5LOZA

Structure of yeast ent1 enth domain
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
137
structure length
136
Chain Sequence
MGSSSTQVLVRNATSNDNHQVSKDSLIELAKSYDSADFFEIMDMLDKRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQIVRVKAKELTALLSDDERLNEERNMNIKGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ubiquitin-binding domain
molecule keywords Epsin-1
publication title A bacterial genetic selection system for ubiquitylation cascade discovery.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 56
structure length 136
sequence length 137
ec nomenclature
pdb deposition date 2016-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5lozA00
3D9JA 3G2WA 3LDZA 1UJJA 4FLBA 2QY7A 1HF8A 2L0IA 4GZCA 5LP0A 1SZ9A 3G2VA 3CLJA 4JXTA 3RRUA 5J08A 2DCPA 1HFAA 1SZAA 1UJKA 3D9IA 3ONLA 4HFGA 4NACA 1X5BA 3D9OA 1PY1A 5CMYA 3ZYKA 1H0AA 3D9PA 3ZYQA 1MHQA 1LF8A 1INZA 3D9LA 2KM4A 1JPLA 3D9MA 1HG5A 1HG2A 5LOZA 3ONKA 3D9KA 3G2TA 4Q96A 1ELKA 4Q94A 1XGWA 1EDUA 3ZYMA 2BF0X 2MOWA 2V8SE 5CMWA 3G2UA 4AVXA 1VDYA 2L0TB 2LO6A 3G2SA 3D9NA 3ZYLA 1HX8A 1JUQA 1EYHA 4FU3A 1DVPA 4GZDA 1JWGA 2DIWA 1JWFA
chains in the Genus database with same CATH superfamily
5CCMA 3UPVA 3W9FA 3FTYA 1E7VA 5A7DB 3BG1B 1RW2A 2BEDA 2XPYA 4WUYA 4TV3A 2WXMA 4G1TA 3I3NA 2V8SE 5BT1A 3I4GA 3QAQA 4F1SA 2WXQA 1E8YA 1IQUA 3Q15A 2EIME 2EQXA 4NURA 2L6JA 5ANRA 4DRXE 2DYRE 3FH8A 3TWXA 3TWUA 2VTBA 4OVUA 1OWMA 4MBGA 5EX3A 4GPKA 5JMND 1TEZA 3VTXA 4BX8A 3JCKC 3UM3A 1BI8B 4AY5A 4PDXA 2NSZA 1UJJA 5C2YA 2CHZA 4R7LA 3PZ3A 5G04C 4KT6B 5BPPA 4NACA 3RAUA 4PS8A 2V4LA 5EDSA 3C5RA 2B0OE 3DSTA 5AQ7A 4EBAA 3DXMG 3UKUG 3L54A 3BG0B 1D8DA 5CEDB 4DK5A 5G05C 3PZDA 4BETA 2KCLA 4G24A 4XKBA 5CRUA 2PQNA 2ZIRA 1HE8A 5KJLA 2XZDG 1TN6A 3FUDA 3D9MA 5CBNA 5LX8A 3ZUVB 1EPUA 3P2BA 2R17C 1VDYA 5CRVA 1TNBA 1PAQA 1H2TC 2F8YA 3SFYA 2J08A 4ANXA 2XEHA 2P9PG 3RSEG 1Y6IA 3AS5A 2GRMA 1O1RA 4ME2A 2I1JA 3KEAA 1QNFA 4G25A 3OTNA 2YINA 3DRAA 2MHKA 4GU5A 3TWVA 3IHVA 2HM8A 3LKUA 5ARFA 3LS8A 1BLXB 3FU6A 3EUVA 1ELKA 1NA0A 1FPPA 3ISMC 3G2SA 3VLDA 4NRHB 3PVLA 4GZDA 4L2YA 1IXVA 4A1SA 4DX6D 3LCAA 4UQZA 3QC1A 1A5EA 3LJNA 2P9NG 1UN8A 2WXKA 5FZQA 4UI9J 1IKND 4PS3A 3SFXA 3HRAA 3FFLA 4HXIA 4WNDA 3L13A 4GMRA 1BPOA 3Q7AA 3ULEG 3DSVA 2R2LA 4O60A 1WG0A 2ETAA 4N3CA 5ARGA 2KCVA 2X6KA 4GYYA 1PY1A 4FHKA 4I2WA 2IY0C 4TUUA 5CEAA 4HB5A 4U0UA 4C9BB 5BXOA 2BF0X 4ZFHA 5BXUA 3S7JA 3O4ZA 1MX6A 4AM9A 3S7BA 5LP0A 1QZ2A 1ZB1A 2V5FA 3PE4A 1SZAA 4ILHB 2P9LG 4FJYA 2FO1E 3U9WA 2J49A 5T4YA 2PM7A 3CK9A 3SO8A 3OXGA 3FTUA 4I1OB 4FADA 2RFAA 4ILGA 2C2LA 3APCA 5H7PA 3APFA 3UXGA 2XPZA 3FTXA 3ULQA 1IHGA 3UM1A 3CVWA 3B7BA 4OAVB 1S63A 2R5SA 4AJWA 3MYVA 3UINC 1TR4A 4KXKB 4UWHA 1Q2ZA 4GB9A 3UT4A 4L23A 4XIFA 1OWNA 3DWLG 5EKQD 2LXMA 4O1PA 4Z68A 2VGYA 3ZYQA 5CHEE 2Y4UA 4LG6A 3CQCB 3EU5A 1HG2A 3DBSA 1XGWA 5JHAA 4LEUA 4AV7A 4GA1A 3ZYLA 4ACLA 3FY4A 1N4QA 4GZ6A 1DVPA 1TNOA 2Q7FA 2JLBA 3FH5A 2R59A 2IFUA 2WM9A 1HFAA 4HFGA 2WXIA 5EILA 4LERA 1FCHA 3C98A 4XEIG 3ZRHA 3D3MA 2VGXB 1D8EA 3ZN3A 2WMOA 2AXVA 4RSYA 4A3TA 3FTZA 4F7AA 3V2OA 3R7QA 3AG3E 4UWFA 3FU5A 3ZHEA 3E32A 3ASHA 2I9CA 5JJ6A 1OCZE 3ZYMA 4QQIA 3C3OA 5FWQA 3KSQA 3V2XA 3TL5A 3HVEB 5ENTD 3EIQC 2I1KA 4LSZE 3NOCD 4BTAA 1KPSB 5JA4D 1MX2A 4B8CB 2H6GA 4BESA 1EF1C 2XHEA 4URKA 3JXIA 3ASGA 1E96B 1ELWA 1HU3A 3L9TA 3NF1A 1YCSB 3UI2A 4MKTA 3LVQE 4HOSA 1H6KA 3SZ7A 4JZYA 4DPRA 2X6JA 4CZ2D 2NXPA 5G55A 4TXPA 2GRLA 5M72A 1PC2A 3CSTA 4Q96A 2J8SD 3BUAA 4AVXA 3HXDA 3CHRA 4DLOA 2LXLA 4U8HA 3RO2A 4AEZC 2ONDA 2H6HA 3T9KA 1JWFA 2JEKA 4APFA 4J7WA 3ZGQA 3WG7E 2HYZA 3PNLB 3LY7A 4H7YA 3DEPA 1LD8A 5A6CA 4BSXA 3JQ0A 4UUCA 3FTWA 4RVBA 3CKCA 2RFMA 2OVBA 2IO3C 4YVQC 3T5VA 1HXIA 3FEXA 4B89A 4DX1A 3Q5MA 4RQIA 3GZSA 4J8YA 3PE3A 1DC2A 3CHMA 4B93B 2IONA 3PH0C 3ABKE 3RIBA 5G2NA 3TAXA 3UM0A 4F6RD 3V79K 1O1SA 4UI9K 2WQHA 3KS2A 4GYOA 3VLFA 5E76A 5AQ9A 2OOEA 5AQAA 5FQ7A 4KVMA 4U8YD 3TWSA 2OVFA 1N52A 4HRNA 4HI8A 4CT0A 3HYMB 4P29A 2YHCA 4UI9C 5T3RA 2XCCA 1N0QA 3R9AB 5EX0A 3PS6A 2XS1A 2YQ8A 2FF4A 3N71A 3CVVA 2IEJA 4Y6WA 1HX8A 3PDNA 1JCSA 4FHJA 5AARA 3LY9A 4CDRA 2VSYA 3MKQA 4F1PA 3AG2E 1K8KG 3RK6A 2CFUA 3CVPA 4KZ0A 3TXMA 3MJWA 2HE0A 3V30A 4GPMA 1V55E 3DSSA 5AYWD 1JUQA 4G8KA 3DXKG 1W3BA 2OV8A 2OCCE 2UY1A 4J8SA 5HRYA 3CVNA 3D9LA 4X8QA 4GZ5A 3NAWA 3ZPJA 2LSVA 2F37A 1E7UA 3UIPC 1KZOA 2XQ0A 3AS8A 3BU8A 3K9IA 1OWPA 3Q9NC 2R03A 3ZW3A 4Q69A 2P9SG 4ACKA 3CKBA 5LFAA 5AQBA 3ZEFA 3FUMA 3I5PA 3Q4AB 3J5PA 4EZLA 4G2VA 2RD0A 2LAIA 1KZPA 3OXLA 4GMJA 1MYOA 4LUNU 2HR2A 2KCKA 4TXRA 5LCWJ 3MA5A 5ENRD 3D9PA 5EYLA 3L17A 3TWTA 4E85A 2Y3AA 1YMPA 3L22A 3MEKA 3MZLB 3L16A 3Q79A 3QKYA 4JHRA 3ASOE 2XGOA 5HI7A 2XGMA 5A23A 3T5XA 2LNIA 4CGWA 3LJ3A 4N3BA 2BUGA 3TWWA 4JEUA 5BV0A 2WXOA 4ANVA 4OVVA 4ANUA 1QYMA 2QFCA 2QYJA 4EPZA 4GTTA 4LNUD 3PNTB 3WXXA 4U7EB 1DNPA 4CCAA 5KJMA 3DEOA 3IEGA 1ZBPA 3C3RA 3Q73A 4HVBA 2VTBB 2KM4A 4JC8A 4K5AB 3Q7FA 1N4RA 4BY6A 3FDHA 4HORA 4I1MA 3FUNA 2A4ZA 3NBNB 1JWGA 2WXPA 3HXCA 4CRWA 2XPIA 3RRUA 4GTSA 3B7SA 1DCQA 4KMOA 1MJ0A 3TGOA 1V54E 2AXZA 4RLYA 2KC7A 3G2TA 4BT9A 3DSWA 4GCOA 3ML8A 1K3ZD 3MKRA 4OAUC 3FUFA 3J5QB 4DX5D 4I43A 4M7CA 3CK8A 3ASDA 4I2ZA 1IYGA 4JHKA 5KJKA 4WNEA 5D2MC 1LF8A 3EHNA 5FQ8A 1DCEA 3CK7A 3PRZA 2PM6A 5T8IA 3CQGB 4J6IA 3CVUA 3UM2A 5EIDA 3UIOC 4A3VA 5KNHD 5DBKA 5CERB 1UOHA 3Q47B 4N39A 3UT7A 3ASFA 4YDWA 3RO3A 2BTDA 2Y4TA 2FBNA 5EYPF 3IBEA 4JEHA 1Z3YA 4N5QA 2X6HA 4WWNA 3QNKA 4YDEA 4J8EA 4ABNA 2GRQB 2F0YA 1OY3D 1RZ4A 2EIKE 1GW6A 3R9MA 4UQXA 4DUIA 5ITZF 2HO1A 5C1DA 3EHQA 3ONLA 2NYJA 1ZU2A 1IQRA 3CEQA 1Y8MA 3KD7A 1QQEA 3S2AA 5D66A 2VSXE 1OT8A 5B1BE 4YNDA 2J4BA 2PZIA 1OUVA 2V4HC 4JXTA 4U07A 1K1BA 4FULA 2L9BA 4UWGA 5J90A 5BW8C 3UMVA 3LYAA 3RRNB 3ZNGA 5ENNA 2IO2C 3PUJA 2GRRB 1LTXA 3MV2B 4GA0A 1MX4A 4EECA 4IULA 5FZSA 3T8KA 1TN8A 1U3CA 3PEUB 5B3SE 3ZVVA 4MRUA 2FEZA 5CMYA 3U3WA 4U8VD 3UUXA 4B8AA 3RU0A 1FT1A 4BWRA 4HNAD 5KJNA 2AXUA 5D0QD 4BT8A 4GMLA 3ZFWA 3FTVA 3L6AA 4U0ZA 4L7TA 3PZ1A 5HQ8A 1BI7B 1WDYA 3AJIA 1OWOA 1AP7A 3QJZA 5ENSD 4JHJA 2BKGA 4UQYA 2LSUA 1P5QA 5JJ7A 4EQFA 4PUCA 2KZTA 3T8MA 4G11A 4BFRA 1ELRA 2UWJG 3V31A 2KXPC 2PL2A 3TJPA 2E2EA 3O48A 2GW1A 2MOWA 3DSUA 4L9PA 4AY6A 5AAOA 3FU3A 5FZRA 2H6FA 1TNZA 5LCWC 4U95D 3Q49B 3D9IA 1UW4B 4O6FA 5D0OD 1H2VC 4CEMA 3OXFA 3R7RA 3UTMA 3TXNA 2XZTG 1YA0A 2AJAA 1OCCE 3LDZA 3FH7A 2L0IA 4GZCA 1SVXA 5FT9A 2A5EA 4G26A 1MZCA 1MQSA 3LVRE 1S70B 3UQ3A 3ZHEB 4CGVA 3TWQA 4LNBA 3FWVA 1TN7A 3RJVA 2L0TB 4K0RA 3G2WA 2J07A 2VQ2A 4AOFA 3PREA 3B13A 1H2UA 3SHFA 2DYSE 4LRZA 1S0PA 4XE0A 2PQRA 1MHQA 2IF4A 2WXRA 2ILRA 3E34A 2VSNA 3FULA 4GTVA 4LNGA 2GGFA 2L6BA 4EHMA 3QWWA 3E37A 3JQ1A 4GTOA 3AAAC 1UN9A 1N54A 2P2CP 1JCQA 3QARA 1A17A 1K1AA 4GCNA 4K03A 1U3DA 2XRZA 2I2OA 4I17A 4JW1A 1HS6A 4TXQA 4Q94A 4K5CA 3U4TA 3Q75A 2J9QA 3FEYA 4EZKA 3IXEA 4HOQA 2Y0BG 3P1UA 5BV1A 2X6IA 4BTBA 3QOUA 1FT2A 3CV0A 1N9AA 4NQ0A 1O5MA 1EYHA 3HDXA 4NIKA 3DSXA 4GA2A 2WXNA 5AJDA 3D9OA 3JYSA 4AXHA 2X3MA 3URZA 2WXFA 1N94A 4GTQA 2WQ7A 2KATA 4J8DA 2X6FA 4JA9A 4MLPA 1NA3A 3G2UA 1WM5A 4C48B 2XRYA 3CLJA 2WB2A 1L5JA 4TRQA 3SY2A 2GRPB 3ESKA 2NC9A 3D9KA 5CMWA 3CVQA 2DWZA 2LAHA 4UWLA 1E90A 2AVPA 5FIOA 1YYHA 2JABA 1IHBA 4EZJA 2EIJE 3L08A 4JD2G 4YVOA 4H7XA 4XX5A 2H6IA 4DX2A 2DIWA 4U0SA 3FU0A 4GTMA 3X2QE 3JUIA 4PH4B 3MKQB 2BKKB 1Z3XA 1BU9A 2EILE 4I9EA 4RG6A 4G8LA 2CFZA 1N11A 3CHSA 1O1TA 3ENEA 4GTPA 4DI4A 1KT1A 4HS2A 4A1GA 3RKVA 4HQDA 4HOTA 5FQ6A 2PNNA 3AG4E 3U64A 4N2SA 4GTRA 3E4BA 2V5QC 2UY1B 1OCOE 3NB2A 3ZU7B 3D9NA 3LY8A 4AIFA 3NOGD 2XEEA 3HXEA 3TG5A 3GZ2A 4APOA 3HHMA 3EHRA 4J0UA 1XNFA 4JPSA 5B1AE 3SQVA 4WNGA 1TNYA 2QYUA 2WXLA 3B7TA 4N5CA 1HO8A 2IU1A 5ENQD 2YHEA 1H19A 5ENOD 3UKRG 2ZU6B 3QWPA 2CHXA 2RG8A 3CVXA 4YDOA 2X38A 4KBQA 4A63B 3C3QA 3TG4A 5CCLA 4WNFA 1NL4A 2GRNB 2WPVA 4C0MA 4JVSA 4AP2A 1U2VG 5AJLA 4HRLA 5AENA 4E6HA 1E8WA 4QFVA 3B95A 1HZ4A 1UJKA 4GYWA 2VGEA 4WAFA 2AWIA 5EIBE 3AG1E 1H6PA 3E33A 4ATGA 1G3NB 1E8XA 4PS7A 4FU3A 3NZSA 3CVLA 4B94A 1SZ9A 2A5UA 5FTPA 5E75A 2WVIA 4HBDA 4I9CA 4L2LA 3UT8A 3ZXPA 3QDNA 4Y6CA 3D9HA 3U66A 3AU5A 1JCRA 1HG5A 3IHYA 2VSOE 3QWVA 4ANWA 3PEVB 1NZNA 3UX4A 2OEWA 1OXJA 3CHOA 1Z5SC 2P9UG 3EU9A 1N4SA 2VJ8A 2LO6A 4HLEA 4J8FA 2DZNA 1HF8A 4YDYA 1OWLA 3SI5A 2C0MA 3AS4A 2CHWA 4F53A 4M3OA 3B7UX 1H6OA 2FULA 3FUJA 5BUZA 3HG0D 4FA6A 1QBQA 4MS6A 3QK0A 5FINA 3CHQA 3BEEA 1SA4A 3QB2A 3VTYA 2Y1LE 3ASNE 4FLHA 4WWPA 2XGSA 3ML9A 2DBAA 4O1OA 1D9SA 2QY7A 4CT4A 3VLEA 4BSZB 5KWDA 4XZ4A 4XI9A 5FQ4A 4TUMA 3PUKA 4FP7A 2CG2A 2WXGA 3FTSA 1TJFA 2P9KG 2EINE 2B6CA 2DCPA 4DLQA 4DX7D 2LUHA 4I6EA 3LXUX 4DI3A 2V0PA 2IQCA 2IJGX 1KLXA 2VGXA 4CYMD 5ANLA 4ILIA 3TWRA 3E30A 4L1BA 3MCXA 4V3IA 4HOUA 3L82A 4XKCA 5CECB 4HRMB 3NZUA 4HI9A 4DJAA 3HIZA 3ZYKA 2P9IG 3SNXA 4ZHBA 3KSLA 4CDNA 1INZA 4JL0A 3IV0A 3I4RB 3HVEA 1SA5A 1TJCA 3BQOA 3ZXSA 2AW6A 1N95A 2MRIA 3EJNA 3GYZA 2XENA 1WAO1 2QZAA 5G04J 3Q9UC 5J08A 1NP7A 2OEVA 4I1AA 4KVOA 3HXFA 2ZGGA 4XI0A 4EBAG 3DPDA 5G05J 1NFIE 3ONKA 3D9JA 2RKKA 2FI7A 5HS0A 3KEZA 3MGBA 1JPLA 4I6GA 5CBOA 3SF4A 2M63A 3S7DA 4ATZD 4JA7A 4N2QA 2E0IA 3SGHA 1TYQG 4HLLA 2ETCA 2J4DA 3LEWA 1WY6A 4KZCA 5AN8A 3SD5A 3AU4A 1FVHA 4GZ3A 2KZTB 1X81A 3EIJA 4BEPA 1SQMA 2Y69E 5ENPD 3ABLE 3Q78A 2KBXA 3JXJA 2P58C 1AWCB 2DZOA 5DIZA 3CSFA 1H0AA 1NI1A 2ETBA 3OAWA 3W9GA 2CG3A 4N3AA 2ZXWE 2WQ6A 1UG3A 4FLBA 3APDA 3FUIA 2WXJA 5IY5E 1HH8A 1N4PA 2YNQA 4I6JA 3SBTB 2WMNA 3HXBA 5HKPA 3DPYA 3FUHA 2F8XK 4FC8A 1N0RA 1LD7A 3EDTB 4IN3B 2MYOA 4C0EA 3FUKA 3FHEA 3PZ2A 1KT0A 4B0ZA 1SW6A 3CGHA 3S7FA 5JHBA 4G23A 4IYPA 1EDUA 3CVYA 3ABME 5AIJA 5JJTA 5KCMA 3IKOB 3CHPA 3MX3A 4RG9A 3CR3A 1TNUA 1FVFA 2J09A 3SFZA 3ESLA 3F6QA 4LCTA 3GW4A 3CIAA 2FO7A 4KYOB 4IRUA 4U04A 1E8ZA 4OYSA 4BERA 5FJYA 2C0LA 5KNGA 4F3VA 2GROB 3G2VA 1OCRE 2DVWA 3SBSA 3ZIMA 4K5BA 2ZGDA 1B89A 3NQPA 3EHMA 3MV3B 4BX9A 2QC9A 2VYIA 3PZ4A 4A55A 1Z6TA 3ULYA 2XS8A 4UWKA 4GAAA 3ZKJA 2IOSA 2XCBA 4JB8P 3RRMB 2XEVA 4WWOA 4CDMA 2R05A 5KBAA 5BNWA 3LPZA 2ZISA 5LOZA 4W9RA 1S64A 2R02A 3KAEA 2IOLA 3C72A 3FP3A 4U63A 3JUEA 4U96D 1X5BA 3FUEA 3B7RL 2I6HA 3GZ1A 4FJZA 5EN5D 2WXHA 4D10C 1BD8A
chains in the Genus database with same CATH topology
3FTVA 4RVBA 3CKCA 2OVBA 4YVQC 5CCMA 3UPVA 3L6AA 3T5VA 1HXIA 3FEXA 4B89A 3FTYA 3Q5MA 1E7VA 3CHOA 4U0ZA 4L7TA 5A7DB 3GZSA 3PE3A 3BG1B 3CHMA 2IONA 5HQ8A 3PH0C 2XPYA 4WUYA 3RIBA 4TV3A 5G2NA 2WXMA 4G1TA 3TAXA 3I3NA 2VJ8A 2V8SE 5BT1A 3I4GA 1OWOA 2LO6A 3QAQA 4F1SA 2WXQA 3QJZA 4HLEA 4UI9K 2WQHA 1E8YA 4J8FA 1IQUA 4JHJA 3Q15A 2EQXA 4NURA 4UQYA 1HF8A 2LSUA 2L6JA 3KS2A 5ANRA 1P5QA 1OWLA 4GYOA 5JJ7A 3SI5A 3VLFA 5E76A 2C0MA 4EQFA 3AS4A 3FH8A 2CHWA 4PUCA 4F53A 2KZTA 3T8MA 2VTBA 4OVUA 4M3OA 4G11A 2OOEA 3B7UX 5FQ7A 1ELRA 1OWMA 2UWJG 4KVMA 4BFRA 2OVFA 5EX3A 1N52A 4GPKA 2FULA 2PL2A 3TJPA 3FUJA 2E2EA 3VTXA 5BUZA 4BX8A 1TEZA 3O48A 2GW1A 2MOWA 3JCKC 4AY5A 4PDXA 4AY6A 4CT0A 3FU3A 5FZRA 2NSZA 4FA6A 1UJJA 3HYMB 4P29A 5C2YA 2CHZA 4R7LA 5G04C 5LCWC 4MS6A 4KT6B 3QK0A 3Q49B 3D9IA 4NACA 2YHCA 5BPPA 1UW4B 4O6FA 4PS8A 4UI9C 5D0OD 5T3RA 1H2VC 2XCCA 2V4LA 4CEMA 5EDSA 3OXFA 3CHQA 3R9AB 5EX0A 3PS6A 3R7RA 4EBAA 3TXNA 3BEEA 2YQ8A 3BG0B 3L54A 3QB2A 2FF4A 3VTYA 3N71A 3CVVA 4Y6WA 4WWPA 4FLHA 4DK5A 2XGSA 1YA0A 1HX8A 3ML9A 5G05C 3PZDA 3PDNA 4FHJA 2DBAA 3LDZA 2KCLA 2QY7A 3FH7A 2L0IA 4G24A 4GZCA 4XKBA 3LY9A 3VLEA 4CT4A 4CDRA 5FT9A 2PQNA 2VSYA 3MKQA 1HE8A 4G26A 5KJLA 3RK6A 2CFUA 3CVPA 4XZ4A 4KZ0A 3TXMA 1MQSA 3FUDA 3LVRE 4XI9A 3MJWA 3D9MA 5FQ4A 3UQ3A 3ZHEB 4CGVA 5LX8A 3PUKA 3FWVA 1EPUA 3P2BA 4FP7A 2R17C 1VDYA 2L0TB 2CG2A 5AYWD 3RJVA 2WXGA 1JUQA 3FTSA 4K0RA 1TJFA 3G2WA 1PAQA 2J07A 2VQ2A 4AOFA 1H2TC 3PREA 3B13A 1H2UA 2J08A 2DCPA 4ANXA 1W3BA 2OV8A 4DLQA 3SHFA 2UY1A 4J8SA 4LRZA 4I6EA 1S0PA 4XE0A 1Y6IA 2PQRA 3LXUX 3AS5A 1MHQA 2IF4A 2IQCA 2V0PA 2ILRA 2IJGX 2WXRA 2GRMA 1KLXA 3CVNA 3D9LA 2VGXA 5ANLA 4ILIA 4ME2A 2VSNA 3FULA 4L1BA 2I1JA 3MCXA 4GZ5A 4V3IA 1QNFA 4HOUA 3ZPJA 2LSVA 4G25A 3OTNA 2YINA 4XKCA 1E7UA 2GGFA 2MHKA 2XQ0A 3NZUA 4GU5A 3AS8A 3QWWA 3JQ1A 3IHVA 4DJAA 3K9IA 2HM8A 1OWPA 1UN9A 1N54A 3LKUA 3QARA 3HIZA 1A17A 5ARFA 3ZYKA 3ZW3A 4Q69A 4ACKA 4GCNA 3LS8A 4K03A 3CKBA 5LFAA 3FU6A 3SNXA 4CDNA 1U3DA 2XRZA 1INZA 2I2OA 4JL0A 3ZEFA 3IV0A 4I17A 3FUMA 3I5PA 3I4RB 3Q4AB 4JW1A 4EZLA 1ELKA 1HS6A 2RD0A 4G2VA 1NA0A 1TJCA 3HVEA 4Q94A 3U4TA 2LAIA 3ZXSA 3G2SA 3OXLA 2AW6A 3VLDA 4NRHB 4GMJA 2MRIA 3PVLA 4GZDA 3EJNA 4L2YA 3GYZA 4LUNU 2J9QA 3FEYA 4EZKA 1WAO1 4A1SA 3LCAA 4UQZA 4HOQA 3QC1A 2HR2A 2KCKA 5G04J 5LCWJ 3P1UA 5BV1A 2X6IA 5J08A 3MA5A 1UN8A 2WXKA 5FZQA 1NP7A 4BTBA 4UI9J 3D9PA 4PS3A 3L17A 3FFLA 4E85A 2Y3AA 4HXIA 3QOUA 4WNDA 4I1AA 3L13A 3CV0A 4KVOA 1BPOA 3L22A 3MZLB 3MEKA 3L16A 4NQ0A 4XI0A 3QKYA 4JHRA 2XGOA 4EBAG 5HI7A 3DPDA 1EYHA 2XGMA 5G05J 3ONKA 3D9JA 3HDXA 4N3CA 3T5XA 5A23A 2LNIA 4GA2A 2WXNA 5AJDA 5ARGA 4CGWA 2KCVA 3LJ3A 2FI7A 2X6KA 4N3BA 2BUGA 4GYYA 4JEUA 3D9OA 1PY1A 3JYSA 4AXHA 2X3MA 5BV0A 2WXOA 3URZA 4FHKA 4I2WA 2WXFA 4ANVA 4OVVA 4TUUA 3KEZA 4U0UA 4ANUA 3MGBA 1JPLA 4C9BB 2WQ7A 2QFCA 2KATA 4J8DA 4I6GA 2X6FA 2BF0X 4JA9A 4MLPA 1NA3A 3SF4A 2M63A 4EPZA 3G2UA 1WM5A 3PNTB 3S7JA 3S7DA 3O4ZA 4JA7A 3WXXA 1DNPA 4AM9A 3S7BA 4N2QA 5LP0A 4CCAA 2XRYA 5KJMA 2E0IA 1QZ2A 3SGHA 3CLJA 2V5FA 3IEGA 3PE4A 2WB2A 1SZAA 4ILHB 1ZBPA 4FJYA 1L5JA 2J4DA 3LEWA 1WY6A 4KZCA 3SD5A 3U9WA 3AU4A 4HVBA 1FVHA 4GZ3A 2KZTB 2J49A 4TRQA 2VTBB 2KM4A 3EIJA 5T4YA 2PM7A 3CK9A 3ESKA 3FTUA 2NC9A 3OXGA 3D9KA 4JC8A 4I1OB 4BY6A 1SQMA 4FADA 5CMWA 3FDHA 4ILGA 2C2LA 3CVQA 3APCA 4I1MA 4HORA 3FUNA 2A4ZA 2LAHA 3APFA 1JWGA 2WXPA 4CRWA 4UWLA 1E90A 2XPZA 3FTXA 2AVPA 2P58C 2XPIA 3ULQA 1IHGA 3RRUA 5DIZA 3CSFA 3B7SA 4KMOA 1H0AA 3CVWA 3TGOA 4EZJA 2AXZA 2R5SA 2KC7A 4AJWA 3MYVA 3L08A 3OAWA 3G2TA 4YVOA 4BT9A 4H7XA 4GCOA 2CG3A 3ML8A 4XX5A 3MKRA 4N3AA 2WQ6A 3FUFA 4KXKB 1UG3A 2DIWA 4I43A 4UWHA 4U0SA 3CK8A 3ASDA 4FLBA 4GB9A 3UT4A 4L23A 3APDA 1OWNA 3FU0A 4I2ZA 4XIFA 5EKQD 1IYGA 4JHKA 5KJKA 3FUIA 4WNEA 2WXJA 3JUIA 2VGYA 3ZYQA 4PH4B 1HH8A 5CHEE 2Y4UA 3MKQB 1LF8A 1Z3XA 4I9EA 2YNQA 4I6JA 3CQCB 3SBTB 4RG6A 1HG2A 3DBSA 3EHNA 2CFZA 5FQ8A 1XGWA 5JHAA 3CK7A 3PRZA 2PM6A 2WMNA 3CHSA 4LEUA 3ENEA 4GA1A 4AV7A 5T8IA 1KT1A 4DI4A 3CQGB 3FUHA 4HS2A 3ZYLA 4ACLA 4J6IA 3FY4A 4A1GA 4GZ6A 1DVPA 3RKVA 4FC8A 2Q7FA 4HOTA 3EDTB 2JLBA 5FQ6A 3FH5A 4IN3B 2R59A 2IFUA 4C0EA 3U64A 4N2SA 2WM9A 1HFAA 3FUKA 3E4BA 4HFGA 3CVUA 3FHEA 1KT0A 2WXIA 4B0ZA 4LERA 4A3VA 1FCHA 3C98A 2UY1B 5DBKA 3CGHA 3S7FA 5JHBA 3ZRHA 3D3MA 4G23A 4IYPA 1EDUA 3Q47B 2VGXB 3CVYA 5AIJA 4N39A 3ZN3A 3UT7A 3ASFA 3D9NA 3LY8A 4AIFA 5JJTA 5KCMA 3TG5A 3GZ2A 3IKOB 4APOA 3CHPA 3HHMA 2WMOA 3CR3A 2BTDA 2Y4TA 3MX3A 4J0UA 2AXVA 4RG9A 2FBNA 4RSYA 3RO3A 1FVFA 2J09A 3SFZA 4A3TA 3FTZA 4F7AA 1XNFA 3IBEA 4JPSA 4JEHA 1Z3YA 3R7QA 3ESLA 4UWFA 4LCTA 4WNGA 3GW4A 3CIAA 2FO7A 3FU5A 2X6HA 3ZHEA 4WWNA 4KYOB 3QNKA 2WXLA 3B7TA 4N5CA 1HO8A 4J8EA 4IRUA 3ASHA 2I9CA 4ABNA 5JJ6A 2IU1A 4U04A 3ZYMA 2YHEA 1E8ZA 1H19A 4OYSA 2ZU6B 3QWPA 5FWQA 2CHXA 5FJYA 3TL5A 2C0LA 1GW6A 3HVEB 2RG8A 3CVXA 3EIQC 4UQXA 2I1KA 2X38A 4KBQA 4F3VA 5CCLA 3TG4A 4BTAA 3G2VA 2HO1A 5C1DA 4WNFA 3ONLA 3SBSA 3ZIMA 4B8CB 1ZU2A 1IQRA 1B89A 1EF1C 3CEQA 2WPVA 3NQPA 2XHEA 3EHMA 4C0MA 4URKA 4JVSA 3MV3B 4BX9A 1Y8MA 2VYIA 3ASGA 3KD7A 1QQEA 1E96B 3S2AA 1ELWA 1HU3A 2VSXE 3NF1A 4A55A 1Z6TA 4MKTA 3LVQE 4UWKA 4YNDA 4DI3A 4GAAA 4AP2A 2J4BA 4HOSA 2IOSA 2PZIA 5AJLA 1H6KA 3SZ7A 4JZYA 1OUVA 2XCBA 4DPRA 4E6HA 5AENA 1E8WA 4QFVA 4JXTA 4U07A 2X6JA 1HZ4A 1UJKA 4FULA 4GYWA 3RRMB 2XEVA 4WAFA 2AWIA 2NXPA 2L9BA 5G55A 4WWOA 2GRLA 4UWGA 4CDMA 5J90A 5BW8C 5M72A 3UMVA 5BNWA 3LPZA 1PC2A 3LYAA 3RRNB 5LOZA 4ATGA 3CSTA 4Q96A 5ENNA 4W9RA 3PUJA 1E8XA 4PS7A 4AVXA 3CHRA 3MV2B 4DLOA 4GA0A 4U8HA 3RO2A 3KAEA 2ONDA 4FU3A 3NZSA 4AEZC 4EECA 1JWFA 4IULA 5FZSA 3CVLA 1U3CA 3PEUB 2IOLA 3FP3A 4B94A 1SZ9A 2A5UA 2JEKA 4APFA 4U63A 3ZVVA 4MRUA 5FTPA 1X5BA 2FEZA 3FUEA 5CMYA 3U3WA 3B7RL 5E75A 2WVIA 4I9CA 4L2LA 3ZGQA 2HYZA 2I6HA 3UT8A 3UUXA 4B8AA 3PNLB 3GZ1A 3QDNA 3RU0A 3LY7A 4H7YA 4Y6CA 4FJZA 4BWRA 2WXHA 3AU5A 1HG5A 3U66A 5A6CA 5KJNA 4D10C 3IHYA 2VSOE 2AXUA 4BSXA 3JQ0A 3QWVA 4ANWA 5D0QD 3PEVB 4BT8A 1NZNA 4GMLA 3FTWA 3UX4A 3ZFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D9J A;  3G2W A;  3LDZ A;  1UJJ A;  4FLB A;  2QY7 A;  1HF8 A;  2L0I A;  4GZC A;  5LP0 A;  1SZ9 A;  3G2V A;  3CLJ A;  4JXT A;  3RRU A;  5J08 A;  2DCP A;  1HFA A;  1SZA A;  1UJK A;  3D9I A;  3ONL A;  4HFG A;  4NAC A;  1X5B A;  3D9O A;  1PY1 A;  5CMY A;  3ZYK A;  1H0A A;  3D9P A;  3ZYQ A;  1MHQ A;  1LF8 A;  1INZ A;  3D9L A;  2KM4 A;  1JPL A;  3D9M A;  1HG5 A;  1HG2 A;  5LOZ A;  3ONK A;  3D9K A;  3G2T A;  4Q96 A;  1ELK A;  4Q94 A;  1XGW A;  1EDU A;  3ZYM A;  2BF0 X;  2MOW A;  2V8S E;  5CMW A;  3G2U A;  4AVX A;  1VDY A;  2L0T B;  2LO6 A;  3G2S A;  3D9N A;  3ZYL A;  1HX8 A;  1JUQ A;  1EYH A;  4FU3 A;  1DVP A;  4GZD A;  1JWG A;  2DIW A;  1JWF A; 
#chains in the Genus database with same CATH topology
 5CCM A;  3UPV A;  3W9F A;  3FTY A;  1E7V A;  5A7D B;  3BG1 B;  1RW2 A;  2BED A;  2XPY A;  4WUY A;  4TV3 A;  2WXM A;  4G1T A;  3I3N A;  2V8S E;  5BT1 A;  3I4G A;  3QAQ A;  4F1S A;  2WXQ A;  1E8Y A;  1IQU A;  3Q15 A;  2EIM E;  2EQX A;  4NUR A;  2L6J A;  5ANR A;  4DRX E;  2DYR E;  3FH8 A;  3TWX A;  3TWU A;  2VTB A;  4OVU A;  1OWM A;  4MBG A;  5EX3 A;  4GPK A;  5JMN D;  1TEZ A;  3VTX A;  4BX8 A;  3JCK C;  3UM3 A;  1BI8 B;  4AY5 A;  4PDX A;  2NSZ A;  1UJJ A;  5C2Y A;  2CHZ A;  4R7L A;  3PZ3 A;  5G04 C;  4KT6 B;  5BPP A;  4NAC A;  3RAU A;  4PS8 A;  2V4L A;  5EDS A;  3C5R A;  2B0O E;  3DST A;  5AQ7 A;  4EBA A;  3DXM G;  3UKU G;  3L54 A;  3BG0 B;  1D8D A;  5CED B;  4DK5 A;  5G05 C;  3PZD A;  4BET A;  2KCL A;  4G24 A;  4XKB A;  5CRU A;  2PQN A;  2ZIR A;  1HE8 A;  5KJL A;  2XZD G;  1TN6 A;  3FUD A;  3D9M A;  5CBN A;  5LX8 A;  3ZUV B;  1EPU A;  3P2B A;  2R17 C;  1VDY A;  5CRV A;  1TNB A;  1PAQ A;  1H2T C;  2F8Y A;  3SFY A;  2J08 A;  4ANX A;  2XEH A;  2P9P G;  3RSE G;  1Y6I A;  3AS5 A;  2GRM A;  1O1R A;  4ME2 A;  2I1J A;  3KEA A;  1QNF A;  4G25 A;  3OTN A;  2YIN A;  3DRA A;  2MHK A;  4GU5 A;  3TWV A;  3IHV A;  2HM8 A;  3LKU A;  5ARF A;  3LS8 A;  1BLX B;  3FU6 A;  3EUV A;  1ELK A;  1NA0 A;  1FPP A;  3ISM C;  3G2S A;  3VLD A;  4NRH B;  3PVL A;  4GZD A;  4L2Y A;  1IXV A;  4A1S A;  4DX6 D;  3LCA A;  4UQZ A;  3QC1 A;  1A5E A;  3LJN A;  2P9N G;  1UN8 A;  2WXK A;  5FZQ A;  4UI9 J;  1IKN D;  4PS3 A;  3SFX A;  3HRA A;  3FFL A;  4HXI A;  4WND A;  3L13 A;  4GMR A;  1BPO A;  3Q7A A;  3ULE G;  3DSV A;  2R2L A;  4O60 A;  1WG0 A;  2ETA A;  4N3C A;  5ARG A;  2KCV A;  2X6K A;  4GYY A;  1PY1 A;  4FHK A;  4I2W A;  2IY0 C;  4TUU A;  5CEA A;  4HB5 A;  4U0U A;  4C9B B;  5BXO A;  2BF0 X;  4ZFH A;  5BXU A;  3S7J A;  3O4Z A;  1MX6 A;  4AM9 A;  3S7B A;  5LP0 A;  1QZ2 A;  1ZB1 A;  2V5F A;  3PE4 A;  1SZA A;  4ILH B;  2P9L G;  4FJY A;  2FO1 E;  3U9W A;  2J49 A;  5T4Y A;  2PM7 A;  3CK9 A;  3SO8 A;  3OXG A;  3FTU A;  4I1O B;  4FAD A;  2RFA A;  4ILG A;  2C2L A;  3APC A;  5H7P A;  3APF A;  3UXG A;  2XPZ A;  3FTX A;  3ULQ A;  1IHG A;  3UM1 A;  3CVW A;  3B7B A;  4OAV B;  1S63 A;  2R5S A;  4AJW A;  3MYV A;  3UIN C;  1TR4 A;  4KXK B;  4UWH A;  1Q2Z A;  4GB9 A;  3UT4 A;  4L23 A;  4XIF A;  1OWN A;  3DWL G;  5EKQ D;  2LXM A;  4O1P A;  4Z68 A;  2VGY A;  3ZYQ A;  5CHE E;  2Y4U A;  4LG6 A;  3CQC B;  3EU5 A;  1HG2 A;  3DBS A;  1XGW A;  5JHA A;  4LEU A;  4AV7 A;  4GA1 A;  3ZYL A;  4ACL A;  3FY4 A;  1N4Q A;  4GZ6 A;  1DVP A;  1TNO A;  2Q7F A;  2JLB A;  3FH5 A;  2R59 A;  2IFU A;  2WM9 A;  1HFA A;  4HFG A;  2WXI A;  5EIL A;  4LER A;  1FCH A;  3C98 A;  4XEI G;  3ZRH A;  3D3M A;  2VGX B;  1D8E A;  3ZN3 A;  2WMO A;  2AXV A;  4RSY A;  4A3T A;  3FTZ A;  4F7A A;  3V2O A;  3R7Q A;  3AG3 E;  4UWF A;  3FU5 A;  3ZHE A;  3E32 A;  3ASH A;  2I9C A;  5JJ6 A;  1OCZ E;  3ZYM A;  4QQI A;  3C3O A;  5FWQ A;  3KSQ A;  3V2X A;  3TL5 A;  3HVE B;  5ENT D;  3EIQ C;  2I1K A;  4LSZ E;  3NOC D;  4BTA A;  1KPS B;  5JA4 D;  1MX2 A;  4B8C B;  2H6G A;  4BES A;  1EF1 C;  2XHE A;  4URK A;  3JXI A;  3ASG A;  1E96 B;  1ELW A;  1HU3 A;  3L9T A;  3NF1 A;  1YCS B;  3UI2 A;  4MKT A;  3LVQ E;  4HOS A;  1H6K A;  3SZ7 A;  4JZY A;  4DPR A;  2X6J A;  4CZ2 D;  2NXP A;  5G55 A;  4TXP A;  2GRL A;  5M72 A;  1PC2 A;  3CST A;  4Q96 A;  2J8S D;  3BUA A;  4AVX A;  3HXD A;  3CHR A;  4DLO A;  2LXL A;  4U8H A;  3RO2 A;  4AEZ C;  2OND A;  2H6H A;  3T9K A;  1JWF A;  2JEK A;  4APF A;  4J7W A;  3ZGQ A;  3WG7 E;  2HYZ A;  3PNL B;  3LY7 A;  4H7Y A;  3DEP A;  1LD8 A;  5A6C A;  4BSX A;  3JQ0 A;  4UUC A;  3FTW A;  4RVB A;  3CKC A;  2RFM A;  2OVB A;  2IO3 C;  4YVQ C;  3T5V A;  1HXI A;  3FEX A;  4B89 A;  4DX1 A;  3Q5M A;  4RQI A;  3GZS A;  4J8Y A;  3PE3 A;  1DC2 A;  3CHM A;  4B93 B;  2ION A;  3PH0 C;  3ABK E;  3RIB A;  5G2N A;  3TAX A;  3UM0 A;  4F6R D;  3V79 K;  1O1S A;  4UI9 K;  2WQH A;  3KS2 A;  4GYO A;  3VLF A;  5E76 A;  5AQ9 A;  2OOE A;  5AQA A;  5FQ7 A;  4KVM A;  4U8Y D;  3TWS A;  2OVF A;  1N52 A;  4HRN A;  4HI8 A;  4CT0 A;  3HYM B;  4P29 A;  2YHC A;  4UI9 C;  5T3R A;  2XCC A;  1N0Q A;  3R9A B;  5EX0 A;  3PS6 A;  2XS1 A;  2YQ8 A;  2FF4 A;  3N71 A;  3CVV A;  2IEJ A;  4Y6W A;  1HX8 A;  3PDN A;  1JCS A;  4FHJ A;  5AAR A;  3LY9 A;  4CDR A;  2VSY A;  3MKQ A;  4F1P A;  3AG2 E;  1K8K G;  3RK6 A;  2CFU A;  3CVP A;  4KZ0 A;  3TXM A;  3MJW A;  2HE0 A;  3V30 A;  4GPM A;  1V55 E;  3DSS A;  5AYW D;  1JUQ A;  4G8K A;  3DXK G;  1W3B A;  2OV8 A;  2OCC E;  2UY1 A;  4J8S A;  5HRY A;  3CVN A;  3D9L A;  4X8Q A;  4GZ5 A;  3NAW A;  3ZPJ A;  2LSV A;  2F37 A;  1E7U A;  3UIP C;  1KZO A;  2XQ0 A;  3AS8 A;  3BU8 A;  3K9I A;  1OWP A;  3Q9N C;  2R03 A;  3ZW3 A;  4Q69 A;  2P9S G;  4ACK A;  3CKB A;  5LFA A;  5AQB A;  3ZEF A;  3FUM A;  3I5P A;  3Q4A B;  3J5P A;  4EZL A;  4G2V A;  2RD0 A;  2LAI A;  1KZP A;  3OXL A;  4GMJ A;  1MYO A;  4LUN U;  2HR2 A;  2KCK A;  4TXR A;  5LCW J;  3MA5 A;  5ENR D;  3D9P A;  5EYL A;  3L17 A;  3TWT A;  4E85 A;  2Y3A A;  1YMP A;  3L22 A;  3MEK A;  3MZL B;  3L16 A;  3Q79 A;  3QKY A;  4JHR A;  3ASO E;  2XGO A;  5HI7 A;  2XGM A;  5A23 A;  3T5X A;  2LNI A;  4CGW A;  3LJ3 A;  4N3B A;  2BUG A;  3TWW A;  4JEU A;  5BV0 A;  2WXO A;  4ANV A;  4OVV A;  4ANU A;  1QYM A;  2QFC A;  2QYJ A;  4EPZ A;  4GTT A;  4LNU D;  3PNT B;  3WXX A;  4U7E B;  1DNP A;  4CCA A;  5KJM A;  3DEO A;  3IEG A;  1ZBP A;  3C3R A;  3Q73 A;  4HVB A;  2VTB B;  2KM4 A;  4JC8 A;  4K5A B;  3Q7F A;  1N4R A;  4BY6 A;  3FDH A;  4HOR A;  4I1M A;  3FUN A;  2A4Z A;  3NBN B;  1JWG A;  2WXP A;  3HXC A;  4CRW A;  2XPI A;  3RRU A;  4GTS A;  3B7S A;  1DCQ A;  4KMO A;  1MJ0 A;  3TGO A;  1V54 E;  2AXZ A;  4RLY A;  2KC7 A;  3G2T A;  4BT9 A;  3DSW A;  4GCO A;  3ML8 A;  1K3Z D;  3MKR A;  4OAU C;  3FUF A;  3J5Q B;  4DX5 D;  4I43 A;  4M7C A;  3CK8 A;  3ASD A;  4I2Z A;  1IYG A;  4JHK A;  5KJK A;  4WNE A;  5D2M C;  1LF8 A;  3EHN A;  5FQ8 A;  1DCE A;  3CK7 A;  3PRZ A;  2PM6 A;  5T8I A;  3CQG B;  4J6I A;  3CVU A;  3UM2 A;  5EID A;  3UIO C;  4A3V A;  5KNH D;  5DBK A;  5CER B;  1UOH A;  3Q47 B;  4N39 A;  3UT7 A;  3ASF A;  4YDW A;  3RO3 A;  2BTD A;  2Y4T A;  2FBN A;  5EYP F;  3IBE A;  4JEH A;  1Z3Y A;  4N5Q A;  2X6H A;  4WWN A;  3QNK A;  4YDE A;  4J8E A;  4ABN A;  2GRQ B;  2F0Y A;  1OY3 D;  1RZ4 A;  2EIK E;  1GW6 A;  3R9M A;  4UQX A;  4DUI A;  5ITZ F;  2HO1 A;  5C1D A;  3EHQ A;  3ONL A;  2NYJ A;  1ZU2 A;  1IQR A;  3CEQ A;  1Y8M A;  3KD7 A;  1QQE A;  3S2A A;  5D66 A;  2VSX E;  1OT8 A;  5B1B E;  4YND A;  2J4B A;  2PZI A;  1OUV A;  2V4H C;  4JXT A;  4U07 A;  1K1B A;  4FUL A;  2L9B A;  4UWG A;  5J90 A;  5BW8 C;  3UMV A;  3LYA A;  3RRN B;  3ZNG A;  5ENN A;  2IO2 C;  3PUJ A;  2GRR B;  1LTX A;  3MV2 B;  4GA0 A;  1MX4 A;  4EEC A;  4IUL A;  5FZS A;  3T8K A;  1TN8 A;  1U3C A;  3PEU B;  5B3S E;  3ZVV A;  4MRU A;  2FEZ A;  5CMY A;  3U3W A;  4U8V D;  3UUX A;  4B8A A;  3RU0 A;  1FT1 A;  4BWR A;  4HNA D;  5KJN A;  2AXU A;  5D0Q D;  4BT8 A;  4GML A;  3ZFW A;  3FTV A;  3L6A A;  4U0Z A;  4L7T A;  3PZ1 A;  5HQ8 A;  1BI7 B;  1WDY A;  3AJI A;  1OWO A;  1AP7 A;  3QJZ A;  5ENS D;  4JHJ A;  2BKG A;  4UQY A;  2LSU A;  1P5Q A;  5JJ7 A;  4EQF A;  4PUC A;  2KZT A;  3T8M A;  4G11 A;  4BFR A;  1ELR A;  2UWJ G;  3V31 A;  2KXP C;  2PL2 A;  3TJP A;  2E2E A;  3O48 A;  2GW1 A;  2MOW A;  3DSU A;  4L9P A;  4AY6 A;  5AAO A;  3FU3 A;  5FZR A;  2H6F A;  1TNZ A;  5LCW C;  4U95 D;  3Q49 B;  3D9I A;  1UW4 B;  4O6F A;  5D0O D;  1H2V C;  4CEM A;  3OXF A;  3R7R A;  3UTM A;  3TXN A;  2XZT G;  1YA0 A;  2AJA A;  1OCC E;  3LDZ A;  3FH7 A;  2L0I A;  4GZC A;  1SVX A;  5FT9 A;  2A5E A;  4G26 A;  1MZC A;  1MQS A;  3LVR E;  1S70 B;  3UQ3 A;  3ZHE B;  4CGV A;  3TWQ A;  4LNB A;  3FWV A;  1TN7 A;  3RJV A;  2L0T B;  4K0R A;  3G2W A;  2J07 A;  2VQ2 A;  4AOF A;  3PRE A;  3B13 A;  1H2U A;  3SHF A;  2DYS E;  4LRZ A;  1S0P A;  4XE0 A;  2PQR A;  1MHQ A;  2IF4 A;  2WXR A;  2ILR A;  3E34 A;  2VSN A;  3FUL A;  4GTV A;  4LNG A;  2GGF A;  2L6B A;  4EHM A;  3QWW A;  3E37 A;  3JQ1 A;  4GTO A;  3AAA C;  1UN9 A;  1N54 A;  2P2C P;  1JCQ A;  3QAR A;  1A17 A;  1K1A A;  4GCN A;  4K03 A;  1U3D A;  2XRZ A;  2I2O A;  4I17 A;  4JW1 A;  1HS6 A;  4TXQ A;  4Q94 A;  4K5C A;  3U4T A;  3Q75 A;  2J9Q A;  3FEY A;  4EZK A;  3IXE A;  4HOQ A;  2Y0B G;  3P1U A;  5BV1 A;  2X6I A;  4BTB A;  3QOU A;  1FT2 A;  3CV0 A;  1N9A A;  4NQ0 A;  1O5M A;  1EYH A;  3HDX A;  4NIK A;  3DSX A;  4GA2 A;  2WXN A;  5AJD A;  3D9O A;  3JYS A;  4AXH A;  2X3M A;  3URZ A;  2WXF A;  1N94 A;  4GTQ A;  2WQ7 A;  2KAT A;  4J8D A;  2X6F A;  4JA9 A;  4MLP A;  1NA3 A;  3G2U A;  1WM5 A;  4C48 B;  2XRY A;  3CLJ A;  2WB2 A;  1L5J A;  4TRQ A;  3SY2 A;  2GRP B;  3ESK A;  2NC9 A;  3D9K A;  5CMW A;  3CVQ A;  2DWZ A;  2LAH A;  4UWL A;  1E90 A;  2AVP A;  5FIO A;  1YYH A;  2JAB A;  1IHB A;  4EZJ A;  2EIJ E;  3L08 A;  4JD2 G;  4YVO A;  4H7X A;  4XX5 A;  2H6I A;  4DX2 A;  2DIW A;  4U0S A;  3FU0 A;  4GTM A;  3X2Q E;  3JUI A;  4PH4 B;  3MKQ B;  2BKK B;  1Z3X A;  1BU9 A;  2EIL E;  4I9E A;  4RG6 A;  4G8L A;  2CFZ A;  1N11 A;  3CHS A;  1O1T A;  3ENE A;  4GTP A;  4DI4 A;  1KT1 A;  4HS2 A;  4A1G A;  3RKV A;  4HQD A;  4HOT A;  5FQ6 A;  2PNN A;  3AG4 E;  3U64 A;  4N2S A;  4GTR A;  3E4B A;  2V5Q C;  2UY1 B;  1OCO E;  3NB2 A;  3ZU7 B;  3D9N A;  3LY8 A;  4AIF A;  3NOG D;  2XEE A;  3HXE A;  3TG5 A;  3GZ2 A;  4APO A;  3HHM A;  3EHR A;  4J0U A;  1XNF A;  4JPS A;  5B1A E;  3SQV A;  4WNG A;  1TNY A;  2QYU A;  2WXL A;  3B7T A;  4N5C A;  1HO8 A;  2IU1 A;  5ENQ D;  2YHE A;  1H19 A;  5ENO D;  3UKR G;  2ZU6 B;  3QWP A;  2CHX A;  2RG8 A;  3CVX A;  4YDO A;  2X38 A;  4KBQ A;  4A63 B;  3C3Q A;  3TG4 A;  5CCL A;  4WNF A;  1NL4 A;  2GRN B;  2WPV A;  4C0M A;  4JVS A;  4AP2 A;  1U2V G;  5AJL A;  4HRL A;  5AEN A;  4E6H A;  1E8W A;  4QFV A;  3B95 A;  1HZ4 A;  1UJK A;  4GYW A;  2VGE A;  4WAF A;  2AWI A;  5EIB E;  3AG1 E;  1H6P A;  3E33 A;  4ATG A;  1G3N B;  1E8X A;  4PS7 A;  4FU3 A;  3NZS A;  3CVL A;  4B94 A;  1SZ9 A;  2A5U A;  5FTP A;  5E75 A;  2WVI A;  4HBD A;  4I9C A;  4L2L A;  3UT8 A;  3ZXP A;  3QDN A;  4Y6C A;  3D9H A;  3U66 A;  3AU5 A;  1JCR A;  1HG5 A;  3IHY A;  2VSO E;  3QWV A;  4ANW A;  3PEV B;  1NZN A;  3UX4 A;  2OEW A;  1OXJ A;  3CHO A;  1Z5S C;  2P9U G;  3EU9 A;  1N4S A;  2VJ8 A;  2LO6 A;  4HLE A;  4J8F A;  2DZN A;  1HF8 A;  4YDY A;  1OWL A;  3SI5 A;  2C0M A;  3AS4 A;  2CHW A;  4F53 A;  4M3O A;  3B7U X;  1H6O A;  2FUL A;  3FUJ A;  5BUZ A;  3HG0 D;  4FA6 A;  1QBQ A;  4MS6 A;  3QK0 A;  5FIN A;  3CHQ A;  3BEE A;  1SA4 A;  3QB2 A;  3VTY A;  2Y1L E;  3ASN E;  4FLH A;  4WWP A;  2XGS A;  3ML9 A;  2DBA A;  4O1O A;  1D9S A;  2QY7 A;  4CT4 A;  3VLE A;  4BSZ B;  5KWD A;  4XZ4 A;  4XI9 A;  5FQ4 A;  4TUM A;  3PUK A;  4FP7 A;  2CG2 A;  2WXG A;  3FTS A;  1TJF A;  2P9K G;  2EIN E;  2B6C A;  2DCP A;  4DLQ A;  4DX7 D;  2LUH A;  4I6E A;  3LXU X;  4DI3 A;  2V0P A;  2IQC A;  2IJG X;  1KLX A;  2VGX A;  4CYM D;  5ANL A;  4ILI A;  3TWR A;  3E30 A;  4L1B A;  3MCX A;  4V3I A;  4HOU A;  3L82 A;  4XKC A;  5CEC B;  4HRM B;  3NZU A;  4HI9 A;  4DJA A;  3HIZ A;  3ZYK A;  2P9I G;  3SNX A;  4ZHB A;  3KSL A;  4CDN A;  1INZ A;  4JL0 A;  3IV0 A;  3I4R B;  3HVE A;  1SA5 A;  1TJC A;  3BQO A;  3ZXS A;  2AW6 A;  1N95 A;  2MRI A;  3EJN A;  3GYZ A;  2XEN A;  1WAO 1;  2QZA A;  5G04 J;  3Q9U C;  5J08 A;  1NP7 A;  2OEV A;  4I1A A;  4KVO A;  3HXF A;  2ZGG A;  4XI0 A;  4EBA G;  3DPD A;  5G05 J;  1NFI E;  3ONK A;  3D9J A;  2RKK A;  2FI7 A;  5HS0 A;  3KEZ A;  3MGB A;  1JPL A;  4I6G A;  5CBO A;  3SF4 A;  2M63 A;  3S7D A;  4ATZ D;  4JA7 A;  4N2Q A;  2E0I A;  3SGH A;  1TYQ G;  4HLL A;  2ETC A;  2J4D A;  3LEW A;  1WY6 A;  4KZC A;  5AN8 A;  3SD5 A;  3AU4 A;  1FVH A;  4GZ3 A;  2KZT B;  1X81 A;  3EIJ A;  4BEP A;  1SQM A;  2Y69 E;  5ENP D;  3ABL E;  3Q78 A;  2KBX A;  3JXJ A;  2P58 C;  1AWC B;  2DZO A;  5DIZ A;  3CSF A;  1H0A A;  1NI1 A;  2ETB A;  3OAW A;  3W9G A;  2CG3 A;  4N3A A;  2ZXW E;  2WQ6 A;  1UG3 A;  4FLB A;  3APD A;  3FUI A;  2WXJ A;  5IY5 E;  1HH8 A;  1N4P A;  2YNQ A;  4I6J A;  3SBT B;  2WMN A;  3HXB A;  5HKP A;  3DPY A;  3FUH A;  2F8X K;  4FC8 A;  1N0R A;  1LD7 A;  3EDT B;  4IN3 B;  2MYO A;  4C0E A;  3FUK A;  3FHE A;  3PZ2 A;  1KT0 A;  4B0Z A;  1SW6 A;  3CGH A;  3S7F A;  5JHB A;  4G23 A;  4IYP A;  1EDU A;  3CVY A;  3ABM E;  5AIJ A;  5JJT A;  5KCM A;  3IKO B;  3CHP A;  3MX3 A;  4RG9 A;  3CR3 A;  1TNU A;  1FVF A;  2J09 A;  3SFZ A;  3ESL A;  3F6Q A;  4LCT A;  3GW4 A;  3CIA A;  2FO7 A;  4KYO B;  4IRU A;  4U04 A;  1E8Z A;  4OYS A;  4BER A;  5FJY A;  2C0L A;  5KNG A;  4F3V A;  2GRO B;  3G2V A;  1OCR E;  2DVW A;  3SBS A;  3ZIM A;  4K5B A;  2ZGD A;  1B89 A;  3NQP A;  3EHM A;  3MV3 B;  4BX9 A;  2QC9 A;  2VYI A;  3PZ4 A;  4A55 A;  1Z6T A;  3ULY A;  2XS8 A;  4UWK A;  4GAA A;  3ZKJ A;  2IOS A;  2XCB A;  4JB8 P;  3RRM B;  2XEV A;  4WWO A;  4CDM A;  2R05 A;  5KBA A;  5BNW A;  3LPZ A;  2ZIS A;  5LOZ A;  4W9R A;  1S64 A;  2R02 A;  3KAE A;  2IOL A;  3C72 A;  3FP3 A;  4U63 A;  3JUE A;  4U96 D;  1X5B A;  3FUE A;  3B7R L;  2I6H A;  3GZ1 A;  4FJZ A;  5EN5 D;  2WXH A;  4D10 C;  1BD8 A; 
#chains in the Genus database with same CATH homology
 3FTV A;  4RVB A;  3CKC A;  2OVB A;  4YVQ C;  5CCM A;  3UPV A;  3L6A A;  3T5V A;  1HXI A;  3FEX A;  4B89 A;  3FTY A;  3Q5M A;  1E7V A;  3CHO A;  4U0Z A;  4L7T A;  5A7D B;  3GZS A;  3PE3 A;  3BG1 B;  3CHM A;  2ION A;  5HQ8 A;  3PH0 C;  2XPY A;  4WUY A;  3RIB A;  4TV3 A;  5G2N A;  2WXM A;  4G1T A;  3TAX A;  3I3N A;  2VJ8 A;  2V8S E;  5BT1 A;  3I4G A;  1OWO A;  2LO6 A;  3QAQ A;  4F1S A;  2WXQ A;  3QJZ A;  4HLE A;  4UI9 K;  2WQH A;  1E8Y A;  4J8F A;  1IQU A;  4JHJ A;  3Q15 A;  2EQX A;  4NUR A;  4UQY A;  1HF8 A;  2LSU A;  2L6J A;  3KS2 A;  5ANR A;  1P5Q A;  1OWL A;  4GYO A;  5JJ7 A;  3SI5 A;  3VLF A;  5E76 A;  2C0M A;  4EQF A;  3AS4 A;  3FH8 A;  2CHW A;  4PUC A;  4F53 A;  2KZT A;  3T8M A;  2VTB A;  4OVU A;  4M3O A;  4G11 A;  2OOE A;  3B7U X;  5FQ7 A;  1ELR A;  1OWM A;  2UWJ G;  4KVM A;  4BFR A;  2OVF A;  5EX3 A;  1N52 A;  4GPK A;  2FUL A;  2PL2 A;  3TJP A;  3FUJ A;  2E2E A;  3VTX A;  5BUZ A;  4BX8 A;  1TEZ A;  3O48 A;  2GW1 A;  2MOW A;  3JCK C;  4AY5 A;  4PDX A;  4AY6 A;  4CT0 A;  3FU3 A;  5FZR A;  2NSZ A;  4FA6 A;  1UJJ A;  3HYM B;  4P29 A;  5C2Y A;  2CHZ A;  4R7L A;  5G04 C;  5LCW C;  4MS6 A;  4KT6 B;  3QK0 A;  3Q49 B;  3D9I A;  4NAC A;  2YHC A;  5BPP A;  1UW4 B;  4O6F A;  4PS8 A;  4UI9 C;  5D0O D;  5T3R A;  1H2V C;  2XCC A;  2V4L A;  4CEM A;  5EDS A;  3OXF A;  3CHQ A;  3R9A B;  5EX0 A;  3PS6 A;  3R7R A;  4EBA A;  3TXN A;  3BEE A;  2YQ8 A;  3BG0 B;  3L54 A;  3QB2 A;  2FF4 A;  3VTY A;  3N71 A;  3CVV A;  4Y6W A;  4WWP A;  4FLH A;  4DK5 A;  2XGS A;  1YA0 A;  1HX8 A;  3ML9 A;  5G05 C;  3PZD A;  3PDN A;  4FHJ A;  2DBA A;  3LDZ A;  2KCL A;  2QY7 A;  3FH7 A;  2L0I A;  4G24 A;  4GZC A;  4XKB A;  3LY9 A;  3VLE A;  4CT4 A;  4CDR A;  5FT9 A;  2PQN A;  2VSY A;  3MKQ A;  1HE8 A;  4G26 A;  5KJL A;  3RK6 A;  2CFU A;  3CVP A;  4XZ4 A;  4KZ0 A;  3TXM A;  1MQS A;  3FUD A;  3LVR E;  4XI9 A;  3MJW A;  3D9M A;  5FQ4 A;  3UQ3 A;  3ZHE B;  4CGV A;  5LX8 A;  3PUK A;  3FWV A;  1EPU A;  3P2B A;  4FP7 A;  2R17 C;  1VDY A;  2L0T B;  2CG2 A;  5AYW D;  3RJV A;  2WXG A;  1JUQ A;  3FTS A;  4K0R A;  1TJF A;  3G2W A;  1PAQ A;  2J07 A;  2VQ2 A;  4AOF A;  1H2T C;  3PRE A;  3B13 A;  1H2U A;  2J08 A;  2DCP A;  4ANX A;  1W3B A;  2OV8 A;  4DLQ A;  3SHF A;  2UY1 A;  4J8S A;  4LRZ A;  4I6E A;  1S0P A;  4XE0 A;  1Y6I A;  2PQR A;  3LXU X;  3AS5 A;  1MHQ A;  2IF4 A;  2IQC A;  2V0P A;  2ILR A;  2IJG X;  2WXR A;  2GRM A;  1KLX A;  3CVN A;  3D9L A;  2VGX A;  5ANL A;  4ILI A;  4ME2 A;  2VSN A;  3FUL A;  4L1B A;  2I1J A;  3MCX A;  4GZ5 A;  4V3I A;  1QNF A;  4HOU A;  3ZPJ A;  2LSV A;  4G25 A;  3OTN A;  2YIN A;  4XKC A;  1E7U A;  2GGF A;  2MHK A;  2XQ0 A;  3NZU A;  4GU5 A;  3AS8 A;  3QWW A;  3JQ1 A;  3IHV A;  4DJA A;  3K9I A;  2HM8 A;  1OWP A;  1UN9 A;  1N54 A;  3LKU A;  3QAR A;  3HIZ A;  1A17 A;  5ARF A;  3ZYK A;  3ZW3 A;  4Q69 A;  4ACK A;  4GCN A;  3LS8 A;  4K03 A;  3CKB A;  5LFA A;  3FU6 A;  3SNX A;  4CDN A;  1U3D A;  2XRZ A;  1INZ A;  2I2O A;  4JL0 A;  3ZEF A;  3IV0 A;  4I17 A;  3FUM A;  3I5P A;  3I4R B;  3Q4A B;  4JW1 A;  4EZL A;  1ELK A;  1HS6 A;  2RD0 A;  4G2V A;  1NA0 A;  1TJC A;  3HVE A;  4Q94 A;  3U4T A;  2LAI A;  3ZXS A;  3G2S A;  3OXL A;  2AW6 A;  3VLD A;  4NRH B;  4GMJ A;  2MRI A;  3PVL A;  4GZD A;  3EJN A;  4L2Y A;  3GYZ A;  4LUN U;  2J9Q A;  3FEY A;  4EZK A;  1WAO 1;  4A1S A;  3LCA A;  4UQZ A;  4HOQ A;  3QC1 A;  2HR2 A;  2KCK A;  5G04 J;  5LCW J;  3P1U A;  5BV1 A;  2X6I A;  5J08 A;  3MA5 A;  1UN8 A;  2WXK A;  5FZQ A;  1NP7 A;  4BTB A;  4UI9 J;  3D9P A;  4PS3 A;  3L17 A;  3FFL A;  4E85 A;  2Y3A A;  4HXI A;  3QOU A;  4WND A;  4I1A A;  3L13 A;  3CV0 A;  4KVO A;  1BPO A;  3L22 A;  3MZL B;  3MEK A;  3L16 A;  4NQ0 A;  4XI0 A;  3QKY A;  4JHR A;  2XGO A;  4EBA G;  5HI7 A;  3DPD A;  1EYH A;  2XGM A;  5G05 J;  3ONK A;  3D9J A;  3HDX A;  4N3C A;  3T5X A;  5A23 A;  2LNI A;  4GA2 A;  2WXN A;  5AJD A;  5ARG A;  4CGW A;  2KCV A;  3LJ3 A;  2FI7 A;  2X6K A;  4N3B A;  2BUG A;  4GYY A;  4JEU A;  3D9O A;  1PY1 A;  3JYS A;  4AXH A;  2X3M A;  5BV0 A;  2WXO A;  3URZ A;  4FHK A;  4I2W A;  2WXF A;  4ANV A;  4OVV A;  4TUU A;  3KEZ A;  4U0U A;  4ANU A;  3MGB A;  1JPL A;  4C9B B;  2WQ7 A;  2QFC A;  2KAT A;  4J8D A;  4I6G A;  2X6F A;  2BF0 X;  4JA9 A;  4MLP A;  1NA3 A;  3SF4 A;  2M63 A;  4EPZ A;  3G2U A;  1WM5 A;  3PNT B;  3S7J A;  3S7D A;  3O4Z A;  4JA7 A;  3WXX A;  1DNP A;  4AM9 A;  3S7B A;  4N2Q A;  5LP0 A;  4CCA A;  2XRY A;  5KJM A;  2E0I A;  1QZ2 A;  3SGH A;  3CLJ A;  2V5F A;  3IEG A;  3PE4 A;  2WB2 A;  1SZA A;  4ILH B;  1ZBP A;  4FJY A;  1L5J A;  2J4D A;  3LEW A;  1WY6 A;  4KZC A;  3SD5 A;  3U9W A;  3AU4 A;  4HVB A;  1FVH A;  4GZ3 A;  2KZT B;  2J49 A;  4TRQ A;  2VTB B;  2KM4 A;  3EIJ A;  5T4Y A;  2PM7 A;  3CK9 A;  3ESK A;  3FTU A;  2NC9 A;  3OXG A;  3D9K A;  4JC8 A;  4I1O B;  4BY6 A;  1SQM A;  4FAD A;  5CMW A;  3FDH A;  4ILG A;  2C2L A;  3CVQ A;  3APC A;  4I1M A;  4HOR A;  3FUN A;  2A4Z A;  2LAH A;  3APF A;  1JWG A;  2WXP A;  4CRW A;  4UWL A;  1E90 A;  2XPZ A;  3FTX A;  2AVP A;  2P58 C;  2XPI A;  3ULQ A;  1IHG A;  3RRU A;  5DIZ A;  3CSF A;  3B7S A;  4KMO A;  1H0A A;  3CVW A;  3TGO A;  4EZJ A;  2AXZ A;  2R5S A;  2KC7 A;  4AJW A;  3MYV A;  3L08 A;  3OAW A;  3G2T A;  4YVO A;  4BT9 A;  4H7X A;  4GCO A;  2CG3 A;  3ML8 A;  4XX5 A;  3MKR A;  4N3A A;  2WQ6 A;  3FUF A;  4KXK B;  1UG3 A;  2DIW A;  4I43 A;  4UWH A;  4U0S A;  3CK8 A;  3ASD A;  4FLB A;  4GB9 A;  3UT4 A;  4L23 A;  3APD A;  1OWN A;  3FU0 A;  4I2Z A;  4XIF A;  5EKQ D;  1IYG A;  4JHK A;  5KJK A;  3FUI A;  4WNE A;  2WXJ A;  3JUI A;  2VGY A;  3ZYQ A;  4PH4 B;  1HH8 A;  5CHE E;  2Y4U A;  3MKQ B;  1LF8 A;  1Z3X A;  4I9E A;  2YNQ A;  4I6J A;  3CQC B;  3SBT B;  4RG6 A;  1HG2 A;  3DBS A;  3EHN A;  2CFZ A;  5FQ8 A;  1XGW A;  5JHA A;  3CK7 A;  3PRZ A;  2PM6 A;  2WMN A;  3CHS A;  4LEU A;  3ENE A;  4GA1 A;  4AV7 A;  5T8I A;  1KT1 A;  4DI4 A;  3CQG B;  3FUH A;  4HS2 A;  3ZYL A;  4ACL A;  4J6I A;  3FY4 A;  4A1G A;  4GZ6 A;  1DVP A;  3RKV A;  4FC8 A;  2Q7F A;  4HOT A;  3EDT B;  2JLB A;  5FQ6 A;  3FH5 A;  4IN3 B;  2R59 A;  2IFU A;  4C0E A;  3U64 A;  4N2S A;  2WM9 A;  1HFA A;  3FUK A;  3E4B A;  4HFG A;  3CVU A;  3FHE A;  1KT0 A;  2WXI A;  4B0Z A;  4LER A;  4A3V A;  1FCH A;  3C98 A;  2UY1 B;  5DBK A;  3CGH A;  3S7F A;  5JHB A;  3ZRH A;  3D3M A;  4G23 A;  4IYP A;  1EDU A;  3Q47 B;  2VGX B;  3CVY A;  5AIJ A;  4N39 A;  3ZN3 A;  3UT7 A;  3ASF A;  3D9N A;  3LY8 A;  4AIF A;  5JJT A;  5KCM A;  3TG5 A;  3GZ2 A;  3IKO B;  4APO A;  3CHP A;  3HHM A;  2WMO A;  3CR3 A;  2BTD A;  2Y4T A;  3MX3 A;  4J0U A;  2AXV A;  4RG9 A;  2FBN A;  4RSY A;  3RO3 A;  1FVF A;  2J09 A;  3SFZ A;  4A3T A;  3FTZ A;  4F7A A;  1XNF A;  3IBE A;  4JPS A;  4JEH A;  1Z3Y A;  3R7Q A;  3ESL A;  4UWF A;  4LCT A;  4WNG A;  3GW4 A;  3CIA A;  2FO7 A;  3FU5 A;  2X6H A;  3ZHE A;  4WWN A;  4KYO B;  3QNK A;  2WXL A;  3B7T A;  4N5C A;  1HO8 A;  4J8E A;  4IRU A;  3ASH A;  2I9C A;  4ABN A;  5JJ6 A;  2IU1 A;  4U04 A;  3ZYM A;  2YHE A;  1E8Z A;  1H19 A;  4OYS A;  2ZU6 B;  3QWP A;  5FWQ A;  2CHX A;  5FJY A;  3TL5 A;  2C0L A;  1GW6 A;  3HVE B;  2RG8 A;  3CVX A;  3EIQ C;  4UQX A;  2I1K A;  2X38 A;  4KBQ A;  4F3V A;  5CCL A;  3TG4 A;  4BTA A;  3G2V A;  2HO1 A;  5C1D A;  4WNF A;  3ONL A;  3SBS A;  3ZIM A;  4B8C B;  1ZU2 A;  1IQR A;  1B89 A;  1EF1 C;  3CEQ A;  2WPV A;  3NQP A;  2XHE A;  3EHM A;  4C0M A;  4URK A;  4JVS A;  3MV3 B;  4BX9 A;  1Y8M A;  2VYI A;  3ASG A;  3KD7 A;  1QQE A;  1E96 B;  3S2A A;  1ELW A;  1HU3 A;  2VSX E;  3NF1 A;  4A55 A;  1Z6T A;  4MKT A;  3LVQ E;  4UWK A;  4YND A;  4DI3 A;  4GAA A;  4AP2 A;  2J4B A;  4HOS A;  2IOS A;  2PZI A;  5AJL A;  1H6K A;  3SZ7 A;  4JZY A;  1OUV A;  2XCB A;  4DPR A;  4E6H A;  5AEN A;  1E8W A;  4QFV A;  4JXT A;  4U07 A;  2X6J A;  1HZ4 A;  1UJK A;  4FUL A;  4GYW A;  3RRM B;  2XEV A;  4WAF A;  2AWI A;  2NXP A;  2L9B A;  5G55 A;  4WWO A;  2GRL A;  4UWG A;  4CDM A;  5J90 A;  5BW8 C;  5M72 A;  3UMV A;  5BNW A;  3LPZ A;  1PC2 A;  3LYA A;  3RRN B;  5LOZ A;  4ATG A;  3CST A;  4Q96 A;  5ENN A;  4W9R A;  3PUJ A;  1E8X A;  4PS7 A;  4AVX A;  3CHR A;  3MV2 B;  4DLO A;  4GA0 A;  4U8H A;  3RO2 A;  3KAE A;  2OND A;  4FU3 A;  3NZS A;  4AEZ C;  4EEC A;  1JWF A;  4IUL A;  5FZS A;  3CVL A;  1U3C A;  3PEU B;  2IOL A;  3FP3 A;  4B94 A;  1SZ9 A;  2A5U A;  2JEK A;  4APF A;  4U63 A;  3ZVV A;  4MRU A;  5FTP A;  1X5B A;  2FEZ A;  3FUE A;  5CMY A;  3U3W A;  3B7R L;  5E75 A;  2WVI A;  4I9C A;  4L2L A;  3ZGQ A;  2HYZ A;  2I6H A;  3UT8 A;  3UUX A;  4B8A A;  3PNL B;  3GZ1 A;  3QDN A;  3RU0 A;  3LY7 A;  4H7Y A;  4Y6C A;  4FJZ A;  4BWR A;  2WXH A;  3AU5 A;  1HG5 A;  3U66 A;  5A6C A;  5KJN A;  4D10 C;  3IHY A;  2VSO E;  2AXU A;  4BSX A;  3JQ0 A;  3QWV A;  4ANW A;  5D0Q D;  3PEV B;  4BT8 A;  1NZN A;  4GML A;  3FTW A;  3UX4 A;  3ZFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...