1SW6A

S. cerevisiae swi6 ankyrin-repeat fragment
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
301
structure length
254
Chain Sequence
GPIITFTHDLTSDFLSSPLKIMKALPSPVVNDNEQKMKLEAFLQRLLFSFDSLLQEVNDAFPNTQLNLNIPVDEHGNTPLHWLTSIANLELVKHLVKHGSNRLYGDNMGESCLVKAVKSVNNYDSGTFEALLDYLYPCLILEDSMNRTILHHIIITSGMTGCSAAAKYYLDILMGWIVKKQNRPIQSGDSILENLDLKWIIANMLNAQDSNGDTCLNIAARLGNISIVDALLDYGADPFIANKSGLRPVDFGAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structural analysis of the yeast cell cycle regulator Swi6 reveals variations of the ankyrin fold and has implications for Swi6 function.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription regulation
molecule keywords REGULATORY PROTEIN SWI6
total genus 89
structure length 254
sequence length 301
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13606 Ank_3 Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1sw6A00
4Z68A 5BXOA 1BU9A 3JXIA 5EILA 2V5QC 3C5RA 2Y0BG 5HS0A 5AQAA 5CERB 3EHRA 4GMRA 1K3ZD 4ZHBA 3EU9A 2FO1E 3W9FA 2BKGA 4HQDA 5BXUA 4CZ2D 4K5CA 3F6QA 4HNAD 5JMND 5FINA 4LNUD 4JB8P 4K5BA 4U8YD 4YDYA 4LSZE 5ENPD 5CBNA 3NBNB 5AN8A 4DX5D 2XEEA 2A5EA 4QQIA 3KEAA 5AAOA 5AARA 1K1AA 3W9GA 4ZFHA 2L6BA 4HRLA 2XENA 3D9HA 5CEAA 4UUCA 5HRYA 4HB5A 2F37A 5ITZF 3B95A 4J8YA 2RFAA 2ETCA 2J8SD 3V31A 1BLXB 2ETBA 3TWSA 4B93B 4A63B 2ETAA 4DX6D 5ENTD 2ZGDA 4BERA 2VGEA 5ENRD 1YCSB 1BI8B 5EN5D 3TWQA 2BKKB 4BESA 3EHQA 4F1PA 4HBDA 3LJNA 3V30A 1IKND 2P2CP 2V4HC 2AJAA 3AJIA 4HRMB 5EIBE 3J5QB 1K1BA 2DWZA 1OY3D 2HE0A 2MYOA 1IHBA 1S70B 1SVXA 3ZUVB 2RFMA 3HG0D 4NIKA 4BSZB 4C48B 4O1PA 4G8KA 2KXPC 1G3NB 3V79K 1MYOA 5FIOA 5KWDA 4BEPA 3SO8A 1WG0A 4DX7D 4U95D 1DC2A 4O1OA 4LG6A 1QYMA 4HI9A 4QFVA 4YDWA 4U96D 2F8XK 4K5AB 5AQ9A 1DCQA 3UTMA 3T9KA 3DEOA 5EIDA 4O60A 3Q9NC 4J7WA 4OAUC 3DEPA 5CEDB 1UOHA 3JXJA 5EYLA 2F8YA 3NOCD 4HLLA 1D9SA 4DUIA 4F6RD 4ATZD 1NFIE 2XZTG 1WDYA 1N0RA 4G8LA 5KBAA 1N11A 4TUMA 3TWTA 4DRXE 3ZU7B 4BETA 3TWWA 3JUEA 5AQ7A 1MX6A 1MX4A 1MX2A 1N0QA 4DX2A 1A5EA 1SW6A 4DX1A 3TWVA 2KBXA 2DZNA 2Y1LE 1IXVA 5ENSD 5KNGA 3TWRA 3UXGA 3NOGD 3Q9UC 5CBOA 4RLYA 3IXEA 3ZNGA 2XEHA 2XZDG 5D66A 3TWUA 3V2OA 3TWXA 3V2XA 1YYHA 5ENOD 2JABA 4OAVB 5HKPA 1MJ0A 1TR4A 3ZKJA 5CECB 5AQBA 4GPMA 4U8VD 3HRAA 2DVWA 1YMPA 1BI7B 5ENQD 2PNNA 1BD8A 4N5QA 4CYMD 1AWCB 4HRNA 3T8KA 3UI2A 2NYJA 2QYJA 3AAAC 4HI8A 5JA4D 1AP7A 2DZOA 2B0OE 3J5PA 2ZGGA 2QC9A 5KNHD 1OT8A 3B7BA 5EYPF
chains in the Genus database with same CATH superfamily
4B89A 5AJDA 1BU9A 4UWKA 4K0RA 4GCOA 4BX9A 1E7VA 4U7EB 2L0TB 3DSTA 3D9IA 4ZFHA 3W9GA 4HRLA 3MV3B 5J08A 3CHOA 3SNXA 4FLHA 5AIJA 2VQ2A 3E34A 4YNDA 2AJAA 1NA0A 4CCAA 4TXQA 4CYMD 3HG0D 3HVEB 4G8KA 2XQ0A 4WWOA 3ZIMA 2XEVA 5LP0A 2XS8A 3DXMG 2CFUA 4I2WA 4PS7A 2AXUA 1N52A 3PZDA 1TNOA 1Z3YA 3SBTB 2Y4TA 3WG7E 1WDYA 1PC2A 2I2OA 2LAHA 3FUMA 1MX6A 1SW6A 1ZB1A 1TN8A 3U66A 5T3RA 4U0UA 5JHBA 2XZDG 4I9EA 1MJ0A 3U9WA 3NAWA 1S0PA 2DVWA 4HOSA 3FTUA 3OXGA 3Q79A 1UJKA 1DVPA 3B7BA 3QWPA 1JCRA 1E8ZA 1UJJA 4WNGA 5HS0A 3RIBA 3RJVA 5HQ8A 4LSZE 1NP7A 5G2NA 3APCA 4FHKA 4WNDA 4KVMA 4ILGA 4NQ0A 3LY9A 1Z5SC 2F37A 1H6KA 4J8YA 3CV0A 1SZAA 2OEVA 4B93B 4JC8A 2OV8A 2ZGDA 4BERA 2VGEA 3WXXA 3QARA 1H2VC 4EBAA 4HRMB 5FQ8A 1NA3A 3QC1A 1H2TC 3Q7AA 2WXGA 2IJGX 3GZ1A 5FT9A 4CGWA 4BTBA 1G3NB 3EJNA 5CMWA 3C72A 3UMVA 1D8DA 4GZDA 2JEKA 3HHMA 3LDZA 4GPKA 4LNGA 4XX5A 2UY1B 4DUIA 4F6RD 5KBAA 3TWTA 2RD0A 1TJFA 1MX4A 1ELWA 1OCOE 2RG8A 1V54E 3SGHA 2PQRA 5FQ4A 2BF0X 4EPZA 3PZ3A 3AAAC 2DZOA 1HE8A 3LYAA 4Z68A 5B3SE 5ANLA 3RKVA 4I6JA 4A1GA 5CERB 2FO1E 3W9FA 5JMND 4OYSA 3AG3E 5FINA 5LX8A 2HO1A 1RZ4A 1OUVA 2XPYA 3U4TA 1HS6A 4QQIA 1KT1A 3PEVB 4I43A 2GRPB 4A1SA 3FTSA 5HRYA 2IQCA 5IY5E 4E6HA 1FT2A 2ETBA 3ZEFA 3AS4A 1BI8B 5EN5D 2IY0C 3EHQA 5KJMA 3FTWA 3ZRHA 4FLBA 5FWQA 4BSZB 3E4BA 5ANRA 1PAQA 2Y3AA 2OVFA 4LG6A 3MZLB 4FADA 5EDSA 3ULQA 4AY5A 4F3VA 4A55A 5ARFA 4ANXA 1N0RA 3CQGB 3NZSA 3I3NA 3HXBA 4UI9K 3CHPA 3FY4A 3ZYLA 4ILHB 4KZ0A 3D9MA 3Q7FA 3RSEG 1YYHA 4E85A 2KZTA 3UQ3A 5JJ6A 1FVFA 3PNTB 1WY6A 4KT6B 2EIJE 2PQNA 3CVPA 3UI2A 1IQRA 3RRNB 3EUVA 5T4YA 4JPSA 3UIPC 2VJ8A 3LY8A 4JL0A 3DSUA 4GMRA 4I2ZA 4HQDA 1WM5A 2WXHA 4K5BA 4DX5D 4BSXA 1EDUA 4H7YA 5AARA 2L6BA 2V4LA 2WXFA 2IF4A 3MJWA 1VDYA 5FZQA 3SD5A 3QWVA 2J09A 2CHWA 4URKA 1JPLA 2RFMA 3CGHA 3RK6A 2FULA 4DX7D 3APFA 3B7UX 3O48A 3FUHA 4BFRA 3ML8A 2AVPA 4UQXA 2OCCE 3I5PA 4EECA 5EYLA 5BV1A 2R03A 4JXTA 3BU8A 3OTNA 4L7TA 5BW8C 3JYSA 5CRUA 5CHEE 3NB2A 3TWWA 3ZYKA 4I17A 3TWRA 1FVHA 2VTBB 4EZKA 5BPPA 3IXEA 2P9SG 3ZNGA 3L9TA 5A23A 5D66A 3TWUA 4GTSA 3VTYA 2L0IA 2VGXA 2JABA 3PREA 5EX3A 4U8VD 1O5MA 1IQUA 4JHKA 2YHCA 3AU4A 4APFA 4C0MA 3JQ0A 3RRMB 3PRZA 3OAWA 3JXIA 3ASFA 4I6GA 3E30A 1HH8A 1KT0A 2XS1A 4DPRA 4K5CA 5LCWJ 1BPOA 1E8WA 2XCCA 4JB8P 5CBNA 3FH8A 3G2WA 2IOSA 3OXFA 2GGFA 4NRHB 3CHRA 4J8EA 4EBAG 3VLDA 3AG1E 1K1BA 4WAFA 1LD7A 2WMOA 3L17A 3T8MA 3LXUX 4ILIA 2YINA 4HI9A 5KJKA 3Q4AB 4AOFA 2XCBA 3NOCD 4N2SA 1Y8MA 4ATZD 2MHKA 4ACLA 3CVLA 1MHQA 2OVBA 5G05J 2Y1LE 4X8QA 3UXGA 4AVXA 3R9AB 2XGSA 4DLOA 4F1SA 4ANVA 3FWVA 4G24A 3AG2E 3G2UA 2KCVA 4H7XA 3CQCB 4Y6WA 2ONDA 4BX8A 4HVBA 4GYOA 1N4SA 4HOQA 3PZ1A 4LEUA 2BEDA 4GTMA 3L13A 2HR2A 4L9PA 2GRNB 3K9IA 5EILA 4N5CA 3IBEA 3EHRA 3T5VA 2J08A 3PDNA 3UT7A 5KJNA 4AP2A 1W3BA 3ULYA 2P9KG 5AAOA 1H6OA 1H6PA 3R7RA 1MQSA 3MV2B 1OWMA 4O6FA 4A63B 4GZ3A 5LCWC 1TNUA 3FP3A 3FUFA 1S64A 3UM3A 3V30A 3C98A 2MYOA 1SVXA 3ZXSA 2FI7A 4B94A 1TNZA 2H6FA 4L1BA 4JW1A 3UTMA 3T9KA 5EIDA 3EIJA 1TJCA 4UI9J 3JXJA 4U07A 4A3VA 1N11A 3FEYA 5E75A 4I9CA 1U2VG 5CBOA 3CHQA 2GRLA 2XEHA 3DWLG 4N3BA 3V2XA 1SQMA 4GTVA 1HFAA 4TXPA 3FH5A 3CLJA 4JHRA 2AWIA 3RO2A 4HS2A 3SI5A 2P9IG 3Q73A 2WXIA 5CCLA 5BUZA 2C0LA 3D9NA 1AP7A 2ZGGA 2QC9A 3PUKA 3HDXA 5AYWD 4JA9A 1HU3A 4WNFA 5DIZA 3TG4A 1TYQG 3CVXA 3QB2A 3PH0C 5G04C 1K3ZD 2LUHA 5T8IA 3HXDA 4AY6A 3F6QA 1NI1A 2FF4A 2A5EA 3UT4A 3ZXPA 2WM9A 3ASGA 2XRZA 4K03A 4FU3A 2VYIA 2P2CP 3GZSA 3ASOE 3MKRA 3ZUVB 2NC9A 3KSLA 5AENA 1MYOA 3FU5A 1WG0A 4O1OA 3X2QE 4U96D 3KD7A 2NXPA 3P2BA 3U64A 3BG1B 1GW6A 3URZA 1H19A 2KZTB 4TRQA 4EZLA 1O1SA 2VGYA 4UI9C 2XZTG 3G2SA 2EINE 2NSZA 1A17A 3C3OA 2IO2C 1IYGA 4L2YA 3ONLA 4KYOB 4ANWA 2KATA 4GZCA 5E76A 3S7FA 1Z6TA 4U0ZA 2VSXE 4OAVB 4JEUA 4MS6A 1D8EA 1RW2A 3DSVA 3KAEA 3DPDA 3SF4A 5KNHD 2IOLA 4XIFA 1U3DA 3HXFA 2R2LA 4HORA 2WXRA 5AQAA 4XE0A 5A6CA 4Q96A 5KJLA 1K8KG 3NBNB 5G05C 2XRYA 2A5UA 2CFZA 4U0SA 3FTZA 4U8HA 5FQ6A 4FJZA 1JCSA 2RFAA 3CVYA 3TXMA 5JJTA 3L82A 3VLEA 3TWQA 3VTXA 4XI9A 4Q94A 1SA4A 3SQVA 5EIBE 1OY3D 1E8YA 1QNFA 3AS8A 4BEPA 4CDRA 4P29A 2MOWA 4U95D 2L6JA 4YVOA 1OCCE 4QFVA 1PY1A 3Q9NC 4J7WA 3PVLA 4GZ5A 3GYZA 3IHYA 3ZW3A 3LCAA 3DPYA 3LVRE 3GZ2A 4BETA 1E7UA 4IRUA 4FULA 2L9BA 2QFCA 3UIOC 4J0UA 5ENSD 3FU0A 4C9BB 3Q9UC 4RLYA 3D9OA 1QBQA 4KZCA 3IEGA 3DSXA 3LKUA 3QNKA 3EDTB 3D9PA 4G2VA 2BTDA 2IO3C 1OT8A 2XPZA 5EYPF 1X81A 3CVWA 4CT0A 2P9PG 3EU5A 3TJPA 4HNAD 4PS3A 2GROB 4N2QA 3MGBA 4N3AA 2Y4UA 2VSOE 3ESKA 2XENA 3HXEA 5M72A 3FUIA 4HB5A 4GZ6A 3ZYQA 4F53A 3NF1A 3PUJA 4ATGA 1LD8A 5H7PA 4FJYA 3S2AA 4MRUA 2M63A 3KSQA 5B1AE 5C2YA 5D0OD 3E33A 4YDWA 3LS8A 3QK0A 4G11A 2WXNA 3B7TA 4JHJA 3B7SA 2J07A 2VSYA 5G55A 2J9QA 4F7AA 5ARGA 4KMOA 3IV0A 4V3IA 3PNLB 5EKQD 5B1BE 4KXKB 2C0MA 2P9LG 2PZIA 1OWPA 4GPMA 4I1MA 2WQHA 3VLFA 3BUAA 2WXQA 4BTAA 2FO7A 2DYRE 2QYJA 4GA0A 4JEHA 4CT4A 4GYYA 3MKQA 2QZAA 1ZU2A 1DNPA 2V5QC 2C2LA 2R59A 2GW1A 1NZNA 3R9MA 2KCKA 4CZ2D 3G2TA 2WXKA 3CHMA 2KCLA 2LO6A 4LNUD 3CK9A 4DJAA 3RAUA 2PL2A 3MX3A 1JWFA 5AN8A 2XEEA 2X3MA 1SA5A 1O1TA 1KZOA 2ETCA 2IEJA 3QDNA 2WQ7A 4HBDA 4JA7A 3AJIA 3LJ3A 5BT1A 4NIKA 1HG5A 4KBQA 5FIOA 2ZIRA 4OVUA 2F8XK 2V0PA 5HI7A 3JUIA 3MA5A 3ZHEB 3NQPA 1FPPA 5D2MC 1S63A 1UOHA 4G25A 3ABLE 3KEZA 4ME2A 2AXZA 4HFGA 2FEZA 2I1JA 3JCKC 4GAAA 3D9LA 4GA2A 4I1OB 1LF8A 4G23A 4LCTA 2WB2A 2DZNA 2J4BA 1V55E 3CVQA 4APOA 3HIZA 4I6EA 5ENOD 4RSYA 3CEQA 5AQBA 3CSTA 3PZ2A 3LY7A 5FZSA 5ENQD 4HRNA 4LRZA 4DI4A 4CDNA 1FCHA 1N94A 2EIKE 2EQXA 1IXVA 2P58C 4B0ZA 3ZGQA 2LNIA 3AU5A 2VGXB 3UKUG 3ASNE 3FTXA 1LTXA 5ENPD 1QQEA 5FZRA 4FHJA 1H0AA 4BY6A 3ABME 1E90A 2J8SD 2CG2A 1BLXB 3L6AA 3TWSA 5CMYA 4BWRA 1XNFA 4MBGA 2UY1A 3ZN3A 3CKCA 3P1UA 1S70B 3L22A 4N39A 2WVIA 1Q2ZA 2KXPC 3V79K 4J6IA 1WAO1 4MLPA 5G04J 4GMJA 5BV0A 4PS8A 1OCZE 4K5AB 3S7BA 4FC8A 2AW6A 3Q5MA 5CEDB 3ABKE 4EHMA 3ASHA 3RU0A 3CR3A 1NFIE 3TGOA 2R17C 4UWFA 4TUMA 1E96B 4CDMA 2CHZA 1MX2A 4GTOA 3ENEA 1N95A 1UN8A 4B8AA 3E37A 3ZPJA 4L23A 1N4PA 4J8SA 3ASDA 4JVSA 4JZYA 4B8CB 4N5QA 1UN9A 3FUNA 4EQFA 3QKYA 4PUCA 1NL4A 3CHSA 3PZ4A 3SZ7A 3MYVA 4BT8A 3JQ1A 3CK7A 4WWNA 4L2LA 3Q78A 3CK8A 2J4DA 4D10C 2MRIA 2BUGA 3ZHEA 3FEXA 3HXCA 3I4RB 4YDYA 4UQYA 3CVVA 3UX4A 1N4QA 3D3MA 1ELRA 3FUJA 4TUUA 3APDA 4BESA 3TXNA 4MKTA 4GYWA 4GU5A 2EILE 2FBNA 2IONA 2KC7A 1HX8A 4ABNA 3HVEA 5JHAA 4GTPA 2WXOA 4RG6A 3RRUA 5D0QD 2F8YA 4PH4B 2HYZA 2P9UG 1D9SA 4NURA 3D9KA 3QAQA 4DRXE 3JUEA 5AQ7A 2YQ8A 4DX2A 2DBAA 5LFAA 4UWHA 2KBXA 4EZJA 3L08A 3EIQC 4DLQA 3Q75A 2WXPA 4UQZA 3FU3A 3Q49B 5CECB 2I1KA 3GW4A 1P5QA 3CSFA 3Q15A 2AXVA 4YVQC 4CGVA 2B0OE 4Q69A 5BXOA 4UWLA 3DXKG 5CRVA 2H6HA 2QY7A 3ESLA 1OWOA 3ZVVA 5BXUA 3CKBA 3FU6A 3TAXA 3CVNA 3FFLA 2VSNA 3HYMB 3KEAA 2R5SA 4Y6CA 2J49A 3DSWA 3UUXA 2CG3A 5ITZF 3B95A 1UG3A 5ENTD 3SY2A 5EX0A 5FQ7A 4AV7A 2H6IA 1TNBA 3C3RA 2DYSE 1OXJA 3PE3A 1U3CA 2ZISA 2HE0A 3UM2A 4LERA 3SO8A 4GTQA 3E32A 3LEWA 2LXMA 4AXHA 4G1TA 2X6IA 3LPZA 2JLBA 3G2VA 3FH7A 4IN3B 3B7RL 4LNBA 1TN6A 1MZCA 1KZPA 4IYPA 1TEZA 4BT9A 4R7LA 2PM6A 4TV3A 4A3TA 3D9JA 4W9RA 3V2OA 2QYUA 1TR4A 3ZKJA 3HRAA 1EPUA 2PNNA 2VTBA 3SFXA 3MEKA 1IHGA 3FDHA 5JA4D 3PEUB 1QZ2A 3OXLA 2ZXWE 2RKKA 5ENNA 3UM1A 4IULA 1Z3XA 2ILRA 3IKOB 4J8FA 1HF8A 1JCQA 3BG0B 4ZHBA 3EU9A 4FP7A 4HOTA 3DBSA 3MCXA 2GRMA 3QJZA 4U8YD 3ZFWA 3B13A 3LVQE 3FUDA 3MKQB 5CEAA 1N4RA 3ML9A 2WPVA 3V31A 3FTVA 4XKCA 1YCSB 2LAIA 3CIAA 3LJNA 4WNEA 2V4HC 1ZBPA 1IHBA 4C48B 2CHXA 4DK5A 4N3CA 1KLXA 5KWDA 3UKRG 3I4GA 2YNQA 1DC2A 1QYMA 1YA0A 5AJLA 2XPIA 4WUYA 3DEOA 4RQIA 5C1DA 1O1RA 1N54A 4XI0A 2X6JA 2DCPA 4GB9A 1L5JA 5BNWA 1HZ4A 3AS5A 4FA6A 3KS2A 1SZ9A 4ACKA 4DI3A 4C0EA 2F0YA 1TN7A 3UPVA 3C3QA 4DX1A 3SBSA 5KNGA 1ELKA 3TWVA 3UT8A 1DCEA 2GRRB 3FTYA 5HKPA 2V5FA 3O4ZA 3FUEA 1BD8A 2R05A 3T8KA 4HI8A 3IHVA 2I6HA 4YDEA 1X5BA 3J5PA 3SFZA 1JUQA 4GMLA 2A4ZA 4I1AA 2OEWA 2WXJA 4YDOA 4AIFA 4M3OA 2BKGA 5CCMA 1HXIA 5LOZA 3T5XA 3FULA 1K1AA 1OCRE 3D9HA 4GCNA 4UUCA 1E8XA 5JJ7A 3PS6A 3ZYMA 3R7QA 4CRWA 2X6HA 5ENRD 4GTRA 3U3WA 2BKKB 4F1PA 1IKND 3SFYA 2GRQB 3J5QB 4XZ4A 3UM0A 2H6GA 2X6KA 2V8SE 1HO8A 1DCQA 5FTPA 3TG5A 2WMNA 4OAUC 2E2EA 2PM7A 2EIME 1INZA 3L54A 4GA1A 3BEEA 2UWJG 3CVUA 3ZU7B 2DIWA 4PDXA 1OWLA 1N0QA 4AJWA 2E0IA 3NOGD 2ZU6B 4UWGA 3S7DA 3TWXA 2IU1A 3BQOA 3QWWA 3ONKA 3SHFA 4OVVA 1UW4B 4JD2G 3EHMA 2Y69E 4G26A 1OWNA 4HLEA 1EYHA 1B89A 3C5RA 2Y0BG 3L16A 2LXLA 2XGMA 4AEZC 4M7CA 3DSSA 2YHEA 4AM9A 4WWPA 2XHEA 2P9NG 4XEIG 3EHNA 3RO3A 3AG4E 2WXLA 1TNYA 3QOUA 2B6CA 3FHEA 2I9CA 3NZUA 3UINC 2HM8A 5A7DB 4CEMA 4DX6D 1FT1A 2ETAA 2LSUA 4HXIA 1H2UA 4RVBA 1KPSB 4ANUA 4GTTA 2LSVA 2DWZA 2Q7FA 4O1PA 5J90A 5KCMA 1EF1C 4U63A 2X38A 4RG9A 3FUKA 5DBKA 2R02A 5AQ9A 2XGOA 4O60A 4KVOA 4XKBA 3DEPA 3DRAA 2IFUA 3Q47B 1HG2A 2KM4A 5FJYA 3ISMC 4HLLA 4TXRA 4G8LA 1N9AA 2WXMA 4NACA 3PE4A 1A5EA 2WQ6A 2X6FA 4U04A 3N71A 4HOUA 2OOEA 1YMPA 1BI7B 3ULEG 1Y6IA 3TL5A 1AWCB 2NYJA 1JWGA 1XGWA 4J8DA 3S7JA 4LUNU
chains in the Genus database with same CATH topology
4Z68A 5BXOA 1BU9A 3JXIA 5EILA 2V5QC 3C5RA 2Y0BG 5HS0A 5AQAA 5CERB 3EHRA 4GMRA 1K3ZD 4ZHBA 3EU9A 2FO1E 3W9FA 2BKGA 4HQDA 5BXUA 4CZ2D 4K5CA 3F6QA 4HNAD 5JMND 5FINA 4LNUD 4JB8P 4K5BA 4U8YD 4YDYA 4LSZE 5ENPD 5CBNA 3NBNB 5AN8A 4DX5D 2XEEA 2A5EA 4QQIA 3KEAA 5AAOA 5AARA 1K1AA 3W9GA 4ZFHA 2L6BA 4HRLA 2XENA 3D9HA 5CEAA 4UUCA 5HRYA 4HB5A 2F37A 5ITZF 3B95A 4J8YA 2RFAA 2ETCA 2J8SD 3V31A 1BLXB 2ETBA 3TWSA 4B93B 4A63B 2ETAA 4DX6D 5ENTD 2ZGDA 4BERA 2VGEA 5ENRD 1YCSB 1BI8B 5EN5D 3TWQA 2BKKB 4BESA 3EHQA 4F1PA 4HBDA 3LJNA 3V30A 1IKND 2P2CP 2V4HC 2AJAA 3AJIA 4HRMB 5EIBE 3J5QB 1K1BA 2DWZA 1OY3D 2HE0A 2MYOA 1IHBA 1S70B 1SVXA 3ZUVB 2RFMA 3HG0D 4NIKA 4BSZB 4C48B 4O1PA 4G8KA 2KXPC 1G3NB 3V79K 1MYOA 5FIOA 5KWDA 4BEPA 3SO8A 1WG0A 4DX7D 4U95D 1DC2A 4O1OA 4LG6A 1QYMA 4HI9A 4QFVA 4YDWA 4U96D 2F8XK 4K5AB 5AQ9A 1DCQA 3UTMA 3T9KA 3DEOA 5EIDA 4O60A 3Q9NC 4J7WA 4OAUC 3DEPA 5CEDB 1UOHA 3JXJA 5EYLA 2F8YA 3NOCD 4HLLA 1D9SA 4DUIA 4F6RD 4ATZD 1NFIE 2XZTG 1WDYA 1N0RA 4G8LA 5KBAA 1N11A 4TUMA 3TWTA 4DRXE 3ZU7B 4BETA 3TWWA 3JUEA 5AQ7A 1MX6A 1MX4A 1MX2A 1N0QA 4DX2A 1A5EA 1SW6A 4DX1A 3TWVA 2KBXA 2DZNA 2Y1LE 1IXVA 5ENSD 5KNGA 3TWRA 3UXGA 3NOGD 3Q9UC 5CBOA 4RLYA 3IXEA 3ZNGA 2XEHA 2XZDG 5D66A 3TWUA 3V2OA 3TWXA 3V2XA 1YYHA 5ENOD 2JABA 4OAVB 5HKPA 1MJ0A 1TR4A 3ZKJA 5CECB 5AQBA 4GPMA 4U8VD 3HRAA 2DVWA 1YMPA 1BI7B 5ENQD 2PNNA 1BD8A 4N5QA 4CYMD 1AWCB 4HRNA 3T8KA 3UI2A 2NYJA 2QYJA 3AAAC 4HI8A 5JA4D 1AP7A 2DZOA 2B0OE 3J5PA 2ZGGA 2QC9A 5KNHD 1OT8A 3B7BA 5EYPF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z68 A;  5BXO A;  1BU9 A;  3JXI A;  5EIL A;  2V5Q C;  3C5R A;  2Y0B G;  5HS0 A;  5AQA A;  5CER B;  3EHR A;  4GMR A;  1K3Z D;  4ZHB A;  3EU9 A;  2FO1 E;  3W9F A;  2BKG A;  4HQD A;  5BXU A;  4CZ2 D;  4K5C A;  3F6Q A;  4HNA D;  5JMN D;  5FIN A;  4LNU D;  4JB8 P;  4K5B A;  4U8Y D;  4YDY A;  4LSZ E;  5ENP D;  5CBN A;  3NBN B;  5AN8 A;  4DX5 D;  2XEE A;  2A5E A;  4QQI A;  3KEA A;  5AAO A;  5AAR A;  1K1A A;  3W9G A;  4ZFH A;  2L6B A;  4HRL A;  2XEN A;  3D9H A;  5CEA A;  4UUC A;  5HRY A;  4HB5 A;  2F37 A;  5ITZ F;  3B95 A;  4J8Y A;  2RFA A;  2ETC A;  2J8S D;  3V31 A;  1BLX B;  2ETB A;  3TWS A;  4B93 B;  4A63 B;  2ETA A;  4DX6 D;  5ENT D;  2ZGD A;  4BER A;  2VGE A;  5ENR D;  1YCS B;  1BI8 B;  5EN5 D;  3TWQ A;  2BKK B;  4BES A;  3EHQ A;  4F1P A;  4HBD A;  3LJN A;  3V30 A;  1IKN D;  2P2C P;  2V4H C;  2AJA A;  3AJI A;  4HRM B;  5EIB E;  3J5Q B;  1K1B A;  2DWZ A;  1OY3 D;  2HE0 A;  2MYO A;  1IHB A;  1S70 B;  1SVX A;  3ZUV B;  2RFM A;  3HG0 D;  4NIK A;  4BSZ B;  4C48 B;  4O1P A;  4G8K A;  2KXP C;  1G3N B;  3V79 K;  1MYO A;  5FIO A;  5KWD A;  4BEP A;  3SO8 A;  1WG0 A;  4DX7 D;  4U95 D;  1DC2 A;  4O1O A;  4LG6 A;  1QYM A;  4HI9 A;  4QFV A;  4YDW A;  4U96 D;  2F8X K;  4K5A B;  5AQ9 A;  1DCQ A;  3UTM A;  3T9K A;  3DEO A;  5EID A;  4O60 A;  3Q9N C;  4J7W A;  4OAU C;  3DEP A;  5CED B;  1UOH A;  3JXJ A;  5EYL A;  2F8Y A;  3NOC D;  4HLL A;  1D9S A;  4DUI A;  4F6R D;  4ATZ D;  1NFI E;  2XZT G;  1WDY A;  1N0R A;  4G8L A;  5KBA A;  1N11 A;  4TUM A;  3TWT A;  4DRX E;  3ZU7 B;  4BET A;  3TWW A;  3JUE A;  5AQ7 A;  1MX6 A;  1MX4 A;  1MX2 A;  1N0Q A;  4DX2 A;  1A5E A;  1SW6 A;  4DX1 A;  3TWV A;  2KBX A;  2DZN A;  2Y1L E;  1IXV A;  5ENS D;  5KNG A;  3TWR A;  3UXG A;  3NOG D;  3Q9U C;  5CBO A;  4RLY A;  3IXE A;  3ZNG A;  2XEH A;  2XZD G;  5D66 A;  3TWU A;  3V2O A;  3TWX A;  3V2X A;  1YYH A;  5ENO D;  2JAB A;  4OAV B;  5HKP A;  1MJ0 A;  1TR4 A;  3ZKJ A;  5CEC B;  5AQB A;  4GPM A;  4U8V D;  3HRA A;  2DVW A;  1YMP A;  1BI7 B;  5ENQ D;  2PNN A;  1BD8 A;  4N5Q A;  4CYM D;  1AWC B;  4HRN A;  3T8K A;  3UI2 A;  2NYJ A;  2QYJ A;  3AAA C;  4HI8 A;  5JA4 D;  1AP7 A;  2DZO A;  2B0O E;  3J5P A;  2ZGG A;  2QC9 A;  5KNH D;  1OT8 A;  3B7B A;  5EYP F; 
#chains in the Genus database with same CATH topology
 4B89 A;  5AJD A;  1BU9 A;  4UWK A;  4K0R A;  4GCO A;  4BX9 A;  1E7V A;  4U7E B;  2L0T B;  3DST A;  3D9I A;  4ZFH A;  3W9G A;  4HRL A;  3MV3 B;  5J08 A;  3CHO A;  3SNX A;  4FLH A;  5AIJ A;  2VQ2 A;  3E34 A;  4YND A;  2AJA A;  1NA0 A;  4CCA A;  4TXQ A;  4CYM D;  3HG0 D;  3HVE B;  4G8K A;  2XQ0 A;  4WWO A;  3ZIM A;  2XEV A;  5LP0 A;  2XS8 A;  3DXM G;  2CFU A;  4I2W A;  4PS7 A;  2AXU A;  1N52 A;  3PZD A;  1TNO A;  1Z3Y A;  3SBT B;  2Y4T A;  3WG7 E;  1WDY A;  1PC2 A;  2I2O A;  2LAH A;  3FUM A;  1MX6 A;  1SW6 A;  1ZB1 A;  1TN8 A;  3U66 A;  5T3R A;  4U0U A;  5JHB A;  2XZD G;  4I9E A;  1MJ0 A;  3U9W A;  3NAW A;  1S0P A;  2DVW A;  4HOS A;  3FTU A;  3OXG A;  3Q79 A;  1UJK A;  1DVP A;  3B7B A;  3QWP A;  1JCR A;  1E8Z A;  1UJJ A;  4WNG A;  5HS0 A;  3RIB A;  3RJV A;  5HQ8 A;  4LSZ E;  1NP7 A;  5G2N A;  3APC A;  4FHK A;  4WND A;  4KVM A;  4ILG A;  4NQ0 A;  3LY9 A;  1Z5S C;  2F37 A;  1H6K A;  4J8Y A;  3CV0 A;  1SZA A;  2OEV A;  4B93 B;  4JC8 A;  2OV8 A;  2ZGD A;  4BER A;  2VGE A;  3WXX A;  3QAR A;  1H2V C;  4EBA A;  4HRM B;  5FQ8 A;  1NA3 A;  3QC1 A;  1H2T C;  3Q7A A;  2WXG A;  2IJG X;  3GZ1 A;  5FT9 A;  4CGW A;  4BTB A;  1G3N B;  3EJN A;  5CMW A;  3C72 A;  3UMV A;  1D8D A;  4GZD A;  2JEK A;  3HHM A;  3LDZ A;  4GPK A;  4LNG A;  4XX5 A;  2UY1 B;  4DUI A;  4F6R D;  5KBA A;  3TWT A;  2RD0 A;  1TJF A;  1MX4 A;  1ELW A;  1OCO E;  2RG8 A;  1V54 E;  3SGH A;  2PQR A;  5FQ4 A;  2BF0 X;  4EPZ A;  3PZ3 A;  3AAA C;  2DZO A;  1HE8 A;  3LYA A;  4Z68 A;  5B3S E;  5ANL A;  3RKV A;  4I6J A;  4A1G A;  5CER B;  2FO1 E;  3W9F A;  5JMN D;  4OYS A;  3AG3 E;  5FIN A;  5LX8 A;  2HO1 A;  1RZ4 A;  1OUV A;  2XPY A;  3U4T A;  1HS6 A;  4QQI A;  1KT1 A;  3PEV B;  4I43 A;  2GRP B;  4A1S A;  3FTS A;  5HRY A;  2IQC A;  5IY5 E;  4E6H A;  1FT2 A;  2ETB A;  3ZEF A;  3AS4 A;  1BI8 B;  5EN5 D;  2IY0 C;  3EHQ A;  5KJM A;  3FTW A;  3ZRH A;  4FLB A;  5FWQ A;  4BSZ B;  3E4B A;  5ANR A;  1PAQ A;  2Y3A A;  2OVF A;  4LG6 A;  3MZL B;  4FAD A;  5EDS A;  3ULQ A;  4AY5 A;  4F3V A;  4A55 A;  5ARF A;  4ANX A;  1N0R A;  3CQG B;  3NZS A;  3I3N A;  3HXB A;  4UI9 K;  3CHP A;  3FY4 A;  3ZYL A;  4ILH B;  4KZ0 A;  3D9M A;  3Q7F A;  3RSE G;  1YYH A;  4E85 A;  2KZT A;  3UQ3 A;  5JJ6 A;  1FVF A;  3PNT B;  1WY6 A;  4KT6 B;  2EIJ E;  2PQN A;  3CVP A;  3UI2 A;  1IQR A;  3RRN B;  3EUV A;  5T4Y A;  4JPS A;  3UIP C;  2VJ8 A;  3LY8 A;  4JL0 A;  3DSU A;  4GMR A;  4I2Z A;  4HQD A;  1WM5 A;  2WXH A;  4K5B A;  4DX5 D;  4BSX A;  1EDU A;  4H7Y A;  5AAR A;  2L6B A;  2V4L A;  2WXF A;  2IF4 A;  3MJW A;  1VDY A;  5FZQ A;  3SD5 A;  3QWV A;  2J09 A;  2CHW A;  4URK A;  1JPL A;  2RFM A;  3CGH A;  3RK6 A;  2FUL A;  4DX7 D;  3APF A;  3B7U X;  3O48 A;  3FUH A;  4BFR A;  3ML8 A;  2AVP A;  4UQX A;  2OCC E;  3I5P A;  4EEC A;  5EYL A;  5BV1 A;  2R03 A;  4JXT A;  3BU8 A;  3OTN A;  4L7T A;  5BW8 C;  3JYS A;  5CRU A;  5CHE E;  3NB2 A;  3TWW A;  3ZYK A;  4I17 A;  3TWR A;  1FVH A;  2VTB B;  4EZK A;  5BPP A;  3IXE A;  2P9S G;  3ZNG A;  3L9T A;  5A23 A;  5D66 A;  3TWU A;  4GTS A;  3VTY A;  2L0I A;  2VGX A;  2JAB A;  3PRE A;  5EX3 A;  4U8V D;  1O5M A;  1IQU A;  4JHK A;  2YHC A;  3AU4 A;  4APF A;  4C0M A;  3JQ0 A;  3RRM B;  3PRZ A;  3OAW A;  3JXI A;  3ASF A;  4I6G A;  3E30 A;  1HH8 A;  1KT0 A;  2XS1 A;  4DPR A;  4K5C A;  5LCW J;  1BPO A;  1E8W A;  2XCC A;  4JB8 P;  5CBN A;  3FH8 A;  3G2W A;  2IOS A;  3OXF A;  2GGF A;  4NRH B;  3CHR A;  4J8E A;  4EBA G;  3VLD A;  3AG1 E;  1K1B A;  4WAF A;  1LD7 A;  2WMO A;  3L17 A;  3T8M A;  3LXU X;  4ILI A;  2YIN A;  4HI9 A;  5KJK A;  3Q4A B;  4AOF A;  2XCB A;  3NOC D;  4N2S A;  1Y8M A;  4ATZ D;  2MHK A;  4ACL A;  3CVL A;  1MHQ A;  2OVB A;  5G05 J;  2Y1L E;  4X8Q A;  3UXG A;  4AVX A;  3R9A B;  2XGS A;  4DLO A;  4F1S A;  4ANV A;  3FWV A;  4G24 A;  3AG2 E;  3G2U A;  2KCV A;  4H7X A;  3CQC B;  4Y6W A;  2OND A;  4BX8 A;  4HVB A;  4GYO A;  1N4S A;  4HOQ A;  3PZ1 A;  4LEU A;  2BED A;  4GTM A;  3L13 A;  2HR2 A;  4L9P A;  2GRN B;  3K9I A;  5EIL A;  4N5C A;  3IBE A;  3EHR A;  3T5V A;  2J08 A;  3PDN A;  3UT7 A;  5KJN A;  4AP2 A;  1W3B A;  3ULY A;  2P9K G;  5AAO A;  1H6O A;  1H6P A;  3R7R A;  1MQS A;  3MV2 B;  1OWM A;  4O6F A;  4A63 B;  4GZ3 A;  5LCW C;  1TNU A;  3FP3 A;  3FUF A;  1S64 A;  3UM3 A;  3V30 A;  3C98 A;  2MYO A;  1SVX A;  3ZXS A;  2FI7 A;  4B94 A;  1TNZ A;  2H6F A;  4L1B A;  4JW1 A;  3UTM A;  3T9K A;  5EID A;  3EIJ A;  1TJC A;  4UI9 J;  3JXJ A;  4U07 A;  4A3V A;  1N11 A;  3FEY A;  5E75 A;  4I9C A;  1U2V G;  5CBO A;  3CHQ A;  2GRL A;  2XEH A;  3DWL G;  4N3B A;  3V2X A;  1SQM A;  4GTV A;  1HFA A;  4TXP A;  3FH5 A;  3CLJ A;  4JHR A;  2AWI A;  3RO2 A;  4HS2 A;  3SI5 A;  2P9I G;  3Q73 A;  2WXI A;  5CCL A;  5BUZ A;  2C0L A;  3D9N A;  1AP7 A;  2ZGG A;  2QC9 A;  3PUK A;  3HDX A;  5AYW D;  4JA9 A;  1HU3 A;  4WNF A;  5DIZ A;  3TG4 A;  1TYQ G;  3CVX A;  3QB2 A;  3PH0 C;  5G04 C;  1K3Z D;  2LUH A;  5T8I A;  3HXD A;  4AY6 A;  3F6Q A;  1NI1 A;  2FF4 A;  2A5E A;  3UT4 A;  3ZXP A;  2WM9 A;  3ASG A;  2XRZ A;  4K03 A;  4FU3 A;  2VYI A;  2P2C P;  3GZS A;  3ASO E;  3MKR A;  3ZUV B;  2NC9 A;  3KSL A;  5AEN A;  1MYO A;  3FU5 A;  1WG0 A;  4O1O A;  3X2Q E;  4U96 D;  3KD7 A;  2NXP A;  3P2B A;  3U64 A;  3BG1 B;  1GW6 A;  3URZ A;  1H19 A;  2KZT B;  4TRQ A;  4EZL A;  1O1S A;  2VGY A;  4UI9 C;  2XZT G;  3G2S A;  2EIN E;  2NSZ A;  1A17 A;  3C3O A;  2IO2 C;  1IYG A;  4L2Y A;  3ONL A;  4KYO B;  4ANW A;  2KAT A;  4GZC A;  5E76 A;  3S7F A;  1Z6T A;  4U0Z A;  2VSX E;  4OAV B;  4JEU A;  4MS6 A;  1D8E A;  1RW2 A;  3DSV A;  3KAE A;  3DPD A;  3SF4 A;  5KNH D;  2IOL A;  4XIF A;  1U3D A;  3HXF A;  2R2L A;  4HOR A;  2WXR A;  5AQA A;  4XE0 A;  5A6C A;  4Q96 A;  5KJL A;  1K8K G;  3NBN B;  5G05 C;  2XRY A;  2A5U A;  2CFZ A;  4U0S A;  3FTZ A;  4U8H A;  5FQ6 A;  4FJZ A;  1JCS A;  2RFA A;  3CVY A;  3TXM A;  5JJT A;  3L82 A;  3VLE A;  3TWQ A;  3VTX A;  4XI9 A;  4Q94 A;  1SA4 A;  3SQV A;  5EIB E;  1OY3 D;  1E8Y A;  1QNF A;  3AS8 A;  4BEP A;  4CDR A;  4P29 A;  2MOW A;  4U95 D;  2L6J A;  4YVO A;  1OCC E;  4QFV A;  1PY1 A;  3Q9N C;  4J7W A;  3PVL A;  4GZ5 A;  3GYZ A;  3IHY A;  3ZW3 A;  3LCA A;  3DPY A;  3LVR E;  3GZ2 A;  4BET A;  1E7U A;  4IRU A;  4FUL A;  2L9B A;  2QFC A;  3UIO C;  4J0U A;  5ENS D;  3FU0 A;  4C9B B;  3Q9U C;  4RLY A;  3D9O A;  1QBQ A;  4KZC A;  3IEG A;  3DSX A;  3LKU A;  3QNK A;  3EDT B;  3D9P A;  4G2V A;  2BTD A;  2IO3 C;  1OT8 A;  2XPZ A;  5EYP F;  1X81 A;  3CVW A;  4CT0 A;  2P9P G;  3EU5 A;  3TJP A;  4HNA D;  4PS3 A;  2GRO B;  4N2Q A;  3MGB A;  4N3A A;  2Y4U A;  2VSO E;  3ESK A;  2XEN A;  3HXE A;  5M72 A;  3FUI A;  4HB5 A;  4GZ6 A;  3ZYQ A;  4F53 A;  3NF1 A;  3PUJ A;  4ATG A;  1LD8 A;  5H7P A;  4FJY A;  3S2A A;  4MRU A;  2M63 A;  3KSQ A;  5B1A E;  5C2Y A;  5D0O D;  3E33 A;  4YDW A;  3LS8 A;  3QK0 A;  4G11 A;  2WXN A;  3B7T A;  4JHJ A;  3B7S A;  2J07 A;  2VSY A;  5G55 A;  2J9Q A;  4F7A A;  5ARG A;  4KMO A;  3IV0 A;  4V3I A;  3PNL B;  5EKQ D;  5B1B E;  4KXK B;  2C0M A;  2P9L G;  2PZI A;  1OWP A;  4GPM A;  4I1M A;  2WQH A;  3VLF A;  3BUA A;  2WXQ A;  4BTA A;  2FO7 A;  2DYR E;  2QYJ A;  4GA0 A;  4JEH A;  4CT4 A;  4GYY A;  3MKQ A;  2QZA A;  1ZU2 A;  1DNP A;  2V5Q C;  2C2L A;  2R59 A;  2GW1 A;  1NZN A;  3R9M A;  2KCK A;  4CZ2 D;  3G2T A;  2WXK A;  3CHM A;  2KCL A;  2LO6 A;  4LNU D;  3CK9 A;  4DJA A;  3RAU A;  2PL2 A;  3MX3 A;  1JWF A;  5AN8 A;  2XEE A;  2X3M A;  1SA5 A;  1O1T A;  1KZO A;  2ETC A;  2IEJ A;  3QDN A;  2WQ7 A;  4HBD A;  4JA7 A;  3AJI A;  3LJ3 A;  5BT1 A;  4NIK A;  1HG5 A;  4KBQ A;  5FIO A;  2ZIR A;  4OVU A;  2F8X K;  2V0P A;  5HI7 A;  3JUI A;  3MA5 A;  3ZHE B;  3NQP A;  1FPP A;  5D2M C;  1S63 A;  1UOH A;  4G25 A;  3ABL E;  3KEZ A;  4ME2 A;  2AXZ A;  4HFG A;  2FEZ A;  2I1J A;  3JCK C;  4GAA A;  3D9L A;  4GA2 A;  4I1O B;  1LF8 A;  4G23 A;  4LCT A;  2WB2 A;  2DZN A;  2J4B A;  1V55 E;  3CVQ A;  4APO A;  3HIZ A;  4I6E A;  5ENO D;  4RSY A;  3CEQ A;  5AQB A;  3CST A;  3PZ2 A;  3LY7 A;  5FZS A;  5ENQ D;  4HRN A;  4LRZ A;  4DI4 A;  4CDN A;  1FCH A;  1N94 A;  2EIK E;  2EQX A;  1IXV A;  2P58 C;  4B0Z A;  3ZGQ A;  2LNI A;  3AU5 A;  2VGX B;  3UKU G;  3ASN E;  3FTX A;  1LTX A;  5ENP D;  1QQE A;  5FZR A;  4FHJ A;  1H0A A;  4BY6 A;  3ABM E;  1E90 A;  2J8S D;  2CG2 A;  1BLX B;  3L6A A;  3TWS A;  5CMY A;  4BWR A;  1XNF A;  4MBG A;  2UY1 A;  3ZN3 A;  3CKC A;  3P1U A;  1S70 B;  3L22 A;  4N39 A;  2WVI A;  1Q2Z A;  2KXP C;  3V79 K;  4J6I A;  1WAO 1;  4MLP A;  5G04 J;  4GMJ A;  5BV0 A;  4PS8 A;  1OCZ E;  4K5A B;  3S7B A;  4FC8 A;  2AW6 A;  3Q5M A;  5CED B;  3ABK E;  4EHM A;  3ASH A;  3RU0 A;  3CR3 A;  1NFI E;  3TGO A;  2R17 C;  4UWF A;  4TUM A;  1E96 B;  4CDM A;  2CHZ A;  1MX2 A;  4GTO A;  3ENE A;  1N95 A;  1UN8 A;  4B8A A;  3E37 A;  3ZPJ A;  4L23 A;  1N4P A;  4J8S A;  3ASD A;  4JVS A;  4JZY A;  4B8C B;  4N5Q A;  1UN9 A;  3FUN A;  4EQF A;  3QKY A;  4PUC A;  1NL4 A;  3CHS A;  3PZ4 A;  3SZ7 A;  3MYV A;  4BT8 A;  3JQ1 A;  3CK7 A;  4WWN A;  4L2L A;  3Q78 A;  3CK8 A;  2J4D A;  4D10 C;  2MRI A;  2BUG A;  3ZHE A;  3FEX A;  3HXC A;  3I4R B;  4YDY A;  4UQY A;  3CVV A;  3UX4 A;  1N4Q A;  3D3M A;  1ELR A;  3FUJ A;  4TUU A;  3APD A;  4BES A;  3TXN A;  4MKT A;  4GYW A;  4GU5 A;  2EIL E;  2FBN A;  2ION A;  2KC7 A;  1HX8 A;  4ABN A;  3HVE A;  5JHA A;  4GTP A;  2WXO A;  4RG6 A;  3RRU A;  5D0Q D;  2F8Y A;  4PH4 B;  2HYZ A;  2P9U G;  1D9S A;  4NUR A;  3D9K A;  3QAQ A;  4DRX E;  3JUE A;  5AQ7 A;  2YQ8 A;  4DX2 A;  2DBA A;  5LFA A;  4UWH A;  2KBX A;  4EZJ A;  3L08 A;  3EIQ C;  4DLQ A;  3Q75 A;  2WXP A;  4UQZ A;  3FU3 A;  3Q49 B;  5CEC B;  2I1K A;  3GW4 A;  1P5Q A;  3CSF A;  3Q15 A;  2AXV A;  4YVQ C;  4CGV A;  2B0O E;  4Q69 A;  5BXO A;  4UWL A;  3DXK G;  5CRV A;  2H6H A;  2QY7 A;  3ESL A;  1OWO A;  3ZVV A;  5BXU A;  3CKB A;  3FU6 A;  3TAX A;  3CVN A;  3FFL A;  2VSN A;  3HYM B;  3KEA A;  2R5S A;  4Y6C A;  2J49 A;  3DSW A;  3UUX A;  2CG3 A;  5ITZ F;  3B95 A;  1UG3 A;  5ENT D;  3SY2 A;  5EX0 A;  5FQ7 A;  4AV7 A;  2H6I A;  1TNB A;  3C3R A;  2DYS E;  1OXJ A;  3PE3 A;  1U3C A;  2ZIS A;  2HE0 A;  3UM2 A;  4LER A;  3SO8 A;  4GTQ A;  3E32 A;  3LEW A;  2LXM A;  4AXH A;  4G1T A;  2X6I A;  3LPZ A;  2JLB A;  3G2V A;  3FH7 A;  4IN3 B;  3B7R L;  4LNB A;  1TN6 A;  1MZC A;  1KZP A;  4IYP A;  1TEZ A;  4BT9 A;  4R7L A;  2PM6 A;  4TV3 A;  4A3T A;  3D9J A;  4W9R A;  3V2O A;  2QYU A;  1TR4 A;  3ZKJ A;  3HRA A;  1EPU A;  2PNN A;  2VTB A;  3SFX A;  3MEK A;  1IHG A;  3FDH A;  5JA4 D;  3PEU B;  1QZ2 A;  3OXL A;  2ZXW E;  2RKK A;  5ENN A;  3UM1 A;  4IUL A;  1Z3X A;  2ILR A;  3IKO B;  4J8F A;  1HF8 A;  1JCQ A;  3BG0 B;  4ZHB A;  3EU9 A;  4FP7 A;  4HOT A;  3DBS A;  3MCX A;  2GRM A;  3QJZ A;  4U8Y D;  3ZFW A;  3B13 A;  3LVQ E;  3FUD A;  3MKQ B;  5CEA A;  1N4R A;  3ML9 A;  2WPV A;  3V31 A;  3FTV A;  4XKC A;  1YCS B;  2LAI A;  3CIA A;  3LJN A;  4WNE A;  2V4H C;  1ZBP A;  1IHB A;  4C48 B;  2CHX A;  4DK5 A;  4N3C A;  1KLX A;  5KWD A;  3UKR G;  3I4G A;  2YNQ A;  1DC2 A;  1QYM A;  1YA0 A;  5AJL A;  2XPI A;  4WUY A;  3DEO A;  4RQI A;  5C1D A;  1O1R A;  1N54 A;  4XI0 A;  2X6J A;  2DCP A;  4GB9 A;  1L5J A;  5BNW A;  1HZ4 A;  3AS5 A;  4FA6 A;  3KS2 A;  1SZ9 A;  4ACK A;  4DI3 A;  4C0E A;  2F0Y A;  1TN7 A;  3UPV A;  3C3Q A;  4DX1 A;  3SBS A;  5KNG A;  1ELK A;  3TWV A;  3UT8 A;  1DCE A;  2GRR B;  3FTY A;  5HKP A;  2V5F A;  3O4Z A;  3FUE A;  1BD8 A;  2R05 A;  3T8K A;  4HI8 A;  3IHV A;  2I6H A;  4YDE A;  1X5B A;  3J5P A;  3SFZ A;  1JUQ A;  4GML A;  2A4Z A;  4I1A A;  2OEW A;  2WXJ A;  4YDO A;  4AIF A;  4M3O A;  2BKG A;  5CCM A;  1HXI A;  5LOZ A;  3T5X A;  3FUL A;  1K1A A;  1OCR E;  3D9H A;  4GCN A;  4UUC A;  1E8X A;  5JJ7 A;  3PS6 A;  3ZYM A;  3R7Q A;  4CRW A;  2X6H A;  5ENR D;  4GTR A;  3U3W A;  2BKK B;  4F1P A;  1IKN D;  3SFY A;  2GRQ B;  3J5Q B;  4XZ4 A;  3UM0 A;  2H6G A;  2X6K A;  2V8S E;  1HO8 A;  1DCQ A;  5FTP A;  3TG5 A;  2WMN A;  4OAU C;  2E2E A;  2PM7 A;  2EIM E;  1INZ A;  3L54 A;  4GA1 A;  3BEE A;  2UWJ G;  3CVU A;  3ZU7 B;  2DIW A;  4PDX A;  1OWL A;  1N0Q A;  4AJW A;  2E0I A;  3NOG D;  2ZU6 B;  4UWG A;  3S7D A;  3TWX A;  2IU1 A;  3BQO A;  3QWW A;  3ONK A;  3SHF A;  4OVV A;  1UW4 B;  4JD2 G;  3EHM A;  2Y69 E;  4G26 A;  1OWN A;  4HLE A;  1EYH A;  1B89 A;  3C5R A;  2Y0B G;  3L16 A;  2LXL A;  2XGM A;  4AEZ C;  4M7C A;  3DSS A;  2YHE A;  4AM9 A;  4WWP A;  2XHE A;  2P9N G;  4XEI G;  3EHN A;  3RO3 A;  3AG4 E;  2WXL A;  1TNY A;  3QOU A;  2B6C A;  3FHE A;  2I9C A;  3NZU A;  3UIN C;  2HM8 A;  5A7D B;  4CEM A;  4DX6 D;  1FT1 A;  2ETA A;  2LSU A;  4HXI A;  1H2U A;  4RVB A;  1KPS B;  4ANU A;  4GTT A;  2LSV A;  2DWZ A;  2Q7F A;  4O1P A;  5J90 A;  5KCM A;  1EF1 C;  4U63 A;  2X38 A;  4RG9 A;  3FUK A;  5DBK A;  2R02 A;  5AQ9 A;  2XGO A;  4O60 A;  4KVO A;  4XKB A;  3DEP A;  3DRA A;  2IFU A;  3Q47 B;  1HG2 A;  2KM4 A;  5FJY A;  3ISM C;  4HLL A;  4TXR A;  4G8L A;  1N9A A;  2WXM A;  4NAC A;  3PE4 A;  1A5E A;  2WQ6 A;  2X6F A;  4U04 A;  3N71 A;  4HOU A;  2OOE A;  1YMP A;  1BI7 B;  3ULE G;  1Y6I A;  3TL5 A;  1AWC B;  2NYJ A;  1JWG A;  1XGW A;  4J8D A;  3S7J A;  4LUN U; 
#chains in the Genus database with same CATH homology
 4Z68 A;  5BXO A;  1BU9 A;  3JXI A;  5EIL A;  2V5Q C;  3C5R A;  2Y0B G;  5HS0 A;  5AQA A;  5CER B;  3EHR A;  4GMR A;  1K3Z D;  4ZHB A;  3EU9 A;  2FO1 E;  3W9F A;  2BKG A;  4HQD A;  5BXU A;  4CZ2 D;  4K5C A;  3F6Q A;  4HNA D;  5JMN D;  5FIN A;  4LNU D;  4JB8 P;  4K5B A;  4U8Y D;  4YDY A;  4LSZ E;  5ENP D;  5CBN A;  3NBN B;  5AN8 A;  4DX5 D;  2XEE A;  2A5E A;  4QQI A;  3KEA A;  5AAO A;  5AAR A;  1K1A A;  3W9G A;  4ZFH A;  2L6B A;  4HRL A;  2XEN A;  3D9H A;  5CEA A;  4UUC A;  5HRY A;  4HB5 A;  2F37 A;  5ITZ F;  3B95 A;  4J8Y A;  2RFA A;  2ETC A;  2J8S D;  3V31 A;  1BLX B;  2ETB A;  3TWS A;  4B93 B;  4A63 B;  2ETA A;  4DX6 D;  5ENT D;  2ZGD A;  4BER A;  2VGE A;  5ENR D;  1YCS B;  1BI8 B;  5EN5 D;  3TWQ A;  2BKK B;  4BES A;  3EHQ A;  4F1P A;  4HBD A;  3LJN A;  3V30 A;  1IKN D;  2P2C P;  2V4H C;  2AJA A;  3AJI A;  4HRM B;  5EIB E;  3J5Q B;  1K1B A;  2DWZ A;  1OY3 D;  2HE0 A;  2MYO A;  1IHB A;  1S70 B;  1SVX A;  3ZUV B;  2RFM A;  3HG0 D;  4NIK A;  4BSZ B;  4C48 B;  4O1P A;  4G8K A;  2KXP C;  1G3N B;  3V79 K;  1MYO A;  5FIO A;  5KWD A;  4BEP A;  3SO8 A;  1WG0 A;  4DX7 D;  4U95 D;  1DC2 A;  4O1O A;  4LG6 A;  1QYM A;  4HI9 A;  4QFV A;  4YDW A;  4U96 D;  2F8X K;  4K5A B;  5AQ9 A;  1DCQ A;  3UTM A;  3T9K A;  3DEO A;  5EID A;  4O60 A;  3Q9N C;  4J7W A;  4OAU C;  3DEP A;  5CED B;  1UOH A;  3JXJ A;  5EYL A;  2F8Y A;  3NOC D;  4HLL A;  1D9S A;  4DUI A;  4F6R D;  4ATZ D;  1NFI E;  2XZT G;  1WDY A;  1N0R A;  4G8L A;  5KBA A;  1N11 A;  4TUM A;  3TWT A;  4DRX E;  3ZU7 B;  4BET A;  3TWW A;  3JUE A;  5AQ7 A;  1MX6 A;  1MX4 A;  1MX2 A;  1N0Q A;  4DX2 A;  1A5E A;  1SW6 A;  4DX1 A;  3TWV A;  2KBX A;  2DZN A;  2Y1L E;  1IXV A;  5ENS D;  5KNG A;  3TWR A;  3UXG A;  3NOG D;  3Q9U C;  5CBO A;  4RLY A;  3IXE A;  3ZNG A;  2XEH A;  2XZD G;  5D66 A;  3TWU A;  3V2O A;  3TWX A;  3V2X A;  1YYH A;  5ENO D;  2JAB A;  4OAV B;  5HKP A;  1MJ0 A;  1TR4 A;  3ZKJ A;  5CEC B;  5AQB A;  4GPM A;  4U8V D;  3HRA A;  2DVW A;  1YMP A;  1BI7 B;  5ENQ D;  2PNN A;  1BD8 A;  4N5Q A;  4CYM D;  1AWC B;  4HRN A;  3T8K A;  3UI2 A;  2NYJ A;  2QYJ A;  3AAA C;  4HI8 A;  5JA4 D;  1AP7 A;  2DZO A;  2B0O E;  3J5P A;  2ZGG A;  2QC9 A;  5KNH D;  1OT8 A;  3B7B A;  5EYP F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...