5LOZA

Structure of yeast ent1 enth domain
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
137
structure length
136
Chain Sequence
MGSSSTQVLVRNATSNDNHQVSKDSLIELAKSYDSADFFEIMDMLDKRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQIVRVKAKELTALLSDDERLNEERNMNIKGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A bacterial genetic selection system for ubiquitylation cascade discovery.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ubiquitin-binding domain
molecule keywords Epsin-1
total genus 56
structure length 136
sequence length 137
ec nomenclature
pdb deposition date 2016-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5lozA00
4JXTA 1JPLA 1XGWA 3D9JA 3G2TA 1DVPA 3D9PA 1LF8A 2QY7A 3G2SA 1EYHA 3ONLA 2V8SE 4FU3A 4HFGA 4Q94A 2BF0X 3ZYKA 3ZYLA 5CMWA 3ONKA 1UJJA 2KM4A 1HFAA 1SZAA 3G2WA 4Q96A 3RRUA 1H0AA 1SZ9A 1ELKA 1EDUA 1HX8A 3D9NA 4GZCA 3CLJA 5LP0A 1HG5A 2L0IA 2L0TB 5CMYA 4NACA 3ZYQA 1VDYA 2DIWA 2LO6A 2MOWA 3D9OA 1UJKA 3LDZA 1X5BA 3ZYMA 1PY1A 1HG2A 2DCPA 3D9KA 3G2UA 3D9IA 1INZA 3D9MA 5LOZA 1JWGA 1MHQA 5J08A 4AVXA 3G2VA 4FLBA 3D9LA 1JWFA 1JUQA 4GZDA 1HF8A
chains in the Genus database with same CATH superfamily
4G1TA 5D0QD 4F53A 5FQ8A 2J07A 2Y4UA 2KM4A 2LSUA 2AWIA 3FUNA 1IHBA 2WM9A 2Y4TA 4APFA 2IO3C 4N5CA 3RRMB 4UWFA 3PDNA 1N9AA 2VGYA 3EDTB 3C3QA 2QC9A 4AOFA 4C9BB 4K5CA 4G23A 4BSXA 1EDUA 3FWVA 4WWPA 3O4ZA 1U2VG 4N39A 1VDYA 4N3BA 2R02A 4LG6A 4K03A 4HOQA 4GZ5A 2JABA 4CGWA 4GYYA 3ASOE 5H7PA 4JD2G 2FI7A 5AQBA 1SZ9A 3SHFA 2YNQA 2VGXA 3IKOB 2DBAA 1ZU2A 4JA7A 2FO7A 4KXKB 2UY1A 2WXIA 3R9MA 3BQOA 3UQ3A 2M63A 4UQYA 4HXIA 3SFYA 3S7JA 2C0LA 4L2YA 2XRZA 2L6JA 2XEHA 2IY0C 2V5FA 4JC8A 4W9RA 5CMYA 4GYOA 3QNKA 1O1RA 4QFVA 3I4GA 4KZCA 1A17A 3FU5A 4JHRA 4PH4B 3D9PA 5EILA 1E90A 5G05C 3UPVA 4DX1A 1EPUA 1O1SA 2EIJE 1UJKA 1H6KA 2VJ8A 4HI8A 3ZYMA 3FTVA 3ZW3A 3LY8A 1UW4B 1D8DA 1Z5SC 5T3RA 4A1SA 3QK0A 4UWLA 4CDNA 2LAHA 4CGVA 1TNUA 4EECA 3U66A 3LY9A 4UWKA 4AV7A 1E8YA 3V79K 2GRNB 4N3AA 3RJVA 4M7CA 4WNFA 3MV3B 4I6JA 4K5AB 2BUGA 2A4ZA 2LXLA 4H7XA 1N4RA 3CV0A 4LCTA 3ZGQA 3CGHA 4HLLA 4OVUA 1OCCE 2P9IG 2WQ7A 3PNLB 1N0QA 2VQ2A 4HVBA 3HXFA 1E8ZA 5KNHD 3HXDA 1PAQA 3AU5A 4GTPA 1KT1A 2A5UA 4NIKA 3V2OA 3SGHA 4UWHA 4J8FA 3IEGA 3Q75A 2OVBA 1OT8A 1DVPA 3OXGA 3AS8A 3QWVA 1HFAA 5ENRD 4IRUA 3JQ1A 1MZCA 4LUNU 2QYJA 5HQ8A 3J5PA 4TUUA 2MHKA 4UI9C 5G55A 3LS8A 1OWMA 2J8SD 2AXVA 2HE0A 2WXJA 3HDXA 4AP2A 3ZU7B 2ZGGA 3JUEA 4BERA 3ESLA 1TN8A 3APFA 2CFZA 1FT1A 4HNAD 3LXUX 3N71A 4DX2A 4AJWA 4DPRA 3EHMA 2PQNA 5ENPD 3UIPC 3CKBA 4U8VD 4UUCA 5CERB 4JW1A 2RKKA 1V55E 2ZIRA 2HO1A 4RVBA 3BU8A 2WXHA 3FUDA 5EIBE 2HYZA 4C0EA 1BPOA 2Y0BG 2FBNA 2QFCA 3CVYA 3TWWA 2I6HA 1KPSB 4ILHB 3ULYA 4DUIA 3FUEA 3IHYA 3ASDA 2DIWA 4AEZC 3IXEA 4A3VA 4ABNA 1MHQA 4HS2A 5JHBA 2OCCE 1ELRA 4PS8A 5KNGA 4CDMA 3E32A 4YDWA 2BKGA 4JHJA 4RG9A 3G2WA 5LCWJ 4TXRA 2J9QA 5AIJA 4ZHBA 5ITZF 4J6IA 4N3CA 3G2UA 2LSVA 5E76A 2WVIA 3PEVB 5DBKA 4EZKA 5G04J 2RFMA 1N95A 4ATZD 3U64A 3VLFA 1SA4A 4LEUA 2X3MA 2XPIA 3OXLA 5KWDA 2FO1E 3HVEB 5BV1A 3MYVA 2PZIA 3DPYA 1GW6A 4HI9A 5CEDB 1FVHA 1L5JA 3GYZA 2P9PG 3KS2A 4AXHA 3S2AA 5BXOA 5EKQD 2OV8A 2QZAA 2WMOA 4O1PA 4U8HA 3ZIMA 3ISMC 4FLBA 3FTWA 3ABLE 3ABKE 4I1OB 1X81A 3AU4A 4LRZA 3PZDA 3SD5A 5T8IA 4MRUA 1IKND 3LJNA 1H2VC 4ACKA 4TXQA 3FH7A 2DYSE 1JWFA 1OUVA 3EHRA 3U9WA 3IHVA 3CHPA 4DJAA 3GZSA 3ZN3A 3CKCA 4BTBA 4XKCA 5JHAA 3EU9A 3FTXA 3ZYQA 4GPMA 2XQ0A 4G24A 3ULQA 2VSYA 5CCMA 4CCAA 4I6EA 4O6FA 5DIZA 4URKA 3D9JA 4I6GA 4BX9A 4XKBA 3DSTA 4GTVA 3RSEG 4TRQA 3FU3A 4U04A 1JCSA 5CBNA 1G3NB 1NI1A 2XGMA 2R59A 1OCOE 1H19A 5KJMA 1ZB1A 2RD0A 1JCQA 3LY7A 1TNBA 1D9SA 1MYOA 2JEKA 3VTXA 2WPVA 3KEAA 3CHMA 2IO2C 3UT8A 2YHEA 4FLHA 3DXKG 2PQRA 1WY6A 5AAOA 4G25A 4L9PA 4XEIG 2X38A 4U8YD 3Q78A 4GCOA 4TV3A 2ZU6B 2P9LG 3CVXA 4N2SA 3OTNA 2ZGDA 3MX3A 2VTBB 1E96B 3UT7A 2R5SA 3UT4A 3VTYA 3FUMA 3NBNB 4E6HA 2DZOA 2LUHA 3CHSA 3EU5A 4M3OA 1AWCB 1OWOA 3CVPA 2V4HC 3B7SA 4Q94A 1Y8MA 2Y3AA 3EJNA 4KBQA 2OEVA 4ANVA 3S7BA 5LFAA 3C98A 1TN7A 4JB8P 1FCHA 2B6CA 2YQ8A 2QYUA 3ZFWA 2X6HA 3I5PA 3MKQA 4RSYA 5IY5E 2X6IA 2YHCA 3QOUA 3ZYKA 2NXPA 4WNDA 2J4BA 4TXPA 4MBGA 3SY2A 5CHEE 3TWTA 5LP0A 1Z3YA 3Q4AB 1K1BA 1N0RA 5ARGA 3MCXA 1YA0A 3BUAA 3PVLA 4DI3A 5AQAA 4J8YA 3G2VA 4EBAA 3FEYA 3CHQA 2EILE 3SFXA 4F3VA 3AS5A 2WXFA 3OXFA 4I43A 3AG2E 4RG6A 3CK8A 1MX4A 2H6GA 5G04C 2XCCA 3JQ0A 4HBDA 5ENTD 3UM1A 3CHRA 3GZ1A 3LJ3A 3C3RA 3D9KA 2FF4A 3DSVA 1V54E 4I2ZA 4CEMA 2EIKE 3LYAA 1NZNA 2WXKA 3PNTB 3MKQB 2VSOE 4BY6A 2MYOA 5B1BE 2WXGA 3DWLG 4G8KA 1N52A 4A55A 5BT1A 3LEWA 3QB2A 3D9OA 4U0UA 1X5BA 1HG2A 3D9MA 1WDYA 1SVXA 1WAO1 4HLEA 3L9TA 1BLXB 1EF1C 2EINE 2Q7FA 5BW8C 3ZXSA 4IULA 1S64A 1MQSA 2KZTB 5G2NA 2CHXA 4HRNA 4BWRA 2C2LA 3QWWA 5FZQA 4HOUA 3DEOA 3ZUVB 4DX7D 5KJKA 3KSLA 1FVFA 1S63A 3S7FA 4XI0A 1WM5A 2NC9A 4NACA 3ENEA 3B7UX 3ZEFA 1K8KG 3U4TA 4BTAA 4V3IA 2PM7A 5KJLA 3KAEA 3B7RL 3TAXA 2IFUA 3C72A 4OAUC 2XEEA 2I1KA 4O60A 3PZ2A 1S0PA 1E7VA 2GRRB 3TWSA 5B1AE 2L9BA 5A6CA 3CSTA 5CBOA 4TUMA 3ESKA 5AJLA 1NP7A 4JHKA 1XNFA 4GTTA 3OAWA 5FQ4A 5ENSD 2YINA 4APOA 4NQ0A 3UKRG 4ILGA 4YDEA 3CR3A 4EZJA 3Q9NC 2IU1A 1INZA 3CQGB 1MX2A 2LAIA 4YVOA 5E75A 4ATGA 3NB2A 3TG4A 1QNFA 1SZAA 5EX0A 2X6KA 4CT4A 3V30A 4U96D 3ZRHA 4JEHA 4XIFA 1SA5A 3T9KA 3ZVVA 3W9FA 2B0OE 4EQFA 3R7RA 5AN8A 1ZBPA 3AAAC 5AQ7A 4B93B 3PZ3A 2KXPC 3K9IA 3JUIA 4K0RA 2WXLA 5BUZA 3FDHA 2DCPA 2OOEA 1IQRA 4I1MA 2IJGX 4WWNA 5JJ6A 3URZA 2P58C 2Y1LE 4F7AA 4ME2A 4GA0A 4EBAG 3SF4A 3ZPJA 3TWUA 2MOWA 3I3NA 5BPPA 2ZISA 3UXGA 1Q2ZA 2L6BA 3HXCA 3FTYA 3MZLB 1TJFA 1QYMA 3EHQA 3E34A 4CYMD 4N5QA 3DPDA 5G05J 3TWRA 4L23A 1LTXA 3MGBA 4YDOA 3UKUG 2KC7A 3ZKJA 4GYWA 2P2CP 3AS4A 4HOTA 3UI2A 1U3CA 3UTMA 3ZXPA 3L22A 2P9KG 1HH8A 3HYMB 5EYPF 3ZYLA 5FZSA 3DBSA 2AXUA 1YCSB 3PUJA 4KT6B 5EYLA 5AYWD 2WQ6A 2E0IA 3AG4E 1HZ4A 1QBQA 1HF8A 3NZUA 2XENA 4F1SA 4FU3A 3ML9A 3SFZA 2IQCA 3ONKA 3UM0A 1BI7B 4L7TA 5JJTA 4DK5A 2GROB 3RO3A 3ABME 1K1AA 3D9IA 2V0PA 2CG3A 2NSZA 1OWPA 2NYJA 2GRLA 4HQDA 5J90A 3EHNA 3UINC 1B89A 1O5MA 1TNZA 3FUFA 3CK7A 3LVRE 1LD7A 4K5BA 4PS3A 4B0ZA 4FC8A 2I1JA 5EN5D 5FZRA 2IF4A 2J49A 2R05A 4I9EA 1N11A 4BT8A 2F8XK 4GMRA 3HXBA 3PREA 3PUKA 4WUYA 3ASHA 3CVQA 3R7QA 3MJWA 1W3BA 2AXZA 4FP7A 3ZHEA 3RAUA 3CVNA 4U95D 3WG7E 1N4SA 4MS6A 3RKVA 2JLBA 2AJAA 2FULA 3KD7A 2XCBA 4GZDA 5CMWA 3PZ1A 3PEUB 2KBXA 3T8KA 1IQUA 4AY6A 4Y6WA 2WXMA 1E8XA 3SO8A 3FP3A 1O1TA 5JJ7A 4LERA 3MEKA 4UQXA 4LNGA 2WMNA 1IHGA 4PDXA 3EUVA 2XEVA 3UX4A 3UIOC 2ETBA 4CZ2D 4GAAA 4CRWA 4A1GA 4JEUA 1JWGA 2XPYA 3Q7AA 4UQZA 4GPKA 3CQCB 3B95A 4IN3B 1XGWA 5C2YA 4MLPA 3T5XA 4ANXA 3E4BA 2BF0X 2BKKB 3FH8A 1Y6IA 2XGOA 2C0MA 3CSFA 4GMLA 1KT0A 2I2OA 2MRIA 2WXRA 4YDYA 4DX6D 3DRAA 3TXNA 2R2LA 3TWVA 4JPSA 4ILIA 1JPLA 3PZ4A 2KATA 4GTQA 3T8MA 2KCKA 3BG0B 5D2MC 2KCLA 2WQHA 3P1UA 1OWNA 5LX8A 3ULEG 2BTDA 4ACLA 4KYOB 2Y69E 1BU9A 3VLEA 3QKYA 3FTZA 1E7UA 5FJYA 3SZ7A 3ZNGA 4BETA 1ELWA 3QWPA 2VTBA 3V2XA 3B7BA 1H6PA 5ANRA 1A5EA 3FY4A 5LCWC 4BFRA 2RG8A 5EIDA 1N54A 3ML8A 4BSZB 2J4DA 3FEXA 2VGEA 4F6RD 4A3TA 4XE0A 4QQIA 4JZYA 2CFUA 3FH5A 3ONLA 5CRUA 2P9NG 3Q47B 4FJYA 3B7TA 3FUHA 4EPZA 4GTRA 3FUIA 4G26A 4L1BA 5ENOD 3D3MA 3D9NA 2VSXE 2GGFA 1E8WA 3DEPA 1TNYA 2X6FA 5AARA 5ARFA 1TNOA 1HXIA 2X6JA 3UM2A 4UI9J 4G11A 3AG3E 2GW1A 3QARA 2A5EA 2BEDA 4HORA 4X8QA 3PE3A 2KZTA 5FINA 5KCMA 3W9GA 2PM6A 4ANWA 3X2QE 2J08A 4EZLA 3CVWA 1LF8A 3L54A 3PS6A 3B13A 1IYGA 4FADA 2AW6A 3E30A 2ETAA 4XX5A 3RRUA 4UWGA 5FQ6A 3VLDA 2KCVA 2IOLA 1YYHA 4KVOA 4P29A 5FIOA 4C48B 4ZFHA 4FHKA 4CDRA 4J8SA 3HIZA 3JXJA 3QC1A 2RFAA 3U3WA 1BI8B 2EIME 4Y6CA 4U0SA 3CIAA 4U63A 4DRXE 1LD8A 2XHEA 1S70B 4NURA 5BV0A 3NAWA 4I17A 2L0IA 1PC2A 5BNWA 2UWJG 1TYQG 3UMVA 1UN8A 3L6AA 4Q96A 3RO2A 3SBTB 4WAFA 2XGSA 4HRLA 1HX8A 1TR4A 3Q5MA 1DCEA 2ZXWE 1HG5A 3HRAA 3SQVA 3EIQC 4O1OA 4PS7A 3LDZA 4J8DA 3Q73A 5A23A 3HHMA 3D9LA 1WG0A 3DSSA 3MV2B 4HOSA 3Q49B 2GRPB 4FA6A 2HR2A 4DLOA 4HRMB 3MA5A 2V5QC 3TJPA 3E37A 2XZDG 3EIJA 2L0TB 3SNXA 4GA2A 4WNEA 5D0OD 2UY1B 4NRHB 3UM3A 4AVXA 4WWOA 3HVEA 3G2SA 4GZ3A 2H6IA 5D66A 3T5VA 4GB9A 4DLQA 4DX5D 1JCRA 1D8EA 3O48A 1N4PA 5LOZA 5FTPA 4LNUD 1H2UA 3ASGA 3DXMG 3SBSA 4U0ZA 2CHWA 4FHJA 4B89A 4BEPA 1TEZA 4FULA 4L2LA 5CCLA 2P9UG 4LSZE 5CECB 4GTSA 3FUJA 5ENNA 2IOSA 2ONDA 4OAVB 2FEZA 4GA1A 1Z3XA 4Z68A 2WXQA 5M72A 2DWZA 2I9CA 2XS1A 3LCAA 4J8EA 3L82A 2F8YA 4BESA 1N94A 3KSQA 4KZ0A 3QAQA 4G8LA 3TL5A 2LXMA 4I2WA 5CEAA 3JXIA 5FWQA 1KZPA 4AIFA 4JVSA 2WXPA 1SQMA 1DNPA 5FQ7A 4IYPA 3CLJA 3CEQA 1UOHA 3E33A 4KVMA 5B3SE 1HS6A 2HM8A 2VYIA 1UG3A 3D9HA 2WXOA 4XI9A 3HXEA 3DSXA 2V8SE 3TGOA 3KEZA 1FT2A 1Z6TA 1H0AA 1ELKA 4B94A 1OCRE 3TG5A 5BXUA 3APDA 1DC2A 4U07A 1OXJA 3S7DA 2WB2A 2DYRE 3RRNB 1H6OA 2V4LA 3CK9A 1SW6A 4PUCA 1HU3A 2QY7A 4HFGA 3NZSA 2GRQB 1UJJA 1YMPA 2GRMA 3MKRA 2AVPA 3CVLA 1IXVA 4R7LA 4D10C 4DI4A 2F0YA 5KBAA 1RZ4A 3I4RB 2PNNA 3PRZA 3ASNE 3NOCD 1TN6A 4XZ4A 1HO8A 2J09A 3BG1B 4YVQC 3UUXA 5FT9A 2ETCA 5JMND 1QQEA 2P9SG 4F1PA 4CT0A 4J7WA 3FHEA 4AY5A 2PL2A 2IONA 3FTUA 3DSUA 1DCQA 2H6HA 3PH0C 5CRVA 5C1DA 5HS0A 5EDSA 1AP7A 4GTMA 4WNGA 4JA9A 4J0UA 2LNIA 3G2TA 3BEEA 3RK6A 3RIBA 2F37A 3DSWA 3TXMA 5A7DB 4OYSA 3FU6A 4U7EB 4BT9A 3ZHEB 2XZTG 4AM9A 3CVVA 2R03A 4EHMA 3L08A 1K3ZD 1QZ2A 4H7YA 1OWLA 2CG2A 1NL4A 3FUKA 4GZCA 5JA4D 4OVVA 4ANUA 3FFLA 3JCKC 2LO6A 4KMOA 3NQPA 4I9CA 3L17A 1UN9A 1NFIE 3ASFA 4JXTA 4YNDA 3FTSA 4RQIA 1BD8A 2XRYA 3GZ2A 4B8AA 1N4QA 3GW4A 4GMJA 2E2EA 5T4YA 3Q15A 5HRYA 3LVQE 5ANLA 1KLXA 1JUQA 4C0MA 4LNBA 5HI7A 3TWQA 3WXXA 2DVWA 3FULA 1RW2A 3IV0A 3C5RA 4GTOA 2ILRA 3QDNA 3NF1A 3RU0A 4GU5A 4I1AA 3QJZA 1MJ0A 3SI5A 5KJNA 3R9AB 4B8CB 4E85A 3V31A 2XS8A 3FU0A 1OY3D 1KZOA 1FPPA 3APCA 3IBEA 3LPZA 2EQXA 1HE8A 4UI9K 3P2BA 1EYHA 3F6QA 3Q7FA 3L16A 4Q69A 5EX3A 3TWXA 4A63B 3Q79A 1P5QA 3Q9UC 3AJIA 4N2QA 4HB5A 2VGXB 4FJZA 2CHZA 2DZNA 1MX6A 4RLYA 5AQ9A 3CVUA 4GCNA 1NA3A 2OEWA 2IEJA 3AG1E 2H6FA 2VSNA 3JYSA 4MKTA 1U3DA 3PE4A 5ENQD 2R17C 1TJCA 4JL0A 2WXNA 2XPZA 3NOGD 2OVFA 3CHOA 4BX8A 4GZ6A 3HG0D 1NA0A 5AENA 1OCZE 5HKPA 3L13A 3C3OA 3LKUA 1PY1A 5J08A 4G2VA 5AJDA 1H2TC 3J5QB
chains in the Genus database with same CATH topology
3NZUA 4O6FA 4G1TA 3D9JA 4I6GA 5DIZA 4BX9A 4F1SA 5D0QD 3HVEA 3G2SA 4FU3A 4GZ3A 4XKBA 4F53A 3ML9A 2J07A 5FQ8A 3SFZA 2IQCA 2Y4UA 3ONKA 2KM4A 2LSUA 4L7TA 4TRQA 2AWIA 3FU3A 4U04A 3T5VA 4GB9A 4DLQA 2XGMA 3FUNA 2R59A 5JJTA 2WM9A 2Y4TA 4APFA 1H19A 5KJMA 2RD0A 4DK5A 4N5CA 3LY7A 3RRMB 3O48A 3PDNA 4UWFA 2JEKA 3RO3A 2VGYA 5LOZA 5FTPA 3VTXA 3EDTB 1H2UA 3ASGA 2WPVA 3D9IA 3SBSA 3CHMA 4U0ZA 2V0PA 4AOFA 2CHWA 4FHJA 2CG3A 4B89A 4C9BB 1TEZA 3UT8A 2YHEA 4FULA 4L2LA 4FLHA 5CCLA 4G23A 2PQRA 2NSZA 4BSXA 1WY6A 1OWPA 4G25A 1EDUA 3FWVA 4WWPA 3O4ZA 2GRLA 5J90A 3EHNA 2X38A 3FUJA 5ENNA 4GCOA 2IOSA 2ONDA 4TV3A 2ZU6B 4N39A 2FEZA 4GA1A 1VDYA 1B89A 1Z3XA 3FUFA 4N3BA 3CK7A 3LVRE 2WXQA 3CVXA 4PS3A 4N2SA 4B0ZA 4FC8A 5M72A 3OTNA 4K03A 2I1JA 4HOQA 2I9CA 3MX3A 2VTBB 4GZ5A 5FZRA 1E96B 3UT7A 2IF4A 4CGWA 3LCAA 4GYYA 4J8EA 2J49A 2R5SA 4I9EA 2FI7A 3UT4A 1SZ9A 3VTYA 4BT8A 3SHFA 3FUMA 4I6EA 4KZ0A 3QAQA 4E6HA 2YNQA 2VGXA 3IKOB 3TL5A 2DBAA 3PREA 1ZU2A 4JA7A 2FO7A 4I2WA 3CHSA 4KXKB 3PUKA 4WUYA 2UY1A 4M3OA 2WXIA 1OWOA 5FWQA 3CVPA 3ASHA 3UQ3A 2M63A 3CVQA 3B7SA 3R7QA 4Q94A 4AIFA 4UQYA 3MJWA 4HXIA 4JVSA 3S7JA 1W3BA 2WXPA 1Y8MA 2AXZA 2C0LA 4L2YA 1SQMA 4FP7A 1DNPA 2L6JA 5FQ7A 2XRZA 2V5FA 3CLJA 4IYPA 4JC8A 2Y3AA 3EJNA 3CEQA 4KBQA 3ZHEA 4W9RA 3CVNA 4KVMA 5CMYA 4GYOA 3QNKA 4ANVA 4MS6A 3S7BA 5LFAA 4QFVA 1HS6A 3C98A 3I4GA 3RKVA 2JLBA 2HM8A 2VYIA 4KZCA 1A17A 1UG3A 2FULA 1FCHA 3KD7A 2XCBA 2WXOA 3FU5A 2YQ8A 3ZFWA 4GZDA 2X6HA 3I5PA 4XI9A 3MKQA 5CMWA 3PEUB 4JHRA 4PH4B 4RSYA 3D9PA 2X6IA 1E90A 2V8SE 2YHCA 5G05C 3QOUA 3ZYKA 2NXPA 3UPVA 3TGOA 4WNDA 1EPUA 3KEZA 2J4BA 1Z6TA 1IQUA 5CHEE 1H0AA 4AY6A 1ELKA 4Y6WA 4B94A 3TG5A 5LP0A 2WXMA 1Z3YA 3Q4AB 3APDA 4U07A 1E8XA 3MCXA 5ARGA 3S7DA 1YA0A 3FP3A 1UJKA 1H6KA 2VJ8A 3MEKA 4LERA 3ZYMA 5JJ7A 2WB2A 4UQXA 3FTVA 3ZW3A 3PVLA 3LY8A 1UW4B 4DI3A 5T3RA 3G2VA 4A1SA 2WMNA 3RRNB 3FEYA 2V4LA 3CHQA 4EBAA 3CK9A 3QK0A 4UWLA 4CDNA 2LAHA 4PUCA 4CGVA 1HU3A 2QY7A 4HFGA 4EECA 3AS5A 3NZSA 1IHGA 2WXFA 4PDXA 4F3VA 3LY9A 4UWKA 4AV7A 3U66A 1E8YA 3OXFA 4I43A 4WWOA 4RG6A 1UJJA 2GRMA 2XEVA 3CK8A 3MKRA 2AVPA 5G04C 3UX4A 3CVLA 4N3AA 3RJVA 2XCCA 4WNFA 3JQ0A 3MV3B 4GAAA 4R7LA 4CRWA 4A1GA 4I6JA 4JEUA 4D10C 4DI4A 3CHRA 3GZ1A 3LJ3A 2BUGA 2A4ZA 3D9KA 2FF4A 4H7XA 1JWGA 2XPYA 3CV0A 4LCTA 3ZGQA 4I2ZA 4UQZA 3CGHA 4OVUA 3I4RB 3CQCB 4CEMA 4GPKA 4IN3B 1XGWA 4MLPA 5C2YA 3LYAA 3PRZA 1NZNA 3PNLB 3T5XA 2WQ7A 4ANXA 2WXKA 2VQ2A 2BF0X 3E4BA 3FH8A 3PNTB 4XZ4A 3MKQB 4HVBA 2VSOE 1Y6IA 1HO8A 2J09A 2XGOA 3BG1B 4BY6A 2C0MA 3CSFA 4YVQC 1E8ZA 2WXGA 3UUXA 5FT9A 1N52A 1PAQA 4A55A 4URKA 3AU5A 5BT1A 3LEWA 4GMLA 1KT0A 2I2OA 3QB2A 3D9OA 1QQEA 2MRIA 1X5BA 4U0UA 1HG2A 1KT1A 2A5UA 2WXRA 3D9MA 4CT0A 1WAO1 3SGHA 3FHEA 4UWHA 4J8FA 3TXNA 4HLEA 3IEGA 1EF1C 4AY5A 4JPSA 4ILIA 1JPLA 2OVBA 1DVPA 3OXGA 2KATA 3T8MA 2KCKA 3AS8A 3QWVA 2Q7FA 5BW8C 2PL2A 3ZXSA 3BG0B 1HFAA 2IONA 4IULA 1MQSA 4IRUA 3FTUA 2KZTB 5G2NA 2KCLA 2WQHA 3P1UA 3JQ1A 1OWNA 5LX8A 3PH0C 4LUNU 2CHXA 5C1DA 5HQ8A 5EDSA 4BWRA 2BTDA 4TUUA 4ACLA 2MHKA 4UI9C 2C2LA 5G55A 4WNGA 3LS8A 4JA9A 3QWWA 5FZQA 4J0UA 4KYOB 4HOUA 1OWMA 2AXVA 2WXJA 3HDXA 3VLEA 2LNIA 5KJKA 3QKYA 3FTZA 1E7UA 3G2TA 5FJYA 3SZ7A 4AP2A 3BEEA 3RK6A 1ELWA 3RIBA 1FVFA 3QWPA 3ESLA 3S7FA 4XI0A 2VTBA 1WM5A 3TXMA 3APFA 5ANRA 2CFZA 5A7DB 2NC9A 4OYSA 4NACA 3ENEA 3FY4A 3B7UX 3FU6A 5LCWC 3ZEFA 4BT9A 3ZHEB 3LXUX 3U4TA 4BTAA 4V3IA 2PM7A 4AM9A 3N71A 5KJLA 3CVVA 4AJWA 4DPRA 3EHMA 4BFRA 3KAEA 3B7RL 2RG8A 3L08A 2PQNA 1QZ2A 4H7YA 1OWLA 2CG2A 3FUKA 3TAXA 1N54A 3ML8A 2IFUA 2J4DA 2I1KA 3CKBA 3FEXA 4GZCA 1S0PA 1E7VA 4OVVA 4JW1A 4ANUA 3FFLA 3JCKC 2L9BA 4A3TA 2LO6A 5A6CA 3CSTA 2HO1A 4RVBA 4XE0A 4KMOA 3NQPA 4I9CA 2WXHA 3L17A 3ESKA 3FUDA 5AJLA 1NP7A 1UN9A 2HYZA 2CFUA 3FH5A 4JHKA 1XNFA 1BPOA 4JZYA 4C0EA 3ONLA 2FBNA 2QFCA 3ASFA 3Q47B 3OAWA 4FJYA 3B7TA 4JXTA 5FQ4A 4YNDA 3CVYA 3FTSA 3FUHA 4EPZA 2I6HA 2YINA 3FUIA 4G26A 4L1BA 2XRYA 4NQ0A 4APOA 4ILGA 4ILHB 3D3MA 3D9NA 2VSXE 3GZ2A 4B8AA 3GW4A 2GGFA 4GMJA 1E8WA 3FUEA 3CR3A 2E2EA 3IHYA 4EZJA 3ASDA 2DIWA 5T4YA 4AEZC 3Q15A 2IU1A 2X6FA 1INZA 4A3VA 3CQGB 4ABNA 1MHQA 3LVQE 4HS2A 5ARFA 5ANLA 2X6JA 1HXIA 1KLXA 5JHBA 1JUQA 4C0MA 2LAIA 1ELRA 4PS8A 4UI9J 4YVOA 5E75A 4ATGA 4CDMA 5HI7A 4G11A 3WXXA 3TG4A 2GW1A 4JHJA 4RG9A 1QNFA 3G2WA 1SZAA 3QARA 3FULA 5EX0A 5LCWJ 2X6KA 3IV0A 4CT4A 2J9QA 5AIJA 4HORA 4J6IA 2ILRA 3QDNA 4N3CA 3PE3A 2KZTA 3NF1A 5KCMA 3ZRHA 2PM6A 2LSVA 3G2UA 4JEHA 2WVIA 5E76A 4XIFA 3RU0A 4ANWA 3ZVVA 3PEVB 4GU5A 4I1AA 4EQFA 2J08A 5DBKA 3QJZA 3R7RA 4EZLA 3SI5A 3CVWA 1LF8A 1ZBPA 3L54A 3PS6A 4EZKA 5G04J 5KJNA 3B13A 1IYGA 4FADA 2AW6A 3K9IA 3R9AB 4B8CB 4XX5A 3FU0A 3RRUA 3JUIA 4K0RA 4UWGA 3U64A 3VLFA 4E85A 2WXLA 5BUZA 5FQ6A 3VLDA 3FDHA 2KCVA 2IOLA 4P29A 4KVOA 4FHKA 4LEUA 2X3MA 3APCA 2DCPA 2OOEA 2XPIA 4CDRA 3OXLA 4J8SA 3HIZA 1IQRA 3IBEA 3LPZA 3QC1A 3HVEB 5BV1A 3MYVA 4I1MA 2EQXA 1HE8A 2PZIA 3U3WA 4UI9K 3P2BA 4Y6CA 1GW6A 1EYHA 4U0SA 3CIAA 4U63A 2XHEA 1FVHA 1L5JA 3GYZA 3KS2A 4NURA 5BV0A 4AXHA 3L16A 2IJGX 4Q69A 4I17A 5EX3A 3S2AA 2L0IA 4WWNA 1PC2A 5JJ6A 5BNWA 1P5QA 3URZA 2P58C 2UWJG 4F7AA 4N2QA 5EKQD 4ME2A 4GA0A 3UMVA 4EBAG 1UN8A 2OV8A 2WMOA 4U8HA 3SF4A 2VGXB 3ZPJA 3ZIMA 3L6AA 4FLBA 4FJZA 2MOWA 3I3NA 4Q96A 2CHZA 3RO2A 3SBTB 4WAFA 5BPPA 3FTWA 3CVUA 2XGSA 4I1OB 4GCNA 3FTYA 1NA3A 3MZLB 1TJFA 1HX8A 3AU4A 3Q5MA 4LRZA 3PZDA 3SD5A 3DPDA 1HG5A 2VSNA 5T8IA 5G05J 4L23A 4MRUA 3EIQC 3JYSA 3MGBA 4PS7A 2KC7A 3LDZA 4J8DA 4MKTA 4GYWA 5A23A 1H2VC 3AS4A 4ACKA 1U3DA 3HHMA 3PE4A 3FH7A 4HOTA 3D9LA 2R17C 1TJCA 1U3CA 1JWFA 4JL0A 2WXNA 2XPZA 1OUVA 2OVFA 3CHOA 3L22A 3MV2B 1HH8A 3HYMB 4BX8A 4GZ6A 3U9WA 4HOSA 3Q49B 3ZYLA 3IHVA 4FA6A 2HR2A 4DLOA 3CHPA 4DJAA 3GZSA 3MA5A 3ZN3A 3CKCA 3TJPA 4BTBA 4XKCA 1NA0A 5AENA 5JHAA 3EIJA 2L0TB 3SNXA 5FZSA 3L13A 4GA2A 4WNEA 3FTXA 5D0OD 2UY1B 2AXUA 3DBSA 3ZYQA 3PUJA 3LKUA 4KT6B 1PY1A 2XQ0A 5AYWD 2WQ6A 4NRHB 4G24A 3ULQA 2VSYA 5CCMA 5J08A 2E0IA 4G2VA 5AJDA 1H2TC 4AVXA 4CCAA 1HZ4A 1HF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JXT A;  1JPL A;  1XGW A;  3D9J A;  3G2T A;  1DVP A;  3D9P A;  1LF8 A;  2QY7 A;  3G2S A;  1EYH A;  3ONL A;  2V8S E;  4FU3 A;  4HFG A;  4Q94 A;  2BF0 X;  3ZYK A;  3ZYL A;  5CMW A;  3ONK A;  1UJJ A;  2KM4 A;  1HFA A;  1SZA A;  3G2W A;  4Q96 A;  3RRU A;  1H0A A;  1SZ9 A;  1ELK A;  1EDU A;  1HX8 A;  3D9N A;  4GZC A;  3CLJ A;  5LP0 A;  1HG5 A;  2L0I A;  2L0T B;  5CMY A;  4NAC A;  3ZYQ A;  1VDY A;  2DIW A;  2LO6 A;  2MOW A;  3D9O A;  1UJK A;  3LDZ A;  1X5B A;  3ZYM A;  1PY1 A;  1HG2 A;  2DCP A;  3D9K A;  3G2U A;  3D9I A;  1INZ A;  3D9M A;  5LOZ A;  1JWG A;  1MHQ A;  5J08 A;  4AVX A;  3G2V A;  4FLB A;  3D9L A;  1JWF A;  1JUQ A;  4GZD A;  1HF8 A; 
#chains in the Genus database with same CATH topology
 4G1T A;  5D0Q D;  4F53 A;  5FQ8 A;  2J07 A;  2Y4U A;  2KM4 A;  2LSU A;  2AWI A;  3FUN A;  1IHB A;  2WM9 A;  2Y4T A;  4APF A;  2IO3 C;  4N5C A;  3RRM B;  4UWF A;  3PDN A;  1N9A A;  2VGY A;  3EDT B;  3C3Q A;  2QC9 A;  4AOF A;  4C9B B;  4K5C A;  4G23 A;  4BSX A;  1EDU A;  3FWV A;  4WWP A;  3O4Z A;  1U2V G;  4N39 A;  1VDY A;  4N3B A;  2R02 A;  4LG6 A;  4K03 A;  4HOQ A;  4GZ5 A;  2JAB A;  4CGW A;  4GYY A;  3ASO E;  5H7P A;  4JD2 G;  2FI7 A;  5AQB A;  1SZ9 A;  3SHF A;  2YNQ A;  2VGX A;  3IKO B;  2DBA A;  1ZU2 A;  4JA7 A;  2FO7 A;  4KXK B;  2UY1 A;  2WXI A;  3R9M A;  3BQO A;  3UQ3 A;  2M63 A;  4UQY A;  4HXI A;  3SFY A;  3S7J A;  2C0L A;  4L2Y A;  2XRZ A;  2L6J A;  2XEH A;  2IY0 C;  2V5F A;  4JC8 A;  4W9R A;  5CMY A;  4GYO A;  3QNK A;  1O1R A;  4QFV A;  3I4G A;  4KZC A;  1A17 A;  3FU5 A;  4JHR A;  4PH4 B;  3D9P A;  5EIL A;  1E90 A;  5G05 C;  3UPV A;  4DX1 A;  1EPU A;  1O1S A;  2EIJ E;  1UJK A;  1H6K A;  2VJ8 A;  4HI8 A;  3ZYM A;  3FTV A;  3ZW3 A;  3LY8 A;  1UW4 B;  1D8D A;  1Z5S C;  5T3R A;  4A1S A;  3QK0 A;  4UWL A;  4CDN A;  2LAH A;  4CGV A;  1TNU A;  4EEC A;  3U66 A;  3LY9 A;  4UWK A;  4AV7 A;  1E8Y A;  3V79 K;  2GRN B;  4N3A A;  3RJV A;  4M7C A;  4WNF A;  3MV3 B;  4I6J A;  4K5A B;  2BUG A;  2A4Z A;  2LXL A;  4H7X A;  1N4R A;  3CV0 A;  4LCT A;  3ZGQ A;  3CGH A;  4HLL A;  4OVU A;  1OCC E;  2P9I G;  2WQ7 A;  3PNL B;  1N0Q A;  2VQ2 A;  4HVB A;  3HXF A;  1E8Z A;  5KNH D;  3HXD A;  1PAQ A;  3AU5 A;  4GTP A;  1KT1 A;  2A5U A;  4NIK A;  3V2O A;  3SGH A;  4UWH A;  4J8F A;  3IEG A;  3Q75 A;  2OVB A;  1OT8 A;  1DVP A;  3OXG A;  3AS8 A;  3QWV A;  1HFA A;  5ENR D;  4IRU A;  3JQ1 A;  1MZC A;  4LUN U;  2QYJ A;  5HQ8 A;  3J5P A;  4TUU A;  2MHK A;  4UI9 C;  5G55 A;  3LS8 A;  1OWM A;  2J8S D;  2AXV A;  2HE0 A;  2WXJ A;  3HDX A;  4AP2 A;  3ZU7 B;  2ZGG A;  3JUE A;  4BER A;  3ESL A;  1TN8 A;  3APF A;  2CFZ A;  1FT1 A;  4HNA D;  3LXU X;  3N71 A;  4DX2 A;  4AJW A;  4DPR A;  3EHM A;  2PQN A;  5ENP D;  3UIP C;  3CKB A;  4U8V D;  4UUC A;  5CER B;  4JW1 A;  2RKK A;  1V55 E;  2ZIR A;  2HO1 A;  4RVB A;  3BU8 A;  2WXH A;  3FUD A;  5EIB E;  2HYZ A;  4C0E A;  1BPO A;  2Y0B G;  2FBN A;  2QFC A;  3CVY A;  3TWW A;  2I6H A;  1KPS B;  4ILH B;  3ULY A;  4DUI A;  3FUE A;  3IHY A;  3ASD A;  2DIW A;  4AEZ C;  3IXE A;  4A3V A;  4ABN A;  1MHQ A;  4HS2 A;  5JHB A;  2OCC E;  1ELR A;  4PS8 A;  5KNG A;  4CDM A;  3E32 A;  4YDW A;  2BKG A;  4JHJ A;  4RG9 A;  3G2W A;  5LCW J;  4TXR A;  2J9Q A;  5AIJ A;  4ZHB A;  5ITZ F;  4J6I A;  4N3C A;  3G2U A;  2LSV A;  5E76 A;  2WVI A;  3PEV B;  5DBK A;  4EZK A;  5G04 J;  2RFM A;  1N95 A;  4ATZ D;  3U64 A;  3VLF A;  1SA4 A;  4LEU A;  2X3M A;  2XPI A;  3OXL A;  5KWD A;  2FO1 E;  3HVE B;  5BV1 A;  3MYV A;  2PZI A;  3DPY A;  1GW6 A;  4HI9 A;  5CED B;  1FVH A;  1L5J A;  3GYZ A;  2P9P G;  3KS2 A;  4AXH A;  3S2A A;  5BXO A;  5EKQ D;  2OV8 A;  2QZA A;  2WMO A;  4O1P A;  4U8H A;  3ZIM A;  3ISM C;  4FLB A;  3FTW A;  3ABL E;  3ABK E;  4I1O B;  1X81 A;  3AU4 A;  4LRZ A;  3PZD A;  3SD5 A;  5T8I A;  4MRU A;  1IKN D;  3LJN A;  1H2V C;  4ACK A;  4TXQ A;  3FH7 A;  2DYS E;  1JWF A;  1OUV A;  3EHR A;  3U9W A;  3IHV A;  3CHP A;  4DJA A;  3GZS A;  3ZN3 A;  3CKC A;  4BTB A;  4XKC A;  5JHA A;  3EU9 A;  3FTX A;  3ZYQ A;  4GPM A;  2XQ0 A;  4G24 A;  3ULQ A;  2VSY A;  5CCM A;  4CCA A;  4I6E A;  4O6F A;  5DIZ A;  4URK A;  3D9J A;  4I6G A;  4BX9 A;  4XKB A;  3DST A;  4GTV A;  3RSE G;  4TRQ A;  3FU3 A;  4U04 A;  1JCS A;  5CBN A;  1G3N B;  1NI1 A;  2XGM A;  2R59 A;  1OCO E;  1H19 A;  5KJM A;  1ZB1 A;  2RD0 A;  1JCQ A;  3LY7 A;  1TNB A;  1D9S A;  1MYO A;  2JEK A;  3VTX A;  2WPV A;  3KEA A;  3CHM A;  2IO2 C;  3UT8 A;  2YHE A;  4FLH A;  3DXK G;  2PQR A;  1WY6 A;  5AAO A;  4G25 A;  4L9P A;  4XEI G;  2X38 A;  4U8Y D;  3Q78 A;  4GCO A;  4TV3 A;  2ZU6 B;  2P9L G;  3CVX A;  4N2S A;  3OTN A;  2ZGD A;  3MX3 A;  2VTB B;  1E96 B;  3UT7 A;  2R5S A;  3UT4 A;  3VTY A;  3FUM A;  3NBN B;  4E6H A;  2DZO A;  2LUH A;  3CHS A;  3EU5 A;  4M3O A;  1AWC B;  1OWO A;  3CVP A;  2V4H C;  3B7S A;  4Q94 A;  1Y8M A;  2Y3A A;  3EJN A;  4KBQ A;  2OEV A;  4ANV A;  3S7B A;  5LFA A;  3C98 A;  1TN7 A;  4JB8 P;  1FCH A;  2B6C A;  2YQ8 A;  2QYU A;  3ZFW A;  2X6H A;  3I5P A;  3MKQ A;  4RSY A;  5IY5 E;  2X6I A;  2YHC A;  3QOU A;  3ZYK A;  2NXP A;  4WND A;  2J4B A;  4TXP A;  4MBG A;  3SY2 A;  5CHE E;  3TWT A;  5LP0 A;  1Z3Y A;  3Q4A B;  1K1B A;  1N0R A;  5ARG A;  3MCX A;  1YA0 A;  3BUA A;  3PVL A;  4DI3 A;  5AQA A;  4J8Y A;  3G2V A;  4EBA A;  3FEY A;  3CHQ A;  2EIL E;  3SFX A;  4F3V A;  3AS5 A;  2WXF A;  3OXF A;  4I43 A;  3AG2 E;  4RG6 A;  3CK8 A;  1MX4 A;  2H6G A;  5G04 C;  2XCC A;  3JQ0 A;  4HBD A;  5ENT D;  3UM1 A;  3CHR A;  3GZ1 A;  3LJ3 A;  3C3R A;  3D9K A;  2FF4 A;  3DSV A;  1V54 E;  4I2Z A;  4CEM A;  2EIK E;  3LYA A;  1NZN A;  2WXK A;  3PNT B;  3MKQ B;  2VSO E;  4BY6 A;  2MYO A;  5B1B E;  2WXG A;  3DWL G;  4G8K A;  1N52 A;  4A55 A;  5BT1 A;  3LEW A;  3QB2 A;  3D9O A;  4U0U A;  1X5B A;  1HG2 A;  3D9M A;  1WDY A;  1SVX A;  1WAO 1;  4HLE A;  3L9T A;  1BLX B;  1EF1 C;  2EIN E;  2Q7F A;  5BW8 C;  3ZXS A;  4IUL A;  1S64 A;  1MQS A;  2KZT B;  5G2N A;  2CHX A;  4HRN A;  4BWR A;  2C2L A;  3QWW A;  5FZQ A;  4HOU A;  3DEO A;  3ZUV B;  4DX7 D;  5KJK A;  3KSL A;  1FVF A;  1S63 A;  3S7F A;  4XI0 A;  1WM5 A;  2NC9 A;  4NAC A;  3ENE A;  3B7U X;  3ZEF A;  1K8K G;  3U4T A;  4BTA A;  4V3I A;  2PM7 A;  5KJL A;  3KAE A;  3B7R L;  3TAX A;  2IFU A;  3C72 A;  4OAU C;  2XEE A;  2I1K A;  4O60 A;  3PZ2 A;  1S0P A;  1E7V A;  2GRR B;  3TWS A;  5B1A E;  2L9B A;  5A6C A;  3CST A;  5CBO A;  4TUM A;  3ESK A;  5AJL A;  1NP7 A;  4JHK A;  1XNF A;  4GTT A;  3OAW A;  5FQ4 A;  5ENS D;  2YIN A;  4APO A;  4NQ0 A;  3UKR G;  4ILG A;  4YDE A;  3CR3 A;  4EZJ A;  3Q9N C;  2IU1 A;  1INZ A;  3CQG B;  1MX2 A;  2LAI A;  4YVO A;  5E75 A;  4ATG A;  3NB2 A;  3TG4 A;  1QNF A;  1SZA A;  5EX0 A;  2X6K A;  4CT4 A;  3V30 A;  4U96 D;  3ZRH A;  4JEH A;  4XIF A;  1SA5 A;  3T9K A;  3ZVV A;  3W9F A;  2B0O E;  4EQF A;  3R7R A;  5AN8 A;  1ZBP A;  3AAA C;  5AQ7 A;  4B93 B;  3PZ3 A;  2KXP C;  3K9I A;  3JUI A;  4K0R A;  2WXL A;  5BUZ A;  3FDH A;  2DCP A;  2OOE A;  1IQR A;  4I1M A;  2IJG X;  4WWN A;  5JJ6 A;  3URZ A;  2P58 C;  2Y1L E;  4F7A A;  4ME2 A;  4GA0 A;  4EBA G;  3SF4 A;  3ZPJ A;  3TWU A;  2MOW A;  3I3N A;  5BPP A;  2ZIS A;  3UXG A;  1Q2Z A;  2L6B A;  3HXC A;  3FTY A;  3MZL B;  1TJF A;  1QYM A;  3EHQ A;  3E34 A;  4CYM D;  4N5Q A;  3DPD A;  5G05 J;  3TWR A;  4L23 A;  1LTX A;  3MGB A;  4YDO A;  3UKU G;  2KC7 A;  3ZKJ A;  4GYW A;  2P2C P;  3AS4 A;  4HOT A;  3UI2 A;  1U3C A;  3UTM A;  3ZXP A;  3L22 A;  2P9K G;  1HH8 A;  3HYM B;  5EYP F;  3ZYL A;  5FZS A;  3DBS A;  2AXU A;  1YCS B;  3PUJ A;  4KT6 B;  5EYL A;  5AYW D;  2WQ6 A;  2E0I A;  3AG4 E;  1HZ4 A;  1QBQ A;  1HF8 A;  3NZU A;  2XEN A;  4F1S A;  4FU3 A;  3ML9 A;  3SFZ A;  2IQC A;  3ONK A;  3UM0 A;  1BI7 B;  4L7T A;  5JJT A;  4DK5 A;  2GRO B;  3RO3 A;  3ABM E;  1K1A A;  3D9I A;  2V0P A;  2CG3 A;  2NSZ A;  1OWP A;  2NYJ A;  2GRL A;  4HQD A;  5J90 A;  3EHN A;  3UIN C;  1B89 A;  1O5M A;  1TNZ A;  3FUF A;  3CK7 A;  3LVR E;  1LD7 A;  4K5B A;  4PS3 A;  4B0Z A;  4FC8 A;  2I1J A;  5EN5 D;  5FZR A;  2IF4 A;  2J49 A;  2R05 A;  4I9E A;  1N11 A;  4BT8 A;  2F8X K;  4GMR A;  3HXB A;  3PRE A;  3PUK A;  4WUY A;  3ASH A;  3CVQ A;  3R7Q A;  3MJW A;  1W3B A;  2AXZ A;  4FP7 A;  3ZHE A;  3RAU A;  3CVN A;  4U95 D;  3WG7 E;  1N4S A;  4MS6 A;  3RKV A;  2JLB A;  2AJA A;  2FUL A;  3KD7 A;  2XCB A;  4GZD A;  5CMW A;  3PZ1 A;  3PEU B;  2KBX A;  3T8K A;  1IQU A;  4AY6 A;  4Y6W A;  2WXM A;  1E8X A;  3SO8 A;  3FP3 A;  1O1T A;  5JJ7 A;  4LER A;  3MEK A;  4UQX A;  4LNG A;  2WMN A;  1IHG A;  4PDX A;  3EUV A;  2XEV A;  3UX4 A;  3UIO C;  2ETB A;  4CZ2 D;  4GAA A;  4CRW A;  4A1G A;  4JEU A;  1JWG A;  2XPY A;  3Q7A A;  4UQZ A;  4GPK A;  3CQC B;  3B95 A;  4IN3 B;  1XGW A;  5C2Y A;  4MLP A;  3T5X A;  4ANX A;  3E4B A;  2BF0 X;  2BKK B;  3FH8 A;  1Y6I A;  2XGO A;  2C0M A;  3CSF A;  4GML A;  1KT0 A;  2I2O A;  2MRI A;  2WXR A;  4YDY A;  4DX6 D;  3DRA A;  3TXN A;  2R2L A;  3TWV A;  4JPS A;  4ILI A;  1JPL A;  3PZ4 A;  2KAT A;  4GTQ A;  3T8M A;  2KCK A;  3BG0 B;  5D2M C;  2KCL A;  2WQH A;  3P1U A;  1OWN A;  5LX8 A;  3ULE G;  2BTD A;  4ACL A;  4KYO B;  2Y69 E;  1BU9 A;  3VLE A;  3QKY A;  3FTZ A;  1E7U A;  5FJY A;  3SZ7 A;  3ZNG A;  4BET A;  1ELW A;  3QWP A;  2VTB A;  3V2X A;  3B7B A;  1H6P A;  5ANR A;  1A5E A;  3FY4 A;  5LCW C;  4BFR A;  2RG8 A;  5EID A;  1N54 A;  3ML8 A;  4BSZ B;  2J4D A;  3FEX A;  2VGE A;  4F6R D;  4A3T A;  4XE0 A;  4QQI A;  4JZY A;  2CFU A;  3FH5 A;  3ONL A;  5CRU A;  2P9N G;  3Q47 B;  4FJY A;  3B7T A;  3FUH A;  4EPZ A;  4GTR A;  3FUI A;  4G26 A;  4L1B A;  5ENO D;  3D3M A;  3D9N A;  2VSX E;  2GGF A;  1E8W A;  3DEP A;  1TNY A;  2X6F A;  5AAR A;  5ARF A;  1TNO A;  1HXI A;  2X6J A;  3UM2 A;  4UI9 J;  4G11 A;  3AG3 E;  2GW1 A;  3QAR A;  2A5E A;  2BED A;  4HOR A;  4X8Q A;  3PE3 A;  2KZT A;  5FIN A;  5KCM A;  3W9G A;  2PM6 A;  4ANW A;  3X2Q E;  2J08 A;  4EZL A;  3CVW A;  1LF8 A;  3L54 A;  3PS6 A;  3B13 A;  1IYG A;  4FAD A;  2AW6 A;  3E30 A;  2ETA A;  4XX5 A;  3RRU A;  4UWG A;  5FQ6 A;  3VLD A;  2KCV A;  2IOL A;  1YYH A;  4KVO A;  4P29 A;  5FIO A;  4C48 B;  4ZFH A;  4FHK A;  4CDR A;  4J8S A;  3HIZ A;  3JXJ A;  3QC1 A;  2RFA A;  3U3W A;  1BI8 B;  2EIM E;  4Y6C A;  4U0S A;  3CIA A;  4U63 A;  4DRX E;  1LD8 A;  2XHE A;  1S70 B;  4NUR A;  5BV0 A;  3NAW A;  4I17 A;  2L0I A;  1PC2 A;  5BNW A;  2UWJ G;  1TYQ G;  3UMV A;  1UN8 A;  3L6A A;  4Q96 A;  3RO2 A;  3SBT B;  4WAF A;  2XGS A;  4HRL A;  1HX8 A;  1TR4 A;  3Q5M A;  1DCE A;  2ZXW E;  1HG5 A;  3HRA A;  3SQV A;  3EIQ C;  4O1O A;  4PS7 A;  3LDZ A;  4J8D A;  3Q73 A;  5A23 A;  3HHM A;  3D9L A;  1WG0 A;  3DSS A;  3MV2 B;  4HOS A;  3Q49 B;  2GRP B;  4FA6 A;  2HR2 A;  4DLO A;  4HRM B;  3MA5 A;  2V5Q C;  3TJP A;  3E37 A;  2XZD G;  3EIJ A;  2L0T B;  3SNX A;  4GA2 A;  4WNE A;  5D0O D;  2UY1 B;  4NRH B;  3UM3 A;  4AVX A;  4WWO A;  3HVE A;  3G2S A;  4GZ3 A;  2H6I A;  5D66 A;  3T5V A;  4GB9 A;  4DLQ A;  4DX5 D;  1JCR A;  1D8E A;  3O48 A;  1N4P A;  5LOZ A;  5FTP A;  4LNU D;  1H2U A;  3ASG A;  3DXM G;  3SBS A;  4U0Z A;  2CHW A;  4FHJ A;  4B89 A;  4BEP A;  1TEZ A;  4FUL A;  4L2L A;  5CCL A;  2P9U G;  4LSZ E;  5CEC B;  4GTS A;  3FUJ A;  5ENN A;  2IOS A;  2OND A;  4OAV B;  2FEZ A;  4GA1 A;  1Z3X A;  4Z68 A;  2WXQ A;  5M72 A;  2DWZ A;  2I9C A;  2XS1 A;  3LCA A;  4J8E A;  3L82 A;  2F8Y A;  4BES A;  1N94 A;  3KSQ A;  4KZ0 A;  3QAQ A;  4G8L A;  3TL5 A;  2LXM A;  4I2W A;  5CEA A;  3JXI A;  5FWQ A;  1KZP A;  4AIF A;  4JVS A;  2WXP A;  1SQM A;  1DNP A;  5FQ7 A;  4IYP A;  3CLJ A;  3CEQ A;  1UOH A;  3E33 A;  4KVM A;  5B3S E;  1HS6 A;  2HM8 A;  2VYI A;  1UG3 A;  3D9H A;  2WXO A;  4XI9 A;  3HXE A;  3DSX A;  2V8S E;  3TGO A;  3KEZ A;  1FT2 A;  1Z6T A;  1H0A A;  1ELK A;  4B94 A;  1OCR E;  3TG5 A;  5BXU A;  3APD A;  1DC2 A;  4U07 A;  1OXJ A;  3S7D A;  2WB2 A;  2DYR E;  3RRN B;  1H6O A;  2V4L A;  3CK9 A;  1SW6 A;  4PUC A;  1HU3 A;  2QY7 A;  4HFG A;  3NZS A;  2GRQ B;  1UJJ A;  1YMP A;  2GRM A;  3MKR A;  2AVP A;  3CVL A;  1IXV A;  4R7L A;  4D10 C;  4DI4 A;  2F0Y A;  5KBA A;  1RZ4 A;  3I4R B;  2PNN A;  3PRZ A;  3ASN E;  3NOC D;  1TN6 A;  4XZ4 A;  1HO8 A;  2J09 A;  3BG1 B;  4YVQ C;  3UUX A;  5FT9 A;  2ETC A;  5JMN D;  1QQE A;  2P9S G;  4F1P A;  4CT0 A;  4J7W A;  3FHE A;  4AY5 A;  2PL2 A;  2ION A;  3FTU A;  3DSU A;  1DCQ A;  2H6H A;  3PH0 C;  5CRV A;  5C1D A;  5HS0 A;  5EDS A;  1AP7 A;  4GTM A;  4WNG A;  4JA9 A;  4J0U A;  2LNI A;  3G2T A;  3BEE A;  3RK6 A;  3RIB A;  2F37 A;  3DSW A;  3TXM A;  5A7D B;  4OYS A;  3FU6 A;  4U7E B;  4BT9 A;  3ZHE B;  2XZT G;  4AM9 A;  3CVV A;  2R03 A;  4EHM A;  3L08 A;  1K3Z D;  1QZ2 A;  4H7Y A;  1OWL A;  2CG2 A;  1NL4 A;  3FUK A;  4GZC A;  5JA4 D;  4OVV A;  4ANU A;  3FFL A;  3JCK C;  2LO6 A;  4KMO A;  3NQP A;  4I9C A;  3L17 A;  1UN9 A;  1NFI E;  3ASF A;  4JXT A;  4YND A;  3FTS A;  4RQI A;  1BD8 A;  2XRY A;  3GZ2 A;  4B8A A;  1N4Q A;  3GW4 A;  4GMJ A;  2E2E A;  5T4Y A;  3Q15 A;  5HRY A;  3LVQ E;  5ANL A;  1KLX A;  1JUQ A;  4C0M A;  4LNB A;  5HI7 A;  3TWQ A;  3WXX A;  2DVW A;  3FUL A;  1RW2 A;  3IV0 A;  3C5R A;  4GTO A;  2ILR A;  3QDN A;  3NF1 A;  3RU0 A;  4GU5 A;  4I1A A;  3QJZ A;  1MJ0 A;  3SI5 A;  5KJN A;  3R9A B;  4B8C B;  4E85 A;  3V31 A;  2XS8 A;  3FU0 A;  1OY3 D;  1KZO A;  1FPP A;  3APC A;  3IBE A;  3LPZ A;  2EQX A;  1HE8 A;  4UI9 K;  3P2B A;  1EYH A;  3F6Q A;  3Q7F A;  3L16 A;  4Q69 A;  5EX3 A;  3TWX A;  4A63 B;  3Q79 A;  1P5Q A;  3Q9U C;  3AJI A;  4N2Q A;  4HB5 A;  2VGX B;  4FJZ A;  2CHZ A;  2DZN A;  1MX6 A;  4RLY A;  5AQ9 A;  3CVU A;  4GCN A;  1NA3 A;  2OEW A;  2IEJ A;  3AG1 E;  2H6F A;  2VSN A;  3JYS A;  4MKT A;  1U3D A;  3PE4 A;  5ENQ D;  2R17 C;  1TJC A;  4JL0 A;  2WXN A;  2XPZ A;  3NOG D;  2OVF A;  3CHO A;  4BX8 A;  4GZ6 A;  3HG0 D;  1NA0 A;  5AEN A;  1OCZ E;  5HKP A;  3L13 A;  3C3O A;  3LKU A;  1PY1 A;  5J08 A;  4G2V A;  5AJD A;  1H2T C;  3J5Q B; 
#chains in the Genus database with same CATH homology
 3NZU A;  4O6F A;  4G1T A;  3D9J A;  4I6G A;  5DIZ A;  4BX9 A;  4F1S A;  5D0Q D;  3HVE A;  3G2S A;  4FU3 A;  4GZ3 A;  4XKB A;  4F53 A;  3ML9 A;  2J07 A;  5FQ8 A;  3SFZ A;  2IQC A;  2Y4U A;  3ONK A;  2KM4 A;  2LSU A;  4L7T A;  4TRQ A;  2AWI A;  3FU3 A;  4U04 A;  3T5V A;  4GB9 A;  4DLQ A;  2XGM A;  3FUN A;  2R59 A;  5JJT A;  2WM9 A;  2Y4T A;  4APF A;  1H19 A;  5KJM A;  2RD0 A;  4DK5 A;  4N5C A;  3LY7 A;  3RRM B;  3O48 A;  3PDN A;  4UWF A;  2JEK A;  3RO3 A;  2VGY A;  5LOZ A;  5FTP A;  3VTX A;  3EDT B;  1H2U A;  3ASG A;  2WPV A;  3D9I A;  3SBS A;  3CHM A;  4U0Z A;  2V0P A;  4AOF A;  2CHW A;  4FHJ A;  2CG3 A;  4B89 A;  4C9B B;  1TEZ A;  3UT8 A;  2YHE A;  4FUL A;  4L2L A;  4FLH A;  5CCL A;  4G23 A;  2PQR A;  2NSZ A;  4BSX A;  1WY6 A;  1OWP A;  4G25 A;  1EDU A;  3FWV A;  4WWP A;  3O4Z A;  2GRL A;  5J90 A;  3EHN A;  2X38 A;  3FUJ A;  5ENN A;  4GCO A;  2IOS A;  2OND A;  4TV3 A;  2ZU6 B;  4N39 A;  2FEZ A;  4GA1 A;  1VDY A;  1B89 A;  1Z3X A;  3FUF A;  4N3B A;  3CK7 A;  3LVR E;  2WXQ A;  3CVX A;  4PS3 A;  4N2S A;  4B0Z A;  4FC8 A;  5M72 A;  3OTN A;  4K03 A;  2I1J A;  4HOQ A;  2I9C A;  3MX3 A;  2VTB B;  4GZ5 A;  5FZR A;  1E96 B;  3UT7 A;  2IF4 A;  4CGW A;  3LCA A;  4GYY A;  4J8E A;  2J49 A;  2R5S A;  4I9E A;  2FI7 A;  3UT4 A;  1SZ9 A;  3VTY A;  4BT8 A;  3SHF A;  3FUM A;  4I6E A;  4KZ0 A;  3QAQ A;  4E6H A;  2YNQ A;  2VGX A;  3IKO B;  3TL5 A;  2DBA A;  3PRE A;  1ZU2 A;  4JA7 A;  2FO7 A;  4I2W A;  3CHS A;  4KXK B;  3PUK A;  4WUY A;  2UY1 A;  4M3O A;  2WXI A;  1OWO A;  5FWQ A;  3CVP A;  3ASH A;  3UQ3 A;  2M63 A;  3CVQ A;  3B7S A;  3R7Q A;  4Q94 A;  4AIF A;  4UQY A;  3MJW A;  4HXI A;  4JVS A;  3S7J A;  1W3B A;  2WXP A;  1Y8M A;  2AXZ A;  2C0L A;  4L2Y A;  1SQM A;  4FP7 A;  1DNP A;  2L6J A;  5FQ7 A;  2XRZ A;  2V5F A;  3CLJ A;  4IYP A;  4JC8 A;  2Y3A A;  3EJN A;  3CEQ A;  4KBQ A;  3ZHE A;  4W9R A;  3CVN A;  4KVM A;  5CMY A;  4GYO A;  3QNK A;  4ANV A;  4MS6 A;  3S7B A;  5LFA A;  4QFV A;  1HS6 A;  3C98 A;  3I4G A;  3RKV A;  2JLB A;  2HM8 A;  2VYI A;  4KZC A;  1A17 A;  1UG3 A;  2FUL A;  1FCH A;  3KD7 A;  2XCB A;  2WXO A;  3FU5 A;  2YQ8 A;  3ZFW A;  4GZD A;  2X6H A;  3I5P A;  4XI9 A;  3MKQ A;  5CMW A;  3PEU B;  4JHR A;  4PH4 B;  4RSY A;  3D9P A;  2X6I A;  1E90 A;  2V8S E;  2YHC A;  5G05 C;  3QOU A;  3ZYK A;  2NXP A;  3UPV A;  3TGO A;  4WND A;  1EPU A;  3KEZ A;  2J4B A;  1Z6T A;  1IQU A;  5CHE E;  1H0A A;  4AY6 A;  1ELK A;  4Y6W A;  4B94 A;  3TG5 A;  5LP0 A;  2WXM A;  1Z3Y A;  3Q4A B;  3APD A;  4U07 A;  1E8X A;  3MCX A;  5ARG A;  3S7D A;  1YA0 A;  3FP3 A;  1UJK A;  1H6K A;  2VJ8 A;  3MEK A;  4LER A;  3ZYM A;  5JJ7 A;  2WB2 A;  4UQX A;  3FTV A;  3ZW3 A;  3PVL A;  3LY8 A;  1UW4 B;  4DI3 A;  5T3R A;  3G2V A;  4A1S A;  2WMN A;  3RRN B;  3FEY A;  2V4L A;  3CHQ A;  4EBA A;  3CK9 A;  3QK0 A;  4UWL A;  4CDN A;  2LAH A;  4PUC A;  4CGV A;  1HU3 A;  2QY7 A;  4HFG A;  4EEC A;  3AS5 A;  3NZS A;  1IHG A;  2WXF A;  4PDX A;  4F3V A;  3LY9 A;  4UWK A;  4AV7 A;  3U66 A;  1E8Y A;  3OXF A;  4I43 A;  4WWO A;  4RG6 A;  1UJJ A;  2GRM A;  2XEV A;  3CK8 A;  3MKR A;  2AVP A;  5G04 C;  3UX4 A;  3CVL A;  4N3A A;  3RJV A;  2XCC A;  4WNF A;  3JQ0 A;  3MV3 B;  4GAA A;  4R7L A;  4CRW A;  4A1G A;  4I6J A;  4JEU A;  4D10 C;  4DI4 A;  3CHR A;  3GZ1 A;  3LJ3 A;  2BUG A;  2A4Z A;  3D9K A;  2FF4 A;  4H7X A;  1JWG A;  2XPY A;  3CV0 A;  4LCT A;  3ZGQ A;  4I2Z A;  4UQZ A;  3CGH A;  4OVU A;  3I4R B;  3CQC B;  4CEM A;  4GPK A;  4IN3 B;  1XGW A;  4MLP A;  5C2Y A;  3LYA A;  3PRZ A;  1NZN A;  3PNL B;  3T5X A;  2WQ7 A;  4ANX A;  2WXK A;  2VQ2 A;  2BF0 X;  3E4B A;  3FH8 A;  3PNT B;  4XZ4 A;  3MKQ B;  4HVB A;  2VSO E;  1Y6I A;  1HO8 A;  2J09 A;  2XGO A;  3BG1 B;  4BY6 A;  2C0M A;  3CSF A;  4YVQ C;  1E8Z A;  2WXG A;  3UUX A;  5FT9 A;  1N52 A;  1PAQ A;  4A55 A;  4URK A;  3AU5 A;  5BT1 A;  3LEW A;  4GML A;  1KT0 A;  2I2O A;  3QB2 A;  3D9O A;  1QQE A;  2MRI A;  1X5B A;  4U0U A;  1HG2 A;  1KT1 A;  2A5U A;  2WXR A;  3D9M A;  4CT0 A;  1WAO 1;  3SGH A;  3FHE A;  4UWH A;  4J8F A;  3TXN A;  4HLE A;  3IEG A;  1EF1 C;  4AY5 A;  4JPS A;  4ILI A;  1JPL A;  2OVB A;  1DVP A;  3OXG A;  2KAT A;  3T8M A;  2KCK A;  3AS8 A;  3QWV A;  2Q7F A;  5BW8 C;  2PL2 A;  3ZXS A;  3BG0 B;  1HFA A;  2ION A;  4IUL A;  1MQS A;  4IRU A;  3FTU A;  2KZT B;  5G2N A;  2KCL A;  2WQH A;  3P1U A;  3JQ1 A;  1OWN A;  5LX8 A;  3PH0 C;  4LUN U;  2CHX A;  5C1D A;  5HQ8 A;  5EDS A;  4BWR A;  2BTD A;  4TUU A;  4ACL A;  2MHK A;  4UI9 C;  2C2L A;  5G55 A;  4WNG A;  3LS8 A;  4JA9 A;  3QWW A;  5FZQ A;  4J0U A;  4KYO B;  4HOU A;  1OWM A;  2AXV A;  2WXJ A;  3HDX A;  3VLE A;  2LNI A;  5KJK A;  3QKY A;  3FTZ A;  1E7U A;  3G2T A;  5FJY A;  3SZ7 A;  4AP2 A;  3BEE A;  3RK6 A;  1ELW A;  3RIB A;  1FVF A;  3QWP A;  3ESL A;  3S7F A;  4XI0 A;  2VTB A;  1WM5 A;  3TXM A;  3APF A;  5ANR A;  2CFZ A;  5A7D B;  2NC9 A;  4OYS A;  4NAC A;  3ENE A;  3FY4 A;  3B7U X;  3FU6 A;  5LCW C;  3ZEF A;  4BT9 A;  3ZHE B;  3LXU X;  3U4T A;  4BTA A;  4V3I A;  2PM7 A;  4AM9 A;  3N71 A;  5KJL A;  3CVV A;  4AJW A;  4DPR A;  3EHM A;  4BFR A;  3KAE A;  3B7R L;  2RG8 A;  3L08 A;  2PQN A;  1QZ2 A;  4H7Y A;  1OWL A;  2CG2 A;  3FUK A;  3TAX A;  1N54 A;  3ML8 A;  2IFU A;  2J4D A;  2I1K A;  3CKB A;  3FEX A;  4GZC A;  1S0P A;  1E7V A;  4OVV A;  4JW1 A;  4ANU A;  3FFL A;  3JCK C;  2L9B A;  4A3T A;  2LO6 A;  5A6C A;  3CST A;  2HO1 A;  4RVB A;  4XE0 A;  4KMO A;  3NQP A;  4I9C A;  2WXH A;  3L17 A;  3ESK A;  3FUD A;  5AJL A;  1NP7 A;  1UN9 A;  2HYZ A;  2CFU A;  3FH5 A;  4JHK A;  1XNF A;  1BPO A;  4JZY A;  4C0E A;  3ONL A;  2FBN A;  2QFC A;  3ASF A;  3Q47 B;  3OAW A;  4FJY A;  3B7T A;  4JXT A;  5FQ4 A;  4YND A;  3CVY A;  3FTS A;  3FUH A;  4EPZ A;  2I6H A;  2YIN A;  3FUI A;  4G26 A;  4L1B A;  2XRY A;  4NQ0 A;  4APO A;  4ILG A;  4ILH B;  3D3M A;  3D9N A;  2VSX E;  3GZ2 A;  4B8A A;  3GW4 A;  2GGF A;  4GMJ A;  1E8W A;  3FUE A;  3CR3 A;  2E2E A;  3IHY A;  4EZJ A;  3ASD A;  2DIW A;  5T4Y A;  4AEZ C;  3Q15 A;  2IU1 A;  2X6F A;  1INZ A;  4A3V A;  3CQG B;  4ABN A;  1MHQ A;  3LVQ E;  4HS2 A;  5ARF A;  5ANL A;  2X6J A;  1HXI A;  1KLX A;  5JHB A;  1JUQ A;  4C0M A;  2LAI A;  1ELR A;  4PS8 A;  4UI9 J;  4YVO A;  5E75 A;  4ATG A;  4CDM A;  5HI7 A;  4G11 A;  3WXX A;  3TG4 A;  2GW1 A;  4JHJ A;  4RG9 A;  1QNF A;  3G2W A;  1SZA A;  3QAR A;  3FUL A;  5EX0 A;  5LCW J;  2X6K A;  3IV0 A;  4CT4 A;  2J9Q A;  5AIJ A;  4HOR A;  4J6I A;  2ILR A;  3QDN A;  4N3C A;  3PE3 A;  2KZT A;  3NF1 A;  5KCM A;  3ZRH A;  2PM6 A;  2LSV A;  3G2U A;  4JEH A;  2WVI A;  5E76 A;  4XIF A;  3RU0 A;  4ANW A;  3ZVV A;  3PEV B;  4GU5 A;  4I1A A;  4EQF A;  2J08 A;  5DBK A;  3QJZ A;  3R7R A;  4EZL A;  3SI5 A;  3CVW A;  1LF8 A;  1ZBP A;  3L54 A;  3PS6 A;  4EZK A;  5G04 J;  5KJN A;  3B13 A;  1IYG A;  4FAD A;  2AW6 A;  3K9I A;  3R9A B;  4B8C B;  4XX5 A;  3FU0 A;  3RRU A;  3JUI A;  4K0R A;  4UWG A;  3U64 A;  3VLF A;  4E85 A;  2WXL A;  5BUZ A;  5FQ6 A;  3VLD A;  3FDH A;  2KCV A;  2IOL A;  4P29 A;  4KVO A;  4FHK A;  4LEU A;  2X3M A;  3APC A;  2DCP A;  2OOE A;  2XPI A;  4CDR A;  3OXL A;  4J8S A;  3HIZ A;  1IQR A;  3IBE A;  3LPZ A;  3QC1 A;  3HVE B;  5BV1 A;  3MYV A;  4I1M A;  2EQX A;  1HE8 A;  2PZI A;  3U3W A;  4UI9 K;  3P2B A;  4Y6C A;  1GW6 A;  1EYH A;  4U0S A;  3CIA A;  4U63 A;  2XHE A;  1FVH A;  1L5J A;  3GYZ A;  3KS2 A;  4NUR A;  5BV0 A;  4AXH A;  3L16 A;  2IJG X;  4Q69 A;  4I17 A;  5EX3 A;  3S2A A;  2L0I A;  4WWN A;  1PC2 A;  5JJ6 A;  5BNW A;  1P5Q A;  3URZ A;  2P58 C;  2UWJ G;  4F7A A;  4N2Q A;  5EKQ D;  4ME2 A;  4GA0 A;  3UMV A;  4EBA G;  1UN8 A;  2OV8 A;  2WMO A;  4U8H A;  3SF4 A;  2VGX B;  3ZPJ A;  3ZIM A;  3L6A A;  4FLB A;  4FJZ A;  2MOW A;  3I3N A;  4Q96 A;  2CHZ A;  3RO2 A;  3SBT B;  4WAF A;  5BPP A;  3FTW A;  3CVU A;  2XGS A;  4I1O B;  4GCN A;  3FTY A;  1NA3 A;  3MZL B;  1TJF A;  1HX8 A;  3AU4 A;  3Q5M A;  4LRZ A;  3PZD A;  3SD5 A;  3DPD A;  1HG5 A;  2VSN A;  5T8I A;  5G05 J;  4L23 A;  4MRU A;  3EIQ C;  3JYS A;  3MGB A;  4PS7 A;  2KC7 A;  3LDZ A;  4J8D A;  4MKT A;  4GYW A;  5A23 A;  1H2V C;  3AS4 A;  4ACK A;  1U3D A;  3HHM A;  3PE4 A;  3FH7 A;  4HOT A;  3D9L A;  2R17 C;  1TJC A;  1U3C A;  1JWF A;  4JL0 A;  2WXN A;  2XPZ A;  1OUV A;  2OVF A;  3CHO A;  3L22 A;  3MV2 B;  1HH8 A;  3HYM B;  4BX8 A;  4GZ6 A;  3U9W A;  4HOS A;  3Q49 B;  3ZYL A;  3IHV A;  4FA6 A;  2HR2 A;  4DLO A;  3CHP A;  4DJA A;  3GZS A;  3MA5 A;  3ZN3 A;  3CKC A;  3TJP A;  4BTB A;  4XKC A;  1NA0 A;  5AEN A;  5JHA A;  3EIJ A;  2L0T B;  3SNX A;  5FZS A;  3L13 A;  4GA2 A;  4WNE A;  3FTX A;  5D0O D;  2UY1 B;  2AXU A;  3DBS A;  3ZYQ A;  3PUJ A;  3LKU A;  4KT6 B;  1PY1 A;  2XQ0 A;  5AYW D;  2WQ6 A;  4NRH B;  4G24 A;  3ULQ A;  2VSY A;  5CCM A;  5J08 A;  2E0I A;  4G2V A;  5AJD A;  1H2T C;  4AVX A;  4CCA A;  1HZ4 A;  1HF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...