1SW6A

S. cerevisiae swi6 ankyrin-repeat fragment
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
301
structure length
254
Chain Sequence
b'GPIITFTHDLTSDFLSSPLKIMKALPSPVVNDNEQKMKLEAFLQRLLFSFDSLLQEVNDAFPNTQLNLNIPVDEHGNTPLHWLTSIANLELVKHLVKHGSNRLYGDNMGESCLVKAVKSVNNYDSGTFEALLDYLYPCLILEDSMNRTILHHIIITSGMTGCSAAAKYYLDILMGWIVKKQNRPIQSGDSILENLDLKWIIANMLNAQDSNGDTCLNIAARLGNISIVDALLDYGADPFIANKSGLRPVDFGAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REGULATORY PROTEIN SWI6
publication title X-ray structural analysis of the yeast cell cycle regulator Swi6 reveals variations of the ankyrin fold and has implications for Swi6 function.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription regulation
total genus 89
structure length 254
sequence length 301
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13606 Ank_3 Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1sw6A00
3TWVA 4JB8P 2ZGDA 2ETBA 4LNUD 3JUEA 3JXJA 1WG0A 1K1BA 5KBAA 3UTMA 5CBOA 4O60A 5ENTD 3AAAC 5HRYA 4DX2A 4DX5D 5CEDB 4J7WA 5ENRD 4LG6A 5AQ9A 4BSZB 4DUIA 2F8XK 1MX2A 5KNHD 1N0RA 1DCQA 3J5QB 2XENA 1MJ0A 2DZNA 3HRAA 4K5CA 4BETA 5BXUA 3NBNB 3J5PA 2XZTG 5HKPA 3HG0D 4TUMA 1MYOA 3TWUA 1MX4A 3D9HA 5KNGA 4A63B 4BEPA 5KWDA 4NIKA 2DZOA 3ZNGA 4HQDA 3ZKJA 2DWZA 4GPMA 4HRMB 5EN5D 2ETAA 4RLYA 2QC9A 2XEHA 1IXVA 3C5RA 3B95A 1IHBA 4J8YA 5CECB 5BXOA 1SVXA 1AWCB 4HI8A 3IXEA 1BU9A 5ITZF 5EILA 3EHQA 5AN8A 2JABA 3AJIA 3NOCD 3Q9NC 2DVWA 2NYJA 2Y1LE 1SW6A 4U8VD 4BERA 1BI8B 1N0QA 2V5QC 3NOGD 5ENSD 4DX6D 1A5EA 4G8LA 1MX6A 4BESA 4OAVB 4OAUC 5FINA 4G8KA 1BD8A 4HLLA 4DX1A 4O1PA 2A5EA 5AQ7A 3TWWA 2ETCA 5JA4D 1BLXB 4YDYA 5ENPD 3T8KA 1IKND 3W9FA 5EIDA 4QFVA 1YMPA 4ATZD 3TWTA 3V31A 4HRNA 3F6QA 3ZUVB 3W9GA 2XZDG 1K3ZD 1OT8A 4N5QA 5D66A 3TWXA 2KXPC 3EU9A 5EYLA 5AARA 4ZFHA 1YCSB 2BKKB 4HI9A 1WDYA 2FO1E 3B7BA 2HE0A 2ZGGA 5ENQD 5AQBA 2P2CP 4F6RD 5CEAA 3V30A 4HBDA 2F8YA 2J8SD 4CZ2D 3JXIA 1N11A 1S70B 1UOHA 4Z68A 2KBXA 2L6BA 1OY3D 5CBNA 4HNAD 4LSZE 4K5AB 3UI2A 3TWQA 4HB5A 4ZHBA 3TWSA 2XEEA 4K5BA 2F37A 4U96D 1BI7B 5FIOA 2Y0BG 3V2OA 5EIBE 3UXGA 4F1PA 2AJAA 3TWRA 4U8YD 1DC2A 3DEOA 4GMRA 3KEAA 4O1OA 3EHRA 4CYMD 3DEPA 1K1AA 5AQAA 3ZU7B 4DRXE 5ENOD 1TR4A 4U95D 3LJNA 1AP7A 1YYHA 2RFAA 5CERB 2MYOA 2B0OE 2V4HC 1NFIE 4B93B 4HRLA 3V2XA 4YDWA 3T9KA 4QQIA 3V79K 5JMND 3Q9UC 5EYPF 5HS0A 1QYMA 2QYJA 4UUCA 2RFMA 5AAOA 1D9SA 4DX7D 2BKGA 2VGEA 1G3NB 3SO8A 4C48B 2PNNA
chains in the Genus database with same CATH superfamily
3FDHA 2DYRE 5HRYA 2GRPB 3NQPA 3FU5A 2X6JA 4DK5A 3PEUB 1FVHA 1SZ9A 5KNGA 3PH0C 4BWRA 4HORA 1QBQA 3G2WA 2R2LA 4YDEA 5KJLA 4J8YA 3UM2A 3ZXSA 4HI8A 1BU9A 4ANWA 4GTTA 4TUUA 3Q5MA 1IHGA 5BV1A 1Z6TA 2WXLA 3GYZA 4UWGA 5CHEE 3CVXA 3I4RB 2A5EA 4O1PA 4J6IA 3L9TA 1W3BA 4HVBA 2WXQA 4GAAA 3JQ1A 3AS8A 2LUHA 3B13A 3VLDA 3PE3A 3CSTA 1YCSB 5ENQD 4LERA 3PUJA 4FJYA 4GYWA 3ZN3A 4A1SA 5ANRA 2LSUA 3TWQA 3CIAA 4U96D 4XI0A 4JC8A 4PUCA 2OV8A 4WNFA 2XPYA 3AS5A 3ABLE 4XEIG 4DLOA 1MHQA 5FQ6A 2FEZA 2V8SE 5AAOA 1L5JA 1G3NB 1TJFA 4OVUA 3QNKA 4HS2A 4WNEA 5CBOA 4O60A 5T8IA 3QWPA 2CHWA 1DCQA 3LXUX 1RZ4A 3T5VA 1HH8A 2WXFA 2NC9A 3FUNA 2CHXA 3UINC 3ASGA 3ZKJA 2WB2A 3CK9A 3FUKA 4UI9C 4I1AA 4C9BB 2P9UG 4U0ZA 1YA0A 5ENPD 2YHCA 3FTSA 1IKND 3C72A 3TXMA 2VGXA 3DPDA 4LNBA 1A17A 2R59A 4GCNA 5AARA 2CHZA 3V30A 4CZ2D 4UWKA 1UOHA 3CVQA 2ZXWE 3LJ3A 1NA3A 3Q78A 5FZQA 4LEUA 1P5QA 4FLHA 5LOZA 3KEAA 3FU6A 2MYOA 3E34A 4I17A 4C0EA 3V79K 1KLXA 3JCKC 3L13A 4A3VA 3CHMA 1NI1A 4Q69A 4XZ4A 5BW8C 3BG1B 3P1UA 3LY7A 5ENRD 2KCVA 5D2MC 2EIJE 5KWDA 4HRMB 2GRNB 2KZTA 3GZ2A 2R05A 3APFA 5ITZF 4B94A 2P9SG 1QQEA 4PH4B 3CEQA 2MHKA 5JHBA 1N54A 3ZGQA 3CSFA 2Y4TA 5AQ7A 3ASOE 3AG1E 4LNGA 3BEEA 2WXGA 2NXPA 2WQ6A 4O6FA 3FUHA 2E0IA 1TEZA 4L1BA 3G2SA 2I1JA 2VTBA 2X6HA 2HE0A 2A4ZA 4XI9A 4N2SA 5AIJA 4G1TA 5JJ7A 2NSZA 4UWHA 4ZHBA 2XCCA 2H6GA 4GU5A 3G2TA 3C3RA 5FIOA 4XKBA 4U8YD 5FWQA 4TXQA 1H0AA 4TXPA 3D3MA 4G24A 3RU0A 5KJKA 2V4HC 3HXBA 2IFUA 3LVQE 3RJVA 2FO7A 2H6HA 4I6EA 4WWPA 4L23A 4U0UA 3SO8A 4EBAA 3B7RL 3Q75A 4MRUA 3TWVA 3MV2B 4GCOA 1K1BA 5ENTD 3LCAA 3D9PA 2MOWA 4YVOA 3PE4A 3E37A 1KT1A 1Y6IA 4GMJA 4TV3A 1ZB1A 2X6IA 4CGWA 2V5FA 3KSQA 3PZ4A 5EILA 4CRWA 4F7AA 5EKQD 3OXLA 4AM9A 4IN3B 4DJAA 2V5QC 2IU1A 1SZAA 2BEDA 3HXCA 3LPZA 5KCMA 3APDA 3G2UA 2JEKA 4U07A 2J4BA 2L9BA 1YMPA 4EBAG 4PS3A 1TNZA 4MKTA 1LD8A 3Q7AA 4FC8A 3E4BA 1QNFA 4TXRA 4AY5A 3UI2A 3QC1A 3IKOB 5G04J 2WXJA 3WG7E 4ANVA 1JCQA 2XRZA 2DBAA 1O1SA 3ZYQA 2XGOA 3HXEA 2KCLA 1HF8A 1UN9A 1E7VA 2EIME 3MV3B 4U7EB 4EECA 2BKGA 4B89A 3I5PA 1QZ2A 2VQ2A 2EIKE 4NACA 1E7UA 3AAAC 4DUIA 4XKCA 4L9PA 5BV0A 3L16A 3T5XA 3URZA 3TWUA 3D9HA 4N2QA 4UWFA 1LTXA 4NIKA 4HFGA 4G11A 4I2WA 2ETAA 5FZSA 4EZLA 1IHBA 4AV7A 1GW6A 2UY1B 1HFAA 3CQCB 3NOGD 1MX6A 3DSWA 3PZDA 1BD8A 3EU5A 4GMLA 4HLLA 3U3WA 3RKVA 2P58C 2Y4UA 3UM3A 3Q7FA 4FU3A 3V31A 2XZDG 4FHJA 1D8DA 3E30A 1MZCA 4BFRA 3ASDA 4PS8A 1WDYA 3NZSA 4EPZA 5CEAA 2IO3C 2XRYA 3AG3E 1LF8A 3VLFA 2FF4A 4NURA 3C98A 3ZYKA 2XS8A 3FTZA 1O1TA 2Y0BG 1OCZE 2J09A 4V3IA 3MYVA 3DEOA 3LYAA 3K9IA 5ENOD 1IYGA 4U95D 2IONA 4GTMA 1E8XA 3LJNA 4A1GA 1AP7A 5A23A 2H6IA 3ESLA 4BT9A 5HQ8A 3TG5A 3U64A 4HRLA 5C1DA 4E85A 3QOUA 1D9SA 4G23A 3ZW3A 3MX3A 3QWVA 4MBGA 4WNDA 3UTMA 2WMOA 1N9AA 2HR2A 3D9NA 2RKKA 1JCSA 1DNPA 3EUVA 2QY7A 3ZNGA 2P9NG 3FTXA 3FUFA 3HVEA 2LSVA 2WQHA 1AWCB 4U8VD 3HHMA 5ENSD 3KAEA 3PUKA 4IULA 1E8ZA 4DX1A 2CG2A 3DSVA 1JPLA 3N71A 5G05J 4GZ6A 4L7TA 2F0YA 4JPSA 2M63A 3UKRG 4F1SA 3FTUA 5G2NA 5D66A 4I1OB 4FADA 3UUXA 1HXIA 4LUNU 2DCPA 5G04C 5LCWC 3U66A 2VSOE 1U3DA 2PM7A 3GZSA 3TL5A 3ULEG 3C3OA 2VSYA 1OWLA 2PZIA 4N3CA 2PL2A 3GZ1A 1IQUA 4U63A 4DRXE 3AG2E 3LKUA 1TR4A 3CKCA 3G2VA 4KBQA 1KZPA 3CKBA 4B93B 4KZ0A 4QQIA 3RK6A 3D9JA 4Y6WA 4JW1A 4PDXA 3L22A 3S2AA 4DX2A 1MX2A 1N0RA 2XENA 3ISMC 1NZNA 1TN6A 3HRAA 5KJMA 3P2BA 4JEHA 3QK0A 2KCKA 4NQ0A 4YNDA 5CECB 1TJCA 3EJNA 3NOCD 2NYJA 3TG4A 3UT8A 4CDRA 5FINA 2IOSA 4K0RA 5E76A 4WUYA 1TN7A 4GTOA 4GA1A 4ILHB 4J8SA 4J8FA 5HI7A 4HRNA 3SFYA 3D9MA 3B7TA 3FULA 3LEWA 3L17A 3OAWA 2WMNA 2J8SD 5CCLA 2L6JA 2ZISA 4UQXA 2J07A 3CHSA 5M72A 1S70B 4FHKA 5FQ7A 1BPOA 3FUDA 5AYWD 4HOSA 5FQ8A 4FJZA 4CGVA 2AJAA 1EDUA 4BTAA 2VSXE 3EHNA 3EDTB 2MRIA 3FUEA 4EZJA 3PZ3A 3PNLB 3GW4A 3FU0A 5JMND 2QYJA 1NP7A 4EZKA 4L2LA 1UW4B 4JB8P 1N52A 5DBKA 1D8EA 4BSZB 1DVPA 3ENEA 2X38A 3UT7A 3DWLG 3PREA 2IOLA 5KJNA 1TNYA 1TNOA 4G2VA 4JA9A 1U3CA 4G25A 4ILIA 4GZ5A 1WM5A 1XGWA 1E8WA 2WXOA 5G05C 2CFZA 5H7PA 1EPUA 2R02A 3DSXA 3CR3A 4APOA 4DPRA 4TRQA 4QFVA 3VTYA 4MLPA 1KPSB 3UM0A 3CK7A 3ULQA 2BKKB 1SA4A 2ZGGA 2P2CP 4HBDA 3UPVA 3UKUG 4J8EA 4UQYA 2C0MA 4CT0A 2BF0X 3CVYA 1FVFA 3CHPA 3KSLA 4HB5A 1UN8A 3UXGA 2J4DA 3TWRA 2VGXB 5JJTA 5BT1A 5BUZA 3S7DA 2R5SA 1IQRA 4Y6CA 3O48A 1UJJA 2GRRB 3O4ZA 4YDWA 4UI9K 2Y69E 1WY6A 5AENA 3FEXA 2PNNA 2R17C 2ZGDA 4RG9A 2WXRA 1FT2A 4AXHA 2QZAA 1HU3A 2XGSA 3U4TA 4BETA 3UX4A 5HKPA 2GGFA 4H7XA 2XPIA 1JUQA 2JLBA 4YDOA 5EN5D 2QC9A 3NB2A 4HOTA 2ONDA 3OXGA 3IXEA 3QB2A 5FJYA 4KT6B 3ABKE 3Q9NC 2Y1LE 3L08A 3MKQA 4B0ZA 4I2ZA 3PRZA 4OAVB 2FBNA 4G8KA 4WWNA 5A6CA 4G26A 1BLXB 1ELWA 4BSXA 5CRVA 1E90A 1Q2ZA 2WM9A 4ATZD 2P9IG 1OCCE 3MJWA 2LNIA 1OT8A 2V0PA 3OTNA 1TYQG 2KZTB 3PVLA 4R7LA 3JUIA 3LS8A 4N39A 5FTPA 3ML8A 4XE0A 3KS2A 5FQ4A 3ZVVA 3IV0A 3LDZA 2YHEA 4HOQA 3B7UX 5C2YA 4F1PA 5IY5E 3EHRA 5T3RA 1K1AA 2VJ8A 3UIPC 4AP2A 3S7BA 2WXIA 2VTBB 3Q9UC 5EYPF 2YINA 2L0IA 3DRAA 4ATGA 4I1MA 2XPZA 4WNGA 5KBAA 5CEDB 3ZFWA 1H2TC 3SFXA 5KNHD 2WXHA 3MZLB 3SQVA 3RAUA 4KZCA 2XZTG 3HG0D 4ACKA 4XX5A 3DSUA 2DWZA 2XEVA 3C5RA 1IXVA 1HS6A 5BXOA 5LX8A 2YQ8A 4JD2G 3C3QA 3EHQA 2JABA 3DPYA 1SW6A 4OVVA 4U8HA 4GPKA 1NL4A 2XCBA 1U2VG 1X81A 5CRUA 2H6FA 4GZDA 3X2QE 3T8KA 1UJKA 4AJWA 2GROB 3W9GA 3IHVA 4CDMA 1E96B 3TWXA 5ANLA 5B1BE 5EYLA 4GYOA 1K8KG 4WWOA 3SZ7A 2HO1A 1N4RA 1VDYA 3S7JA 2VGYA 2L6BA 5CBNA 1ELKA 4HNAD 4LSZE 3R9AB 4EQFA 4ME2A 3CVLA 3QJZA 2ZIRA 3SBTB 3ASHA 4P29A 2GW1A 4W9RA 1KT0A 3DEPA 3QARA 1OUVA 3JYSA 3DBSA 4RSYA 2QFCA 3FP3A 3L82A 2X3MA 1XNFA 4IYPA 4LNUD 3JUEA 5AQ9A 3FH5A 3QDNA 1RW2A 4K5CA 5CCMA 4JVSA 5EDSA 3NBNB 3ULYA 3QKYA 1V55E 4FULA 1MX4A 4BEPA 3UMVA 3MEKA 2J08A 4RQIA 3I4GA 4M7CA 4E6HA 4A3TA 3ZYMA 1V54E 2DVWA 1S64A 4C0MA 5EX3A 3SNXA 1TNBA 4BTBA 2I1KA 5EX0A 4LCTA 3FH7A 3DXKG 3IBEA 3FTVA 2VSNA 3TWTA 4ABNA 4GYYA 2LAIA 3CLJA 5JHAA 2AVPA 4LRZA 1ZBPA 5AJLA 3R9MA 1N11A 2IO2C 1INZA 3FHEA 1B89A 3ZHEA 4N3BA 3S7FA 3CVUA 4N3AA 2AXVA 1BI7B 3RIBA 3SY2A 1OCRE 2AXZA 5JJ6A 4GMRA 3CVWA 4KVMA 4I6JA 2KM4A 4GA0A 2Q7FA 2IQCA 4GTQA 4ACLA 5A7DB 4DX7D 2RG8A 4JHJA 2CFUA 4XIFA 2EILE 2LXLA 4LG6A 4UWLA 2PM6A 4KMOA 3ZEFA 1O1RA 3UM1A 2X6KA 3ONKA 4TUMA 3RO2A 3ML9A 4A63B 1EYHA 2P9PG 1PY1A 3Q79A 4HQDA 2WPVA 3IHYA 3D9IA 3B95A 3KD7A 3QAQA 4YVQC 3DSTA 1H6OA 3OXFA 3T8MA 2OCCE 1BI8B 4BY6A 4G8LA 2WXNA 2BUGA 1HG5A 4Q96A 3HYMB 3TWWA 4BX8A 4GTSA 5ENNA 3CHQA 1EF1C 1HE8A 2AXUA 1X5BA 5D0OD 3IEGA 4N5CA 2FI7A 3HVEB 2P9LG 4F6RD 2XQ0A 3VTXA 3TJPA 2OOEA 3Q4AB 4B8CB 3SBSA 4HOUA 3UQ3A 3ONLA 4GA2A 3ZHEB 3UT4A 4O1OA 4JA7A 4AIFA 5AQAA 4ANXA 3BQOA 3LY9A 4H7YA 2GRLA 3E33A 4M3OA 1OXJA 4X8QA 5CERB 2B0OE 1NFIE 1HX8A 3T9KA 1QYMA 1N4QA 2RFMA 2I2OA 3AU4A 3ZXPA 3JXJA 1WG0A 3EHMA 4J7WA 2F8XK 3BUAA 4IRUA 4J0UA 1MYOA 1H19A 4GTVA 2LAHA 4GPMA 2WVIA 1TNUA 3PZ1A 3HDXA 1A5EA 1PC2A 4DX6D 3AG4E 3MCXA 1OWPA 4WAFA 4MS6A 4CDNA 1H6PA 2ILRA 2UWJG 3LY8A 4GZ3A 3RRUA 4D10C 2C2LA 3F6QA 2PQRA 5D0QD 3SF4A 1FPPA 2KXPC 3FEYA 3QWWA 4I43A 2J49A 3BU8A 1S63A 1S0PA 5BPPA 3EIQC 3MGBA 4Z68A 2KBXA 1O5MA 3V2OA 3PEVB 2AWIA 3VLEA 2E2EA 3D9OA 2OVBA 1JCRA 5ARFA 2IEJA 3NF1A 3D9LA 3FH8A 2ZU6B 4KVOA 1HG2A 2YNQA 5BNWA 4DX5D 2A5UA 1MQSA 4GTPA 3Q73A 1MJ0A 2V4LA 5BXUA 1H2VC 3MA5A 5LFAA 3J5PA 3CVPA 3WXXA 4RLYA 2WQ7A 2WXPA 1H6KA 2KATA 3Q47B 2RD0A 3Q15A 2HM8A 4BT8A 2VYIA 4U0SA 1PAQA 3AU5A 2I6HA 3ASFA 3TAXA 2DYSE 2C0LA 3SD5A 2P9KG 3FTWA 2LXMA 1SQMA 1NA0A 2QYUA 3ZUVB 3ESKA 3EU9A 3SHFA 2R03A 4ZFHA 2FO1E 3CHOA 4J8DA 2F8YA 3FUMA 4BX9A 4K03A 4EHMA 5AJDA 1TN8A 1OY3D 5E75A 3ZYLA 4CEMA 4HXIA 4K5AB 3SI5A 2EINE 4URKA 3PNTB 2XEEA 2XGMA 3JQ0A 3TXNA 2HYZA 4UQZA 4CYMD 3ZU7B 5FT9A 4CCAA 1JWGA 4JZYA 4CT4A 1N4PA 3RRMB 2UY1A 3FUIA 2EQXA 5CMWA 3HXFA 4Q94A 1FCHA 4UUCA 3PDNA 3FWVA 4APFA 1Z3YA 4ANUA 2GRMA 4OYSA 5LP0A 4AOFA 4F3VA 4L2YA 4A55A 3J5QB 1OWNA 2DZNA 5DIZA 5J08A 2DZOA 2KC7A 2BTDA 3AS4A 3BG0B 2XEHA 3DSSA 4RG6A 1OWMA 3CHRA 5AN8A 1WAO1 3AJIA 1E8YA 4AVXA 3PZ2A 4GB9A 3RSEG 4BESA 2OEWA 4I6GA 1KZOA 2B6CA 3ZRHA 4DLQA 1Z3XA 2ETCA 2DIWA 2WXMA 5JA4D 2CG3A 5EIDA 3CV0A 2IJGX 5CMYA 3SGHA 5LCWJ 4GZCA 1JWFA 3LVRE 4U04A 3RRNB 4JL0A 4JEUA 3APCA 3B7BA 1HO8A 4KYOB 4I9CA 1LD7A 3MKQB 4JHRA 5FZRA 3TWSA 3CK8A 2X6FA 4K5BA 2F37A 3ABME 5EIBE 2J9QA 4PS7A 3I3NA 1UG3A 1SA5A 1ZU2A 2RFAA 2PQNA 3CVNA 2OVFA 3V2XA 3NZUA 3Q49B 3B7SA 2GRQB 5HS0A 3ASNE 4NRHB 4C48B 3D9KA 2ETBA 2Y3AA 1DCEA 1FT1A 2I9CA 3R7QA 4JHKA 3L6AA 5ARGA 3PS6A 4FP7A 1OWOA 1OCOE 2LO6A 5B1AE 4FLBA 2XHEA 1N4SA 2FULA 1SVXA 3TGOA 4HLEA 4DI4A 2IF4A 4KXKB 4BERA 2XS1A 1N0QA 1H2UA 4OAUC 4UI9J 1ELRA 3HXDA 3KEZA 3FFLA 1HZ4A 3E32A 3FY4A 3U9WA 3CVVA 4YDYA 3HIZA 3R7RA 3W9FA 3L54A 1Z5SC 3UIOC 1K3ZD 4N5QA 4FA6A 4HI9A 5J90A 3RO3A 4AEZC 5AQBA 4F53A 4RVBA 4AY6A 5B3SE 3JXIA 2WXKA 3EIJA 4GTRA 3CGHA 1N94A 3CQGB 2L0TB 4DI3A 3FUJA 3FU3A 1N95A 5T4YA 4B8AA 3NAWA 3ZPJA 1DC2A 3DXMG 3SFZA 2OEVA 4I9EA 2IY0C 1YYHA 2AW6A 3ZIMA 4ILGA 3FTYA 3MKRA 1Y8MA 5G55A 2VGEA 4JXTA
chains in the Genus database with same CATH topology
3TWVA 4JB8P 2ZGDA 2ETBA 4LNUD 3JUEA 3JXJA 1WG0A 1K1BA 5KBAA 3UTMA 5CBOA 4O60A 5ENTD 3AAAC 5HRYA 4DX2A 4DX5D 5CEDB 4J7WA 5ENRD 4LG6A 5AQ9A 4BSZB 4DUIA 2F8XK 1MX2A 5KNHD 1N0RA 1DCQA 3J5QB 2XENA 1MJ0A 2DZNA 3HRAA 4K5CA 4BETA 5BXUA 3NBNB 3J5PA 2XZTG 5HKPA 3HG0D 4TUMA 1MYOA 3TWUA 1MX4A 3D9HA 5KNGA 4A63B 4BEPA 5KWDA 4NIKA 2DZOA 3ZNGA 4HQDA 3ZKJA 2DWZA 4GPMA 4HRMB 5EN5D 2ETAA 4RLYA 2QC9A 2XEHA 1IXVA 3C5RA 3B95A 1IHBA 4J8YA 5CECB 5BXOA 1SVXA 1AWCB 4HI8A 3IXEA 1BU9A 5ITZF 5EILA 3EHQA 5AN8A 2JABA 3AJIA 3NOCD 3Q9NC 2DVWA 2NYJA 2Y1LE 1SW6A 4U8VD 4BERA 1BI8B 1N0QA 2V5QC 3NOGD 5ENSD 4DX6D 1A5EA 4G8LA 1MX6A 4BESA 4OAVB 4OAUC 5FINA 4G8KA 1BD8A 4HLLA 4DX1A 4O1PA 2A5EA 5AQ7A 3TWWA 2ETCA 5JA4D 1BLXB 4YDYA 5ENPD 3T8KA 1IKND 3W9FA 5EIDA 4QFVA 1YMPA 4ATZD 3TWTA 3V31A 4HRNA 3F6QA 3ZUVB 3W9GA 2XZDG 1K3ZD 1OT8A 4N5QA 5D66A 3TWXA 2KXPC 3EU9A 5EYLA 5AARA 4ZFHA 1YCSB 2BKKB 4HI9A 1WDYA 2FO1E 3B7BA 2HE0A 2ZGGA 5ENQD 5AQBA 2P2CP 4F6RD 5CEAA 3V30A 4HBDA 2F8YA 2J8SD 4CZ2D 3JXIA 1N11A 1S70B 1UOHA 4Z68A 2KBXA 2L6BA 1OY3D 5CBNA 4HNAD 4LSZE 4K5AB 3UI2A 3TWQA 4HB5A 4ZHBA 3TWSA 2XEEA 4K5BA 2F37A 4U96D 1BI7B 5FIOA 2Y0BG 3V2OA 5EIBE 3UXGA 4F1PA 2AJAA 3TWRA 4U8YD 1DC2A 3DEOA 4GMRA 3KEAA 4O1OA 3EHRA 4CYMD 3DEPA 1K1AA 5AQAA 3ZU7B 4DRXE 5ENOD 1TR4A 4U95D 3LJNA 1AP7A 1YYHA 2RFAA 5CERB 2MYOA 2B0OE 2V4HC 1NFIE 4B93B 4HRLA 3V2XA 4YDWA 3T9KA 4QQIA 3V79K 5JMND 3Q9UC 5EYPF 5HS0A 1QYMA 2QYJA 4UUCA 2RFMA 5AAOA 1D9SA 4DX7D 2BKGA 2VGEA 1G3NB 3SO8A 4C48B 2PNNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TWV A;  4JB8 P;  2ZGD A;  2ETB A;  4LNU D;  3JUE A;  3JXJ A;  1WG0 A;  1K1B A;  5KBA A;  3UTM A;  5CBO A;  4O60 A;  5ENT D;  3AAA C;  5HRY A;  4DX2 A;  4DX5 D;  5CED B;  4J7W A;  5ENR D;  4LG6 A;  5AQ9 A;  4BSZ B;  4DUI A;  2F8X K;  1MX2 A;  5KNH D;  1N0R A;  1DCQ A;  3J5Q B;  2XEN A;  1MJ0 A;  2DZN A;  3HRA A;  4K5C A;  4BET A;  5BXU A;  3NBN B;  3J5P A;  2XZT G;  5HKP A;  3HG0 D;  4TUM A;  1MYO A;  3TWU A;  1MX4 A;  3D9H A;  5KNG A;  4A63 B;  4BEP A;  5KWD A;  4NIK A;  2DZO A;  3ZNG A;  4HQD A;  3ZKJ A;  2DWZ A;  4GPM A;  4HRM B;  5EN5 D;  2ETA A;  4RLY A;  2QC9 A;  2XEH A;  1IXV A;  3C5R A;  3B95 A;  1IHB A;  4J8Y A;  5CEC B;  5BXO A;  1SVX A;  1AWC B;  4HI8 A;  3IXE A;  1BU9 A;  5ITZ F;  5EIL A;  3EHQ A;  5AN8 A;  2JAB A;  3AJI A;  3NOC D;  3Q9N C;  2DVW A;  2NYJ A;  2Y1L E;  1SW6 A;  4U8V D;  4BER A;  1BI8 B;  1N0Q A;  2V5Q C;  3NOG D;  5ENS D;  4DX6 D;  1A5E A;  4G8L A;  1MX6 A;  4BES A;  4OAV B;  4OAU C;  5FIN A;  4G8K A;  1BD8 A;  4HLL A;  4DX1 A;  4O1P A;  2A5E A;  5AQ7 A;  3TWW A;  2ETC A;  5JA4 D;  1BLX B;  4YDY A;  5ENP D;  3T8K A;  1IKN D;  3W9F A;  5EID A;  4QFV A;  1YMP A;  4ATZ D;  3TWT A;  3V31 A;  4HRN A;  3F6Q A;  3ZUV B;  3W9G A;  2XZD G;  1K3Z D;  1OT8 A;  4N5Q A;  5D66 A;  3TWX A;  2KXP C;  3EU9 A;  5EYL A;  5AAR A;  4ZFH A;  1YCS B;  2BKK B;  4HI9 A;  1WDY A;  2FO1 E;  3B7B A;  2HE0 A;  2ZGG A;  5ENQ D;  5AQB A;  2P2C P;  4F6R D;  5CEA A;  3V30 A;  4HBD A;  2F8Y A;  2J8S D;  4CZ2 D;  3JXI A;  1N11 A;  1S70 B;  1UOH A;  4Z68 A;  2KBX A;  2L6B A;  1OY3 D;  5CBN A;  4HNA D;  4LSZ E;  4K5A B;  3UI2 A;  3TWQ A;  4HB5 A;  4ZHB A;  3TWS A;  2XEE A;  4K5B A;  2F37 A;  4U96 D;  1BI7 B;  5FIO A;  2Y0B G;  3V2O A;  5EIB E;  3UXG A;  4F1P A;  2AJA A;  3TWR A;  4U8Y D;  1DC2 A;  3DEO A;  4GMR A;  3KEA A;  4O1O A;  3EHR A;  4CYM D;  3DEP A;  1K1A A;  5AQA A;  3ZU7 B;  4DRX E;  5ENO D;  1TR4 A;  4U95 D;  3LJN A;  1AP7 A;  1YYH A;  2RFA A;  5CER B;  2MYO A;  2B0O E;  2V4H C;  1NFI E;  4B93 B;  4HRL A;  3V2X A;  4YDW A;  3T9K A;  4QQI A;  3V79 K;  5JMN D;  3Q9U C;  5EYP F;  5HS0 A;  1QYM A;  2QYJ A;  4UUC A;  2RFM A;  5AAO A;  1D9S A;  4DX7 D;  2BKG A;  2VGE A;  1G3N B;  3SO8 A;  4C48 B;  2PNN A; 
#chains in the Genus database with same CATH topology
 3FDH A;  2DYR E;  5HRY A;  2GRP B;  3NQP A;  3FU5 A;  2X6J A;  4DK5 A;  3PEU B;  1FVH A;  1SZ9 A;  5KNG A;  3PH0 C;  4BWR A;  4HOR A;  1QBQ A;  3G2W A;  2R2L A;  4YDE A;  5KJL A;  4J8Y A;  3UM2 A;  3ZXS A;  4HI8 A;  1BU9 A;  4ANW A;  4GTT A;  4TUU A;  3Q5M A;  1IHG A;  5BV1 A;  1Z6T A;  2WXL A;  3GYZ A;  4UWG A;  5CHE E;  3CVX A;  3I4R B;  2A5E A;  4O1P A;  4J6I A;  3L9T A;  1W3B A;  4HVB A;  2WXQ A;  4GAA A;  3JQ1 A;  3AS8 A;  2LUH A;  3B13 A;  3VLD A;  3PE3 A;  3CST A;  1YCS B;  5ENQ D;  4LER A;  3PUJ A;  4FJY A;  4GYW A;  3ZN3 A;  4A1S A;  5ANR A;  2LSU A;  3TWQ A;  3CIA A;  4U96 D;  4XI0 A;  4JC8 A;  4PUC A;  2OV8 A;  4WNF A;  2XPY A;  3AS5 A;  3ABL E;  4XEI G;  4DLO A;  1MHQ A;  5FQ6 A;  2FEZ A;  2V8S E;  5AAO A;  1L5J A;  1G3N B;  1TJF A;  4OVU A;  3QNK A;  4HS2 A;  4WNE A;  5CBO A;  4O60 A;  5T8I A;  3QWP A;  2CHW A;  1DCQ A;  3LXU X;  1RZ4 A;  3T5V A;  1HH8 A;  2WXF A;  2NC9 A;  3FUN A;  2CHX A;  3UIN C;  3ASG A;  3ZKJ A;  2WB2 A;  3CK9 A;  3FUK A;  4UI9 C;  4I1A A;  4C9B B;  2P9U G;  4U0Z A;  1YA0 A;  5ENP D;  2YHC A;  3FTS A;  1IKN D;  3C72 A;  3TXM A;  2VGX A;  3DPD A;  4LNB A;  1A17 A;  2R59 A;  4GCN A;  5AAR A;  2CHZ A;  3V30 A;  4CZ2 D;  4UWK A;  1UOH A;  3CVQ A;  2ZXW E;  3LJ3 A;  1NA3 A;  3Q78 A;  5FZQ A;  4LEU A;  1P5Q A;  4FLH A;  5LOZ A;  3KEA A;  3FU6 A;  2MYO A;  3E34 A;  4I17 A;  4C0E A;  3V79 K;  1KLX A;  3JCK C;  3L13 A;  4A3V A;  3CHM A;  1NI1 A;  4Q69 A;  4XZ4 A;  5BW8 C;  3BG1 B;  3P1U A;  3LY7 A;  5ENR D;  2KCV A;  5D2M C;  2EIJ E;  5KWD A;  4HRM B;  2GRN B;  2KZT A;  3GZ2 A;  2R05 A;  3APF A;  5ITZ F;  4B94 A;  2P9S G;  1QQE A;  4PH4 B;  3CEQ A;  2MHK A;  5JHB A;  1N54 A;  3ZGQ A;  3CSF A;  2Y4T A;  5AQ7 A;  3ASO E;  3AG1 E;  4LNG A;  3BEE A;  2WXG A;  2NXP A;  2WQ6 A;  4O6F A;  3FUH A;  2E0I A;  1TEZ A;  4L1B A;  3G2S A;  2I1J A;  2VTB A;  2X6H A;  2HE0 A;  2A4Z A;  4XI9 A;  4N2S A;  5AIJ A;  4G1T A;  5JJ7 A;  2NSZ A;  4UWH A;  4ZHB A;  2XCC A;  2H6G A;  4GU5 A;  3G2T A;  3C3R A;  5FIO A;  4XKB A;  4U8Y D;  5FWQ A;  4TXQ A;  1H0A A;  4TXP A;  3D3M A;  4G24 A;  3RU0 A;  5KJK A;  2V4H C;  3HXB A;  2IFU A;  3LVQ E;  3RJV A;  2FO7 A;  2H6H A;  4I6E A;  4WWP A;  4L23 A;  4U0U A;  3SO8 A;  4EBA A;  3B7R L;  3Q75 A;  4MRU A;  3TWV A;  3MV2 B;  4GCO A;  1K1B A;  5ENT D;  3LCA A;  3D9P A;  2MOW A;  4YVO A;  3PE4 A;  3E37 A;  1KT1 A;  1Y6I A;  4GMJ A;  4TV3 A;  1ZB1 A;  2X6I A;  4CGW A;  2V5F A;  3KSQ A;  3PZ4 A;  5EIL A;  4CRW A;  4F7A A;  5EKQ D;  3OXL A;  4AM9 A;  4IN3 B;  4DJA A;  2V5Q C;  2IU1 A;  1SZA A;  2BED A;  3HXC A;  3LPZ A;  5KCM A;  3APD A;  3G2U A;  2JEK A;  4U07 A;  2J4B A;  2L9B A;  1YMP A;  4EBA G;  4PS3 A;  1TNZ A;  4MKT A;  1LD8 A;  3Q7A A;  4FC8 A;  3E4B A;  1QNF A;  4TXR A;  4AY5 A;  3UI2 A;  3QC1 A;  3IKO B;  5G04 J;  2WXJ A;  3WG7 E;  4ANV A;  1JCQ A;  2XRZ A;  2DBA A;  1O1S A;  3ZYQ A;  2XGO A;  3HXE A;  2KCL A;  1HF8 A;  1UN9 A;  1E7V A;  2EIM E;  3MV3 B;  4U7E B;  4EEC A;  2BKG A;  4B89 A;  3I5P A;  1QZ2 A;  2VQ2 A;  2EIK E;  4NAC A;  1E7U A;  3AAA C;  4DUI A;  4XKC A;  4L9P A;  5BV0 A;  3L16 A;  3T5X A;  3URZ A;  3TWU A;  3D9H A;  4N2Q A;  4UWF A;  1LTX A;  4NIK A;  4HFG A;  4G11 A;  4I2W A;  2ETA A;  5FZS A;  4EZL A;  1IHB A;  4AV7 A;  1GW6 A;  2UY1 B;  1HFA A;  3CQC B;  3NOG D;  1MX6 A;  3DSW A;  3PZD A;  1BD8 A;  3EU5 A;  4GML A;  4HLL A;  3U3W A;  3RKV A;  2P58 C;  2Y4U A;  3UM3 A;  3Q7F A;  4FU3 A;  3V31 A;  2XZD G;  4FHJ A;  1D8D A;  3E30 A;  1MZC A;  4BFR A;  3ASD A;  4PS8 A;  1WDY A;  3NZS A;  4EPZ A;  5CEA A;  2IO3 C;  2XRY A;  3AG3 E;  1LF8 A;  3VLF A;  2FF4 A;  4NUR A;  3C98 A;  3ZYK A;  2XS8 A;  3FTZ A;  1O1T A;  2Y0B G;  1OCZ E;  2J09 A;  4V3I A;  3MYV A;  3DEO A;  3LYA A;  3K9I A;  5ENO D;  1IYG A;  4U95 D;  2ION A;  4GTM A;  1E8X A;  3LJN A;  4A1G A;  1AP7 A;  5A23 A;  2H6I A;  3ESL A;  4BT9 A;  5HQ8 A;  3TG5 A;  3U64 A;  4HRL A;  5C1D A;  4E85 A;  3QOU A;  1D9S A;  4G23 A;  3ZW3 A;  3MX3 A;  3QWV A;  4MBG A;  4WND A;  3UTM A;  2WMO A;  1N9A A;  2HR2 A;  3D9N A;  2RKK A;  1JCS A;  1DNP A;  3EUV A;  2QY7 A;  3ZNG A;  2P9N G;  3FTX A;  3FUF A;  3HVE A;  2LSV A;  2WQH A;  1AWC B;  4U8V D;  3HHM A;  5ENS D;  3KAE A;  3PUK A;  4IUL A;  1E8Z A;  4DX1 A;  2CG2 A;  3DSV A;  1JPL A;  3N71 A;  5G05 J;  4GZ6 A;  4L7T A;  2F0Y A;  4JPS A;  2M63 A;  3UKR G;  4F1S A;  3FTU A;  5G2N A;  5D66 A;  4I1O B;  4FAD A;  3UUX A;  1HXI A;  4LUN U;  2DCP A;  5G04 C;  5LCW C;  3U66 A;  2VSO E;  1U3D A;  2PM7 A;  3GZS A;  3TL5 A;  3ULE G;  3C3O A;  2VSY A;  1OWL A;  2PZI A;  4N3C A;  2PL2 A;  3GZ1 A;  1IQU A;  4U63 A;  4DRX E;  3AG2 E;  3LKU A;  1TR4 A;  3CKC A;  3G2V A;  4KBQ A;  1KZP A;  3CKB A;  4B93 B;  4KZ0 A;  4QQI A;  3RK6 A;  3D9J A;  4Y6W A;  4JW1 A;  4PDX A;  3L22 A;  3S2A A;  4DX2 A;  1MX2 A;  1N0R A;  2XEN A;  3ISM C;  1NZN A;  1TN6 A;  3HRA A;  5KJM A;  3P2B A;  4JEH A;  3QK0 A;  2KCK A;  4NQ0 A;  4YND A;  5CEC B;  1TJC A;  3EJN A;  3NOC D;  2NYJ A;  3TG4 A;  3UT8 A;  4CDR A;  5FIN A;  2IOS A;  4K0R A;  5E76 A;  4WUY A;  1TN7 A;  4GTO A;  4GA1 A;  4ILH B;  4J8S A;  4J8F A;  5HI7 A;  4HRN A;  3SFY A;  3D9M A;  3B7T A;  3FUL A;  3LEW A;  3L17 A;  3OAW A;  2WMN A;  2J8S D;  5CCL A;  2L6J A;  2ZIS A;  4UQX A;  2J07 A;  3CHS A;  5M72 A;  1S70 B;  4FHK A;  5FQ7 A;  1BPO A;  3FUD A;  5AYW D;  4HOS A;  5FQ8 A;  4FJZ A;  4CGV A;  2AJA A;  1EDU A;  4BTA A;  2VSX E;  3EHN A;  3EDT B;  2MRI A;  3FUE A;  4EZJ A;  3PZ3 A;  3PNL B;  3GW4 A;  3FU0 A;  5JMN D;  2QYJ A;  1NP7 A;  4EZK A;  4L2L A;  1UW4 B;  4JB8 P;  1N52 A;  5DBK A;  1D8E A;  4BSZ B;  1DVP A;  3ENE A;  2X38 A;  3UT7 A;  3DWL G;  3PRE A;  2IOL A;  5KJN A;  1TNY A;  1TNO A;  4G2V A;  4JA9 A;  1U3C A;  4G25 A;  4ILI A;  4GZ5 A;  1WM5 A;  1XGW A;  1E8W A;  2WXO A;  5G05 C;  2CFZ A;  5H7P A;  1EPU A;  2R02 A;  3DSX A;  3CR3 A;  4APO A;  4DPR A;  4TRQ A;  4QFV A;  3VTY A;  4MLP A;  1KPS B;  3UM0 A;  3CK7 A;  3ULQ A;  2BKK B;  1SA4 A;  2ZGG A;  2P2C P;  4HBD A;  3UPV A;  3UKU G;  4J8E A;  4UQY A;  2C0M A;  4CT0 A;  2BF0 X;  3CVY A;  1FVF A;  3CHP A;  3KSL A;  4HB5 A;  1UN8 A;  3UXG A;  2J4D A;  3TWR A;  2VGX B;  5JJT A;  5BT1 A;  5BUZ A;  3S7D A;  2R5S A;  1IQR A;  4Y6C A;  3O48 A;  1UJJ A;  2GRR B;  3O4Z A;  4YDW A;  4UI9 K;  2Y69 E;  1WY6 A;  5AEN A;  3FEX A;  2PNN A;  2R17 C;  2ZGD A;  4RG9 A;  2WXR A;  1FT2 A;  4AXH A;  2QZA A;  1HU3 A;  2XGS A;  3U4T A;  4BET A;  3UX4 A;  5HKP A;  2GGF A;  4H7X A;  2XPI A;  1JUQ A;  2JLB A;  4YDO A;  5EN5 D;  2QC9 A;  3NB2 A;  4HOT A;  2OND A;  3OXG A;  3IXE A;  3QB2 A;  5FJY A;  4KT6 B;  3ABK E;  3Q9N C;  2Y1L E;  3L08 A;  3MKQ A;  4B0Z A;  4I2Z A;  3PRZ A;  4OAV B;  2FBN A;  4G8K A;  4WWN A;  5A6C A;  4G26 A;  1BLX B;  1ELW A;  4BSX A;  5CRV A;  1E90 A;  1Q2Z A;  2WM9 A;  4ATZ D;  2P9I G;  1OCC E;  3MJW A;  2LNI A;  1OT8 A;  2V0P A;  3OTN A;  1TYQ G;  2KZT B;  3PVL A;  4R7L A;  3JUI A;  3LS8 A;  4N39 A;  5FTP A;  3ML8 A;  4XE0 A;  3KS2 A;  5FQ4 A;  3ZVV A;  3IV0 A;  3LDZ A;  2YHE A;  4HOQ A;  3B7U X;  5C2Y A;  4F1P A;  5IY5 E;  3EHR A;  5T3R A;  1K1A A;  2VJ8 A;  3UIP C;  4AP2 A;  3S7B A;  2WXI A;  2VTB B;  3Q9U C;  5EYP F;  2YIN A;  2L0I A;  3DRA A;  4ATG A;  4I1M A;  2XPZ A;  4WNG A;  5KBA A;  5CED B;  3ZFW A;  1H2T C;  3SFX A;  5KNH D;  2WXH A;  3MZL B;  3SQV A;  3RAU A;  4KZC A;  2XZT G;  3HG0 D;  4ACK A;  4XX5 A;  3DSU A;  2DWZ A;  2XEV A;  3C5R A;  1IXV A;  1HS6 A;  5BXO A;  5LX8 A;  2YQ8 A;  4JD2 G;  3C3Q A;  3EHQ A;  2JAB A;  3DPY A;  1SW6 A;  4OVV A;  4U8H A;  4GPK A;  1NL4 A;  2XCB A;  1U2V G;  1X81 A;  5CRU A;  2H6F A;  4GZD A;  3X2Q E;  3T8K A;  1UJK A;  4AJW A;  2GRO B;  3W9G A;  3IHV A;  4CDM A;  1E96 B;  3TWX A;  5ANL A;  5B1B E;  5EYL A;  4GYO A;  1K8K G;  4WWO A;  3SZ7 A;  2HO1 A;  1N4R A;  1VDY A;  3S7J A;  2VGY A;  2L6B A;  5CBN A;  1ELK A;  4HNA D;  4LSZ E;  3R9A B;  4EQF A;  4ME2 A;  3CVL A;  3QJZ A;  2ZIR A;  3SBT B;  3ASH A;  4P29 A;  2GW1 A;  4W9R A;  1KT0 A;  3DEP A;  3QAR A;  1OUV A;  3JYS A;  3DBS A;  4RSY A;  2QFC A;  3FP3 A;  3L82 A;  2X3M A;  1XNF A;  4IYP A;  4LNU D;  3JUE A;  5AQ9 A;  3FH5 A;  3QDN A;  1RW2 A;  4K5C A;  5CCM A;  4JVS A;  5EDS A;  3NBN B;  3ULY A;  3QKY A;  1V55 E;  4FUL A;  1MX4 A;  4BEP A;  3UMV A;  3MEK A;  2J08 A;  4RQI A;  3I4G A;  4M7C A;  4E6H A;  4A3T A;  3ZYM A;  1V54 E;  2DVW A;  1S64 A;  4C0M A;  5EX3 A;  3SNX A;  1TNB A;  4BTB A;  2I1K A;  5EX0 A;  4LCT A;  3FH7 A;  3DXK G;  3IBE A;  3FTV A;  2VSN A;  3TWT A;  4ABN A;  4GYY A;  2LAI A;  3CLJ A;  5JHA A;  2AVP A;  4LRZ A;  1ZBP A;  5AJL A;  3R9M A;  1N11 A;  2IO2 C;  1INZ A;  3FHE A;  1B89 A;  3ZHE A;  4N3B A;  3S7F A;  3CVU A;  4N3A A;  2AXV A;  1BI7 B;  3RIB A;  3SY2 A;  1OCR E;  2AXZ A;  5JJ6 A;  4GMR A;  3CVW A;  4KVM A;  4I6J A;  2KM4 A;  4GA0 A;  2Q7F A;  2IQC A;  4GTQ A;  4ACL A;  5A7D B;  4DX7 D;  2RG8 A;  4JHJ A;  2CFU A;  4XIF A;  2EIL E;  2LXL A;  4LG6 A;  4UWL A;  2PM6 A;  4KMO A;  3ZEF A;  1O1R A;  3UM1 A;  2X6K A;  3ONK A;  4TUM A;  3RO2 A;  3ML9 A;  4A63 B;  1EYH A;  2P9P G;  1PY1 A;  3Q79 A;  4HQD A;  2WPV A;  3IHY A;  3D9I A;  3B95 A;  3KD7 A;  3QAQ A;  4YVQ C;  3DST A;  1H6O A;  3OXF A;  3T8M A;  2OCC E;  1BI8 B;  4BY6 A;  4G8L A;  2WXN A;  2BUG A;  1HG5 A;  4Q96 A;  3HYM B;  3TWW A;  4BX8 A;  4GTS A;  5ENN A;  3CHQ A;  1EF1 C;  1HE8 A;  2AXU A;  1X5B A;  5D0O D;  3IEG A;  4N5C A;  2FI7 A;  3HVE B;  2P9L G;  4F6R D;  2XQ0 A;  3VTX A;  3TJP A;  2OOE A;  3Q4A B;  4B8C B;  3SBS A;  4HOU A;  3UQ3 A;  3ONL A;  4GA2 A;  3ZHE B;  3UT4 A;  4O1O A;  4JA7 A;  4AIF A;  5AQA A;  4ANX A;  3BQO A;  3LY9 A;  4H7Y A;  2GRL A;  3E33 A;  4M3O A;  1OXJ A;  4X8Q A;  5CER B;  2B0O E;  1NFI E;  1HX8 A;  3T9K A;  1QYM A;  1N4Q A;  2RFM A;  2I2O A;  3AU4 A;  3ZXP A;  3JXJ A;  1WG0 A;  3EHM A;  4J7W A;  2F8X K;  3BUA A;  4IRU A;  4J0U A;  1MYO A;  1H19 A;  4GTV A;  2LAH A;  4GPM A;  2WVI A;  1TNU A;  3PZ1 A;  3HDX A;  1A5E A;  1PC2 A;  4DX6 D;  3AG4 E;  3MCX A;  1OWP A;  4WAF A;  4MS6 A;  4CDN A;  1H6P A;  2ILR A;  2UWJ G;  3LY8 A;  4GZ3 A;  3RRU A;  4D10 C;  2C2L A;  3F6Q A;  2PQR A;  5D0Q D;  3SF4 A;  1FPP A;  2KXP C;  3FEY A;  3QWW A;  4I43 A;  2J49 A;  3BU8 A;  1S63 A;  1S0P A;  5BPP A;  3EIQ C;  3MGB A;  4Z68 A;  2KBX A;  1O5M A;  3V2O A;  3PEV B;  2AWI A;  3VLE A;  2E2E A;  3D9O A;  2OVB A;  1JCR A;  5ARF A;  2IEJ A;  3NF1 A;  3D9L A;  3FH8 A;  2ZU6 B;  4KVO A;  1HG2 A;  2YNQ A;  5BNW A;  4DX5 D;  2A5U A;  1MQS A;  4GTP A;  3Q73 A;  1MJ0 A;  2V4L A;  5BXU A;  1H2V C;  3MA5 A;  5LFA A;  3J5P A;  3CVP A;  3WXX A;  4RLY A;  2WQ7 A;  2WXP A;  1H6K A;  2KAT A;  3Q47 B;  2RD0 A;  3Q15 A;  2HM8 A;  4BT8 A;  2VYI A;  4U0S A;  1PAQ A;  3AU5 A;  2I6H A;  3ASF A;  3TAX A;  2DYS E;  2C0L A;  3SD5 A;  2P9K G;  3FTW A;  2LXM A;  1SQM A;  1NA0 A;  2QYU A;  3ZUV B;  3ESK A;  3EU9 A;  3SHF A;  2R03 A;  4ZFH A;  2FO1 E;  3CHO A;  4J8D A;  2F8Y A;  3FUM A;  4BX9 A;  4K03 A;  4EHM A;  5AJD A;  1TN8 A;  1OY3 D;  5E75 A;  3ZYL A;  4CEM A;  4HXI A;  4K5A B;  3SI5 A;  2EIN E;  4URK A;  3PNT B;  2XEE A;  2XGM A;  3JQ0 A;  3TXN A;  2HYZ A;  4UQZ A;  4CYM D;  3ZU7 B;  5FT9 A;  4CCA A;  1JWG A;  4JZY A;  4CT4 A;  1N4P A;  3RRM B;  2UY1 A;  3FUI A;  2EQX A;  5CMW A;  3HXF A;  4Q94 A;  1FCH A;  4UUC A;  3PDN A;  3FWV A;  4APF A;  1Z3Y A;  4ANU A;  2GRM A;  4OYS A;  5LP0 A;  4AOF A;  4F3V A;  4L2Y A;  4A55 A;  3J5Q B;  1OWN A;  2DZN A;  5DIZ A;  5J08 A;  2DZO A;  2KC7 A;  2BTD A;  3AS4 A;  3BG0 B;  2XEH A;  3DSS A;  4RG6 A;  1OWM A;  3CHR A;  5AN8 A;  1WAO 1;  3AJI A;  1E8Y A;  4AVX A;  3PZ2 A;  4GB9 A;  3RSE G;  4BES A;  2OEW A;  4I6G A;  1KZO A;  2B6C A;  3ZRH A;  4DLQ A;  1Z3X A;  2ETC A;  2DIW A;  2WXM A;  5JA4 D;  2CG3 A;  5EID A;  3CV0 A;  2IJG X;  5CMY A;  3SGH A;  5LCW J;  4GZC A;  1JWF A;  3LVR E;  4U04 A;  3RRN B;  4JL0 A;  4JEU A;  3APC A;  3B7B A;  1HO8 A;  4KYO B;  4I9C A;  1LD7 A;  3MKQ B;  4JHR A;  5FZR A;  3TWS A;  3CK8 A;  2X6F A;  4K5B A;  2F37 A;  3ABM E;  5EIB E;  2J9Q A;  4PS7 A;  3I3N A;  1UG3 A;  1SA5 A;  1ZU2 A;  2RFA A;  2PQN A;  3CVN A;  2OVF A;  3V2X A;  3NZU A;  3Q49 B;  3B7S A;  2GRQ B;  5HS0 A;  3ASN E;  4NRH B;  4C48 B;  3D9K A;  2ETB A;  2Y3A A;  1DCE A;  1FT1 A;  2I9C A;  3R7Q A;  4JHK A;  3L6A A;  5ARG A;  3PS6 A;  4FP7 A;  1OWO A;  1OCO E;  2LO6 A;  5B1A E;  4FLB A;  2XHE A;  1N4S A;  2FUL A;  1SVX A;  3TGO A;  4HLE A;  4DI4 A;  2IF4 A;  4KXK B;  4BER A;  2XS1 A;  1N0Q A;  1H2U A;  4OAU C;  4UI9 J;  1ELR A;  3HXD A;  3KEZ A;  3FFL A;  1HZ4 A;  3E32 A;  3FY4 A;  3U9W A;  3CVV A;  4YDY A;  3HIZ A;  3R7R A;  3W9F A;  3L54 A;  1Z5S C;  3UIO C;  1K3Z D;  4N5Q A;  4FA6 A;  4HI9 A;  5J90 A;  3RO3 A;  4AEZ C;  5AQB A;  4F53 A;  4RVB A;  4AY6 A;  5B3S E;  3JXI A;  2WXK A;  3EIJ A;  4GTR A;  3CGH A;  1N94 A;  3CQG B;  2L0T B;  4DI3 A;  3FUJ A;  3FU3 A;  1N95 A;  5T4Y A;  4B8A A;  3NAW A;  3ZPJ A;  1DC2 A;  3DXM G;  3SFZ A;  2OEV A;  4I9E A;  2IY0 C;  1YYH A;  2AW6 A;  3ZIM A;  4ILG A;  3FTY A;  3MKR A;  1Y8M A;  5G55 A;  2VGE A;  4JXT A; 
#chains in the Genus database with same CATH homology
 3TWV A;  4JB8 P;  2ZGD A;  2ETB A;  4LNU D;  3JUE A;  3JXJ A;  1WG0 A;  1K1B A;  5KBA A;  3UTM A;  5CBO A;  4O60 A;  5ENT D;  3AAA C;  5HRY A;  4DX2 A;  4DX5 D;  5CED B;  4J7W A;  5ENR D;  4LG6 A;  5AQ9 A;  4BSZ B;  4DUI A;  2F8X K;  1MX2 A;  5KNH D;  1N0R A;  1DCQ A;  3J5Q B;  2XEN A;  1MJ0 A;  2DZN A;  3HRA A;  4K5C A;  4BET A;  5BXU A;  3NBN B;  3J5P A;  2XZT G;  5HKP A;  3HG0 D;  4TUM A;  1MYO A;  3TWU A;  1MX4 A;  3D9H A;  5KNG A;  4A63 B;  4BEP A;  5KWD A;  4NIK A;  2DZO A;  3ZNG A;  4HQD A;  3ZKJ A;  2DWZ A;  4GPM A;  4HRM B;  5EN5 D;  2ETA A;  4RLY A;  2QC9 A;  2XEH A;  1IXV A;  3C5R A;  3B95 A;  1IHB A;  4J8Y A;  5CEC B;  5BXO A;  1SVX A;  1AWC B;  4HI8 A;  3IXE A;  1BU9 A;  5ITZ F;  5EIL A;  3EHQ A;  5AN8 A;  2JAB A;  3AJI A;  3NOC D;  3Q9N C;  2DVW A;  2NYJ A;  2Y1L E;  1SW6 A;  4U8V D;  4BER A;  1BI8 B;  1N0Q A;  2V5Q C;  3NOG D;  5ENS D;  4DX6 D;  1A5E A;  4G8L A;  1MX6 A;  4BES A;  4OAV B;  4OAU C;  5FIN A;  4G8K A;  1BD8 A;  4HLL A;  4DX1 A;  4O1P A;  2A5E A;  5AQ7 A;  3TWW A;  2ETC A;  5JA4 D;  1BLX B;  4YDY A;  5ENP D;  3T8K A;  1IKN D;  3W9F A;  5EID A;  4QFV A;  1YMP A;  4ATZ D;  3TWT A;  3V31 A;  4HRN A;  3F6Q A;  3ZUV B;  3W9G A;  2XZD G;  1K3Z D;  1OT8 A;  4N5Q A;  5D66 A;  3TWX A;  2KXP C;  3EU9 A;  5EYL A;  5AAR A;  4ZFH A;  1YCS B;  2BKK B;  4HI9 A;  1WDY A;  2FO1 E;  3B7B A;  2HE0 A;  2ZGG A;  5ENQ D;  5AQB A;  2P2C P;  4F6R D;  5CEA A;  3V30 A;  4HBD A;  2F8Y A;  2J8S D;  4CZ2 D;  3JXI A;  1N11 A;  1S70 B;  1UOH A;  4Z68 A;  2KBX A;  2L6B A;  1OY3 D;  5CBN A;  4HNA D;  4LSZ E;  4K5A B;  3UI2 A;  3TWQ A;  4HB5 A;  4ZHB A;  3TWS A;  2XEE A;  4K5B A;  2F37 A;  4U96 D;  1BI7 B;  5FIO A;  2Y0B G;  3V2O A;  5EIB E;  3UXG A;  4F1P A;  2AJA A;  3TWR A;  4U8Y D;  1DC2 A;  3DEO A;  4GMR A;  3KEA A;  4O1O A;  3EHR A;  4CYM D;  3DEP A;  1K1A A;  5AQA A;  3ZU7 B;  4DRX E;  5ENO D;  1TR4 A;  4U95 D;  3LJN A;  1AP7 A;  1YYH A;  2RFA A;  5CER B;  2MYO A;  2B0O E;  2V4H C;  1NFI E;  4B93 B;  4HRL A;  3V2X A;  4YDW A;  3T9K A;  4QQI A;  3V79 K;  5JMN D;  3Q9U C;  5EYP F;  5HS0 A;  1QYM A;  2QYJ A;  4UUC A;  2RFM A;  5AAO A;  1D9S A;  4DX7 D;  2BKG A;  2VGE A;  1G3N B;  3SO8 A;  4C48 B;  2PNN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...