1SW6A

S. cerevisiae swi6 ankyrin-repeat fragment
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
301
structure length
254
Chain Sequence
GPIITFTHDLTSDFLSSPLKIMKALPSPVVNDNEQKMKLEAFLQRLLFSFDSLLQEVNDAFPNTQLNLNIPVDEHGNTPLHWLTSIANLELVKHLVKHGSNRLYGDNMGESCLVKAVKSVNNYDSGTFEALLDYLYPCLILEDSMNRTILHHIIITSGMTGCSAAAKYYLDILMGWIVKKQNRPIQSGDSILENLDLKWIIANMLNAQDSNGDTCLNIAARLGNISIVDALLDYGADPFIANKSGLRPVDFGAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulation
molecule keywords REGULATORY PROTEIN SWI6
publication title X-ray structural analysis of the yeast cell cycle regulator Swi6 reveals variations of the ankyrin fold and has implications for Swi6 function.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 89
structure length 254
sequence length 301
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13606 Ank_3 Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1sw6A00
1YCSB 3AJIA 5ENOD 3AAAC 4J7WA 2J8SD 5CBOA 4HI9A 3EHRA 3TWWA 1BD8A 3DEOA 4CYMD 3V2XA 2L6BA 3J5PA 4O1OA 4QFVA 1YYHA 3JXIA 2ZGDA 3T8KA 3ZU7B 5CEAA 5ENQD 1BI7B 3HRAA 4DX1A 4DUIA 1MX2A 1G3NB 3V30A 4OAUC 2F8XK 4DX5D 3V79K 1K1AA 1N11A 3D9HA 2B0OE 4N5QA 1BI8B 4HI8A 5AARA 4ZFHA 4OAVB 3IXEA 1A5EA 4LSZE 5JMND 4K5CA 1N0RA 4YDWA 3JXJA 1MX4A 3V2OA 2F8YA 1MJ0A 4DX2A 5AAOA 3JUEA 4A63B 1OT8A 2NYJA 1TR4A 4U96D 1S70B 4Z68A 3Q9UC 2QC9A 2RFMA 5ENTD 4HRMB 5JA4D 5CECB 5BXOA 2BKKB 5AQ9A 3NOGD 4UUCA 2V4HC 3ZKJA 4DX6D 4DRXE 1BLXB 3TWTA 2KXPC 1K3ZD 2V5QC 5D66A 5ENPD 4BESA 4YDYA 4K5AB 2PNNA 2DWZA 3F6QA 5EIDA 2RFAA 1DC2A 4U95D 4U8YD 4F6RD 3Q9NC 1IHBA 1NFIE 3HG0D 3EHQA 2XZDG 5EYPF 2JABA 3W9GA 5KNGA 3TWVA 4RLYA 5AQ7A 2ETAA 5KWDA 1YMPA 3TWQA 3B7BA 2XEEA 3UTMA 4O1PA 5ENSD 1AP7A 2ETBA 4BSZB 5ENRD 4HRNA 5CERB 1MYOA 2KBXA 4ATZD 2HE0A 2MYOA 3NBNB 4GPMA 1D9SA 3T9KA 4TUMA 1OY3D 5HS0A 4BETA 5CEDB 1AWCB 5EN5D 4LG6A 2XEHA 4O60A 2Y0BG 3UXGA 3C5RA 1WG0A 2BKGA 2A5EA 4HRLA 1N0QA 3ZNGA 4G8KA 4J8YA 5CBNA 4C48B 3KEAA 1UOHA 3ZUVB 2DZNA 2XENA 3NOCD 2XZTG 5EILA 5FIOA 4HB5A 3TWXA 5EIBE 1BU9A 2P2CP 3LJNA 1DCQA 3DEPA 2VGEA 3J5QB 2F37A 2DZOA 5AQAA 4G8LA 4BEPA 3EU9A 2FO1E 3TWUA 1QYMA 5EYLA 3B95A 1MX6A 2AJAA 1IXVA 1SVXA 3SO8A 2ZGGA 2QYJA 4B93B 2ETCA 4U8VD 3TWSA 4LNUD 1SW6A 4JB8P 3UI2A 5ITZF 5BXUA 1IKND 5AN8A 2Y1LE 4BERA 2DVWA 5FINA 5KBAA 4DX7D 4QQIA 4ZHBA 4K5BA 4GMRA 1K1BA 5KNHD 3TWRA 4HQDA 4HNAD 5HKPA 5AQBA 3W9FA 5HRYA 4HBDA 4CZ2D 4NIKA 4F1PA 4HLLA 1WDYA 3V31A
chains in the Genus database with same CATH superfamily
5ENOD 4HI9A 3ZVVA 3CVWA 1SQMA 3T5VA 2R17C 4XKCA 1NA0A 5G55A 5JHAA 4XKBA 3KSQA 1QQEA 4I6GA 2F8XK 4N5QA 2B0OE 4OAVB 4E6HA 3DXKG 3O48A 5FTPA 3V2OA 1MX4A 3FH8A 1Y8MA 2RKKA 1H0AA 4PS8A 4DPRA 4HRMB 4UUCA 4DRXE 2WQ6A 1H2TC 2XRYA 3HVEB 3FU5A 2IU1A 4GZCA 1NFIE 4BX9A 3EHQA 4AV7A 4KVMA 4EBAA 5KWDA 2HR2A 3UKRG 3CVPA 4GA1A 3RSEG 3Q15A 2H6HA 3QARA 5EN5D 3ZIMA 1WG0A 4BFRA 3I4GA 1OWNA 3MKQB 3U64A 2GRQB 2FO7A 3BQOA 1NI1A 3QAQA 3GZ2A 2WM9A 4Y6CA 2CG2A 2WXPA 3CHRA 4A3TA 2XS1A 3CSTA 4U7EB 1UN9A 3DSTA 4MS6A 4JL0A 1PY1A 2OEWA 2V5FA 1JUQA 4U0UA 3AAAC 2P9KG 4G25A 4KZCA 3DEOA 2L6BA 4N5CA 4UWFA 3FY4A 3RU0A 3HRAA 2XPIA 2GW1A 5HQ8A 4HI8A 3E34A 3APCA 3DSUA 1N0RA 3DRAA 4W9RA 3SD5A 4U0SA 2FI7A 2KZTB 4U96D 4OYSA 1QBQA 3UUXA 4B8CB 5D0OD 1RW2A 3FUDA 5G2NA 2VTBA 1JCQA 3FEYA 4U8YD 3D9OA 3CHPA 2ETAA 4APFA 3L6AA 2ZISA 4DLQA 1V55E 3GZSA 3AS5A 4GPMA 1OY3D 3SBSA 3C98A 4YNDA 2XS8A 4G8KA 2LSUA 5KJMA 3ZXSA 3ASFA 2LO6A 4RG9A 3J5QB 4WNGA 4E85A 1N9AA 1NL4A 4JPSA 1OUVA 2WXOA 5EYLA 1IXVA 3LPZA 1SVXA 4URKA 3DSXA 3LDZA 4ILHB 3PE4A 4PS7A 4HQDA 4HOQA 5HKPA 2LAHA 3FU6A 5LFAA 4AY6A 2AXVA 3ZEFA 5G05J 3ASOE 3HXCA 5CHEE 3FU0A 3AG2E 4DUIA 3UT4A 3UT8A 1DC2A 3IXEA 3OXLA 4MLPA 3JUEA 1OWOA 4UI9J 5BXOA 3ZFWA 3QWVA 3FUFA 2CHXA 3CHMA 4ACKA 3GYZA 3QOUA 3MEKA 4J8SA 3PVLA 4F6RD 5KCMA 1KZPA 2P9PG 3SY2A 4CEMA 3RRUA 3AG1E 3ULEG 2XEEA 2ZXWE 3KAEA 5ENSD 3BU8A 2AWIA 3L22A 4HRNA 2HE0A 4L7TA 3EU5A 1OCRE 4B8AA 3CEQA 2AVPA 3C5RA 2P9IG 3PREA 1NP7A 5JHBA 2KCLA 1TJCA 2GRPB 2BF0X 4C0EA 4BT8A 1DCQA 5FT9A 5EX3A 3TG4A 3PNLB 4AVXA 1QYMA 5DIZA 5DBKA 4V3IA 4AEZC 3TWSA 1FVFA 3UI2A 4ATGA 4GCNA 3D9MA 2J49A 4HNAD 3QC1A 4L9PA 5FJYA 3DSWA 4U63A 4CZ2D 3AJIA 3FULA 1Z6TA 3DSSA 3EDTB 1MHQA 2DYSE 4M7CA 4Q96A 3FTSA 3Q7AA 3SFXA 3NAWA 3Q47B 1N4PA 2P9NG 4CT4A 4A1GA 2GROB 4IRUA 1N52A 4IULA 4JVSA 4UWLA 4PS3A 2HO1A 4CCAA 3LS8A 1EPUA 2QC9A 1JCRA 3TL5A 2I6HA 4ABNA 3ESKA 3Q75A 5BV0A 1HXIA 3RRMB 3EJNA 4K5AB 2PNNA 3CVXA 3QDNA 3SFZA 5EKQD 4I2ZA 3UKUG 4M3OA 1SZAA 3CHOA 3U4TA 1YA0A 5ENRD 5KJLA 1U2VG 2MYOA 3NBNB 2KCKA 2VTBB 1INZA 2R2LA 4I43A 3KSLA 3JUIA 1TN8A 4EQFA 4GA0A 3CV0A 4TUUA 3ZXPA 2V0PA 4HB5A 3KS2A 1XNFA 3RRNB 3MKQA 3IHYA 3FTWA 3ZN3A 4G24A 4IYPA 3FUJA 3CSFA 4JB8P 5BXUA 4H7YA 4K5BA 4GMRA 1S0PA 4K03A 5B1BE 3W9FA 1IYGA 2DBAA 4WNFA 2VSYA 1WDYA 3V31A 2C0MA 5BNWA 4GZDA 4J8FA 4FJZA 1OCCE 1YYHA 3FHEA 4CDNA 1G3NB 2OOEA 2L0IA 3PZ3A 1LD7A 3V79K 5D0QD 5E76A 1N11A 4NQ0A 1IQUA 4J8EA 2JLBA 3Q9UC 4KYOB 4A3VA 2KZTA 4GB9A 1DCEA 4R7LA 2BEDA 3G2UA 3HIZA 4GTSA 2YQ8A 3Q9NC 3HG0D 1OWLA 3W9GA 3DPDA 3UPVA 4GYYA 3SF4A 2IF4A 1KPSB 4GYOA 2IO2C 5A7DB 3ZYKA 2ETBA 4ANXA 4BX8A 1LF8A 4O60A 1UJKA 5CRVA 4XE0A 3E4BA 2UWJG 4Q69A 3TXNA 2AW6A 4LNGA 4HS2A 2XGSA 3LJ3A 4FC8A 4FA6A 4YDOA 2FO1E 4JC8A 2ZGGA 2QYJA 4CRWA 3ZGQA 4RG6A 2DVWA 3FH5A 1Z3XA 1H2VC 4JHRA 2C2LA 4KBQA 4J7WA 1KZOA 2J8SD 4CT0A 2Y4TA 5LCWJ 5A6CA 1A17A 3ZU7B 3CKCA 4OAUC 4EPZA 2P9LG 3IEGA 2UY1B 1MJ0A 4FHKA 2NXPA 2YHEA 1UJJA 4JHKA 3CVNA 3ZYMA 4DK5A 1X81A 5C1DA 3TXMA 4GZ3A 3NOGD 5HI7A 1BLXB 3AS4A 2V5QC 3ZYLA 3SHFA 2DWZA 3Q49B 4U95D 4GTRA 5ANLA 3TAXA 3VTXA 2KM4A 1JCSA 1MYOA 1UN8A 3OXGA 1FVHA 3DSVA 3DWLG 3UM3A 4F7AA 3ESLA 4RVBA 1O1TA 2A5EA 1WY6A 3ZNGA 3HXFA 3AU4A 4AM9A 3MZLB 4NURA 3CGHA 2JEKA 3QB2A 5LOZA 2Q7FA 2WQHA 2VGXA 3PNTB 1SZ9A 3Q79A 4P29A 4BEPA 4EZKA 3D9PA 4ANVA 1JWGA 2GRRB 2J4DA 3SO8A 3G2VA 4N3BA 4U8VD 4LNUD 4L2LA 1B89A 2I1JA 2C0LA 4HBDA 3MA5A 2IQCA 1HZ4A 4AOFA 3DBSA 1MQSA 3J5PA 2PL2A 1RZ4A 3PEVB 5ENQD 2J4BA 1DVPA 3NB2A 3ML8A 1N4QA 4DX5D 2EQXA 2GRMA 2VSNA 4GA2A 4DX2A 1OT8A 2VGYA 2IOLA 3IBEA 1E96B 2M63A 2XCCA 4ILGA 4UI9K 2I1KA 4G2VA 2XPYA 1PAQA 4OVUA 4UWKA 4A1SA 4TRQA 3PUKA 2X6IA 3UIOC 3Q78A 4GYWA 4FJYA 4JD2G 4WNDA 1U3DA 3RAUA 3CQGB 4GPKA 4KT6B 3LY9A 3HHMA 3AG3E 3ML9A 1O5MA 4K0RA 3UT7A 2DIWA 2Y0BG 5LCWC 2FBNA 1FCHA 1TNUA 3CR3A 2CFZA 2ONDA 3UINC 4J8DA 3Q7FA 4XI0A 3R7QA 1H6PA 4DLOA 3DEPA 4XX5A 2DZOA 3ASGA 3S2AA 1Y6IA 5AIJA 1PC2A 3BUAA 4JA9A 3RK6A 5FINA 2L9BA 3D9NA 2IOSA 1TNOA 2B6CA 3P1UA 4HLLA 4KZ0A 1ELKA 1YCSB 2X38A 2LXLA 4UQYA 4WWNA 5FZSA 4GZ5A 4JW1A 1TNZA 3WG7E 2H6FA 3ZPJA 2IO3C 3MV2B 3FUMA 4G1TA 4UQXA 4WNEA 3ASDA 4ZFHA 3BG0B 4K5CA 3CQCB 2F8YA 1H2UA 1D8EA 1HH8A 3I4RB 2GRNB 1UW4B 4WWOA 1KLXA 4EBAG 1IHGA 3UX4A 4Y6WA 3L13A 4AJWA 3U9WA 4PUCA 3F6QA 5FQ7A 3LY8A 5EYPF 1FT2A 3MX3A 2AXUA 5AQ7A 1HX8A 4N2SA 3B7BA 3KEZA 5CERB 2KBXA 4U04A 3E32A 4I17A 2PM6A 3L82A 3X2QE 4FHJA 5A23A 2EIKE 2KCVA 3CVYA 4H7XA 4N39A 3DPYA 2NSZA 4G26A 2DZNA 1VDYA 2LXMA 5EIBE 3FFLA 4MKTA 3EHMA 2DCPA 1E7VA 1MX6A 4Q94A 4BY6A 5JJ6A 5LP0A 4GAAA 3FH7A 3T8MA 3FTXA 4DX7D 2I2OA 4PDXA 1EYHA 2VGXB 1E8XA 3ZYQA 1FT1A 3EIJA 3FU3A 5FQ4A 4I1OB 1QNFA 2WXHA 3D9KA 3T8KA 4TXPA 4WUYA 1H6KA 3RJVA 3VLDA 5T8IA 3UM2A 2J9QA 2WXRA 5AARA 5KJKA 3HXEA 5JMND 5H7PA 2LSVA 4IN3B 2NYJA 3JQ0A 4F3VA 2UY1A 3VLEA 2BKKB 3FUEA 3CHSA 2A4ZA 1TN7A 4L1BA 3I5PA 1ZU2A 4L2YA 3AG4E 2XGMA 5CCLA 2F0YA 5KNGA 3IKOB 3TWVA 3TWQA 3P2BA 4O1PA 4GTMA 5HS0A 3C3RA 1H19A 2WB2A 2J08A 3I3NA 3B7SA 2I9CA 5CBNA 2XCBA 3FTVA 2LNIA 1UOHA 2XZTG 1HU3A 3MKRA 4U07A 3C3QA 1OCZE 3GW4A 4TXRA 2KATA 5AYWD 2WXMA 4HOUA 2WXLA 2Y1LE 4J0UA 4EZLA 2Y4UA 3VTYA 3PZ4A 4YDEA 3CK9A 3LY7A 2OCCE 3V2XA 2AXZA 2EINE 2L0TB 3JXIA 3ENEA 1P5QA 1HF8A 3APDA 1MX2A 3V30A 2V4LA 2WXFA 3SQVA 4GTPA 3MCXA 4RQIA 1BI8B 4LRZA 4A55A 4I1MA 2VYIA 1S70B 4Z68A 2RFMA 5ENTD 3B7UX 2V4HC 3LVQE 4C9BB 3TWTA 3LCAA 5ENPD 2X3MA 3C3OA 3G2TA 4TV3A 3SNXA 1S64A 2Y69E 4JHJA 3B13A 3UTMA 1V54E 2EIME 4BSZB 1XGWA 3LKUA 4HOSA 2R05A 1D9SA 2YHCA 5T4YA 4PH4B 5B1AE 4AP2A 2OVFA 4BTBA 5LX8A 3PEUB 3NZSA 1UG3A 4DI4A 2WPVA 2ZU6B 4GZ6A 1SA5A 3LJNA 3UM1A 2PQRA 4ME2A 5AENA 3UIPC 4X8QA 5ITZF 3JCKC 3L17A 5KBAA 2FULA 4CGVA 1S63A 1BPOA 2QZAA 4ACLA 5BPPA 5CMWA 3O4ZA 4C0MA 5AJLA 3D9IA 3TWWA 4O1OA 4QFVA 1BI7B 3MGBA 3L9TA 5AAOA 2IEJA 2CHZA 3ABKE 5G04C 3LEWA 3PZ1A 2WQ7A 5AJDA 3PZ2A 2WXNA 3ISMC 3UQ3A 3UMVA 4XI9A 4YDYA 5E75A 4AY5A 4FADA 1X5BA 1JPLA 3OAWA 3VLFA 2QY7A 2E2EA 1LTXA 1EDUA 4TUMA 2P58C 4NACA 2E0IA 5IY5E 3AU5A 2OEVA 4C48B 3ZUVB 2OV8A 3CVLA 2GGFA 1BU9A 5AQAA 4DI3A 2PZIA 3EU9A 4XIFA 3B95A 2ILRA 4B93B 1E7UA 5AN8A 1Z5SC 4BERA 2R59A 1OXJA 5EDSA 3TWRA 2CFUA 3LYAA 5AQBA 5HRYA 3ASHA 4F1PA 1TNYA 4CYMD 2P9SG 1O1SA 2ZGDA 2XGOA 4DJAA 3ONLA 2CHWA 4BWRA 1OCOE 4I2WA 4B94A 4A63B 3GZ1A 4EZJA 4NRHB 3ZHEA 1HG2A 2L6JA 1N4SA 2RFAA 1IHBA 3URZA 1ELWA 3D9LA 4RLYA 1E90A 5KJNA 4UQZA 1AP7A 1SA4A 1E8ZA 4ATZD 3ZW3A 3FTZA 2J07A 1AWCB 3CK8A 3ABLE 2PM7A 4BT9A 3RIBA 4HFGA 4N2QA 3MJWA 1D8DA 3FEXA 3APFA 2IONA 3ASNE 2P2CP 3N71A 3QK0A 4G11A 4L23A 1K8KG 3EIQC 4F1SA 3TWUA 3QKYA 3SZ7A 5M72A 4LERA 3FUIA 1SW6A 3RKVA 3JYSA 2J09A 4B0ZA 1WAO1 5ENNA 1K1BA 2XEVA 4CDMA 1QZ2A 4I9EA 3JQ1A 3EUVA 1FPPA 3EHRA 1U3CA 4N3CA 2R5SA 2WXJA 4I6EA 1Z3YA 1K1AA 1A5EA 3L08A 2VQ2A 4YDWA 2X6KA 5FWQA 4GTVA 4OVVA 5JA4D 4FULA 1EF1C 4U0ZA 3ZKJA 4DX6D 3B7TA 4GMLA 2KXPC 3FUNA 2BUGA 2XZDG 2JABA 4CGWA 3S7JA 3MYVA 3Q5MA 3S7BA 4HVBA 4YVOA 4BETA 2R02A 3PDNA 2IY0C 3KD7A 2BKGA 4HRLA 2XHEA 5BUZA 5CRUA 3KEAA 4ILIA 2WXQA 3FP3A 3PS6A 4TXQA 5J08A 2LUHA 1E8YA 4CDRA 3TG5A 4G8LA 4HLEA 5T3RA 2IJGX 4JA7A 5FQ8A 3CVVA 2FF4A 3PH0C 1KT0A 1IKND 2HYZA 3EHNA 5FZRA 2EIJE 5KNHD 4LUNU 3E37A 3PZDA 1TJFA 4GU5A 3FWVA 5CBOA 2HM8A 3OXFA 4WAFA 5ANRA 3CKBA 2XRZA 4MRUA 2X6JA 4G23A 2NC9A 4FLHA 4AIFA 3D9HA 2OVBA 5BT1A 4LSZE 1WM5A 1OWPA 5BV1A 4N3AA 3BEEA 5JJTA 4I1AA 2KC7A 4LNBA 5CECB 2XPZA 3G2SA 3HXBA 1TNBA 3SBTB 1K3ZD 4HXIA 4BESA 1TN6A 3LVRE 5EIDA 3MV3B 3L16A 4O6FA 3ZHEB 4KVOA 1YMPA 4FLBA 3WXXA 4YVQC 3QWWA 3Q73A 3S7FA 3FUHA 5CEDB 4GMJA 1DNPA 3CLJA 1N0QA 1HE8A 4J8YA 2RG8A 2RD0A 2VSXE 3PRZA 3AS8A 3ULQA 3K9IA 2VGEA 3NF1A 5BW8C 3CIAA 2WMNA 1HO8A 2MRIA 1HG5A 3ONKA 1JWFA 2CG3A 2DYRE 1E8WA 1Q2ZA 4JZYA 4BSXA 3CHQA 4QQIA 3C72A 3CK7A 3HDXA 5G04J 3QWPA 2P9UG 2LAIA 1MZCA 3U3WA 3R7RA 4AXHA 3FTYA 5ARGA 4D10C 2R03A 1LD8A 2WXIA 3FDHA 2QFCA 1N4RA 1W3BA 1KT1A 3NQPA 4LEUA 2VSOE 4EHMA 3L54A 4HOTA 3HVEA 4J6IA 4UWGA 5EX0A 4GTOA 3QNKA 3QJZA 2XQ0A 2VJ8A 5AQ9A 3IV0A 4WWPA 2WXKA 1TYQG 3S7DA 5D66A 5G05C 3SGHA 4I6JA 3E30A 5D2MC 2ZIRA 1N94A 4MBGA 4XZ4A 4I9CA 4UI9C 4LG6A 1TEZA 3UXGA 2WVIA 3FTUA 4JEHA 1L5JA 4RSYA 4FP7A 3LXUX 2XENA 3TJPA 3TWXA 1ZBPA 5C2YA 5J90A 4JXTA 3ULYA 1N54A 3DXMG 4XEIG 2H6GA 1OWMA 3U66A 3OTNA 2QYUA 1ELRA 4LCTA 4ANWA 3B7RL 3PE3A 4GTQA 4ZHBA 4ANUA 3HXDA 1H6OA 2PQNA 5CMYA 4GTTA 4GCOA 4UWHA 4KMOA 3G2WA 5B3SE 1BD8A 3E33A 3PUJA 4FU3A 5CEAA 1NZNA 4KXKB 4APOA 4DX1A 2YINA 2YNQA 2GRLA 3UM0A 2A5UA 3SFYA 3JXJA 2Y3AA 1TR4A 3CVQA 2X6HA 4HORA 1HFAA 4JEUA 3RO2A 3T5XA 2FEZA 4BTAA 3FUKA 2MOWA 2V8SE 3TGOA 5FZQA 4EECA 3HYMB 2H6IA 1GW6A 4F53A 3ABME 3SI5A 3R9MA 3NZUA 4B89A 2WXGA 3T9KA 2X6FA 2BTDA 2XEHA 3D3MA 3CVUA 5JJ7A 4U8HA 3R9AB 1O1RA 3NOCD 5EILA 5FIOA 5CCMA 2EILE 3IHVA 2F37A 1N95A 3ZRHA 3RO3A 5FQ6A 2WMOA 2AJAA 2ETCA 1IQRA 5ARFA 1NA3A 2MHKA 3BG1B 3Q4AB 1HS6A 2IFUA 1ZB1A 4NIKA 3D9JA
chains in the Genus database with same CATH topology
1YCSB 3AJIA 5ENOD 3AAAC 4J7WA 2J8SD 5CBOA 4HI9A 3EHRA 3TWWA 1BD8A 3DEOA 4CYMD 3V2XA 2L6BA 3J5PA 4O1OA 4QFVA 1YYHA 3JXIA 2ZGDA 3T8KA 3ZU7B 5CEAA 5ENQD 1BI7B 3HRAA 4DX1A 4DUIA 1MX2A 1G3NB 3V30A 4OAUC 2F8XK 4DX5D 3V79K 1K1AA 1N11A 3D9HA 2B0OE 4N5QA 1BI8B 4HI8A 5AARA 4ZFHA 4OAVB 3IXEA 1A5EA 4LSZE 5JMND 4K5CA 1N0RA 4YDWA 3JXJA 1MX4A 3V2OA 2F8YA 1MJ0A 4DX2A 5AAOA 3JUEA 4A63B 1OT8A 2NYJA 1TR4A 4U96D 1S70B 4Z68A 3Q9UC 2QC9A 2RFMA 5ENTD 4HRMB 5JA4D 5CECB 5BXOA 2BKKB 5AQ9A 3NOGD 4UUCA 2V4HC 3ZKJA 4DX6D 4DRXE 1BLXB 3TWTA 2KXPC 1K3ZD 2V5QC 5D66A 5ENPD 4BESA 4YDYA 4K5AB 2PNNA 2DWZA 3F6QA 5EIDA 2RFAA 1DC2A 4U95D 4U8YD 4F6RD 3Q9NC 1IHBA 1NFIE 3HG0D 3EHQA 2XZDG 5EYPF 2JABA 3W9GA 5KNGA 3TWVA 4RLYA 5AQ7A 2ETAA 5KWDA 1YMPA 3TWQA 3B7BA 2XEEA 3UTMA 4O1PA 5ENSD 1AP7A 2ETBA 4BSZB 5ENRD 4HRNA 5CERB 1MYOA 2KBXA 4ATZD 2HE0A 2MYOA 3NBNB 4GPMA 1D9SA 3T9KA 4TUMA 1OY3D 5HS0A 4BETA 5CEDB 1AWCB 5EN5D 4LG6A 2XEHA 4O60A 2Y0BG 3UXGA 3C5RA 1WG0A 2BKGA 2A5EA 4HRLA 1N0QA 3ZNGA 4G8KA 4J8YA 5CBNA 4C48B 3KEAA 1UOHA 3ZUVB 2DZNA 2XENA 3NOCD 2XZTG 5EILA 5FIOA 4HB5A 3TWXA 5EIBE 1BU9A 2P2CP 3LJNA 1DCQA 3DEPA 2VGEA 3J5QB 2F37A 2DZOA 5AQAA 4G8LA 4BEPA 3EU9A 2FO1E 3TWUA 1QYMA 5EYLA 3B95A 1MX6A 2AJAA 1IXVA 1SVXA 3SO8A 2ZGGA 2QYJA 4B93B 2ETCA 4U8VD 3TWSA 4LNUD 1SW6A 4JB8P 3UI2A 5ITZF 5BXUA 1IKND 5AN8A 2Y1LE 4BERA 2DVWA 5FINA 5KBAA 4DX7D 4QQIA 4ZHBA 4K5BA 4GMRA 1K1BA 5KNHD 3TWRA 4HQDA 4HNAD 5HKPA 5AQBA 3W9FA 5HRYA 4HBDA 4CZ2D 4NIKA 4F1PA 4HLLA 1WDYA 3V31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YCS B;  3AJI A;  5ENO D;  3AAA C;  4J7W A;  2J8S D;  5CBO A;  4HI9 A;  3EHR A;  3TWW A;  1BD8 A;  3DEO A;  4CYM D;  3V2X A;  2L6B A;  3J5P A;  4O1O A;  4QFV A;  1YYH A;  3JXI A;  2ZGD A;  3T8K A;  3ZU7 B;  5CEA A;  5ENQ D;  1BI7 B;  3HRA A;  4DX1 A;  4DUI A;  1MX2 A;  1G3N B;  3V30 A;  4OAU C;  2F8X K;  4DX5 D;  3V79 K;  1K1A A;  1N11 A;  3D9H A;  2B0O E;  4N5Q A;  1BI8 B;  4HI8 A;  5AAR A;  4ZFH A;  4OAV B;  3IXE A;  1A5E A;  4LSZ E;  5JMN D;  4K5C A;  1N0R A;  4YDW A;  3JXJ A;  1MX4 A;  3V2O A;  2F8Y A;  1MJ0 A;  4DX2 A;  5AAO A;  3JUE A;  4A63 B;  1OT8 A;  2NYJ A;  1TR4 A;  4U96 D;  1S70 B;  4Z68 A;  3Q9U C;  2QC9 A;  2RFM A;  5ENT D;  4HRM B;  5JA4 D;  5CEC B;  5BXO A;  2BKK B;  5AQ9 A;  3NOG D;  4UUC A;  2V4H C;  3ZKJ A;  4DX6 D;  4DRX E;  1BLX B;  3TWT A;  2KXP C;  1K3Z D;  2V5Q C;  5D66 A;  5ENP D;  4BES A;  4YDY A;  4K5A B;  2PNN A;  2DWZ A;  3F6Q A;  5EID A;  2RFA A;  1DC2 A;  4U95 D;  4U8Y D;  4F6R D;  3Q9N C;  1IHB A;  1NFI E;  3HG0 D;  3EHQ A;  2XZD G;  5EYP F;  2JAB A;  3W9G A;  5KNG A;  3TWV A;  4RLY A;  5AQ7 A;  2ETA A;  5KWD A;  1YMP A;  3TWQ A;  3B7B A;  2XEE A;  3UTM A;  4O1P A;  5ENS D;  1AP7 A;  2ETB A;  4BSZ B;  5ENR D;  4HRN A;  5CER B;  1MYO A;  2KBX A;  4ATZ D;  2HE0 A;  2MYO A;  3NBN B;  4GPM A;  1D9S A;  3T9K A;  4TUM A;  1OY3 D;  5HS0 A;  4BET A;  5CED B;  1AWC B;  5EN5 D;  4LG6 A;  2XEH A;  4O60 A;  2Y0B G;  3UXG A;  3C5R A;  1WG0 A;  2BKG A;  2A5E A;  4HRL A;  1N0Q A;  3ZNG A;  4G8K A;  4J8Y A;  5CBN A;  4C48 B;  3KEA A;  1UOH A;  3ZUV B;  2DZN A;  2XEN A;  3NOC D;  2XZT G;  5EIL A;  5FIO A;  4HB5 A;  3TWX A;  5EIB E;  1BU9 A;  2P2C P;  3LJN A;  1DCQ A;  3DEP A;  2VGE A;  3J5Q B;  2F37 A;  2DZO A;  5AQA A;  4G8L A;  4BEP A;  3EU9 A;  2FO1 E;  3TWU A;  1QYM A;  5EYL A;  3B95 A;  1MX6 A;  2AJA A;  1IXV A;  1SVX A;  3SO8 A;  2ZGG A;  2QYJ A;  4B93 B;  2ETC A;  4U8V D;  3TWS A;  4LNU D;  1SW6 A;  4JB8 P;  3UI2 A;  5ITZ F;  5BXU A;  1IKN D;  5AN8 A;  2Y1L E;  4BER A;  2DVW A;  5FIN A;  5KBA A;  4DX7 D;  4QQI A;  4ZHB A;  4K5B A;  4GMR A;  1K1B A;  5KNH D;  3TWR A;  4HQD A;  4HNA D;  5HKP A;  5AQB A;  3W9F A;  5HRY A;  4HBD A;  4CZ2 D;  4NIK A;  4F1P A;  4HLL A;  1WDY A;  3V31 A; 
#chains in the Genus database with same CATH topology
 5ENO D;  4HI9 A;  3ZVV A;  3CVW A;  1SQM A;  3T5V A;  2R17 C;  4XKC A;  1NA0 A;  5G55 A;  5JHA A;  4XKB A;  3KSQ A;  1QQE A;  4I6G A;  2F8X K;  4N5Q A;  2B0O E;  4OAV B;  4E6H A;  3DXK G;  3O48 A;  5FTP A;  3V2O A;  1MX4 A;  3FH8 A;  1Y8M A;  2RKK A;  1H0A A;  4PS8 A;  4DPR A;  4HRM B;  4UUC A;  4DRX E;  2WQ6 A;  1H2T C;  2XRY A;  3HVE B;  3FU5 A;  2IU1 A;  4GZC A;  1NFI E;  4BX9 A;  3EHQ A;  4AV7 A;  4KVM A;  4EBA A;  5KWD A;  2HR2 A;  3UKR G;  3CVP A;  4GA1 A;  3RSE G;  3Q15 A;  2H6H A;  3QAR A;  5EN5 D;  3ZIM A;  1WG0 A;  4BFR A;  3I4G A;  1OWN A;  3MKQ B;  3U64 A;  2GRQ B;  2FO7 A;  3BQO A;  1NI1 A;  3QAQ A;  3GZ2 A;  2WM9 A;  4Y6C A;  2CG2 A;  2WXP A;  3CHR A;  4A3T A;  2XS1 A;  3CST A;  4U7E B;  1UN9 A;  3DST A;  4MS6 A;  4JL0 A;  1PY1 A;  2OEW A;  2V5F A;  1JUQ A;  4U0U A;  3AAA C;  2P9K G;  4G25 A;  4KZC A;  3DEO A;  2L6B A;  4N5C A;  4UWF A;  3FY4 A;  3RU0 A;  3HRA A;  2XPI A;  2GW1 A;  5HQ8 A;  4HI8 A;  3E34 A;  3APC A;  3DSU A;  1N0R A;  3DRA A;  4W9R A;  3SD5 A;  4U0S A;  2FI7 A;  2KZT B;  4U96 D;  4OYS A;  1QBQ A;  3UUX A;  4B8C B;  5D0O D;  1RW2 A;  3FUD A;  5G2N A;  2VTB A;  1JCQ A;  3FEY A;  4U8Y D;  3D9O A;  3CHP A;  2ETA A;  4APF A;  3L6A A;  2ZIS A;  4DLQ A;  1V55 E;  3GZS A;  3AS5 A;  4GPM A;  1OY3 D;  3SBS A;  3C98 A;  4YND A;  2XS8 A;  4G8K A;  2LSU A;  5KJM A;  3ZXS A;  3ASF A;  2LO6 A;  4RG9 A;  3J5Q B;  4WNG A;  4E85 A;  1N9A A;  1NL4 A;  4JPS A;  1OUV A;  2WXO A;  5EYL A;  1IXV A;  3LPZ A;  1SVX A;  4URK A;  3DSX A;  3LDZ A;  4ILH B;  3PE4 A;  4PS7 A;  4HQD A;  4HOQ A;  5HKP A;  2LAH A;  3FU6 A;  5LFA A;  4AY6 A;  2AXV A;  3ZEF A;  5G05 J;  3ASO E;  3HXC A;  5CHE E;  3FU0 A;  3AG2 E;  4DUI A;  3UT4 A;  3UT8 A;  1DC2 A;  3IXE A;  3OXL A;  4MLP A;  3JUE A;  1OWO A;  4UI9 J;  5BXO A;  3ZFW A;  3QWV A;  3FUF A;  2CHX A;  3CHM A;  4ACK A;  3GYZ A;  3QOU A;  3MEK A;  4J8S A;  3PVL A;  4F6R D;  5KCM A;  1KZP A;  2P9P G;  3SY2 A;  4CEM A;  3RRU A;  3AG1 E;  3ULE G;  2XEE A;  2ZXW E;  3KAE A;  5ENS D;  3BU8 A;  2AWI A;  3L22 A;  4HRN A;  2HE0 A;  4L7T A;  3EU5 A;  1OCR E;  4B8A A;  3CEQ A;  2AVP A;  3C5R A;  2P9I G;  3PRE A;  1NP7 A;  5JHB A;  2KCL A;  1TJC A;  2GRP B;  2BF0 X;  4C0E A;  4BT8 A;  1DCQ A;  5FT9 A;  5EX3 A;  3TG4 A;  3PNL B;  4AVX A;  1QYM A;  5DIZ A;  5DBK A;  4V3I A;  4AEZ C;  3TWS A;  1FVF A;  3UI2 A;  4ATG A;  4GCN A;  3D9M A;  2J49 A;  4HNA D;  3QC1 A;  4L9P A;  5FJY A;  3DSW A;  4U63 A;  4CZ2 D;  3AJI A;  3FUL A;  1Z6T A;  3DSS A;  3EDT B;  1MHQ A;  2DYS E;  4M7C A;  4Q96 A;  3FTS A;  3Q7A A;  3SFX A;  3NAW A;  3Q47 B;  1N4P A;  2P9N G;  4CT4 A;  4A1G A;  2GRO B;  4IRU A;  1N52 A;  4IUL A;  4JVS A;  4UWL A;  4PS3 A;  2HO1 A;  4CCA A;  3LS8 A;  1EPU A;  2QC9 A;  1JCR A;  3TL5 A;  2I6H A;  4ABN A;  3ESK A;  3Q75 A;  5BV0 A;  1HXI A;  3RRM B;  3EJN A;  4K5A B;  2PNN A;  3CVX A;  3QDN A;  3SFZ A;  5EKQ D;  4I2Z A;  3UKU G;  4M3O A;  1SZA A;  3CHO A;  3U4T A;  1YA0 A;  5ENR D;  5KJL A;  1U2V G;  2MYO A;  3NBN B;  2KCK A;  2VTB B;  1INZ A;  2R2L A;  4I43 A;  3KSL A;  3JUI A;  1TN8 A;  4EQF A;  4GA0 A;  3CV0 A;  4TUU A;  3ZXP A;  2V0P A;  4HB5 A;  3KS2 A;  1XNF A;  3RRN B;  3MKQ A;  3IHY A;  3FTW A;  3ZN3 A;  4G24 A;  4IYP A;  3FUJ A;  3CSF A;  4JB8 P;  5BXU A;  4H7Y A;  4K5B A;  4GMR A;  1S0P A;  4K03 A;  5B1B E;  3W9F A;  1IYG A;  2DBA A;  4WNF A;  2VSY A;  1WDY A;  3V31 A;  2C0M A;  5BNW A;  4GZD A;  4J8F A;  4FJZ A;  1OCC E;  1YYH A;  3FHE A;  4CDN A;  1G3N B;  2OOE A;  2L0I A;  3PZ3 A;  1LD7 A;  3V79 K;  5D0Q D;  5E76 A;  1N11 A;  4NQ0 A;  1IQU A;  4J8E A;  2JLB A;  3Q9U C;  4KYO B;  4A3V A;  2KZT A;  4GB9 A;  1DCE A;  4R7L A;  2BED A;  3G2U A;  3HIZ A;  4GTS A;  2YQ8 A;  3Q9N C;  3HG0 D;  1OWL A;  3W9G A;  3DPD A;  3UPV A;  4GYY A;  3SF4 A;  2IF4 A;  1KPS B;  4GYO A;  2IO2 C;  5A7D B;  3ZYK A;  2ETB A;  4ANX A;  4BX8 A;  1LF8 A;  4O60 A;  1UJK A;  5CRV A;  4XE0 A;  3E4B A;  2UWJ G;  4Q69 A;  3TXN A;  2AW6 A;  4LNG A;  4HS2 A;  2XGS A;  3LJ3 A;  4FC8 A;  4FA6 A;  4YDO A;  2FO1 E;  4JC8 A;  2ZGG A;  2QYJ A;  4CRW A;  3ZGQ A;  4RG6 A;  2DVW A;  3FH5 A;  1Z3X A;  1H2V C;  4JHR A;  2C2L A;  4KBQ A;  4J7W A;  1KZO A;  2J8S D;  4CT0 A;  2Y4T A;  5LCW J;  5A6C A;  1A17 A;  3ZU7 B;  3CKC A;  4OAU C;  4EPZ A;  2P9L G;  3IEG A;  2UY1 B;  1MJ0 A;  4FHK A;  2NXP A;  2YHE A;  1UJJ A;  4JHK A;  3CVN A;  3ZYM A;  4DK5 A;  1X81 A;  5C1D A;  3TXM A;  4GZ3 A;  3NOG D;  5HI7 A;  1BLX B;  3AS4 A;  2V5Q C;  3ZYL A;  3SHF A;  2DWZ A;  3Q49 B;  4U95 D;  4GTR A;  5ANL A;  3TAX A;  3VTX A;  2KM4 A;  1JCS A;  1MYO A;  1UN8 A;  3OXG A;  1FVH A;  3DSV A;  3DWL G;  3UM3 A;  4F7A A;  3ESL A;  4RVB A;  1O1T A;  2A5E A;  1WY6 A;  3ZNG A;  3HXF A;  3AU4 A;  4AM9 A;  3MZL B;  4NUR A;  3CGH A;  2JEK A;  3QB2 A;  5LOZ A;  2Q7F A;  2WQH A;  2VGX A;  3PNT B;  1SZ9 A;  3Q79 A;  4P29 A;  4BEP A;  4EZK A;  3D9P A;  4ANV A;  1JWG A;  2GRR B;  2J4D A;  3SO8 A;  3G2V A;  4N3B A;  4U8V D;  4LNU D;  4L2L A;  1B89 A;  2I1J A;  2C0L A;  4HBD A;  3MA5 A;  2IQC A;  1HZ4 A;  4AOF A;  3DBS A;  1MQS A;  3J5P A;  2PL2 A;  1RZ4 A;  3PEV B;  5ENQ D;  2J4B A;  1DVP A;  3NB2 A;  3ML8 A;  1N4Q A;  4DX5 D;  2EQX A;  2GRM A;  2VSN A;  4GA2 A;  4DX2 A;  1OT8 A;  2VGY A;  2IOL A;  3IBE A;  1E96 B;  2M63 A;  2XCC A;  4ILG A;  4UI9 K;  2I1K A;  4G2V A;  2XPY A;  1PAQ A;  4OVU A;  4UWK A;  4A1S A;  4TRQ A;  3PUK A;  2X6I A;  3UIO C;  3Q78 A;  4GYW A;  4FJY A;  4JD2 G;  4WND A;  1U3D A;  3RAU A;  3CQG B;  4GPK A;  4KT6 B;  3LY9 A;  3HHM A;  3AG3 E;  3ML9 A;  1O5M A;  4K0R A;  3UT7 A;  2DIW A;  2Y0B G;  5LCW C;  2FBN A;  1FCH A;  1TNU A;  3CR3 A;  2CFZ A;  2OND A;  3UIN C;  4J8D A;  3Q7F A;  4XI0 A;  3R7Q A;  1H6P A;  4DLO A;  3DEP A;  4XX5 A;  2DZO A;  3ASG A;  3S2A A;  1Y6I A;  5AIJ A;  1PC2 A;  3BUA A;  4JA9 A;  3RK6 A;  5FIN A;  2L9B A;  3D9N A;  2IOS A;  1TNO A;  2B6C A;  3P1U A;  4HLL A;  4KZ0 A;  1ELK A;  1YCS B;  2X38 A;  2LXL A;  4UQY A;  4WWN A;  5FZS A;  4GZ5 A;  4JW1 A;  1TNZ A;  3WG7 E;  2H6F A;  3ZPJ A;  2IO3 C;  3MV2 B;  3FUM A;  4G1T A;  4UQX A;  4WNE A;  3ASD A;  4ZFH A;  3BG0 B;  4K5C A;  3CQC B;  2F8Y A;  1H2U A;  1D8E A;  1HH8 A;  3I4R B;  2GRN B;  1UW4 B;  4WWO A;  1KLX A;  4EBA G;  1IHG A;  3UX4 A;  4Y6W A;  3L13 A;  4AJW A;  3U9W A;  4PUC A;  3F6Q A;  5FQ7 A;  3LY8 A;  5EYP F;  1FT2 A;  3MX3 A;  2AXU A;  5AQ7 A;  1HX8 A;  4N2S A;  3B7B A;  3KEZ A;  5CER B;  2KBX A;  4U04 A;  3E32 A;  4I17 A;  2PM6 A;  3L82 A;  3X2Q E;  4FHJ A;  5A23 A;  2EIK E;  2KCV A;  3CVY A;  4H7X A;  4N39 A;  3DPY A;  2NSZ A;  4G26 A;  2DZN A;  1VDY A;  2LXM A;  5EIB E;  3FFL A;  4MKT A;  3EHM A;  2DCP A;  1E7V A;  1MX6 A;  4Q94 A;  4BY6 A;  5JJ6 A;  5LP0 A;  4GAA A;  3FH7 A;  3T8M A;  3FTX A;  4DX7 D;  2I2O A;  4PDX A;  1EYH A;  2VGX B;  1E8X A;  3ZYQ A;  1FT1 A;  3EIJ A;  3FU3 A;  5FQ4 A;  4I1O B;  1QNF A;  2WXH A;  3D9K A;  3T8K A;  4TXP A;  4WUY A;  1H6K A;  3RJV A;  3VLD A;  5T8I A;  3UM2 A;  2J9Q A;  2WXR A;  5AAR A;  5KJK A;  3HXE A;  5JMN D;  5H7P A;  2LSV A;  4IN3 B;  2NYJ A;  3JQ0 A;  4F3V A;  2UY1 A;  3VLE A;  2BKK B;  3FUE A;  3CHS A;  2A4Z A;  1TN7 A;  4L1B A;  3I5P A;  1ZU2 A;  4L2Y A;  3AG4 E;  2XGM A;  5CCL A;  2F0Y A;  5KNG A;  3IKO B;  3TWV A;  3TWQ A;  3P2B A;  4O1P A;  4GTM A;  5HS0 A;  3C3R A;  1H19 A;  2WB2 A;  2J08 A;  3I3N A;  3B7S A;  2I9C A;  5CBN A;  2XCB A;  3FTV A;  2LNI A;  1UOH A;  2XZT G;  1HU3 A;  3MKR A;  4U07 A;  3C3Q A;  1OCZ E;  3GW4 A;  4TXR A;  2KAT A;  5AYW D;  2WXM A;  4HOU A;  2WXL A;  2Y1L E;  4J0U A;  4EZL A;  2Y4U A;  3VTY A;  3PZ4 A;  4YDE A;  3CK9 A;  3LY7 A;  2OCC E;  3V2X A;  2AXZ A;  2EIN E;  2L0T B;  3JXI A;  3ENE A;  1P5Q A;  1HF8 A;  3APD A;  1MX2 A;  3V30 A;  2V4L A;  2WXF A;  3SQV A;  4GTP A;  3MCX A;  4RQI A;  1BI8 B;  4LRZ A;  4A55 A;  4I1M A;  2VYI A;  1S70 B;  4Z68 A;  2RFM A;  5ENT D;  3B7U X;  2V4H C;  3LVQ E;  4C9B B;  3TWT A;  3LCA A;  5ENP D;  2X3M A;  3C3O A;  3G2T A;  4TV3 A;  3SNX A;  1S64 A;  2Y69 E;  4JHJ A;  3B13 A;  3UTM A;  1V54 E;  2EIM E;  4BSZ B;  1XGW A;  3LKU A;  4HOS A;  2R05 A;  1D9S A;  2YHC A;  5T4Y A;  4PH4 B;  5B1A E;  4AP2 A;  2OVF A;  4BTB A;  5LX8 A;  3PEU B;  3NZS A;  1UG3 A;  4DI4 A;  2WPV A;  2ZU6 B;  4GZ6 A;  1SA5 A;  3LJN A;  3UM1 A;  2PQR A;  4ME2 A;  5AEN A;  3UIP C;  4X8Q A;  5ITZ F;  3JCK C;  3L17 A;  5KBA A;  2FUL A;  4CGV A;  1S63 A;  1BPO A;  2QZA A;  4ACL A;  5BPP A;  5CMW A;  3O4Z A;  4C0M A;  5AJL A;  3D9I A;  3TWW A;  4O1O A;  4QFV A;  1BI7 B;  3MGB A;  3L9T A;  5AAO A;  2IEJ A;  2CHZ A;  3ABK E;  5G04 C;  3LEW A;  3PZ1 A;  2WQ7 A;  5AJD A;  3PZ2 A;  2WXN A;  3ISM C;  3UQ3 A;  3UMV A;  4XI9 A;  4YDY A;  5E75 A;  4AY5 A;  4FAD A;  1X5B A;  1JPL A;  3OAW A;  3VLF A;  2QY7 A;  2E2E A;  1LTX A;  1EDU A;  4TUM A;  2P58 C;  4NAC A;  2E0I A;  5IY5 E;  3AU5 A;  2OEV A;  4C48 B;  3ZUV B;  2OV8 A;  3CVL A;  2GGF A;  1BU9 A;  5AQA A;  4DI3 A;  2PZI A;  3EU9 A;  4XIF A;  3B95 A;  2ILR A;  4B93 B;  1E7U A;  5AN8 A;  1Z5S C;  4BER A;  2R59 A;  1OXJ A;  5EDS A;  3TWR A;  2CFU A;  3LYA A;  5AQB A;  5HRY A;  3ASH A;  4F1P A;  1TNY A;  4CYM D;  2P9S G;  1O1S A;  2ZGD A;  2XGO A;  4DJA A;  3ONL A;  2CHW A;  4BWR A;  1OCO E;  4I2W A;  4B94 A;  4A63 B;  3GZ1 A;  4EZJ A;  4NRH B;  3ZHE A;  1HG2 A;  2L6J A;  1N4S A;  2RFA A;  1IHB A;  3URZ A;  1ELW A;  3D9L A;  4RLY A;  1E90 A;  5KJN A;  4UQZ A;  1AP7 A;  1SA4 A;  1E8Z A;  4ATZ D;  3ZW3 A;  3FTZ A;  2J07 A;  1AWC B;  3CK8 A;  3ABL E;  2PM7 A;  4BT9 A;  3RIB A;  4HFG A;  4N2Q A;  3MJW A;  1D8D A;  3FEX A;  3APF A;  2ION A;  3ASN E;  2P2C P;  3N71 A;  3QK0 A;  4G11 A;  4L23 A;  1K8K G;  3EIQ C;  4F1S A;  3TWU A;  3QKY A;  3SZ7 A;  5M72 A;  4LER A;  3FUI A;  1SW6 A;  3RKV A;  3JYS A;  2J09 A;  4B0Z A;  1WAO 1;  5ENN A;  1K1B A;  2XEV A;  4CDM A;  1QZ2 A;  4I9E A;  3JQ1 A;  3EUV A;  1FPP A;  3EHR A;  1U3C A;  4N3C A;  2R5S A;  2WXJ A;  4I6E A;  1Z3Y A;  1K1A A;  1A5E A;  3L08 A;  2VQ2 A;  4YDW A;  2X6K A;  5FWQ A;  4GTV A;  4OVV A;  5JA4 D;  4FUL A;  1EF1 C;  4U0Z A;  3ZKJ A;  4DX6 D;  3B7T A;  4GML A;  2KXP C;  3FUN A;  2BUG A;  2XZD G;  2JAB A;  4CGW A;  3S7J A;  3MYV A;  3Q5M A;  3S7B A;  4HVB A;  4YVO A;  4BET A;  2R02 A;  3PDN A;  2IY0 C;  3KD7 A;  2BKG A;  4HRL A;  2XHE A;  5BUZ A;  5CRU A;  3KEA A;  4ILI A;  2WXQ A;  3FP3 A;  3PS6 A;  4TXQ A;  5J08 A;  2LUH A;  1E8Y A;  4CDR A;  3TG5 A;  4G8L A;  4HLE A;  5T3R A;  2IJG X;  4JA7 A;  5FQ8 A;  3CVV A;  2FF4 A;  3PH0 C;  1KT0 A;  1IKN D;  2HYZ A;  3EHN A;  5FZR A;  2EIJ E;  5KNH D;  4LUN U;  3E37 A;  3PZD A;  1TJF A;  4GU5 A;  3FWV A;  5CBO A;  2HM8 A;  3OXF A;  4WAF A;  5ANR A;  3CKB A;  2XRZ A;  4MRU A;  2X6J A;  4G23 A;  2NC9 A;  4FLH A;  4AIF A;  3D9H A;  2OVB A;  5BT1 A;  4LSZ E;  1WM5 A;  1OWP A;  5BV1 A;  4N3A A;  3BEE A;  5JJT A;  4I1A A;  2KC7 A;  4LNB A;  5CEC B;  2XPZ A;  3G2S A;  3HXB A;  1TNB A;  3SBT B;  1K3Z D;  4HXI A;  4BES A;  1TN6 A;  3LVR E;  5EID A;  3MV3 B;  3L16 A;  4O6F A;  3ZHE B;  4KVO A;  1YMP A;  4FLB A;  3WXX A;  4YVQ C;  3QWW A;  3Q73 A;  3S7F A;  3FUH A;  5CED B;  4GMJ A;  1DNP A;  3CLJ A;  1N0Q A;  1HE8 A;  4J8Y A;  2RG8 A;  2RD0 A;  2VSX E;  3PRZ A;  3AS8 A;  3ULQ A;  3K9I A;  2VGE A;  3NF1 A;  5BW8 C;  3CIA A;  2WMN A;  1HO8 A;  2MRI A;  1HG5 A;  3ONK A;  1JWF A;  2CG3 A;  2DYR E;  1E8W A;  1Q2Z A;  4JZY A;  4BSX A;  3CHQ A;  4QQI A;  3C72 A;  3CK7 A;  3HDX A;  5G04 J;  3QWP A;  2P9U G;  2LAI A;  1MZC A;  3U3W A;  3R7R A;  4AXH A;  3FTY A;  5ARG A;  4D10 C;  2R03 A;  1LD8 A;  2WXI A;  3FDH A;  2QFC A;  1N4R A;  1W3B A;  1KT1 A;  3NQP A;  4LEU A;  2VSO E;  4EHM A;  3L54 A;  4HOT A;  3HVE A;  4J6I A;  4UWG A;  5EX0 A;  4GTO A;  3QNK A;  3QJZ A;  2XQ0 A;  2VJ8 A;  5AQ9 A;  3IV0 A;  4WWP A;  2WXK A;  1TYQ G;  3S7D A;  5D66 A;  5G05 C;  3SGH A;  4I6J A;  3E30 A;  5D2M C;  2ZIR A;  1N94 A;  4MBG A;  4XZ4 A;  4I9C A;  4UI9 C;  4LG6 A;  1TEZ A;  3UXG A;  2WVI A;  3FTU A;  4JEH A;  1L5J A;  4RSY A;  4FP7 A;  3LXU X;  2XEN A;  3TJP A;  3TWX A;  1ZBP A;  5C2Y A;  5J90 A;  4JXT A;  3ULY A;  1N54 A;  3DXM G;  4XEI G;  2H6G A;  1OWM A;  3U66 A;  3OTN A;  2QYU A;  1ELR A;  4LCT A;  4ANW A;  3B7R L;  3PE3 A;  4GTQ A;  4ZHB A;  4ANU A;  3HXD A;  1H6O A;  2PQN A;  5CMY A;  4GTT A;  4GCO A;  4UWH A;  4KMO A;  3G2W A;  5B3S E;  1BD8 A;  3E33 A;  3PUJ A;  4FU3 A;  5CEA A;  1NZN A;  4KXK B;  4APO A;  4DX1 A;  2YIN A;  2YNQ A;  2GRL A;  3UM0 A;  2A5U A;  3SFY A;  3JXJ A;  2Y3A A;  1TR4 A;  3CVQ A;  2X6H A;  4HOR A;  1HFA A;  4JEU A;  3RO2 A;  3T5X A;  2FEZ A;  4BTA A;  3FUK A;  2MOW A;  2V8S E;  3TGO A;  5FZQ A;  4EEC A;  3HYM B;  2H6I A;  1GW6 A;  4F53 A;  3ABM E;  3SI5 A;  3R9M A;  3NZU A;  4B89 A;  2WXG A;  3T9K A;  2X6F A;  2BTD A;  2XEH A;  3D3M A;  3CVU A;  5JJ7 A;  4U8H A;  3R9A B;  1O1R A;  3NOC D;  5EIL A;  5FIO A;  5CCM A;  2EIL E;  3IHV A;  2F37 A;  1N95 A;  3ZRH A;  3RO3 A;  5FQ6 A;  2WMO A;  2AJA A;  2ETC A;  1IQR A;  5ARF A;  1NA3 A;  2MHK A;  3BG1 B;  3Q4A B;  1HS6 A;  2IFU A;  1ZB1 A;  4NIK A;  3D9J A; 
#chains in the Genus database with same CATH homology
 1YCS B;  3AJI A;  5ENO D;  3AAA C;  4J7W A;  2J8S D;  5CBO A;  4HI9 A;  3EHR A;  3TWW A;  1BD8 A;  3DEO A;  4CYM D;  3V2X A;  2L6B A;  3J5P A;  4O1O A;  4QFV A;  1YYH A;  3JXI A;  2ZGD A;  3T8K A;  3ZU7 B;  5CEA A;  5ENQ D;  1BI7 B;  3HRA A;  4DX1 A;  4DUI A;  1MX2 A;  1G3N B;  3V30 A;  4OAU C;  2F8X K;  4DX5 D;  3V79 K;  1K1A A;  1N11 A;  3D9H A;  2B0O E;  4N5Q A;  1BI8 B;  4HI8 A;  5AAR A;  4ZFH A;  4OAV B;  3IXE A;  1A5E A;  4LSZ E;  5JMN D;  4K5C A;  1N0R A;  4YDW A;  3JXJ A;  1MX4 A;  3V2O A;  2F8Y A;  1MJ0 A;  4DX2 A;  5AAO A;  3JUE A;  4A63 B;  1OT8 A;  2NYJ A;  1TR4 A;  4U96 D;  1S70 B;  4Z68 A;  3Q9U C;  2QC9 A;  2RFM A;  5ENT D;  4HRM B;  5JA4 D;  5CEC B;  5BXO A;  2BKK B;  5AQ9 A;  3NOG D;  4UUC A;  2V4H C;  3ZKJ A;  4DX6 D;  4DRX E;  1BLX B;  3TWT A;  2KXP C;  1K3Z D;  2V5Q C;  5D66 A;  5ENP D;  4BES A;  4YDY A;  4K5A B;  2PNN A;  2DWZ A;  3F6Q A;  5EID A;  2RFA A;  1DC2 A;  4U95 D;  4U8Y D;  4F6R D;  3Q9N C;  1IHB A;  1NFI E;  3HG0 D;  3EHQ A;  2XZD G;  5EYP F;  2JAB A;  3W9G A;  5KNG A;  3TWV A;  4RLY A;  5AQ7 A;  2ETA A;  5KWD A;  1YMP A;  3TWQ A;  3B7B A;  2XEE A;  3UTM A;  4O1P A;  5ENS D;  1AP7 A;  2ETB A;  4BSZ B;  5ENR D;  4HRN A;  5CER B;  1MYO A;  2KBX A;  4ATZ D;  2HE0 A;  2MYO A;  3NBN B;  4GPM A;  1D9S A;  3T9K A;  4TUM A;  1OY3 D;  5HS0 A;  4BET A;  5CED B;  1AWC B;  5EN5 D;  4LG6 A;  2XEH A;  4O60 A;  2Y0B G;  3UXG A;  3C5R A;  1WG0 A;  2BKG A;  2A5E A;  4HRL A;  1N0Q A;  3ZNG A;  4G8K A;  4J8Y A;  5CBN A;  4C48 B;  3KEA A;  1UOH A;  3ZUV B;  2DZN A;  2XEN A;  3NOC D;  2XZT G;  5EIL A;  5FIO A;  4HB5 A;  3TWX A;  5EIB E;  1BU9 A;  2P2C P;  3LJN A;  1DCQ A;  3DEP A;  2VGE A;  3J5Q B;  2F37 A;  2DZO A;  5AQA A;  4G8L A;  4BEP A;  3EU9 A;  2FO1 E;  3TWU A;  1QYM A;  5EYL A;  3B95 A;  1MX6 A;  2AJA A;  1IXV A;  1SVX A;  3SO8 A;  2ZGG A;  2QYJ A;  4B93 B;  2ETC A;  4U8V D;  3TWS A;  4LNU D;  1SW6 A;  4JB8 P;  3UI2 A;  5ITZ F;  5BXU A;  1IKN D;  5AN8 A;  2Y1L E;  4BER A;  2DVW A;  5FIN A;  5KBA A;  4DX7 D;  4QQI A;  4ZHB A;  4K5B A;  4GMR A;  1K1B A;  5KNH D;  3TWR A;  4HQD A;  4HNA D;  5HKP A;  5AQB A;  3W9F A;  5HRY A;  4HBD A;  4CZ2 D;  4NIK A;  4F1P A;  4HLL A;  1WDY A;  3V31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...