5LOZA

Structure of yeast ent1 enth domain
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
137
structure length
136
Chain Sequence
MGSSSTQVLVRNATSNDNHQVSKDSLIELAKSYDSADFFEIMDMLDKRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQIVRVKAKELTALLSDDERLNEERNMNIKGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epsin-1
publication title A bacterial genetic selection system for ubiquitylation cascade discovery.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ubiquitin-binding domain
total genus 56
structure length 136
sequence length 137
ec nomenclature
pdb deposition date 2016-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5lozA00
4Q94A 1HX8A 1LF8A 2V8SE 3G2WA 1H0AA 1X5BA 1JWGA 3D9IA 1UJJA 1JWFA 1HG2A 5CMYA 1MHQA 3D9PA 1DVPA 4FLBA 1INZA 2QY7A 4JXTA 2DCPA 5J08A 3CLJA 2MOWA 3LDZA 1JPLA 1JUQA 3ZYMA 3D9MA 1EDUA 2LO6A 2DIWA 3D9NA 1HG5A 3G2UA 1UJKA 3RRUA 2BF0X 3G2SA 1VDYA 3G2TA 3ZYLA 1HF8A 3D9OA 1ELKA 3G2VA 4FU3A 4GZCA 1XGWA 4HFGA 4NACA 5LOZA 3ZYQA 5CMWA 3ONLA 2L0TB 3ZYKA 4AVXA 1SZAA 1PY1A 4GZDA 2KM4A 3D9LA 3ONKA 1SZ9A 5LP0A 1EYHA 3D9KA 3D9JA 4Q96A 2L0IA 1HFAA
chains in the Genus database with same CATH superfamily
3C98A 1SW6A 3ZN3A 4HI8A 5CRUA 3RIBA 4DLQA 1INZA 5KWDA 3JQ1A 3R9MA 4DI4A 1UN9A 2KATA 2XEEA 3KAEA 3E4BA 4DLOA 3UIOC 2C2LA 3ML8A 3TWRA 2VSXE 3FUJA 3HDXA 4JA7A 5LCWJ 4NURA 3CQCB 5AYWD 4EZLA 3JUEA 4U95D 1G3NB 2X6FA 2XEVA 3Q7FA 4J7WA 1Z3YA 3SQVA 4ACKA 1OUVA 3C3QA 4A55A 2EIME 5JJ7A 4YDEA 3HXEA 1IHBA 1X5BA 2YQ8A 4AV7A 5D0OD 3S7BA 2UY1B 2A5UA 2X6KA 2Y0BG 4BFRA 3LVRE 2C0MA 2LAIA 1PY1A 4G24A 2I1KA 1N0QA 4V3IA 2DZOA 3J5PA 3MV3B 4GA0A 5HS0A 4GCOA 3DSVA 2VYIA 2WQHA 4UWKA 3APFA 2NSZA 4RLYA 4ILHB 4AJWA 1QBQA 4N3CA 3UXGA 4ANVA 3U4TA 4AIFA 3Q9NC 1N11A 2IJGX 4U04A 4RSYA 5A23A 5FQ7A 2WXKA 2XS1A 4GTMA 1UOHA 3C5RA 3QARA 4CT4A 3KSLA 3FH8A 3FWVA 3PREA 5FIOA 2VSOE 2NYJA 2DWZA 4CDNA 1NA3A 3IKOB 4XI9A 1UG3A 2J07A 3ONLA 4JZYA 2EIJE 3CVPA 4KVOA 5KJLA 2QC9A 4GMRA 4LERA 3DBSA 2X6HA 4I9EA 4TXQA 2P9KG 4U8VD 4UQYA 2GRNB 3IEGA 3C3OA 3UQ3A 4HRNA 5B3SE 4C0EA 1H19A 3CK8A 3JXIA 4LRZA 2MYOA 2I2OA 3ISMC 3BUAA 3CHSA 3L54A 4XIFA 4G26A 1YA0A 5ENNA 3SNXA 4G23A 3B95A 5T4YA 1ZB1A 3ZXPA 5KJNA 3LS8A 4PS3A 5A6CA 2P9SG 3G2TA 2WQ6A 1N4QA 1Y8MA 2KCVA 3AS8A 3LEWA 3L9TA 2CHWA 4G2VA 3ZIMA 3L82A 2WQ7A 2DZNA 4HRMB 4J8YA 1AP7A 5FZQA 1UJKA 4JC8A 3AU5A 3CHRA 3RU0A 3ASDA 4O1OA 4UQZA 5HRYA 3UT7A 3D9JA 3V31A 4ANWA 4F53A 3G2WA 2AJAA 5AENA 3Q9UC 2PQNA 2WXGA 4PUCA 2F8YA 4BWRA 5CBOA 3S7DA 2HO1A 3UM2A 2C0LA 2OCCE 3VLEA 1HO8A 1SQMA 1N4RA 4FJYA 4ANUA 2Y69E 1JPLA 4PDXA 3MX3A 1TYQG 1EF1C 3G2SA 3HXDA 3O48A 1W3BA 1E7UA 2GRRB 3L22A 2PZIA 3CVLA 4DPRA 1UJJA 1Z3XA 3E32A 1K8KG 2YNQA 4GTPA 5CHEE 4U0SA 2BF0X 4L23A 4HBDA 3JXJA 3NBNB 3AG2E 3AG3E 4D10C 2PL2A 5AN8A 2EIKE 1E96B 3AS4A 3DXKG 3HXBA 3Q4AB 4F1SA 2DVWA 5ENRD 3L13A 4OVVA 2OV8A 3Q5MA 3RJVA 4GB9A 3TWTA 4N2SA 3E37A 2VGXA 3N71A 2XENA 3MKRA 4JEUA 2J09A 3I3NA 4BSXA 2OOEA 3PE4A 4BSZB 3Q79A 3ZU7B 3PS6A 2AXVA 4ATGA 4QFVA 4LUNU 4N5CA 4LCTA 3ABKE 5B1BE 4UI9K 1TNYA 2VSNA 3DSTA 3VTXA 3RK6A 2RFAA 4BEPA 3ULEG 4EBAA 3CHQA 3RKVA 3SZ7A 4YDYA 3B7RL 1Y6IA 1XGWA 5EYPF 4ZHBA 4GTRA 3IHYA 1N54A 2IF4A 3BU8A 3W9GA 2AWIA 2WXNA 3KEZA 3TXMA 1ZBPA 1UW4B 4M7CA 3JCKC 3JYSA 4DI3A 4KVMA 1QYMA 5ENSD 5AJLA 4GTTA 5C1DA 4J0UA 1HFAA 1LF8A 5E76A 5ENPD 1JCSA 1DVPA 1FT2A 4JXTA 1ZU2A 4A63B 4TV3A 2KCKA 1E8XA 2B6CA 3U66A 1SA4A 5AQ9A 1FVHA 3D9HA 3ONKA 3T8MA 4BESA 5BUZA 2UWJG 4J8EA 4CGVA 1JWGA 1YMPA 2H6HA 3EHMA 3LDZA 4ACLA 3HHMA 2X6IA 4HFGA 4GZCA 3GZ1A 2Y4TA 2CG2A 2R59A 3C72A 4K5AB 4G1TA 2LXLA 4CT0A 4AP2A 5BXUA 2HE0A 2MRIA 3T5VA 2FBNA 5ANRA 1U3DA 3F6QA 5J08A 4IRUA 1S64A 3PZ3A 2CFUA 4HNAD 4I6GA 3SFXA 5CEDB 1D9SA 2R5SA 2WB2A 5FQ4A 3CSFA 4HQDA 3PUJA 5IY5E 3QWVA 2ETCA 5FQ8A 3FTZA 3TAXA 4HVBA 2PNNA 3E33A 3P2BA 1SVXA 5FWQA 2HM8A 4KBQA 3U9WA 2WXHA 1HF8A 3B7BA 3CVWA 2IFUA 3I4GA 4L9PA 3OAWA 2CG3A 5T8IA 4JHJA 3MKQB 1H0AA 1MHQA 2XPYA 3OTNA 1JUQA 1AWCB 4LSZE 1K1BA 3CIAA 3R7RA 4GTSA 4AY5A 2I1JA 3D9OA 4ZFHA 3FTWA 4GYWA 3MCXA 4UWFA 4XZ4A 3TXNA 4WNEA 4J6IA 4J8DA 4IULA 5BXOA 2OEVA 2ZISA 3ASGA 2KXPC 5CRVA 4YNDA 2LO6A 3G2UA 3UUXA 3E30A 5LX8A 3ZFWA 3NQPA 4HXIA 4F1PA 4LG6A 4G8LA 1N4SA 4N5QA 4XE0A 5ARFA 4FHKA 4FLBA 4LEUA 3PEUB 2XEHA 1K1AA 4KZ0A 3HVEB 3NF1A 3UKUG 4FU3A 2GRQB 4Y6CA 4WNGA 5KCMA 1OWMA 2QYUA 3ZKJA 4F7AA 2XZDG 4XKBA 5FZSA 3MA5A 3C3RA 4I43A 5AAOA 3O4ZA 1KT1A 3VLDA 3G2VA 3QOUA 4CEMA 3AG1E 4L1BA 4N3AA 4EZJA 3FUEA 3ML9A 4EBAG 1IYGA 1HX8A 4NQ0A 2FO7A 2MOWA 3DEOA 5G05C 5BPPA 3SD5A 3Q7AA 3KS2A 3AS5A 2V5FA 4GCNA 4B89A 3PE3A 5FINA 3BQOA 2WMNA 3FUKA 3UTMA 3ZPJA 5CCLA 3ASNE 4U0ZA 4IYPA 2V4HC 3HIZA 3VLFA 1XNFA 1V55E 2ILRA 3L17A 3QB2A 3L6AA 3EU9A 4XI0A 4DX2A 3DPDA 3FEXA 3BG0B 3L08A 3ZYKA 1HZ4A 5D0QD 1O5MA 3LJNA 1OWOA 2FO1E 2HR2A 1X81A 3D9PA 2YHEA 2LAHA 3V79K 2P9NG 4FULA 3ZHEA 1EDUA 2ETAA 2LNIA 2BKKB 4O60A 5D2MC 3UPVA 3B7TA 1P5QA 1FT1A 2I9CA 5JHBA 3AU4A 3TWXA 5G05J 4L2LA 2DCPA 2RKKA 3UI2A 1FPPA 4G25A 2YHCA 5JJTA 1NP7A 1NFIE 1BI7B 1WM5A 5LOZA 4LNUD 5AJDA 1BD8A 1TEZA 2P9UG 3SHFA 2ONDA 3SBTB 5AQBA 2LSUA 4XKCA 3B13A 5BNWA 3CK9A 1N0RA 3ZGQA 4U8YD 2XQ0A 3T9KA 2IO3C 2P2CP 4J8SA 2H6GA 4U8HA 2WXMA 3GZSA 3Q75A 2KZTA 3OXLA 2ZGGA 2XRYA 2A5EA 4Z68A 1N52A 5FQ6A 1YYHA 3UMVA 4I6JA 1TNUA 3Q78A 1GW6A 2EQXA 4HLEA 5HI7A 1S0PA 2DYSE 5CMYA 4PS8A 2F8XK 2FF4A 4EQFA 3LKUA 4KMOA 4KXKB 3GW4A 1DC2A 3FU0A 4MS6A 1U2VG 1S63A 4AXHA 2WM9A 4DX5D 4WWPA 5A7DB 4URKA 3CK7A 1OWLA 3D9IA 5LFAA 4ANXA 3VTYA 2DYRE 3B7UX 3ZYMA 1TNZA 3S7FA 3R7QA 1HXIA 1O1SA 1LTXA 2V5QC 4UWGA 3ENEA 4RG6A 2OVFA 4GA2A 4HI9A 2OEWA 3IV0A 1A5EA 2WXJA 3T5XA 1KT0A 3FUNA 3HG0D 3ASHA 4MKTA 4YVOA 5DIZA 1MZCA 3Q47B 2OVBA 3EU5A 3V2XA 4K0RA 4XEIG 3P1UA 2XGOA 2WXRA 4WAFA 2YINA 3CR3A 2XZTG 1E8WA 5ENOD 3FU5A 2J4DA 4FLHA 4YDOA 3D9NA 1Z5SC 4JB8P 2E0IA 3ASFA 3NOGD 3ZNGA 4KT6B 4EZKA 1H2UA 3PZ1A 4BX8A 3WG7E 4R7LA 1KLXA 2J4BA 3RRNB 3RO2A 3FHEA 3IBEA 2L9BA 3CVUA 2R03A 4GMLA 4I17A 3AJIA 2JABA 2KBXA 1WY6A 1O1TA 2RFMA 5G04C 3I5PA 4ME2A 3ESLA 1JCQA 2LSVA 2FULA 2EILE 1IQUA 4AY6A 5AIJA 3LY7A 3E34A 2JEKA 4GTOA 4FA6A 3CQGB 5FJYA 4C48B 3IHVA 3Q73A 4OAUC 3ZYQA 3AG4E 4G8KA 4I1MA 1SZ9A 1OCRE 3FUHA 4GZ5A 1MX2A 1OXJA 3FFLA 3NAWA 3AAAC 4N3BA 3MV2B 2VGXB 2IOSA 4GPMA 4BY6A 3U64A 4AOFA 5D66A 5JA4D 2VTBA 3LPZA 3RO3A 4U0UA 1WDYA 2L0IA 2V8SE 4KZCA 4AEZC 1HG2A 2CFZA 2NC9A 2WPVA 3BEEA 3PZ4A 5KNHD 3FEYA 5G04J 4H7XA 3RRMB 4OVUA 5G55A 1FCHA 2AXUA 1BI8B 3SO8A 1LD7A 4GPKA 3CSTA 4LNGA 4F6RD 3QWWA 3FUDA 3S2AA 2CHXA 5FT9A 4OAVB 3FU3A 1IKND 4MBGA 4I6EA 1JCRA 5EIDA 3TG4A 2LXMA 1SZAA 3V30A 4N2QA 3CVVA 1TJFA 4TXPA 4B0ZA 5G2NA 4U07A 4K5BA 3ULQA 1O1RA 4DUIA 1N95A 5KJMA 3UM3A 4LNBA 3GZ2A 5ANLA 4BETA 1IXVA 2ETBA 3MEKA 2WMOA 4I2ZA 2GRPB 4TUUA 3ZUVB 1MJ0A 4HS2A 5EN5D 1H6KA 3V2OA 2VGEA 4GZ6A 4JW1A 5EX3A 3FH7A 3PNTB 1OY3D 2XGSA 1DCQA 2X3MA 3JQ0A 3HXCA 3APDA 4H7YA 1ELKA 5T3RA 1TJCA 4GA1A 2QFCA 1IHGA 1H2TC 2J49A 2P9LG 2VJ8A 5LCWC 2R02A 3TWUA 3SI5A 4CGWA 2FEZA 2GW1A 4UI9C 2HYZA 4CCAA 4AM9A 3PZDA 2NXPA 2PM6A 3HRAA 2PQRA 1E8ZA 4HLLA 3DXMG 1KPSB 4DK5A 3LY9A 4BT9A 3B7SA 4CRWA 1TN7A 3FTSA 1OWPA 4J8FA 5BW8C 3LXUX 1NA0A 4A3TA 2UY1A 5AQ7A 4AVXA 4DX6D 2XPIA 3QNKA 5KBAA 5CERB 4GTQA 5EKQD 1HE8A 1OWNA 3D9KA 4NIKA 2J08A 1TN6A 3CVYA 3ZW3A 3FU6A 3SBSA 2A4ZA 1ELRA 4X8QA 5CMWA 2ZGDA 4PH4B 4HB5A 3ZRHA 1E90A 2DBAA 5LP0A 3TWSA 2IQCA 2GRMA 4DX7D 4Y6WA 4EPZA 4UI9J 3EHQA 2F37A 2B0OE 3MYVA 4FADA 1HG5A 1OCOE 1S70B 3CHOA 1TNOA 4XX5A 3KEAA 4UUCA 3TWVA 1MX6A 2IEJA 3PZ2A 1JWFA 2L6JA 2WXOA 3FDHA 3EUVA 2Y4UA 4GAAA 4JD2G 5ITZF 3CKBA 4C0MA 2L0TB 3MGBA 4A1GA 3PDNA 2WXFA 3TWQA 2H6FA 3DWLG 1V54E 1QNFA 3L16A 1ELWA 5AARA 1HH8A 2QY7A 4CDMA 4RG9A 2IONA 4GMJA 1VDYA 3DSWA 3DSXA 4WWOA 2JLBA 3CGHA 3OXGA 5M72A 1DNPA 3FTVA 3EIJA 2V0PA 3S7JA 3I4RB 3NOCD 3EDTB 3EHRA 4RVBA 1WAO1 2P58C 4CDRA 1OCZE 2X38A 2GRLA 2RD0A 2H6IA 2XCBA 3SGHA 3TG5A 5EX0A 1IQRA 4K03A 3PRZA 4E85A 3APCA 3ZVVA 4L7TA 3BG1B 4UWHA 3SF4A 2J9QA 1BPOA 2BTDA 2IOLA 4RQIA 2RG8A 4WWNA 1L5JA 1EYHA 5BV1A 2GROB 1MX4A 2XPZA 3K9IA 1LD8A 2AW6A 3SFZA 4PS7A 4O6FA 4HRLA 1FVFA 3QC1A 3ZYLA 3CEQA 4F3VA 2PM7A 3D3MA 3RSEG 2BUGA 3FH5A 3TL5A 4HORA 4FC8A 5ENQD 3FTYA 1N9AA 3ASOE 3ZHEB 3W9FA 3PEVB 4JHRA 2P9PG 5EYLA 3D9MA 3EJNA 4JVSA 3FP3A 4ILIA 3U3WA 4BX9A 2WXIA 1RZ4A 3FUFA 3FTXA 5FTPA 1TNBA 2R2LA 2R17C 2WXQA 5ARGA 4Q69A 4FHJA 5EIBE 2L6BA 1E8YA 1BLXB 2MHKA 5JMND 4ATZD 1D8DA 2KC7A 3MJWA 1HS6A 4G11A 2V4LA 4E6HA 2Y3AA 5JJ6A 3ABLE 3LYAA 4GYYA 3UM1A 1TR4A 2XGMA 1TN8A 4C9BB 1RW2A 3HYMB 3UX4A 4BERA 4JHKA 1H6PA 4GZ3A 4JPSA 4DRXE 2E2EA 3CKCA 4HOTA 1NL4A 2XS8A 4MRUA 4IN3B 2KZTB 1BU9A 5B1AE 3DEPA 4FP7A 1B89A 4APOA 2BEDA 3UM0A 3MZLB 3TJPA 4CZ2D 3UINC 2QYJA 3RRUA 1QQEA 4WNFA 1MQSA 4I9CA 3TWWA 3NZSA 4BTAA 4GTVA 4A1SA 4UQXA 1H2VC 3J5QB 4Q96A 3ESKA 4A3VA 2P9IG 1E7VA 3UT8A 2Q7FA 3ZEFA 1A17A 3PVLA 2QZAA 3DSSA 4B93B 4APFA 2XRZA 5CBNA 2BKGA 3GYZA 4BT8A 4MLPA 3QJZA 3NB2A 4FJZA 3Q15A 4YDWA 3EIQC 4HOQA 3LJ3A 4EECA 4HOSA 2I6HA 2R05A 4U7EB 3D9LA 1KZOA 3UIPC 4I1AA 1WG0A 3PNLB 5CEAA 4Q94A 3URZA 4WUYA 1OT8A 3KSQA 1DCEA 4O1PA 1YCSB 4UWLA 1U3CA 2XCCA 1NZNA 4B8AA 1OCCE 4NACA 1K3ZD 4GZDA 1PC2A 5HQ8A 4U96D 2CHZA 3CVQA 2VQ2A 3FUIA 4I2WA 2AXZA 1HU3A 4YVQC 3QWPA 3DRAA 5BV0A 2KCLA 2IU1A 1NI1A 4GU5A 4K5CA 4ABNA 2WVIA 2WXPA 3KD7A 3IXEA 3CVXA 3SY2A 4B8CB 3X2QE 4JL0A 1D8EA 2IY0C 3CHMA 3ABME 1Z6TA 4B94A 4CYMD 4NRHB 5AQAA 3FTUA 2ZXWE 3WXXA 4DX1A 4P29A 5CCMA 2IO2C 3FY4A 5C2YA 3QK0A 3CHPA 2VSYA 3LCAA 3UT4A 3ZXSA 3PH0C 1UN8A 3CV0A 4JEHA 3TGOA 4TRQA 2AVPA 3JUIA 3NZUA 4HOUA 3DSUA 3LVQE 4JA9A 2LUHA 5EILA 5KJKA 3R9AB 3MKQA 5CECB 3FUMA 2DIWA 2VTBB 1KZPA 1H6OA 4U63A 1Q2ZA 4L2YA 1MYOA 3OXFA 1PAQA 2ZU6B 4DJAA 3T8KA 5ENTD 4WNDA 3RAUA 1N94A 4TXRA 3CLJA 2XHEA 2FI7A 4TUMA 3LY8A 2EINE 2M63A 4N39A 3QAQA 5KNGA 5EDSA 1QZ2A 5HKPA 3SFYA 4M3OA 3PUKA 1N4PA 4ILGA 2GGFA 4BTBA 2X6JA 3Q49B 5E75A 1SA5A 3QDNA 3CVNA 2VGYA 5J90A 4EHMA 3HVEA 3UKRG 4W9RA 5BT1A 2Y1LE 3FULA 3QKYA 4KYOB 3HXFA 4GYOA 5JHAA 2ZIRA 4QQIA 1EPUA 2WXLA 4I1OB 5FZRA 4OYSA 2KM4A 5DBKA 3ULYA 3EHNA 2F0YA 5H7PA 3DPYA 2J8SD
chains in the Genus database with same CATH topology
2WXJA 1LF8A 3T5XA 3C98A 1KT0A 3APCA 3ZVVA 3FUNA 5E76A 3ZN3A 4L7TA 3RIBA 1DVPA 3ASHA 3BG1B 4DLQA 3JQ1A 4JXTA 4UWHA 3SF4A 1INZA 1ZU2A 4MKTA 2J9QA 1BPOA 2BTDA 4YVOA 4TV3A 5DIZA 3Q47B 2OVBA 2KCKA 1E8XA 4DI4A 4J0UA 4K0RA 1UN9A 3P1UA 2XGOA 2KATA 3U66A 2WXRA 3KAEA 3E4BA 1FVHA 4DLOA 2C2LA 3ML8A 2IOLA 4WAFA 2YINA 3CR3A 2RG8A 4WWNA 2VSXE 1L5JA 3ONKA 3FUJA 1EYHA 3HDXA 4JA7A 3T8MA 5BV1A 5BUZA 2UWJG 5LCWJ 4J8EA 4NURA 1E8WA 4CGVA 3CQCB 2XPZA 5AYWD 4EZLA 1JWGA 3K9IA 3FU5A 2J4DA 3EHMA 2AW6A 4FLHA 3LDZA 4PS7A 3SFZA 4O6FA 4ACLA 3HHMA 3D9NA 2X6FA 2XEVA 2E0IA 3ASFA 2X6IA 1FVFA 3QC1A 3ZYLA 4KT6B 4EZKA 4HFGA 1H2UA 4GZCA 3CEQA 3GZ1A 4BX8A 1Z3YA 4R7LA 2Y4TA 2CG2A 2PM7A 1KLXA 4F3VA 2R59A 4ACKA 3D3MA 1OUVA 2BUGA 4A55A 4G1TA 3FH5A 3TL5A 2J4BA 4FC8A 3RO2A 3RRNB 3FTYA 5JJ7A 4HORA 4CT0A 4AP2A 2MRIA 3T5VA 3ZHEB 2FBNA 2YQ8A 1X5BA 5ANRA 1U3DA 3PEVB 3FHEA 4JHRA 3IBEA 4AV7A 2L9BA 5J08A 4IRUA 5D0OD 3CVUA 3S7BA 2UY1B 2A5UA 3D9MA 2CFUA 3EJNA 3FP3A 4ILIA 4JVSA 2X6KA 3U3WA 4GMLA 4BX9A 2WXIA 4I17A 4BFRA 4I6GA 1WY6A 3FUFA 3FTXA 3I5PA 3LVRE 4ME2A 3ESLA 5FTPA 5G04C 2R5SA 2LSVA 2C0MA 2R17C 2WXQA 5ARGA 2LAIA 3CSFA 5FQ4A 3PUJA 1PY1A 4FHJA 4Q69A 2FULA 4G24A 1E8YA 3QWVA 2MHKA 1IQUA 5FQ8A 2I1KA 3FTZA 4AY6A 4V3IA 2KC7A 3TAXA 4HVBA 5AIJA 3LY7A 1HS6A 3MJWA 4G11A 2JEKA 3MV3B 4GA0A 3P2BA 2V4LA 4GCOA 5FWQA 3CQGB 4E6HA 4FA6A 5FJYA 2Y3AA 2HM8A 2VYIA 2WQHA 4UWKA 5JJ6A 3APFA 2NSZA 4KBQA 3U9WA 2WXHA 4ILHB 1HF8A 4AJWA 3IHVA 4N3CA 3ZYQA 4ANVA 3LYAA 4GYYA 3U4TA 4AIFA 4I1MA 3CVWA 1SZ9A 2IFUA 3I4GA 3OAWA 2CG3A 2XGMA 3FUHA 5T8IA 4C9BB 4GZ5A 4JHJA 3MKQB 3HYMB 2IJGX 1H0AA 3UX4A 4U04A 1MHQA 3FFLA 4JHKA 2XPYA 4RSYA 4GZ3A 3OTNA 5FQ7A 5A23A 1JUQA 2WXKA 4JPSA 4N3BA 3MV2B 2VGXB 2E2EA 3CKCA 2IOSA 3CIAA 3QARA 3R7RA 4HOTA 4BY6A 3U64A 4CT4A 3FH8A 4AY5A 3FWVA 2I1JA 3D9OA 3PREA 3FTWA 4AOFA 4GYWA 4MRUA 2VTBA 4IN3B 3LPZA 2KZTB 3MCXA 4UWFA 4XZ4A 3RO3A 2VSOE 4U0UA 3TXNA 4WNEA 4J6IA 4CDNA 1NA3A 4J8DA 2L0IA 4FP7A 4IULA 1B89A 4APOA 2V8SE 4KZCA 4AEZC 1HG2A 3MZLB 3TJPA 2CFZA 3ASGA 2NC9A 2WPVA 3BEEA 3IKOB 4YNDA 2LO6A 3FEYA 4XI9A 5G04J 4H7XA 3G2UA 3UUXA 3RRUA 5LX8A 1UG3A 3RRMB 3ZFWA 1QQEA 3NQPA 4WNFA 4OVUA 1MQSA 4I9CA 2J07A 4HXIA 3ONLA 1FCHA 2AXUA 3NZSA 5G55A 4JZYA 4GPKA 3CSTA 4BTAA 4A1SA 4UQXA 3CVPA 4XE0A 1H2VC 4KVOA 5ARFA 4Q96A 5KJLA 3ESKA 3QWWA 4A3VA 3FUDA 4FHKA 2CHXA 3S2AA 4LERA 4FLBA 3DBSA 4LEUA 2X6HA 4I9EA 5FT9A 3PEUB 1E7VA 3FU3A 3UT8A 2Q7FA 4UQYA 4I6EA 3IEGA 3UQ3A 3ZEFA 4KZ0A 3HVEB 4C0EA 1H19A 3CK8A 1A17A 3NF1A 3PVLA 4LRZA 4FU3A 4Y6CA 3TG4A 2I2OA 4WNGA 1SZAA 4APFA 2XRZA 5KCMA 4N2QA 3CHSA 1OWMA 3L54A 4XIFA 3CVVA 4G26A 1TJFA 4B0ZA 1YA0A 5G2NA 5ENNA 3GYZA 4U07A 3SNXA 4G23A 4BT8A 3ULQA 4MLPA 4F7AA 5T4YA 3QJZA 4XKBA 5FZSA 5KJMA 5KJNA 3LS8A 3MA5A 4PS3A 4I43A 4FJZA 3Q15A 5A6CA 3GZ2A 3G2TA 5ANLA 3EIQC 1KT1A 3O4ZA 4HOQA 3VLDA 2WQ6A 3G2VA 3QOUA 3LJ3A 4EECA 4CEMA 1Y8MA 3MEKA 2WMOA 2KCVA 2I6HA 4I2ZA 4HOSA 3AS8A 3D9LA 3LEWA 4L1BA 4TUUA 2WB2A 2CHWA 4G2VA 4I1AA 3FUEA 3ML9A 4HS2A 4N3AA 3PNLB 4EBAG 4EZJA 1IYGA 4Q94A 1HX8A 3ZIMA 3URZA 4WUYA 1H6KA 4NQ0A 2WQ7A 4GZ6A 4JW1A 2FO7A 5EX3A 2MOWA 3FH7A 3PNTB 5G05C 2XGSA 5BPPA 2X3MA 5FZQA 1UJKA 3JQ0A 3SD5A 4UWLA 3KS2A 3APDA 3AS5A 1U3CA 2V5FA 1NZNA 2XCCA 4H7YA 4B8AA 4GCNA 4JC8A 1ELKA 5T3RA 4NACA 4B89A 3PE3A 1TJCA 3AU5A 3CHRA 4GA1A 1PC2A 3ASDA 4GZDA 3RU0A 5HQ8A 2QFCA 2CHZA 1IHGA 3CVQA 2WMNA 1H2TC 2VQ2A 3FUKA 2J49A 3FUIA 4I2WA 2AXZA 4UQZA 3ZPJA 3UT7A 5CCLA 3D9JA 1HU3A 4YVQC 4U0ZA 4IYPA 3HIZA 4ANWA 3VLFA 4F53A 3G2WA 2VJ8A 5LCWC 1XNFA 2ILRA 3QWPA 3L17A 3QB2A 3SI5A 3L6AA 4CGWA 4XI0A 5AENA 5BV0A 2PQNA 2WXGA 4PUCA 2KCLA 2IU1A 2FEZA 2GW1A 4UI9C 2HYZA 4GU5A 4BWRA 3DPDA 4CCAA 4AM9A 3FEXA 2NXPA 2PM6A 3PZDA 4ABNA 2WVIA 2PQRA 3BG0B 3L08A 3S7DA 2HO1A 3ZYKA 1E8ZA 2WXPA 1HZ4A 5D0QD 2C0LA 3KD7A 3VLEA 1HO8A 3CVXA 1OWOA 4DK5A 1SQMA 3LY9A 4B8CB 2HR2A 4JL0A 4BT9A 3B7SA 4FJYA 4CRWA 3CHMA 3D9PA 2YHEA 2LAHA 3FTSA 4ANUA 1OWPA 1Z6TA 4J8FA 4B94A 4FULA 1JPLA 4NRHB 3ZHEA 3FTUA 1EDUA 4PDXA 5BW8C 3MX3A 1EF1C 2LNIA 3WXXA 3G2SA 3LXUX 1NA0A 3O48A 4A3TA 2UY1A 1W3BA 4P29A 3UPVA 5CCMA 1E7UA 4AVXA 3B7TA 2XPIA 3QNKA 3L22A 3FY4A 1P5QA 2I9CA 5EKQD 5C2YA 2PZIA 3QK0A 3CHPA 5JHBA 1HE8A 1OWNA 3D9KA 3CVLA 2VSYA 3LCAA 2J08A 3UT4A 3ZXSA 3AU4A 3PH0C 1UN8A 3CVYA 3CV0A 4JEHA 4L2LA 5G05J 4DPRA 1UJJA 1Z3XA 3TGOA 4TRQA 3ZW3A 2DCPA 3FU6A 2YNQA 3SBSA 2AVPA 3JUIA 2A4ZA 5CHEE 4U0SA 1ELRA 3NZUA 2BF0X 4G25A 2YHCA 5JJTA 1NP7A 4HOUA 4L23A 1WM5A 5CMWA 5LOZA 4PH4B 3LVQE 5AJDA 3ZRHA 1E90A 2DBAA 5LP0A 4D10C 2PL2A 1TEZA 2IQCA 3AS4A 1E96B 2ONDA 3SHFA 4JA9A 3SBTB 2GRMA 4Y6WA 3Q4AB 5KJKA 4EPZA 4F1SA 4UI9J 2LSUA 4XKCA 3R9AB 3MKQA 3L13A 3FUMA 4OVVA 2OV8A 3B13A 2DIWA 3Q5MA 3MYVA 3RJVA 1HG5A 3CK9A 4FADA 3ZGQA 5BNWA 2XQ0A 4GB9A 2VTBB 4N2SA 4U63A 2VGXA 3N71A 4L2YA 3CHOA 3MKRA 4JEUA 4J8SA 2J09A 3I3NA 4XX5A 4BSXA 3OXFA 4U8HA 1PAQA 2ZU6B 2WXMA 2OOEA 3GZSA 3PE4A 4DJAA 2KZTA 4WNDA 3PS6A 2AXVA 3OXLA 1JWFA 4ATGA 2L6JA 2WXOA 2XRYA 4QFVA 4LUNU 3CLJA 4N5CA 3FDHA 4LCTA 2XHEA 2Y4UA 1N52A 2FI7A 4GAAA 5FQ6A 3UMVA 3LY8A 3CKBA 2M63A 4N39A 4C0MA 4UI9K 3QAQA 4I6JA 2L0TB 5EDSA 3MGBA 4A1GA 2VSNA 1GW6A 3PDNA 1QZ2A 2WXFA 3VTXA 2EQXA 4HLEA 4M3OA 5HI7A 3PUKA 1S0PA 3RK6A 4ILGA 2GGFA 4BTBA 1QNFA 3L16A 5CMYA 4PS8A 1ELWA 1HH8A 2QY7A 2X6JA 2FF4A 3Q49B 5E75A 4EQFA 4CDMA 3LKUA 4RG9A 2IONA 4EBAA 4KMOA 4KXKB 3CHQA 3GW4A 4GMJA 3RKVA 1VDYA 3QDNA 3CVNA 3FU0A 4WWOA 3SZ7A 2JLBA 1Y6IA 2VGYA 1XGWA 3B7RL 3CGHA 3OXGA 4MS6A 5M72A 1DNPA 5J90A 3FTVA 3HVEA 4AXHA 2WM9A 3EIJA 4W9RA 2V0PA 4WWPA 3IHYA 1N54A 2IF4A 5A7DB 3S7JA 5BT1A 3I4RB 4URKA 3EDTB 3FULA 3QKYA 4RVBA 1WAO1 3CK7A 2P58C 1OWLA 3D9IA 4KYOB 5LFAA 4GYOA 4CDRA 4ANXA 5JHAA 3VTYA 2AWIA 2X38A 2GRLA 3B7UX 2RD0A 3ZYMA 2WXNA 3KEZA 1EPUA 3S7FA 3TXMA 2WXLA 1ZBPA 3R7QA 1UW4B 1HXIA 2XCBA 4I1OB 3SGHA 3JCKC 3JYSA 4UWGA 3TG5A 3ENEA 4RG6A 4DI3A 2OVFA 5FZRA 4GA2A 4KVMA 5EX0A 1IQRA 4OYSA 2KM4A 4K03A 5DBKA 3PRZA 3EHNA 5AJLA 4E85A 5C1DA 3IV0A 1HFAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q94 A;  1HX8 A;  1LF8 A;  2V8S E;  3G2W A;  1H0A A;  1X5B A;  1JWG A;  3D9I A;  1UJJ A;  1JWF A;  1HG2 A;  5CMY A;  1MHQ A;  3D9P A;  1DVP A;  4FLB A;  1INZ A;  2QY7 A;  4JXT A;  2DCP A;  5J08 A;  3CLJ A;  2MOW A;  3LDZ A;  1JPL A;  1JUQ A;  3ZYM A;  3D9M A;  1EDU A;  2LO6 A;  2DIW A;  3D9N A;  1HG5 A;  3G2U A;  1UJK A;  3RRU A;  2BF0 X;  3G2S A;  1VDY A;  3G2T A;  3ZYL A;  1HF8 A;  3D9O A;  1ELK A;  3G2V A;  4FU3 A;  4GZC A;  1XGW A;  4HFG A;  4NAC A;  5LOZ A;  3ZYQ A;  5CMW A;  3ONL A;  2L0T B;  3ZYK A;  4AVX A;  1SZA A;  1PY1 A;  4GZD A;  2KM4 A;  3D9L A;  3ONK A;  1SZ9 A;  5LP0 A;  1EYH A;  3D9K A;  3D9J A;  4Q96 A;  2L0I A;  1HFA A; 
#chains in the Genus database with same CATH topology
 3C98 A;  1SW6 A;  3ZN3 A;  4HI8 A;  5CRU A;  3RIB A;  4DLQ A;  1INZ A;  5KWD A;  3JQ1 A;  3R9M A;  4DI4 A;  1UN9 A;  2KAT A;  2XEE A;  3KAE A;  3E4B A;  4DLO A;  3UIO C;  2C2L A;  3ML8 A;  3TWR A;  2VSX E;  3FUJ A;  3HDX A;  4JA7 A;  5LCW J;  4NUR A;  3CQC B;  5AYW D;  4EZL A;  3JUE A;  4U95 D;  1G3N B;  2X6F A;  2XEV A;  3Q7F A;  4J7W A;  1Z3Y A;  3SQV A;  4ACK A;  1OUV A;  3C3Q A;  4A55 A;  2EIM E;  5JJ7 A;  4YDE A;  3HXE A;  1IHB A;  1X5B A;  2YQ8 A;  4AV7 A;  5D0O D;  3S7B A;  2UY1 B;  2A5U A;  2X6K A;  2Y0B G;  4BFR A;  3LVR E;  2C0M A;  2LAI A;  1PY1 A;  4G24 A;  2I1K A;  1N0Q A;  4V3I A;  2DZO A;  3J5P A;  3MV3 B;  4GA0 A;  5HS0 A;  4GCO A;  3DSV A;  2VYI A;  2WQH A;  4UWK A;  3APF A;  2NSZ A;  4RLY A;  4ILH B;  4AJW A;  1QBQ A;  4N3C A;  3UXG A;  4ANV A;  3U4T A;  4AIF A;  3Q9N C;  1N11 A;  2IJG X;  4U04 A;  4RSY A;  5A23 A;  5FQ7 A;  2WXK A;  2XS1 A;  4GTM A;  1UOH A;  3C5R A;  3QAR A;  4CT4 A;  3KSL A;  3FH8 A;  3FWV A;  3PRE A;  5FIO A;  2VSO E;  2NYJ A;  2DWZ A;  4CDN A;  1NA3 A;  3IKO B;  4XI9 A;  1UG3 A;  2J07 A;  3ONL A;  4JZY A;  2EIJ E;  3CVP A;  4KVO A;  5KJL A;  2QC9 A;  4GMR A;  4LER A;  3DBS A;  2X6H A;  4I9E A;  4TXQ A;  2P9K G;  4U8V D;  4UQY A;  2GRN B;  3IEG A;  3C3O A;  3UQ3 A;  4HRN A;  5B3S E;  4C0E A;  1H19 A;  3CK8 A;  3JXI A;  4LRZ A;  2MYO A;  2I2O A;  3ISM C;  3BUA A;  3CHS A;  3L54 A;  4XIF A;  4G26 A;  1YA0 A;  5ENN A;  3SNX A;  4G23 A;  3B95 A;  5T4Y A;  1ZB1 A;  3ZXP A;  5KJN A;  3LS8 A;  4PS3 A;  5A6C A;  2P9S G;  3G2T A;  2WQ6 A;  1N4Q A;  1Y8M A;  2KCV A;  3AS8 A;  3LEW A;  3L9T A;  2CHW A;  4G2V A;  3ZIM A;  3L82 A;  2WQ7 A;  2DZN A;  4HRM B;  4J8Y A;  1AP7 A;  5FZQ A;  1UJK A;  4JC8 A;  3AU5 A;  3CHR A;  3RU0 A;  3ASD A;  4O1O A;  4UQZ A;  5HRY A;  3UT7 A;  3D9J A;  3V31 A;  4ANW A;  4F53 A;  3G2W A;  2AJA A;  5AEN A;  3Q9U C;  2PQN A;  2WXG A;  4PUC A;  2F8Y A;  4BWR A;  5CBO A;  3S7D A;  2HO1 A;  3UM2 A;  2C0L A;  2OCC E;  3VLE A;  1HO8 A;  1SQM A;  1N4R A;  4FJY A;  4ANU A;  2Y69 E;  1JPL A;  4PDX A;  3MX3 A;  1TYQ G;  1EF1 C;  3G2S A;  3HXD A;  3O48 A;  1W3B A;  1E7U A;  2GRR B;  3L22 A;  2PZI A;  3CVL A;  4DPR A;  1UJJ A;  1Z3X A;  3E32 A;  1K8K G;  2YNQ A;  4GTP A;  5CHE E;  4U0S A;  2BF0 X;  4L23 A;  4HBD A;  3JXJ A;  3NBN B;  3AG2 E;  3AG3 E;  4D10 C;  2PL2 A;  5AN8 A;  2EIK E;  1E96 B;  3AS4 A;  3DXK G;  3HXB A;  3Q4A B;  4F1S A;  2DVW A;  5ENR D;  3L13 A;  4OVV A;  2OV8 A;  3Q5M A;  3RJV A;  4GB9 A;  3TWT A;  4N2S A;  3E37 A;  2VGX A;  3N71 A;  2XEN A;  3MKR A;  4JEU A;  2J09 A;  3I3N A;  4BSX A;  2OOE A;  3PE4 A;  4BSZ B;  3Q79 A;  3ZU7 B;  3PS6 A;  2AXV A;  4ATG A;  4QFV A;  4LUN U;  4N5C A;  4LCT A;  3ABK E;  5B1B E;  4UI9 K;  1TNY A;  2VSN A;  3DST A;  3VTX A;  3RK6 A;  2RFA A;  4BEP A;  3ULE G;  4EBA A;  3CHQ A;  3RKV A;  3SZ7 A;  4YDY A;  3B7R L;  1Y6I A;  1XGW A;  5EYP F;  4ZHB A;  4GTR A;  3IHY A;  1N54 A;  2IF4 A;  3BU8 A;  3W9G A;  2AWI A;  2WXN A;  3KEZ A;  3TXM A;  1ZBP A;  1UW4 B;  4M7C A;  3JCK C;  3JYS A;  4DI3 A;  4KVM A;  1QYM A;  5ENS D;  5AJL A;  4GTT A;  5C1D A;  4J0U A;  1HFA A;  1LF8 A;  5E76 A;  5ENP D;  1JCS A;  1DVP A;  1FT2 A;  4JXT A;  1ZU2 A;  4A63 B;  4TV3 A;  2KCK A;  1E8X A;  2B6C A;  3U66 A;  1SA4 A;  5AQ9 A;  1FVH A;  3D9H A;  3ONK A;  3T8M A;  4BES A;  5BUZ A;  2UWJ G;  4J8E A;  4CGV A;  1JWG A;  1YMP A;  2H6H A;  3EHM A;  3LDZ A;  4ACL A;  3HHM A;  2X6I A;  4HFG A;  4GZC A;  3GZ1 A;  2Y4T A;  2CG2 A;  2R59 A;  3C72 A;  4K5A B;  4G1T A;  2LXL A;  4CT0 A;  4AP2 A;  5BXU A;  2HE0 A;  2MRI A;  3T5V A;  2FBN A;  5ANR A;  1U3D A;  3F6Q A;  5J08 A;  4IRU A;  1S64 A;  3PZ3 A;  2CFU A;  4HNA D;  4I6G A;  3SFX A;  5CED B;  1D9S A;  2R5S A;  2WB2 A;  5FQ4 A;  3CSF A;  4HQD A;  3PUJ A;  5IY5 E;  3QWV A;  2ETC A;  5FQ8 A;  3FTZ A;  3TAX A;  4HVB A;  2PNN A;  3E33 A;  3P2B A;  1SVX A;  5FWQ A;  2HM8 A;  4KBQ A;  3U9W A;  2WXH A;  1HF8 A;  3B7B A;  3CVW A;  2IFU A;  3I4G A;  4L9P A;  3OAW A;  2CG3 A;  5T8I A;  4JHJ A;  3MKQ B;  1H0A A;  1MHQ A;  2XPY A;  3OTN A;  1JUQ A;  1AWC B;  4LSZ E;  1K1B A;  3CIA A;  3R7R A;  4GTS A;  4AY5 A;  2I1J A;  3D9O A;  4ZFH A;  3FTW A;  4GYW A;  3MCX A;  4UWF A;  4XZ4 A;  3TXN A;  4WNE A;  4J6I A;  4J8D A;  4IUL A;  5BXO A;  2OEV A;  2ZIS A;  3ASG A;  2KXP C;  5CRV A;  4YND A;  2LO6 A;  3G2U A;  3UUX A;  3E30 A;  5LX8 A;  3ZFW A;  3NQP A;  4HXI A;  4F1P A;  4LG6 A;  4G8L A;  1N4S A;  4N5Q A;  4XE0 A;  5ARF A;  4FHK A;  4FLB A;  4LEU A;  3PEU B;  2XEH A;  1K1A A;  4KZ0 A;  3HVE B;  3NF1 A;  3UKU G;  4FU3 A;  2GRQ B;  4Y6C A;  4WNG A;  5KCM A;  1OWM A;  2QYU A;  3ZKJ A;  4F7A A;  2XZD G;  4XKB A;  5FZS A;  3MA5 A;  3C3R A;  4I43 A;  5AAO A;  3O4Z A;  1KT1 A;  3VLD A;  3G2V A;  3QOU A;  4CEM A;  3AG1 E;  4L1B A;  4N3A A;  4EZJ A;  3FUE A;  3ML9 A;  4EBA G;  1IYG A;  1HX8 A;  4NQ0 A;  2FO7 A;  2MOW A;  3DEO A;  5G05 C;  5BPP A;  3SD5 A;  3Q7A A;  3KS2 A;  3AS5 A;  2V5F A;  4GCN A;  4B89 A;  3PE3 A;  5FIN A;  3BQO A;  2WMN A;  3FUK A;  3UTM A;  3ZPJ A;  5CCL A;  3ASN E;  4U0Z A;  4IYP A;  2V4H C;  3HIZ A;  3VLF A;  1XNF A;  1V55 E;  2ILR A;  3L17 A;  3QB2 A;  3L6A A;  3EU9 A;  4XI0 A;  4DX2 A;  3DPD A;  3FEX A;  3BG0 B;  3L08 A;  3ZYK A;  1HZ4 A;  5D0Q D;  1O5M A;  3LJN A;  1OWO A;  2FO1 E;  2HR2 A;  1X81 A;  3D9P A;  2YHE A;  2LAH A;  3V79 K;  2P9N G;  4FUL A;  3ZHE A;  1EDU A;  2ETA A;  2LNI A;  2BKK B;  4O60 A;  5D2M C;  3UPV A;  3B7T A;  1P5Q A;  1FT1 A;  2I9C A;  5JHB A;  3AU4 A;  3TWX A;  5G05 J;  4L2L A;  2DCP A;  2RKK A;  3UI2 A;  1FPP A;  4G25 A;  2YHC A;  5JJT A;  1NP7 A;  1NFI E;  1BI7 B;  1WM5 A;  5LOZ A;  4LNU D;  5AJD A;  1BD8 A;  1TEZ A;  2P9U G;  3SHF A;  2OND A;  3SBT B;  5AQB A;  2LSU A;  4XKC A;  3B13 A;  5BNW A;  3CK9 A;  1N0R A;  3ZGQ A;  4U8Y D;  2XQ0 A;  3T9K A;  2IO3 C;  2P2C P;  4J8S A;  2H6G A;  4U8H A;  2WXM A;  3GZS A;  3Q75 A;  2KZT A;  3OXL A;  2ZGG A;  2XRY A;  2A5E A;  4Z68 A;  1N52 A;  5FQ6 A;  1YYH A;  3UMV A;  4I6J A;  1TNU A;  3Q78 A;  1GW6 A;  2EQX A;  4HLE A;  5HI7 A;  1S0P A;  2DYS E;  5CMY A;  4PS8 A;  2F8X K;  2FF4 A;  4EQF A;  3LKU A;  4KMO A;  4KXK B;  3GW4 A;  1DC2 A;  3FU0 A;  4MS6 A;  1U2V G;  1S63 A;  4AXH A;  2WM9 A;  4DX5 D;  4WWP A;  5A7D B;  4URK A;  3CK7 A;  1OWL A;  3D9I A;  5LFA A;  4ANX A;  3VTY A;  2DYR E;  3B7U X;  3ZYM A;  1TNZ A;  3S7F A;  3R7Q A;  1HXI A;  1O1S A;  1LTX A;  2V5Q C;  4UWG A;  3ENE A;  4RG6 A;  2OVF A;  4GA2 A;  4HI9 A;  2OEW A;  3IV0 A;  1A5E A;  2WXJ A;  3T5X A;  1KT0 A;  3FUN A;  3HG0 D;  3ASH A;  4MKT A;  4YVO A;  5DIZ A;  1MZC A;  3Q47 B;  2OVB A;  3EU5 A;  3V2X A;  4K0R A;  4XEI G;  3P1U A;  2XGO A;  2WXR A;  4WAF A;  2YIN A;  3CR3 A;  2XZT G;  1E8W A;  5ENO D;  3FU5 A;  2J4D A;  4FLH A;  4YDO A;  3D9N A;  1Z5S C;  4JB8 P;  2E0I A;  3ASF A;  3NOG D;  3ZNG A;  4KT6 B;  4EZK A;  1H2U A;  3PZ1 A;  4BX8 A;  3WG7 E;  4R7L A;  1KLX A;  2J4B A;  3RRN B;  3RO2 A;  3FHE A;  3IBE A;  2L9B A;  3CVU A;  2R03 A;  4GML A;  4I17 A;  3AJI A;  2JAB A;  2KBX A;  1WY6 A;  1O1T A;  2RFM A;  5G04 C;  3I5P A;  4ME2 A;  3ESL A;  1JCQ A;  2LSV A;  2FUL A;  2EIL E;  1IQU A;  4AY6 A;  5AIJ A;  3LY7 A;  3E34 A;  2JEK A;  4GTO A;  4FA6 A;  3CQG B;  5FJY A;  4C48 B;  3IHV A;  3Q73 A;  4OAU C;  3ZYQ A;  3AG4 E;  4G8K A;  4I1M A;  1SZ9 A;  1OCR E;  3FUH A;  4GZ5 A;  1MX2 A;  1OXJ A;  3FFL A;  3NAW A;  3AAA C;  4N3B A;  3MV2 B;  2VGX B;  2IOS A;  4GPM A;  4BY6 A;  3U64 A;  4AOF A;  5D66 A;  5JA4 D;  2VTB A;  3LPZ A;  3RO3 A;  4U0U A;  1WDY A;  2L0I A;  2V8S E;  4KZC A;  4AEZ C;  1HG2 A;  2CFZ A;  2NC9 A;  2WPV A;  3BEE A;  3PZ4 A;  5KNH D;  3FEY A;  5G04 J;  4H7X A;  3RRM B;  4OVU A;  5G55 A;  1FCH A;  2AXU A;  1BI8 B;  3SO8 A;  1LD7 A;  4GPK A;  3CST A;  4LNG A;  4F6R D;  3QWW A;  3FUD A;  3S2A A;  2CHX A;  5FT9 A;  4OAV B;  3FU3 A;  1IKN D;  4MBG A;  4I6E A;  1JCR A;  5EID A;  3TG4 A;  2LXM A;  1SZA A;  3V30 A;  4N2Q A;  3CVV A;  1TJF A;  4TXP A;  4B0Z A;  5G2N A;  4U07 A;  4K5B A;  3ULQ A;  1O1R A;  4DUI A;  1N95 A;  5KJM A;  3UM3 A;  4LNB A;  3GZ2 A;  5ANL A;  4BET A;  1IXV A;  2ETB A;  3MEK A;  2WMO A;  4I2Z A;  2GRP B;  4TUU A;  3ZUV B;  1MJ0 A;  4HS2 A;  5EN5 D;  1H6K A;  3V2O A;  2VGE A;  4GZ6 A;  4JW1 A;  5EX3 A;  3FH7 A;  3PNT B;  1OY3 D;  2XGS A;  1DCQ A;  2X3M A;  3JQ0 A;  3HXC A;  3APD A;  4H7Y A;  1ELK A;  5T3R A;  1TJC A;  4GA1 A;  2QFC A;  1IHG A;  1H2T C;  2J49 A;  2P9L G;  2VJ8 A;  5LCW C;  2R02 A;  3TWU A;  3SI5 A;  4CGW A;  2FEZ A;  2GW1 A;  4UI9 C;  2HYZ A;  4CCA A;  4AM9 A;  3PZD A;  2NXP A;  2PM6 A;  3HRA A;  2PQR A;  1E8Z A;  4HLL A;  3DXM G;  1KPS B;  4DK5 A;  3LY9 A;  4BT9 A;  3B7S A;  4CRW A;  1TN7 A;  3FTS A;  1OWP A;  4J8F A;  5BW8 C;  3LXU X;  1NA0 A;  4A3T A;  2UY1 A;  5AQ7 A;  4AVX A;  4DX6 D;  2XPI A;  3QNK A;  5KBA A;  5CER B;  4GTQ A;  5EKQ D;  1HE8 A;  1OWN A;  3D9K A;  4NIK A;  2J08 A;  1TN6 A;  3CVY A;  3ZW3 A;  3FU6 A;  3SBS A;  2A4Z A;  1ELR A;  4X8Q A;  5CMW A;  2ZGD A;  4PH4 B;  4HB5 A;  3ZRH A;  1E90 A;  2DBA A;  5LP0 A;  3TWS A;  2IQC A;  2GRM A;  4DX7 D;  4Y6W A;  4EPZ A;  4UI9 J;  3EHQ A;  2F37 A;  2B0O E;  3MYV A;  4FAD A;  1HG5 A;  1OCO E;  1S70 B;  3CHO A;  1TNO A;  4XX5 A;  3KEA A;  4UUC A;  3TWV A;  1MX6 A;  2IEJ A;  3PZ2 A;  1JWF A;  2L6J A;  2WXO A;  3FDH A;  3EUV A;  2Y4U A;  4GAA A;  4JD2 G;  5ITZ F;  3CKB A;  4C0M A;  2L0T B;  3MGB A;  4A1G A;  3PDN A;  2WXF A;  3TWQ A;  2H6F A;  3DWL G;  1V54 E;  1QNF A;  3L16 A;  1ELW A;  5AAR A;  1HH8 A;  2QY7 A;  4CDM A;  4RG9 A;  2ION A;  4GMJ A;  1VDY A;  3DSW A;  3DSX A;  4WWO A;  2JLB A;  3CGH A;  3OXG A;  5M72 A;  1DNP A;  3FTV A;  3EIJ A;  2V0P A;  3S7J A;  3I4R B;  3NOC D;  3EDT B;  3EHR A;  4RVB A;  1WAO 1;  2P58 C;  4CDR A;  1OCZ E;  2X38 A;  2GRL A;  2RD0 A;  2H6I A;  2XCB A;  3SGH A;  3TG5 A;  5EX0 A;  1IQR A;  4K03 A;  3PRZ A;  4E85 A;  3APC A;  3ZVV A;  4L7T A;  3BG1 B;  4UWH A;  3SF4 A;  2J9Q A;  1BPO A;  2BTD A;  2IOL A;  4RQI A;  2RG8 A;  4WWN A;  1L5J A;  1EYH A;  5BV1 A;  2GRO B;  1MX4 A;  2XPZ A;  3K9I A;  1LD8 A;  2AW6 A;  3SFZ A;  4PS7 A;  4O6F A;  4HRL A;  1FVF A;  3QC1 A;  3ZYL A;  3CEQ A;  4F3V A;  2PM7 A;  3D3M A;  3RSE G;  2BUG A;  3FH5 A;  3TL5 A;  4HOR A;  4FC8 A;  5ENQ D;  3FTY A;  1N9A A;  3ASO E;  3ZHE B;  3W9F A;  3PEV B;  4JHR A;  2P9P G;  5EYL A;  3D9M A;  3EJN A;  4JVS A;  3FP3 A;  4ILI A;  3U3W A;  4BX9 A;  2WXI A;  1RZ4 A;  3FUF A;  3FTX A;  5FTP A;  1TNB A;  2R2L A;  2R17 C;  2WXQ A;  5ARG A;  4Q69 A;  4FHJ A;  5EIB E;  2L6B A;  1E8Y A;  1BLX B;  2MHK A;  5JMN D;  4ATZ D;  1D8D A;  2KC7 A;  3MJW A;  1HS6 A;  4G11 A;  2V4L A;  4E6H A;  2Y3A A;  5JJ6 A;  3ABL E;  3LYA A;  4GYY A;  3UM1 A;  1TR4 A;  2XGM A;  1TN8 A;  4C9B B;  1RW2 A;  3HYM B;  3UX4 A;  4BER A;  4JHK A;  1H6P A;  4GZ3 A;  4JPS A;  4DRX E;  2E2E A;  3CKC A;  4HOT A;  1NL4 A;  2XS8 A;  4MRU A;  4IN3 B;  2KZT B;  1BU9 A;  5B1A E;  3DEP A;  4FP7 A;  1B89 A;  4APO A;  2BED A;  3UM0 A;  3MZL B;  3TJP A;  4CZ2 D;  3UIN C;  2QYJ A;  3RRU A;  1QQE A;  4WNF A;  1MQS A;  4I9C A;  3TWW A;  3NZS A;  4BTA A;  4GTV A;  4A1S A;  4UQX A;  1H2V C;  3J5Q B;  4Q96 A;  3ESK A;  4A3V A;  2P9I G;  1E7V A;  3UT8 A;  2Q7F A;  3ZEF A;  1A17 A;  3PVL A;  2QZA A;  3DSS A;  4B93 B;  4APF A;  2XRZ A;  5CBN A;  2BKG A;  3GYZ A;  4BT8 A;  4MLP A;  3QJZ A;  3NB2 A;  4FJZ A;  3Q15 A;  4YDW A;  3EIQ C;  4HOQ A;  3LJ3 A;  4EEC A;  4HOS A;  2I6H A;  2R05 A;  4U7E B;  3D9L A;  1KZO A;  3UIP C;  4I1A A;  1WG0 A;  3PNL B;  5CEA A;  4Q94 A;  3URZ A;  4WUY A;  1OT8 A;  3KSQ A;  1DCE A;  4O1P A;  1YCS B;  4UWL A;  1U3C A;  2XCC A;  1NZN A;  4B8A A;  1OCC E;  4NAC A;  1K3Z D;  4GZD A;  1PC2 A;  5HQ8 A;  4U96 D;  2CHZ A;  3CVQ A;  2VQ2 A;  3FUI A;  4I2W A;  2AXZ A;  1HU3 A;  4YVQ C;  3QWP A;  3DRA A;  5BV0 A;  2KCL A;  2IU1 A;  1NI1 A;  4GU5 A;  4K5C A;  4ABN A;  2WVI A;  2WXP A;  3KD7 A;  3IXE A;  3CVX A;  3SY2 A;  4B8C B;  3X2Q E;  4JL0 A;  1D8E A;  2IY0 C;  3CHM A;  3ABM E;  1Z6T A;  4B94 A;  4CYM D;  4NRH B;  5AQA A;  3FTU A;  2ZXW E;  3WXX A;  4DX1 A;  4P29 A;  5CCM A;  2IO2 C;  3FY4 A;  5C2Y A;  3QK0 A;  3CHP A;  2VSY A;  3LCA A;  3UT4 A;  3ZXS A;  3PH0 C;  1UN8 A;  3CV0 A;  4JEH A;  3TGO A;  4TRQ A;  2AVP A;  3JUI A;  3NZU A;  4HOU A;  3DSU A;  3LVQ E;  4JA9 A;  2LUH A;  5EIL A;  5KJK A;  3R9A B;  3MKQ A;  5CEC B;  3FUM A;  2DIW A;  2VTB B;  1KZP A;  1H6O A;  4U63 A;  1Q2Z A;  4L2Y A;  1MYO A;  3OXF A;  1PAQ A;  2ZU6 B;  4DJA A;  3T8K A;  5ENT D;  4WND A;  3RAU A;  1N94 A;  4TXR A;  3CLJ A;  2XHE A;  2FI7 A;  4TUM A;  3LY8 A;  2EIN E;  2M63 A;  4N39 A;  3QAQ A;  5KNG A;  5EDS A;  1QZ2 A;  5HKP A;  3SFY A;  4M3O A;  3PUK A;  1N4P A;  4ILG A;  2GGF A;  4BTB A;  2X6J A;  3Q49 B;  5E75 A;  1SA5 A;  3QDN A;  3CVN A;  2VGY A;  5J90 A;  4EHM A;  3HVE A;  3UKR G;  4W9R A;  5BT1 A;  2Y1L E;  3FUL A;  3QKY A;  4KYO B;  3HXF A;  4GYO A;  5JHA A;  2ZIR A;  4QQI A;  1EPU A;  2WXL A;  4I1O B;  5FZR A;  4OYS A;  2KM4 A;  5DBK A;  3ULY A;  3EHN A;  2F0Y A;  5H7P A;  3DPY A;  2J8S D; 
#chains in the Genus database with same CATH homology
 2WXJ A;  1LF8 A;  3T5X A;  3C98 A;  1KT0 A;  3APC A;  3ZVV A;  3FUN A;  5E76 A;  3ZN3 A;  4L7T A;  3RIB A;  1DVP A;  3ASH A;  3BG1 B;  4DLQ A;  3JQ1 A;  4JXT A;  4UWH A;  3SF4 A;  1INZ A;  1ZU2 A;  4MKT A;  2J9Q A;  1BPO A;  2BTD A;  4YVO A;  4TV3 A;  5DIZ A;  3Q47 B;  2OVB A;  2KCK A;  1E8X A;  4DI4 A;  4J0U A;  4K0R A;  1UN9 A;  3P1U A;  2XGO A;  2KAT A;  3U66 A;  2WXR A;  3KAE A;  3E4B A;  1FVH A;  4DLO A;  2C2L A;  3ML8 A;  2IOL A;  4WAF A;  2YIN A;  3CR3 A;  2RG8 A;  4WWN A;  2VSX E;  1L5J A;  3ONK A;  3FUJ A;  1EYH A;  3HDX A;  4JA7 A;  3T8M A;  5BV1 A;  5BUZ A;  2UWJ G;  5LCW J;  4J8E A;  4NUR A;  1E8W A;  4CGV A;  3CQC B;  2XPZ A;  5AYW D;  4EZL A;  1JWG A;  3K9I A;  3FU5 A;  2J4D A;  3EHM A;  2AW6 A;  4FLH A;  3LDZ A;  4PS7 A;  3SFZ A;  4O6F A;  4ACL A;  3HHM A;  3D9N A;  2X6F A;  2XEV A;  2E0I A;  3ASF A;  2X6I A;  1FVF A;  3QC1 A;  3ZYL A;  4KT6 B;  4EZK A;  4HFG A;  1H2U A;  4GZC A;  3CEQ A;  3GZ1 A;  4BX8 A;  1Z3Y A;  4R7L A;  2Y4T A;  2CG2 A;  2PM7 A;  1KLX A;  4F3V A;  2R59 A;  4ACK A;  3D3M A;  1OUV A;  2BUG A;  4A55 A;  4G1T A;  3FH5 A;  3TL5 A;  2J4B A;  4FC8 A;  3RO2 A;  3RRN B;  3FTY A;  5JJ7 A;  4HOR A;  4CT0 A;  4AP2 A;  2MRI A;  3T5V A;  3ZHE B;  2FBN A;  2YQ8 A;  1X5B A;  5ANR A;  1U3D A;  3PEV B;  3FHE A;  4JHR A;  3IBE A;  4AV7 A;  2L9B A;  5J08 A;  4IRU A;  5D0O D;  3CVU A;  3S7B A;  2UY1 B;  2A5U A;  3D9M A;  2CFU A;  3EJN A;  3FP3 A;  4ILI A;  4JVS A;  2X6K A;  3U3W A;  4GML A;  4BX9 A;  2WXI A;  4I17 A;  4BFR A;  4I6G A;  1WY6 A;  3FUF A;  3FTX A;  3I5P A;  3LVR E;  4ME2 A;  3ESL A;  5FTP A;  5G04 C;  2R5S A;  2LSV A;  2C0M A;  2R17 C;  2WXQ A;  5ARG A;  2LAI A;  3CSF A;  5FQ4 A;  3PUJ A;  1PY1 A;  4FHJ A;  4Q69 A;  2FUL A;  4G24 A;  1E8Y A;  3QWV A;  2MHK A;  1IQU A;  5FQ8 A;  2I1K A;  3FTZ A;  4AY6 A;  4V3I A;  2KC7 A;  3TAX A;  4HVB A;  5AIJ A;  3LY7 A;  1HS6 A;  3MJW A;  4G11 A;  2JEK A;  3MV3 B;  4GA0 A;  3P2B A;  2V4L A;  4GCO A;  5FWQ A;  3CQG B;  4E6H A;  4FA6 A;  5FJY A;  2Y3A A;  2HM8 A;  2VYI A;  2WQH A;  4UWK A;  5JJ6 A;  3APF A;  2NSZ A;  4KBQ A;  3U9W A;  2WXH A;  4ILH B;  1HF8 A;  4AJW A;  3IHV A;  4N3C A;  3ZYQ A;  4ANV A;  3LYA A;  4GYY A;  3U4T A;  4AIF A;  4I1M A;  3CVW A;  1SZ9 A;  2IFU A;  3I4G A;  3OAW A;  2CG3 A;  2XGM A;  3FUH A;  5T8I A;  4C9B B;  4GZ5 A;  4JHJ A;  3MKQ B;  3HYM B;  2IJG X;  1H0A A;  3UX4 A;  4U04 A;  1MHQ A;  3FFL A;  4JHK A;  2XPY A;  4RSY A;  4GZ3 A;  3OTN A;  5FQ7 A;  5A23 A;  1JUQ A;  2WXK A;  4JPS A;  4N3B A;  3MV2 B;  2VGX B;  2E2E A;  3CKC A;  2IOS A;  3CIA A;  3QAR A;  3R7R A;  4HOT A;  4BY6 A;  3U64 A;  4CT4 A;  3FH8 A;  4AY5 A;  3FWV A;  2I1J A;  3D9O A;  3PRE A;  3FTW A;  4AOF A;  4GYW A;  4MRU A;  2VTB A;  4IN3 B;  3LPZ A;  2KZT B;  3MCX A;  4UWF A;  4XZ4 A;  3RO3 A;  2VSO E;  4U0U A;  3TXN A;  4WNE A;  4J6I A;  4CDN A;  1NA3 A;  4J8D A;  2L0I A;  4FP7 A;  4IUL A;  1B89 A;  4APO A;  2V8S E;  4KZC A;  4AEZ C;  1HG2 A;  3MZL B;  3TJP A;  2CFZ A;  3ASG A;  2NC9 A;  2WPV A;  3BEE A;  3IKO B;  4YND A;  2LO6 A;  3FEY A;  4XI9 A;  5G04 J;  4H7X A;  3G2U A;  3UUX A;  3RRU A;  5LX8 A;  1UG3 A;  3RRM B;  3ZFW A;  1QQE A;  3NQP A;  4WNF A;  4OVU A;  1MQS A;  4I9C A;  2J07 A;  4HXI A;  3ONL A;  1FCH A;  2AXU A;  3NZS A;  5G55 A;  4JZY A;  4GPK A;  3CST A;  4BTA A;  4A1S A;  4UQX A;  3CVP A;  4XE0 A;  1H2V C;  4KVO A;  5ARF A;  4Q96 A;  5KJL A;  3ESK A;  3QWW A;  4A3V A;  3FUD A;  4FHK A;  2CHX A;  3S2A A;  4LER A;  4FLB A;  3DBS A;  4LEU A;  2X6H A;  4I9E A;  5FT9 A;  3PEU B;  1E7V A;  3FU3 A;  3UT8 A;  2Q7F A;  4UQY A;  4I6E A;  3IEG A;  3UQ3 A;  3ZEF A;  4KZ0 A;  3HVE B;  4C0E A;  1H19 A;  3CK8 A;  1A17 A;  3NF1 A;  3PVL A;  4LRZ A;  4FU3 A;  4Y6C A;  3TG4 A;  2I2O A;  4WNG A;  1SZA A;  4APF A;  2XRZ A;  5KCM A;  4N2Q A;  3CHS A;  1OWM A;  3L54 A;  4XIF A;  3CVV A;  4G26 A;  1TJF A;  4B0Z A;  1YA0 A;  5G2N A;  5ENN A;  3GYZ A;  4U07 A;  3SNX A;  4G23 A;  4BT8 A;  3ULQ A;  4MLP A;  4F7A A;  5T4Y A;  3QJZ A;  4XKB A;  5FZS A;  5KJM A;  5KJN A;  3LS8 A;  3MA5 A;  4PS3 A;  4I43 A;  4FJZ A;  3Q15 A;  5A6C A;  3GZ2 A;  3G2T A;  5ANL A;  3EIQ C;  1KT1 A;  3O4Z A;  4HOQ A;  3VLD A;  2WQ6 A;  3G2V A;  3QOU A;  3LJ3 A;  4EEC A;  4CEM A;  1Y8M A;  3MEK A;  2WMO A;  2KCV A;  2I6H A;  4I2Z A;  4HOS A;  3AS8 A;  3D9L A;  3LEW A;  4L1B A;  4TUU A;  2WB2 A;  2CHW A;  4G2V A;  4I1A A;  3FUE A;  3ML9 A;  4HS2 A;  4N3A A;  3PNL B;  4EBA G;  4EZJ A;  1IYG A;  4Q94 A;  1HX8 A;  3ZIM A;  3URZ A;  4WUY A;  1H6K A;  4NQ0 A;  2WQ7 A;  4GZ6 A;  4JW1 A;  2FO7 A;  5EX3 A;  2MOW A;  3FH7 A;  3PNT B;  5G05 C;  2XGS A;  5BPP A;  2X3M A;  5FZQ A;  1UJK A;  3JQ0 A;  3SD5 A;  4UWL A;  3KS2 A;  3APD A;  3AS5 A;  1U3C A;  2V5F A;  1NZN A;  2XCC A;  4H7Y A;  4B8A A;  4GCN A;  4JC8 A;  1ELK A;  5T3R A;  4NAC A;  4B89 A;  3PE3 A;  1TJC A;  3AU5 A;  3CHR A;  4GA1 A;  1PC2 A;  3ASD A;  4GZD A;  3RU0 A;  5HQ8 A;  2QFC A;  2CHZ A;  1IHG A;  3CVQ A;  2WMN A;  1H2T C;  2VQ2 A;  3FUK A;  2J49 A;  3FUI A;  4I2W A;  2AXZ A;  4UQZ A;  3ZPJ A;  3UT7 A;  5CCL A;  3D9J A;  1HU3 A;  4YVQ C;  4U0Z A;  4IYP A;  3HIZ A;  4ANW A;  3VLF A;  4F53 A;  3G2W A;  2VJ8 A;  5LCW C;  1XNF A;  2ILR A;  3QWP A;  3L17 A;  3QB2 A;  3SI5 A;  3L6A A;  4CGW A;  4XI0 A;  5AEN A;  5BV0 A;  2PQN A;  2WXG A;  4PUC A;  2KCL A;  2IU1 A;  2FEZ A;  2GW1 A;  4UI9 C;  2HYZ A;  4GU5 A;  4BWR A;  3DPD A;  4CCA A;  4AM9 A;  3FEX A;  2NXP A;  2PM6 A;  3PZD A;  4ABN A;  2WVI A;  2PQR A;  3BG0 B;  3L08 A;  3S7D A;  2HO1 A;  3ZYK A;  1E8Z A;  2WXP A;  1HZ4 A;  5D0Q D;  2C0L A;  3KD7 A;  3VLE A;  1HO8 A;  3CVX A;  1OWO A;  4DK5 A;  1SQM A;  3LY9 A;  4B8C B;  2HR2 A;  4JL0 A;  4BT9 A;  3B7S A;  4FJY A;  4CRW A;  3CHM A;  3D9P A;  2YHE A;  2LAH A;  3FTS A;  4ANU A;  1OWP A;  1Z6T A;  4J8F A;  4B94 A;  4FUL A;  1JPL A;  4NRH B;  3ZHE A;  3FTU A;  1EDU A;  4PDX A;  5BW8 C;  3MX3 A;  1EF1 C;  2LNI A;  3WXX A;  3G2S A;  3LXU X;  1NA0 A;  3O48 A;  4A3T A;  2UY1 A;  1W3B A;  4P29 A;  3UPV A;  5CCM A;  1E7U A;  4AVX A;  3B7T A;  2XPI A;  3QNK A;  3L22 A;  3FY4 A;  1P5Q A;  2I9C A;  5EKQ D;  5C2Y A;  2PZI A;  3QK0 A;  3CHP A;  5JHB A;  1HE8 A;  1OWN A;  3D9K A;  3CVL A;  2VSY A;  3LCA A;  2J08 A;  3UT4 A;  3ZXS A;  3AU4 A;  3PH0 C;  1UN8 A;  3CVY A;  3CV0 A;  4JEH A;  4L2L A;  5G05 J;  4DPR A;  1UJJ A;  1Z3X A;  3TGO A;  4TRQ A;  3ZW3 A;  2DCP A;  3FU6 A;  2YNQ A;  3SBS A;  2AVP A;  3JUI A;  2A4Z A;  5CHE E;  4U0S A;  1ELR A;  3NZU A;  2BF0 X;  4G25 A;  2YHC A;  5JJT A;  1NP7 A;  4HOU A;  4L23 A;  1WM5 A;  5CMW A;  5LOZ A;  4PH4 B;  3LVQ E;  5AJD A;  3ZRH A;  1E90 A;  2DBA A;  5LP0 A;  4D10 C;  2PL2 A;  1TEZ A;  2IQC A;  3AS4 A;  1E96 B;  2OND A;  3SHF A;  4JA9 A;  3SBT B;  2GRM A;  4Y6W A;  3Q4A B;  5KJK A;  4EPZ A;  4F1S A;  4UI9 J;  2LSU A;  4XKC A;  3R9A B;  3MKQ A;  3L13 A;  3FUM A;  4OVV A;  2OV8 A;  3B13 A;  2DIW A;  3Q5M A;  3MYV A;  3RJV A;  1HG5 A;  3CK9 A;  4FAD A;  3ZGQ A;  5BNW A;  2XQ0 A;  4GB9 A;  2VTB B;  4N2S A;  4U63 A;  2VGX A;  3N71 A;  4L2Y A;  3CHO A;  3MKR A;  4JEU A;  4J8S A;  2J09 A;  3I3N A;  4XX5 A;  4BSX A;  3OXF A;  4U8H A;  1PAQ A;  2ZU6 B;  2WXM A;  2OOE A;  3GZS A;  3PE4 A;  4DJA A;  2KZT A;  4WND A;  3PS6 A;  2AXV A;  3OXL A;  1JWF A;  4ATG A;  2L6J A;  2WXO A;  2XRY A;  4QFV A;  4LUN U;  3CLJ A;  4N5C A;  3FDH A;  4LCT A;  2XHE A;  2Y4U A;  1N52 A;  2FI7 A;  4GAA A;  5FQ6 A;  3UMV A;  3LY8 A;  3CKB A;  2M63 A;  4N39 A;  4C0M A;  4UI9 K;  3QAQ A;  4I6J A;  2L0T B;  5EDS A;  3MGB A;  4A1G A;  2VSN A;  1GW6 A;  3PDN A;  1QZ2 A;  2WXF A;  3VTX A;  2EQX A;  4HLE A;  4M3O A;  5HI7 A;  3PUK A;  1S0P A;  3RK6 A;  4ILG A;  2GGF A;  4BTB A;  1QNF A;  3L16 A;  5CMY A;  4PS8 A;  1ELW A;  1HH8 A;  2QY7 A;  2X6J A;  2FF4 A;  3Q49 B;  5E75 A;  4EQF A;  4CDM A;  3LKU A;  4RG9 A;  2ION A;  4EBA A;  4KMO A;  4KXK B;  3CHQ A;  3GW4 A;  4GMJ A;  3RKV A;  1VDY A;  3QDN A;  3CVN A;  3FU0 A;  4WWO A;  3SZ7 A;  2JLB A;  1Y6I A;  2VGY A;  1XGW A;  3B7R L;  3CGH A;  3OXG A;  4MS6 A;  5M72 A;  1DNP A;  5J90 A;  3FTV A;  3HVE A;  4AXH A;  2WM9 A;  3EIJ A;  4W9R A;  2V0P A;  4WWP A;  3IHY A;  1N54 A;  2IF4 A;  5A7D B;  3S7J A;  5BT1 A;  3I4R B;  4URK A;  3EDT B;  3FUL A;  3QKY A;  4RVB A;  1WAO 1;  3CK7 A;  2P58 C;  1OWL A;  3D9I A;  4KYO B;  5LFA A;  4GYO A;  4CDR A;  4ANX A;  5JHA A;  3VTY A;  2AWI A;  2X38 A;  2GRL A;  3B7U X;  2RD0 A;  3ZYM A;  2WXN A;  3KEZ A;  1EPU A;  3S7F A;  3TXM A;  2WXL A;  1ZBP A;  3R7Q A;  1UW4 B;  1HXI A;  2XCB A;  4I1O B;  3SGH A;  3JCK C;  3JYS A;  4UWG A;  3TG5 A;  3ENE A;  4RG6 A;  4DI3 A;  2OVF A;  5FZR A;  4GA2 A;  4KVM A;  5EX0 A;  1IQR A;  4OYS A;  2KM4 A;  4K03 A;  5DBK A;  3PRZ A;  3EHN A;  5AJL A;  4E85 A;  5C1D A;  3IV0 A;  1HFA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...