1SW6A

S. cerevisiae swi6 ankyrin-repeat fragment
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
301
structure length
254
Chain Sequence
GPIITFTHDLTSDFLSSPLKIMKALPSPVVNDNEQKMKLEAFLQRLLFSFDSLLQEVNDAFPNTQLNLNIPVDEHGNTPLHWLTSIANLELVKHLVKHGSNRLYGDNMGESCLVKAVKSVNNYDSGTFEALLDYLYPCLILEDSMNRTILHHIIITSGMTGCSAAAKYYLDILMGWIVKKQNRPIQSGDSILENLDLKWIIANMLNAQDSNGDTCLNIAARLGNISIVDALLDYGADPFIANKSGLRPVDFGAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REGULATORY PROTEIN SWI6
publication title X-ray structural analysis of the yeast cell cycle regulator Swi6 reveals variations of the ankyrin fold and has implications for Swi6 function.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription regulation
total genus 89
structure length 254
sequence length 301
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13606 Ank_3 Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1sw6A00
2Y1LE 4YDYA 1K3ZD 4J8YA 4NIKA 5JA4D 1BU9A 4U8YD 2QYJA 4JB8P 1BLXB 1AWCB 3EU9A 4DX1A 4HRNA 3TWQA 5CBNA 5EIDA 3JXIA 2A5EA 2F37A 3B95A 3TWUA 3HG0D 4GPMA 4O1OA 3UI2A 5KNGA 2RFMA 3LJNA 5D66A 2ETBA 5AQ7A 4A63B 5CEDB 5AARA 3NBNB 1MYOA 4O1PA 4BEPA 2AJAA 4K5CA 4DX2A 1NFIE 4DX7D 4LG6A 3V31A 2VGEA 4BSZB 5EILA 4HRLA 4QFVA 5EIBE 3D9HA 4N5QA 4Z68A 5AQAA 5BXOA 2FO1E 4U95D 1MX6A 1BI8B 4UUCA 1K1BA 4C48B 4G8KA 3NOCD 3HRAA 4G8LA 5ENQD 5AQ9A 3AJIA 1K1AA 2BKGA 3DEOA 4QQIA 4LNUD 3AAAC 1WG0A 3JUEA 3SO8A 3ZU7B 2DWZA 4O60A 4F1PA 4BESA 1OY3D 1N0RA 3W9FA 3TWVA 1TR4A 1YYHA 3T9KA 5ITZF 5AAOA 3C5RA 5JMND 4HRMB 3NOGD 1G3NB 4K5BA 3J5PA 2P2CP 4OAVB 3V79K 4ZFHA 3TWWA 3ZNGA 2XEHA 5KWDA 2BKKB 4HB5A 2V5QC 5FINA 3IXEA 5HKPA 3UXGA 2F8XK 1MJ0A 2F8YA 4BETA 2B0OE 3T8KA 4U8VD 4CZ2D 1DC2A 4HI8A 1IHBA 3KEAA 4B93B 4ATZD 5CECB 3DEPA 3Q9NC 1DCQA 3ZKJA 1UOHA 2NYJA 2DZOA 1OT8A 5CEAA 3J5QB 1SVXA 4TUMA 5EN5D 2J8SD 1S70B 2QC9A 5ENRD 3EHRA 3TWXA 4DX5D 5AN8A 3TWSA 1YCSB 1IXVA 5ENSD 1QYMA 1YMPA 5ENTD 3TWTA 2XENA 3W9GA 2ZGGA 2L6BA 1MX2A 4F6RD 2XZDG 2PNNA 1WDYA 3B7BA 4RLYA 2Y0BG 5CBOA 3F6QA 1D9SA 1MX4A 2XEEA 1AP7A 2ETCA 5KBAA 5EYLA 2KXPC 3EHQA 5FIOA 2JABA 5EYPF 5HS0A 4OAUC 2ETAA 1BD8A 4J7WA 5HRYA 5KNHD 4LSZE 5ENPD 2ZGDA 3UTMA 1A5EA 3Q9UC 5BXUA 2KBXA 3V2OA 2DZNA 3ZUVB 4HLLA 4YDWA 1SW6A 3JXJA 4K5AB 3V2XA 5AQBA 4DUIA 4HI9A 4BERA 2DVWA 1N0QA 4GMRA 2XZTG 4U96D 1N11A 4DX6D 2RFAA 4ZHBA 4CYMD 3V30A 5CERB 5ENOD 3TWRA 1BI7B 4HQDA 4HBDA 1IKND 4HNAD 2MYOA 4DRXE 2HE0A 2V4HC
chains in the Genus database with same CATH superfamily
2WB2A 3UM1A 1UN9A 4EZJA 4GYOA 3KEZA 4CRWA 5CEDB 1FCHA 2DBAA 4BSZB 2X3MA 3SFYA 3PDNA 3HXCA 1H6OA 3L6AA 4V3IA 5FQ7A 2WXRA 3LEWA 4AY6A 1BI8B 4JA7A 4FLHA 4IN3B 1E96B 4F1PA 3WXXA 2YQ8A 3UIOC 3PNTB 4HS2A 4WNDA 2X38A 3J5PA 3Q5MA 3QC1A 3FULA 1IHBA 1KPSB 3HXDA 3MKQB 3P1UA 1JPLA 4AV7A 4CGVA 2P9NG 2HYZA 3D9KA 3Q4AB 4GCOA 2J8SD 3ZHEB 3EHRA 2AWIA 4G1TA 2X6HA 2XENA 2L6BA 4N3CA 3MX3A 1MX4A 3NF1A 2FI7A 4KZ0A 5EYLA 3SY2A 4BT8A 1E8WA 2KBXA 4MBGA 4JEHA 3D9IA 4AOFA 1DVPA 4AM9A 4WWNA 3ASDA 2LXMA 1X5BA 4EECA 4C9BB 3L16A 4JZYA 4UI9K 2CHXA 4NACA 4WNGA 4U8YD 5BV0A 4GYWA 2P9LG 4ANVA 2CFZA 4N3AA 3HG0D 1E7VA 4CDMA 3I3NA 2ETBA 5G2NA 4WNEA 4XI9A 4HLEA 2PL2A 3QWPA 3HVEA 3FU5A 2IJGX 2GROB 4ILHB 5CCMA 1UJKA 5KJNA 5B1BE 4CDNA 4I17A 4ILGA 3JUIA 2I9CA 5FZQA 3CK7A 4X8QA 2V8SE 4BESA 5JHBA 1TN7A 2JLBA 5LOZA 2OEWA 1W3BA 2P2CP 3AU4A 3Q15A 4XX5A 2FULA 5BUZA 4AP2A 3CEQA 1H6KA 2WXPA 1WM5A 2X6FA 4AXHA 4BT9A 2PQRA 3ABME 3QWVA 4XKBA 2J09A 4O6FA 1QYMA 3PVLA 3CVXA 3B7BA 4RLYA 1AP7A 3EHQA 2JABA 5A23A 4U0SA 5HRYA 3U66A 3ZXPA 3R9AB 4DI4A 4BX8A 4I9EA 3E33A 3ZPJA 3FUKA 5G55A 1E8ZA 1SZAA 2J08A 3UT4A 4F7AA 3EHNA 4F1SA 1HH8A 4JVSA 2PM6A 2A4ZA 4PH4B 4DJAA 4DLOA 5EKQD 4GMLA 1KLXA 3C72A 1X81A 3JXIA 4I6GA 5LP0A 3UM3A 5HQ8A 4HOUA 2AJAA 4XI0A 3SI5A 1N94A 2PZIA 4WUYA 3VTXA 3AG3E 1A17A 2DIWA 4CDRA 2AVPA 2DCPA 3C3RA 3FTVA 4B8CB 4WNFA 2BKGA 3ZW3A 3R9MA 3PZ1A 4HFGA 3HHMA 5EX3A 5ITZF 2BEDA 3CHOA 1O1TA 3V79K 3C98A 3FUFA 5FINA 1ZBPA 3EIQC 4U8VD 3KEAA 3EDTB 1IQUA 3FH5A 4TUMA 2AXUA 3R7QA 4H7XA 3ASFA 5AN8A 5FQ4A 1TN6A 2BF0X 4YVOA 3FUIA 2WXJA 3LVRE 4G24A 4GZ3A 2PNNA 2KZTB 2L9BA 3FDHA 3S7DA 2OOEA 3EUVA 1A5EA 4ANUA 3S2AA 4GTOA 4BERA 4DX6D 2RFAA 4TXPA 5DIZA 3AG4E 2EIJE 4DRXE 2V4HC 3T5XA 2WQHA 1N4RA 2XPZA 4JEUA 3HXEA 3CR3A 2VTBB 1O1RA 5AARA 4B89A 2IONA 2RKKA 4DK5A 2R03A 3ZYQA 2V0PA 4Z68A 3CLJA 1LF8A 2XRYA 2MRIA 1NP7A 1E8XA 4FJYA 1TJCA 5ENQD 2WM9A 2I2OA 2RD0A 3IBEA 3DSWA 2XHEA 5CMYA 3UIPC 1QBQA 3T5VA 3C5RA 1ELKA 3SZ7A 1UW4B 2H6GA 4GZCA 3FH7A 4UWFA 3Q9NC 2DZOA 5CCLA 1SVXA 2VSOE 1N54A 1RW2A 3NB2A 2BTDA 4I1OB 4G2VA 3FTZA 5CBOA 2KXPC 4OAUC 4G11A 2ZIRA 3S7FA 2P58C 2XEVA 3L13A 4N5CA 1RZ4A 1Y6IA 4E85A 2WVIA 3UM2A 3CSTA 2R17C 5EX0A 3NQPA 1HZ4A 4Q96A 1FPPA 4ATGA 4ABNA 4HRNA 2XGOA 5ARGA 4PS8A 5CBNA 2CFUA 4MKTA 2IU1A 2KZTA 4DX2A 3Q79A 2J4BA 1K1BA 3VTYA 5ANLA 1QZ2A 1Z3YA 4TV3A 4J8FA 4RVBA 4U07A 2XQ0A 3ASNE 3PS6A 2AXZA 4GZDA 4M7CA 2XCBA 1TNBA 3JYSA 3O4ZA 4URKA 1SQMA 1MQSA 4J0UA 2LUHA 3AS5A 2FEZA 4L1BA 2E0IA 2WXQA 3EHMA 1HU3A 2VTBA 3E37A 1EPUA 1OCCE 2QZAA 3U3WA 3L9TA 3TXMA 2CHWA 3D9PA 3UKUG 3EJNA 3DSXA 4YDWA 4XKCA 1SW6A 3UX4A 4HI9A 1N11A 1TN8A 4GU5A 2A5UA 4GCNA 3TWRA 4ACLA 3UPVA 2EILE 2LSUA 4PS7A 4NQ0A 3O48A 5KCMA 2ZU6B 2WXGA 3FTSA 2NC9A 3PRZA 4DX1A 4F3VA 3HVEB 4A3TA 5KJKA 3QB2A 3N71A 4GPMA 3P2BA 5KNGA 4BY6A 3MV2B 3NBNB 3CV0A 3AS4A 2P9UG 3V31A 4Y6WA 4LCTA 2VJ8A 3DWLG 4JHJA 4TXRA 2VSNA 3D9OA 2QFCA 2X6KA 1H2TC 2WQ7A 3CVNA 1P5QA 3MEKA 4ILIA 5FJYA 2ZXWE 4Y6CA 3TJPA 4UWLA 3ZVVA 2X6JA 3ZEFA 4JXTA 1S63A 4OAVB 2F0YA 3IV0A 3QDNA 3OXLA 4GA0A 1SA5A 2H6IA 3DSVA 3PUJA 4BETA 3T8KA 4BFRA 4ATZD 1EYHA 3GZ1A 4APFA 1HXIA 1H2UA 2BUGA 1MHQA 2KC7A 1OWNA 1YMPA 3GW4A 4C0MA 2Y0BG 1E90A 1N4PA 4WWOA 4J7WA 2FBNA 5KNHD 1FVFA 4FC8A 3HDXA 3ZUVB 4EBAG 3URZA 3DXKG 4GTSA 4D10C 1N0QA 1OWOA 3RRNB 2LNIA 3V30A 3CK8A 4NRHB 1IKND 3UINC 4UI9C 4KXKB 3APCA 3FTWA 2GRRB 4HXIA 4L2LA 3RAUA 4U04A 5JA4D 3FEXA 3CGHA 3EU9A 4JD2G 4A3VA 3LY7A 2Y4UA 4O1PA 4K5CA 3RO3A 3LPZA 4RQIA 2VGEA 4UWHA 4N2QA 5G05C 4XEIG 3CHQA 1FT2A 3FP3A 2XCCA 3TAXA 5AQ9A 1HG2A 4GZ5A 1N0RA 4K0RA 5JHAA 2MOWA 1NA0A 3FU0A 4GAAA 1YYHA 5A7DB 5JMND 4YNDA 1G3NB 4GTPA 2HO1A 1L5JA 3Q7AA 3VLDA 4ZFHA 2XEHA 4DLQA 2BKKB 2WXHA 4BX9A 1NI1A 3RO2A 2XPYA 4UQZA 3G2VA 4U63A 3KS2A 5CEAA 2LAIA 1IYGA 4CEMA 2IO3C 1JCRA 2GRMA 2V5FA 1XNFA 5T3RA 3ABKE 1LTXA 3UTMA 1O5MA 2LSVA 4JHRA 3L08A 4APOA 3UUXA 4EPZA 3E30A 4J8EA 3CQCB 1JCQA 3OTNA 2QYJA 5AYWD 4I2WA 1N9AA 3I4GA 2NXPA 3QAQA 3ASOE 5FT9A 2WQ6A 1O1SA 4RG6A 3ULEG 2H6FA 4LG6A 2J49A 2C0MA 3MGBA 2ONDA 2P9KG 2XS8A 4HOTA 4G8KA 4DPRA 1H19A 3QNKA 4LUNU 3MKRA 4I1MA 3ZYMA 3CVYA 2C0LA 2J4DA 2VGYA 3CHPA 2JEKA 3ESLA 3HIZA 4HB5A 2L6JA 5AJLA 3JQ1A 4J8DA 1TYQG 3E32A 3OXGA 3ZKJA 4GMJA 2J9QA 5EDSA 2FF4A 1D8EA 1D9SA 3Q7FA 2IOSA 1TNYA 3QARA 2I1JA 5BXUA 5CHEE 2H6HA 2EIME 3LVQE 4HORA 4N39A 3FY4A 3DRAA 2OVBA 5E75A 3BU8A 3KSLA 4CT0A 2P9SG 4JC8A 1KZOA 5BNWA 2LXLA 3RRUA 3C3QA 2Y3AA 4MRUA 4EBAA 1BU9A 1FVHA 1HE8A 1AWCB 4OVUA 2CG3A 3PE3A 3BQOA 3TWUA 5J90A 4J8SA 5AQ7A 3LJNA 1KT1A 4B94A 4DX7D 4EQFA 5AQAA 3SGHA 1YA0A 3FHEA 2IO2C 3FUEA 4JA9A 4LNUD 1WG0A 4GTVA 3UT7A 1PAQA 4KBQA 4LNGA 2RG8A 4I9CA 3CHRA 5KWDA 4P29A 4YDOA 1MJ0A 1OCOE 1DC2A 3CKCA 1FT1A 3UQ3A 4JL0A 4JHKA 2I6HA 3MV3B 4FHJA 3FEYA 1YCSB 4XIFA 5ENTD 3LJ3A 3AG1E 4F6RD 3SFZA 3R7RA 3F6QA 3RK6A 1OWPA 3L82A 4LSZE 3ZFWA 4FA6A 3UT8A 1SZ9A 2NSZA 4TXQA 5AENA 5A6CA 5M72A 5BV1A 3CVWA 3TG4A 2AXVA 4TRQA 4IRUA 1OCZE 4LNBA 3L22A 4HBDA 3IEGA 3Q47B 2R5SA 2Y1LE 1U3CA 4EZLA 4GZ6A 3HXBA 5AIJA 2QY7A 5EIDA 3CVPA 4FULA 3B95A 4O1OA 3UI2A 3Q75A 5IY5E 1JUQA 1OWLA 3U9WA 1B89A 4HRLA 2PM7A 3D9LA 2FO1E 3GZSA 1MX6A 4Q69A 5CMWA 3NOCD 1N4SA 3HRAA 3AJIA 1K1AA 3ZRHA 3KAEA 3JUEA 4G26A 2R05A 3EIJA 1VDYA 3APDA 4JPSA 2Q7FA 4HRMB 4U0ZA 3ULQA 4IULA 5FQ6A 1K8KG 2V5QC 4EZKA 2ILRA 1TNUA 2F8YA 4CZ2D 2QYUA 2EQXA 4HI8A 4B93B 4I6EA 3TG5A 5JJTA 1TEZA 4FU3A 4WAFA 3TWSA 1HO8A 4LRZA 1NL4A 2GRNB 4UI9J 1H2VC 1WY6A 2ZGDA 4NURA 1Z3XA 4HLLA 3AS8A 2X6IA 2HR2A 1U3DA 1JWFA 4TUUA 4I1AA 5FZRA 2KCLA 1S0PA 5CERB 3GZ2A 1IHGA 1TNOA 3CK9A 1ELWA 5G05J 5AJDA 4J8YA 1WAO1 3PEVB 1N52A 4JW1A 2WMNA 4FHKA 3L17A 1QQEA 2Y69E 4N5QA 1XGWA 3CVLA 4L2YA 2WXNA 3PE4A 3Q49B 3G2SA 1U2VG 3VLEA 4WWPA 1HX8A 2IFUA 1HG5A 4I43A 4O60A 4HOSA 2KATA 4MS6A 2XGMA 4YDEA 2WXOA 4GA1A 4W9RA 3MYVA 2F8XK 3FU3A 1QNFA 3ML9A 3DEPA 5EN5D 2DYRE 1S70B 3CKBA 2IQCA 3W9GA 2MHKA 4C0EA 3D9NA 2ETCA 5FIOA 3CVQA 5HS0A 4HVBA 3OAWA 3CSFA 3ZIMA 5D0QD 4ANXA 2P9IG 2LO6A 3SBTB 3RU0A 1IQRA 3QKYA 1SA4A 4CT4A 3PUKA 3LY8A 2EIKE 3TXNA 2WXMA 3B7TA 3PZDA 4UWGA 3G2WA 1OUVA 2VQ2A 2A5EA 1LD7A 5D0OD 3HYMB 4KYOB 1MYOA 3SNXA 1NFIE 2UY1B 2P9PG 4K03A 3QK0A 2ZISA 3TGOA 5BXOA 5LFAA 4G8LA 3L54A 4HOQA 1OY3D 5CRUA 3W9FA 3ASHA 2YNQA 4GB9A 1ZU2A 4AEZC 4L7TA 1H0AA 1LD8A 3IXEA 3UM0A 4CCAA 2YINA 3IKOB 2NYJA 1HS6A 3KD7A 3ZN3A 3LS8A 3UKRG 3TWXA 2V4LA 3C3OA 2R02A 2M63A 1V55E 4OVVA 2VSYA 2VGXA 3DSTA 2WMOA 5H7PA 3FUNA 3Q9UC 4K5AB 3WG7E 4B0ZA 4BTAA 5G04C 3DSSA 5LCWC 1N4QA 3RSEG 1K3ZD 4NIKA 2WXKA 4KVOA 5DBKA 1ELRA 3LDZA 2KCKA 3DBSA 4OYSA 3FTUA 4KZCA 2VYIA 4A1SA 2XS1A 1BPOA 5ANRA 2B6CA 3CQGB 3Q73A 5EIBE 4H7YA 3SD5A 3RRMB 1EDUA 3B7RL 4C48B 5KJMA 1H6PA 3FU6A 2WXIA 4AJWA 4QQIA 3ML8A 1NZNA 5FTPA 2GRLA 2IOLA 5ARFA 4GA2A 5D2MC 3QWWA 1TR4A 3Q78A 3ENEA 5BPPA 2GW1A 1ZB1A 3UXGA 5HKPA 3SF4A 1Q2ZA 3ABLE 2B0OE 3ZYLA 4FP7A 1DCQA 3FTXA 3NZSA 3MCXA 4N3BA 2AW6A 2UY1A 2J07A 3TWTA 2ZGGA 1MX2A 3E34A 3IHYA 3MKQA 3OXFA 2GRPB 4I2ZA 5ENNA 2ETAA 3MA5A 1E8YA 4EHMA 5ENPD 4BWRA 3ZHEA 4PUCA 3JXJA 5FQ8A 3MZLB 4XE0A 5AQBA 3LCAA 3MJWA 3PZ3A 3PREA 1DCEA 3SHFA 3RKVA 3FUDA 3ASGA 4HQDA 4ME2A 5E76A 4HNAD 3SBSA 4AY5A 1BLXB 4UQYA 3B7SA 2XRZA 4UQXA 5BW8C 3S7BA 2HM8A 2KM4A 3HXFA 2YHEA 4A63B 4AIFA 1OXJA 4F53A 3BEEA 3T8MA 3D9HA 4PS3A 4FADA 3RIBA 1TJFA 3B7UX 1UJJA 3JQ0A 3RJVA 2R2LA 5AAOA 2I1KA 3FUJA 3LY9A 4DI3A 4N2SA 4ANWA 5LX8A 1UOHA 3X2QE 4KMOA 4G25A 3J5QB 3SQVA 2OVFA 2XGSA 5BT1A 3BG0B 3FH8A 3GYZA 5FZSA 4I6JA 1BD8A 4KVMA 3DXMG 3ONLA 4UWKA 2DZNA 3BG1B 4GPKA 5T4YA 3IHVA 2OEVA 3G2UA 4GMRA 4YVQC 4GYYA 3E4BA 4CYMD 1TNZA 3SFXA 2WXLA 1HF8A 2MYOA 4R7LA 5C2YA 1JWGA 1GW6A 4KT6B 3CVUA 3QJZA 3DPDA 2GGFA 4LERA 4FJZA 5B1AE 2CHZA 3LKUA 5JJ7A 1OWMA 2L0IA 3PEUB 2KCVA 2RFMA 2OV8A 5D66A 5C1DA 1S64A 4ACKA 2XPIA 4BEPA 4Q94A 3ZXSA 3AG2E 2R59A 4QFVA 4BSXA 1JCSA 1EF1C 5JJ6A 1INZA 4L9PA 3PNLB 3LYAA 3D3MA 3DEOA 1Z6TA 4MLPA 3SO8A 4U8HA 3FFLA 3PZ2A 5FWQA 2PQNA 1MZCA 3TWVA 1HFAA 3T9KA 2L0TB 5T8IA 2YHCA 4K5BA 1N95A 2E2EA 3ZNGA 3ONKA 1PC2A 3CIAA 3FWVA 3DPYA 2WXFA 4RSYA 3ULYA 3NAWA 3KSQA 1OT8A 2UWJG 3PZ4A 4U7EB 2QC9A 4L23A 1OCRE 1IXVA 4E6HA 1WDYA 4G23A 5J08A 1E7UA 3S7JA 3G2TA 3V2OA 3U4TA 3EU5A 4B8AA 4J6IA 3V2XA 4DUIA 2IY0C 3FUHA 4U96D 5B3SE 1KT0A 5KJLA 3I5PA 3D9JA 1BI7B 3DSUA 4YDYA 2EINE 4JB8P 3ESKA 3D9MA 2Y4TA 3TWQA 4A1GA 3I4RB 2F37A 1UN8A 3CHMA 3U64A 4GTTA 2VSXE 4BTBA 5EILA 3FUMA 4XZ4A 2FO7A 3JCKC 1D8DA 4U95D 4UUCA 3CVVA 4GTRA 4RG9A 3UMVA 3VLFA 3LXUX 4U0UA 3FTYA 2WPVA 3AAAC 3ZU7B 2DWZA 4IYPA 1V54E 1PY1A 2LAHA 2C2LA 3NOGD 3TWWA 3ZGQA 3B13A 4GTQA 5CECB 2VGXB 5CRVA 4AVXA 3BUAA 1KZPA 5ENRD 4DX5D 2DYSE 5ENSD 5HI7A 1DNPA 1Z5SC 5G04J 4CGWA 2XZDG 2XEEA 3NZUA 5LCWJ 3CHSA 5KBAA 5EYPF 2CG2A 4GTMA 3K9IA 2IEJA 1NA3A 3PH0C 2GRQB 3ISMC 3QOUA 3TL5A 4A55A 2DVWA 1UG3A 4LEUA 2XZTG 4ZHBA 3AU5A 3ZYKA 4PDXA 5ENOD 2OCCE 4M3OA 4FLBA 2HE0A 1Y8MA 2IF4A 3APFA
chains in the Genus database with same CATH topology
2Y1LE 4YDYA 1K3ZD 4J8YA 4NIKA 5JA4D 1BU9A 4U8YD 2QYJA 4JB8P 1BLXB 1AWCB 3EU9A 4DX1A 4HRNA 3TWQA 5CBNA 5EIDA 3JXIA 2A5EA 2F37A 3B95A 3TWUA 3HG0D 4GPMA 4O1OA 3UI2A 5KNGA 2RFMA 3LJNA 5D66A 2ETBA 5AQ7A 4A63B 5CEDB 5AARA 3NBNB 1MYOA 4O1PA 4BEPA 2AJAA 4K5CA 4DX2A 1NFIE 4DX7D 4LG6A 3V31A 2VGEA 4BSZB 5EILA 4HRLA 4QFVA 5EIBE 3D9HA 4N5QA 4Z68A 5AQAA 5BXOA 2FO1E 4U95D 1MX6A 1BI8B 4UUCA 1K1BA 4C48B 4G8KA 3NOCD 3HRAA 4G8LA 5ENQD 5AQ9A 3AJIA 1K1AA 2BKGA 3DEOA 4QQIA 4LNUD 3AAAC 1WG0A 3JUEA 3SO8A 3ZU7B 2DWZA 4O60A 4F1PA 4BESA 1OY3D 1N0RA 3W9FA 3TWVA 1TR4A 1YYHA 3T9KA 5ITZF 5AAOA 3C5RA 5JMND 4HRMB 3NOGD 1G3NB 4K5BA 3J5PA 2P2CP 4OAVB 3V79K 4ZFHA 3TWWA 3ZNGA 2XEHA 5KWDA 2BKKB 4HB5A 2V5QC 5FINA 3IXEA 5HKPA 3UXGA 2F8XK 1MJ0A 2F8YA 4BETA 2B0OE 3T8KA 4U8VD 4CZ2D 1DC2A 4HI8A 1IHBA 3KEAA 4B93B 4ATZD 5CECB 3DEPA 3Q9NC 1DCQA 3ZKJA 1UOHA 2NYJA 2DZOA 1OT8A 5CEAA 3J5QB 1SVXA 4TUMA 5EN5D 2J8SD 1S70B 2QC9A 5ENRD 3EHRA 3TWXA 4DX5D 5AN8A 3TWSA 1YCSB 1IXVA 5ENSD 1QYMA 1YMPA 5ENTD 3TWTA 2XENA 3W9GA 2ZGGA 2L6BA 1MX2A 4F6RD 2XZDG 2PNNA 1WDYA 3B7BA 4RLYA 2Y0BG 5CBOA 3F6QA 1D9SA 1MX4A 2XEEA 1AP7A 2ETCA 5KBAA 5EYLA 2KXPC 3EHQA 5FIOA 2JABA 5EYPF 5HS0A 4OAUC 2ETAA 1BD8A 4J7WA 5HRYA 5KNHD 4LSZE 5ENPD 2ZGDA 3UTMA 1A5EA 3Q9UC 5BXUA 2KBXA 3V2OA 2DZNA 3ZUVB 4HLLA 4YDWA 1SW6A 3JXJA 4K5AB 3V2XA 5AQBA 4DUIA 4HI9A 4BERA 2DVWA 1N0QA 4GMRA 2XZTG 4U96D 1N11A 4DX6D 2RFAA 4ZHBA 4CYMD 3V30A 5CERB 5ENOD 3TWRA 1BI7B 4HQDA 4HBDA 1IKND 4HNAD 2MYOA 4DRXE 2HE0A 2V4HC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y1L E;  4YDY A;  1K3Z D;  4J8Y A;  4NIK A;  5JA4 D;  1BU9 A;  4U8Y D;  2QYJ A;  4JB8 P;  1BLX B;  1AWC B;  3EU9 A;  4DX1 A;  4HRN A;  3TWQ A;  5CBN A;  5EID A;  3JXI A;  2A5E A;  2F37 A;  3B95 A;  3TWU A;  3HG0 D;  4GPM A;  4O1O A;  3UI2 A;  5KNG A;  2RFM A;  3LJN A;  5D66 A;  2ETB A;  5AQ7 A;  4A63 B;  5CED B;  5AAR A;  3NBN B;  1MYO A;  4O1P A;  4BEP A;  2AJA A;  4K5C A;  4DX2 A;  1NFI E;  4DX7 D;  4LG6 A;  3V31 A;  2VGE A;  4BSZ B;  5EIL A;  4HRL A;  4QFV A;  5EIB E;  3D9H A;  4N5Q A;  4Z68 A;  5AQA A;  5BXO A;  2FO1 E;  4U95 D;  1MX6 A;  1BI8 B;  4UUC A;  1K1B A;  4C48 B;  4G8K A;  3NOC D;  3HRA A;  4G8L A;  5ENQ D;  5AQ9 A;  3AJI A;  1K1A A;  2BKG A;  3DEO A;  4QQI A;  4LNU D;  3AAA C;  1WG0 A;  3JUE A;  3SO8 A;  3ZU7 B;  2DWZ A;  4O60 A;  4F1P A;  4BES A;  1OY3 D;  1N0R A;  3W9F A;  3TWV A;  1TR4 A;  1YYH A;  3T9K A;  5ITZ F;  5AAO A;  3C5R A;  5JMN D;  4HRM B;  3NOG D;  1G3N B;  4K5B A;  3J5P A;  2P2C P;  4OAV B;  3V79 K;  4ZFH A;  3TWW A;  3ZNG A;  2XEH A;  5KWD A;  2BKK B;  4HB5 A;  2V5Q C;  5FIN A;  3IXE A;  5HKP A;  3UXG A;  2F8X K;  1MJ0 A;  2F8Y A;  4BET A;  2B0O E;  3T8K A;  4U8V D;  4CZ2 D;  1DC2 A;  4HI8 A;  1IHB A;  3KEA A;  4B93 B;  4ATZ D;  5CEC B;  3DEP A;  3Q9N C;  1DCQ A;  3ZKJ A;  1UOH A;  2NYJ A;  2DZO A;  1OT8 A;  5CEA A;  3J5Q B;  1SVX A;  4TUM A;  5EN5 D;  2J8S D;  1S70 B;  2QC9 A;  5ENR D;  3EHR A;  3TWX A;  4DX5 D;  5AN8 A;  3TWS A;  1YCS B;  1IXV A;  5ENS D;  1QYM A;  1YMP A;  5ENT D;  3TWT A;  2XEN A;  3W9G A;  2ZGG A;  2L6B A;  1MX2 A;  4F6R D;  2XZD G;  2PNN A;  1WDY A;  3B7B A;  4RLY A;  2Y0B G;  5CBO A;  3F6Q A;  1D9S A;  1MX4 A;  2XEE A;  1AP7 A;  2ETC A;  5KBA A;  5EYL A;  2KXP C;  3EHQ A;  5FIO A;  2JAB A;  5EYP F;  5HS0 A;  4OAU C;  2ETA A;  1BD8 A;  4J7W A;  5HRY A;  5KNH D;  4LSZ E;  5ENP D;  2ZGD A;  3UTM A;  1A5E A;  3Q9U C;  5BXU A;  2KBX A;  3V2O A;  2DZN A;  3ZUV B;  4HLL A;  4YDW A;  1SW6 A;  3JXJ A;  4K5A B;  3V2X A;  5AQB A;  4DUI A;  4HI9 A;  4BER A;  2DVW A;  1N0Q A;  4GMR A;  2XZT G;  4U96 D;  1N11 A;  4DX6 D;  2RFA A;  4ZHB A;  4CYM D;  3V30 A;  5CER B;  5ENO D;  3TWR A;  1BI7 B;  4HQD A;  4HBD A;  1IKN D;  4HNA D;  2MYO A;  4DRX E;  2HE0 A;  2V4H C; 
#chains in the Genus database with same CATH topology
 2WB2 A;  3UM1 A;  1UN9 A;  4EZJ A;  4GYO A;  3KEZ A;  4CRW A;  5CED B;  1FCH A;  2DBA A;  4BSZ B;  2X3M A;  3SFY A;  3PDN A;  3HXC A;  1H6O A;  3L6A A;  4V3I A;  5FQ7 A;  2WXR A;  3LEW A;  4AY6 A;  1BI8 B;  4JA7 A;  4FLH A;  4IN3 B;  1E96 B;  4F1P A;  3WXX A;  2YQ8 A;  3UIO C;  3PNT B;  4HS2 A;  4WND A;  2X38 A;  3J5P A;  3Q5M A;  3QC1 A;  3FUL A;  1IHB A;  1KPS B;  3HXD A;  3MKQ B;  3P1U A;  1JPL A;  4AV7 A;  4CGV A;  2P9N G;  2HYZ A;  3D9K A;  3Q4A B;  4GCO A;  2J8S D;  3ZHE B;  3EHR A;  2AWI A;  4G1T A;  2X6H A;  2XEN A;  2L6B A;  4N3C A;  3MX3 A;  1MX4 A;  3NF1 A;  2FI7 A;  4KZ0 A;  5EYL A;  3SY2 A;  4BT8 A;  1E8W A;  2KBX A;  4MBG A;  4JEH A;  3D9I A;  4AOF A;  1DVP A;  4AM9 A;  4WWN A;  3ASD A;  2LXM A;  1X5B A;  4EEC A;  4C9B B;  3L16 A;  4JZY A;  4UI9 K;  2CHX A;  4NAC A;  4WNG A;  4U8Y D;  5BV0 A;  4GYW A;  2P9L G;  4ANV A;  2CFZ A;  4N3A A;  3HG0 D;  1E7V A;  4CDM A;  3I3N A;  2ETB A;  5G2N A;  4WNE A;  4XI9 A;  4HLE A;  2PL2 A;  3QWP A;  3HVE A;  3FU5 A;  2IJG X;  2GRO B;  4ILH B;  5CCM A;  1UJK A;  5KJN A;  5B1B E;  4CDN A;  4I17 A;  4ILG A;  3JUI A;  2I9C A;  5FZQ A;  3CK7 A;  4X8Q A;  2V8S E;  4BES A;  5JHB A;  1TN7 A;  2JLB A;  5LOZ A;  2OEW A;  1W3B A;  2P2C P;  3AU4 A;  3Q15 A;  4XX5 A;  2FUL A;  5BUZ A;  4AP2 A;  3CEQ A;  1H6K A;  2WXP A;  1WM5 A;  2X6F A;  4AXH A;  4BT9 A;  2PQR A;  3ABM E;  3QWV A;  4XKB A;  2J09 A;  4O6F A;  1QYM A;  3PVL A;  3CVX A;  3B7B A;  4RLY A;  1AP7 A;  3EHQ A;  2JAB A;  5A23 A;  4U0S A;  5HRY A;  3U66 A;  3ZXP A;  3R9A B;  4DI4 A;  4BX8 A;  4I9E A;  3E33 A;  3ZPJ A;  3FUK A;  5G55 A;  1E8Z A;  1SZA A;  2J08 A;  3UT4 A;  4F7A A;  3EHN A;  4F1S A;  1HH8 A;  4JVS A;  2PM6 A;  2A4Z A;  4PH4 B;  4DJA A;  4DLO A;  5EKQ D;  4GML A;  1KLX A;  3C72 A;  1X81 A;  3JXI A;  4I6G A;  5LP0 A;  3UM3 A;  5HQ8 A;  4HOU A;  2AJA A;  4XI0 A;  3SI5 A;  1N94 A;  2PZI A;  4WUY A;  3VTX A;  3AG3 E;  1A17 A;  2DIW A;  4CDR A;  2AVP A;  2DCP A;  3C3R A;  3FTV A;  4B8C B;  4WNF A;  2BKG A;  3ZW3 A;  3R9M A;  3PZ1 A;  4HFG A;  3HHM A;  5EX3 A;  5ITZ F;  2BED A;  3CHO A;  1O1T A;  3V79 K;  3C98 A;  3FUF A;  5FIN A;  1ZBP A;  3EIQ C;  4U8V D;  3KEA A;  3EDT B;  1IQU A;  3FH5 A;  4TUM A;  2AXU A;  3R7Q A;  4H7X A;  3ASF A;  5AN8 A;  5FQ4 A;  1TN6 A;  2BF0 X;  4YVO A;  3FUI A;  2WXJ A;  3LVR E;  4G24 A;  4GZ3 A;  2PNN A;  2KZT B;  2L9B A;  3FDH A;  3S7D A;  2OOE A;  3EUV A;  1A5E A;  4ANU A;  3S2A A;  4GTO A;  4BER A;  4DX6 D;  2RFA A;  4TXP A;  5DIZ A;  3AG4 E;  2EIJ E;  4DRX E;  2V4H C;  3T5X A;  2WQH A;  1N4R A;  2XPZ A;  4JEU A;  3HXE A;  3CR3 A;  2VTB B;  1O1R A;  5AAR A;  4B89 A;  2ION A;  2RKK A;  4DK5 A;  2R03 A;  3ZYQ A;  2V0P A;  4Z68 A;  3CLJ A;  1LF8 A;  2XRY A;  2MRI A;  1NP7 A;  1E8X A;  4FJY A;  1TJC A;  5ENQ D;  2WM9 A;  2I2O A;  2RD0 A;  3IBE A;  3DSW A;  2XHE A;  5CMY A;  3UIP C;  1QBQ A;  3T5V A;  3C5R A;  1ELK A;  3SZ7 A;  1UW4 B;  2H6G A;  4GZC A;  3FH7 A;  4UWF A;  3Q9N C;  2DZO A;  5CCL A;  1SVX A;  2VSO E;  1N54 A;  1RW2 A;  3NB2 A;  2BTD A;  4I1O B;  4G2V A;  3FTZ A;  5CBO A;  2KXP C;  4OAU C;  4G11 A;  2ZIR A;  3S7F A;  2P58 C;  2XEV A;  3L13 A;  4N5C A;  1RZ4 A;  1Y6I A;  4E85 A;  2WVI A;  3UM2 A;  3CST A;  2R17 C;  5EX0 A;  3NQP A;  1HZ4 A;  4Q96 A;  1FPP A;  4ATG A;  4ABN A;  4HRN A;  2XGO A;  5ARG A;  4PS8 A;  5CBN A;  2CFU A;  4MKT A;  2IU1 A;  2KZT A;  4DX2 A;  3Q79 A;  2J4B A;  1K1B A;  3VTY A;  5ANL A;  1QZ2 A;  1Z3Y A;  4TV3 A;  4J8F A;  4RVB A;  4U07 A;  2XQ0 A;  3ASN E;  3PS6 A;  2AXZ A;  4GZD A;  4M7C A;  2XCB A;  1TNB A;  3JYS A;  3O4Z A;  4URK A;  1SQM A;  1MQS A;  4J0U A;  2LUH A;  3AS5 A;  2FEZ A;  4L1B A;  2E0I A;  2WXQ A;  3EHM A;  1HU3 A;  2VTB A;  3E37 A;  1EPU A;  1OCC E;  2QZA A;  3U3W A;  3L9T A;  3TXM A;  2CHW A;  3D9P A;  3UKU G;  3EJN A;  3DSX A;  4YDW A;  4XKC A;  1SW6 A;  3UX4 A;  4HI9 A;  1N11 A;  1TN8 A;  4GU5 A;  2A5U A;  4GCN A;  3TWR A;  4ACL A;  3UPV A;  2EIL E;  2LSU A;  4PS7 A;  4NQ0 A;  3O48 A;  5KCM A;  2ZU6 B;  2WXG A;  3FTS A;  2NC9 A;  3PRZ A;  4DX1 A;  4F3V A;  3HVE B;  4A3T A;  5KJK A;  3QB2 A;  3N71 A;  4GPM A;  3P2B A;  5KNG A;  4BY6 A;  3MV2 B;  3NBN B;  3CV0 A;  3AS4 A;  2P9U G;  3V31 A;  4Y6W A;  4LCT A;  2VJ8 A;  3DWL G;  4JHJ A;  4TXR A;  2VSN A;  3D9O A;  2QFC A;  2X6K A;  1H2T C;  2WQ7 A;  3CVN A;  1P5Q A;  3MEK A;  4ILI A;  5FJY A;  2ZXW E;  4Y6C A;  3TJP A;  4UWL A;  3ZVV A;  2X6J A;  3ZEF A;  4JXT A;  1S63 A;  4OAV B;  2F0Y A;  3IV0 A;  3QDN A;  3OXL A;  4GA0 A;  1SA5 A;  2H6I A;  3DSV A;  3PUJ A;  4BET A;  3T8K A;  4BFR A;  4ATZ D;  1EYH A;  3GZ1 A;  4APF A;  1HXI A;  1H2U A;  2BUG A;  1MHQ A;  2KC7 A;  1OWN A;  1YMP A;  3GW4 A;  4C0M A;  2Y0B G;  1E90 A;  1N4P A;  4WWO A;  4J7W A;  2FBN A;  5KNH D;  1FVF A;  4FC8 A;  3HDX A;  3ZUV B;  4EBA G;  3URZ A;  3DXK G;  4GTS A;  4D10 C;  1N0Q A;  1OWO A;  3RRN B;  2LNI A;  3V30 A;  3CK8 A;  4NRH B;  1IKN D;  3UIN C;  4UI9 C;  4KXK B;  3APC A;  3FTW A;  2GRR B;  4HXI A;  4L2L A;  3RAU A;  4U04 A;  5JA4 D;  3FEX A;  3CGH A;  3EU9 A;  4JD2 G;  4A3V A;  3LY7 A;  2Y4U A;  4O1P A;  4K5C A;  3RO3 A;  3LPZ A;  4RQI A;  2VGE A;  4UWH A;  4N2Q A;  5G05 C;  4XEI G;  3CHQ A;  1FT2 A;  3FP3 A;  2XCC A;  3TAX A;  5AQ9 A;  1HG2 A;  4GZ5 A;  1N0R A;  4K0R A;  5JHA A;  2MOW A;  1NA0 A;  3FU0 A;  4GAA A;  1YYH A;  5A7D B;  5JMN D;  4YND A;  1G3N B;  4GTP A;  2HO1 A;  1L5J A;  3Q7A A;  3VLD A;  4ZFH A;  2XEH A;  4DLQ A;  2BKK B;  2WXH A;  4BX9 A;  1NI1 A;  3RO2 A;  2XPY A;  4UQZ A;  3G2V A;  4U63 A;  3KS2 A;  5CEA A;  2LAI A;  1IYG A;  4CEM A;  2IO3 C;  1JCR A;  2GRM A;  2V5F A;  1XNF A;  5T3R A;  3ABK E;  1LTX A;  3UTM A;  1O5M A;  2LSV A;  4JHR A;  3L08 A;  4APO A;  3UUX A;  4EPZ A;  3E30 A;  4J8E A;  3CQC B;  1JCQ A;  3OTN A;  2QYJ A;  5AYW D;  4I2W A;  1N9A A;  3I4G A;  2NXP A;  3QAQ A;  3ASO E;  5FT9 A;  2WQ6 A;  1O1S A;  4RG6 A;  3ULE G;  2H6F A;  4LG6 A;  2J49 A;  2C0M A;  3MGB A;  2OND A;  2P9K G;  2XS8 A;  4HOT A;  4G8K A;  4DPR A;  1H19 A;  3QNK A;  4LUN U;  3MKR A;  4I1M A;  3ZYM A;  3CVY A;  2C0L A;  2J4D A;  2VGY A;  3CHP A;  2JEK A;  3ESL A;  3HIZ A;  4HB5 A;  2L6J A;  5AJL A;  3JQ1 A;  4J8D A;  1TYQ G;  3E32 A;  3OXG A;  3ZKJ A;  4GMJ A;  2J9Q A;  5EDS A;  2FF4 A;  1D8E A;  1D9S A;  3Q7F A;  2IOS A;  1TNY A;  3QAR A;  2I1J A;  5BXU A;  5CHE E;  2H6H A;  2EIM E;  3LVQ E;  4HOR A;  4N39 A;  3FY4 A;  3DRA A;  2OVB A;  5E75 A;  3BU8 A;  3KSL A;  4CT0 A;  2P9S G;  4JC8 A;  1KZO A;  5BNW A;  2LXL A;  3RRU A;  3C3Q A;  2Y3A A;  4MRU A;  4EBA A;  1BU9 A;  1FVH A;  1HE8 A;  1AWC B;  4OVU A;  2CG3 A;  3PE3 A;  3BQO A;  3TWU A;  5J90 A;  4J8S A;  5AQ7 A;  3LJN A;  1KT1 A;  4B94 A;  4DX7 D;  4EQF A;  5AQA A;  3SGH A;  1YA0 A;  3FHE A;  2IO2 C;  3FUE A;  4JA9 A;  4LNU D;  1WG0 A;  4GTV A;  3UT7 A;  1PAQ A;  4KBQ A;  4LNG A;  2RG8 A;  4I9C A;  3CHR A;  5KWD A;  4P29 A;  4YDO A;  1MJ0 A;  1OCO E;  1DC2 A;  3CKC A;  1FT1 A;  3UQ3 A;  4JL0 A;  4JHK A;  2I6H A;  3MV3 B;  4FHJ A;  3FEY A;  1YCS B;  4XIF A;  5ENT D;  3LJ3 A;  3AG1 E;  4F6R D;  3SFZ A;  3R7R A;  3F6Q A;  3RK6 A;  1OWP A;  3L82 A;  4LSZ E;  3ZFW A;  4FA6 A;  3UT8 A;  1SZ9 A;  2NSZ A;  4TXQ A;  5AEN A;  5A6C A;  5M72 A;  5BV1 A;  3CVW A;  3TG4 A;  2AXV A;  4TRQ A;  4IRU A;  1OCZ E;  4LNB A;  3L22 A;  4HBD A;  3IEG A;  3Q47 B;  2R5S A;  2Y1L E;  1U3C A;  4EZL A;  4GZ6 A;  3HXB A;  5AIJ A;  2QY7 A;  5EID A;  3CVP A;  4FUL A;  3B95 A;  4O1O A;  3UI2 A;  3Q75 A;  5IY5 E;  1JUQ A;  1OWL A;  3U9W A;  1B89 A;  4HRL A;  2PM7 A;  3D9L A;  2FO1 E;  3GZS A;  1MX6 A;  4Q69 A;  5CMW A;  3NOC D;  1N4S A;  3HRA A;  3AJI A;  1K1A A;  3ZRH A;  3KAE A;  3JUE A;  4G26 A;  2R05 A;  3EIJ A;  1VDY A;  3APD A;  4JPS A;  2Q7F A;  4HRM B;  4U0Z A;  3ULQ A;  4IUL A;  5FQ6 A;  1K8K G;  2V5Q C;  4EZK A;  2ILR A;  1TNU A;  2F8Y A;  4CZ2 D;  2QYU A;  2EQX A;  4HI8 A;  4B93 B;  4I6E A;  3TG5 A;  5JJT A;  1TEZ A;  4FU3 A;  4WAF A;  3TWS A;  1HO8 A;  4LRZ A;  1NL4 A;  2GRN B;  4UI9 J;  1H2V C;  1WY6 A;  2ZGD A;  4NUR A;  1Z3X A;  4HLL A;  3AS8 A;  2X6I A;  2HR2 A;  1U3D A;  1JWF A;  4TUU A;  4I1A A;  5FZR A;  2KCL A;  1S0P A;  5CER B;  3GZ2 A;  1IHG A;  1TNO A;  3CK9 A;  1ELW A;  5G05 J;  5AJD A;  4J8Y A;  1WAO 1;  3PEV B;  1N52 A;  4JW1 A;  2WMN A;  4FHK A;  3L17 A;  1QQE A;  2Y69 E;  4N5Q A;  1XGW A;  3CVL A;  4L2Y A;  2WXN A;  3PE4 A;  3Q49 B;  3G2S A;  1U2V G;  3VLE A;  4WWP A;  1HX8 A;  2IFU A;  1HG5 A;  4I43 A;  4O60 A;  4HOS A;  2KAT A;  4MS6 A;  2XGM A;  4YDE A;  2WXO A;  4GA1 A;  4W9R A;  3MYV A;  2F8X K;  3FU3 A;  1QNF A;  3ML9 A;  3DEP A;  5EN5 D;  2DYR E;  1S70 B;  3CKB A;  2IQC A;  3W9G A;  2MHK A;  4C0E A;  3D9N A;  2ETC A;  5FIO A;  3CVQ A;  5HS0 A;  4HVB A;  3OAW A;  3CSF A;  3ZIM A;  5D0Q D;  4ANX A;  2P9I G;  2LO6 A;  3SBT B;  3RU0 A;  1IQR A;  3QKY A;  1SA4 A;  4CT4 A;  3PUK A;  3LY8 A;  2EIK E;  3TXN A;  2WXM A;  3B7T A;  3PZD A;  4UWG A;  3G2W A;  1OUV A;  2VQ2 A;  2A5E A;  1LD7 A;  5D0O D;  3HYM B;  4KYO B;  1MYO A;  3SNX A;  1NFI E;  2UY1 B;  2P9P G;  4K03 A;  3QK0 A;  2ZIS A;  3TGO A;  5BXO A;  5LFA A;  4G8L A;  3L54 A;  4HOQ A;  1OY3 D;  5CRU A;  3W9F A;  3ASH A;  2YNQ A;  4GB9 A;  1ZU2 A;  4AEZ C;  4L7T A;  1H0A A;  1LD8 A;  3IXE A;  3UM0 A;  4CCA A;  2YIN A;  3IKO B;  2NYJ A;  1HS6 A;  3KD7 A;  3ZN3 A;  3LS8 A;  3UKR G;  3TWX A;  2V4L A;  3C3O A;  2R02 A;  2M63 A;  1V55 E;  4OVV A;  2VSY A;  2VGX A;  3DST A;  2WMO A;  5H7P A;  3FUN A;  3Q9U C;  4K5A B;  3WG7 E;  4B0Z A;  4BTA A;  5G04 C;  3DSS A;  5LCW C;  1N4Q A;  3RSE G;  1K3Z D;  4NIK A;  2WXK A;  4KVO A;  5DBK A;  1ELR A;  3LDZ A;  2KCK A;  3DBS A;  4OYS A;  3FTU A;  4KZC A;  2VYI A;  4A1S A;  2XS1 A;  1BPO A;  5ANR A;  2B6C A;  3CQG B;  3Q73 A;  5EIB E;  4H7Y A;  3SD5 A;  3RRM B;  1EDU A;  3B7R L;  4C48 B;  5KJM A;  1H6P A;  3FU6 A;  2WXI A;  4AJW A;  4QQI A;  3ML8 A;  1NZN A;  5FTP A;  2GRL A;  2IOL A;  5ARF A;  4GA2 A;  5D2M C;  3QWW A;  1TR4 A;  3Q78 A;  3ENE A;  5BPP A;  2GW1 A;  1ZB1 A;  3UXG A;  5HKP A;  3SF4 A;  1Q2Z A;  3ABL E;  2B0O E;  3ZYL A;  4FP7 A;  1DCQ A;  3FTX A;  3NZS A;  3MCX A;  4N3B A;  2AW6 A;  2UY1 A;  2J07 A;  3TWT A;  2ZGG A;  1MX2 A;  3E34 A;  3IHY A;  3MKQ A;  3OXF A;  2GRP B;  4I2Z A;  5ENN A;  2ETA A;  3MA5 A;  1E8Y A;  4EHM A;  5ENP D;  4BWR A;  3ZHE A;  4PUC A;  3JXJ A;  5FQ8 A;  3MZL B;  4XE0 A;  5AQB A;  3LCA A;  3MJW A;  3PZ3 A;  3PRE A;  1DCE A;  3SHF A;  3RKV A;  3FUD A;  3ASG A;  4HQD A;  4ME2 A;  5E76 A;  4HNA D;  3SBS A;  4AY5 A;  1BLX B;  4UQY A;  3B7S A;  2XRZ A;  4UQX A;  5BW8 C;  3S7B A;  2HM8 A;  2KM4 A;  3HXF A;  2YHE A;  4A63 B;  4AIF A;  1OXJ A;  4F53 A;  3BEE A;  3T8M A;  3D9H A;  4PS3 A;  4FAD A;  3RIB A;  1TJF A;  3B7U X;  1UJJ A;  3JQ0 A;  3RJV A;  2R2L A;  5AAO A;  2I1K A;  3FUJ A;  3LY9 A;  4DI3 A;  4N2S A;  4ANW A;  5LX8 A;  1UOH A;  3X2Q E;  4KMO A;  4G25 A;  3J5Q B;  3SQV A;  2OVF A;  2XGS A;  5BT1 A;  3BG0 B;  3FH8 A;  3GYZ A;  5FZS A;  4I6J A;  1BD8 A;  4KVM A;  3DXM G;  3ONL A;  4UWK A;  2DZN A;  3BG1 B;  4GPK A;  5T4Y A;  3IHV A;  2OEV A;  3G2U A;  4GMR A;  4YVQ C;  4GYY A;  3E4B A;  4CYM D;  1TNZ A;  3SFX A;  2WXL A;  1HF8 A;  2MYO A;  4R7L A;  5C2Y A;  1JWG A;  1GW6 A;  4KT6 B;  3CVU A;  3QJZ A;  3DPD A;  2GGF A;  4LER A;  4FJZ A;  5B1A E;  2CHZ A;  3LKU A;  5JJ7 A;  1OWM A;  2L0I A;  3PEU B;  2KCV A;  2RFM A;  2OV8 A;  5D66 A;  5C1D A;  1S64 A;  4ACK A;  2XPI A;  4BEP A;  4Q94 A;  3ZXS A;  3AG2 E;  2R59 A;  4QFV A;  4BSX A;  1JCS A;  1EF1 C;  5JJ6 A;  1INZ A;  4L9P A;  3PNL B;  3LYA A;  3D3M A;  3DEO A;  1Z6T A;  4MLP A;  3SO8 A;  4U8H A;  3FFL A;  3PZ2 A;  5FWQ A;  2PQN A;  1MZC A;  3TWV A;  1HFA A;  3T9K A;  2L0T B;  5T8I A;  2YHC A;  4K5B A;  1N95 A;  2E2E A;  3ZNG A;  3ONK A;  1PC2 A;  3CIA A;  3FWV A;  3DPY A;  2WXF A;  4RSY A;  3ULY A;  3NAW A;  3KSQ A;  1OT8 A;  2UWJ G;  3PZ4 A;  4U7E B;  2QC9 A;  4L23 A;  1OCR E;  1IXV A;  4E6H A;  1WDY A;  4G23 A;  5J08 A;  1E7U A;  3S7J A;  3G2T A;  3V2O A;  3U4T A;  3EU5 A;  4B8A A;  4J6I A;  3V2X A;  4DUI A;  2IY0 C;  3FUH A;  4U96 D;  5B3S E;  1KT0 A;  5KJL A;  3I5P A;  3D9J A;  1BI7 B;  3DSU A;  4YDY A;  2EIN E;  4JB8 P;  3ESK A;  3D9M A;  2Y4T A;  3TWQ A;  4A1G A;  3I4R B;  2F37 A;  1UN8 A;  3CHM A;  3U64 A;  4GTT A;  2VSX E;  4BTB A;  5EIL A;  3FUM A;  4XZ4 A;  2FO7 A;  3JCK C;  1D8D A;  4U95 D;  4UUC A;  3CVV A;  4GTR A;  4RG9 A;  3UMV A;  3VLF A;  3LXU X;  4U0U A;  3FTY A;  2WPV A;  3AAA C;  3ZU7 B;  2DWZ A;  4IYP A;  1V54 E;  1PY1 A;  2LAH A;  2C2L A;  3NOG D;  3TWW A;  3ZGQ A;  3B13 A;  4GTQ A;  5CEC B;  2VGX B;  5CRV A;  4AVX A;  3BUA A;  1KZP A;  5ENR D;  4DX5 D;  2DYS E;  5ENS D;  5HI7 A;  1DNP A;  1Z5S C;  5G04 J;  4CGW A;  2XZD G;  2XEE A;  3NZU A;  5LCW J;  3CHS A;  5KBA A;  5EYP F;  2CG2 A;  4GTM A;  3K9I A;  2IEJ A;  1NA3 A;  3PH0 C;  2GRQ B;  3ISM C;  3QOU A;  3TL5 A;  4A55 A;  2DVW A;  1UG3 A;  4LEU A;  2XZT G;  4ZHB A;  3AU5 A;  3ZYK A;  4PDX A;  5ENO D;  2OCC E;  4M3O A;  4FLB A;  2HE0 A;  1Y8M A;  2IF4 A;  3APF A; 
#chains in the Genus database with same CATH homology
 2Y1L E;  4YDY A;  1K3Z D;  4J8Y A;  4NIK A;  5JA4 D;  1BU9 A;  4U8Y D;  2QYJ A;  4JB8 P;  1BLX B;  1AWC B;  3EU9 A;  4DX1 A;  4HRN A;  3TWQ A;  5CBN A;  5EID A;  3JXI A;  2A5E A;  2F37 A;  3B95 A;  3TWU A;  3HG0 D;  4GPM A;  4O1O A;  3UI2 A;  5KNG A;  2RFM A;  3LJN A;  5D66 A;  2ETB A;  5AQ7 A;  4A63 B;  5CED B;  5AAR A;  3NBN B;  1MYO A;  4O1P A;  4BEP A;  2AJA A;  4K5C A;  4DX2 A;  1NFI E;  4DX7 D;  4LG6 A;  3V31 A;  2VGE A;  4BSZ B;  5EIL A;  4HRL A;  4QFV A;  5EIB E;  3D9H A;  4N5Q A;  4Z68 A;  5AQA A;  5BXO A;  2FO1 E;  4U95 D;  1MX6 A;  1BI8 B;  4UUC A;  1K1B A;  4C48 B;  4G8K A;  3NOC D;  3HRA A;  4G8L A;  5ENQ D;  5AQ9 A;  3AJI A;  1K1A A;  2BKG A;  3DEO A;  4QQI A;  4LNU D;  3AAA C;  1WG0 A;  3JUE A;  3SO8 A;  3ZU7 B;  2DWZ A;  4O60 A;  4F1P A;  4BES A;  1OY3 D;  1N0R A;  3W9F A;  3TWV A;  1TR4 A;  1YYH A;  3T9K A;  5ITZ F;  5AAO A;  3C5R A;  5JMN D;  4HRM B;  3NOG D;  1G3N B;  4K5B A;  3J5P A;  2P2C P;  4OAV B;  3V79 K;  4ZFH A;  3TWW A;  3ZNG A;  2XEH A;  5KWD A;  2BKK B;  4HB5 A;  2V5Q C;  5FIN A;  3IXE A;  5HKP A;  3UXG A;  2F8X K;  1MJ0 A;  2F8Y A;  4BET A;  2B0O E;  3T8K A;  4U8V D;  4CZ2 D;  1DC2 A;  4HI8 A;  1IHB A;  3KEA A;  4B93 B;  4ATZ D;  5CEC B;  3DEP A;  3Q9N C;  1DCQ A;  3ZKJ A;  1UOH A;  2NYJ A;  2DZO A;  1OT8 A;  5CEA A;  3J5Q B;  1SVX A;  4TUM A;  5EN5 D;  2J8S D;  1S70 B;  2QC9 A;  5ENR D;  3EHR A;  3TWX A;  4DX5 D;  5AN8 A;  3TWS A;  1YCS B;  1IXV A;  5ENS D;  1QYM A;  1YMP A;  5ENT D;  3TWT A;  2XEN A;  3W9G A;  2ZGG A;  2L6B A;  1MX2 A;  4F6R D;  2XZD G;  2PNN A;  1WDY A;  3B7B A;  4RLY A;  2Y0B G;  5CBO A;  3F6Q A;  1D9S A;  1MX4 A;  2XEE A;  1AP7 A;  2ETC A;  5KBA A;  5EYL A;  2KXP C;  3EHQ A;  5FIO A;  2JAB A;  5EYP F;  5HS0 A;  4OAU C;  2ETA A;  1BD8 A;  4J7W A;  5HRY A;  5KNH D;  4LSZ E;  5ENP D;  2ZGD A;  3UTM A;  1A5E A;  3Q9U C;  5BXU A;  2KBX A;  3V2O A;  2DZN A;  3ZUV B;  4HLL A;  4YDW A;  1SW6 A;  3JXJ A;  4K5A B;  3V2X A;  5AQB A;  4DUI A;  4HI9 A;  4BER A;  2DVW A;  1N0Q A;  4GMR A;  2XZT G;  4U96 D;  1N11 A;  4DX6 D;  2RFA A;  4ZHB A;  4CYM D;  3V30 A;  5CER B;  5ENO D;  3TWR A;  1BI7 B;  4HQD A;  4HBD A;  1IKN D;  4HNA D;  2MYO A;  4DRX E;  2HE0 A;  2V4H C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...