5LOZA

Structure of yeast ent1 enth domain
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
137
structure length
136
Chain Sequence
MGSSSTQVLVRNATSNDNHQVSKDSLIELAKSYDSADFFEIMDMLDKRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQIVRVKAKELTALLSDDERLNEERNMNIKGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epsin-1
publication title A bacterial genetic selection system for ubiquitylation cascade discovery.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ubiquitin-binding domain
total genus 56
structure length 136
sequence length 137
ec nomenclature
pdb deposition date 2016-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5lozA00
3D9NA 3D9PA 4HFGA 3G2TA 1JPLA 3CLJA 4NACA 3ZYQA 3D9MA 1JWFA 3RRUA 1UJJA 2L0IA 3G2UA 1DVPA 3G2WA 5CMYA 1HG2A 3ONLA 1HFAA 2KM4A 3G2SA 3ZYMA 3D9JA 1MHQA 1SZAA 4Q94A 1X5BA 4AVXA 5CMWA 1JUQA 5LOZA 1INZA 5LP0A 1VDYA 1UJKA 2QY7A 2L0TB 2V8SE 4FLBA 1ELKA 3D9LA 1EDUA 3D9KA 4JXTA 2LO6A 3LDZA 1JWGA 4GZCA 3ZYKA 1PY1A 2BF0X 1XGWA 3G2VA 4FU3A 1LF8A 3D9IA 4Q96A 1HF8A 1HX8A 1H0AA 2MOWA 5J08A 2DCPA 1HG5A 2DIWA 1EYHA 1SZ9A 3ZYLA 3D9OA 4GZDA 3ONKA
chains in the Genus database with same CATH superfamily
1MZCA 5AENA 5CMYA 3AAAC 3KSQA 3CQGB 2VQ2A 4HS2A 2OEWA 5LX8A 4GPMA 5CECB 5G2NA 5JMND 4KT6B 2HR2A 4WNGA 2KXPC 2MOWA 2AXUA 4FHJA 3CK9A 3EUVA 4FC8A 1QNFA 4HFGA 5AQ9A 3RRNB 4GYOA 3UM0A 3CV0A 1H6KA 4LNBA 1JCRA 2GRPB 4LERA 3RKVA 3T8KA 3N71A 1OT8A 3QARA 3CEQA 3HVEB 5BW8C 1IQRA 1BPOA 4JA7A 3KEAA 3AS4A 4RG6A 4FA6A 4YDYA 3JXJA 4KZCA 2F8XK 3AS8A 2A5EA 4A55A 1FT1A 1HG5A 4BEPA 3E4BA 4GZDA 2Q7FA 3FUKA 3MKQB 3DWLG 4W9RA 1QBQA 4N39A 4U07A 3RRMB 4J6IA 4JHJA 2LUHA 3CKCA 3RSEG 5CBOA 5KJNA 5BT1A 3CSFA 2IO3C 1RZ4A 4V3IA 2XEVA 1K1AA 1KPSB 4HBDA 5FINA 2FF4A 4AV7A 5FWQA 2XEHA 5KNGA 5A6CA 2CHZA 4XI9A 4MKTA 1L5JA 2LSUA 4G2VA 3BU8A 5CEDB 5E75A 4AVXA 4DJAA 2H6IA 5KWDA 3ZXSA 1LD7A 2WXNA 3UX4A 3EIJA 1V54E 4GZ6A 1UG3A 3R9AB 4I2WA 3CVLA 3T8MA 4PS8A 5D0QD 4CZ2D 1NP7A 4G1TA 3HXFA 4WNEA 1BI7B 2I1KA 4IN3B 3C5RA 4NIKA 4CDNA 4AY5A 5FZSA 4DX1A 3NB2A 2WVIA 3MV3B 4OVVA 3PUKA 3B7SA 2GRQB 5E76A 3L6AA 3UIPC 3UPVA 2GW1A 3FTUA 3TWVA 1EPUA 3DPYA 3QWWA 4ABNA 3OXGA 4C48B 4HXIA 4LCTA 3ZUVB 2FEZA 4G24A 3RU0A 3ZU7B 3R9MA 3NQPA 4IRUA 3NAWA 3FU0A 2WXFA 2X6FA 3K9IA 1JWGA 2NXPA 3ABKE 3HVEA 1NI1A 3FH7A 3HHMA 4I1OB 2BEDA 3Q78A 3ASFA 1EF1C 4HI9A 3QB2A 2JEKA 3G2TA 3ZN3A 3QJZA 3ESKA 3CVYA 5EYLA 4AIFA 2WQ7A 3UXGA 1NL4A 2VGXB 3MKQA 1O1RA 4LSZE 3L9TA 3OAWA 1BD8A 5CCMA 1TN7A 3R7QA 2XS1A 3U4TA 1TR4A 3FH8A 3KD7A 2GGFA 2GRLA 4ANXA 4WNFA 4XI0A 2C0MA 2WMNA 4TXQA 2X3MA 4HRNA 3Q7FA 3QDNA 3CVWA 5ENPD 3AG4E 4M7CA 2EINE 5AN8A 3D9JA 4U96D 3ASNE 2Y0BG 4BT9A 5ENRD 1Z5SC 4N2QA 3ZGQA 5HQ8A 1RW2A 2XRZA 4EZJA 3SO8A 1H2TC 2XS8A 4ATGA 4HOSA 4AXHA 2J07A 1OUVA 3JQ0A 3PE4A 1NA3A 1V55E 1GW6A 4PUCA 4HRMB 4HI8A 4OYSA 3FUJA 2AJAA 5C2YA 1SA4A 4GMJA 3E34A 2V4LA 3LCAA 3AS5A 4GTMA 5FQ8A 4NACA 1Z3XA 2IONA 2L0IA 4APFA 3ZYMA 1TEZA 4ATZD 2WQ6A 3GZ1A 1IXVA 3ASOE 3Q9NC 3EU9A 4ZFHA 4YNDA 4O60A 5ENQD 4HLEA 2IF4A 3JYSA 3Q73A 4U8YD 3B95A 4FULA 2VSOE 1D9SA 3EU5A 3L13A 5DBKA 1YCSB 4GA1A 2XZDG 4Y6CA 4ACKA 2Y4UA 3Q15A 2BTDA 2WXHA 5DIZA 5HRYA 3MJWA 3ONKA 2QYUA 3CLJA 3HG0D 4K5BA 3B7RL 2XZTG 3IHYA 4RLYA 5D66A 5KJMA 3FEYA 3FUNA 1PC2A 3C3OA 2VSXE 3PZ3A 3LY8A 1FT2A 4F1PA 1TNYA 3D9OA 5EN5D 3ML8A 2C2LA 2RFMA 4JHRA 2VGXA 4UQZA 2EIKE 3QAQA 3HXCA 3ZW3A 5HKPA 3TWWA 3TWUA 5CMWA 5CERB 3U64A 3EDTB 4G8KA 3D9KA 4CEMA 5FIOA 2IQCA 4L7TA 3EHQA 3PZ4A 2IFUA 4EZKA 3MZLB 3JUIA 4E85A 3RAUA 4G26A 1OWLA 4OAVB 2P9KG 3R7RA 3SBTB 2L0TB 3ABLE 3CIAA 1EDUA 3J5PA 1W3BA 2I1JA 2L6BA 5AAOA 5B3SE 3FTXA 4B94A 1HXIA 1WM5A 5EX0A 2J09A 3S7BA 2X38A 5IY5E 4U7EB 4UI9C 2V0PA 5ITZF 2KCVA 3VLEA 1VDYA 3FFLA 2V5FA 4I6JA 4N3BA 3APCA 4J0UA 5AIJA 3TL5A 2V4HC 4BETA 3B13A 4B93B 3Q75A 4TXPA 3TXNA 3TWXA 3EIQC 2X6KA 1Y8MA 3I4GA 2RFAA 1NA0A 3MV2B 3L17A 4HRLA 2QY7A 2UY1B 2UWJG 4I9CA 3W9GA 5FT9A 1ELRA 1KZOA 1S0PA 4UQXA 3RK6A 5T3RA 4RG9A 2AXVA 4RVBA 1MQSA 1MX2A 3E32A 4U8VD 2WXRA 2QYJA 4HNAD 5FZRA 1HFAA 3JXIA 4U0SA 4E6HA 5FJYA 4CT4A 3TWQA 1TN8A 4PS3A 4MLPA 4L23A 3IV0A 3VTYA 1JWFA 4GAAA 2DBAA 2XRYA 3BQOA 3LJ3A 4HLLA 1H2UA 1E8XA 3DSTA 1H19A 4R7LA 3TGOA 3SBSA 3APDA 2XCBA 1N52A 2KM4A 4LUNU 3ZRHA 2B6CA 2VSNA 1E8WA 3FULA 2OEVA 1DCQA 3ASDA 2AVPA 4QFVA 4XZ4A 1DC2A 3NZSA 3ZFWA 3FUHA 2PQRA 3I4RB 3UTMA 2I6HA 2WXIA 4A3VA 3PE3A 4GTRA 3LS8A 3RRUA 1G3NB 1SZAA 1WY6A 2V8SE 3FTZA 3QKYA 2ILRA 5CRVA 3IEGA 3C72A 4N3CA 3CR3A 4NURA 2WXMA 3DSWA 5ARFA 3ESLA 4BT8A 3FP3A 3S7DA 4DX2A 2E2EA 1QZ2A 3HXEA 1IKND 3VLFA 2L9BA 4GA2A 3MX3A 3O48A 4JZYA 4I9EA 3ML9A 3T9KA 1INZA 1E7UA 3JUEA 5T4YA 2X6HA 2B0OE 2EIME 1U2VG 3ZXPA 3ASHA 4BFRA 1OCOE 4BSZB 2UY1A 3UQ3A 1HS6A 2J4DA 1K8KG 3PEUB 1FVHA 2QC9A 3Q4AB 3PS6A 3EHNA 4AY6A 3W9FA 1E90A 5A7DB 2VTBA 4PH4B 3FTWA 2ZIRA 2FO1E 4H7XA 4A1GA 2WXQA 3AG1E 2ONDA 4U0UA 3CVQA 4LG6A 1ZB1A 2ZU6B 3CHPA 3MYVA 4EECA 2BUGA 5H7PA 3I5PA 4TUUA 4WWOA 3B7TA 4I1AA 1AP7A 2DIWA 3J5QB 3D9PA 2YQ8A 3SY2A 3HXBA 2GRMA 3V30A 3RIBA 4CYMD 4WUYA 3PZ1A 4XE0A 4GTSA 1A5EA 1OCCE 2XPYA 4DLQA 3MCXA 3CHQA 1SQMA 3NF1A 2Y3AA 3ZKJA 4HOUA 4DUIA 3SFZA 2DYSE 3APFA 3QWVA 4FLHA 5FQ4A 4N5CA 2AWIA 4N5QA 2I9CA 3O4ZA 1ELKA 2KCKA 3SZ7A 5G04J 5G04C 4AOFA 4Q96A 1YYHA 4CGVA 2LNIA 2EIJE 4BX9A 1JCQA 1N9AA 5KCMA 3DSVA 1N4RA 5AARA 4BX8A 1E8YA 4I17A 4GTPA 4GTTA 2QZAA 5J90A 1NZNA 1WAO1 4K03A 5T8IA 3PVLA 3L54A 4AEZC 4XX5A 1O1SA 1HU3A 1MX6A 1UW4B 4EPZA 1XNFA 3AU4A 2PM7A 4EBAA 4JB8P 4KZ0A 3FHEA 3LKUA 3FU5A 3SNXA 2NSZA 2GROB 1TNZA 1TJCA 3URZA 2M63A 4WWNA 2ETBA 4UWGA 2CHXA 2ZGGA 1TNOA 3V79K 2GRNB 3B7UX 3FU3A 3EJNA 2DCPA 3PZ2A 1OY3D 3ZYLA 3PRZA 4I6GA 3NBNB 1OWOA 3AU5A 3S7FA 1D8DA 3NZUA 3UINC 2LAIA 4TV3A 2Y4TA 4YVQC 5LP0A 5FQ6A 4YDEA 3Q9UC 4QQIA 3OTNA 3JCKC 2XENA 3TWRA 1Q2ZA 5G55A 2MYOA 2KCLA 5EDSA 4GMRA 3L82A 3SI5A 2P9SG 3EHMA 4UWKA 4I6EA 4CT0A 3CVVA 3TAXA 2LO6A 3ASGA 3LEWA 1BLXB 4JPSA 3ZPJA 4OAUC 4J8SA 4EHMA 3LYAA 2FULA 1WG0A 4BTAA 5G05J 3TJPA 2CFUA 3L16A 3NOGD 3CVUA 3X2QE 4DX6D 4O1OA 3FDHA 4B0ZA 3UUXA 4GA0A 4L9PA 4L2LA 4ME2A 3KSLA 2VJ8A 1HE8A 1HZ4A 4J8EA 4DRXE 4TXRA 4CDMA 3LY7A 3D9IA 2WXOA 3FU6A 3UKRG 5KBAA 3CVPA 2BKKB 3ULYA 2IU1A 2OV8A 4U0ZA 2JABA 3CKBA 2BF0X 1TJFA 4J7WA 3TG4A 5J08A 3RO2A 4APOA 2ZXWE 2HO1A 1N95A 3KEZA 2CHWA 4C0MA 4FADA 2DZNA 4LRZA 4F6RD 4Z68A 4BSXA 2BKGA 3Q7AA 2PL2A 4DX7D 1IYGA 4TUMA 2EQXA 2H6FA 4AM9A 3CQCB 2VGEA 2EILE 3I3NA 1OWPA 3TWSA 3RO3A 2XPZA 5CCLA 1HH8A 2CG3A 1PY1A 2ETAA 3QK0A 3IBEA 3FTYA 4KBQA 2LAHA 1ZBPA 2XEEA 1TYQG 1NFIE 4JL0A 2RG8A 5AQ7A 4U63A 4XKBA 3TXMA 4O1PA 3Q47B 5ANLA 2LXMA 3DEOA 2P9NG 2XHEA 4ILGA 3UM2A 2DYRE 2MRIA 4K5CA 2HM8A 5FQ7A 3SGHA 5JJ6A 5FTPA 2P9UG 1X81A 1X5BA 4LNUD 5LCWJ 4KMOA 3CVXA 1LTXA 4XKCA 1SVXA 2PZIA 4GTVA 3U9WA 2ETCA 2X6IA 3UMVA 4PDXA 2XPIA 1UJJA 3LPZA 1HG2A 2ZGDA 3ONLA 4HORA 2R5SA 3LY9A 3DSUA 3L08A 4DX5D 5JA4D 3GW4A 4CGWA 4FU3A 4LEUA 3SQVA 5JJ7A 3UT8A 2J4BA 4RSYA 1U3DA 2IY0C 3E30A 1MHQA 4F7AA 4FJZA 3IKOB 3DEPA 1N11A 2H6HA 2OCCE 3NOCD 4LNGA 2XGMA 1Y6IA 3LJNA 2YHEA 3BUAA 3DSXA 1UN9A 3HDXA 1K3ZD 4JEUA 4KYOB 3S7JA 1HO8A 4J8FA 3CHSA 4AP2A 3GYZA 4I1MA 1OXJA 3TG5A 4I43A 3T5XA 3WXXA 2R03A 2YINA 1KT1A 1TNBA 2VYIA 3FY4A 3SD5A 4XEIG 3C3QA 3L22A 3MGBA 3BG1B 1UOHA 1B89A 2IOSA 2VGYA 5BNWA 1TNUA 2WXJA 4ILHB 4J8YA 1IHBA 4KVOA 3LVQE 2OVBA 3G2UA 3ENEA 4MRUA 2DZOA 3UT7A 1N4SA 3C98A 4G11A 2RD0A 3G2VA 1MJ0A 3U66A 1SZ9A 3DXKG 3ZVVA 1A17A 3P1UA 3QNKA 3CVNA 5EIBE 3ZHEB 4A3TA 4JW1A 2F37A 4Q94A 4H7YA 1OCRE 1BI8B 1O5MA 3UI2A 2L6JA 1P5QA 3CGHA 4JC8A 3DBSA 2P9LG 2DWZA 4URKA 4GCOA 3F6QA 1KLXA 3CHOA 3ZIMA 5LOZA 3D9LA 3HRAA 5AYWD 2R2LA 3PNLB 4C9BB 4BESA 3FEXA 2Y69E 2KZTB 4F1SA 2J08A 5EYPF 2IO2C 5CEAA 4I2ZA 3LVRE 3OXLA 3E33A 4KXKB 1YMPA 4GZCA 4L1BA 5BUZA 3FUMA 1LF8A 3CHRA 4U95D 2IEJA 3UM3A 1E96B 2P9IG 4AJWA 5CBNA 2H6GA 2Y1LE 4FHKA 3S2AA 4ANUA 5FZQA 1FPPA 2XQ0A 2MHKA 4JA9A 4CRWA 4BERA 4B89A 3IXEA 4WAFA 2HE0A 1DVPA 2CFZA 5HS0A 4D10C 4TRQA 2C0LA 3V31A 3PEVB 3DSSA 5ANRA 1OWNA 2X6JA 4HQDA 3MEKA 5ARGA 3FUDA 1LD8A 2WXKA 4IULA 1E8ZA 4Q69A 4WNDA 2QFCA 5B1BE 1SW6A 4JVSA 4UWHA 5C1DA 4GTOA 5ENOD 5JHBA 3PREA 5CHEE 4OVUA 1S70B 2WXGA 1Z3YA 1HF8A 1MX4A 3E37A 4YDOA 4BTBA 4DLOA 2PQNA 3ABME 3PH0C 4NRHB 4K5AB 2WXPA 4GPKA 1KT0A 4EZLA 3G2SA 5JHAA 2AXZA 3AG3E 3HXDA 4U8HA 3ZHEA 4HB5A 2WPVA 4N3AA 3PZDA 4ANWA 4GB9A 4JD2G 4K0RA 3DPDA 2PNNA 1JPLA 1QYMA 3D3MA 3BEEA 3KS2A 2R05A 1N0QA 3ISMC 5BV0A 3VLDA 4DI3A 2OOEA 1IHGA 4GYYA 4GCNA 5AQBA 2FI7A 4BWRA 1QQEA 2XCCA 3BG0B 4HOQA 4UWFA 1H2VC 1D8EA 3GZSA 2XGSA 3KAEA 5BPPA 2KZTA 3LDZA 2DVWA 1DNPA 4MS6A 5ENTD 4L2YA 4GU5A 3HIZA 4B8CB 5M72A 4FP7A 3DRAA 2J9QA 3G2WA 5LFAA 1S64A 1SA5A 5BXOA 1KZPA 1JCSA 4HOTA 3MA5A 3FUIA 3C3RA 2P2CP 3Q5MA 5AJDA 3TWTA 2WB2A 1TN6A 1S63A 5BXUA 3FH5A 4ANVA 4ACLA 4GZ3A 2F8YA 2YNQA 2IJGX 4BY6A 3Q49B 5A23A 2WXLA 1WDYA 3CHMA 1IQUA 3ZYKA 2XGOA 2P58C 2RKKA 1N94A 5G05C 5B1AE 2FBNA 3RJVA 4JEHA 2VSYA 3QOUA 2YHCA 2J49A 3FWVA 3V2XA 4DI4A 4ILIA 4MBGA 4HVBA 1BU9A 4FLBA 4G8LA 3SF4A 1YA0A 2V5QC 5D0OD 3CK8A 5HI7A 2WM9A 5EILA 3UKUG 1H6PA 2A4ZA 4EQFA 2OVFA 5EKQD 2NC9A 3EHRA 3UT4A 3FTVA 5KJLA 3ULQA 3JQ1A 4P29A 2R02A 3B7BA 3ULEG 2J8SD 1U3CA 3FUFA 3D9NA 2FO7A 3V2OA 2JLBA 4GTQA 4IYPA 4A63B 3DXMG 3UIOC 5JJTA 4GZ5A 4JXTA 4CCAA 1FVFA 4G23A 2NYJA 4ZHBA 3QWPA 1OCZE 3ZYQA 4A1SA 1H6OA 3GZ2A 4O6FA 4J8DA 2A5UA 4RQIA 1JUQA 1ELWA 2ZISA 4WWPA 1UJKA 1UN8A 2CG2A 2PM6A 3HYMB 4JHKA 2KATA 4DK5A 1E7VA 1O1TA 4UUCA 4PS7A 1FCHA 1HX8A 4YDWA 3QC1A 4UI9K 2KBXA 3LXUX 3OXFA 3SFYA 4EBAG 1AWCB 3P2BA 3PUJA 4X8QA 4NQ0A 5AQAA 2WQHA 1XGWA 3CSTA 4GMLA 3SFXA 4B8AA 3SHFA 1N0RA 5CRUA 3UM1A 3AG2E 1EYHA 2P9PG 5BV1A 4UWLA 2KC7A 3MKRA 3CK7A 5EX3A 5KJKA 4UI9J 2IOLA 4M3OA 3AJIA 5ENSD 3IHVA 4FJYA 4YVOA 2LSVA 3PNTB 4C0EA 2AW6A 5KNHD 2WMOA 5LCWC 3FTSA 4Y6WA 2R17C 4F3VA 1MYOA 1H0AA 4G25A 3D9HA 5EIDA 3T5VA 5AJLA 3ZEFA 3D9MA 2HYZA 2GRRB 2R59A 1OWMA 1ZU2A 4XIFA 3WG7E 1K1BA 4KVMA 2I2OA 2F0YA 4GYWA 1N4PA 4U04A 3PDNA 1N4QA 2LXLA 3FUEA 4CDRA 5ENNA 3U3WA 3ZNGA 4N2SA 1Z6TA 4DPRA 2VTBB 5D2MC 1PAQA 4F53A 1DCEA 4UQYA 3VTXA 1N54A 2E0IA 3Q79A
chains in the Genus database with same CATH topology
3ML8A 2C2LA 3ZW3A 4JHRA 2VGXA 4UQZA 3QAQA 1E96B 4AJWA 5AENA 5CMYA 2M63A 4FHKA 4WWNA 3S2AA 5CMWA 3CQGB 2VQ2A 4HS2A 4ANUA 5FZQA 4UWGA 3U64A 3EDTB 5LX8A 2CHXA 2XQ0A 3D9KA 5G2NA 2MHKA 4JA9A 4KT6B 2HR2A 4CRWA 3B7UX 3FU3A 4WNGA 4CEMA 3SFZA 2IQCA 4L7TA 2MOWA 3EJNA 2DCPA 2AXUA 4B89A 4FHJA 3ZYLA 2IFUA 3CK9A 4EZKA 3PRZA 4I6GA 4FC8A 3MZLB 1OWOA 3AU5A 3JUIA 4WAFA 3S7FA 4E85A 1QNFA 4HFGA 4G26A 1DVPA 1OWLA 3NZUA 2LAIA 3RRNB 2CFZA 4TV3A 2Y4TA 4YVQC 3R7RA 4D10C 4GYOA 4TRQA 5LP0A 5FQ6A 3SBTB 2C0LA 2L0TB 3PEVB 3CIAA 3CV0A 3OTNA 1H6KA 1EDUA 3JCKC 5ANRA 1OWNA 1W3BA 2X6JA 2I1JA 3MEKA 5ARGA 3FTXA 4B94A 4LERA 1HXIA 3RKVA 1WM5A 3FUDA 3N71A 5EX0A 2J09A 3S7BA 3QARA 5G55A 3CEQA 2WXKA 4IULA 1E8ZA 4Q69A 2X38A 3HVEB 2QFCA 4WNDA 2KCLA 1IQRA 5BW8C 1BPOA 4JA7A 5EDSA 4UI9C 3AS4A 2V0PA 2KCVA 3VLEA 4RG6A 1VDYA 3FFLA 4JVSA 4UWHA 5C1DA 3SI5A 2V5FA 4FA6A 4I6JA 5JHBA 3EHMA 4UWKA 4I6EA 4CT0A 3CVVA 4N3BA 2LO6A 3APCA 3PREA 4J0UA 3ASGA 4KZCA 3LEWA 3AS8A 4JPSA 5CHEE 5AIJA 3TL5A 4OVUA 4A55A 3ZPJA 2WXGA 4J8SA 1Z3YA 2FULA 3LYAA 1HF8A 3B13A 4BTBA 1HG5A 5G05J 3TJPA 4BTAA 2CFUA 4DLOA 2PQNA 3L16A 3E4BA 3TXNA 4GZDA 3PH0C 2Q7FA 4NRHB 3EIQC 3FUKA 3MKQB 2WXPA 2X6KA 3CVUA 1Y8MA 1KT0A 4GPKA 3FDHA 3I4GA 4EZLA 4B0ZA 1NA0A 3MV2B 3UUXA 4W9RA 3G2SA 3L17A 4N39A 5JHAA 4GA0A 4L2LA 4ME2A 2AXZA 4U07A 3RRMB 2QY7A 2UY1B 4J6IA 2UWJG 2VJ8A 4JHJA 1HE8A 4I9CA 1HZ4A 3CKCA 4J8EA 4U8HA 5FT9A 3ZHEA 1ELRA 1S0PA 5KJNA 4UQXA 2WPVA 4N3AA 3RK6A 3PZDA 5BT1A 5T3RA 3CSFA 4CDMA 3LY7A 4V3IA 4RG9A 3D9IA 4ANWA 2AXVA 4GB9A 2XEVA 4RVBA 4K0RA 1MQSA 2WXOA 3DPDA 1JPLA 3FU6A 2WXRA 3CVPA 5FZRA 1HFAA 3D3MA 2IU1A 3BEEA 3KS2A 4U0SA 2OV8A 5BV0A 4E6HA 3VLDA 4DI3A 5FJYA 4U0ZA 2OOEA 2FF4A 1IHGA 3CKBA 4AV7A 4CT4A 2BF0X 4GYYA 1TJFA 5FWQA 3TG4A 5J08A 4PS3A 4GCNA 4MLPA 3RO2A 4APOA 2HO1A 3KEZA 4L23A 5A6CA 2CHWA 2CHZA 4XI9A 2FI7A 4C0MA 3IV0A 3VTYA 4MKTA 4FADA 1L5JA 2LSUA 1JWFA 4LRZA 4GAAA 1QQEA 4G2VA 4BWRA 2DBAA 4BSXA 2XCCA 2XRYA 5E75A 4AVXA 4DJAA 2PL2A 3BG0B 4HOQA 4UWFA 1H2VC 3GZSA 3LJ3A 1IYGA 2XGSA 3ZXSA 3KAEA 5BPPA 2KZTA 3LDZA 2WXNA 3UX4A 3EIJA 2EQXA 1H2UA 1DNPA 1E8XA 4MS6A 4L2YA 4GU5A 4GZ6A 1H19A 1UG3A 4R7LA 3HIZA 3TGOA 4B8CB 3SBSA 4AM9A 5M72A 3CQCB 4FP7A 3R9AB 4I2WA 3CVLA 2J9QA 3T8MA 3I3NA 3G2WA 5LFAA 3APDA 4PS8A 2XCBA 1N52A 2KM4A 5D0QD 4LUNU 3ZRHA 1NP7A 1OWPA 4G1TA 2VSNA 4WNEA 4HOTA 3MA5A 3RO3A 1E8WA 3FULA 2I1KA 2XPZA 5CCLA 1HH8A 2CG3A 2AVPA 3ASDA 4QFVA 3FUIA 4XZ4A 4IN3B 1PY1A 4CDNA 3NZSA 3ZFWA 4AY5A 5FZSA 3Q5MA 5AJDA 3FUHA 3QK0A 2WVIA 3IBEA 3FTYA 3MV3B 2LAHA 4KBQA 1ZBPA 4OVVA 3PUKA 2PQRA 3I4RB 2WB2A 3B7SA 4JL0A 5E76A 2RG8A 3L6AA 2I6HA 2WXIA 4A3VA 3PE3A 3UPVA 2GW1A 3LS8A 3FH5A 4U63A 3RRUA 3FTUA 4ANVA 4ACLA 4GZ3A 4XKBA 1EPUA 3TXMA 3Q47B 2YNQA 5ANLA 2IJGX 1SZAA 4BY6A 3Q49B 1WY6A 5A23A 3QWWA 2V8SE 4ABNA 2WXLA 3OXGA 2XHEA 3CHMA 3FTZA 3QKYA 4ILGA 1IQUA 3ZYKA 4HXIA 2ILRA 2XGOA 2P58C 3IEGA 2MRIA 4LCTA 2HM8A 5FQ7A 2FEZA 4G24A 4N3CA 5G05C 3CR3A 3TAXA 3RU0A 3SGHA 4NURA 2WXMA 2FBNA 5ARFA 3ESLA 4BT8A 5JJ6A 3RJVA 4JEHA 3NQPA 3FP3A 4IRUA 3S7DA 2VSYA 3QOUA 2YHCA 5FTPA 2J49A 1X5BA 3FWVA 3FU0A 4DI4A 4ILIA 2WXFA 4HVBA 4FLBA 5LCWJ 2E2EA 4KMOA 1QZ2A 2X6FA 3K9IA 1JWGA 2NXPA 3CVXA 3SF4A 1YA0A 3HVEA 5D0OD 3CK8A 3FH7A 5HI7A 3HHMA 2WM9A 4I1OB 4XKCA 2PZIA 3VLFA 2L9BA 3U9WA 4GA2A 3MX3A 2X6IA 3ASFA 3O48A 4JZYA 1EF1C 4I9EA 2A4ZA 3UMVA 4PDXA 3QB2A 2JEKA 3G2TA 2XPIA 3ZN3A 3QJZA 1UJJA 4EQFA 3LPZA 1HG2A 3ML9A 3ONLA 3ESKA 3CVYA 2OVFA 4HORA 5EKQD 4AIFA 1INZA 2R5SA 2NC9A 1E7UA 2WQ7A 5T4YA 3FTVA 3LY9A 3UT4A 5KJLA 2VGXB 2X6HA 3L08A 3MKQA 3ULQA 3JQ1A 4P29A 3GW4A 4CGWA 4FU3A 4LEUA 3OAWA 5JJ7A 3ASHA 4BFRA 3UT8A 2J4BA 2UY1A 4RSYA 5CCMA 1U3CA 3FUFA 3UQ3A 3R7QA 3D9NA 2FO7A 1HS6A 2J4DA 3U4TA 1U3DA 3PEUB 3FH8A 3KD7A 2JLBA 1FVHA 4IYPA 1MHQA 4F7AA 4FJZA 3IKOB 3Q4AB 5JJTA 2GGFA 3PS6A 3EHNA 2GRLA 4GZ5A 4ANXA 4JXTA 4WNFA 4XI0A 2C0MA 2WMNA 4AY6A 2XGMA 1Y6IA 1FVFA 2YHEA 4G23A 4CCAA 2X3MA 1E90A 5A7DB 2VTBA 4PH4B 3FTWA 3QDNA 1UN9A 3CVWA 3QWPA 4H7XA 4A1GA 3HDXA 4JEUA 2WXQA 4KYOB 3ZYQA 3S7JA 4A1SA 2ONDA 3GZ2A 4U0UA 4O6FA 1HO8A 3CVQA 4J8DA 4J8FA 3D9JA 3CHSA 2A5UA 4AP2A 3GYZA 1JUQA 1ELWA 4WWPA 2ZU6B 3CHPA 3MYVA 4I1MA 4I43A 1UJKA 1UN8A 2BUGA 2CG2A 2PM6A 3T5XA 3TG5A 3WXXA 2YINA 1KT1A 3HYMB 2VYIA 4JHKA 4BT9A 3I5PA 3FY4A 3SD5A 4N2QA 2KATA 4DK5A 3ZGQA 4TUUA 5HQ8A 1E7VA 3B7TA 4WWOA 4I1AA 4PS7A 3L22A 3MGBA 1FCHA 1HX8A 4EZJA 2XRZA 3BG1B 2DIWA 1B89A 1H2TC 2IOSA 3QC1A 4ATGA 4HOSA 4UI9K 2VGYA 4AXHA 3OXFA 2J07A 3LXUX 1OUVA 4EBAG 5BNWA 2WXJA 3JQ0A 4ILHB 3D9PA 4KVOA 2YQ8A 3PE4A 3LVQE 1NA3A 2OVBA 1GW6A 3P2BA 3G2UA 3ENEA 4MRUA 4PUCA 4OYSA 3FUJA 2GRMA 3UT7A 3RIBA 4WUYA 4XE0A 5C2YA 3PUJA 3C98A 4G11A 4GMJA 4NQ0A 2RD0A 2WQHA 1XGWA 3G2VA 2V4LA 3CSTA 3LCAA 4GMLA 4B8AA 3SHFA 2XPYA 4DLQA 3U66A 3MCXA 1EYHA 1SZ9A 3AS5A 3CHQA 1SQMA 3NF1A 3ZVVA 4UWLA 5BV1A 1A17A 2KC7A 2Y3AA 3MKRA 3CK7A 3P1UA 3QNKA 3CVNA 4HOUA 1Z3XA 4NACA 2IONA 5EX3A 5FQ8A 3ZHEB 4A3TA 5KJKA 4FLHA 3APFA 2L0IA 2IOLA 3QWVA 4JW1A 4UI9J 5FQ4A 4N5CA 4M3OA 4APFA 3ZYMA 2AWIA 1TEZA 4Q94A 3IHVA 4FJYA 2WQ6A 4H7YA 4YVOA 2LSVA 3GZ1A 3PNTB 2I9CA 3O4ZA 4C0EA 1ELKA 2AW6A 2WMOA 2KCKA 5LCWC 3FTSA 2L6JA 4Y6WA 2R17C 3SZ7A 1P5QA 3CGHA 4YNDA 4F3VA 5G04J 5G04C 4JC8A 4AOFA 4Q96A 1H0AA 4G25A 4CGVA 3DBSA 2LNIA 4HLEA 4BX9A 3T5VA 2IF4A 4EECA 5AJLA 4URKA 3ZEFA 3D9MA 3JYSA 4FULA 5KCMA 2VSOE 4GCOA 3L13A 2HYZA 1KLXA 5DBKA 3CHOA 3ZIMA 4GA1A 4Y6CA 5LOZA 4BX8A 1E8YA 2R59A 4I17A 4ACKA 3D9LA 1OWMA 1ZU2A 4XIFA 5AYWD 2Y4UA 3Q15A 5J90A 1NZNA 2BTDA 4KVMA 1WAO1 4K03A 2WXHA 5DIZA 2I2OA 3PNLB 4GYWA 5T8IA 3MJWA 3PVLA 4C9BB 4U04A 3ONKA 3PDNA 3L54A 3FEXA 4AEZC 2KZTB 4F1SA 2J08A 3FUEA 4XX5A 4CDRA 3CLJA 3B7RL 4I2ZA 1HU3A 3LVRE 5ENNA 3U3WA 4N2SA 3IHYA 1UW4B 1Z6TA 4DPRA 4EPZA 2VTBB 1XNFA 3OXLA 3AU4A 5KJMA 3FEYA 2PM7A 3FUNA 4KXKB 4KZ0A 4EBAA 1PAQA 1PC2A 3FHEA 3LKUA 4F53A 4UQYA 3VTXA 3FU5A 2VSXE 4GZCA 1N54A 4L1BA 5BUZA 3FUMA 3LY8A 3SNXA 2NSZA 1LF8A 2E0IA 3CHRA 1TJCA 3URZA 3D9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D9N A;  3D9P A;  4HFG A;  3G2T A;  1JPL A;  3CLJ A;  4NAC A;  3ZYQ A;  3D9M A;  1JWF A;  3RRU A;  1UJJ A;  2L0I A;  3G2U A;  1DVP A;  3G2W A;  5CMY A;  1HG2 A;  3ONL A;  1HFA A;  2KM4 A;  3G2S A;  3ZYM A;  3D9J A;  1MHQ A;  1SZA A;  4Q94 A;  1X5B A;  4AVX A;  5CMW A;  1JUQ A;  5LOZ A;  1INZ A;  5LP0 A;  1VDY A;  1UJK A;  2QY7 A;  2L0T B;  2V8S E;  4FLB A;  1ELK A;  3D9L A;  1EDU A;  3D9K A;  4JXT A;  2LO6 A;  3LDZ A;  1JWG A;  4GZC A;  3ZYK A;  1PY1 A;  2BF0 X;  1XGW A;  3G2V A;  4FU3 A;  1LF8 A;  3D9I A;  4Q96 A;  1HF8 A;  1HX8 A;  1H0A A;  2MOW A;  5J08 A;  2DCP A;  1HG5 A;  2DIW A;  1EYH A;  1SZ9 A;  3ZYL A;  3D9O A;  4GZD A;  3ONK A; 
#chains in the Genus database with same CATH topology
 1MZC A;  5AEN A;  5CMY A;  3AAA C;  3KSQ A;  3CQG B;  2VQ2 A;  4HS2 A;  2OEW A;  5LX8 A;  4GPM A;  5CEC B;  5G2N A;  5JMN D;  4KT6 B;  2HR2 A;  4WNG A;  2KXP C;  2MOW A;  2AXU A;  4FHJ A;  3CK9 A;  3EUV A;  4FC8 A;  1QNF A;  4HFG A;  5AQ9 A;  3RRN B;  4GYO A;  3UM0 A;  3CV0 A;  1H6K A;  4LNB A;  1JCR A;  2GRP B;  4LER A;  3RKV A;  3T8K A;  3N71 A;  1OT8 A;  3QAR A;  3CEQ A;  3HVE B;  5BW8 C;  1IQR A;  1BPO A;  4JA7 A;  3KEA A;  3AS4 A;  4RG6 A;  4FA6 A;  4YDY A;  3JXJ A;  4KZC A;  2F8X K;  3AS8 A;  2A5E A;  4A55 A;  1FT1 A;  1HG5 A;  4BEP A;  3E4B A;  4GZD A;  2Q7F A;  3FUK A;  3MKQ B;  3DWL G;  4W9R A;  1QBQ A;  4N39 A;  4U07 A;  3RRM B;  4J6I A;  4JHJ A;  2LUH A;  3CKC A;  3RSE G;  5CBO A;  5KJN A;  5BT1 A;  3CSF A;  2IO3 C;  1RZ4 A;  4V3I A;  2XEV A;  1K1A A;  1KPS B;  4HBD A;  5FIN A;  2FF4 A;  4AV7 A;  5FWQ A;  2XEH A;  5KNG A;  5A6C A;  2CHZ A;  4XI9 A;  4MKT A;  1L5J A;  2LSU A;  4G2V A;  3BU8 A;  5CED B;  5E75 A;  4AVX A;  4DJA A;  2H6I A;  5KWD A;  3ZXS A;  1LD7 A;  2WXN A;  3UX4 A;  3EIJ A;  1V54 E;  4GZ6 A;  1UG3 A;  3R9A B;  4I2W A;  3CVL A;  3T8M A;  4PS8 A;  5D0Q D;  4CZ2 D;  1NP7 A;  4G1T A;  3HXF A;  4WNE A;  1BI7 B;  2I1K A;  4IN3 B;  3C5R A;  4NIK A;  4CDN A;  4AY5 A;  5FZS A;  4DX1 A;  3NB2 A;  2WVI A;  3MV3 B;  4OVV A;  3PUK A;  3B7S A;  2GRQ B;  5E76 A;  3L6A A;  3UIP C;  3UPV A;  2GW1 A;  3FTU A;  3TWV A;  1EPU A;  3DPY A;  3QWW A;  4ABN A;  3OXG A;  4C48 B;  4HXI A;  4LCT A;  3ZUV B;  2FEZ A;  4G24 A;  3RU0 A;  3ZU7 B;  3R9M A;  3NQP A;  4IRU A;  3NAW A;  3FU0 A;  2WXF A;  2X6F A;  3K9I A;  1JWG A;  2NXP A;  3ABK E;  3HVE A;  1NI1 A;  3FH7 A;  3HHM A;  4I1O B;  2BED A;  3Q78 A;  3ASF A;  1EF1 C;  4HI9 A;  3QB2 A;  2JEK A;  3G2T A;  3ZN3 A;  3QJZ A;  3ESK A;  3CVY A;  5EYL A;  4AIF A;  2WQ7 A;  3UXG A;  1NL4 A;  2VGX B;  3MKQ A;  1O1R A;  4LSZ E;  3L9T A;  3OAW A;  1BD8 A;  5CCM A;  1TN7 A;  3R7Q A;  2XS1 A;  3U4T A;  1TR4 A;  3FH8 A;  3KD7 A;  2GGF A;  2GRL A;  4ANX A;  4WNF A;  4XI0 A;  2C0M A;  2WMN A;  4TXQ A;  2X3M A;  4HRN A;  3Q7F A;  3QDN A;  3CVW A;  5ENP D;  3AG4 E;  4M7C A;  2EIN E;  5AN8 A;  3D9J A;  4U96 D;  3ASN E;  2Y0B G;  4BT9 A;  5ENR D;  1Z5S C;  4N2Q A;  3ZGQ A;  5HQ8 A;  1RW2 A;  2XRZ A;  4EZJ A;  3SO8 A;  1H2T C;  2XS8 A;  4ATG A;  4HOS A;  4AXH A;  2J07 A;  1OUV A;  3JQ0 A;  3PE4 A;  1NA3 A;  1V55 E;  1GW6 A;  4PUC A;  4HRM B;  4HI8 A;  4OYS A;  3FUJ A;  2AJA A;  5C2Y A;  1SA4 A;  4GMJ A;  3E34 A;  2V4L A;  3LCA A;  3AS5 A;  4GTM A;  5FQ8 A;  4NAC A;  1Z3X A;  2ION A;  2L0I A;  4APF A;  3ZYM A;  1TEZ A;  4ATZ D;  2WQ6 A;  3GZ1 A;  1IXV A;  3ASO E;  3Q9N C;  3EU9 A;  4ZFH A;  4YND A;  4O60 A;  5ENQ D;  4HLE A;  2IF4 A;  3JYS A;  3Q73 A;  4U8Y D;  3B95 A;  4FUL A;  2VSO E;  1D9S A;  3EU5 A;  3L13 A;  5DBK A;  1YCS B;  4GA1 A;  2XZD G;  4Y6C A;  4ACK A;  2Y4U A;  3Q15 A;  2BTD A;  2WXH A;  5DIZ A;  5HRY A;  3MJW A;  3ONK A;  2QYU A;  3CLJ A;  3HG0 D;  4K5B A;  3B7R L;  2XZT G;  3IHY A;  4RLY A;  5D66 A;  5KJM A;  3FEY A;  3FUN A;  1PC2 A;  3C3O A;  2VSX E;  3PZ3 A;  3LY8 A;  1FT2 A;  4F1P A;  1TNY A;  3D9O A;  5EN5 D;  3ML8 A;  2C2L A;  2RFM A;  4JHR A;  2VGX A;  4UQZ A;  2EIK E;  3QAQ A;  3HXC A;  3ZW3 A;  5HKP A;  3TWW A;  3TWU A;  5CMW A;  5CER B;  3U64 A;  3EDT B;  4G8K A;  3D9K A;  4CEM A;  5FIO A;  2IQC A;  4L7T A;  3EHQ A;  3PZ4 A;  2IFU A;  4EZK A;  3MZL B;  3JUI A;  4E85 A;  3RAU A;  4G26 A;  1OWL A;  4OAV B;  2P9K G;  3R7R A;  3SBT B;  2L0T B;  3ABL E;  3CIA A;  1EDU A;  3J5P A;  1W3B A;  2I1J A;  2L6B A;  5AAO A;  5B3S E;  3FTX A;  4B94 A;  1HXI A;  1WM5 A;  5EX0 A;  2J09 A;  3S7B A;  2X38 A;  5IY5 E;  4U7E B;  4UI9 C;  2V0P A;  5ITZ F;  2KCV A;  3VLE A;  1VDY A;  3FFL A;  2V5F A;  4I6J A;  4N3B A;  3APC A;  4J0U A;  5AIJ A;  3TL5 A;  2V4H C;  4BET A;  3B13 A;  4B93 B;  3Q75 A;  4TXP A;  3TXN A;  3TWX A;  3EIQ C;  2X6K A;  1Y8M A;  3I4G A;  2RFA A;  1NA0 A;  3MV2 B;  3L17 A;  4HRL A;  2QY7 A;  2UY1 B;  2UWJ G;  4I9C A;  3W9G A;  5FT9 A;  1ELR A;  1KZO A;  1S0P A;  4UQX A;  3RK6 A;  5T3R A;  4RG9 A;  2AXV A;  4RVB A;  1MQS A;  1MX2 A;  3E32 A;  4U8V D;  2WXR A;  2QYJ A;  4HNA D;  5FZR A;  1HFA A;  3JXI A;  4U0S A;  4E6H A;  5FJY A;  4CT4 A;  3TWQ A;  1TN8 A;  4PS3 A;  4MLP A;  4L23 A;  3IV0 A;  3VTY A;  1JWF A;  4GAA A;  2DBA A;  2XRY A;  3BQO A;  3LJ3 A;  4HLL A;  1H2U A;  1E8X A;  3DST A;  1H19 A;  4R7L A;  3TGO A;  3SBS A;  3APD A;  2XCB A;  1N52 A;  2KM4 A;  4LUN U;  3ZRH A;  2B6C A;  2VSN A;  1E8W A;  3FUL A;  2OEV A;  1DCQ A;  3ASD A;  2AVP A;  4QFV A;  4XZ4 A;  1DC2 A;  3NZS A;  3ZFW A;  3FUH A;  2PQR A;  3I4R B;  3UTM A;  2I6H A;  2WXI A;  4A3V A;  3PE3 A;  4GTR A;  3LS8 A;  3RRU A;  1G3N B;  1SZA A;  1WY6 A;  2V8S E;  3FTZ A;  3QKY A;  2ILR A;  5CRV A;  3IEG A;  3C72 A;  4N3C A;  3CR3 A;  4NUR A;  2WXM A;  3DSW A;  5ARF A;  3ESL A;  4BT8 A;  3FP3 A;  3S7D A;  4DX2 A;  2E2E A;  1QZ2 A;  3HXE A;  1IKN D;  3VLF A;  2L9B A;  4GA2 A;  3MX3 A;  3O48 A;  4JZY A;  4I9E A;  3ML9 A;  3T9K A;  1INZ A;  1E7U A;  3JUE A;  5T4Y A;  2X6H A;  2B0O E;  2EIM E;  1U2V G;  3ZXP A;  3ASH A;  4BFR A;  1OCO E;  4BSZ B;  2UY1 A;  3UQ3 A;  1HS6 A;  2J4D A;  1K8K G;  3PEU B;  1FVH A;  2QC9 A;  3Q4A B;  3PS6 A;  3EHN A;  4AY6 A;  3W9F A;  1E90 A;  5A7D B;  2VTB A;  4PH4 B;  3FTW A;  2ZIR A;  2FO1 E;  4H7X A;  4A1G A;  2WXQ A;  3AG1 E;  2OND A;  4U0U A;  3CVQ A;  4LG6 A;  1ZB1 A;  2ZU6 B;  3CHP A;  3MYV A;  4EEC A;  2BUG A;  5H7P A;  3I5P A;  4TUU A;  4WWO A;  3B7T A;  4I1A A;  1AP7 A;  2DIW A;  3J5Q B;  3D9P A;  2YQ8 A;  3SY2 A;  3HXB A;  2GRM A;  3V30 A;  3RIB A;  4CYM D;  4WUY A;  3PZ1 A;  4XE0 A;  4GTS A;  1A5E A;  1OCC E;  2XPY A;  4DLQ A;  3MCX A;  3CHQ A;  1SQM A;  3NF1 A;  2Y3A A;  3ZKJ A;  4HOU A;  4DUI A;  3SFZ A;  2DYS E;  3APF A;  3QWV A;  4FLH A;  5FQ4 A;  4N5C A;  2AWI A;  4N5Q A;  2I9C A;  3O4Z A;  1ELK A;  2KCK A;  3SZ7 A;  5G04 J;  5G04 C;  4AOF A;  4Q96 A;  1YYH A;  4CGV A;  2LNI A;  2EIJ E;  4BX9 A;  1JCQ A;  1N9A A;  5KCM A;  3DSV A;  1N4R A;  5AAR A;  4BX8 A;  1E8Y A;  4I17 A;  4GTP A;  4GTT A;  2QZA A;  5J90 A;  1NZN A;  1WAO 1;  4K03 A;  5T8I A;  3PVL A;  3L54 A;  4AEZ C;  4XX5 A;  1O1S A;  1HU3 A;  1MX6 A;  1UW4 B;  4EPZ A;  1XNF A;  3AU4 A;  2PM7 A;  4EBA A;  4JB8 P;  4KZ0 A;  3FHE A;  3LKU A;  3FU5 A;  3SNX A;  2NSZ A;  2GRO B;  1TNZ A;  1TJC A;  3URZ A;  2M63 A;  4WWN A;  2ETB A;  4UWG A;  2CHX A;  2ZGG A;  1TNO A;  3V79 K;  2GRN B;  3B7U X;  3FU3 A;  3EJN A;  2DCP A;  3PZ2 A;  1OY3 D;  3ZYL A;  3PRZ A;  4I6G A;  3NBN B;  1OWO A;  3AU5 A;  3S7F A;  1D8D A;  3NZU A;  3UIN C;  2LAI A;  4TV3 A;  2Y4T A;  4YVQ C;  5LP0 A;  5FQ6 A;  4YDE A;  3Q9U C;  4QQI A;  3OTN A;  3JCK C;  2XEN A;  3TWR A;  1Q2Z A;  5G55 A;  2MYO A;  2KCL A;  5EDS A;  4GMR A;  3L82 A;  3SI5 A;  2P9S G;  3EHM A;  4UWK A;  4I6E A;  4CT0 A;  3CVV A;  3TAX A;  2LO6 A;  3ASG A;  3LEW A;  1BLX B;  4JPS A;  3ZPJ A;  4OAU C;  4J8S A;  4EHM A;  3LYA A;  2FUL A;  1WG0 A;  4BTA A;  5G05 J;  3TJP A;  2CFU A;  3L16 A;  3NOG D;  3CVU A;  3X2Q E;  4DX6 D;  4O1O A;  3FDH A;  4B0Z A;  3UUX A;  4GA0 A;  4L9P A;  4L2L A;  4ME2 A;  3KSL A;  2VJ8 A;  1HE8 A;  1HZ4 A;  4J8E A;  4DRX E;  4TXR A;  4CDM A;  3LY7 A;  3D9I A;  2WXO A;  3FU6 A;  3UKR G;  5KBA A;  3CVP A;  2BKK B;  3ULY A;  2IU1 A;  2OV8 A;  4U0Z A;  2JAB A;  3CKB A;  2BF0 X;  1TJF A;  4J7W A;  3TG4 A;  5J08 A;  3RO2 A;  4APO A;  2ZXW E;  2HO1 A;  1N95 A;  3KEZ A;  2CHW A;  4C0M A;  4FAD A;  2DZN A;  4LRZ A;  4F6R D;  4Z68 A;  4BSX A;  2BKG A;  3Q7A A;  2PL2 A;  4DX7 D;  1IYG A;  4TUM A;  2EQX A;  2H6F A;  4AM9 A;  3CQC B;  2VGE A;  2EIL E;  3I3N A;  1OWP A;  3TWS A;  3RO3 A;  2XPZ A;  5CCL A;  1HH8 A;  2CG3 A;  1PY1 A;  2ETA A;  3QK0 A;  3IBE A;  3FTY A;  4KBQ A;  2LAH A;  1ZBP A;  2XEE A;  1TYQ G;  1NFI E;  4JL0 A;  2RG8 A;  5AQ7 A;  4U63 A;  4XKB A;  3TXM A;  4O1P A;  3Q47 B;  5ANL A;  2LXM A;  3DEO A;  2P9N G;  2XHE A;  4ILG A;  3UM2 A;  2DYR E;  2MRI A;  4K5C A;  2HM8 A;  5FQ7 A;  3SGH A;  5JJ6 A;  5FTP A;  2P9U G;  1X81 A;  1X5B A;  4LNU D;  5LCW J;  4KMO A;  3CVX A;  1LTX A;  4XKC A;  1SVX A;  2PZI A;  4GTV A;  3U9W A;  2ETC A;  2X6I A;  3UMV A;  4PDX A;  2XPI A;  1UJJ A;  3LPZ A;  1HG2 A;  2ZGD A;  3ONL A;  4HOR A;  2R5S A;  3LY9 A;  3DSU A;  3L08 A;  4DX5 D;  5JA4 D;  3GW4 A;  4CGW A;  4FU3 A;  4LEU A;  3SQV A;  5JJ7 A;  3UT8 A;  2J4B A;  4RSY A;  1U3D A;  2IY0 C;  3E30 A;  1MHQ A;  4F7A A;  4FJZ A;  3IKO B;  3DEP A;  1N11 A;  2H6H A;  2OCC E;  3NOC D;  4LNG A;  2XGM A;  1Y6I A;  3LJN A;  2YHE A;  3BUA A;  3DSX A;  1UN9 A;  3HDX A;  1K3Z D;  4JEU A;  4KYO B;  3S7J A;  1HO8 A;  4J8F A;  3CHS A;  4AP2 A;  3GYZ A;  4I1M A;  1OXJ A;  3TG5 A;  4I43 A;  3T5X A;  3WXX A;  2R03 A;  2YIN A;  1KT1 A;  1TNB A;  2VYI A;  3FY4 A;  3SD5 A;  4XEI G;  3C3Q A;  3L22 A;  3MGB A;  3BG1 B;  1UOH A;  1B89 A;  2IOS A;  2VGY A;  5BNW A;  1TNU A;  2WXJ A;  4ILH B;  4J8Y A;  1IHB A;  4KVO A;  3LVQ E;  2OVB A;  3G2U A;  3ENE A;  4MRU A;  2DZO A;  3UT7 A;  1N4S A;  3C98 A;  4G11 A;  2RD0 A;  3G2V A;  1MJ0 A;  3U66 A;  1SZ9 A;  3DXK G;  3ZVV A;  1A17 A;  3P1U A;  3QNK A;  3CVN A;  5EIB E;  3ZHE B;  4A3T A;  4JW1 A;  2F37 A;  4Q94 A;  4H7Y A;  1OCR E;  1BI8 B;  1O5M A;  3UI2 A;  2L6J A;  1P5Q A;  3CGH A;  4JC8 A;  3DBS A;  2P9L G;  2DWZ A;  4URK A;  4GCO A;  3F6Q A;  1KLX A;  3CHO A;  3ZIM A;  5LOZ A;  3D9L A;  3HRA A;  5AYW D;  2R2L A;  3PNL B;  4C9B B;  4BES A;  3FEX A;  2Y69 E;  2KZT B;  4F1S A;  2J08 A;  5EYP F;  2IO2 C;  5CEA A;  4I2Z A;  3LVR E;  3OXL A;  3E33 A;  4KXK B;  1YMP A;  4GZC A;  4L1B A;  5BUZ A;  3FUM A;  1LF8 A;  3CHR A;  4U95 D;  2IEJ A;  3UM3 A;  1E96 B;  2P9I G;  4AJW A;  5CBN A;  2H6G A;  2Y1L E;  4FHK A;  3S2A A;  4ANU A;  5FZQ A;  1FPP A;  2XQ0 A;  2MHK A;  4JA9 A;  4CRW A;  4BER A;  4B89 A;  3IXE A;  4WAF A;  2HE0 A;  1DVP A;  2CFZ A;  5HS0 A;  4D10 C;  4TRQ A;  2C0L A;  3V31 A;  3PEV B;  3DSS A;  5ANR A;  1OWN A;  2X6J A;  4HQD A;  3MEK A;  5ARG A;  3FUD A;  1LD8 A;  2WXK A;  4IUL A;  1E8Z A;  4Q69 A;  4WND A;  2QFC A;  5B1B E;  1SW6 A;  4JVS A;  4UWH A;  5C1D A;  4GTO A;  5ENO D;  5JHB A;  3PRE A;  5CHE E;  4OVU A;  1S70 B;  2WXG A;  1Z3Y A;  1HF8 A;  1MX4 A;  3E37 A;  4YDO A;  4BTB A;  4DLO A;  2PQN A;  3ABM E;  3PH0 C;  4NRH B;  4K5A B;  2WXP A;  4GPK A;  1KT0 A;  4EZL A;  3G2S A;  5JHA A;  2AXZ A;  3AG3 E;  3HXD A;  4U8H A;  3ZHE A;  4HB5 A;  2WPV A;  4N3A A;  3PZD A;  4ANW A;  4GB9 A;  4JD2 G;  4K0R A;  3DPD A;  2PNN A;  1JPL A;  1QYM A;  3D3M A;  3BEE A;  3KS2 A;  2R05 A;  1N0Q A;  3ISM C;  5BV0 A;  3VLD A;  4DI3 A;  2OOE A;  1IHG A;  4GYY A;  4GCN A;  5AQB A;  2FI7 A;  4BWR A;  1QQE A;  2XCC A;  3BG0 B;  4HOQ A;  4UWF A;  1H2V C;  1D8E A;  3GZS A;  2XGS A;  3KAE A;  5BPP A;  2KZT A;  3LDZ A;  2DVW A;  1DNP A;  4MS6 A;  5ENT D;  4L2Y A;  4GU5 A;  3HIZ A;  4B8C B;  5M72 A;  4FP7 A;  3DRA A;  2J9Q A;  3G2W A;  5LFA A;  1S64 A;  1SA5 A;  5BXO A;  1KZP A;  1JCS A;  4HOT A;  3MA5 A;  3FUI A;  3C3R A;  2P2C P;  3Q5M A;  5AJD A;  3TWT A;  2WB2 A;  1TN6 A;  1S63 A;  5BXU A;  3FH5 A;  4ANV A;  4ACL A;  4GZ3 A;  2F8Y A;  2YNQ A;  2IJG X;  4BY6 A;  3Q49 B;  5A23 A;  2WXL A;  1WDY A;  3CHM A;  1IQU A;  3ZYK A;  2XGO A;  2P58 C;  2RKK A;  1N94 A;  5G05 C;  5B1A E;  2FBN A;  3RJV A;  4JEH A;  2VSY A;  3QOU A;  2YHC A;  2J49 A;  3FWV A;  3V2X A;  4DI4 A;  4ILI A;  4MBG A;  4HVB A;  1BU9 A;  4FLB A;  4G8L A;  3SF4 A;  1YA0 A;  2V5Q C;  5D0O D;  3CK8 A;  5HI7 A;  2WM9 A;  5EIL A;  3UKU G;  1H6P A;  2A4Z A;  4EQF A;  2OVF A;  5EKQ D;  2NC9 A;  3EHR A;  3UT4 A;  3FTV A;  5KJL A;  3ULQ A;  3JQ1 A;  4P29 A;  2R02 A;  3B7B A;  3ULE G;  2J8S D;  1U3C A;  3FUF A;  3D9N A;  2FO7 A;  3V2O A;  2JLB A;  4GTQ A;  4IYP A;  4A63 B;  3DXM G;  3UIO C;  5JJT A;  4GZ5 A;  4JXT A;  4CCA A;  1FVF A;  4G23 A;  2NYJ A;  4ZHB A;  3QWP A;  1OCZ E;  3ZYQ A;  4A1S A;  1H6O A;  3GZ2 A;  4O6F A;  4J8D A;  2A5U A;  4RQI A;  1JUQ A;  1ELW A;  2ZIS A;  4WWP A;  1UJK A;  1UN8 A;  2CG2 A;  2PM6 A;  3HYM B;  4JHK A;  2KAT A;  4DK5 A;  1E7V A;  1O1T A;  4UUC A;  4PS7 A;  1FCH A;  1HX8 A;  4YDW A;  3QC1 A;  4UI9 K;  2KBX A;  3LXU X;  3OXF A;  3SFY A;  4EBA G;  1AWC B;  3P2B A;  3PUJ A;  4X8Q A;  4NQ0 A;  5AQA A;  2WQH A;  1XGW A;  3CST A;  4GML A;  3SFX A;  4B8A A;  3SHF A;  1N0R A;  5CRU A;  3UM1 A;  3AG2 E;  1EYH A;  2P9P G;  5BV1 A;  4UWL A;  2KC7 A;  3MKR A;  3CK7 A;  5EX3 A;  5KJK A;  4UI9 J;  2IOL A;  4M3O A;  3AJI A;  5ENS D;  3IHV A;  4FJY A;  4YVO A;  2LSV A;  3PNT B;  4C0E A;  2AW6 A;  5KNH D;  2WMO A;  5LCW C;  3FTS A;  4Y6W A;  2R17 C;  4F3V A;  1MYO A;  1H0A A;  4G25 A;  3D9H A;  5EID A;  3T5V A;  5AJL A;  3ZEF A;  3D9M A;  2HYZ A;  2GRR B;  2R59 A;  1OWM A;  1ZU2 A;  4XIF A;  3WG7 E;  1K1B A;  4KVM A;  2I2O A;  2F0Y A;  4GYW A;  1N4P A;  4U04 A;  3PDN A;  1N4Q A;  2LXL A;  3FUE A;  4CDR A;  5ENN A;  3U3W A;  3ZNG A;  4N2S A;  1Z6T A;  4DPR A;  2VTB B;  5D2M C;  1PAQ A;  4F53 A;  1DCE A;  4UQY A;  3VTX A;  1N54 A;  2E0I A;  3Q79 A; 
#chains in the Genus database with same CATH homology
 3ML8 A;  2C2L A;  3ZW3 A;  4JHR A;  2VGX A;  4UQZ A;  3QAQ A;  1E96 B;  4AJW A;  5AEN A;  5CMY A;  2M63 A;  4FHK A;  4WWN A;  3S2A A;  5CMW A;  3CQG B;  2VQ2 A;  4HS2 A;  4ANU A;  5FZQ A;  4UWG A;  3U64 A;  3EDT B;  5LX8 A;  2CHX A;  2XQ0 A;  3D9K A;  5G2N A;  2MHK A;  4JA9 A;  4KT6 B;  2HR2 A;  4CRW A;  3B7U X;  3FU3 A;  4WNG A;  4CEM A;  3SFZ A;  2IQC A;  4L7T A;  2MOW A;  3EJN A;  2DCP A;  2AXU A;  4B89 A;  4FHJ A;  3ZYL A;  2IFU A;  3CK9 A;  4EZK A;  3PRZ A;  4I6G A;  4FC8 A;  3MZL B;  1OWO A;  3AU5 A;  3JUI A;  4WAF A;  3S7F A;  4E85 A;  1QNF A;  4HFG A;  4G26 A;  1DVP A;  1OWL A;  3NZU A;  2LAI A;  3RRN B;  2CFZ A;  4TV3 A;  2Y4T A;  4YVQ C;  3R7R A;  4D10 C;  4GYO A;  4TRQ A;  5LP0 A;  5FQ6 A;  3SBT B;  2C0L A;  2L0T B;  3PEV B;  3CIA A;  3CV0 A;  3OTN A;  1H6K A;  1EDU A;  3JCK C;  5ANR A;  1OWN A;  1W3B A;  2X6J A;  2I1J A;  3MEK A;  5ARG A;  3FTX A;  4B94 A;  4LER A;  1HXI A;  3RKV A;  1WM5 A;  3FUD A;  3N71 A;  5EX0 A;  2J09 A;  3S7B A;  3QAR A;  5G55 A;  3CEQ A;  2WXK A;  4IUL A;  1E8Z A;  4Q69 A;  2X38 A;  3HVE B;  2QFC A;  4WND A;  2KCL A;  1IQR A;  5BW8 C;  1BPO A;  4JA7 A;  5EDS A;  4UI9 C;  3AS4 A;  2V0P A;  2KCV A;  3VLE A;  4RG6 A;  1VDY A;  3FFL A;  4JVS A;  4UWH A;  5C1D A;  3SI5 A;  2V5F A;  4FA6 A;  4I6J A;  5JHB A;  3EHM A;  4UWK A;  4I6E A;  4CT0 A;  3CVV A;  4N3B A;  2LO6 A;  3APC A;  3PRE A;  4J0U A;  3ASG A;  4KZC A;  3LEW A;  3AS8 A;  4JPS A;  5CHE E;  5AIJ A;  3TL5 A;  4OVU A;  4A55 A;  3ZPJ A;  2WXG A;  4J8S A;  1Z3Y A;  2FUL A;  3LYA A;  1HF8 A;  3B13 A;  4BTB A;  1HG5 A;  5G05 J;  3TJP A;  4BTA A;  2CFU A;  4DLO A;  2PQN A;  3L16 A;  3E4B A;  3TXN A;  4GZD A;  3PH0 C;  2Q7F A;  4NRH B;  3EIQ C;  3FUK A;  3MKQ B;  2WXP A;  2X6K A;  3CVU A;  1Y8M A;  1KT0 A;  4GPK A;  3FDH A;  3I4G A;  4EZL A;  4B0Z A;  1NA0 A;  3MV2 B;  3UUX A;  4W9R A;  3G2S A;  3L17 A;  4N39 A;  5JHA A;  4GA0 A;  4L2L A;  4ME2 A;  2AXZ A;  4U07 A;  3RRM B;  2QY7 A;  2UY1 B;  4J6I A;  2UWJ G;  2VJ8 A;  4JHJ A;  1HE8 A;  4I9C A;  1HZ4 A;  3CKC A;  4J8E A;  4U8H A;  5FT9 A;  3ZHE A;  1ELR A;  1S0P A;  5KJN A;  4UQX A;  2WPV A;  4N3A A;  3RK6 A;  3PZD A;  5BT1 A;  5T3R A;  3CSF A;  4CDM A;  3LY7 A;  4V3I A;  4RG9 A;  3D9I A;  4ANW A;  2AXV A;  4GB9 A;  2XEV A;  4RVB A;  4K0R A;  1MQS A;  2WXO A;  3DPD A;  1JPL A;  3FU6 A;  2WXR A;  3CVP A;  5FZR A;  1HFA A;  3D3M A;  2IU1 A;  3BEE A;  3KS2 A;  4U0S A;  2OV8 A;  5BV0 A;  4E6H A;  3VLD A;  4DI3 A;  5FJY A;  4U0Z A;  2OOE A;  2FF4 A;  1IHG A;  3CKB A;  4AV7 A;  4CT4 A;  2BF0 X;  4GYY A;  1TJF A;  5FWQ A;  3TG4 A;  5J08 A;  4PS3 A;  4GCN A;  4MLP A;  3RO2 A;  4APO A;  2HO1 A;  3KEZ A;  4L23 A;  5A6C A;  2CHW A;  2CHZ A;  4XI9 A;  2FI7 A;  4C0M A;  3IV0 A;  3VTY A;  4MKT A;  4FAD A;  1L5J A;  2LSU A;  1JWF A;  4LRZ A;  4GAA A;  1QQE A;  4G2V A;  4BWR A;  2DBA A;  4BSX A;  2XCC A;  2XRY A;  5E75 A;  4AVX A;  4DJA A;  2PL2 A;  3BG0 B;  4HOQ A;  4UWF A;  1H2V C;  3GZS A;  3LJ3 A;  1IYG A;  2XGS A;  3ZXS A;  3KAE A;  5BPP A;  2KZT A;  3LDZ A;  2WXN A;  3UX4 A;  3EIJ A;  2EQX A;  1H2U A;  1DNP A;  1E8X A;  4MS6 A;  4L2Y A;  4GU5 A;  4GZ6 A;  1H19 A;  1UG3 A;  4R7L A;  3HIZ A;  3TGO A;  4B8C B;  3SBS A;  4AM9 A;  5M72 A;  3CQC B;  4FP7 A;  3R9A B;  4I2W A;  3CVL A;  2J9Q A;  3T8M A;  3I3N A;  3G2W A;  5LFA A;  3APD A;  4PS8 A;  2XCB A;  1N52 A;  2KM4 A;  5D0Q D;  4LUN U;  3ZRH A;  1NP7 A;  1OWP A;  4G1T A;  2VSN A;  4WNE A;  4HOT A;  3MA5 A;  3RO3 A;  1E8W A;  3FUL A;  2I1K A;  2XPZ A;  5CCL A;  1HH8 A;  2CG3 A;  2AVP A;  3ASD A;  4QFV A;  3FUI A;  4XZ4 A;  4IN3 B;  1PY1 A;  4CDN A;  3NZS A;  3ZFW A;  4AY5 A;  5FZS A;  3Q5M A;  5AJD A;  3FUH A;  3QK0 A;  2WVI A;  3IBE A;  3FTY A;  3MV3 B;  2LAH A;  4KBQ A;  1ZBP A;  4OVV A;  3PUK A;  2PQR A;  3I4R B;  2WB2 A;  3B7S A;  4JL0 A;  5E76 A;  2RG8 A;  3L6A A;  2I6H A;  2WXI A;  4A3V A;  3PE3 A;  3UPV A;  2GW1 A;  3LS8 A;  3FH5 A;  4U63 A;  3RRU A;  3FTU A;  4ANV A;  4ACL A;  4GZ3 A;  4XKB A;  1EPU A;  3TXM A;  3Q47 B;  2YNQ A;  5ANL A;  2IJG X;  1SZA A;  4BY6 A;  3Q49 B;  1WY6 A;  5A23 A;  3QWW A;  2V8S E;  4ABN A;  2WXL A;  3OXG A;  2XHE A;  3CHM A;  3FTZ A;  3QKY A;  4ILG A;  1IQU A;  3ZYK A;  4HXI A;  2ILR A;  2XGO A;  2P58 C;  3IEG A;  2MRI A;  4LCT A;  2HM8 A;  5FQ7 A;  2FEZ A;  4G24 A;  4N3C A;  5G05 C;  3CR3 A;  3TAX A;  3RU0 A;  3SGH A;  4NUR A;  2WXM A;  2FBN A;  5ARF A;  3ESL A;  4BT8 A;  5JJ6 A;  3RJV A;  4JEH A;  3NQP A;  3FP3 A;  4IRU A;  3S7D A;  2VSY A;  3QOU A;  2YHC A;  5FTP A;  2J49 A;  1X5B A;  3FWV A;  3FU0 A;  4DI4 A;  4ILI A;  2WXF A;  4HVB A;  4FLB A;  5LCW J;  2E2E A;  4KMO A;  1QZ2 A;  2X6F A;  3K9I A;  1JWG A;  2NXP A;  3CVX A;  3SF4 A;  1YA0 A;  3HVE A;  5D0O D;  3CK8 A;  3FH7 A;  5HI7 A;  3HHM A;  2WM9 A;  4I1O B;  4XKC A;  2PZI A;  3VLF A;  2L9B A;  3U9W A;  4GA2 A;  3MX3 A;  2X6I A;  3ASF A;  3O48 A;  4JZY A;  1EF1 C;  4I9E A;  2A4Z A;  3UMV A;  4PDX A;  3QB2 A;  2JEK A;  3G2T A;  2XPI A;  3ZN3 A;  3QJZ A;  1UJJ A;  4EQF A;  3LPZ A;  1HG2 A;  3ML9 A;  3ONL A;  3ESK A;  3CVY A;  2OVF A;  4HOR A;  5EKQ D;  4AIF A;  1INZ A;  2R5S A;  2NC9 A;  1E7U A;  2WQ7 A;  5T4Y A;  3FTV A;  3LY9 A;  3UT4 A;  5KJL A;  2VGX B;  2X6H A;  3L08 A;  3MKQ A;  3ULQ A;  3JQ1 A;  4P29 A;  3GW4 A;  4CGW A;  4FU3 A;  4LEU A;  3OAW A;  5JJ7 A;  3ASH A;  4BFR A;  3UT8 A;  2J4B A;  2UY1 A;  4RSY A;  5CCM A;  1U3C A;  3FUF A;  3UQ3 A;  3R7Q A;  3D9N A;  2FO7 A;  1HS6 A;  2J4D A;  3U4T A;  1U3D A;  3PEU B;  3FH8 A;  3KD7 A;  2JLB A;  1FVH A;  4IYP A;  1MHQ A;  4F7A A;  4FJZ A;  3IKO B;  3Q4A B;  5JJT A;  2GGF A;  3PS6 A;  3EHN A;  2GRL A;  4GZ5 A;  4ANX A;  4JXT A;  4WNF A;  4XI0 A;  2C0M A;  2WMN A;  4AY6 A;  2XGM A;  1Y6I A;  1FVF A;  2YHE A;  4G23 A;  4CCA A;  2X3M A;  1E90 A;  5A7D B;  2VTB A;  4PH4 B;  3FTW A;  3QDN A;  1UN9 A;  3CVW A;  3QWP A;  4H7X A;  4A1G A;  3HDX A;  4JEU A;  2WXQ A;  4KYO B;  3ZYQ A;  3S7J A;  4A1S A;  2OND A;  3GZ2 A;  4U0U A;  4O6F A;  1HO8 A;  3CVQ A;  4J8D A;  4J8F A;  3D9J A;  3CHS A;  2A5U A;  4AP2 A;  3GYZ A;  1JUQ A;  1ELW A;  4WWP A;  2ZU6 B;  3CHP A;  3MYV A;  4I1M A;  4I43 A;  1UJK A;  1UN8 A;  2BUG A;  2CG2 A;  2PM6 A;  3T5X A;  3TG5 A;  3WXX A;  2YIN A;  1KT1 A;  3HYM B;  2VYI A;  4JHK A;  4BT9 A;  3I5P A;  3FY4 A;  3SD5 A;  4N2Q A;  2KAT A;  4DK5 A;  3ZGQ A;  4TUU A;  5HQ8 A;  1E7V A;  3B7T A;  4WWO A;  4I1A A;  4PS7 A;  3L22 A;  3MGB A;  1FCH A;  1HX8 A;  4EZJ A;  2XRZ A;  3BG1 B;  2DIW A;  1B89 A;  1H2T C;  2IOS A;  3QC1 A;  4ATG A;  4HOS A;  4UI9 K;  2VGY A;  4AXH A;  3OXF A;  2J07 A;  3LXU X;  1OUV A;  4EBA G;  5BNW A;  2WXJ A;  3JQ0 A;  4ILH B;  3D9P A;  4KVO A;  2YQ8 A;  3PE4 A;  3LVQ E;  1NA3 A;  2OVB A;  1GW6 A;  3P2B A;  3G2U A;  3ENE A;  4MRU A;  4PUC A;  4OYS A;  3FUJ A;  2GRM A;  3UT7 A;  3RIB A;  4WUY A;  4XE0 A;  5C2Y A;  3PUJ A;  3C98 A;  4G11 A;  4GMJ A;  4NQ0 A;  2RD0 A;  2WQH A;  1XGW A;  3G2V A;  2V4L A;  3CST A;  3LCA A;  4GML A;  4B8A A;  3SHF A;  2XPY A;  4DLQ A;  3U66 A;  3MCX A;  1EYH A;  1SZ9 A;  3AS5 A;  3CHQ A;  1SQM A;  3NF1 A;  3ZVV A;  4UWL A;  5BV1 A;  1A17 A;  2KC7 A;  2Y3A A;  3MKR A;  3CK7 A;  3P1U A;  3QNK A;  3CVN A;  4HOU A;  1Z3X A;  4NAC A;  2ION A;  5EX3 A;  5FQ8 A;  3ZHE B;  4A3T A;  5KJK A;  4FLH A;  3APF A;  2L0I A;  2IOL A;  3QWV A;  4JW1 A;  4UI9 J;  5FQ4 A;  4N5C A;  4M3O A;  4APF A;  3ZYM A;  2AWI A;  1TEZ A;  4Q94 A;  3IHV A;  4FJY A;  2WQ6 A;  4H7Y A;  4YVO A;  2LSV A;  3GZ1 A;  3PNT B;  2I9C A;  3O4Z A;  4C0E A;  1ELK A;  2AW6 A;  2WMO A;  2KCK A;  5LCW C;  3FTS A;  2L6J A;  4Y6W A;  2R17 C;  3SZ7 A;  1P5Q A;  3CGH A;  4YND A;  4F3V A;  5G04 J;  5G04 C;  4JC8 A;  4AOF A;  4Q96 A;  1H0A A;  4G25 A;  4CGV A;  3DBS A;  2LNI A;  4HLE A;  4BX9 A;  3T5V A;  2IF4 A;  4EEC A;  5AJL A;  4URK A;  3ZEF A;  3D9M A;  3JYS A;  4FUL A;  5KCM A;  2VSO E;  4GCO A;  3L13 A;  2HYZ A;  1KLX A;  5DBK A;  3CHO A;  3ZIM A;  4GA1 A;  4Y6C A;  5LOZ A;  4BX8 A;  1E8Y A;  2R59 A;  4I17 A;  4ACK A;  3D9L A;  1OWM A;  1ZU2 A;  4XIF A;  5AYW D;  2Y4U A;  3Q15 A;  5J90 A;  1NZN A;  2BTD A;  4KVM A;  1WAO 1;  4K03 A;  2WXH A;  5DIZ A;  2I2O A;  3PNL B;  4GYW A;  5T8I A;  3MJW A;  3PVL A;  4C9B B;  4U04 A;  3ONK A;  3PDN A;  3L54 A;  3FEX A;  4AEZ C;  2KZT B;  4F1S A;  2J08 A;  3FUE A;  4XX5 A;  4CDR A;  3CLJ A;  3B7R L;  4I2Z A;  1HU3 A;  3LVR E;  5ENN A;  3U3W A;  4N2S A;  3IHY A;  1UW4 B;  1Z6T A;  4DPR A;  4EPZ A;  2VTB B;  1XNF A;  3OXL A;  3AU4 A;  5KJM A;  3FEY A;  2PM7 A;  3FUN A;  4KXK B;  4KZ0 A;  4EBA A;  1PAQ A;  1PC2 A;  3FHE A;  3LKU A;  4F53 A;  4UQY A;  3VTX A;  3FU5 A;  2VSX E;  4GZC A;  1N54 A;  4L1B A;  5BUZ A;  3FUM A;  3LY8 A;  3SNX A;  2NSZ A;  1LF8 A;  2E0I A;  3CHR A;  1TJC A;  3URZ A;  3D9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...