7UX 3WXXA 2HR2A 3ASHA 2H6GA 3CHSA 4I9EA 5LP0A 3ZN3A 1OCRE 3DEOA 4G2VA 3CLJA 4WNFA 2R59A 3ZIMA 5G04C 3FTWA 3LXUX 2DYSE 3QJZA 2IQCA 4XEIG 2P9LG 3ULYA 3FUKA 5HRYA 4ACLA 2L0IA 2ETBA 4F3VA 1H2UA 4N3BA 3CVLA 4ANUA 2OCCE 4JVSA 3CSFA 2MHKA 4CT0A 5EKQD 3JUIA 4F6RD 4FULA 2VSYA 1N4SA 2DYRE 3FTXA 4GTRA 4CT4A 1GW6A 3SD5A 1TN7A 4HQDA 4KMOA 3PZ2A 3P1UA 3GW4A 3UIPC 4B94A 3FUIA 1E8WA 2WXNA 2PM6A 2AJAA 4ANVA 4EECA 4JW1A 5JJTA 3CKBA 2OEWA 3VLFA 2ONDA 4L23A 3LJ3A 2CHZA 1H19A 3ISMC 3ML8A 3LY7A 4LCTA 2FO1E 5CEDB 5D0OD 2X6IA 3E34A 2V5FA 4HOTA 2LXLA 3TG5A 4NIKA 3UM2A 4NQ0A 4KT6B 4U63A 5LFAA 3CVQA 2KBXA 1E7VA 1U3CA 2Y69E 1ZBPA 4LSZE 5A7DB 2R03A 3CVPA 4FU3A 2XS8A 3DSXA 4HB5A 4XI0A 3ZXSA 3CQGB 3I4RB 3CHMA 3CK8A 1OCCE 1W3BA 4J8SA 1E8XA 4XE0A 5EN5D 5HS0A 2HE0A 2YHCA 3CK7A 4UWLA 3FP3A 4GTOA 4LNGA 3G2SA 4EBAG 1UOHA 5FTPA 2WVIA 4ANWA 3CVVA 3DSTA 2P9SG 4YDEA 3DSVA 2KCKA 5AAOA 5CMWA 4B93B 3TWSA 2WQ7A 4UQYA 3ABKE 3SZ7A 4LG6A 4P29A 4KYOB 3PH0C 1FCHA 2BUGA 2XCCA 3PZDA 4FC8A 1FVHA 3ABME 1TN8A 3FDHA 1MX4A 3T8MA 3UIOC 4UWFA 2BKGA 2WXMA 3WG7E 1WDYA 4HOQA 4UI9C 4W9RA 2XEVA 1N4QA 2F0YA 1NA3A 1FT1A 3MX3A 2ETCA 3AS8A 3RRMB 3QOUA 2H6HA 3L54A 5EILA 5FT9A 3BG0B 3NBNB 4B8CB 4GA0A 2HO1A 4H7YA 1RZ4A 1SQMA 2VYIA 4YDYA 4ME2A 2P9PG 2KM4A 4BWRA 4DK5A 2ZU6B 3NZUA 2KCLA 3UM1A 4UWHA 2XGSA 3FU0A 4KZCA 4N3AA 1OY3D 4EBAA 3CVXA 5AQ7A 2DVWA 3L16A 1X81A 3MGBA 4DRXE 2JABA 3FTZA 1ZU2A 3HVEB 3KSLA 3FTVA 4XX5A 4BY6A 2QYUA 5D2MC 2RFAA 1SW6A 4U07A 5CBOA 4TV3A 1BPOA 2IFUA 3D9OA 2FI7A 3LVQE 3FH7A 4GTSA 3FU3A 3NOCD 3CVWA 3S2AA 2HYZA 3FFLA 4I17A 4O6FA 4FJYA 4BESA 4FLHA 2AXUA 4HRLA 1IQRA 3QC1A 4Q94A 5LX8A 3S7FA 5BXOA 3HHMA 3C3QA 2AXZA 1SA5A 1JWGA 2XPZA 1QZ2A 3EIQC 1H6OA 3LKUA 2CFUA 3L22A 2WXOA 3QK0A 3L82A 1Z3XA 2NXPA 2MYOA 1N0QA 1INZA 3QB2A 2LXMA 2FF4A 4E85A 5BNWA 3Q9UC 3RJVA 4ATGA 4LNBA 3RU0A 3RIBA 2H6IA 1WY6A 4U0UA 3O4ZA 4K5AB 2VGYA 1U3DA 3ESKA 4G26A 2DBAA 2IOLA 3ZW3A 4GTVA 1N4PA 4GYOA 5B1AE 3F6QA 2OV8A 5CECB 4I9CA 2Y1LE 4I6JA 3CHRA 1XNFA 1XGWA 3LJNA 3DXMG 2UWJG 1OWMA 5HKPA 4L2LA 5CEAA 1D9SA 5KJMA 2ZGDA 1U2VG 5FQ4A 5EYLA 3UT7A 5AQ9A 4H7XA 4HRMB 2J9QA 4JEHA 2IY0C 4LRZA 1AP7A 4BX9A 4V3IA 5JHBA 4YNDA 4CZ2D 2WXRA 2MRIA 3HXFA 5DIZA 5ENPD 5H7PA 1N54A 2AVPA 4EZJA 1K8KG 4PS3A 2XQ0A 3UUXA 3NOGD 1SVXA 2LSUA 3CQCB 4GTMA 3EHMA 3DSUA 4ILIA 3D9IA 3JYSA 3ZGQA 2BF0X 3T5XA 1WAO1 2GROB 2AXVA 3B7SA 3MEKA 4I2WA 1YCSB 1H0AA 2C0MA 3RO2A 3TWUA 4PS7A 4EHMA 3SHFA 3EHNA 3FUJA 5KNGA 3CK9A 2Q7FA 4DPRA 5HQ8A 2WXFA 2GW1A 2WPVA 1IXVA 4N5CA 4U95D 3Q4AB 3FUEA 3DSWA 3QDNA 3HIZA 4OAUC 3PE3A 3NQPA 4HVBA 3AJIA 4ILGA 3L9TA 4PDXA 3ZNGA 1EYHA 4R7LA 2GRMA 3SFZA 1SA4A 2NC9A 3QAQA 5KWDA 4AV7A 2LO6A 3R7QA 1HXIA 4N3CA 4XIFA 1DVPA 1DCQA 3SF4A 4A63B 4G8KA 3APCA 3MV3B 5FJYA 1QNFA 4NRHB 4ANXA 1UW4B 2FULA 4AM9A 3ULQA 5BV1A 4O1OA 3IKOB 1K1BA 3OAWA 5LCWJ 1IHGA 1HX8A 4HLLA 3UKRG 1S70B 5G05J 2VSNA 2VTBA 5J08A 1FVFA 5C1DA 3W9GA 3ASNE 4I1OB 4G8LA 3APDA 1TNBA 3OXGA 3D9LA 3AAAC 3URZA 5T8IA 3CKCA 1NI1A 3HXBA 2X6HA 1FT2A 4OVUA 3LPZA 2J07A 1TN6A 1MQSA 3FULA 4LERA 2WB2A 1HE8A 2I2OA 5AJDA 3JUEA 3ASOE 3MJWA 5EX3A 4UWGA 3P2BA 3C98A 1Z3YA 3L13A 3UX4A 3D9NA 4RLYA 5AENA 1SZAA 4K0RA 1UN8A 2P58C 4IN3B 3ESLA 1UN9A 2WQ6A 4J8EA 3E4BA 4CYMD 4YVOA 3FEXA 3S7JA 2RFMA 3T8KA 4ZFHA 3MKRA 2I9CA 1TNUA 5BV0A 4HNAD 1DCEA 1BD8A 2VTBB 1H6PA 2GRLA 2WM9A 1BLXB 4BX8A 2XZTG 4GZ3A 5JMND 2IO3C 3ZXPA 3ZFWA 3S7DA 5ITZF 2R02A 1YA0A 4FA6A 4HRNA 4JA9A 1EPUA 1A5EA 1N0RA 2X3MA 2BKKB 1IYGA 3AS5A 4FP7A 5G55A 2OOEA 2XENA 1IQUA 3DWLG 3QNKA 4U8VD 3ZU7B 1KT1A 2BEDA 5T4YA 3R9MA 2R17C 3IBEA 5JJ7A 2AW6A 3AG4E 3FTUA 2P9IG 4GAAA 3CVUA 1JCSA 4X8QA 4EPZA 4L7TA 4CDMA 3UQ3A 5BUZA 3TXNA 1X5BA 4A55A 3ZVVA 3FUFA 4BT9A 2I1JA 2IO2C 3BUAA 1HS6A 3TL5A 1N4RA 3FU6A 3IHVA 2JEKA 1OXJA 1QYMA 4FHKA 3C72A 3GZ2A 4JL0A 1HG2A 3X2QE 3CSTA 2L6BA 3RAUA 4EQFA 2LUHA 3ABLE 5EDSA 2IEJA 3GYZA 4MS6A 2GRQB 3C3OA 3D9PA 2F8YA 5G04J 4CDNA 1NZNA 2RG8A 3UT8A 3E30A 5FINA 4J6IA 3OXFA 1N11A 3EJNA 3UTMA 2HM8A 4Z68A 3G2WA 1HO8A 4AJWA 2WXPA 4DI4A 1SZ9A 1PY1A 3RO3A 4ATZD 3EU5A 3BU8A 3CGHA 4WWOA 4JPSA 2KATA 3TWTA 4F1SA 4G25A 1LTXA 4EZLA 3CVNA 4JHJA 5ARFA 5FQ6A 3U66A 3EUVA 2R05A 4CCAA 4F7AA 3MV2B 3HRAA 3I5PA 1O5MA 4DLQA 2FO7A 4F1PA 2P9KG 3PDNA 4M7CA 3V2XA 4DLOA 4A3VA 2CHXA 4JEUA 1S63A 2QZAA 3MYVA 1G3NB 5EIDA 4OAVB 1H6KA 1TNOA 4LEUA 4MKTA 4D10C 4CGWA 3BEEA 2A5UA 3AG3E 4GZ6A 1Y8MA 1ZB1A 2GRRB 3CHOA 3BQOA 5CHEE 2XCBA 4AIFA 3PVLA 4JB8P 4AY5A 3QKYA 3I3NA 3TG4A 3Q49B 4UI9K 3UT4A 5CRUA 5HI7A 1HFAA 1PC2A 5D0QD 2DZOA 1OUVA 4UUCA 2B6CA 1Y6IA 5JA4D 3CHQA 2ETAA 1N95A 2PL2A 2KXPC 3Q79A 2MOWA 3ENEA 1TNZA 5IY5E 3SY2A 3QWPA 4Y6CA 4AXHA 5ENTD 3ZYKA 3MA5A 2E2EA 3PEVB 2KCVA 4WWNA 3AG1E 5CRVA 5C2YA 4APFA 3SBSA 1BI8B 3TWXA 3V2OA 3CHPA 1NA0A 4JXTA 4FJZA 2X6KA 3K9IA 4GCOA 4GZ5A 5FZRA 4BERA 4G23A 2VSXE 3ASDA 4FLBA 5BPPA 4UQXA 1UJJA 4F53A 1N94A 3J5QB 3PZ4A 1H2TC 3PZ3A 4CGVA 4E6HA 2GRPB 1Z5SC 4UI9J 5LCWC 4GB9A 3AG2E 4N39A 5AARA 4ZHBA 4EZKA 5G05C 4I1AA 4U0ZA 1V54E 5KJNA 2V0PA 2VGEA 3DBSA 1NL4A 3IHYA 3FY4A 3UM0A 5D66A 3PNTB 1E7UA 4OVVA 2V5QC 3D3MA 2YNQA 2LNIA 3B95A 1NP7A 3KS2A 4APOA 4TXQA 3SGHA 5KCMA 5E76A 2JLBA 4XKCA 1KPSB 3FUDA 5DBKA 2H6FA 2CHWA 1E8ZA 1MX6A 2EILE 5ANLA 5AQBA 4AY6A 4B8AA 2B0OE 1UJKA 3RKVA 3LEWA 1TJFA 4AVXA 3SO8A 1HG5A 5FQ8A 3JQ1A 1HU3A 3QWVA 4HOUA 2NYJA 4A1GA 2FBNA
chains in the Genus database with same CATH topology
4HI8A 4DUIA 1D9SA 5ENOD 4B93B 3ZNGA 4GMRA 3TWWA 3JXJA 3V31A 3HRAA 2ZGDA 3TWSA 4U96D 1K1AA 5EYLA 5KBAA 4BERA 4RLYA 5AQ9A 4LG6A 4HRMB 2AJAA 5KWDA 3KEAA 3NOCD 4DX7D 2A5EA 3W9FA 4F1PA 1IHBA 3TWVA 1AP7A 3ZUVB 2QYJA 2F8XK 1OT8A 3J5QB 4BESA 3V2XA 1BI7B 1YMPA 3D9HA 4O1PA 4CZ2D 4HRLA 1QYMA 1MX4A 1DCQA 5ENPD 5CEAA 5AN8A 2V4HC 5EIBE 4CYMD 2BKGA 3HG0D 3TWRA 1DC2A 4J7WA 2XEEA 2FO1E 1IKND 2RFMA 5CEDB 2L6BA 1G3NB 5EYPF 3T8KA 4A63B 4ZFHA 5BXOA 5EIDA 1MJ0A 4OAVB 4HI9A 5CERB 1BU9A 4G8KA 3EHQA 5AARA 3ZKJA 4HNAD 4DX1A 4ZHBA 3DEPA 2J8SD 1BD8A 1WDYA 4NIKA 3NOGD 1SVXA 1WG0A 4DX6D 2ZGGA 1BLXB 3V79K 2XZTG 3EHRA 3DEOA 2KBXA 2F37A 2F8YA 2ETCA 2DZNA 4K5CA 4O1OA 2VGEA 4JB8P 5JMND 1K1BA 5KNHD 5EILA 1NFIE 4BETA 2MYOA 4QQIA 1N0QA 5D66A 4C48B 4LSZE 4DX5D 3NBNB 2V5QC 4HLLA 4QFVA 1YCSB 1MYOA 3J5PA 4BSZB 1S70B 2PNNA 4HB5A 3TWUA 1YYHA 5ITZF 3JXIA 3B95A 5FINA 2DWZA 5HRYA 4O60A 1N11A 4YDYA 5CBNA 3Q9UC 3W9GA 2DZOA 4YDWA 4UUCA 1K3ZD 3UTMA 5JA4D 4HRNA 4Z68A 5AQAA 3IXEA 2ETBA 2ETAA 2QC9A 1A5EA 1N0RA 4LNUD 2BKKB 5KNGA 4DX2A 3EU9A 5EN5D 2KXPC 4G8LA 5ENQD 3B7BA 4K5AB 5HS0A 4ATZD 2P2CP 2HE0A 1OY3D 1MX2A 3T9KA 2XENA 5AQ7A 3UXGA 1MX6A 2DVWA 3AAAC 4U8YD 1IXVA 5ENSD 3F6QA 5AQBA 4U8VD 1UOHA 4U95D 2B0OE 3ZU7B 4N5QA 2XEHA 5ENTD 4DRXE 4F6RD 5BXUA 3TWQA 3C5RA 5CECB 3TWTA 2XZDG 2Y1LE 4J8YA 4HBDA 4K5BA 5ENRD 4BEPA 2JABA 4OAUC 3SO8A 1AWCB 5FIOA 3AJIA 2Y0BG 4TUMA 1BI8B 2RFAA 1SW6A 3LJNA 3TWXA 5HKPA 3Q9NC 3UI2A 3V2OA 3V30A 2NYJA 1TR4A 3JUEA 4HQDA 5AAOA 4GPMA 5CBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HI8 A;  4DUI A;  1D9S A;  5ENO D;  4B93 B;  3ZNG A;  4GMR A;  3TWW A;  3JXJ A;  3V31 A;  3HRA A;  2ZGD A;  3TWS A;  4U96 D;  1K1A A;  5EYL A;  5KBA A;  4BER A;  4RLY A;  5AQ9 A;  4LG6 A;  4HRM B;  2AJA A;  5KWD A;  3KEA A;  3NOC D;  4DX7 D;  2A5E A;  3W9F A;  4F1P A;  1IHB A;  3TWV A;  1AP7 A;  3ZUV B;  2QYJ A;  2F8X K;  1OT8 A;  3J5Q B;  4BES A;  3V2X A;  1BI7 B;  1YMP A;  3D9H A;  4O1P A;  4CZ2 D;  4HRL A;  1QYM A;  1MX4 A;  1DCQ A;  5ENP D;  5CEA A;  5AN8 A;  2V4H C;  5EIB E;  4CYM D;  2BKG A;  3HG0 D;  3TWR A;  1DC2 A;  4J7W A;  2XEE A;  2FO1 E;  1IKN D;  2RFM A;  5CED B;  2L6B A;  1G3N B;  5EYP F;  3T8K A;  4A63 B;  4ZFH A;  5BXO A;  5EID A;  1MJ0 A;  4OAV B;  4HI9 A;  5CER B;  1BU9 A;  4G8K A;  3EHQ A;  5AAR A;  3ZKJ A;  4HNA D;  4DX1 A;  4ZHB A;  3DEP A;  2J8S D;  1BD8 A;  1WDY A;  4NIK A;  3NOG D;  1SVX A;  1WG0 A;  4DX6 D;  2ZGG A;  1BLX B;  3V79 K;  2XZT G;  3EHR A;  3DEO A;  2KBX A;  2F37 A;  2F8Y A;  2ETC A;  2DZN A;  4K5C A;  4O1O A;  2VGE A;  4JB8 P;  5JMN D;  1K1B A;  5KNH D;  5EIL A;  1NFI E;  4BET A;  2MYO A;  4QQI A;  1N0Q A;  5D66 A;  4C48 B;  4LSZ E;  4DX5 D;  3NBN B;  2V5Q C;  4HLL A;  4QFV A;  1YCS B;  1MYO A;  3J5P A;  4BSZ B;  1S70 B;  2PNN A;  4HB5 A;  3TWU A;  1YYH A;  5ITZ F;  3JXI A;  3B95 A;  5FIN A;  2DWZ A;  5HRY A;  4O60 A;  1N11 A;  4YDY A;  5CBN A;  3Q9U C;  3W9G A;  2DZO A;  4YDW A;  4UUC A;  1K3Z D;  3UTM A;  5JA4 D;  4HRN A;  4Z68 A;  5AQA A;  3IXE A;  2ETB A;  2ETA A;  2QC9 A;  1A5E A;  1N0R A;  4LNU D;  2BKK B;  5KNG A;  4DX2 A;  3EU9 A;  5EN5 D;  2KXP C;  4G8L A;  5ENQ D;  3B7B A;  4K5A B;  5HS0 A;  4ATZ D;  2P2C P;  2HE0 A;  1OY3 D;  1MX2 A;  3T9K A;  2XEN A;  5AQ7 A;  3UXG A;  1MX6 A;  2DVW A;  3AAA C;  4U8Y D;  1IXV A;  5ENS D;  3F6Q A;  5AQB A;  4U8V D;  1UOH A;  4U95 D;  2B0O E;  3ZU7 B;  4N5Q A;  2XEH A;  5ENT D;  4DRX E;  4F6R D;  5BXU A;  3TWQ A;  3C5R A;  5CEC B;  3TWT A;  2XZD G;  2Y1L E;  4J8Y A;  4HBD A;  4K5B A;  5ENR D;  4BEP A;  2JAB A;  4OAU C;  3SO8 A;  1AWC B;  5FIO A;  3AJI A;  2Y0B G;  4TUM A;  1BI8 B;  2RFA A;  1SW6 A;  3LJN A;  3TWX A;  5HKP A;  3Q9N C;  3UI2 A;  3V2O A;  3V30 A;  2NYJ A;  1TR4 A;  3JUE A;  4HQD A;  5AAO A;  4GPM A;  5CBO A; 
#chains in the Genus database with same CATH topology
 3ASF A;  3TWW A;  4NAC A;  3BG1 B;  4JA7 A;  1A17 A;  5CCM A;  3Q7A A;  1E90 A;  4DX7 D;  5T3R A;  2A5E A;  3AS4 A;  4DJA A;  3EDT B;  2V4H C;  3DPY A;  3APF A;  3HG0 D;  3SFX A;  1MJ0 A;  3ONL A;  4N2S A;  3UM3 A;  3HXC A;  2J8S D;  4GCN A;  4DX6 D;  3DSS A;  1HF8 A;  4YDO A;  3N71 A;  2PZI A;  2ZIR A;  1TJC A;  2ION A;  4BT8 A;  4GA1 A;  4BSZ B;  2DWZ A;  1TEZ A;  3ASG A;  4ILH B;  4GZC A;  5FWQ A;  4G24 A;  4GML A;  4TUU A;  4I6G A;  4KVO A;  4J8D A;  3KEZ A;  4BFR A;  3B7B A;  5ANR A;  1FPP A;  3ZEF A;  3T9K A;  4GTT A;  2IF4 A;  2RKK A;  3KAE A;  3B7R L;  1QQE A;  2Y4T A;  5BXU A;  4NUR A;  4WNG A;  1JCQ A;  4J8Y A;  5KJL A;  2V8S E;  2XS1 A;  3U9W A;  4Q69 A;  1AWC B;  2WXK A;  3U64 A;  2OVB A;  4CDR A;  3Q15 A;  2IOS A;  4UQZ A;  4I2Z A;  1KZO A;  5KJK A;  3V31 A;  2WXQ A;  3LYA A;  4KZ0 A;  2L9B A;  3VTY A;  2DCP A;  1UG3 A;  4KXK B;  1S0P A;  2F8X K;  3Q73 A;  4K03 A;  5A23 A;  2GGF A;  3TXM A;  4U8H A;  3D9H A;  4O1P A;  3SI5 A;  2PM7 A;  1DC2 A;  3R9A B;  3TWR A;  4FAD A;  2WXG A;  2J09 A;  2PQR A;  3LY8 A;  5JHA A;  5CER B;  3KD7 A;  3FUM A;  4HLE A;  4J8F A;  4WND A;  4U04 A;  2E0I A;  2XRZ A;  2L0T B;  2CG3 A;  3HYM B;  4PS8 A;  5B3S E;  3B7T A;  3LCA A;  1OWL A;  4G11 A;  3DPD A;  4MRU A;  2VSO E;  4JD2 G;  4UWK A;  1ELK A;  1JPL A;  3D9J A;  4QFV A;  3DXK G;  2V4L A;  4U7E B;  5B1B E;  2I6H A;  3LVR E;  3AU5 A;  3CV0 A;  1JUQ A;  4I6E A;  5JJ6 A;  1MHQ A;  2XGO A;  3L6A A;  1N9A A;  4JHK A;  3VTX A;  2KZT A;  3E33 A;  5ENS D;  3C3R A;  4ACK A;  4JHR A;  1P5Q A;  3RRN B;  4HFG A;  3ZYL A;  4XZ4 A;  4BEP A;  4L1B A;  5BW8 C;  4I43 A;  4GYY A;  1HZ4 A;  1Q2Z A;  1E8Y A;  2J08 A;  3ML9 A;  1OWO A;  4HI8 A;  3VLD A;  1OWP A;  2C2L A;  4WNE A;  5KBA A;  4G1T A;  1O1R A;  3UIN C;  3Q7F A;  3TWV A;  3FTY A;  3ZUV B;  1OT8 A;  2WXI A;  3D9M A;  2IU1 A;  1KT0 A;  3PS6 A;  3FTS A;  4JZY A;  2M63 A;  3RRU A;  3OXL A;  5CMY A;  4HI9 A;  1TNY A;  4HS2 A;  1JWF A;  1EF1 C;  5CCL A;  2YHE A;  3PUJ A;  1WG0 A;  2RD0 A;  4RG6 A;  2J4D A;  4U0S A;  1Z6T A;  2F37 A;  5AYW D;  2DZN A;  2R5S A;  2P9N G;  2LAI A;  2X6J A;  4QQI A;  1EDU A;  4HOS A;  3ULE G;  1MYO A;  3J5P A;  3U4T A;  1YYH A;  4KVM A;  2KZT B;  3CVY A;  2FEZ A;  5M72 A;  4CRW A;  1K3Z D;  2P9U G;  2OVF A;  3EU9 A;  1KLX A;  3CEQ A;  4GZD A;  2PQN A;  3O48 A;  2XPY A;  1MX2 A;  5FZQ A;  1QBQ A;  3SFY A;  3UXG A;  3G2U A;  4GPK A;  4N5Q A;  3HVE A;  2R2L A;  3D9K A;  4DI3 A;  4K5B A;  4GYW A;  4AP2 A;  5E75 A;  3UKU G;  3DRA A;  3ZYM A;  2J4B A;  2Y0B G;  4HXI A;  3R7R A;  3IEG A;  5J90 A;  1LF8 A;  4A1S A;  5AJL A;  4GMR A;  4M3O A;  3UPV A;  4N2Q A;  4C0M A;  3Q47 B;  3KEA A;  5LOZ A;  1JCR A;  4KBQ A;  3CR3 A;  3SBT B;  2C0L A;  2BTD A;  1L5J A;  2EIJ E;  4URK A;  4FHJ A;  2XEE A;  1B89 A;  2LSV A;  3TGO A;  2VQ2 A;  4MBG A;  2ZGG A;  2KC7 A;  2XPI A;  3VLE A;  4C0E A;  1ELR A;  1WM5 A;  4K5C A;  4TXR A;  3I4G A;  1KZP A;  4Q96 A;  5G2N A;  3ZHE A;  4BET A;  3RSE G;  1OWN A;  3PE4 A;  3EIJ A;  5ARG A;  3CIA A;  3L08 A;  3PRE A;  3JXI A;  4CEM A;  5CBN A;  2Y3A A;  4JC8 A;  4PH4 B;  5FQ7 A;  3NZS A;  3PNL B;  3IXE A;  2QC9 A;  4LUN U;  4LNU D;  3FU5 A;  1RW2 A;  3FH5 A;  1PAQ A;  3FWV A;  3RK6 A;  2WXJ A;  2UY1 A;  4U8Y D;  3UMV A;  2XEH A;  3FEY A;  2XZD G;  4HBD A;  3G2T A;  4RQI A;  5FIO A;  2I1K A;  2XRY A;  4TUM A;  3E37 A;  3V30 A;  3NF1 A;  1TR4 A;  1E96 B;  4GTQ A;  3JCK C;  3IV0 A;  2X6F A;  3Q5M A;  1IHB A;  3MCX A;  4L2Y A;  2EIN E;  3HXE A;  4XI9 A;  4AOF A;  2QY7 A;  1V55 E;  1BI7 B;  1YMP A;  1H2V C;  2LAH A;  2EIM E;  5EIB E;  3Q75 A;  4BTB A;  3ZHE B;  3NB2 A;  5EX0 A;  3DEP A;  4PUC A;  2AWI A;  2QFC A;  3EHR A;  4BTA A;  5A6C A;  3TJP A;  3Q78 A;  2CG2 A;  3FUH A;  4YVQ C;  2WQH A;  2WXH A;  2UY1 B;  4O60 A;  4YDW A;  4WWP A;  3U3W A;  3GZ1 A;  3B13 A;  3T5V A;  3ZRH A;  3PUK A;  2Y4U A;  4DX2 A;  4OYS A;  2P2C P;  2GRN B;  2VGX A;  3GZS A;  3PEU B;  2DIW A;  1MZC A;  2EQX A;  5ENR D;  4MLP A;  4GU5 A;  5BT1 A;  3UI2 A;  3Q9N C;  3FUN A;  4GPM A;  4DUI A;  5ENO D;  1VDY A;  3JXJ A;  5AIJ A;  2YIN A;  1O1S A;  2CFZ A;  4U96 D;  1K1A A;  5FZS A;  4RVB A;  3W9F A;  3LY9 A;  4B0Z A;  4WAF A;  4GA2 A;  4AEZ C;  2L6J A;  3JQ0 A;  4B89 A;  5AN8 A;  4I1M A;  4J7W A;  3G2V A;  2XGM A;  2NSZ A;  3MKQ A;  4ABN A;  3PRZ A;  4IYP A;  1HH8 A;  1BU9 A;  2ILR A;  3HDX A;  3EHQ A;  2J49 A;  3ZKJ A;  4DX1 A;  1OCZ E;  3L17 A;  2A4Z A;  1D8D A;  3TAX A;  3V79 K;  4C9B B;  3FHE A;  2X38 A;  4RSY A;  4A3T A;  4RG9 A;  2EIK E;  5KNH D;  1NFI E;  3NAW A;  4C48 B;  1OCO E;  3MZL B;  4DX5 D;  2ZIS A;  3KSQ A;  2OEV A;  2PNN A;  2VGX B;  4WUY A;  4IUL A;  3SNX A;  1N52 A;  3HXD A;  4GMJ A;  3ZYQ A;  4IRU A;  1DNP A;  5AQA A;  3E32 A;  1D8E A;  5ENN A;  3ZPJ A;  4XKB A;  3S7B A;  5ENQ D;  1O1T A;  3LDZ A;  3OTN A;  2YQ8 A;  1S64 A;  2XHE A;  4HOR A;  1ELW A;  3TWQ A;  3C5R A;  3ONK A;  4GTP A;  3FH8 A;  3QAR A;  4Y6W A;  3AU4 A;  4TXP A;  3PZ1 A;  3SQV A;  1LD8 A;  1TYQ G;  3MKQ B;  4J0U A;  3LS8 A;  2VJ8 A;  2IJG X;  2QYJ A;  4L9P A;  3QWW A;  2WMO A;  4TRQ A;  2WXL A;  1LD7 A;  2ZXW E;  1IKN D;  5EYP F;  2WMN A;  4BSX A;  3B7U X;  3WXX A;  2HR2 A;  3ASH A;  2H6G A;  3CHS A;  4I9E A;  5LP0 A;  3ZN3 A;  1OCR E;  3DEO A;  4G2V A;  3CLJ A;  4WNF A;  2R59 A;  3ZIM A;  5G04 C;  3FTW A;  3LXU X;  2DYS E;  3QJZ A;  2IQC A;  4XEI G;  2P9L G;  3ULY A;  3FUK A;  5HRY A;  4ACL A;  2L0I A;  2ETB A;  4F3V A;  1H2U A;  4N3B A;  3CVL A;  4ANU A;  2OCC E;  4JVS A;  3CSF A;  2MHK A;  4CT0 A;  5EKQ D;  3JUI A;  4F6R D;  4FUL A;  2VSY A;  1N4S A;  2DYR E;  3FTX A;  4GTR A;  4CT4 A;  1GW6 A;  3SD5 A;  1TN7 A;  4HQD A;  4KMO A;  3PZ2 A;  3P1U A;  3GW4 A;  3UIP C;  4B94 A;  3FUI A;  1E8W A;  2WXN A;  2PM6 A;  2AJA A;  4ANV A;  4EEC A;  4JW1 A;  5JJT A;  3CKB A;  2OEW A;  3VLF A;  2OND A;  4L23 A;  3LJ3 A;  2CHZ A;  1H19 A;  3ISM C;  3ML8 A;  3LY7 A;  4LCT A;  2FO1 E;  5CED B;  5D0O D;  2X6I A;  3E34 A;  2V5F A;  4HOT A;  2LXL A;  3TG5 A;  4NIK A;  3UM2 A;  4NQ0 A;  4KT6 B;  4U63 A;  5LFA A;  3CVQ A;  2KBX A;  1E7V A;  1U3C A;  2Y69 E;  1ZBP A;  4LSZ E;  5A7D B;  2R03 A;  3CVP A;  4FU3 A;  2XS8 A;  3DSX A;  4HB5 A;  4XI0 A;  3ZXS A;  3CQG B;  3I4R B;  3CHM A;  3CK8 A;  1OCC E;  1W3B A;  4J8S A;  1E8X A;  4XE0 A;  5EN5 D;  5HS0 A;  2HE0 A;  2YHC A;  3CK7 A;  4UWL A;  3FP3 A;  4GTO A;  4LNG A;  3G2S A;  4EBA G;  1UOH A;  5FTP A;  2WVI A;  4ANW A;  3CVV A;  3DST A;  2P9S G;  4YDE A;  3DSV A;  2KCK A;  5AAO A;  5CMW A;  4B93 B;  3TWS A;  2WQ7 A;  4UQY A;  3ABK E;  3SZ7 A;  4LG6 A;  4P29 A;  4KYO B;  3PH0 C;  1FCH A;  2BUG A;  2XCC A;  3PZD A;  4FC8 A;  1FVH A;  3ABM E;  1TN8 A;  3FDH A;  1MX4 A;  3T8M A;  3UIO C;  4UWF A;  2BKG A;  2WXM A;  3WG7 E;  1WDY A;  4HOQ A;  4UI9 C;  4W9R A;  2XEV A;  1N4Q A;  2F0Y A;  1NA3 A;  1FT1 A;  3MX3 A;  2ETC A;  3AS8 A;  3RRM B;  3QOU A;  2H6H A;  3L54 A;  5EIL A;  5FT9 A;  3BG0 B;  3NBN B;  4B8C B;  4GA0 A;  2HO1 A;  4H7Y A;  1RZ4 A;  1SQM A;  2VYI A;  4YDY A;  4ME2 A;  2P9P G;  2KM4 A;  4BWR A;  4DK5 A;  2ZU6 B;  3NZU A;  2KCL A;  3UM1 A;  4UWH A;  2XGS A;  3FU0 A;  4KZC A;  4N3A A;  1OY3 D;  4EBA A;  3CVX A;  5AQ7 A;  2DVW A;  3L16 A;  1X81 A;  3MGB A;  4DRX E;  2JAB A;  3FTZ A;  1ZU2 A;  3HVE B;  3KSL A;  3FTV A;  4XX5 A;  4BY6 A;  2QYU A;  5D2M C;  2RFA A;  1SW6 A;  4U07 A;  5CBO A;  4TV3 A;  1BPO A;  2IFU A;  3D9O A;  2FI7 A;  3LVQ E;  3FH7 A;  4GTS A;  3FU3 A;  3NOC D;  3CVW A;  3S2A A;  2HYZ A;  3FFL A;  4I17 A;  4O6F A;  4FJY A;  4BES A;  4FLH A;  2AXU A;  4HRL A;  1IQR A;  3QC1 A;  4Q94 A;  5LX8 A;  3S7F A;  5BXO A;  3HHM A;  3C3Q A;  2AXZ A;  1SA5 A;  1JWG A;  2XPZ A;  1QZ2 A;  3EIQ C;  1H6O A;  3LKU A;  2CFU A;  3L22 A;  2WXO A;  3QK0 A;  3L82 A;  1Z3X A;  2NXP A;  2MYO A;  1N0Q A;  1INZ A;  3QB2 A;  2LXM A;  2FF4 A;  4E85 A;  5BNW A;  3Q9U C;  3RJV A;  4ATG A;  4LNB A;  3RU0 A;  3RIB A;  2H6I A;  1WY6 A;  4U0U A;  3O4Z A;  4K5A B;  2VGY A;  1U3D A;  3ESK A;  4G26 A;  2DBA A;  2IOL A;  3ZW3 A;  4GTV A;  1N4P A;  4GYO A;  5B1A E;  3F6Q A;  2OV8 A;  5CEC B;  4I9C A;  2Y1L E;  4I6J A;  3CHR A;  1XNF A;  1XGW A;  3LJN A;  3DXM G;  2UWJ G;  1OWM A;  5HKP A;  4L2L A;  5CEA A;  1D9S A;  5KJM A;  2ZGD A;  1U2V G;  5FQ4 A;  5EYL A;  3UT7 A;  5AQ9 A;  4H7X A;  4HRM B;  2J9Q A;  4JEH A;  2IY0 C;  4LRZ A;  1AP7 A;  4BX9 A;  4V3I A;  5JHB A;  4YND A;  4CZ2 D;  2WXR A;  2MRI A;  3HXF A;  5DIZ A;  5ENP D;  5H7P A;  1N54 A;  2AVP A;  4EZJ A;  1K8K G;  4PS3 A;  2XQ0 A;  3UUX A;  3NOG D;  1SVX A;  2LSU A;  3CQC B;  4GTM A;  3EHM A;  3DSU A;  4ILI A;  3D9I A;  3JYS A;  3ZGQ A;  2BF0 X;  3T5X A;  1WAO 1;  2GRO B;  2AXV A;  3B7S A;  3MEK A;  4I2W A;  1YCS B;  1H0A A;  2C0M A;  3RO2 A;  3TWU A;  4PS7 A;  4EHM A;  3SHF A;  3EHN A;  3FUJ A;  5KNG A;  3CK9 A;  2Q7F A;  4DPR A;  5HQ8 A;  2WXF A;  2GW1 A;  2WPV A;  1IXV A;  4N5C A;  4U95 D;  3Q4A B;  3FUE A;  3DSW A;  3QDN A;  3HIZ A;  4OAU C;  3PE3 A;  3NQP A;  4HVB A;  3AJI A;  4ILG A;  3L9T A;  4PDX A;  3ZNG A;  1EYH A;  4R7L A;  2GRM A;  3SFZ A;  1SA4 A;  2NC9 A;  3QAQ A;  5KWD A;  4AV7 A;  2LO6 A;  3R7Q A;  1HXI A;  4N3C A;  4XIF A;  1DVP A;  1DCQ A;  3SF4 A;  4A63 B;  4G8K A;  3APC A;  3MV3 B;  5FJY A;  1QNF A;  4NRH B;  4ANX A;  1UW4 B;  2FUL A;  4AM9 A;  3ULQ A;  5BV1 A;  4O1O A;  3IKO B;  1K1B A;  3OAW A;  5LCW J;  1IHG A;  1HX8 A;  4HLL A;  3UKR G;  1S70 B;  5G05 J;  2VSN A;  2VTB A;  5J08 A;  1FVF A;  5C1D A;  3W9G A;  3ASN E;  4I1O B;  4G8L A;  3APD A;  1TNB A;  3OXG A;  3D9L A;  3AAA C;  3URZ A;  5T8I A;  3CKC A;  1NI1 A;  3HXB A;  2X6H A;  1FT2 A;  4OVU A;  3LPZ A;  2J07 A;  1TN6 A;  1MQS A;  3FUL A;  4LER A;  2WB2 A;  1HE8 A;  2I2O A;  5AJD A;  3JUE A;  3ASO E;  3MJW A;  5EX3 A;  4UWG A;  3P2B A;  3C98 A;  1Z3Y A;  3L13 A;  3UX4 A;  3D9N A;  4RLY A;  5AEN A;  1SZA A;  4K0R A;  1UN8 A;  2P58 C;  4IN3 B;  3ESL A;  1UN9 A;  2WQ6 A;  4J8E A;  3E4B A;  4CYM D;  4YVO A;  3FEX A;  3S7J A;  2RFM A;  3T8K A;  4ZFH A;  3MKR A;  2I9C A;  1TNU A;  5BV0 A;  4HNA D;  1DCE A;  1BD8 A;  2VTB B;  1H6P A;  2GRL A;  2WM9 A;  1BLX B;  4BX8 A;  2XZT G;  4GZ3 A;  5JMN D;  2IO3 C;  3ZXP A;  3ZFW A;  3S7D A;  5ITZ F;  2R02 A;  1YA0 A;  4FA6 A;  4HRN A;  4JA9 A;  1EPU A;  1A5E A;  1N0R A;  2X3M A;  2BKK B;  1IYG A;  3AS5 A;  4FP7 A;  5G55 A;  2OOE A;  2XEN A;  1IQU A;  3DWL G;  3QNK A;  4U8V D;  3ZU7 B;  1KT1 A;  2BED A;  5T4Y A;  3R9M A;  2R17 C;  3IBE A;  5JJ7 A;  2AW6 A;  3AG4 E;  3FTU A;  2P9I G;  4GAA A;  3CVU A;  1JCS A;  4X8Q A;  4EPZ A;  4L7T A;  4CDM A;  3UQ3 A;  5BUZ A;  3TXN A;  1X5B A;  4A55 A;  3ZVV A;  3FUF A;  4BT9 A;  2I1J A;  2IO2 C;  3BUA A;  1HS6 A;  3TL5 A;  1N4R A;  3FU6 A;  3IHV A;  2JEK A;  1OXJ A;  1QYM A;  4FHK A;  3C72 A;  3GZ2 A;  4JL0 A;  1HG2 A;  3X2Q E;  3CST A;  2L6B A;  3RAU A;  4EQF A;  2LUH A;  3ABL E;  5EDS A;  2IEJ A;  3GYZ A;  4MS6 A;  2GRQ B;  3C3O A;  3D9P A;  2F8Y A;  5G04 J;  4CDN A;  1NZN A;  2RG8 A;  3UT8 A;  3E30 A;  5FIN A;  4J6I A;  3OXF A;  1N11 A;  3EJN A;  3UTM A;  2HM8 A;  4Z68 A;  3G2W A;  1HO8 A;  4AJW A;  2WXP A;  4DI4 A;  1SZ9 A;  1PY1 A;  3RO3 A;  4ATZ D;  3EU5 A;  3BU8 A;  3CGH A;  4WWO A;  4JPS A;  2KAT A;  3TWT A;  4F1S A;  4G25 A;  1LTX A;  4EZL A;  3CVN A;  4JHJ A;  5ARF A;  5FQ6 A;  3U66 A;  3EUV A;  2R05 A;  4CCA A;  4F7A A;  3MV2 B;  3HRA A;  3I5P A;  1O5M A;  4DLQ A;  2FO7 A;  4F1P A;  2P9K G;  3PDN A;  4M7C A;  3V2X A;  4DLO A;  4A3V A;  2CHX A;  4JEU A;  1S63 A;  2QZA A;  3MYV A;  1G3N B;  5EID A;  4OAV B;  1H6K A;  1TNO A;  4LEU A;  4MKT A;  4D10 C;  4CGW A;  3BEE A;  2A5U A;  3AG3 E;  4GZ6 A;  1Y8M A;  1ZB1 A;  2GRR B;  3CHO A;  3BQO A;  5CHE E;  2XCB A;  4AIF A;  3PVL A;  4JB8 P;  4AY5 A;  3QKY A;  3I3N A;  3TG4 A;  3Q49 B;  4UI9 K;  3UT4 A;  5CRU A;  5HI7 A;  1HFA A;  1PC2 A;  5D0Q D;  2DZO A;  1OUV A;  4UUC A;  2B6C A;  1Y6I A;  5JA4 D;  3CHQ A;  2ETA A;  1N95 A;  2PL2 A;  2KXP C;  3Q79 A;  2MOW A;  3ENE A;  1TNZ A;  5IY5 E;  3SY2 A;  3QWP A;  4Y6C A;  4AXH A;  5ENT D;  3ZYK A;  3MA5 A;  2E2E A;  3PEV B;  2KCV A;  4WWN A;  3AG1 E;  5CRV A;  5C2Y A;  4APF A;  3SBS A;  1BI8 B;  3TWX A;  3V2O A;  3CHP A;  1NA0 A;  4JXT A;  4FJZ A;  2X6K A;  3K9I A;  4GCO A;  4GZ5 A;  5FZR A;  4BER A;  4G23 A;  2VSX E;  3ASD A;  4FLB A;  5BPP A;  4UQX A;  1UJJ A;  4F53 A;  1N94 A;  3J5Q B;  3PZ4 A;  1H2T C;  3PZ3 A;  4CGV A;  4E6H A;  2GRP B;  1Z5S C;  4UI9 J;  5LCW C;  4GB9 A;  3AG2 E;  4N39 A;  5AAR A;  4ZHB A;  4EZK A;  5G05 C;  4I1A A;  4U0Z A;  1V54 E;  5KJN A;  2V0P A;  2VGE A;  3DBS A;  1NL4 A;  3IHY A;  3FY4 A;  3UM0 A;  5D66 A;  3PNT B;  1E7U A;  4OVV A;  2V5Q C;  3D3M A;  2YNQ A;  2LNI A;  3B95 A;  1NP7 A;  3KS2 A;  4APO A;  4TXQ A;  3SGH A;  5KCM A;  5E76 A;  2JLB A;  4XKC A;  1KPS B;  3FUD A;  5DBK A;  2H6F A;  2CHW A;  1E8Z A;  1MX6 A;  2EIL E;  5ANL A;  5AQB A;  4AY6 A;  4B8A A;  2B0O E;  1UJK A;  3RKV A;  3LEW A;  1TJF A;  4AVX A;  3SO8 A;  1HG5 A;  5FQ8 A;  3JQ1 A;  1HU3 A;  3QWV A;  4HOU A;  2NYJ A;  4A1G A;  2FBN A; 
#chains in the Genus database with same CATH homology
 4HI8 A;  4DUI A;  1D9S A;  5ENO D;  4B93 B;  3ZNG A;  4GMR A;  3TWW A;  3JXJ A;  3V31 A;  3HRA A;  2ZGD A;  3TWS A;  4U96 D;  1K1A A;  5EYL A;  5KBA A;  4BER A;  4RLY A;  5AQ9 A;  4LG6 A;  4HRM B;  2AJA A;  5KWD A;  3KEA A;  3NOC D;  4DX7 D;  2A5E A;  3W9F A;  4F1P A;  1IHB A;  3TWV A;  1AP7 A;  3ZUV B;  2QYJ A;  2F8X K;  1OT8 A;  3J5Q B;  4BES A;  3V2X A;  1BI7 B;  1YMP A;  3D9H A;  4O1P A;  4CZ2 D;  4HRL A;  1QYM A;  1MX4 A;  1DCQ A;  5ENP D;  5CEA A;  5AN8 A;  2V4H C;  5EIB E;  4CYM D;  2BKG A;  3HG0 D;  3TWR A;  1DC2 A;  4J7W A;  2XEE A;  2FO1 E;  1IKN D;  2RFM A;  5CED B;  2L6B A;  1G3N B;  5EYP F;  3T8K A;  4A63 B;  4ZFH A;  5BXO A;  5EID A;  1MJ0 A;  4OAV B;  4HI9 A;  5CER B;  1BU9 A;  4G8K A;  3EHQ A;  5AAR A;  3ZKJ A;  4HNA D;  4DX1 A;  4ZHB A;  3DEP A;  2J8S D;  1BD8 A;  1WDY A;  4NIK A;  3NOG D;  1SVX A;  1WG0 A;  4DX6 D;  2ZGG A;  1BLX B;  3V79 K;  2XZT G;  3EHR A;  3DEO A;  2KBX A;  2F37 A;  2F8Y A;  2ETC A;  2DZN A;  4K5C A;  4O1O A;  2VGE A;  4JB8 P;  5JMN D;  1K1B A;  5KNH D;  5EIL A;  1NFI E;  4BET A;  2MYO A;  4QQI A;  1N0Q A;  5D66 A;  4C48 B;  4LSZ E;  4DX5 D;  3NBN B;  2V5Q C;  4HLL A;  4QFV A;  1YCS B;  1MYO A;  3J5P A;  4BSZ B;  1S70 B;  2PNN A;  4HB5 A;  3TWU A;  1YYH A;  5ITZ F;  3JXI A;  3B95 A;  5FIN A;  2DWZ A;  5HRY A;  4O60 A;  1N11 A;  4YDY A;  5CBN A;  3Q9U C;  3W9G A;  2DZO A;  4YDW A;  4UUC A;  1K3Z D;  3UTM A;  5JA4 D;  4HRN A;  4Z68 A;  5AQA A;  3IXE A;  2ETB A;  2ETA A;  2QC9 A;  1A5E A;  1N0R A;  4LNU D;  2BKK B;  5KNG A;  4DX2 A;  3EU9 A;  5EN5 D;  2KXP C;  4G8L A;  5ENQ D;  3B7B A;  4K5A B;  5HS0 A;  4ATZ D;  2P2C P;  2HE0 A;  1OY3 D;  1MX2 A;  3T9K A;  2XEN A;  5AQ7 A;  3UXG A;  1MX6 A;  2DVW A;  3AAA C;  4U8Y D;  1IXV A;  5ENS D;  3F6Q A;  5AQB A;  4U8V D;  1UOH A;  4U95 D;  2B0O E;  3ZU7 B;  4N5Q A;  2XEH A;  5ENT D;  4DRX E;  4F6R D;  5BXU A;  3TWQ A;  3C5R A;  5CEC B;  3TWT A;  2XZD G;  2Y1L E;  4J8Y A;  4HBD A;  4K5B A;  5ENR D;  4BEP A;  2JAB A;  4OAU C;  3SO8 A;  1AWC B;  5FIO A;  3AJI A;  2Y0B G;  4TUM A;  1BI8 B;  2RFA A;  1SW6 A;  3LJN A;  3TWX A;  5HKP A;  3Q9N C;  3UI2 A;  3V2O A;  3V30 A;  2NYJ A;  1TR4 A;  3JUE A;  4HQD A;  5AAO A;  4GPM A;  5CBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...